2JQKA

Vps4b mit-chmp2b complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
NLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associating protein 4B
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 72
sequence length 72
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jqkA00
5FVKA 2LRLA 4A5XA 4WZXA 3EABA 4U3CA 2V6XA 3ZT7A 4IT4A 4CN4A 3ZSSA 2V6YA 4P1NA 5CJ5A 2WWVA 1WFDA 2CPTA 2CRBA 4U2ZA 4ZEYA 2XZEA 5CGMA 5FVLA 2JQKA 1WR0A 4U2YA 4CN1A 3K1SA 2W2UA 1YXRA 2MPKA 2RPAA 4U7IA 4NIQA 1WCRA 4U7YA 2V6YB 5LB7B 2LRKA 2WY2A 3ZT6A 2A9UA 4U31A 4CN6A 3ZT5A 4U33A 2DL1A 2K3WA 3ZSTA 2JQ9A 2JQHA
chains in the Genus database with same CATH superfamily
2E9XA 2DLRA 5EK3A 3CVRA 3L39A 4I0UA 2LSIA 2D9DA 2L3LA 3ZMTB 3U3IA 4DIDB 4DV1T 2XM2A 3CQGB 4ILCA 2OA5A 4CXYA 5TAOA 4HWCA 4N78D 3AE1A 1SHZC 4JI8T 3IF8B 4EOZB 1I6ZA 4ZHQE 5FY1A 4DBQA 2LOSA 5LGTB 3N2GE 2NW9A 3QB5A 3IA3A 1ZHCA 3G06A 4DUZT 3K3QC 2QYWA 3QNUA 3AVRA 4HGAA 3NBXX 4ZS2A 3A8YC 4GK5E 4LMLA 4U74A 5L3BB 4HWFA 5HEGA 1J5ET 5EK4A 4AKRB 1FJGT 4JI6T 4TWDA 4KMCA 3ZJ1A 3EI0A 3OBVE 2FJEA 3N9QA 5LOVE 2WWUA 3OTOT 1QSDA 4DR3T 1HG5A 3AVSA 1IBKT 3K3NA 3RC3A 4XZCA 4JI2T 2WU5A 1Z8UA 5FXXA 1UK5A 2NTXA 3Q5EA 4LF6T 1G8XA 3M3ZB 1MNEA 2F4VT 2N1GA 1BR1A 2YKSA 4TNWA 3PUYF 3SS1A 2BG9B 5JDMA 4LMJA 5FL1A 5F5WA 2C5JA 1MIYA 2UXDT 3HKBE 3MACA 2XSBA 1XDPA 1MMDA 2XUEA 5EK2A 3IHRA 3T1HT 4ISTA 3UFEA 5BR8T 1X79A 5JDFA 5IHYA 2JIWA 5JR9B 2E9XD 3PJAJ 2D0UA 3N9LA 4PNIA 3ABVA 1XWMA 1Y64B 3C50A 2V7MA 2H89A 3MJXA 4YHHT 4LFAT 1HNWT 4DR5T 3MZKB 3CK6A 1WYBA 3CX7B 2WDVA 2CWOA 2XQYA 5F3JA 3RX6A 2BDEA 2WDQA 4X66T 3KV9A 3HKCE 4ZI3D 1BR4A 3WAKA 4IE7A 4U2ZA 5FXZA 2G0UA 2K9AA 4DV2T 3SOLA 3FBZA 2CLYB 5AQFB 3FXDB 2LM2A 3NKZA 1VOMA 4X64T 4LF9T 5JDHA 2VURA 3LBXA 4DBRA 5HXSA 1UCUA 5LJMA 5LP6E 4DR2T 2VVSA 3AAIA 1XMQT 4MFRA 2YDSA 1SE7A 3LK3B 1WCRA 5LGUB 3UUXB 5J2UE 3RGLA 4YJ3E 2B1EA 1I94T 2E8IA 4HFDA 3AAEB 2DHRA 5L3CB 1ZP0A 4EIWA 2Q9QB 2J4GA 3P4PA 2GK9A 2MTQA 4HKAA 4GK0E 1UGOA 5FKYA 2BG9C 3RRCA 3AXJB 2J62A 4WZXA 3ETUA 1T98A 2DWKA 4H9OC 1QUUA 1YXRA 4F6RC 5JR9C 1J1JA 4EZ4A 2NW8A 3KFWX 3ETVA 2NWBA 2V1DB 3AE4A 3PURA 5L4EA 4EEBA 2UXBT 5HXCA 4A56A 4IDPA 1IBMT 2V5DA 2D5UA 3NRXA 2WMNA 4UELA 1LRZA 1LVKA 2WAUA 1IJ6A 4X5TA 1WR6A 3QC9A 2VASA 3ZSSA 4ZS3A 2CLYC 5JR9A 2JRKA 2X67A 2UUBT 5ABFB 3OJAA 5KXJA 2Y6XA 3QOFA 1OEDE 5FYMA 3ZMUB 4H9NC 3FZMB 3JCFA 2XHEB 3UTKA 5E0OA 3E0ZA 4IL9A 4I4TE 5HCJA 5IUXA 4DUYT 4LF7T 4PJMA 3N2OA 3C4XA 2E5VA 4IHJE 3AE5A 2LM9A 4A5XA 4EAHA 3ONJA 4HFCA 2N9DA 3PUQA 3FZFB 3ZYMA 4L9IA 3H3MA 5JREA 3AE6A 1Y01A 1OEDB 3K8PC 3TKLB 4TZ4C 2HHHT 2DNXA 3C4ZA 5HWYA 2J1DG 5HEJA 2C5IT 4LF4T 2IIUA 4IIJE 2BBHA 1NWMX 3VRAA 2ZM8A 2XAJB 4AKGA 2VQET 3F57A 1N34T 4ASKA 2WZHA 3AEDA 4IL4A 4MBQA 1HX1B 2N2NA 2FJBA 4BJMA 5ABHA 3ZC1A 2EHOB 1SA0E 5L2LA 4U2YA 2X68A 3C64A 2YOEA 1XNRT 4I43B 5JDGA 3AB3B 1BR2A 