2JQKA

Vps4b mit-chmp2b complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
NLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associating protein 4B
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 72
sequence length 72
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jqkA00
2CRBA 4A5XA 2V6YA 4P1NA 4U3CA 3EABA 4U7YA 3ZT6A 2A9UA 2LRKA 4U31A 4ZEYA 2MPKA 2JQ9A 3K1SA 4CN1A 5FVLA 3ZT7A 4U2YA 3ZSSA 4CN6A 1WR0A 2LRLA 2V6XA 1YXRA 5CGMA 4CN4A 2RPAA 2CPTA 2K3WA 3ZT5A 5FVKA 2JQKA 3ZSTA 4U7IA 5CJ5A 4NIQA 2W2UA 2V6YB 2DL1A 1WFDA 4U33A 4U2ZA 4IT4A 4WZXA 2WY2A 1WCRA 2WWVA 2JQHA 5LB7B 2XZEA
chains in the Genus database with same CATH superfamily
4Z8XA 2VL8A 2LM9A 3T1YT 3B13A 2VKDA 2IIUA 2XM2A 1I6ZA 2LSGA 2XQ5A 4JV5T 5GONE 1FJGT 1MIVA 1OEDE 3KV9A 2HPLA 3IA3A 1B7TA 1YKHB 1WRDA 4ZHQE 2YDRA 1VCTA 4NIQA 5AQSB 3A7MA 2ACXA 3MKDA 2ODVA 2NOXA 3ZYLA 1NAFA 4U31A 3PJAJ 2W62A 3PUVF 1WR6A 3PUQA 4X1IE 3Q9DA 2BKOA 4AKHA 3R84B 3ETVA 3P4QA 4IDZA 5AQVB 2VQFT 2UUBT 2V26A 2LHNA 3FZLB 2C5IT 5TAOA 4JLEA 4Z91A 3TLSA 4EEBA 3H3MA 1Z8UA 4N78D 2KWIB 3DJBA 2AXDS 4NUUA 2LSYA 4YJ3E 1S35A 1ZP0A 3VKHA 2LRLA 3C98B 3O4XE 3Q2MA 4I50E 4GKKT 2D2SA 5L3DB 4JBWF 5IUXA 5LCYA 3CVRA 4JI2T 2X9XA 2KWHA 2Q9QD 4LF8T 5AQQB 3L39A 5JVDE 4ZZCA 4QH5A 2LEHA 3FXDB 1WCRA 1Y64B 5LB7B 5DQVA 4TWFA 3Q5WA 5FXXA 2QVAA 3ZEFB 1M7KA 2A3DA 5EK3A 2IW5B 1W09A 4LF9T 3GWHA 4XZCA 3PUSA 2XAHB 3OJAA 4NXMT 1JNZA 1S94A 2KNDA 3UTKA 3AECA 5HAXA 3X1DA 3HA4A 3IHRA 2VVNA 2CBJA 5AQLB 4UV8B 2E5VA 2DCFA 2BBJA 5LBQB 4HTEA 2HPJA 4B3TT 3JAFA 2X51A 4GIWA 4L5GA 2WWUA 2IUBA 4OYKA 3ZLIA 2P9BA 4IE4A 2YKSA 4IDNA 1T8BA 3AXJB 4X20E 4TN7B 2LSJA 4HFIA 3PUXF 2DL1A 3CPZA 5HCMA 2V5DA 4PFPA 4PJMA 5LNKA 4CXYA 3KBTA 5LGUB 3AEGA 1JNRA 5AQNB 5IYZE 4KX6A 3N2OA 3VRAA 3GMIA 5H6QB 3N9OA 4TZ4C 2PG8A 2JMHA 3AA0B 5LHHB 4QH4A 4DR5T 2E2AA 5JDNA 1KFYA 3I9WA 4YTMA 4EB6E 3AAIA 2VK9A 2M6BA 5HXRA 4X62T 4UR9A 1UX4A 3FHNA 5FP3A 3ZC0A 2JIWA 3UU4A 5DJQC 4YT0A 4TNWA 1ZV4X 2XUEA 4DR7T 3RC8A 5CA1E 3GN5A 5FY7A 1FIOA 2BKPA 4OFZA 4EEDA 4LF7T 4C90A 5LBMA 2LKHA 3UU8A 4IT4A 2HN1A 3C64A 4JI4T 5HEJA 5LHIB 1G8XA 1NEKA 1UGOA 4DBQA 5AQIB 3AA6B 4P0BA 1E2AA 2LRKA 4IE5A 2JQ9A 4HEAA 4GYRA 4AQGA 2Q9QB 5ETWA 3RQWA 2QRXA 4PJJA 4ZEYA 2E9XA 2KT9A 4AKGA 1YW0A 2XSBA 4WBOA 3VR9A 3M65A 3I9YA 2W66A 1ZHCA 3AE3A 2IHR1 4H9QC 4UVAB 4G63A 3AAEB 5IHYA 1T7SA 5JDHA 1R8IA 2NR4A 1UK5A 4UF0B 5JDGA 5HEGA 3SFEA 3RRCA 2XQ4A 4LFCT 3HR0A 1YD8G 5L2LA 4UVBB 4XAXB 4JI7T 2N9DA 2KXPB 2EHOB 4ISTA 3ZSSA 2F4VT 2XQYA 3RYFE 2IDOB 4OYJA 4WBNE 5C2TA 3P50A 2H88A 3O9XA 3L8RA 5J0ZA 3E08A 3LK42 3UULA 2LKGA 1IBKT 2X0YA 2NTXA 3UU5A 3CX7B 2FJAA 2I59A 2K3WA 2WDQA 2E9XC 3PJAA 2PTFA 4LMJA 4TWHA 1IZNB 2WMOA 4HWDA 2BG9B 3H3AA 1XDOA 3C50A 2VB6A 4ZXLA 1GQEA 4LMLA 2BS3A 4YHJA 1KF6A 3PDYA 5AFUL 4UELA 3U3IA 4U74A 3OYZA 1XMQT 3EDUA 2N1GA 4YSZA 2Y48B 2HHHT 4UVCB 