2JQKA

Vps4b mit-chmp2b complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
b'NLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associating protein 4B
molecule tags Protein transport
source organism Homo sapiens
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
total genus 29
structure length 72
sequence length 72
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jqkA00
2DL1A 5FVLA 4CN4A 4CN1A 4NIQA 2V6YB 2LRKA 4IT4A 2JQHA 3ZT6A 2V6YA 2XZEA 4U7IA 3EABA 4U33A 2WWVA 5CGMA 2K3WA 2WY2A 4P1NA 4U7YA 4U3CA 2W2UA 4CN6A 4WZXA 1WCRA 3ZSTA 2RPAA 5CJ5A 3K1SA 3ZSSA 4U2YA 2JQKA 2CPTA 3ZT5A 4U2ZA 3ZT7A 4ZEYA 1YXRA 2JQ9A 2CRBA 2V6XA 5LB7B 2MPKA 5FVKA 1WR0A 4U31A 2A9UA 4A5XA 2LRLA 1WFDA
chains in the Genus database with same CATH superfamily
5JR9C 3N2OA 2XPKA 2Y48B 4IE0A 3LK42 4WNKA 1J5ET 4CXYA 3KVAA 3LBXA 4TV8E 5FXVA 3MXZA 1OEDA 3AECA 4OYJA 3AEGA 3IA3A 4IDOA 1T98A 3RIUA 2BZBA 1I94T 4KHPT 1SE7A 3EHZA 3BQIA 3N2GE 2N2NA 4JEUB 1N34T 1QUUA 2LSKA 3PUWF 4QH4A 3ZMUB 4QH1A 4HTEA 5ABGA 1UK5A 4TNWA 4O4JE 4DMWA 4X5TA 3P8CD 3N5LA 2J62A 4H63H 5E0OA 5CJ5A 5LGUB 4TWFA 3AEBA 2WMOA 2Q9QB 3S4UA 5DJQC 4YTPA 5L2LA 3AE8A 3H3MA 3KV4A 4ZOLE 3U3IA 5C3JA 4B3MT 3CQCB 3N9QA 1OEDB 3A7MA 3FZMB 4O2AE 2IC6A 4GOUA 3NWIA 5AQGB 3OKQA 4I43B 3UULA 3VR8A 2NR4A 5LGTB 2V7LA 2KNDA 2E9XC 2K24A 2AE9A 3MA9A 5LG3A 2WB5A 5HEGA 4CN4A 5FY7A 1VOMA 3UUMA 3C64A 3W15B 4CN1A 4IHJE 2BVLA 4JLEA 2CEAA 5LJNA 4ZZBA 3ZYKA 5JQGE 1MMDA 3PJAJ 4IL4A 5FYMA 1OXZA 3VHLA 1WYBA 4M1PA 3NZPA 2UUAT 2JRKA 1HFAA 2DHRA 1R8IA 1FEWA 2Q9QD 2FJAA 3GMIA 1MNDA 1LRZA 1OWAA 2QRXA 1HTJF 2V8SV 3I0OA 4HWHA 4L9IA 4TX5A 3VU7H 2X66A 2VKDA 3A8YC 4GYRA 4DUZT 2D0TA 3KFWX 2HHHT 3L09A 3RRCA 4HWDA 1E1HB 4O8SA 2X9XA 4OYKA 1HNWT 2CMRA 1YW0A 3CK6A 3M65A 4PFPA 2E9XB 3RF1A 3DTOA 3QC9A 3ZC1A 3CPZA 2MPKA 4DBQA 2XAHB 3IBPA 4U31A 2VQET 4DV2T 3F57A 3PDYA 1OEDC 5LHHB 2C5IT 2V7IA 3P4PA 5IUXA 2X67A 3UUNA 4AKRB 4C91A 2PTFA 4G63A 1HG2A 1WYCA 3IEEA 3P4SA 1NAFA 1IAPA 4H63V 4HWCA 2I6HA 3I9WA 4LMLA 3OJAA 4UR9A 2WU5A 2XASB 4Z90A 2X51A 3E08A 1US7B 5J1GA 3TLSA 1N33T 2WSSV 3UFEA 4BJMA 5J2UE 4EEBA 3FZLB 4JI5T 3VKHA 4UVAB 3RIFA 3RYFE 1HNXT 1M7KA 4QXHB 2XSAA 5LBQB 5CB4E 1X9BA 4PK5A 4F6RC 5LJMA 4JI6T 4QX8B 3UUXB 4HFIA 4PFOA 2LEHA 3AXJA 3SFDA 2HN1A 3K1SA 4HFBA 2CE7A 4WW0A 3ETVA 4DV4T 2CWYA 2XQAA 3O9XA 2VK9A 4DV1T 5FXWA 4UV8B 3EAMA 2IW5B 5FXXA 3RYCE 3UU6A 4DVDA 3RPUA 3UU8A 3WI3A 4EYUA 4IE7A 5HXSA 3B13A 2W00A 4UF0A 2QA7A 5AQTB 5HAXA 1AJ3A 2W4XA 3MKDA 2UUCT 4HN9A 4AXPA 2M6IA 3HR0A 2W61A 3C4ZA 4I0UA 2IHR1 4TNVA 2V7JA 2BS4A 3QB5A 5AQVB 4YT0A 2ZLYA 1ZEEA 1G73A 1ZV4X 3B57A 3CVRA 2ACZA 3KV6A 3RRWA 3UFGA 2WDRA 5JDNA 4LF6T 2B1EA 1W0BA 2LOPA 2BG9B 5HCJA 4ERRA 2BKOA 2FUPA 2WP9A 4ADZA 3AE2A 1HS7A 3PUQA 4HEAA 2YDSA 4IDNA 3AXJB 4X66T 1NWMX 4U7YA 2KT9A 2XQ8A 4DUYT 2LM9A 3K3QC 4TWHA 5FMNA 3CX6B 5AQNB 5LCYA 3GN5A 4WYVA 