2XQ4A 3F31A 3CX6B 2A3DA 3O1HA 1MNDA 5ABEA 5HCMA 3RLFF 4B3TT 3AE2A 1V9DA 3Q2MA 1XZYA 1N32T 4CI1B 5JRCB 3C98B 2UXXB 2CWYA 5AQTB 3ANWB 5HEHA 3BQKA 2WCAA 2UUCT 3RKOA 4E7ZA 4KHZF 3Q9DA 4PK5A 2ES0A 1WLXA 5AQJB 4CXWA 3ONXA 5ABFA 3N9MA 3TLWA 4A97A 3ZT7A 2A2FX 5HEUA 2BVLA 5CJ5A 2M6BA 2ODVA 5LCYA 1D0XA 5HYAA 3PE0A 3FZLB 3IBPA 1OEDC 2IDOB 3AEEA 3P4SA 3B13A 3F2EA 2JQ9A 2JQHA 2YDQA 2WU2A 2HN2A 4HEAA 2XPKA 2UXCT 2W00A 1H7CA 4KP3C 3RKGA 1VCTA 3NVOA 3Q5WA 4LFCT 1GQEA 2RP4A 2JMKA 3ZCJA 2FJAA 3KVAA 1HTJF 3FHNA 2HPLA 3UU8A 1HCIA 3P4RA 3D0TA 1N33T 2XM1A 1HFAA 1OXZA 2WWVA 1OEDA 3ZC0A 4TX5A 4DV6T 3CQXC 2ZMAA 2BS2A 4OYKA 3ZPOA 1US7B 2VL0A 2NR4A 2IUBA 2YU1A 4IDZA 1B7TA 4OHFA 3MXZA 3P7IA 3AE9A 1HS7A 4JI3T 2CPTA 2HH7A 2AXDS 5FVLA 3RIAA 5LGNB 2I0MA 2HN1A 5A1LA 3FZHB 4YFSA 2LSGA 1YKEB 3FB2A 4HFEA 4DV0T 1L0VA 4HFBA 2KWHA 2FUPA 3LDQB 3AA7B 4CXXA 3VU7H 3K3OA 4CI3B 3M65A 4CQIA 3UU3A 4TN7B 2W66A 2VVNA 4GKKT 1Z0PA 3RC8A 2BG9E 2MOZA 4Z91A 4TV9E 2I6HA 2X9YA 5AQMB 5AQRB 2ZM2A 1M7KA 3RQWA 3OVUA 5JRCA 4COFA 2RPAA 2IHR1 3NRYA 3ANWA 4O2BE 4H63V 5KMGP 3ESLA 3E08A 2MAWA 4ZEYA 2LE8A 3I1AA 2KZ7B 4H9PC 5LJNA 5L3EB 4AIUA 2QVAA 2CXFA 1WYCA 4UIGA 1OWAA 4YTPA 4X20E 3ZT5A 3R6NA 1W9RA 3CPZA 2WS3A 3AEBA 2PBIA 2WSSV 3WAJA 3UU4A 4YHJA 3W15B 5BMVE 2VK9A 5CB4E 3T1YT 2J47A 3MA9A 4ZI2C 3EABA 3UT5E 5J2TE 4EYUA 2IW5B 2JJ9A 3TLTA 5AQGB 3L8RA 3JC6D 4GKJT 3UUBA 2H7OA 1O3XA 5JQGE 2XAQB 3OYXA 4PAGA 2LSYA 2YK0A 4IDNA 1D1CA 4TNVA 3PUZF 5LHGB 4QXHB 4QXCB 3C51A 2JQKA 3IEEA 4X62T 4JLEA 4YTNA 5LNKA 4U7YA 2V7KA 1W0BA 3PJAA 1BR0A 2ODUA 4DR1T 2IC6A 2A9UA 3VKGA 4JI7T 2K3WA 1YQ4A 2W67A 2DCFA 5C3JA 3P50A 3P4WA 3J9X1 4ISSA 4YT0A 1MIVA 2CBJA 1T8BA 2XTLA 3RRWA 5LXTE 5J1GA 3I9WA 2W62A 4UR9A 2WY2A 2HPJA 2PJQA 3N9PA 3HKEE 2P9BA 4P1NA 3SWHA 4V1Av 2H7VC 3HR0A 3CKDA 4TV8E 2BS3A 3RYFE 3AA0B 4ILUA 5HWXA 3N9NA 5LG4A 2WB5A 4JI0T 2Z6EA 2X0YA 5FY7A 4DO0A 5L4HA 2XY8B 2LHNA 1N36T 1D1BA 4NXNT 2W63A 5HAXA 3AEAA 2ZM6T 3BQIA 4EGWA 2CCQA 1YW0A 4PK6A 3ZMSB 4LFBT 4JUYA 1S35A 1HNZT 4AISA 3GA8A 3RPUA 3V5UA 4ZZCA 2BG9A 2V26A 1T72A 5JDNA 4CN6A 2JMHA 3EHZA 2BKOA 3EAMA 4IT4A 4QH1A 2D2SA 2V5CA 4ANJA 1J5WA 4LF8T 4ZI2D 3RF1A 3KV6A 3ZN0B 4CZZB 2CHNA 2H3RA 2CMRA 4DV4T 3ZYLA 2WQYA 2YU2A 1KNZA 2VB6A 5AQQB 2X51A 3V5SA 1G73A 3TLUA 3JAEA 3PU8A 4P0AA 4C90A 2ACXA 4LMKA 4IREA 2W4XA 1KNRA 4I50E 4YSXA 1E2AA 3ZSTA 1MMGA 2UUAT 4O4LE 4M1PA 4X1YE 2Q9QC 5DJQC 1E1HB 2X9XA 2W2UA 5LHIB 1AJ3A 3O1IA 3AE7A 4ILAA 2V6YB 3I0QA 2Y8DA 5EZYE 4YTMA 4WYVA 1X9BA 2I59A 3N2KE 5FL0A 4YY3T 1XNQT 5HXEA 1YD8G 3QK6A 3UU6A 2CRBA 2CEAA 2LOPA 4KBMB 1R8IA 2BS4A 2VKOA 4U33A 2Q9QA 2BVMA 5AQHB 3RIUC 4QWNB 1NENA 3RYCE 5HEOA 2WP9A 2E9XB 5ADXL 2LEHA 2XQ5A 3K1SA 5H6QB 5LG3A 4JEUB 3PDYA 3AXJA 3C4WA 4TWHA 2X9WA 3RH3A 3FXEB 5LA6E 1SUMB 2DL1A 3P8CD 3CX8B 2H88A 5ABGA 2K5BB 2YN6A 2XQ6A 4PK4A 1IZNB 2JQQA 3AE3A 5IYZE 4WNKA 2ACZA 3GWHA 