2JQKA

Vps4b mit-chmp2b complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
NLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associating protein 4B
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 72
sequence length 72
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jqkA00
3ZT5A 2CRBA 4U2YA 4CN4A 4U7IA 4ZEYA 2W2UA 5FVKA 2JQKA 2V6YB 5FVLA 1YXRA 3ZSSA 4U7YA 3ZT6A 4CN1A 4U33A 4A5XA 3K1SA 5LB7B 3ZSTA 3EABA 1WFDA 2WY2A 2JQHA 4IT4A 4P1NA 4WZXA 2XZEA 2WWVA 1WCRA 4CN6A 5CGMA 2CPTA 2LRKA 3ZT7A 2MPKA 4U31A 5CJ5A 2A9UA 2K3WA 4U2ZA 4U3CA 2RPAA 2V6YA 2DL1A 2JQ9A 2V6XA 4NIQA 1WR0A 2LRLA
chains in the Genus database with same CATH superfamily
3UQ7A 1T98A 3S4UA 3AEEA 3AVSA 4HFEA 3OYXA 5FXXA 3A7MA 1ZKEA 4AIUA 3UULA 4V1Av 5J2UE 3Q5DA 4YY3T 4LF4T 1E2AA 3O1JA 3B5MA 2ZM6T 1D0YA 4LF9T 4AQGA 4IDPA 1V9DA 2FJBA 5DQVA 4HWIB 4X66T 4CQIA 4E7ZA 2V7JA 2LSKA 1HNXT 4LF6T 2YINA 5ABFB 2PBIA 2QA7A 4HFBA 2LJLA 5ETWA 3RKGA 3MK7C 3LK2B 5JDFA 1IAPA 2BG9B 2NWBA 2KWIB 4WW0A 1ZEEA 4HTEA 2ACXA 1YW0A 2XSAA 4DV2T 4U3CA 3N2OA 3B13A 2VKJA 3UQ4A 2H3RA 4U2YA 4A56A 3OVUA 3TLVA 2IC6A 2HPJA 2KT9A 4P09A 2YK0A 2DI4A 2GK9A 1OWAA 2YDQA 3ESLA 2OA5A 2VKHA 4IE4A 2CPTA 5LMNT 5JDHA 3RC3A 4JV5T 4KMCA 2LM9A 4JUYA 4TN7B 1N36T 3AECA 3ZJ1A 2E5VA 3ZEFB 2ODVA 4ILAA 4DR4T 4YXDA 1CUNA 5FY1A 1D1CA 2E9XD 3EDUA 2V8SV 3KBTA 3BQIA 2WP9A 4B3MT 4O4LE 4NPPA 3NBXX 3C51A 5L3EB 2X9HA 5LG3A 4JI3T 3CQCB 1MIWA 3U3IA 1WRDA 1KNZA 4DV0T 2E5LT 4UVCB 5CJ5A 4NXMT 4NIQA 1NEKA 3CMLA 2NR4A 4GYSA 2WCAA 4UXNB 3Q5WA 2X0HA 4QX7B 1W0AA 5AQUB 4JEHB 4YTNA 1M62A 5LJNA 4NXNT 1N32T 2V1DB 5FNVE 3OJAA 4PFPA 3DJBA 4Q25A 2H7OA 4EYYR 3Q5XA 3SWHA 4HFIA 1XZYA 3F57A 1OEDA 3K8PC 5AQMB 5IWAT 4EGWA 4GYRA 4ADZA 2HN2A 1HX8A 2BVLA 5IHYA 2WU5A 2CRBA 2Y8DA 3ANWA 1HF8A 1XMOT 2K24A 2E9XC 3ONLC 1QLBA 2N9DA 5JDGA 5AQQB 5LYJE 4OYKA 4IE6A 4IE7A 5L4EA 2IIUA 1IBKT 4FI5A 1ZV4X 2KLQA 1IBMT 4IDQA 4ZS2A 3K3QC 3PUYF 3HL6A 2HHHT 3WI3A 4U2ZA 4BAYB 5AQOB 4AQYT 5M4YA 3RH3A 4X20E 3FZLB 2VVSA 5HXRA 3T8OA 4M1PA 4HGAA 2UUCT 3RYCE 4DV3T 1UURA 3HKEE 2XZEA 2V7MA 2N2NA 1Y64B 3P4WA 2J1DG 2CCQA 2NW8A 4A98A 5HYAA 4H9SE 5AQLB 2EHOC 4PJLA 4ZEYA 4YLHA 3VRAA 2B76A 4MHCA 3PUQA 4WYVA 3LBXB 4WZXA 4P1NA 4DR5T 2MPKA 2D9DA 2FBWA 2IW5B 2E8IA 1H7CA 3MA9A 5AQSB 4X64T 4ZZCA 3P4RA 4ZZBA 3MKDA 1YKEB 2CLYC 2BG9E 2A2FX 3FHNA 4QH4A 3VR9A 4AKIA 3BQKA 2H88A 5HEGA 2JRKA 4YTMA 1LVKA 2WDVA 5HXHA 2W0GA 5DABA 4IT4A 1ZOYA 5L3FB 5CB4E 4ISSA 3AE3A 1EZ3A 2CE7A 2XHEB 2XQ7A 4MBQA 2X51A 3H3MA 3T1HT 2LOPA 1UX4A 4ILCA 5KXJA 3Q9DA 5L4HA 1LVFA 2KZ7B 4IDZA 4TWDA 4P0BA 2C5IT 5LBMA 2IHR1 2V7KA 5LXTE 3LK3B 3H3AA 3UUBA 3MXZA 1I6ZA 3FBLA 4CI1B 3FBZA 3HKCE 3QB5A 2VVNA 2C5JA 1J1JA 2LRKA 5LHHB 2J4GA 3V5SA 4DR7T 2H7VC 2NTYA 2OLTA 2UUBT 2LE8A 4IHJE 2DWGA 2VK9A 5HEUA 4PJNA 2DNXA 2KSRA 3KVAA 2A3DA 2BS2A 3ZCJA 3P4QA 4CN6A 3LG7A 4XBFB 4KP3C 4OK0A 