3NRYA 5ABFA 2BZBA 4GK0E 4CN6A 5LMNT 2WSSV 4MLKA 3FZHB 4HKAA 4AKLA 4J2CA 3P4WA 4CI2B 3PUWF 5JRCB 3RKGA 2YU1A 4GOUA 2WM9A 3UUNA 4DR2T 2FJEA 4AQYT 4PNIA 4P09A 5DABA 4HGAA 2RP4A 2V5CA 5AQHB 3OVUA 2RA1A 4PW8A 4HWIB 2N2NA 2DWGA 1AJ3A 3NWIA 3NKZA 2ACZA 3LJCA 3C4XA 2V7IA 3AE1A 2X9YA 2MBGA 2SPCA 4KHPT 3RF1A 2D9DA 2J62A 2NTYA 5J2TE 4I4TE 3NRXA 1SUMB 5L4EA 2VKHA 4JI6T 2A72A 3UQ4A 1LVFA 4O4HE 4TNVA 5HEOA 2LJLA 1XZYA 3MXZA 2D0TA 2M67A 4HFEA 3LFMA 5AQGB 2DNXA 2YOEA 2YINA 3JC6C 5EZYE 3EDVA 2KSRA 2QYWA 1IAPA 5L3GB 4H63H 1MIWA 1VRBA 1HTJF 4DV7T 3PE0A 3P8CD 3ANWB 3AEBA 3VHLA 2JPFA 2XZEA 4ILAA 2H3RA 2CM0A 3KVBA 5JDMA 4PK6A 1WR0A 3TLVA 1N34T 4IHJE 4E7ZA 1BR2A 1N36T 3RIUA 4X65T 4IIJE 4IE0A 4ISSA 1H7CA 4IREA 2B76A 2H7VC 2X9WA 3PUAA 2MPKA 4O4LE 3ZT7A 4IE7A 4ZI3C 3LK2B 5HXEA 2VWAA 4COFA 4H9NC 2XQ9A 1VOMA 2W0GA 2H89A 3EUHA 3PU8A 1V9DA 4U72A 1KNPA 2YDQA 3DTOA 3EABA 4UIGA 2CEAA 4U2YA 2AE9A 3LK3B 4ANJA 3RRWA 2JRKA 2CWOA 1KK7A 3WI3A 2BG9E 4EGWA 4UV9B 3KV4A 4U33A 3MZKB 2E9XD 3V5SA 2CBIA 3O1JA 3OBVE 2CLYC 4O2BE 2OV9A 3AE5A 2ZM2A 4DV0T 4ZZBA 5HWYA 2BDEA 5L3EB 4ILBA 3WAKA 5L3BB 4PAGA 3TLTA 4DIDB 4K0UA 5JTGA 3PV0F 4U2ZA 5C3JA 3RIUC 3AE6A 5BMVE 2L9QA 3KDSE 3AEFA 3J9X1 2ODUA 4AIUA 2K9AA 5JDFA 4CXWA 2I6HA 4DV5T 5AQMB 3CWZB 4WW0A 1CHUA 1HCIA 4F8HA 4X1KE 2YK0A 4EOZB 4XBFB 3UUMA 1D1BA 3CMLA 2CHNA 4EV6A 4DV1T 2CE7A 4HWHA 4L9IA 3RIAA 5JREA 5LG4A 4JI1T 1VCSA 3MK7C 4HFHA 2JQHA 1X79A 5CA0E 3SOLA 4FI5A 5HXHA 3C4ZA 3ONLC 4KI0F 5L3CB 1YQ4A 2KINB 4EAHA 4ZS2A 4X66T 3UU3A 1WYCA 3V5UA 3ZSTA 2MYSA 2V1DB 3HI2A 3QC9A 5IWAT 3NBXX 3CQGB 4HFBA 4DV6T 2BVMA 2QA7A 1US7B 3TLUA 3IF8B 1UURA 4JI0T 4ILCA 2V8SV 3BK9A 4GYSA 5FL1A 1SA0E 4IGUA 1W0AA 1MMDA 4YSXA 5HXSA 3N9QA 1MMNA 3EVYA 2XPKA 2C5KT 3A5XA 4WZXA 3JC6D 3HKDE 4JEUB 2LE8A 2W61A 1U5PA 1QUUA 4AKRB 4H9RC 1T98A 1IJ5A 2XQ6A 1LRZA 4Q25A 3S4UA 3AB3B 4PK5A 5DQWA 3ZMSB 3AXJA 3SFDA 1SHZC 1KNZA 3FB2A 5HEHA 5FY0A 1KEYA 5FY1A 2CXDA 4YLHA 3ETUA 2OLTA 4BA9A 3RX6A 5C8YE 5EK2A 2V7JA 1HFAA 2XQ8A 4KUMB 2MAWA 3HKEE 2CXFA 4QWNB 3ZT6A 1WYBA 4WNKA 4CN1A 2W4XA 3ONXA 3Q5EA 5J2UE 2K5BB 4H9SE 4ZI3D 2WU2A 4DV3T 1BR1A 3A8YC 2CWYA 2UXDT 2WDRA 2A9UA 5AQFB 5JDQA 3KV6A 3ZPOA 4O4JE 2HH7A 3PURA 3G06A 2K24A 1E1HB 4BJMA 5HEUA 4OX9T 3DP7A 3C4WA 4TV9E 2WS3A 4QX7B 3QNUA 4ZS3A 4EXTA 5FYMA 1WLXA 3L3PA 5F3JA 2XM1A 2BKNA 4F6RC 3N9MA 3N5LA 2WU5A 3CX6B 2BS2A 3ABVA 3MJXA 2KLQA 2X0LB 2ZM0A 5JR9A 4QXBB 4DR1T 3H37A 3PUYF 3LBXB 2RPAA 4ADZA 3AEAA 5L3FB 4ERRA 1MNDA 2H7OA 3ZN0B 1QSDA 2W67A 4EIWA 3LSVA 4GKJT 1OEDA 5KXJA 2UXCT 1ZOYA 3I0OA 2V6XA 4X5TA 3AA1B 2XTLA 4UF0A 1ZKEA 4QXCB 4AXPA 5ABFB 2JMKA 5ABHA 3M3ZB 4PJNA 3TLWA 4YSYA 2PBIA 4CN4A 4FJOA 3RQUA 4DR4T 2EHOA 3AEDA 3PTRB 2UXXB 2V7KA 3UFGA 5LYJE 2W2UA 4CI3B 5LOVE 3CIRA 1MNEA 3KFWX 3FBZA 4M1PA 3C51A 2YEVC 4O4IE 4NPPA 2L8KA 2VL0A 2BS4A 1HG2A 4O2AE 5JR9C 1IBLT 2DI4A 1IBMT 4DNDA 4TX5A 