4X1IE 3RIUA 2VL8A 4TUYE 5FMNA 4K0KT 3B5MA 3GN5B 2LT3A 2R6GF 3CQCB 1UUSA 4L0RA 1JNRA 2W61A 3O1JA 1HR0T 1ZEEA 1FEWA 4HN9A 2QGSA 2SPCA 4DMWA 4EEDA 2CBIA 4AI6A 1FIOA 5DABA 4FI5A 5AFUL 4JI1T 3SRZA 3VR9A 4JYAT 2FJDA 1VCSA 4HWIB 4DR4T 4CI2B 2OLTA 2KSRA 3I0OA 4ADZA 5AQKB 1KNPA 3ONLC 1D0YA 4WW0A 1MMNA 5KDMC 3LK2B 4B3RT 1JNZA 3LSVA 4UVAB 1NEKA 1QLBA 2DI4A 3CWZB 4B3MT 1NAFA 2L8KA 3AE8A 5JDQA 2Q9QD 3T8OA 4KUMB 3AEFA 2EHOC 2V6YA 3QB5K 1HG2A 2E9XC 5DQWA 3O4XE 4A98A 2CXDA 2YEVC 3L3PA 5L3DB 3PUVF 4MALA 4XAXB 5AQSB 3ZJ2A 2BKNA 4UEMA 1XDOA 2B76A 4ZZBA 5H6RB 2E5LT 4U3CA 3S4UA 4MHCA 2NW7A 5FNVE 3FZKB 2E2AA 3N9OA 4ZI3C 5L3FB 1WR0A 3PUXF 4H9RC 2C0SA 1D0ZA 4YXDA 4DV7T 4WBOA 2EHOA 2XASB 3KBUA 3LG7A 4K0UA 1M62A 4IDOA 4B6XA 3AA1B 3DJBA 2QRXA 4JBWF 4YSYA 4DR7T 3LBXB 2XQ3A 5AQLB 2YINA 2UU9T 2LSKA 4BJNA 3P4QA 4IGUA 5LMNT 1LKXA 1ZOYA 2NOXA 2NP9A 2KWIB 1W0AA 1VRBA 2LJLA 5LBQB 4P0BA 3CMLA 4O4IE 3DP7A 3X1DA 5LHHB 3KVBA 2X0HA 3FBLA 3GN5A 2M6IA 2XQ9A 2MBGA 3OKQA 1MIWA 3U78A 3ZKRA 4BAYB 3H3AA 2KLQA 3HI2A 1EZ3A 4GYRA 4H9QC 2BZBA 2JPFA 2PTFA 5FXVA 3SFEA 3RYHE 1YKHB 4IE0A 2WDRA 3ZN1B 3J7Yq 5KX5E 5AQUB 2K48A 2X9HA 4BA9A 4JV5T 2BBJA 2MPKA 3B57A 3SFDA 2KINB 2XAHB 4ZOLE 4KX6A 2K24A 4PJJA 2CE7A 4YSZA 5AQIB 3EUHA 3KV4A 3O9XA 2XZEA 4PFPA 3ZMVB 4I55E 1XMOT 5LMUT 2LSJA 4AQFC 2V8SV 4IE5A 3RHWA 2VKJA 3AECA 5LB7B 2EHOD 1CHUA 3LJCA 4UVBB 3RYIE 2C5KT 2XAFB 2LRLA 4Z8XA 3PTRB 2IAKA 4YJ2E 4KI0F 3RIFA 3KV5A 2PG8A 2V7LA 3H37A 3E22E 3VKHA 4U31A 4AXPA 5AQNB 4DV5T 2X0LB 4ILBA 4AQFA 1D1AA 5FY0A 3RQUA 4B3ST 2VKHA 4JEHB 2CHOA 2LRKA 4QHOA 3UFGA 2LHRA 5JH7E 3VHLA 3PUAA 3CIRA 5JDLA 3MKDA 4G2AA 2XQ8A 2RA1A 1WFDA 1LVFA 2XAGB 4H63H 3ZMZB 2VKDA 5C8YE 1HF8A 2KNDA 1IJ5A 2LKHA 4F8HA 3KBTA 4UV9B 4AKIA 3PU3A 5HXRA 4O8SA 4EV6A 4HFHA 4HWDA 2XQAA 3RI5A 4DV3T 1T7SA 2ZLYA 3PUGA 4O4JE 4H9SE 5FVKA 2V6XA 5DQVA 3MK7C 1ZKEA 5L3GB 4AQYT 3UUNA 5AQVB 4QX7B 3R84B 4C91A 3QUJA 2XJ7A 2IC9A 3AA6B 3L09A 4J2CA 2AE9A 5C2TA 5JTGA 1KEYA 3OPCA 1KK7A 2V7JA 4QH4A 4NIQA 4ERRA 4NUUA 4O2AE 4TWFA 4O4HE 3Q5DA 3DTOA 3UULA 1HNXT 2WZIA 4NXMT 2DWGA 4PJNA 3WI3A 5CA1E 1WRDA 1S94A 4GIWA 1FMVA 4EXTA 4L5GA 4DNDA 4MLKA 4JI5T 4EYYR 3GMIA 3ZEFB 3A5XA 3ZYKA 4UXNB 2VQFT 4IDQA 3ZLIA 4UF0B 3LK42 4X1KE 4AKHA 5JVDE 2X66A 2V7IA 2Y48B 4OX9T 4Q25A 5L47A 3PV0F 3JADA 3NZPA 5IWAT 1UX4A 4QH5A 3BQLA 2WM9A 4G63A 2W0GA 4QKNA 5FP3A 2YDRA 2CXLA 4HWHA 3I9YA 1ZV4X 5FXWA 2PFVA 2LLYA 4HTEA 2QA7A 5F8PA 3KINB 1DU2A 4XBFB 4QXBB 3PUSA 3HKDE 2WBLA 3VR8A 1E7PA 3A7MA 1KFYA 3UQ4A 5J0ZA 3TLVA 3UUMA 3UU5A 1U5PA 1CUNA 3HA4A 4U7IA 4OK0A 3JAFA 1FMWA 4QX8B 1UURA 2BKPA 5LBMA 5CA0E 3OYZA 1UX5A 5GONE 4CN4A 2KT9A 4OYJA 3AAAB 1U4QA 3AEGA 2CA5A 5AQPB 3EDUA 2MYSA 4HFIA 1HX8A 2NTYA 4NPPA 4NUVA 5AQOB 2KXPB 3ZCIA 4IE6A 4AKLA 4U72A 2KMFA 4X65T 5ETWA 4AQGA 4CN1A 4DVDA 4HFVA 2D0TA 2CM0A 3HL6A 4LF5T 2FBWA 4UV8B 2L9QA 5CFBA 2LKGA 4JI4T 2XQ7A 2IMLA 3LFMA 3N5LA 4GOUA 5CGMA 5LYJE 4PFOA 2WMOA 4YLHA 2UXNB 3NWIA 4DMVA 3EVYA 1IBLT 1IAPA 5HXHA 4UVCB 4HE8A 3PUWF 2VWAA 4ZI7E 4ZXLA 4IE4A 4P09A 2A72A 5M4YA 3Q5XA 4UF0A 4OFZA 3UQ7A 4KHPT 3ZT6A 4E7SA 2ZM0A 3JC6C 4PJLA 2XSAA 4EB6E 1MMAA 3NZQA 4PW8A 3BK9A 1W09A 3TLSA 3EDVA 2M67A 4WBNE 1YQ3A 2OV9A 4DR6T 4EZHA 4FJOA 3KDSE 4GYSA 3VRBA 1KF6A 4Z90A