4U2YA 4DR2T 4UIGA 5FKYA 5BMVE 3ZYMA 2LLYA 1IBLT 4HE8A 2V1DB 3NBXX 4DIDB 2VASA 4P09A 5FY0A 4JI0T 1LVKA 4AKGA 3RQWA 4YXDA 2K5BB 2W67A 3JAEA 4DR5T 2B76A 4MALA 5LHIB 3ZMSB 2DI4A 5HEUA 1HX8A 3QOFA 3SOLA 5JR9B 2ODUA 4TV9E 5AQOB 5JDQA 4DV6T 2H7VC 3AB3B 3OYXA 4KX6A 4MFRA 2NW9A 4A56A 4EZ4A 2UXDT 4KMCA 2PFVA 5ABFA 5DABA 4BAYB 4YHJA 4GIWA 2YEVC 3LBXB 4DR1T 3GN5B 1WRDA 2X9WA 5EK4A 4AQYT 3DP7A 4CN6A 3QB5K 4WZXA 4HFVA 3K8PC 2XM2A 2K48A 3E22E 3TLVA 5DQVA 2V7MA 3H3AA 3P4RA 4YJ2E 3HI2A 5JDHA 2WDVA 2YDRA 2KWHA 3RH3A 4ILCA 4ZEYA 4JI1T 4LF5T 2BVMA 4OHFA 2BDEA 1HF8A 1KNPA 2K9AA 2XTLA 4NUUA 4TZ4C 5FVKA 1WLXA 2A9UA 3ESLA 3V5UA 2UXBT 4KI0F 5HEJA 1KFYA 4YLHA 4NXMT 3O4XE 2SPCA 1BR4A 1D1CA 3RC8A 4JI2T 4B3RT 3AA0B 1GQEA 2CWOA 2V7KA 2WBLA 3AAIA 4IDPA 1YD8G 4EV6A 2EHOB 4NPPA 3EDVA 2C5KT 4TN7B 4C90A 4X62T 1IJ6A 3J9X1 2ODVA 1YKHB 2LKGA 2WY2A 2ES0A 2WZIA 4AISA 5LXTE 3HKDE 2VL8A 4JBWF 2CHNA 3AE4A 1XMOT 3UQ7A 5LP6E 5FNVE 5LHGB 5AQKB 4MHCA 3PE0A 3T1YT 3RLFF 1BR0A 3FZHB 3CX8B 4H9SE 3PUSA 2EHOD 3ZPOA 2LRLA 3PU3A 1D0YA 4DR7T 2NTYA 2WWUA 4X65T 1XNRT 4JI3T 3AEDA 5ABHA 3RQUA 1E2AA 1XZYA 2BG9A 5IYZE 2KSRA 2EHOC 2P9BA 2GK9A 3BK9A 3CX7B 5JR9A 4DV0T 1XDOA 3SWHA 4AI6A 1S94A 4KP3C 1O3XA 2W66A 4JUYA 2XQYA 3LG7A 2W62A 2JMHA 4IE4A 2LOSA 2L9QA 4IDQA 4U74A 4ILUA 3LSVA 2YK0A 4A98A 1BR2A 3IHRA 4Z91A 3VRAA 2WDQA 3PUGA 5HEHA 4ZZCA 5JH7E 1NENA 2A3DA 5HXEA 1UGOA 3BQKA 5EK3A 4EGWA 3ONLC 3IF8B 4YHHT 2LHNA 5TAOA 3RI5A 3TLUA 3D0TA 3FBLA 2WZHA 3VKGA 3HKBE 4ZI7E 3PV0F 2LHRA 3Q2MA 3OYZA 2X9YA 5IWAT 1D1AA 2PBIA 2DWGA 2XAQB 3Q5EA 4QKNA 4YJ3E 5AQRB 4ILBA 4N78D 1X79A 3UU4A 3AEEA 3K3OA 2FJEA 1KNRA 3N2KE 4UVCB 2K3WA 4MLKA 4OX9T 4AKHA 4JEHB 1FIOA 4YTMA 3AE6A 3M3ZB 2KLQA 1XDPA 2BS2A 2XQ9A 4PJLA 4QXBB 4UXNB 2NOXA 3PJAA 3RYHE 3C51A 3FXDB 2NW7A 3VRBA 4CZZB 3LJCA 2YDQA 3P50A 3MJXA 2Z6EA 2NW8A 3PU8A 3QK6A 3CWZB 2V26A 4TWDA 3KV5A 5GONE 3RX6A 2H3RA 1J5WA 4NUVA 1XWMA 2QVAA 4O4HE 4ZS3A 4UVBB 5CA0E 5AQPB 2IMLA 3SS1A 2LT3A 4PJJA 5LMUT 4I50E 1Z8UA 5H6RB 2BG9C 1T72A 4IGUA 4NIQA 1SHZC 2IIUA 3ZEFB 1MIYA 2VWAA 2CXFA 4ANJA 3QNUA 4Q25A 4ASKA 4EEDA 1HCIA 3Q5WA 4X20E 5L3GB 1UX4A 1VRBA 3JC6C 3JADA 5KX5E 3GA8A 2LJLA 3AE9A 3I9YA 3NKZA 5HXRA 3KINB 2DLRA 3ZT6A 5A1LA 5CGMA 1IJ5A 4KBMB 5F3JA 1E7PA 3C98B 4LFAT 2NWBA 2ZM8A 4IREA 3F31A 2YN6A 2X0YA 4MBQA 2JIWA 3ZMVB 2BS3A 3ZT7A 1YXRA 4EXTA 4UELA 2CBIA 4ZI3D 2W63A 4EZHA 2UUBT 2XQ7A 3RIAA 3FXEB 3ZCIA 3J7Yq 2X9HA 3P4QA 5FVLA 2MOZA 2OLTA 3X1DA 3AAEB 3LK3B 3AE1A 4ISSA 1LVFA 5JDFA 2IDOB 4J2CA 4YY3T 4OK0A 3ZJ2A 2WWVA 2WCAA 3AAAB 2DCFA 1KK7A 2VVNA 2M6BA 5LOVE 2MYSA 3RGLA 3UU3A 4L0RA 3KDSE 3ANWB 4UV9B 1BR1A 4XBFB 4G2AA 2D9DA 3ANWA 2RPAA 3SRZA 5BR8T 4P0AA 4I4TE 1V9DA 1QSDA 2WM9A 1CHUA 4LF8T 5JDGA 1QLBA 1ZP0A 4K0KT 3K3NA 2DNXA 3HL6A 3KV9A 2VQFT 4LF4T 5JREA 4AKIA 5HEOA 4F8HA 4IT4A 1UX5A 5F8PA 1ZHCA 3F2EA 2DL1A 2VVSA 2YOEA 3AA1B 3FZFB 2VKHA 3LDQB 