1ZHCA 3C4WA 5IYZE 2IDOB 1UX5A 5C8YE 1FMWA 3UU3A 5JDNA 4ZOLE 4PW8A 4HFVA 4GK5E 2J47A 4JBWF 2I6HA 4XAXB 2RP4A 2A9UA 4AKLA 2E9XB 3BK9A 3RI5A 5L3DB 5L3CB 3I1AA 3JC6C 1LRZA 3ZC1A 4QX8B 1HG2A 3R6NA 4DNDA 4TZ4C 4HKAA 2LEHA 3A5XA 5L2LA 4XZCA 2JIWA 4MLKA 4YHHT 4DUZT 2JMHA 3TLSA 5FVKA 5TAOA 1IBLT 3OTOT 3ZC0A 3C4XA 5HEOA 2WWVA 3HKBE 3RIFA 4B3RT 1AJ3A 1E1HB 3O1IA 2UXBT 2HPLA 2LSGA 3L3PA 1SA0E 3N2GE 4BJMA 4UV9B 1HS7A 3PUSA 3QK6A 5LB7B 3GWHA 4X1KE 4TV8E 5L3BB 4YT0A 2IC9A 5ADXL 4ZI2C 4KX6A 3P8CD 3TLTA 2ACZA 1HX1B 2XQYA 3N9QA 3ZPOA 3ZMUB 4HFHA 2LKHA 4I0UA 4O2BE 2XAQB 3C4ZA 3C50A 3W15B 3MJXA 3O9XA 3NZPA 4JI4T 3MZKB 3NRXA 4HE8A 2WMOA 2XQ8A 3SRZA 2FJEA 1N34T 3IBPA 3N9OA 3PUAA 3EDVA 2YDRA 4YFSA 5AQIB 2D5UA 2EHOA 2VWAA 3GN5A 2ZM8A 4ISTA 3L09A 1Y01A 4H9QC 4X62T 5JQGE 1KEYA 3AAAB 2K3WA 1NENA 1US7B 1J5ET 1BR0A 4U31A 5LP6E 2WQYA 3KV6A 3F31A 3O1HA 4EV6A 4YSZA 4B3TT 2KXPB 3RIAA 2WY2A 3CIRA 5JDLA 4HN9A 2KMFA 3AA7B 1ZP0A 2V26A 3F2EA 4DV6T 2NW7A 2L8KA 4JYAT 3RHWA 3PURA 5FKYA 3AE1A 2JQKA 4GKKT 4PJMA 3ZMZB 1FMVA 4CXYA 2UXXB 1SE7A 3UUMA 4AKHA 2ZM0A 4PFOA 4AKGA 3CVRA 2MBGA 1W09A 5KX5E 1OEDB 2XAGB 3M3ZB 3CWZB 2CM0A 4NUUA 2LRLA 3IA3A 5JH7E 3HR0A 1XMQT 5EK2A 4TWHA 4YTPA 5LGNB 2D2SA 3WAJA 3AEFA 4DR3T 3ANWB 4CXXA 2BG9A 4EAHA 3HA4A 4TNWA 4H9RC 4EZHA 1VCTA 3IEEA 1YQ4A 3FB2A 1FJGT 1Z0PA 5AQRB 4YSYA 2BDEA 3UU6A 4H9OC 4X1IE 3QOFA 4IREA 4X1YE 3UT5E 2WZIA 5AFUL 2JQ9A 2V6XA 1WR0A 3TKLB 5L3GB 3EI0A 2ODUA 5C3JA 5ABGA 5E0OA 3OYZA 2EHOD 3E0ZA 4KBMB 3U78A 3K3NA 2CMRA 1MIVA 1KK7A 5HWXA 3V5UA 5CGMA 4I55E 2XQ5A 3IF8B 2V6YA 2B1EA 4WBOA 3AEAA 3RKOA 4DUYT 2CXFA 4O4HE 2IAKA 4CN1A 3RLFF 2D0TA 3RGLA 3PUXF 3Q2MA 5L47A 4X5TA 4I43B 4CZZB 5LGTB 2K5BB 3KVBA 4UV8B 1BR2A 3PJAJ 5A1LA 2X9WA 1D1AA 2LKGA 4DR2T 3N5LA 1YQ3A 3ZYLA 5J0ZA 2W00A 1HNWT 4JEUB 2RPAA 1QUUA 2SPCA 4LMKA 4ZHQE 4L9IA 5FXZA 3NVOA 2X67A 1J5WA 3E08A 4UF0A 4LFCT 4GOUA 5EK3A 4DO0A 4H9NC 4ILBA 2PFVA 4ASKA 3PDYA 2WS3A 4IL4A 3J7Yq 1B7TA 2XAHB 3RYIE 3FZFB 4I4TE 3N2KE 2NTXA 3HI2A 5H6RB 5ABEA 1S35A 3FZMB 5HCMA 2ES0A 3K1SA 1O3XA 4Z8XA 2Y48B 3P4SA 3RPUA 1XWMA 3QUJA 4KUMB 3NZQA 4OFZA 1KNRA 3PJAA 2JQQA 1MMGA 2V5CA 4BJNA 4DBRA 4C90A 3ETUA 3JAFA 2L3LA 3CKDA 5LG4A 4AQFA 2MAWA 3ZYKA 1MNDA 2XQ3A 3KINB 3AE7A 2V5DA 3ZN0B 2XM2A 1W9RA 3CQXC 3PU3A 4HWFA 1XDOA 3AA6B 3KFWX 5LOVE 3CX8B 2I59A 2CHOA 3EUHA 3N9LA 4MALA 4B6XA 1G8XA 2YN6A 2HN1A 3I9YA 1XNRT 2KNDA 3KV5A 3JC6D 1BR1A 3H37A 2XAJB 2BG9C 5HXCA 2XASB 4DBQA 1U4QA 1IJ5A 3AE2A 2MOZA 1VCSA 3ONXA 5JRCA 3L39A 4UVAB 5F3JA 3QC9A 4UR9A 4PNIA 3EHZA 4UVBB 1GQEA 4PK6A 3HKDE 3UTKA 2JQHA 3X1DA 5FL0A 5LMUT 3O4XE 2LOSA 1IJ6A 5GONE 1M7KA 4JI0T 3PV0F 4KHPT 3OKQA 5LA6E 3UU5A 3T1YT 2Q9QA 2WSSV 3QNUA 5JDMA 4JI8T 5CA1E 1HTJF 2RA1A 4DV1T 4EYUA 4ZI2D 4EOZB 1HNZT 4KI0F 3VRBA 3RQUA 3N9PA 1YD8G 4FJOA 2CA5A 1Z8UA 4HWCA 2P9BA 4OHFA 4F8HA 3PUVF 3NRYA 3R84B 2X9XA 2WMNA 4LF7T 