chains in the Genus database with same CATH topology
5FVKA 2LRLA 4A5XA 4WZXA 3EABA 4U3CA 2V6XA 3ZT7A 4IT4A 4CN4A 3ZSSA 2V6YA 4P1NA 5CJ5A 2WWVA 1WFDA 2CPTA 2CRBA 4U2ZA 4ZEYA 2XZEA 5CGMA 5FVLA 2JQKA 1WR0A 4U2YA 4CN1A 3K1SA 2W2UA 1YXRA 2MPKA 2RPAA 4U7IA 4NIQA 1WCRA 4U7YA 2V6YB 5LB7B 2LRKA 2WY2A 3ZT6A 2A9UA 4U31A 4CN6A 3ZT5A 4U33A 2DL1A 2K3WA 3ZSTA 2JQ9A 2JQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVK A;  2LRL A;  4A5X A;  4WZX A;  3EAB A;  4U3C A;  2V6X A;  3ZT7 A;  4IT4 A;  4CN4 A;  3ZSS A;  2V6Y A;  4P1N A;  5CJ5 A;  2WWV A;  1WFD A;  2CPT A;  2CRB A;  4U2Z A;  4ZEY A;  2XZE A;  5CGM A;  5FVL A;  2JQK A;  1WR0 A;  4U2Y A;  4CN1 A;  3K1S A;  2W2U A;  1YXR A;  2MPK A;  2RPA A;  4U7I A;  4NIQ A;  1WCR A;  4U7Y A;  2V6Y B;  5LB7 B;  2LRK A;  2WY2 A;  3ZT6 A;  2A9U A;  4U31 A;  4CN6 A;  3ZT5 A;  4U33 A;  2DL1 A;  2K3W A;  3ZST A;  2JQ9 A;  2JQH A; 
#chains in the Genus database with same CATH topology
 2E9X A;  2DLR A;  5EK3 A;  3CVR A;  3L39 A;  4I0U A;  2LSI A;  2D9D A;  2L3L A;  3ZMT B;  3U3I A;  4DID B;  4DV1 T;  2XM2 A;  3CQG B;  4ILC A;  2OA5 A;  4CXY A;  5TAO A;  4HWC A;  4N78 D;  3AE1 A;  1SHZ C;  4JI8 T;  3IF8 B;  4EOZ B;  1I6Z A;  4ZHQ E;  5FY1 A;  4DBQ A;  2LOS A;  5LGT B;  3N2G E;  2NW9 A;  3QB5 A;  3IA3 A;  1ZHC A;  3G06 A;  4DUZ T;  3K3Q C;  2QYW A;  3QNU A;  3AVR A;  4HGA A;  3NBX X;  4ZS2 A;  3A8Y C;  4GK5 E;  4LML A;  4U74 A;  5L3B B;  4HWF A;  5HEG A;  1J5E T;  5EK4 A;  4AKR B;  1FJG T;  4JI6 T;  4TWD A;  4KMC A;  3ZJ1 A;  3EI0 A;  3OBV E;  2FJE A;  3N9Q A;  5LOV E;  2WWU A;  3OTO T;  1QSD A;  4DR3 T;  1HG5 A;  3AVS A;  1IBK T;  3K3N A;  3RC3 A;  4XZC A;  4JI2 T;  2WU5 A;  1Z8U A;  5FXX A;  1UK5 A;  2NTX A;  3Q5E A;  4LF6 T;  1G8X A;  3M3Z B;  1MNE A;  2F4V T;  2N1G A;  1BR1 A;  2YKS A;  4TNW A;  3PUY F;  3SS1 A;  2BG9 B;  5JDM A;  4LMJ A;  5FL1 A;  5F5W A;  2C5J A;  1MIY A;  2UXD T;  3HKB E;  3MAC A;  2XSB A;  1XDP A;  1MMD A;  2XUE A;  5EK2 A;  3IHR A;  3T1H T;  4IST A;  3UFE A;  5BR8 T;  1X79 A;  5JDF A;  5IHY A;  2JIW A;  5JR9 B;  2E9X D;  3PJA J;  2D0U A;  3N9L A;  4PNI A;  3ABV A;  1XWM A;  1Y64 B;  3C50 A;  2V7M A;  2H89 A;  3MJX A;  4YHH T;  4LFA T;  1HNW T;  4DR5 T;  3MZK B;  3CK6 A;  1WYB A;  3CX7 B;  2WDV A;  2CWO A;  2XQY A;  5F3J A;  3RX6 A;  2BDE A;  2WDQ A;  4X66 T;  3KV9 A;  3HKC E;  4ZI3 D;  1BR4 A;  3WAK A;  4IE7 A;  4U2Z A;  5FXZ A;  2G0U A;  2K9A A;  4DV2 T;  3SOL A;  3FBZ A;  2CLY B;  5AQF