4A97A 2DWKA 4GKJT 3ZN1B 5L3BB 2UXXB 4QXCB 5FXZA 3ZKRA 4JYAT 3ETUA 5F5WA 3FZKB 3EVYA 2I0MA 3ZMTB 2WU2A 2XQ6A 1MMGA 2XAFB 1W09A 2UU9T 2YU2A 3EUHA 3EABA 1W0AA 4AKLA 5JRCB 5J2TE 1J1JA 3O1JA 5L3FB 2X0LB 4JI8T 4DV5T 1JNZA 3N9NA 4E7SA 1T8BA 3H37A 4EIWA 3ZSSA 2CM0A 2MTQA 4DR6T 3PUXF 2JPFA 3Q9DA 2CPTA 3UTKA 3ZT5A 3FBZA 3UT5E 1N36T 4PJNA 2C5JA 3C4XA 2CRBA 2Q9QC 2VB6A 3OPCA 4AQFA 3JAFA 5LGNB 2XAJB 4JV5T 4HFEA 4AIUA 2HH7A 4QWNB 4BJNA 3UQ4A 1FJGT 2IUBA 5KMGP 4QH5A 2D2SA 2V6YB 2X68A 5HWYA 2QYWA 1KF6A 1D0ZA 2BKPA 2LE8A 3FB2A 2V5CA 3WAKA 2PJQA 5JVDE 3V5SA 5KXJA 2YINA 2F4VT 2WQYA 2L8KA 2KWIB 3AE3A 3B5MA 3ONJA 3U78A 2WS3A 4EAHA 5ABEA 2CLYC 4CXWA 5FP3A 4EYYR 5HYAA 4LF9T 3ZN0B 1XMQT 1H7CA 2NTXA 2LSYA 4HFCA 4OFZA 2J47A 1B7TA 2XM1A 3T8OA 4CXXA 2XAGB 4IDZA 3O1IA 3RHWA 1HR0T 4UF0B 1XNQT 2WAUA 1YQ4A 4ISTA 2CA5A 1Y01A 4H9RC 5HCMA 3RIUC 3TLWA 1MIWA 1Z0PA 3BQLA 4YSZA 2XQ4A 2E2AA 2H89A 2JQKA 2EHOA 3AA6B 2KINB 4FJOA 5LG4A 3GWHA 1I6ZA 3NVOA 2XSBA 3TLTA 2Y8DA 2XHEB 4K0UA 2C0SA 5AQHB 3HKCE 4X1YE 4A5XA 1WFDA 2HPLA 5L3EB 3ZJ1A 1YKEB 2D0UA 2E5VA 1IBMT 4DNDA 5L47A 3RKGA 5CA1E 2LSJA 1T7SA 2VURA 3RYIE 4GKKT 2LRKA 3C50A 5L3DB 1CUNA 3G06A 4QX7B 4CI3B 5ADXL 1G8XA 4H9OC 5KDMC 4YTNA 4U7IA 1NEKA 2IAKA 3EDUA 4X1IE 4LFCT 5AQQB 3SFEA 2W0GA 2W2UA 4U3CA 3HA4A 2XUEA 3NRXA 4GK5E 3ZSTA 3T1HT 5HXHA 5LA6E 2VKOA 3AVSA 3C4WA 3AA7B 3CIRA 3ZYLA 3KBUA 3OBVE 3I1AA 4HWFA 5CFBA 4AQFC 4DBRA 4EOZB 4XZCA 5IHYA 3JC6D 5LB7B 5L3CB 1N32T 2BBHA 3CQGB 2ZM0A 2JQQA 2N1GA 3MACA 3TKLB 4DR3T 4JI7T 1Y64B 4I55E 2HPJA 4QHOA 5AQFB 1M62A 3CKDA 3MZKB 4PW8A 3LK2B 3AVRA 2YKSA 2L3LA 1LKXA 2HN2A 2VL0A 4LF7T 4IIJE 4IL9A 3ZLIA 2KZ7B 4DO0A 3PUZF 1W9RA 4WBNE 4YFSA 3OTOT 5HWXA 2JQHA 4Z8XA 1MIVA 4L5GA 3ABVA 2V6YA 5LNKA 4YSXA 1HNZT 2MAWA 2R6GF 4O4IE 3CQXC 1YQ3A 2H88A 4PNIA 3N9PA 1ZOYA 2JJ9A 3AEFA 4HKAA 4PJMA 5EZYE 5C8YE 3FHNA 1OEDE 1WCRA 2CLYB 2CHOA 2BG9E 4XAXB 4WBOA 1EZ3A 5M4YA 3R6NA 2AXDS 3P4WA 4AQGA 1IBKT 4LFBT 4O2BE 3E0ZA 4U2ZA 3ZC0A 1D0XA 2H7OA 2IC9A 1IZNB 5EK2A 3PTRB 5JDMA 2Y6XA 3I0QA 1FMVA 3L8RA 2LSGA 3PUAA 4KHZF 1HG5A 3VR9A 4ZS2A 4E7ZA 3MK7C 4GK0E 2E9XA 4U72A 4ZHQE 2XJ7A 1MMAA 4ILAA 1D1BA 5DQWA 5JRCA 2A2FX 2V5DA 2M67A 4JI4T 5ETWA 2G0UA 4O4LE 2FBWA 4COFA 3PURA 2FJDA 4DV3T 2VKJA 1ZKEA 4TUYE 2I59A 2J1DG 2XY8B 3CMLA 4CI2B 2XZEA 5AQUB 4EB6E 5L4EA 1KNZA 3O1HA 5JTGA 3L3PA 4KUMB 4P1NA 4PK4A 4BA9A 5FL0A 3LFMA 3OVUA 2J4GA 5J0ZA 4IE6A 2E5LT 4H9QC 3EI0A 4FI5A 3ONXA 2ZM6T 3N9MA 4H9PC 3UU5A 3DJBA 2WMNA 1KEYA 4UEMA 4HGAA 4X1KE 3ZCJA 2PG8A 3N9LA 2E8IA 5C2TA 2V6XA 3KBTA 4B3ST 3HKEE 5AQIB 1S35A 3RC3A 1SUMB 5HXCA 4HFHA 3AE7A 2MBGA 4DR4T 1WR0A 2D5UA 2RP4A 3PUYF 3UUBA 2XQ3A 4P0BA 4V1Av 2BBJA 1U5PA 2A72A 2QGSA 5AQMB 3ZMZB 5FL1A 3P7IA 4ZI2C 5JDLA 1VCSA 2JMKA 4X64T 4DV7T 4B3TT 3AE5A 2OV9A 2Q9QA 1UURA 2NP9A 3R84B 2BKNA 4CQIA 3NRYA 1FMWA 3PUVF 1MNEA 4ZI3C 3RKOA 5ABFB 2OA5A 3A5XA 5AFUL 5FY1A 1VCTA 4HWIB 2RA1A 4U33A 3NZQA 2N9DA 5L4HA 4B6XA 2X0HA 1L0VA 1HX1B 4DMVA 2KXPB 5LYJE 1MMNA 3QUJA 5AQJB 2ACXA 4GYSA 4LMJA 5AQLB 2CXLA 2E9XD 2CBJA 4HFDA 2ZMAA 1SA0E 1UCUA 4PK6A 4LMKA 1WR6A 2YU1A 3L39A 5LBMA 1DU2A 2LSIA 4IE5A 2UXNB 5AQSB 3KVBA 4ZI2D 4NXNT 2KMFA 2LKHA 4ZXLA 4YSYA 3JCFA 2ZM2A 2CCQA 4PAGA 3N9OA 1JNRA 2CXDA 2JQ9A 2LM2A 3Q5DA 3WAJA 2UXCT 4CI1B 3AEAA 4H9NC 1U4QA 1UUSA 2FJBA 2XQ5A 3Q5XA 5H6QB 5LMNT