2V6YB 4EZHA 4OHFA 2DWKA 5KDMC 3ZYMA 2CMRA 5LXTE 1MIYA 4Z90A 4A56A 2BG9A 3CX8B 3SWHA 1OEDC 4CQIA 2E8IA 3BQIA 3VKGA 2FUPA 4A98A 5JDLA 3J7Yq 2WY2A 2WWVA 1NWMX 1E7PA 3ZCIA 1HF8A 3AE7A 1UX5A 4MHCA 2VURA 3OTOT 3ZCJA 3NZQA 5AQKB 1IJ6A 2J4GA 1HS7A 5M4YA 4LMKA 4NUVA 1J5ET 3ZC1A 5LGNB 3U78A 2WZHA 3RGLA 3CQCB 2EHOC 5BR8T 3F31A 1FEWA 3E0ZA 3T8OA 4KHZF 3RHWA 2CLYB 4JEHB 5JRCA 3RYIE 1YXRA 3OPCA 2ZMAA 4ILUA 3PUZF 3L09A 2XY8B 3QB5K 4DO0A 1D0XA 3I1AA 4P0AA 1G73A 4CXXA 1MMGA 4IL4A 3N2KE 5LMUT 3QB5A 4JI8T 5LHGB 4TV8E 5F5WA 5FXZA 4BAYB 4HFCA 2CHOA 3RLFF 1HNXT 1J5WA 4LF6T 4YTNA 5KX5E 2B1EA 3P7IA 4UEMA 3ZJ1A 5HXCA 3T1HT 1Z0PA 1W0BA 2MOZA 5FXVA 3FZKB 4ASKA 3AVRA 2XSAA 2CPTA 2YN6A 2Y6XA 5A1LA 4IDQA 3AA7B 3RC3A 4H63V 5J1GA 5ABGA 3EAMA 2X0HA 5LA6E 5LJMA 4QX8B 4YFSA 5FNVE 4EYYR 2NW9A 3QOFA 4MALA 3OYXA 4X64T 2UUAT 2ZLYA 3VU7H 2XHEB 2V7LA 3RYHE 2XQ7A 3UUBA 3N9NA 2QGSA 2WB5A 3E22E 3ZMTB 3ANWA 5AQPB 2R6GF 3TKLB 3JCFA 4IDOA 3ESLA 4YXDA 1EZ3A 4KMCA 2OA5A 3K3QC 2IMLA 3CKDA 4K0KT 5EK4A 4PK4A 2D0UA 3K3OA 1N33T 3EI0A 3UFEA 4AI6A 2LSKA 3AAAB 5E0OA 2XAFB 2NW8A 5HCJA 1BR4A 4DMWA 5FVLA 4KBMB 1HX8A 2XAJB 4LFBT 2D5UA 4IE6A 4JYAT 4UXNB 3RPUA 4YY3T 3WAJA 3HKBE 1QLBA 4YHHT 2YDSA 1UUSA 5FKYA 2PFVA 3O1HA 3IEEA 4DR3T 2HN2A 3P4PA 5CGMA 3ZT5A 2FBWA 4U7IA 1T72A 2ES0A 1WFDA 1D0ZA 4HWCA 3RYCE 3KINB 1CUNA 2E5LT 4QHOA 3ZMZB 2J1DG 4QXHB 4LFAT 2W63A 1DU2A 3QUJA 1FMWA 1MMAA 5L4HA 2G0UA 5FXWA 1W9RA 3VR8A 2X9HA 1BR0A 3ZMUB 3Q5XA 3UT5E 4YTPA 2NWBA 4A5XA 4IDPA 3N2GE 3F57A 4PJLA 3HL6A 4ZI7E 5F8PA 2IC6A 4I43B 3ZMVB 1HNZT 5H6RB 4YJ2E 2IAKA 3EHZA 2EHOD 3CQXC 3MA9A 5ADXL 3ZN1B 4PFOA 2UXNB 5LGTB 3LDQB 2LLYA 2JJ9A 4I0UA 4AQFA 4AISA 2LOPA 3ZYKA 5FMNA 2X68A 5CB4E 3B57A 3P4RA 2DHRA 3AE8A 5L47A 2M6IA 3GN5B 3N9LA 3SRZA 1FMVA 3F2EA 2WMNA 2X66A 1D0YA 5HWXA 4B3RT 1XDPA 2VASA 2VVSA 2XASB 3KV5A 1NENA 3ZKRA 2CXLA 4X1YE 2K48A 1OWAA 2CCQA 3AE2A 4TUYE 2MTQA 2LSIA 4JI3T 4G2AA 4LF5T 2WDVA 2X67A 2VKOA 4EZ4A 4ZI2C 1D1CA 1XNQT 1I94T 2FJDA 3OKQA 1U4QA 2E9XB 2Z6EA 4BJNA 2JQQA 2DLRA 3VRBA 2KMFA 1YKEB 5CFBA 3K3NA 4LF4T 2BVLA 3FXEB 4DMVA 3JAEA 3AEEA 2L3LA 2LOSA 4CZZB 1XMOT 3UU6A 4AQFC 2XQ3A 1KNRA 3RKOA 3K8PC 2XQAA 3HKCE 4GK5E 4QH1A 4B6XA 4JI5T 5JR9B 5ABEA 1LKXA 2VKJA 1OXZA 3FZFB 4HFVA 2UUCT 5AQOB 2LM2A 4V1Av 1XNRT 4H9OC 3JADA 4O8SA 4DVDA 2WBLA 4B3MT 1OEDB 4TWDA 2Q9QA 2XAQB 4DR6T 3LG7A 4C91A 4NXNT 3D0TA 3IBPA 3PUGA 4QKNA 3UQ7A 2JQKA 4HE8A 2IC9A 2J47A 4EYUA 2C5JA 3PU3A 3NVOA 3RH3A 3MACA 4B3ST 4U3CA 3B5MA 4MFRA 2PJQA 3W15B 3K1SA 4DV4T 2YU2A 3KBUA 3I0QA 3Q5DA 3UUXB 4ZOLE 5JQGE 4A97A 3AE9A 5JH7E 2GK9A 2C0SA 4HWFA 2XJ7A 4DUYT 1HG5A 3NZPA 2WP9A 2VQET 3KVAA 3FBLA 3LBXA 2WZIA 5LJNA 4E7SA 2NW7A 1UCUA 3GA8A 3FZMB 5AQJB 2Q9QC 4HFDA 1ZEEA 4MBQA 3BQLA 3CK6A 2FJBA 1L0VA 3QK6A 3RI5A 2NP9A 4I55E 2ZM6T 5CJ5A 5LG3A 2I0MA 3RIFA 4WYVA 4DV2T 1J1JA 2ZM8A 1Y01A 3BQKA 2KZ7B 3ONJA 3SS1A 5FVKA 5HYAA 2CRBA 4U7YA 4DUZT 4H9PC 2LT3A 2V7MA 1HR0T 2CA5A 3P4SA 3O1IA 1LVKA 1X9BA 4ZI2D 1HNWT 5AQUB 2V6YA 4OK0A 5AQRB 4P1NA 4DBRA 3AE4A 1O3XA 2BBHA 2LHRA 2WCAA 2UU9T 5KMGP 2Y8DA 1XWMA 3R6NA 5LP6E 1M62A 2WQYA 2XAGB 2W00A 4L0RA 3AVSA 4HN9A 4KP3C 4JUYA 2WAUA 3ZJ2A 4AKIA 4IL9A 3N9PA 1N32T 1SE7A 2A2FX 1YQ3A 4CI1B 5FL0A 1D1AA 2BG9C 5AQTB 2UXBT 1HX1B