B;  3FXD B;  2LM2 A;  3NKZ A;  1VOM A;  4X64 T;  4LF9 T;  5JDH A;  2VUR A;  3LBX A;  4DBR A;  5HXS A;  1UCU A;  5LJM A;  5LP6 E;  4DR2 T;  2VVS A;  3AAI A;  1XMQ T;  4MFR A;  2YDS A;  1SE7 A;  3LK3 B;  1WCR A;  5LGU B;  3UUX B;  5J2U E;  3RGL A;  4YJ3 E;  2B1E A;  1I94 T;  2E8I A;  4HFD A;  3AAE B;  2DHR A;  5L3C B;  1ZP0 A;  4EIW A;  2Q9Q B;  2J4G A;  3P4P A;  2GK9 A;  2MTQ A;  4HKA A;  4GK0 E;  1UGO A;  5FKY A;  2BG9 C;  3RRC A;  3AXJ B;  2J62 A;  4WZX A;  3ETU A;  1T98 A;  2DWK A;  4H9O C;  1QUU A;  1YXR A;  4F6R C;  5JR9 C;  1J1J A;  4EZ4 A;  2NW8 A;  3KFW X;  3ETV A;  2NWB A;  2V1D B;  3AE4 A;  3PUR A;  5L4E A;  4EEB A;  2UXB T;  5HXC A;  4A56 A;  4IDP A;  1IBM T;  2V5D A;  2D5U A;  3NRX A;  2WMN A;  4UEL A;  1LRZ A;  1LVK A;  2WAU A;  1IJ6 A;  4X5T A;  1WR6 A;  3QC9 A;  2VAS A;  3ZSS A;  4ZS3 A;  2CLY C;  5JR9 A;  2JRK A;  2X67 A;  2UUB T;  5ABF B;  3OJA A;  5KXJ A;  2Y6X A;  3QOF A;  1OED E;  5FYM A;  3ZMU B;  4H9N C;  3FZM B;  3JCF A;  2XHE B;  3UTK A;  5E0O A;  3E0Z A;  4IL9 A;  4I4T E;  5HCJ A;  5IUX A;  4DUY T;  4LF7 T;  4PJM A;  3N2O A;  3C4X A;  2E5V A;  4IHJ E;  3AE5 A;  2LM9 A;  4A5X A;  4EAH A;  3ONJ A;  4HFC A;  2N9D A;  3PUQ A;  3FZF B;  3ZYM A;  4L9I A;  3H3M A;  5JRE A;  3AE6 A;  1Y01 A;  1OED B;  3K8P C;  3TKL B;  4TZ4 C;  2HHH T;  2DNX A;  3C4Z A;  5HWY A;  2J1D G;  5HEJ A;  2C5I T;  4LF4 T;  2IIU A;  4IIJ E;  2BBH A;  1NWM X;  3VRA A;  2ZM8 A;  2XAJ B;  4AKG A;  2VQE T;  3F57 A;  1N34 T;  4ASK A;  2WZH A;  3AED A;  4IL4 A;  4MBQ A;  1HX1 B;  2N2N A;  2FJB A;  4BJM A;  5ABH A;  3ZC1 A;  2EHO B;  1SA0 E;  5L2L A;  4U2Y A;  2X68 A;  3C64 A;  2YOE A;  1XNR T;  4I43 B;  5JDG A;  3AB3 B;  1BR2 A;  2XQ4 A;  3F31 A;  3CX6 B;  2A3D A;  3O1H A;  1MND A;  5ABE A;  5HCM A;  3RLF F;  4B3T T;  3AE2 A;  1V9D A;  3Q2M A;  1XZY A;  1N32 T;  4CI1 B;  5JRC B;  3C98 B;  2UXX B;  2CWY A;  5AQT B;  3ANW B;  5HEH A;  3BQK A;  2WCA A;  2UUC T;  3RKO A;  4E7Z A;  4KHZ F;  3Q9D A;  4PK5 A;  2ES0 A;  1WLX A;  5AQJ B;  4CXW A;  3ONX A;  5ABF A;  3N9M A;  3TLW A;  4A97 A;  3ZT7 A;  2A2F X;  5HEU A;  2BVL A;  5CJ5 A;  2M6B A;  2ODV A;  5LCY A;  1D0X A;  5HYA A;  3PE0 A;  3FZL B;  3IBP A;  1OED C;  2IDO B;  3AEE A;  3P4S A;  3B13 A;  3F2E A;  2JQ9 A;  2JQH A;  2YDQ A;  2WU2 A;  2HN2 A;  4HEA A;  2XPK A;  2UXC T;  2W00 A;  1H7C A;  4KP3 C;  3RKG A;  1VCT A;  3NVO A;  3Q5W A;  4LFC T;  1GQE A;  2RP4 A;  2JMK A;  3ZCJ A;  2FJA A;  3KVA A;  1HTJ F;  3FHN A;  2HPL A;  3UU8 A;  1HCI A;  3P4R A;  3D0T A;  1N33 T;  2XM1 A;  1HFA A;  1OXZ A;  2WWV A;  1OED A;  3ZC0 A;  4TX5 A;  4DV6 T;  3CQX C;  2ZMA A;  2BS2 A;  4OYK A;  3ZPO A;  1US7 B;  2VL0 A;  2NR4 A;  2IUB A;  2YU1 A;  4IDZ A;  1B7T A;  4OHF A;  3MXZ A;  3P7I A;  3AE9 A;  1HS7 A;  4JI3 T;  2CPT A;  2HH7 A;  2AXD S;  5FVL A;  3RIA A;  