chains in the Genus database with same CATH topology
2DL1A 5FVLA 4CN4A 4CN1A 4NIQA 2V6YB 2LRKA 4IT4A 2JQHA 3ZT6A 2V6YA 2XZEA 4U7IA 3EABA 4U33A 2WWVA 5CGMA 2K3WA 2WY2A 4P1NA 4U7YA 4U3CA 2W2UA 4CN6A 4WZXA 1WCRA 3ZSTA 2RPAA 5CJ5A 3K1SA 3ZSSA 4U2YA 2JQKA 2CPTA 3ZT5A 4U2ZA 3ZT7A 4ZEYA 1YXRA 2JQ9A 2CRBA 2V6XA 5LB7B 2MPKA 5FVKA 1WR0A 4U31A 2A9UA 4A5XA 2LRLA 1WFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL1 A;  5FVL A;  4CN4 A;  4CN1 A;  4NIQ A;  2V6Y B;  2LRK A;  4IT4 A;  2JQH A;  3ZT6 A;  2V6Y A;  2XZE A;  4U7I A;  3EAB A;  4U33 A;  2WWV A;  5CGM A;  2K3W A;  2WY2 A;  4P1N A;  4U7Y A;  4U3C A;  2W2U A;  4CN6 A;  4WZX A;  1WCR A;  3ZST A;  2RPA A;  5CJ5 A;  3K1S A;  3ZSS A;  4U2Y A;  2JQK A;  2CPT A;  3ZT5 A;  4U2Z A;  3ZT7 A;  4ZEY A;  1YXR A;  2JQ9 A;  2CRB A;  2V6X A;  5LB7 B;  2MPK A;  5FVK A;  1WR0 A;  4U31 A;  2A9U A;  4A5X A;  2LRL A;  1WFD A; 
#chains in the Genus database with same CATH topology
 5JR9 C;  3N2O A;  2XPK A;  2Y48 B;  4IE0 A;  3LK4 2;  4WNK A;  1J5E T;  4CXY A;  3KVA A;  3LBX A;  4TV8 E;  5FXV A;  3MXZ A;  1OED A;  3AEC A;  4OYJ A;  3AEG A;  3IA3 A;  4IDO A;  1T98 A;  3RIU A;  2BZB A;  1I94 T;  4KHP T;  1SE7 A;  3EHZ A;  3BQI A;  3N2G E;  2N2N A;  4JEU B;  1N34 T;  1QUU A;  2LSK A;  3PUW F;  4QH4 A;  3ZMU B;  4QH1 A;  4HTE A;  5ABG A;  1UK5 A;  4TNW A;  4O4J E;  4DMW A;  4X5T A;  3P8C D;  3N5L A;  2J62 A;  4H63 H;  5E0O A;  5CJ5 A;  5LGU B;  4TWF A;  3AEB A;  2WMO A;  2Q9Q B;  3S4U A;  5DJQ C;  4YTP A;  5L2L A;  3AE8 A;  3H3M A;  3KV4 A;  4ZOL E;  3U3I A;  5C3J A;  4B3M T;  3CQC B;  3N9Q A;  1OED B;  3A7M A;  3FZM B;  4O2A E;  2IC6 A;  4GOU A;  3NWI A;  5AQG B;  3OKQ A;  4I43 B;  3UUL A;  3VR8 A;  2NR4 A;  5LGT B;  2V7L A;  2KND A;  2E9X C;  2K24 A;  2AE9 A;  3MA9 A;  5LG3 A;  2WB5 A;  5HEG A;  4CN4 A;  5FY7 A;  1VOM A;  3UUM A;  3C64 A;  3W15 B;  4CN1 A;  4IHJ E;  2BVL A;  4JLE A;  2CEA A;  5LJN A;  4ZZB A;  3ZYK A;  5JQG E;  1MMD A;  3PJA J;  4IL4 A;  5FYM A;  1OXZ A;  3VHL A;  1WYB A;  4M1P A;  3NZP A;  2UUA T;  2JRK A;  1HFA A;  2DHR A;  1R8I A;  1FEW A;  2Q9Q D;  2FJA A;  3GMI A;  1MND A;  1LRZ A;  1OWA A;  2QRX A;  1HTJ F;  2V8S V;  3I0O A;  4HWH A;  4L9I A;  4TX5 A;  3VU7 H;  2X66 A;  2VKD A;  3A8Y C;  4GYR A;  4DUZ T;  2D0T A;  3KFW X;  2HHH T;  3L09 A;  3RRC A;  4HWD A;  1E1H B;  4O8S A;  2X9X A;  4OYK A;  1HNW T;  2CMR A;  1YW0 A;  3CK6 A;  3M65 A;  