chains in the Genus database with same CATH topology
2CRBA 4A5XA 2V6YA 4P1NA 4U3CA 3EABA 4U7YA 3ZT6A 2A9UA 2LRKA 4U31A 4ZEYA 2MPKA 2JQ9A 3K1SA 4CN1A 5FVLA 3ZT7A 4U2YA 3ZSSA 4CN6A 1WR0A 2LRLA 2V6XA 1YXRA 5CGMA 4CN4A 2RPAA 2CPTA 2K3WA 3ZT5A 5FVKA 2JQKA 3ZSTA 4U7IA 5CJ5A 4NIQA 2W2UA 2V6YB 2DL1A 1WFDA 4U33A 4U2ZA 4IT4A 4WZXA 2WY2A 1WCRA 2WWVA 2JQHA 5LB7B 2XZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRB A;  4A5X A;  2V6Y A;  4P1N A;  4U3C A;  3EAB A;  4U7Y A;  3ZT6 A;  2A9U A;  2LRK A;  4U31 A;  4ZEY A;  2MPK A;  2JQ9 A;  3K1S A;  4CN1 A;  5FVL A;  3ZT7 A;  4U2Y A;  3ZSS A;  4CN6 A;  1WR0 A;  2LRL A;  2V6X A;  1YXR A;  5CGM A;  4CN4 A;  2RPA A;  2CPT A;  2K3W A;  3ZT5 A;  5FVK A;  2JQK A;  3ZST A;  4U7I A;  5CJ5 A;  4NIQ A;  2W2U A;  2V6Y B;  2DL1 A;  1WFD A;  4U33 A;  4U2Z A;  4IT4 A;  4WZX A;  2WY2 A;  1WCR A;  2WWV A;  2JQH A;  5LB7 B;  2XZE A; 
#chains in the Genus database with same CATH topology
 4Z8X A;  2VL8 A;  2LM9 A;  3T1Y T;  3B13 A;  2VKD A;  2IIU A;  2XM2 A;  1I6Z A;  2LSG A;  2XQ5 A;  4JV5 T;  5GON E;  1FJG T;  1MIV A;  1OED E;  3KV9 A;  2HPL A;  3IA3 A;  1B7T A;  1YKH B;  1WRD A;  4ZHQ E;  2YDR A;  1VCT A;  4NIQ A;  5AQS B;  3A7M A;  2ACX A;  3MKD A;  2ODV A;  2NOX A;  3ZYL A;  1NAF A;  4U31 A;  3PJA J;  2W62 A;  3PUV F;  1WR6 A;  3PUQ A;  4X1I E;  3Q9D A;  2BKO A;  4AKH A;  3R84 B;  3ETV A;  3P4Q A;  4IDZ A;  5AQV B;  2VQF T;  2UUB T;  2V26 A;  2LHN A;  3FZL B;  2C5I T;  5TAO A;  4JLE A;  4Z91 A;  3TLS A;  4EEB A;  3H3M A;  1Z8U A;  4N78 D;  2KWI B;  3DJB A;  2AXD S;  4NUU A;  2LSY A;  4YJ3 E;  1S35 A;  1ZP0 A;  3VKH A;  2LRL A;  3C98 B;  3O4X E;  3Q2M A;  4I50 E;  4GKK T;  2D2S A;  5L3D B;  4JBW F;  5IUX A;  5LCY A;  3CVR A;  4JI2 T;  2X9X A;  2KWH A;  2Q9Q D;  4LF8 T;  5AQQ B;  3L39 A;  5JVD E;  4ZZC A;  4QH5 A;  2LEH A;  3FXD B;  1WCR A;  1Y64 B;  5LB7 B;  5DQV A;  4TWF A;  3Q5W A;  5FXX A;  2QVA A;  3ZEF B;  1M7K A;  2A3D A;  5EK3 A;  2IW5 B;  1W09 A;  4LF9 T;  3GWH A;  4XZC A;  3PUS A;  2XAH B;  3OJA A;  4NXM T;  1JNZ A;  1S94 A;  2KND A;  3UTK A;  3AEC A;  5HAX A;  3X1D A;  3HA4 A;  3IHR A;  2VVN A;  2CBJ A;  5AQL B;  4UV8 B;  2E5V A;  2DCF A;  2BBJ A;  5LBQ B;  4HTE A;  2HPJ A;  4B3T T;  3JAF A;  2X51 A;  4GIW A;  4L5G A;  2WWU A;  2IUB A;  4OYK A;  3ZLI A;  2P9B A;  4IE4 A;  2YKS A;  4IDN A;  1T8B A;  3AXJ B;  4X20 E;  4TN7 B;  2LSJ A;  4HFI A;  3PUX F;  2DL1 A;  3CPZ A;  5HCM A;  2V5D A;  4PFP A;  4PJM