3RIUC 3FXEB 4EZ4A 2YU2A 4IDOA 5LJMA 4JI1T 4U7YA 4ZI3C 2CWYA 2BKPA 2L9QA 4C91A 2XSBA 4KHZF 3EAMA 2XQAA 2LLYA 5AQJB 3AE8A 3ONJA 3DTOA 4HFDA 1HFAA 4DMVA 2AXDS 2MYSA 2W63A 3G06A 2VKOA 3P50A 2UXNB 2CBJA 1FIOA 2X0YA 2JPFA 3KV9A 2VB6A 4B3ST 5FVLA 3RC8A 3UFEA 2W62A 2W66A 1D1BA 2WM9A 3N9NA 4IGUA 3LK42 3AE5A 2EHOB 3IHRA 3GN5B 2WDRA 2NP9A 3AE9A 1L0VA 2XUEA 3P4PA 1NAFA 5HAXA 3ZMVB 5CA0E 3FZKB 4NUVA 4JI5T 3LSVA 4AQFC 2Q9QD 2LHNA 2BBJA 2XJ7A 1NWMX 4DMWA 3AXJA 4QKNA 1WYBA 3UUNA 2CLYB 4YSXA 5AQGB 2W2UA 2X68A 2FUPA 4YJ2E 2XAFB 2BS3A 1CHUA 1KFYA 2UU9T 2LSYA 2FJDA 2W67A 4QH5A 2LSIA 3DP7A 4K0KT 5J1GA 3GMIA 4QXBB 5JR9A 3I0OA 4HEAA 1I94T 3ZYMA 4DIDB 3KBUA 4LFAT 4PJJA 3VHLA 3PUZF 2YOEA 3I0QA 2VL8A 1JNRA 4LFBT 3OPCA 4EEDA 3ABVA 4EIWA 4E7SA 3PTRB 3PUGA 4GKJT 2UUAT 3AA1B 2HH7A 4DV4T 5JDQA 4JLEA 3AAIA 3VKGA 1G73A 2J62A 2XM1A 4L0RA 2E2AA 3PU8A 5AQVB 3VU7H 2I0MA 2W4XA 3SOLA 2Q9QC 5KMGP 4JI2T 5AQPB 1E7PA 4F6RC 3AA0B 2LSJA 3ZJ2A 2ZLYA 2X9YA 3GA8A 3CX7B 4DR6T 3TLWA 4ZI7E 2V6YB 5ABFA 5LGUB 5AQKB 2CBIA 3UUXB 3MACA 3ZCIA 3AEGA 4Z90A 4LMLA 3FZHB 3JCFA 5FXWA 1VRBA 4CI2B 4DV5T 5FMNA 3BQLA 4ZS3A 3SS1A 3CQGB 2LM2A 3C98B 1MIYA 2LHRA 4AISA 5AQTB 2WZHA 2M6BA 2BKNA 4H9PC 3B57A 4L5GA 4ANJA 3Q5EA 2WU2A 2MTQA 3JAEA 1UCUA 2QYWA 1KF6A 4UF0B 1T72A 5AQHB 1QSDA 2K9AA 1LKXA 4G63A 4PK4A 1W0BA 2CWOA 2XY8B 4PK5A 1MMAA 2CHNA 4CN4A 3RRCA 5C2TA 3RQWA 5HEHA 5J2TE 4O4JE 5DJQC 1WFDA 2VQET 5KDMC 4ZXLA 4O2AE 1YKHB 2JMKA 4CXWA 4LF5T 3E22E 4CI3B 2DL1A 5JTGA 2K48A 2DCFA 2X0LB 3SFDA 3RIUA 4TNVA 2BVMA 2QRXA 4QWNB 4G2AA 4JI7T 3AVRA 5EK4A 3M65A 3K3OA 4HWDA 3AB3B 4J2CA 4LMJA 4N78D 2G0UA 4K0UA 4DV7T 4H63V 3RYFE 2WAUA 2PG8A 4TV9E 1OXZA 4PAGA 4BA9A 5HCJA 2CXLA 2BS4A 4AKRB 3LJCA 1WCRA 2F4VT 3CPZA 1UUSA 3I9WA 5JR9C 2YDSA 5FP3A 4X65T 2V7IA 1BR4A 3J9X1 1MMNA 2XQ6A 3P7IA 4Z91A 1XDPA 2A72A 3AAEB 4COFA 5FXVA 3AE6A 2VASA 2PTFA 3RYHE 3WAKA 1UK5A 2XQ4A 5LNKA 4O4IE 5AQFB 2NOXA 5JRCB 4DVDA 5HXEA 2DWKA 5F8PA 2QGSA 4LF8T 4JI6T 2KWHA 3NWIA 5FY0A 1UGOA 5JREA 5ABHA 3AEDA 3ZT6A 2C0SA 5FY7A 1DU2A 1VOMA 3ZT7A 5JVDE 4AI6A 1WYCA 3AEBA 5EZYE 3ZT5A 2Q9QB 5FL1A 2IUBA 4ERRA 3ZMTB 3EVYA 3ZMSB 5LHGB 2UXCT 2DLRA 4ZI3D 4H63H 2WWUA 5BR8T 3ZN1B 2W61A 3QB5K 3AE4A 4GIWA 1X9BA 3PUWF 4A97A 3LBXA 1MMDA 2WB5A 4QH1A 4WBNE 4IIJE 4U7IA 2XPKA 4IDNA 1OEDE 3ZSSA 2CXDA 4QHOA 4HFCA 4U33A 3CX6B 3EABA 2VQFT 2KINB 2CEAA 5CFBA 2VL0A 3JADA 4OYJA 3NKZA 2ZM2A 5HEJA 4IL9A 4HWHA 3ZSTA 1WR6A 2N1GA 4QXCB 2LT3A 5IUXA 4MFRA 2H89A 4YHJA 3OBVE 2R6GF 1D0ZA 1X79A 3RX6A 2C5KT 3ZKRA 1FEWA 4TUYE 4UELA 1U5PA 4I50E 1T7SA 5BMVE 3UFGA 1R8IA 5LBQB 2XTLA 3LFMA 1S94A 4OX9T 2YU1A 3SFEA 4U72A 2PJQA 1OEDC 2ZMAA 4U74A 2QVAA 3ZLIA 1IZNB 4EEBA 1XNQT 4A5XA 1WLXA 2VKDA 1T8BA 3C64A 2NW9A 2WBLA 4YJ3E 2M67A 3D0TA 3A8YC 5HWYA 5LHIB 3ETVA 1HG5A 2X66A 2XQ9A 3TLUA 1KNPA 4WNKA 2UXDT 2YEVC 2M6IA 4P0AA 1HCIA 5F5WA 4GK0E 4O8SA 5AQNB 3KDSE 4UIGA 4IE5A 1SUMB 1N33T 3RRWA 2FJAA 2OV9A 1SHZC 3UU8A 2D0UA 3AXJB 2Y6XA 4QXHB 3PE0A 5LCYA 2DHRA 2Z6EA 2YKSA 3FXDB 1MNEA 2JJ9A 4EB6E 4IE0A 5JR9B 2V7LA 3L8RA 3CK6A 5H6QB 4UEMA 5FYMA 1JNZA 1D0XA 3N9MA 4AXPA 4EXTA 2AE9A 3LDQB 3VKHA 1YXRA 2BBHA 3RF1A 4DR1T 1HR0T 2BKOA 2E9XA 4TWFA 2BZBA 3UU4A 4ILUA 2WDQA 5DQWA 5HXSA 2IMLA 3KV4A 3VR8A 4TX5A 2VURA