4PFP A;  2E9X B;  3RF1 A;  3DTO A;  3QC9 A;  3ZC1 A;  3CPZ A;  2MPK A;  4DBQ A;  2XAH B;  3IBP A;  4U31 A;  2VQE T;  4DV2 T;  3F57 A;  3PDY A;  1OED C;  5LHH B;  2C5I T;  2V7I A;  3P4P A;  5IUX A;  2X67 A;  3UUN A;  4AKR B;  4C91 A;  2PTF A;  4G63 A;  1HG2 A;  1WYC A;  3IEE A;  3P4S A;  1NAF A;  1IAP A;  4H63 V;  4HWC A;  2I6H A;  3I9W A;  4LML A;  3OJA A;  4UR9 A;  2WU5 A;  2XAS B;  4Z90 A;  2X51 A;  3E08 A;  1US7 B;  5J1G A;  3TLS A;  1N33 T;  2WSS V;  3UFE A;  4BJM A;  5J2U E;  4EEB A;  3FZL B;  4JI5 T;  3VKH A;  4UVA B;  3RIF A;  3RYF E;  1HNX T;  1M7K A;  4QXH B;  2XSA A;  5LBQ B;  5CB4 E;  1X9B A;  4PK5 A;  4F6R C;  5LJM A;  4JI6 T;  4QX8 B;  3UUX B;  4HFI A;  4PFO A;  2LEH A;  3AXJ A;  3SFD A;  2HN1 A;  3K1S A;  4HFB A;  2CE7 A;  4WW0 A;  3ETV A;  4DV4 T;  2CWY A;  2XQA A;  3O9X A;  2VK9 A;  4DV1 T;  5FXW A;  4UV8 B;  3EAM A;  2IW5 B;  5FXX A;  3RYC E;  3UU6 A;  4DVD A;  3RPU A;  3UU8 A;  3WI3 A;  4EYU A;  4IE7 A;  5HXS A;  3B13 A;  2W00 A;  4UF0 A;  2QA7 A;  5AQT B;  5HAX A;  1AJ3 A;  2W4X A;  3MKD A;  2UUC T;  4HN9 A;  4AXP A;  2M6I A;  3HR0 A;  2W61 A;  3C4Z A;  4I0U A;  2IHR 1;  4TNV A;  2V7J A;  2BS4 A;  3QB5 A;  5AQV B;  4YT0 A;  2ZLY A;  1ZEE A;  1G73 A;  1ZV4 X;  3B57 A;  3CVR A;  2ACZ A;  3KV6 A;  3RRW A;  3UFG A;  2WDR A;  5JDN A;  4LF6 T;  2B1E A;  1W0B A;  2LOP A;  2BG9 B;  5HCJ A;  4ERR A;  2BKO A;  2FUP A;  2WP9 A;  4ADZ A;  3AE2 A;  1HS7 A;  3PUQ A;  4HEA A;  2YDS A;  4IDN A;  3AXJ B;  4X66 T;  1NWM X;  4U7Y A;  2KT9 A;  2XQ8 A;  4DUY T;  2LM9 A;  3K3Q C;  4TWH A;  5FMN A;  3CX6 B;  5AQN B;  5LCY A;  3GN5 A;  4WYV A;  4U2Y A;  4DR2 T;  4UIG A;  5FKY A;  5BMV E;  3ZYM A;  2LLY A;  1IBL T;  4HE8 A;  2V1D B;  3NBX X;  4DID B;  2VAS A;  4P09 A;  5FY0 A;  4JI0 T;  1LVK A;  4AKG A;  3RQW A;  4YXD A;  2K5B B;  2W67 A;  3JAE A;  4DR5 T;  2B76 A;  4MAL A;  5LHI B;  3ZMS B;  2DI4 A;  5HEU A;  1HX8 A;  3QOF A;  3SOL A;  5JR9 B;  2ODU A;  4TV9 E;  5AQO B;  5JDQ A;  4DV6 T;  2H7V C;  3AB3 B;  3OYX A;  4KX6 A;  4MFR A;  2NW9 A;  4A56 A;  4EZ4 A;  2UXD T;  4KMC A;  2PFV A;  5ABF A;  5DAB A;  4BAY B;  4YHJ A;  4GIW A;  2YEV C;  3LBX B;  4DR1 T;  3GN5 B;  1WRD A;  2X9W A;  5EK4 A;  4AQY T;  3DP7 A;  4CN6 A;  3QB5 K;  4WZX A;  4HFV A;  3K8P C;  2XM2 A;  2K48 A;  3E22 E;  3TLV A;  5DQV A;  2V7M A;  3H3A A;  3P4R A;  4YJ2 E;  3HI2 A;  5JDH A;  2WDV A;  2YDR A;  2KWH A;  3RH3 A;  4ILC A;  4ZEY A;  4JI1 T;  4LF5 T;  2BVM A;  4OHF A;  2BDE A;  1HF8 A;  1KNP A;  2K9A A;  2XTL A;  4NUU A;  4TZ4 C;  5FVK A;  1WLX A;  2A9U A;  3ESL A;  3V5U A;  2UXB T;  4KI0 F;  5HEJ A;  1KFY A;  4YLH A;  4NXM T;  3O4X E;  2SPC A;  1BR4 A;  1D1C A;  3RC8 A;  4JI2 T;  4B3R T;  3AA0 B;  1GQE A;  2CWO A;  2V7K A;  2WBL A;  3AAI A;  4IDP A;  1YD8 G;  4EV6 A;  2EHO B;  4NPP A;  3EDV A;  2C5K T;  4TN7 B;  4C90 A;  