A;  5LNK A;  4CXY A;  3KBT A;  5LGU B;  3AEG A;  1JNR A;  5AQN B;  5IYZ E;  4KX6 A;  3N2O A;  3VRA A;  3GMI A;  5H6Q B;  3N9O A;  4TZ4 C;  2PG8 A;  2JMH A;  3AA0 B;  5LHH B;  4QH4 A;  4DR5 T;  2E2A A;  5JDN A;  1KFY A;  3I9W A;  4YTM A;  4EB6 E;  3AAI A;  2VK9 A;  2M6B A;  5HXR A;  4X62 T;  4UR9 A;  1UX4 A;  3FHN A;  5FP3 A;  3ZC0 A;  2JIW A;  3UU4 A;  5DJQ C;  4YT0 A;  4TNW A;  1ZV4 X;  2XUE A;  4DR7 T;  3RC8 A;  5CA1 E;  3GN5 A;  5FY7 A;  1FIO A;  2BKP A;  4OFZ A;  4EED A;  4LF7 T;  4C90 A;  5LBM A;  2LKH A;  3UU8 A;  4IT4 A;  2HN1 A;  3C64 A;  4JI4 T;  5HEJ A;  5LHI B;  1G8X A;  1NEK A;  1UGO A;  4DBQ A;  5AQI B;  3AA6 B;  4P0B A;  1E2A A;  2LRK A;  4IE5 A;  2JQ9 A;  4HEA A;  4GYR A;  4AQG A;  2Q9Q B;  5ETW A;  3RQW A;  2QRX A;  4PJJ A;  4ZEY A;  2E9X A;  2KT9 A;  4AKG A;  1YW0 A;  2XSB A;  4WBO A;  3VR9 A;  3M65 A;  3I9Y A;  2W66 A;  1ZHC A;  3AE3 A;  2IHR 1;  4H9Q C;  4UVA B;  4G63 A;  3AAE B;  5IHY A;  1T7S A;  5JDH A;  1R8I A;  2NR4 A;  1UK5 A;  4UF0 B;  5JDG A;  5HEG A;  3SFE A;  3RRC A;  2XQ4 A;  4LFC T;  3HR0 A;  1YD8 G;  5L2L A;  4UVB B;  4XAX B;  4JI7 T;  2N9D A;  2KXP B;  2EHO B;  4IST A;  3ZSS A;  2F4V T;  2XQY A;  3RYF E;  2IDO B;  4OYJ A;  4WBN E;  5C2T A;  3P50 A;  2H88 A;  3O9X A;  3L8R A;  5J0Z A;  3E08 A;  3LK4 2;  3UUL A;  2LKG A;  1IBK T;  2X0Y A;  2NTX A;  3UU5 A;  3CX7 B;  2FJA A;  2I59 A;  2K3W A;  2WDQ A;  2E9X C;  3PJA A;  2PTF A;  4LMJ A;  4TWH A;  1IZN B;  2WMO A;  4HWD A;  2BG9 B;  3H3A A;  1XDO A;  3C50 A;  2VB6 A;  4ZXL A;  1GQE A;  4LML A;  2BS3 A;  4YHJ A;  1KF6 A;  3PDY A;  5AFU L;  4UEL A;  3U3I A;  4U74 A;  3OYZ A;  1XMQ T;  3EDU A;  2N1G A;  4YSZ A;  2Y48 B;  2HHH T;  4UVC B;  3NRY A;  5ABF A;  2BZB A;  4GK0 E;  4CN6 A;  5LMN T;  2WSS V;  4MLK A;  3FZH B;  4HKA A;  4AKL A;  4J2C A;  3P4W A;  4CI2 B;  3PUW F;  5JRC B;  3RKG A;  2YU1 A;  4GOU A;  2WM9 A;  3UUN A;  4DR2 T;  2FJE A;  4AQY T;  4PNI A;  4P09 A;  5DAB A;  4HGA A;  2RP4 A;  2V5C A;  5AQH B;  3OVU A;  2RA1 A;  4PW8 A;  4HWI B;  2N2N A;  2DWG A;  1AJ3 A;  3NWI A;  3NKZ A;  2ACZ A;  3LJC A;  3C4X A;  2V7I A;  3AE1 A;  2X9Y A;  2MBG A;  2SPC A;  4KHP T;  3RF1 A;  2D9D A;  2J62 A;  2NTY A;  5J2T E;  4I4T E;  3NRX A;  1SUM B;  5L4E A;  2VKH A;  4JI6 T;  2A72 A;  3UQ4 A;  1LVF A;  4O4H E;  4TNV A;  5HEO A;  2LJL A;  1XZY A;  3MXZ A;  2D0T A;  2M67 A;  4HFE A;  3LFM A;  5AQG B;  2DNX A;  2YOE A;  2YIN A;  3JC6 C;  5EZY E;  3EDV A;  2KSR A;  2QYW A;  1IAP A;  5L3G B;  4H63 H;  1MIW A;  1VRB A;  1HTJ F;  4DV7 T;  3PE0 A;  3P8C D;  3ANW B;  3AEB A;  3VHL A;  2JPF A;  2XZE A;  4ILA A;  2H3R A;  2CM0 A;  3KVB A;  5JDM A;  4PK6 A;  1WR0 A;  3TLV A;  1N34 T;  4IHJ E;  4E7Z A;  1BR2 A;  1N36 T;  3RIU A;  4X65 T;  4IIJ E;  4IE0 A;  4ISS A;  1H7C A;  4IRE A;  2B76 A;  2H7V C;  2X9W A;  3PUA A;  