chains in the Genus database with same CATH topology
3ZT5A 2CRBA 4U2YA 4CN4A 4U7IA 4ZEYA 2W2UA 5FVKA 2JQKA 2V6YB 5FVLA 1YXRA 3ZSSA 4U7YA 3ZT6A 4CN1A 4U33A 4A5XA 3K1SA 5LB7B 3ZSTA 3EABA 1WFDA 2WY2A 2JQHA 4IT4A 4P1NA 4WZXA 2XZEA 2WWVA 1WCRA 4CN6A 5CGMA 2CPTA 2LRKA 3ZT7A 2MPKA 4U31A 5CJ5A 2A9UA 2K3WA 4U2ZA 4U3CA 2RPAA 2V6YA 2DL1A 2JQ9A 2V6XA 4NIQA 1WR0A 2LRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT5 A;  2CRB A;  4U2Y A;  4CN4 A;  4U7I A;  4ZEY A;  2W2U A;  5FVK A;  2JQK A;  2V6Y B;  5FVL A;  1YXR A;  3ZSS A;  4U7Y A;  3ZT6 A;  4CN1 A;  4U33 A;  4A5X A;  3K1S A;  5LB7 B;  3ZST A;  3EAB A;  1WFD A;  2WY2 A;  2JQH A;  4IT4 A;  4P1N A;  4WZX A;  2XZE A;  2WWV A;  1WCR A;  4CN6 A;  5CGM A;  2CPT A;  2LRK A;  3ZT7 A;  2MPK A;  4U31 A;  5CJ5 A;  2A9U A;  2K3W A;  4U2Z A;  4U3C A;  2RPA A;  2V6Y A;  2DL1 A;  2JQ9 A;  2V6X A;  4NIQ A;  1WR0 A;  2LRL A; 
#chains in the Genus database with same CATH topology
 3UQ7 A;  1T98 A;  3S4U A;  3AEE A;  3AVS A;  4HFE A;  3OYX A;  5FXX A;  3A7M A;  1ZKE A;  4AIU A;  3UUL A;  4V1A v;  5J2U E;  3Q5D A;  4YY3 T;  4LF4 T;  1E2A A;  3O1J A;  3B5M A;  2ZM6 T;  1D0Y A;  4LF9 T;  4AQG A;  4IDP A;  1V9D A;  2FJB A;  5DQV A;  4HWI B;  4X66 T;  4CQI A;  4E7Z A;  2V7J A;  2LSK A;  1HNX T;  4LF6 T;  2YIN A;  5ABF B;  2PBI A;  2QA7 A;  4HFB A;  2LJL A;  5ETW A;  3RKG A;  3MK7 C;  3LK2 B;  5JDF A;  1IAP A;  2BG9 B;  2NWB A;  2KWI B;  4WW0 A;  1ZEE A;  4HTE A;  2ACX A;  1YW0 A;  2XSA A;  4DV2 T;  4U3C A;  3N2O A;  3B13 A;  2VKJ A;  3UQ4 A;  2H3R A;  4U2Y A;  4A56 A;  3OVU A;  3TLV A;  2IC6 A;  2HPJ A;  2KT9 A;  4P09 A;  2YK0 A;  2DI4 A;  2GK9 A;  1OWA A;  2YDQ A;  3ESL A;  2OA5 A;  2VKH A;  4IE4 A;  2CPT A;  5LMN T;  5JDH A;  3RC3 A;  4JV5 T;  4KMC A;  2LM9 A;  4JUY A;  4TN7 B;  1N36 T;  3AEC A;  3ZJ1 A;  2E5V A;  3ZEF B;  2ODV A;  4ILA A;  4DR4 T;  4YXD A;  1CUN A;  5FY1 A;  1D1C A;  2E9X D;  3EDU A;  2V8S V;  3KBT A;  3BQI A;  2WP9 A;  4B3M T;  4O4L E;  4NPP A;  3NBX X;  3C51 A;  5L3E B;  2X9H A;  5LG3 A;  4JI3 T;  3CQC B;  1MIW A;  3U3I A;  1WRD A;  1KNZ A;  4DV0 T;  2E5L T;  4UVC B;  5CJ5 A;  4NXM T;  4NIQ A;  1NEK A;  3CML A;  2NR4 A;  4GYS A;  2WCA A;  4UXN B;  3Q5W A;  2X0H A;  4QX7 B;  1W0A A;  5AQU B;  4JEH B;  4YTN A;  1M62 A;  5LJN A;  4NXN T;  1N32 T;  2V1D B;  5FNV E;  3OJA A;  4PFP A;  3DJB A;  4Q25 A;  2H7O A;  4EYY R;  3Q5X A;  3SWH A;  4HFI A;  1XZY A;  3F57 A;  1OED A;  3K8P C;  5AQM B;  5IWA