5LGN B;  2I0M A;  2HN1 A;  5A1L A;  3FZH B;  4YFS A;  2LSG A;  1YKE B;  3FB2 A;  4HFE A;  4DV0 T;  1L0V A;  4HFB A;  2KWH A;  2FUP A;  3LDQ B;  3AA7 B;  4CXX A;  3VU7 H;  3K3O A;  4CI3 B;  3M65 A;  4CQI A;  3UU3 A;  4TN7 B;  2W66 A;  2VVN A;  4GKK T;  1Z0P A;  3RC8 A;  2BG9 E;  2MOZ A;  4Z91 A;  4TV9 E;  2I6H A;  2X9Y A;  5AQM B;  5AQR B;  2ZM2 A;  1M7K A;  3RQW A;  3OVU A;  5JRC A;  4COF A;  2RPA A;  2IHR 1;  3NRY A;  3ANW A;  4O2B E;  4H63 V;  5KMG P;  3ESL A;  3E08 A;  2MAW A;  4ZEY A;  2LE8 A;  3I1A A;  2KZ7 B;  4H9P C;  5LJN A;  5L3E B;  4AIU A;  2QVA A;  2CXF A;  1WYC A;  4UIG A;  1OWA A;  4YTP A;  4X20 E;  3ZT5 A;  3R6N A;  1W9R A;  3CPZ A;  2WS3 A;  3AEB A;  2PBI A;  2WSS V;  3WAJ A;  3UU4 A;  4YHJ A;  3W15 B;  5BMV E;  2VK9 A;  5CB4 E;  3T1Y T;  2J47 A;  3MA9 A;  4ZI2 C;  3EAB A;  3UT5 E;  5J2T E;  4EYU A;  2IW5 B;  2JJ9 A;  3TLT A;  5AQG B;  3L8R A;  3JC6 D;  4GKJ T;  3UUB A;  2H7O A;  1O3X A;  5JQG E;  2XAQ B;  3OYX A;  4PAG A;  2LSY A;  2YK0 A;  4IDN A;  1D1C A;  4TNV A;  3PUZ F;  5LHG B;  4QXH B;  4QXC B;  3C51 A;  2JQK A;  3IEE A;  4X62 T;  4JLE A;  4YTN A;  5LNK A;  4U7Y A;  2V7K A;  1W0B A;  3PJA A;  1BR0 A;  2ODU A;  4DR1 T;  2IC6 A;  2A9U A;  3VKG A;  4JI7 T;  2K3W A;  1YQ4 A;  2W67 A;  2DCF A;  5C3J A;  3P50 A;  3P4W A;  3J9X 1;  4ISS A;  4YT0 A;  1MIV A;  2CBJ A;  1T8B A;  2XTL A;  3RRW A;  5LXT E;  5J1G A;  3I9W A;  2W62 A;  4UR9 A;  2WY2 A;  2HPJ A;  2PJQ A;  3N9P A;  3HKE E;  2P9B A;  4P1N A;  3SWH A;  4V1A v;  2H7V C;  3HR0 A;  3CKD A;  4TV8 E;  2BS3 A;  3RYF E;  3AA0 B;  4ILU A;  5HWX A;  3N9N A;  5LG4 A;  2WB5 A;  4JI0 T;  2Z6E A;  2X0Y A;  5FY7 A;  4DO0 A;  5L4H A;  2XY8 B;  2LHN A;  1N36 T;  1D1B A;  4NXN T;  2W63 A;  5HAX A;  3AEA A;  2ZM6 T;  3BQI A;  4EGW A;  2CCQ A;  1YW0 A;  4PK6 A;  3ZMS B;  4LFB T;  4JUY A;  1S35 A;  1HNZ T;  4AIS A;  3GA8 A;  3RPU A;  3V5U A;  4ZZC A;  2BG9 A;  2V26 A;  1T72 A;  5JDN A;  4CN6 A;  2JMH A;  3EHZ A;  2BKO A;  3EAM A;  4IT4 A;  4QH1 A;  2D2S A;  2V5C A;  4ANJ A;  1J5W A;  4LF8 T;  4ZI2 D;  3RF1 A;  3KV6 A;  3ZN0 B;  4CZZ B;  2CHN A;  2H3R A;  2CMR A;  4DV4 T;  3ZYL A;  2WQY A;  2YU2 A;  1KNZ A;  2VB6 A;  5AQQ B;  2X51 A;  3V5S A;  1G73 A;  3TLU A;  3JAE A;  3PU8 A;  4P0A A;  4C90 A;  2ACX A;  4LMK A;  4IRE A;  2W4X A;  1KNR A;  4I50 E;  4YSX A;  1E2A A;  3ZST A;  1MMG A;  2UUA T;  4O4L E;  4M1P A;  4X1Y E;  2Q9Q C;  5DJQ C;  1E1H B;  2X9X A;  2W2U A;  5LHI B;  1AJ3 A;  3O1I A;  3AE7 A;  4ILA A;  2V6Y B;  3I0Q A;  2Y8D A;  5EZY E;  4YTM A;  4WYV A;  1X9B A;  2I59 A;  3N2K E;  5FL0 A;  4YY3 T;  1XNQ T;  5HXE A;  1YD8 G;  3QK6 A;  3UU6 A;  2CRB A;  2CEA A;  2LOP A;  4KBM B;  1R8I A;  2BS4 A;  2VKO A;  4U33 A;  2Q9Q A;  2BVM A;  5AQH B;  3RIU C;  4QWN B;  1NEN A;  3RYC E;  5HEO A;  2WP9 A;  2E9X B;  5ADX L;  