2MPK A;  4O4L E;  3ZT7 A;  4IE7 A;  4ZI3 C;  3LK2 B;  5HXE A;  2VWA A;  4COF A;  4H9N C;  2XQ9 A;  1VOM A;  2W0G A;  2H89 A;  3EUH A;  3PU8 A;  1V9D A;  4U72 A;  1KNP A;  2YDQ A;  3DTO A;  3EAB A;  4UIG A;  2CEA A;  4U2Y A;  2AE9 A;  3LK3 B;  4ANJ A;  3RRW A;  2JRK A;  2CWO A;  1KK7 A;  3WI3 A;  2BG9 E;  4EGW A;  4UV9 B;  3KV4 A;  4U33 A;  3MZK B;  2E9X D;  3V5S A;  2CBI A;  3O1J A;  3OBV E;  2CLY C;  4O2B E;  2OV9 A;  3AE5 A;  2ZM2 A;  4DV0 T;  4ZZB A;  5HWY A;  2BDE A;  5L3E B;  4ILB A;  3WAK A;  5L3B B;  4PAG A;  3TLT A;  4DID B;  4K0U A;  5JTG A;  3PV0 F;  4U2Z A;  5C3J A;  3RIU C;  3AE6 A;  5BMV E;  2L9Q A;  3KDS E;  3AEF A;  3J9X 1;  2ODU A;  4AIU A;  2K9A A;  5JDF A;  4CXW A;  2I6H A;  4DV5 T;  5AQM B;  3CWZ B;  4WW0 A;  1CHU A;  1HCI A;  4F8H A;  4X1K E;  2YK0 A;  4EOZ B;  4XBF B;  3UUM A;  1D1B A;  3CML A;  2CHN A;  4EV6 A;  4DV1 T;  2CE7 A;  4HWH A;  4L9I A;  3RIA A;  5JRE A;  5LG4 A;  4JI1 T;  1VCS A;  3MK7 C;  4HFH A;  2JQH A;  1X79 A;  5CA0 E;  3SOL A;  4FI5 A;  5HXH A;  3C4Z A;  3ONL C;  4KI0 F;  5L3C B;  1YQ4 A;  2KIN B;  4EAH A;  4ZS2 A;  4X66 T;  3UU3 A;  1WYC A;  3V5U A;  3ZST A;  2MYS A;  2V1D B;  3HI2 A;  3QC9 A;  5IWA T;  3NBX X;  3CQG B;  4HFB A;  4DV6 T;  2BVM A;  2QA7 A;  1US7 B;  3TLU A;  3IF8 B;  1UUR A;  4JI0 T;  4ILC A;  2V8S V;  3BK9 A;  4GYS A;  5FL1 A;  1SA0 E;  4IGU A;  1W0A A;  1MMD A;  4YSX A;  5HXS A;  3N9Q A;  1MMN A;  3EVY A;  2XPK A;  2C5K T;  3A5X A;  4WZX A;  3JC6 D;  3HKD E;  4JEU B;  2LE8 A;  2W61 A;  1U5P A;  1QUU A;  4AKR B;  4H9R C;  1T98 A;  1IJ5 A;  2XQ6 A;  1LRZ A;  4Q25 A;  3S4U A;  3AB3 B;  4PK5 A;  5DQW A;  3ZMS B;  3AXJ A;  3SFD A;  1SHZ C;  1KNZ A;  3FB2 A;  5HEH A;  5FY0 A;  1KEY A;  5FY1 A;  2CXD A;  4YLH A;  3ETU A;  2OLT A;  4BA9 A;  3RX6 A;  5C8Y E;  5EK2 A;  2V7J A;  1HFA A;  2XQ8 A;  4KUM B;  2MAW A;  3HKE E;  2CXF A;  4QWN B;  3ZT6 A;  1WYB A;  4WNK A;  4CN1 A;  2W4X A;  3ONX A;  3Q5E A;  5J2U E;  2K5B B;  4H9S E;  4ZI3 D;  2WU2 A;  4DV3 T;  1BR1 A;  3A8Y C;  2CWY A;  2UXD T;  2WDR A;  2A9U A;  5AQF B;  5JDQ A;  3KV6 A;  3ZPO A;  4O4J E;  2HH7 A;  3PUR A;  3G06 A;  2K24 A;  1E1H B;  4BJM A;  5HEU A;  4OX9 T;  3DP7 A;  3C4W A;  4TV9 E;  2WS3 A;  4QX7 B;  3QNU A;  4ZS3 A;  4EXT A;  5FYM A;  1WLX A;  3L3P A;  5F3J A;  2XM1 A;  2BKN A;  4F6R C;  3N9M A;  3N5L A;  2WU5 A;  3CX6 B;  2BS2 A;  3ABV A;  3MJX A;  2KLQ A;  2X0L B;  2ZM0 A;  5JR9 A;  4QXB B;  4DR1 T;  3H37 A;  3PUY F;  3LBX B;  2RPA A;  4ADZ A;  3AEA A;  5L3F B;  4ERR A;  1MND A;  2H7O A;  3ZN0 B;  1QSD A;  2W67 A;  4EIW A;  3LSV A;  4GKJ T;  1OED A;  5KXJ A;  2UXC T;  1ZOY A;  3I0O A;  2V6X A;  4X5T A;  3AA1 B;  2XTL A;  4UF0 A;  1ZKE A;  4QXC B;  4AXP A;  5ABF B;  2JMK A;  5ABH A;  3M3Z B;  4PJN A;  3TLW A;  4YSY A;  2PBI A;  4CN4 A;  4FJO A;  3RQU A;  