T;  4EGW A;  4GYR A;  4ADZ A;  2HN2 A;  1HX8 A;  2BVL A;  5IHY A;  2WU5 A;  2CRB A;  2Y8D A;  3ANW A;  1HF8 A;  1XMO T;  2K24 A;  2E9X C;  3ONL C;  1QLB A;  2N9D A;  5JDG A;  5AQQ B;  5LYJ E;  4OYK A;  4IE6 A;  4IE7 A;  5L4E A;  2IIU A;  1IBK T;  4FI5 A;  1ZV4 X;  2KLQ A;  1IBM T;  4IDQ A;  4ZS2 A;  3K3Q C;  3PUY F;  3HL6 A;  2HHH T;  3WI3 A;  4U2Z A;  4BAY B;  5AQO B;  4AQY T;  5M4Y A;  3RH3 A;  4X20 E;  3FZL B;  2VVS A;  5HXR A;  3T8O A;  4M1P A;  4HGA A;  2UUC T;  3RYC E;  4DV3 T;  1UUR A;  3HKE E;  2XZE A;  2V7M A;  2N2N A;  1Y64 B;  3P4W A;  2J1D G;  2CCQ A;  2NW8 A;  4A98 A;  5HYA A;  4H9S E;  5AQL B;  2EHO C;  4PJL A;  4ZEY A;  4YLH A;  3VRA A;  2B76 A;  4MHC A;  3PUQ A;  4WYV A;  3LBX B;  4WZX A;  4P1N A;  4DR5 T;  2MPK A;  2D9D A;  2FBW A;  2IW5 B;  2E8I A;  1H7C A;  3MA9 A;  5AQS B;  4X64 T;  4ZZC A;  3P4R A;  4ZZB A;  3MKD A;  1YKE B;  2CLY C;  2BG9 E;  2A2F X;  3FHN A;  4QH4 A;  3VR9 A;  4AKI A;  3BQK A;  2H88 A;  5HEG A;  2JRK A;  4YTM A;  1LVK A;  2WDV A;  5HXH A;  2W0G A;  5DAB A;  4IT4 A;  1ZOY A;  5L3F B;  5CB4 E;  4ISS A;  3AE3 A;  1EZ3 A;  2CE7 A;  2XHE B;  2XQ7 A;  4MBQ A;  2X51 A;  3H3M A;  3T1H T;  2LOP A;  1UX4 A;  4ILC A;  5KXJ A;  3Q9D A;  5L4H A;  1LVF A;  2KZ7 B;  4IDZ A;  4TWD A;  4P0B A;  2C5I T;  5LBM A;  2IHR 1;  2V7K A;  5LXT E;  3LK3 B;  3H3A A;  3UUB A;  3MXZ A;  1I6Z A;  3FBL A;  4CI1 B;  3FBZ A;  3HKC E;  3QB5 A;  2VVN A;  2C5J A;  1J1J A;  2LRK A;  5LHH B;  2J4G A;  3V5S A;  4DR7 T;  2H7V C;  2NTY A;  2OLT A;  2UUB T;  2LE8 A;  4IHJ E;  2DWG A;  2VK9 A;  5HEU A;  4PJN A;  2DNX A;  2KSR A;  3KVA A;  2A3D A;  2BS2 A;  3ZCJ A;  3P4Q A;  4CN6 A;  3LG7 A;  4XBF B;  4KP3 C;  4OK0 A;  1ZHC A;  3C4W A;  5IYZ E;  2IDO B;  1UX5 A;  5C8Y E;  1FMW A;  3UU3 A;  5JDN A;  4ZOL E;  4PW8 A;  4HFV A;  4GK5 E;  2J47 A;  4JBW F;  2I6H A;  4XAX B;  2RP4 A;  2A9U A;  4AKL A;  2E9X B;  3BK9 A;  3RI5 A;  5L3D B;  5L3C B;  3I1A A;  3JC6 C;  1LRZ A;  3ZC1 A;  4QX8 B;  1HG2 A;  3R6N A;  4DND A;  4TZ4 C;  4HKA A;  2LEH A;  3A5X A;  5L2L A;  4XZC A;  2JIW A;  4MLK A;  4YHH T;  4DUZ T;  2JMH A;  3TLS A;  5FVK A;  5TAO A;  1IBL T;  3OTO T;  3ZC0 A;  3C4X A;  5HEO A;  2WWV A;  3HKB E;  3RIF A;  4B3R T;  1AJ3 A;  1E1H B;  3O1I A;  2UXB T;  2HPL A;  2LSG A;  3L3P A;  1SA0 E;  3N2G E;  4BJM A;  4UV9 B;  1HS7 A;  3PUS A;  3QK6 A;  5LB7 B;  3GWH A;  4X1K E;  4TV8 E;  5L3B B;  4YT0 A;  2IC9 A;  5ADX L;  4ZI2 C;  4KX6 A;  3P8C D;  3TLT A;  2ACZ A;  1HX1 B;  2XQY A;  3N9Q A;  3ZPO A;  3ZMU B;  4HFH A;  2LKH A;  4I0U A;  4O2B E;  2XAQ B;  3C4Z A;  3C50 A;  3W15 B;  3MJX A;  3O9X A;  3NZP A;  4JI4 T;  3MZK B;  3NRX A;  4HE8 A;  2WMO A;  2XQ8 A;  3SRZ A;  2FJE A;  1N34 T;  3IBP A;  3N9O A;  3PUA A;  3EDV A;  2YDR A;  4YFS A;  5AQI B;  2D5U A;  2EHO A;  2VWA A;  3GN5 A;  2ZM8 A;  