4X62 T;  1IJ6 A;  3J9X 1;  2ODV A;  1YKH B;  2LKG A;  2WY2 A;  2ES0 A;  2WZI A;  4AIS A;  5LXT E;  3HKD E;  2VL8 A;  4JBW F;  2CHN A;  3AE4 A;  1XMO T;  3UQ7 A;  5LP6 E;  5FNV E;  5LHG B;  5AQK B;  4MHC A;  3PE0 A;  3T1Y T;  3RLF F;  1BR0 A;  3FZH B;  3CX8 B;  4H9S E;  3PUS A;  2EHO D;  3ZPO A;  2LRL A;  3PU3 A;  1D0Y A;  4DR7 T;  2NTY A;  2WWU A;  4X65 T;  1XNR T;  4JI3 T;  3AED A;  5ABH A;  3RQU A;  1E2A A;  1XZY A;  2BG9 A;  5IYZ E;  2KSR A;  2EHO C;  2P9B A;  2GK9 A;  3BK9 A;  3CX7 B;  5JR9 A;  4DV0 T;  1XDO A;  3SWH A;  4AI6 A;  1S94 A;  4KP3 C;  1O3X A;  2W66 A;  4JUY A;  2XQY A;  3LG7 A;  2W62 A;  2JMH A;  4IE4 A;  2LOS A;  2L9Q A;  4IDQ A;  4U74 A;  4ILU A;  3LSV A;  2YK0 A;  4A98 A;  1BR2 A;  3IHR A;  4Z91 A;  3VRA A;  2WDQ A;  3PUG A;  5HEH A;  4ZZC A;  5JH7 E;  1NEN A;  2A3D A;  5HXE A;  1UGO A;  3BQK A;  5EK3 A;  4EGW A;  3ONL C;  3IF8 B;  4YHH T;  2LHN A;  5TAO A;  3RI5 A;  3TLU A;  3D0T A;  3FBL A;  2WZH A;  3VKG A;  3HKB E;  4ZI7 E;  3PV0 F;  2LHR A;  3Q2M A;  3OYZ A;  2X9Y A;  5IWA T;  1D1A A;  2PBI A;  2DWG A;  2XAQ B;  3Q5E A;  4QKN A;  4YJ3 E;  5AQR B;  4ILB A;  4N78 D;  1X79 A;  3UU4 A;  3AEE A;  3K3O A;  2FJE A;  1KNR A;  3N2K E;  4UVC B;  2K3W A;  4MLK A;  4OX9 T;  4AKH A;  4JEH B;  1FIO A;  4YTM A;  3AE6 A;  3M3Z B;  2KLQ A;  1XDP A;  2BS2 A;  2XQ9 A;  4PJL A;  4QXB B;  4UXN B;  2NOX A;  3PJA A;  3RYH E;  3C51 A;  3FXD B;  2NW7 A;  3VRB A;  4CZZ B;  3LJC A;  2YDQ A;  3P50 A;  3MJX A;  2Z6E A;  2NW8 A;  3PU8 A;  3QK6 A;  3CWZ B;  2V26 A;  4TWD A;  3KV5 A;  5GON E;  3RX6 A;  2H3R A;  1J5W A;  4NUV A;  1XWM A;  2QVA A;  4O4H E;  4ZS3 A;  4UVB B;  5CA0 E;  5AQP B;  2IML A;  3SS1 A;  2LT3 A;  4PJJ A;  5LMU T;  4I50 E;  1Z8U A;  5H6R B;  2BG9 C;  1T72 A;  4IGU A;  4NIQ A;  1SHZ C;  2IIU A;  3ZEF B;  1MIY A;  2VWA A;  2CXF A;  4ANJ A;  3QNU A;  4Q25 A;  4ASK A;  4EED A;  1HCI A;  3Q5W A;  4X20 E;  5L3G B;  1UX4 A;  1VRB A;  3JC6 C;  3JAD A;  5KX5 E;  3GA8 A;  2LJL A;  3AE9 A;  3I9Y A;  3NKZ A;  5HXR A;  3KIN B;  2DLR A;  3ZT6 A;  5A1L A;  5CGM A;  1IJ5 A;  4KBM B;  5F3J A;  1E7P A;  3C98 B;  4LFA T;  2NWB A;  2ZM8 A;  4IRE A;  3F31 A;  2YN6 A;  2X0Y A;  4MBQ A;  2JIW A;  3ZMV B;  2BS3 A;  3ZT7 A;  1YXR A;  4EXT A;  4UEL A;  2CBI A;  4ZI3 D;  2W63 A;  4EZH A;  2UUB T;  2XQ7 A;  3RIA A;  3FXE B;  3ZCI A;  3J7Y q;  2X9H A;  3P4Q A;  5FVL A;  2MOZ A;  2OLT A;  3X1D A;  3AAE B;  3LK3 B;  3AE1 A;  4ISS A;  1LVF A;  5JDF A;  2IDO B;  4J2C A;  4YY3 T;  4OK0 A;  3ZJ2 A;  2WWV A;  2WCA A;  3AAA B;  2DCF A;  1KK7 A;  2VVN A;  2M6B A;  5LOV E;  2MYS A;  3RGL A;  3UU3 A;  4L0R A;  3KDS E;  3ANW B;  4UV9 B;  1BR1 A;  4XBF B;  4G2A A;  2D9D A;  3ANW A;  2RPA A;  3SRZ A;  5BR8 T;  4P0A A;  4I4T E;  1V9D A;  1QSD A;  2WM9 A;  1CHU A;  4LF8 T;  5JDG A;  1QLB A;  1ZP0 A;  4K0K T;  3K3N