4DR4 T;  2EHO A;  3AED A;  3PTR B;  2UXX B;  2V7K A;  3UFG A;  5LYJ E;  2W2U A;  4CI3 B;  5LOV E;  3CIR A;  1MNE A;  3KFW X;  3FBZ A;  4M1P A;  3C51 A;  2YEV C;  4O4I E;  4NPP A;  2L8K A;  2VL0 A;  2BS4 A;  1HG2 A;  4O2A E;  5JR9 C;  1IBL T;  2DI4 A;  1IBM T;  4DND A;  4TX5 A;  2V6Y B;  4EZH A;  4OHF A;  2DWK A;  5KDM C;  3ZYM A;  2CMR A;  5LXT E;  1MIY A;  4Z90 A;  4A56 A;  2BG9 A;  3CX8 B;  3SWH A;  1OED C;  4CQI A;  2E8I A;  3BQI A;  3VKG A;  2FUP A;  4A98 A;  5JDL A;  3J7Y q;  2WY2 A;  2WWV A;  1NWM X;  1E7P A;  3ZCI A;  1HF8 A;  3AE7 A;  1UX5 A;  4MHC A;  2VUR A;  3OTO T;  3ZCJ A;  3NZQ A;  5AQK B;  1IJ6 A;  2J4G A;  1HS7 A;  5M4Y A;  4LMK A;  4NUV A;  1J5E T;  3ZC1 A;  5LGN B;  3U78 A;  2WZH A;  3RGL A;  3CQC B;  2EHO C;  5BR8 T;  3F31 A;  1FEW A;  3E0Z A;  3T8O A;  4KHZ F;  3RHW A;  2CLY B;  4JEH B;  5JRC A;  3RYI E;  1YXR A;  3OPC A;  2ZMA A;  4ILU A;  3PUZ F;  3L09 A;  2XY8 B;  3QB5 K;  4DO0 A;  1D0X A;  3I1A A;  4P0A A;  1G73 A;  4CXX A;  1MMG A;  4IL4 A;  3N2K E;  5LMU T;  3QB5 A;  4JI8 T;  5LHG B;  4TV8 E;  5F5W A;  5FXZ A;  4BAY B;  4HFC A;  2CHO A;  3RLF F;  1HNX T;  1J5W A;  4LF6 T;  4YTN A;  5KX5 E;  2B1E A;  3P7I A;  4UEM A;  3ZJ1 A;  5HXC A;  3T1H T;  1Z0P A;  1W0B A;  2MOZ A;  5FXV A;  3FZK B;  4ASK A;  3AVR A;  2XSA A;  2CPT A;  2YN6 A;  2Y6X A;  5A1L A;  4IDQ A;  3AA7 B;  3RC3 A;  4H63 V;  5J1G A;  5ABG A;  3EAM A;  2X0H A;  5LA6 E;  5LJM A;  4QX8 B;  4YFS A;  5FNV E;  4EYY R;  2NW9 A;  3QOF A;  4MAL A;  3OYX A;  4X64 T;  2UUA T;  2ZLY A;  3VU7 H;  2XHE B;  2V7L A;  3RYH E;  2XQ7 A;  3UUB A;  3N9N A;  2QGS A;  2WB5 A;  3E22 E;  3ZMT B;  3ANW A;  5AQP B;  2R6G F;  3TKL B;  3JCF A;  4IDO A;  3ESL A;  4YXD A;  1EZ3 A;  4KMC A;  2OA5 A;  3K3Q C;  2IML A;  3CKD A;  4K0K T;  5EK4 A;  4PK4 A;  2D0U A;  3K3O A;  1N33 T;  3EI0 A;  3UFE A;  4AI6 A;  2LSK A;  3AAA B;  5E0O A;  2XAF B;  2NW8 A;  5HCJ A;  1BR4 A;  4DMW A;  5FVL A;  4KBM B;  1HX8 A;  2XAJ B;  4LFB T;  2D5U A;  4IE6 A;  4JYA T;  4UXN B;  3RPU A;  4YY3 T;  3WAJ A;  3HKB E;  1QLB A;  4YHH T;  2YDS A;  1UUS A;  5FKY A;  2PFV A;  3O1H A;  3IEE A;  4DR3 T;  2HN2 A;  3P4P A;  5CGM A;  3ZT5 A;  2FBW A;  4U7I A;  1T72 A;  2ES0 A;  1WFD A;  1D0Z A;  4HWC A;  3RYC E;  3KIN B;  1CUN A;  2E5L T;  4QHO A;  3ZMZ B;  2J1D G;  4QXH B;  4LFA T;  2W63 A;  1DU2 A;  3QUJ A;  1FMW A;  1MMA A;  5L4H A;  2G0U A;  5FXW A;  1W9R A;  3VR8 A;  2X9H A;  1BR0 A;  3ZMU B;  3Q5X A;  3UT5 E;  4YTP A;  2NWB A;  4A5X A;  4IDP A;  3N2G E;  3F57 A;  4PJL A;  3HL6 A;  4ZI7 E;  5F8P A;  2IC6 A;  4I43 B;  3ZMV B;  1HNZ T;  5H6R B;  4YJ2 E;  2IAK A;  3EHZ A;  2EHO D;  3CQX C;  3MA9 A;  5ADX L;  3ZN1 B;  4PFO A;  2UXN B;  5LGT B;  3LDQ B;  2LLY A;  2JJ9 A;  4I0U A;  4AQF A;  4AIS A;  2LOP A;  3ZYK A;  5FMN A;  2X68 A;  5CB4 E;  3B57 A;  3P4R