4IST A;  3L09 A;  1Y01 A;  4H9Q C;  4X62 T;  5JQG E;  1KEY A;  3AAA B;  2K3W A;  1NEN A;  1US7 B;  1J5E T;  1BR0 A;  4U31 A;  5LP6 E;  2WQY A;  3KV6 A;  3F31 A;  3O1H A;  4EV6 A;  4YSZ A;  4B3T T;  2KXP B;  3RIA A;  2WY2 A;  3CIR A;  5JDL A;  4HN9 A;  2KMF A;  3AA7 B;  1ZP0 A;  2V26 A;  3F2E A;  4DV6 T;  2NW7 A;  2L8K A;  4JYA T;  3RHW A;  3PUR A;  5FKY A;  3AE1 A;  2JQK A;  4GKK T;  4PJM A;  3ZMZ B;  1FMV A;  4CXY A;  2UXX B;  1SE7 A;  3UUM A;  4AKH A;  2ZM0 A;  4PFO A;  4AKG A;  3CVR A;  2MBG A;  1W09 A;  5KX5 E;  1OED B;  2XAG B;  3M3Z B;  3CWZ B;  2CM0 A;  4NUU A;  2LRL A;  3IA3 A;  5JH7 E;  3HR0 A;  1XMQ T;  5EK2 A;  4TWH A;  4YTP A;  5LGN B;  2D2S A;  3WAJ A;  3AEF A;  4DR3 T;  3ANW B;  4CXX A;  2BG9 A;  4EAH A;  3HA4 A;  4TNW A;  4H9R C;  4EZH A;  1VCT A;  3IEE A;  1YQ4 A;  3FB2 A;  1FJG T;  1Z0P A;  5AQR B;  4YSY A;  2BDE A;  3UU6 A;  4H9O C;  4X1I E;  3QOF A;  4IRE A;  4X1Y E;  3UT5 E;  2WZI A;  5AFU L;  2JQ9 A;  2V6X A;  1WR0 A;  3TKL B;  5L3G B;  3EI0 A;  2ODU A;  5C3J A;  5ABG A;  5E0O A;  3OYZ A;  2EHO D;  3E0Z A;  4KBM B;  3U78 A;  3K3N A;  2CMR A;  1MIV A;  1KK7 A;  5HWX A;  3V5U A;  5CGM A;  4I55 E;  2XQ5 A;  3IF8 B;  2V6Y A;  2B1E A;  4WBO A;  3AEA A;  3RKO A;  4DUY T;  2CXF A;  4O4H E;  2IAK A;  4CN1 A;  3RLF F;  2D0T A;  3RGL A;  3PUX F;  3Q2M A;  5L47 A;  4X5T A;  4I43 B;  4CZZ B;  5LGT B;  2K5B B;  3KVB A;  4UV8 B;  1BR2 A;  3PJA J;  5A1L A;  2X9W A;  1D1A A;  2LKG A;  4DR2 T;  3N5L A;  1YQ3 A;  3ZYL A;  5J0Z A;  2W00 A;  1HNW T;  4JEU B;  2RPA A;  1QUU A;  2SPC A;  4LMK A;  4ZHQ E;  4L9I A;  5FXZ A;  3NVO A;  2X67 A;  1J5W A;  3E08 A;  4UF0 A;  4LFC T;  4GOU A;  5EK3 A;  4DO0 A;  4H9N C;  4ILB A;  2PFV A;  4ASK A;  3PDY A;  2WS3 A;  4IL4 A;  3J7Y q;  1B7T A;  2XAH B;  3RYI E;  3FZF B;  4I4T E;  3N2K E;  2NTX A;  3HI2 A;  5H6R B;  5ABE A;  1S35 A;  3FZM B;  5HCM A;  2ES0 A;  3K1S A;  1O3X A;  4Z8X A;  2Y48 B;  3P4S A;  3RPU A;  1XWM A;  3QUJ A;  4KUM B;  3NZQ A;  4OFZ A;  1KNR A;  3PJA A;  2JQQ A;  1MMG A;  2V5C A;  4BJN A;  4DBR A;  4C90 A;  3ETU A;  3JAF A;  2L3L A;  3CKD A;  5LG4 A;  4AQF A;  2MAW A;  3ZYK A;  1MND A;  2XQ3 A;  3KIN B;  3AE7 A;  2V5D A;  3ZN0 B;  2XM2 A;  1W9R A;  3CQX C;  3PU3 A;  4HWF A;  1XDO A;  3AA6 B;  3KFW X;  5LOV E;  3CX8 B;  2I59 A;  2CHO A;  3EUH A;  3N9L A;  4MAL A;  4B6X A;  1G8X A;  2YN6 A;  2HN1 A;  3I9Y A;  1XNR T;  2KND A;  3KV5 A;  3JC6 D;  1BR1 A;  3H37 A;  2XAJ B;  2BG9 C;  5HXC A;  2XAS B;  4DBQ A;  1U4Q A;  1IJ5 A;  3AE2 A;  2MOZ A;  1VCS A;  3ONX A;  5JRC A;  3L39 A;  4UVA B;  5F3J A;  3QC9 A;  4UR9 A;  4PNI A;  3EHZ A;  4UVB B;  1GQE A;  4PK6 A;  3HKD E;  3UTK A;  2JQH A;  3X1D A;  5FL0 A;  5LMU T;  3O4X E;  2LOS A;  1IJ6 A;  5GON E;  1M7K A;  4JI0 T;  3PV0 F;  4KHP T;  3OKQ A;  5LA6 E;  3UU5 A;  3T1Y T;  