2LEH A;  2XQ5 A;  3K1S A;  5H6Q B;  5LG3 A;  4JEU B;  3PDY A;  3AXJ A;  3C4W A;  4TWH A;  2X9W A;  3RH3 A;  3FXE B;  5LA6 E;  1SUM B;  2DL1 A;  3P8C D;  3CX8 B;  2H88 A;  5ABG A;  2K5B B;  2YN6 A;  2XQ6 A;  4PK4 A;  1IZN B;  2JQQ A;  3AE3 A;  5IYZ E;  4WNK A;  2ACZ A;  3GWH A;  4X1I E;  3RIU A;  2VL8 A;  4TUY E;  5FMN A;  4K0K T;  3B5M A;  3GN5 B;  2LT3 A;  2R6G F;  3CQC B;  1UUS A;  4L0R A;  1JNR A;  2W61 A;  3O1J A;  1HR0 T;  1ZEE A;  1FEW A;  4HN9 A;  2QGS A;  2SPC A;  4DMW A;  4EED A;  2CBI A;  4AI6 A;  1FIO A;  5DAB A;  4FI5 A;  5AFU L;  4JI1 T;  3SRZ A;  3VR9 A;  4JYA T;  2FJD A;  1VCS A;  4HWI B;  4DR4 T;  4CI2 B;  2OLT A;  2KSR A;  3I0O A;  4ADZ A;  5AQK B;  1KNP A;  3ONL C;  1D0Y A;  4WW0 A;  1MMN A;  5KDM C;  3LK2 B;  4B3R T;  1JNZ A;  3LSV A;  4UVA B;  1NEK A;  1QLB A;  2DI4 A;  3CWZ B;  4B3M T;  1NAF A;  2L8K A;  3AE8 A;  5JDQ A;  2Q9Q D;  3T8O A;  4KUM B;  3AEF A;  2EHO C;  2V6Y A;  3QB5 K;  1HG2 A;  2E9X C;  5DQW A;  3O4X E;  4A98 A;  2CXD A;  2YEV C;  3L3P A;  5L3D B;  3PUV F;  4MAL A;  4XAX B;  5AQS B;  3ZJ2 A;  2BKN A;  4UEM A;  1XDO A;  2B76 A;  4ZZB A;  5H6R B;  2E5L T;  4U3C A;  3S4U A;  4MHC A;  2NW7 A;  5FNV E;  3FZK B;  2E2A A;  3N9O A;  4ZI3 C;  5L3F B;  1WR0 A;  3PUX F;  4H9R C;  2C0S A;  1D0Z A;  4YXD A;  4DV7 T;  4WBO A;  2EHO A;  2XAS B;  3KBU A;  3LG7 A;  4K0U A;  1M62 A;  4IDO A;  4B6X A;  3AA1 B;  3DJB A;  2QRX A;  4JBW F;  4YSY A;  4DR7 T;  3LBX B;  2XQ3 A;  5AQL B;  2YIN A;  2UU9 T;  2LSK A;  4BJN A;  3P4Q A;  4IGU A;  5LMN T;  1LKX A;  1ZOY A;  2NOX A;  2NP9 A;  2KWI B;  1W0A A;  1VRB A;  2LJL A;  5LBQ B;  4P0B A;  3CML A;  4O4I E;  3DP7 A;  3X1D A;  5LHH B;  3KVB A;  2X0H A;  3FBL A;  3GN5 A;  2M6I A;  2XQ9 A;  2MBG A;  3OKQ A;  1MIW A;  3U78 A;  3ZKR A;  4BAY B;  3H3A A;  2KLQ A;  3HI2 A;  1EZ3 A;  4GYR A;  4H9Q C;  2BZB A;  2JPF A;  2PTF A;  5FXV A;  3SFE A;  3RYH E;  1YKH B;  4IE0 A;  2WDR A;  3ZN1 B;  3J7Y q;  5KX5 E;  5AQU B;  2K48 A;  2X9H A;  4BA9 A;  4JV5 T;  2BBJ A;  2MPK A;  3B57 A;  3SFD A;  2KIN B;  2XAH B;  4ZOL E;  4KX6 A;  2K24 A;  4PJJ A;  2CE7 A;  4YSZ A;  5AQI B;  3EUH A;  3KV4 A;  3O9X A;  2XZE A;  4PFP A;  3ZMV B;  4I55 E;  1XMO T;  5LMU T;  2LSJ A;  4AQF C;  2V8S V;  4IE5 A;  3RHW A;  2VKJ A;  3AEC A;  5LB7 B;  2EHO D;  1CHU A;  3LJC A;  4UVB B;  3RYI E;  2C5K T;  2XAF B;  2LRL A;  4Z8X A;  3PTR B;  2IAK A;  4YJ2 E;  4KI0 F;  3RIF A;  3KV5 A;  2PG8 A;  2V7L A;  3H37 A;  3E22 E;  3VKH A;  4U31 A;  4AXP A;  5AQN B;  4DV5 T;  2X0L B;  4ILB A;  4AQF A;  1D1A A;  5FY0 A;  3RQU A;  4B3S T;  2VKH A;  4JEH B;  2CHO A;  2LRK A;  4QHO A;  3UFG A;  2LHR A;  5JH7 E;  3VHL A;  3PUA A;  3CIR A;  5JDL A;  3MKD A;  4G2A A;  2XQ8 A;  2RA1 A;  1WFD A;  1LVF A;  2XAG B;  4H63 H;  3ZMZ B;  2VKD A;  5C8Y E;  1HF8 A;  2KND A;  1IJ5 A;  2LKH