A;  2DHR A;  3AE8 A;  5L47 A;  2M6I A;  3GN5 B;  3N9L A;  3SRZ A;  1FMV A;  3F2E A;  2WMN A;  2X66 A;  1D0Y A;  5HWX A;  4B3R T;  1XDP A;  2VAS A;  2VVS A;  2XAS B;  3KV5 A;  1NEN A;  3ZKR A;  2CXL A;  4X1Y E;  2K48 A;  1OWA A;  2CCQ A;  3AE2 A;  4TUY E;  2MTQ A;  2LSI A;  4JI3 T;  4G2A A;  4LF5 T;  2WDV A;  2X67 A;  2VKO A;  4EZ4 A;  4ZI2 C;  1D1C A;  1XNQ T;  1I94 T;  2FJD A;  3OKQ A;  1U4Q A;  2E9X B;  2Z6E A;  4BJN A;  2JQQ A;  2DLR A;  3VRB A;  2KMF A;  1YKE B;  5CFB A;  3K3N A;  4LF4 T;  2BVL A;  3FXE B;  4DMV A;  3JAE A;  3AEE A;  2L3L A;  2LOS A;  4CZZ B;  1XMO T;  3UU6 A;  4AQF C;  2XQ3 A;  1KNR A;  3RKO A;  3K8P C;  2XQA A;  3HKC E;  4GK5 E;  4QH1 A;  4B6X A;  4JI5 T;  5JR9 B;  5ABE A;  1LKX A;  2VKJ A;  1OXZ A;  3FZF B;  4HFV A;  2UUC T;  5AQO B;  2LM2 A;  4V1A v;  1XNR T;  4H9O C;  3JAD A;  4O8S A;  4DVD A;  2WBL A;  4B3M T;  1OED B;  4TWD A;  2Q9Q A;  2XAQ B;  4DR6 T;  3LG7 A;  4C91 A;  4NXN T;  3D0T A;  3IBP A;  3PUG A;  4QKN A;  3UQ7 A;  2JQK A;  4HE8 A;  2IC9 A;  2J47 A;  4EYU A;  2C5J A;  3PU3 A;  3NVO A;  3RH3 A;  3MAC A;  4B3S T;  4U3C A;  3B5M A;  4MFR A;  2PJQ A;  3W15 B;  3K1S A;  4DV4 T;  2YU2 A;  3KBU A;  3I0Q A;  3Q5D A;  3UUX B;  4ZOL E;  5JQG E;  4A97 A;  3AE9 A;  5JH7 E;  2GK9 A;  2C0S A;  4HWF A;  2XJ7 A;  4DUY T;  1HG5 A;  3NZP A;  2WP9 A;  2VQE T;  3KVA A;  3FBL A;  3LBX A;  2WZI A;  5LJN A;  4E7S A;  2NW7 A;  1UCU A;  3GA8 A;  3FZM B;  5AQJ B;  2Q9Q C;  4HFD A;  1ZEE A;  4MBQ A;  3BQL A;  3CK6 A;  2FJB A;  1L0V A;  3QK6 A;  3RI5 A;  2NP9 A;  4I55 E;  2ZM6 T;  5CJ5 A;  5LG3 A;  2I0M A;  3RIF A;  4WYV A;  4DV2 T;  1J1J A;  2ZM8 A;  1Y01 A;  3BQK A;  2KZ7 B;  3ONJ A;  3SS1 A;  5FVK A;  5HYA A;  2CRB A;  4U7Y A;  4DUZ T;  4H9P C;  2LT3 A;  2V7M A;  1HR0 T;  2CA5 A;  3P4S A;  3O1I A;  1LVK A;  1X9B A;  4ZI2 D;  1HNW T;  5AQU B;  2V6Y A;  4OK0 A;  5AQR B;  4P1N A;  4DBR A;  3AE4 A;  1O3X A;  2BBH A;  2LHR A;  2WCA A;  2UU9 T;  5KMG P;  2Y8D A;  1XWM A;  3R6N A;  5LP6 E;  1M62 A;  2WQY A;  2XAG B;  2W00 A;  4L0R A;  3AVS A;  4HN9 A;  4KP3 C;  4JUY A;  2WAU A;  3ZJ2 A;  4AKI A;  4IL9 A;  3N9P A;  1N32 T;  1SE7 A;  2A2F X;  1YQ3 A;  4CI1 B;  5FL0 A;  1D1A A;  2BG9 C;  5AQT B;  2UXB T;  1HX1 B; 
#chains in the Genus database with same CATH homology
 2CRB A;  4A5X A;  2V6Y A;  4P1N A;  4U3C A;  3EAB A;  4U7Y A;  3ZT6 A;  2A9U A;  2LRK A;  4U31 A;  4ZEY A;  2MPK A;  2JQ9 A;  3K1S A;  4CN1 A;  5FVL A;  3ZT7 A;  4U2Y A;  3ZSS A;  4CN6 A;  1WR0 A;  2LRL A;  2V6X A;  1YXR A;  5CGM A;  4CN4 A;  2RPA A;  2CPT A;  2K3W A;  3ZT5 A;  5FVK A;  2JQK A;  3ZST A;  4U7I A;  5CJ5 A;  4NIQ A;  2W2U A;  2V6Y B;  2DL1 A;  1WFD A;  4U33 A;  4U2Z A;  4IT4 A;  4WZX A;  2WY2 A;  1WCR A;  2WWV A;  2JQH A;  5LB7 B;  2XZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...