2Q9Q A;  2WSS V;  3QNU A;  5JDM A;  4JI8 T;  5CA1 E;  1HTJ F;  2RA1 A;  4DV1 T;  4EYU A;  4ZI2 D;  4EOZ B;  1HNZ T;  4KI0 F;  3VRB A;  3RQU A;  3N9P A;  1YD8 G;  4FJO A;  2CA5 A;  1Z8U A;  4HWC A;  2P9B A;  4OHF A;  4F8H A;  3PUV F;  3NRY A;  3R84 B;  2X9X A;  2WMN A;  4LF7 T;  3RIU C;  3FXE B;  4EZ4 A;  2YU2 A;  4IDO A;  5LJM A;  4JI1 T;  4U7Y A;  4ZI3 C;  2CWY A;  2BKP A;  2L9Q A;  4C91 A;  2XSB A;  4KHZ F;  3EAM A;  2XQA A;  2LLY A;  5AQJ B;  3AE8 A;  3ONJ A;  3DTO A;  4HFD A;  1HFA A;  4DMV A;  2AXD S;  2MYS A;  2W63 A;  3G06 A;  2VKO A;  3P50 A;  2UXN B;  2CBJ A;  1FIO A;  2X0Y A;  2JPF A;  3KV9 A;  2VB6 A;  4B3S T;  5FVL A;  3RC8 A;  3UFE A;  2W62 A;  2W66 A;  1D1B A;  2WM9 A;  3N9N A;  4IGU A;  3LK4 2;  3AE5 A;  2EHO B;  3IHR A;  3GN5 B;  2WDR A;  2NP9 A;  3AE9 A;  1L0V A;  2XUE A;  3P4P A;  1NAF A;  5HAX A;  3ZMV B;  5CA0 E;  3FZK B;  4NUV A;  4JI5 T;  3LSV A;  4AQF C;  2Q9Q D;  2LHN A;  2BBJ A;  2XJ7 A;  1NWM X;  4DMW A;  3AXJ A;  4QKN A;  1WYB A;  3UUN A;  2CLY B;  4YSX A;  5AQG B;  2W2U A;  2X68 A;  2FUP A;  4YJ2 E;  2XAF B;  2BS3 A;  1CHU A;  1KFY A;  2UU9 T;  2LSY A;  2FJD A;  2W67 A;  4QH5 A;  2LSI A;  3DP7 A;  4K0K T;  5J1G A;  3GMI A;  4QXB B;  5JR9 A;  3I0O A;  4HEA A;  1I94 T;  3ZYM A;  4DID B;  3KBU A;  4LFA T;  4PJJ A;  3VHL A;  3PUZ F;  2YOE A;  3I0Q A;  2VL8 A;  1JNR A;  4LFB T;  3OPC A;  4EED A;  3ABV A;  4EIW A;  4E7S A;  3PTR B;  3PUG A;  4GKJ T;  2UUA T;  3AA1 B;  2HH7 A;  4DV4 T;  5JDQ A;  4JLE A;  3AAI A;  3VKG A;  1G73 A;  2J62 A;  2XM1 A;  4L0R A;  2E2A A;  3PU8 A;  5AQV B;  3VU7 H;  2I0M A;  2W4X A;  3SOL A;  2Q9Q C;  5KMG P;  4JI2 T;  5AQP B;  1E7P A;  4F6R C;  3AA0 B;  2LSJ A;  3ZJ2 A;  2ZLY A;  2X9Y A;  3GA8 A;  3CX7 B;  4DR6 T;  3TLW A;  4ZI7 E;  2V6Y B;  5ABF A;  5LGU B;  5AQK B;  2CBI A;  3UUX B;  3MAC A;  3ZCI A;  3AEG A;  4Z90 A;  4LML A;  3FZH B;  3JCF A;  5FXW A;  1VRB A;  4CI2 B;  4DV5 T;  5FMN A;  3BQL A;  4ZS3 A;  3SS1 A;  3CQG B;  2LM2 A;  3C98 B;  1MIY A;  2LHR A;  4AIS A;  5AQT B;  2WZH A;  2M6B A;  2BKN A;  4H9P C;  3B57 A;  4L5G A;  4ANJ A;  3Q5E A;  2WU2 A;  2MTQ A;  3JAE A;  1UCU A;  2QYW A;  1KF6 A;  4UF0 B;  1T72 A;  5AQH B;  1QSD A;  2K9A A;  1LKX A;  4G63 A;  4PK4 A;  1W0B A;  2CWO A;  2XY8 B;  4PK5 A;  1MMA A;  2CHN A;  4CN4 A;  3RRC A;  5C2T A;  3RQW A;  5HEH A;  5J2T E;  4O4J E;  5DJQ C;  1WFD A;  2VQE T;  5KDM C;  4ZXL A;  4O2A E;  1YKH B;  2JMK A;  4CXW A;  4LF5 T;  3E22 E;  4CI3 B;  2DL1 A;  5JTG A;  2K48 A;  2DCF A;  2X0L B;  3SFD A;  3RIU A;  4TNV A;  2BVM A;  2QRX A;  4QWN B;  4G2A A;  4JI7 T;  3AVR A;  5EK4 A;  3M65 A;  3K3O A;  4HWD A;  3AB3 B;  4J2C A;  4LMJ A;  4N78 D;  2G0U A;  4K0U A;  4DV7 T;  4H63 V;  3RYF E;  2WAU A;  2PG8 A;  4TV9 E;  1OXZ A;  4PAG A;  4BA9 A;  5HCJ A;  2CXL A;  2BS4 A;  4AKR B;  3LJC