A;  4F8H A;  3KBT A;  4UV9 B;  4AKI A;  3PU3 A;  5HXR A;  4O8S A;  4EV6 A;  4HFH A;  4HWD A;  2XQA A;  3RI5 A;  4DV3 T;  1T7S A;  2ZLY A;  3PUG A;  4O4J E;  4H9S E;  5FVK A;  2V6X A;  5DQV A;  3MK7 C;  1ZKE A;  5L3G B;  4AQY T;  3UUN A;  5AQV B;  4QX7 B;  3R84 B;  4C91 A;  3QUJ A;  2XJ7 A;  2IC9 A;  3AA6 B;  3L09 A;  4J2C A;  2AE9 A;  5C2T A;  5JTG A;  1KEY A;  3OPC A;  1KK7 A;  2V7J A;  4QH4 A;  4NIQ A;  4ERR A;  4NUU A;  4O2A E;  4TWF A;  4O4H E;  3Q5D A;  3DTO A;  3UUL A;  1HNX T;  2WZI A;  4NXM T;  2DWG A;  4PJN A;  3WI3 A;  5CA1 E;  1WRD A;  1S94 A;  4GIW A;  1FMV A;  4EXT A;  4L5G A;  4DND A;  4MLK A;  4JI5 T;  4EYY R;  3GMI A;  3ZEF B;  3A5X A;  3ZYK A;  4UXN B;  2VQF T;  4IDQ A;  3ZLI A;  4UF0 B;  3LK4 2;  4X1K E;  4AKH A;  5JVD E;  2X66 A;  2V7I A;  2Y48 B;  4OX9 T;  4Q25 A;  5L47 A;  3PV0 F;  3JAD A;  3NZP A;  5IWA T;  1UX4 A;  4QH5 A;  3BQL A;  2WM9 A;  4G63 A;  2W0G A;  4QKN A;  5FP3 A;  2YDR A;  2CXL A;  4HWH A;  3I9Y A;  1ZV4 X;  5FXW A;  2PFV A;  2LLY A;  4HTE A;  2QA7 A;  5F8P A;  3KIN B;  1DU2 A;  4XBF B;  4QXB B;  3PUS A;  3HKD E;  2WBL A;  3VR8 A;  1E7P A;  3A7M A;  1KFY A;  3UQ4 A;  5J0Z A;  3TLV A;  3UUM A;  3UU5 A;  1U5P A;  1CUN A;  3HA4 A;  4U7I A;  4OK0 A;  3JAF A;  1FMW A;  4QX8 B;  1UUR A;  2BKP A;  5LBM A;  5CA0 E;  3OYZ A;  1UX5 A;  5GON E;  4CN4 A;  2KT9 A;  4OYJ A;  3AAA B;  1U4Q A;  3AEG A;  2CA5 A;  5AQP B;  3EDU A;  2MYS A;  4HFI A;  1HX8 A;  2NTY A;  4NPP A;  4NUV A;  5AQO B;  2KXP B;  3ZCI A;  4IE6 A;  4AKL A;  4U72 A;  2KMF A;  4X65 T;  5ETW A;  4AQG A;  4CN1 A;  4DVD A;  4HFV A;  2D0T A;  2CM0 A;  3HL6 A;  4LF5 T;  2FBW A;  4UV8 B;  2L9Q A;  5CFB A;  2LKG A;  4JI4 T;  2XQ7 A;  2IML A;  3LFM A;  3N5L A;  4GOU A;  5CGM A;  5LYJ E;  4PFO A;  2WMO A;  4YLH A;  2UXN B;  3NWI A;  4DMV A;  3EVY A;  1IBL T;  1IAP A;  5HXH A;  4UVC B;  4HE8 A;  3PUW F;  2VWA A;  4ZI7 E;  4ZXL A;  4IE4 A;  4P09 A;  2A72 A;  5M4Y A;  3Q5X A;  4UF0 A;  4OFZ A;  3UQ7 A;  4KHP T;  3ZT6 A;  4E7S A;  2ZM0 A;  3JC6 C;  4PJL A;  2XSA A;  4EB6 E;  1MMA A;  3NZQ A;  4PW8 A;  3BK9 A;  1W09 A;  3TLS A;  3EDV A;  2M67 A;  4WBN E;  1YQ3 A;  2OV9 A;  4DR6 T;  4EZH A;  4FJO A;  3KDS E;  4GYS A;  3VRB A;  1KF6 A;  4Z90 A; 
#chains in the Genus database with same CATH homology
 5FVK A;  2LRL A;  4A5X A;  4WZX A;  3EAB A;  4U3C A;  2V6X A;  3ZT7 A;  4IT4 A;  4CN4 A;  3ZSS A;  2V6Y A;  4P1N A;  5CJ5 A;  2WWV A;  1WFD A;  2CPT A;  2CRB A;  4U2Z A;  4ZEY A;  2XZE A;  5CGM A;  5FVL A;  2JQK A;  1WR0 A;  4U2Y A;  4CN1 A;  3K1S A;  2W2U A;  1YXR A;  2MPK A;  2RPA A;  4U7I A;  4NIQ A;  1WCR A;  4U7Y A;  2V6Y B;  5LB7 B;  2LRK A;  2WY2 A;  3ZT6 A;  2A9U A;  4U31 A;  4CN6 A;  3ZT5 A;  4U33 A;  2DL1 A;  2K3W A;  3ZST A;  2JQ9 A;  2JQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...