A;  2DNX A;  3HL6 A;  3KV9 A;  2VQF T;  4LF4 T;  5JRE A;  4AKI A;  5HEO A;  4F8H A;  4IT4 A;  1UX5 A;  5F8P A;  1ZHC A;  3F2E A;  2DL1 A;  2VVS A;  2YOE A;  3AA1 B;  3FZF B;  2VKH A;  3LDQ B;  4A97 A;  2DWK A;  4GKJ T;  3ZN1 B;  5L3B B;  2UXX B;  4QXC B;  5FXZ A;  3ZKR A;  4JYA T;  3ETU A;  5F5W A;  3FZK B;  3EVY A;  2I0M A;  3ZMT B;  2WU2 A;  2XQ6 A;  1MMG A;  2XAF B;  1W09 A;  2UU9 T;  2YU2 A;  3EUH A;  3EAB A;  1W0A A;  4AKL A;  5JRC B;  5J2T E;  1J1J A;  3O1J A;  5L3F B;  2X0L B;  4JI8 T;  4DV5 T;  1JNZ A;  3N9N A;  4E7S A;  1T8B A;  3H37 A;  4EIW A;  3ZSS A;  2CM0 A;  2MTQ A;  4DR6 T;  3PUX F;  2JPF A;  3Q9D A;  2CPT A;  3UTK A;  3ZT5 A;  3FBZ A;  3UT5 E;  1N36 T;  4PJN A;  2C5J A;  3C4X A;  2CRB A;  2Q9Q C;  2VB6 A;  3OPC A;  4AQF A;  3JAF A;  5LGN B;  2XAJ B;  4JV5 T;  4HFE A;  4AIU A;  2HH7 A;  4QWN B;  4BJN A;  3UQ4 A;  1FJG T;  2IUB A;  5KMG P;  4QH5 A;  2D2S A;  2V6Y B;  2X68 A;  5HWY A;  2QYW A;  1KF6 A;  1D0Z A;  2BKP A;  2LE8 A;  3FB2 A;  2V5C A;  3WAK A;  2PJQ A;  5JVD E;  3V5S A;  5KXJ A;  2YIN A;  2F4V T;  2WQY A;  2L8K A;  2KWI B;  3AE3 A;  3B5M A;  3ONJ A;  3U78 A;  2WS3 A;  4EAH A;  5ABE A;  2CLY C;  4CXW A;  5FP3 A;  4EYY R;  5HYA A;  4LF9 T;  3ZN0 B;  1XMQ T;  1H7C A;  2NTX A;  2LSY A;  4HFC A;  4OFZ A;  2J47 A;  1B7T A;  2XM1 A;  3T8O A;  4CXX A;  2XAG B;  4IDZ A;  3O1I A;  3RHW A;  1HR0 T;  4UF0 B;  1XNQ T;  2WAU A;  1YQ4 A;  4IST A;  2CA5 A;  1Y01 A;  4H9R C;  5HCM A;  3RIU C;  3TLW A;  1MIW A;  1Z0P A;  3BQL A;  4YSZ A;  2XQ4 A;  2E2A A;  2H89 A;  2JQK A;  2EHO A;  3AA6 B;  2KIN B;  4FJO A;  5LG4 A;  3GWH A;  1I6Z A;  3NVO A;  2XSB A;  3TLT A;  2Y8D A;  2XHE B;  4K0U A;  2C0S A;  5AQH B;  3HKC E;  4X1Y E;  4A5X A;  1WFD A;  2HPL A;  5L3E B;  3ZJ1 A;  1YKE B;  2D0U A;  2E5V A;  1IBM T;  4DND A;  5L47 A;  3RKG A;  5CA1 E;  2LSJ A;  1T7S A;  2VUR A;  3RYI E;  4GKK T;  2LRK A;  3C50 A;  5L3D B;  1CUN A;  3G06 A;  4QX7 B;  4CI3 B;  5ADX L;  1G8X A;  4H9O C;  5KDM C;  4YTN A;  4U7I A;  1NEK A;  2IAK A;  3EDU A;  4X1I E;  4LFC T;  5AQQ B;  3SFE A;  2W0G A;  2W2U A;  4U3C A;  3HA4 A;  2XUE A;  3NRX A;  4GK5 E;  3ZST A;  3T1H T;  5HXH A;  5LA6 E;  2VKO A;  3AVS A;  3C4W A;  3AA7 B;  3CIR A;  3ZYL A;  3KBU A;  3OBV E;  3I1A A;  4HWF A;  5CFB A;  4AQF C;  4DBR A;  4EOZ B;  4XZC A;  5IHY A;  3JC6 D;  5LB7 B;  5L3C B;  1N32 T;  2BBH A;  3CQG B;  2ZM0 A;  2JQQ A;  2N1G A;  3MAC A;  3TKL B;  4DR3 T;  4JI7 T;  1Y64 B;  4I55 E;  2HPJ A;  4QHO A;  5AQF B;  1M62 A;  3CKD A;  3MZK B;  4PW8 A;  3LK2 B;  3AVR A;  2YKS A;  2L3L A;  1LKX A;  2HN2 A;  2VL0 A;  4LF7 T;  4IIJ E;  4IL9 A;  3ZLI A;  2KZ7 B;  4DO0 A;  3PUZ F;  1W9R A;  4WBN E;  4YFS A;  3OTO T;  5HWX A;  2JQH A;  4Z8X A;  1MIV A;  4L5G A;  3ABV A;  2V6Y A;  5LNK A;  4YSX A;  1HNZ T;  2MAW A;  2R6G F;  4O4I E;  3CQX C;  