A;  1WCR A;  2F4V T;  3CPZ A;  1UUS A;  3I9W A;  5JR9 C;  2YDS A;  5FP3 A;  4X65 T;  2V7I A;  1BR4 A;  3J9X 1;  1MMN A;  2XQ6 A;  3P7I A;  4Z91 A;  1XDP A;  2A72 A;  3AAE B;  4COF A;  5FXV A;  3AE6 A;  2VAS A;  2PTF A;  3RYH E;  3WAK A;  1UK5 A;  2XQ4 A;  5LNK A;  4O4I E;  5AQF B;  2NOX A;  5JRC B;  4DVD A;  5HXE A;  2DWK A;  5F8P A;  2QGS A;  4LF8 T;  4JI6 T;  2KWH A;  3NWI A;  5FY0 A;  1UGO A;  5JRE A;  5ABH A;  3AED A;  3ZT6 A;  2C0S A;  5FY7 A;  1DU2 A;  1VOM A;  3ZT7 A;  5JVD E;  4AI6 A;  1WYC A;  3AEB A;  5EZY E;  3ZT5 A;  2Q9Q B;  5FL1 A;  2IUB A;  4ERR A;  3ZMT B;  3EVY A;  3ZMS B;  5LHG B;  2UXC T;  2DLR A;  4ZI3 D;  4H63 H;  2WWU A;  5BR8 T;  3ZN1 B;  2W61 A;  3QB5 K;  3AE4 A;  4GIW A;  1X9B A;  3PUW F;  4A97 A;  3LBX A;  1MMD A;  2WB5 A;  4QH1 A;  4WBN E;  4IIJ E;  4U7I A;  2XPK A;  4IDN A;  1OED E;  3ZSS A;  2CXD A;  4QHO A;  4HFC A;  4U33 A;  3CX6 B;  3EAB A;  2VQF T;  2KIN B;  2CEA A;  5CFB A;  2VL0 A;  3JAD A;  4OYJ A;  3NKZ A;  2ZM2 A;  5HEJ A;  4IL9 A;  4HWH A;  3ZST A;  1WR6 A;  2N1G A;  4QXC B;  2LT3 A;  5IUX A;  4MFR A;  2H89 A;  4YHJ A;  3OBV E;  2R6G F;  1D0Z A;  1X79 A;  3RX6 A;  2C5K T;  3ZKR A;  1FEW A;  4TUY E;  4UEL A;  1U5P A;  4I50 E;  1T7S A;  5BMV E;  3UFG A;  1R8I A;  5LBQ B;  2XTL A;  3LFM A;  1S94 A;  4OX9 T;  2YU1 A;  3SFE A;  4U72 A;  2PJQ A;  1OED C;  2ZMA A;  4U74 A;  2QVA A;  3ZLI A;  1IZN B;  4EEB A;  1XNQ T;  4A5X A;  1WLX A;  2VKD A;  1T8B A;  3C64 A;  2NW9 A;  2WBL A;  4YJ3 E;  2M67 A;  3D0T A;  3A8Y C;  5HWY A;  5LHI B;  3ETV A;  1HG5 A;  2X66 A;  2XQ9 A;  3TLU A;  1KNP A;  4WNK A;  2UXD T;  2YEV C;  2M6I A;  4P0A A;  1HCI A;  5F5W A;  4GK0 E;  4O8S A;  5AQN B;  3KDS E;  4UIG A;  4IE5 A;  1SUM B;  1N33 T;  3RRW A;  2FJA A;  2OV9 A;  1SHZ C;  3UU8 A;  2D0U A;  3AXJ B;  2Y6X A;  4QXH B;  3PE0 A;  5LCY A;  2DHR A;  2Z6E A;  2YKS A;  3FXD B;  1MNE A;  2JJ9 A;  4EB6 E;  4IE0 A;  5JR9 B;  2V7L A;  3L8R A;  3CK6 A;  5H6Q B;  4UEM A;  5FYM A;  1JNZ A;  1D0X A;  3N9M A;  4AXP A;  4EXT A;  2AE9 A;  3LDQ B;  3VKH A;  1YXR A;  2BBH A;  3RF1 A;  4DR1 T;  1HR0 T;  2BKO A;  2E9X A;  4TWF A;  2BZB A;  3UU4 A;  4ILU A;  2WDQ A;  5DQW A;  5HXS A;  2IML A;  3KV4 A;  3VR8 A;  4TX5 A;  2VUR A; 
#chains in the Genus database with same CATH homology
 3ZT5 A;  2CRB A;  4U2Y A;  4CN4 A;  4U7I A;  4ZEY A;  2W2U A;  5FVK A;  2JQK A;  2V6Y B;  5FVL A;  1YXR A;  3ZSS A;  4U7Y A;  3ZT6 A;  4CN1 A;  4U33 A;  4A5X A;  3K1S A;  5LB7 B;  3ZST A;  3EAB A;  1WFD A;  2WY2 A;  2JQH A;  4IT4 A;  4P1N A;  4WZX A;  2XZE A;  2WWV A;  1WCR A;  4CN6 A;  5CGM A;  2CPT A;  2LRK A;  3ZT7 A;  2MPK A;  4U31 A;  5CJ5 A;  2A9U A;  2K3W A;  4U2Z A;  4U3C A;  2RPA A;  2V6Y A;  2DL1 A;  2JQ9 A;  2V6X A;  4NIQ A;  1WR0 A;  2LRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...