1YQ3 A;  2H88 A;  4PNI A;  3N9P A;  1ZOY A;  2JJ9 A;  3AEF A;  4HKA A;  4PJM A;  5EZY E;  5C8Y E;  3FHN A;  1OED E;  1WCR A;  2CLY B;  2CHO A;  2BG9 E;  4XAX B;  4WBO A;  1EZ3 A;  5M4Y A;  3R6N A;  2AXD S;  3P4W A;  4AQG A;  1IBK T;  4LFB T;  4O2B E;  3E0Z A;  4U2Z A;  3ZC0 A;  1D0X A;  2H7O A;  2IC9 A;  1IZN B;  5EK2 A;  3PTR B;  5JDM A;  2Y6X A;  3I0Q A;  1FMV A;  3L8R A;  2LSG A;  3PUA A;  4KHZ F;  1HG5 A;  3VR9 A;  4ZS2 A;  4E7Z A;  3MK7 C;  4GK0 E;  2E9X A;  4U72 A;  4ZHQ E;  2XJ7 A;  1MMA A;  4ILA A;  1D1B A;  5DQW A;  5JRC A;  2A2F X;  2V5D A;  2M67 A;  4JI4 T;  5ETW A;  2G0U A;  4O4L E;  2FBW A;  4COF A;  3PUR A;  2FJD A;  4DV3 T;  2VKJ A;  1ZKE A;  4TUY E;  2I59 A;  2J1D G;  2XY8 B;  3CML A;  4CI2 B;  2XZE A;  5AQU B;  4EB6 E;  5L4E A;  1KNZ A;  3O1H A;  5JTG A;  3L3P A;  4KUM B;  4P1N A;  4PK4 A;  4BA9 A;  5FL0 A;  3LFM A;  3OVU A;  2J4G A;  5J0Z A;  4IE6 A;  2E5L T;  4H9Q C;  3EI0 A;  4FI5 A;  3ONX A;  2ZM6 T;  3N9M A;  4H9P C;  3UU5 A;  3DJB A;  2WMN A;  1KEY A;  4UEM A;  4HGA A;  4X1K E;  3ZCJ A;  2PG8 A;  3N9L A;  2E8I A;  5C2T A;  2V6X A;  3KBT A;  4B3S T;  3HKE E;  5AQI B;  1S35 A;  3RC3 A;  1SUM B;  5HXC A;  4HFH A;  3AE7 A;  2MBG A;  4DR4 T;  1WR0 A;  2D5U A;  2RP4 A;  3PUY F;  3UUB A;  2XQ3 A;  4P0B A;  4V1A v;  2BBJ A;  1U5P A;  2A72 A;  2QGS A;  5AQM B;  3ZMZ B;  5FL1 A;  3P7I A;  4ZI2 C;  5JDL A;  1VCS A;  2JMK A;  4X64 T;  4DV7 T;  4B3T T;  3AE5 A;  2OV9 A;  2Q9Q A;  1UUR A;  2NP9 A;  3R84 B;  2BKN A;  4CQI A;  3NRY A;  1FMW A;  3PUV F;  1MNE A;  4ZI3 C;  3RKO A;  5ABF B;  2OA5 A;  3A5X A;  5AFU L;  5FY1 A;  1VCT A;  4HWI B;  2RA1 A;  4U33 A;  3NZQ A;  2N9D A;  5L4H A;  4B6X A;  2X0H A;  1L0V A;  1HX1 B;  4DMV A;  2KXP B;  5LYJ E;  1MMN A;  3QUJ A;  5AQJ B;  2ACX A;  4GYS A;  4LMJ A;  5AQL B;  2CXL A;  2E9X D;  2CBJ A;  4HFD A;  2ZMA A;  1SA0 E;  1UCU A;  4PK6 A;  4LMK A;  1WR6 A;  2YU1 A;  3L39 A;  5LBM A;  1DU2 A;  2LSI A;  4IE5 A;  2UXN B;  5AQS B;  3KVB A;  4ZI2 D;  4NXN T;  2KMF A;  2LKH A;  4ZXL A;  4YSY A;  3JCF A;  2ZM2 A;  2CCQ A;  4PAG A;  3N9O A;  1JNR A;  2CXD A;  2JQ9 A;  2LM2 A;  3Q5D A;  3WAJ A;  2UXC T;  4CI1 B;  3AEA A;  4H9N C;  1U4Q A;  1UUS A;  2FJB A;  2XQ5 A;  3Q5X A;  5H6Q B;  5LMN T; 
#chains in the Genus database with same CATH homology
 2DL1 A;  5FVL A;  4CN4 A;  4CN1 A;  4NIQ A;  2V6Y B;  2LRK A;  4IT4 A;  2JQH A;  3ZT6 A;  2V6Y A;  2XZE A;  4U7I A;  3EAB A;  4U33 A;  2WWV A;  5CGM A;  2K3W A;  2WY2 A;  4P1N A;  4U7Y A;  4U3C A;  2W2U A;  4CN6 A;  4WZX A;  1WCR A;  3ZST A;  2RPA A;  5CJ5 A;  3K1S A;  3ZSS A;  4U2Y A;  2JQK A;  2CPT A;  3ZT5 A;  4U2Z A;  3ZT7 A;  4ZEY A;  1YXR A;  2JQ9 A;  2CRB A;  2V6X A;  5LB7 B;  2MPK A;  5FVK A;  1WR0 A;  4U31 A;  2A9U A;  4A5X A;  2LRL A;  1WFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...