2IC9A

The coiled-coil domain (residues 1-93) structure of the sin nombre virus nucleocapsid protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
74
structure length
74
Chain Sequence
MSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Coiled-coil Domain Structure of the Sin Nombre Virus Nucleocapsid Protein.
pubmed doi rcsb
source organism Sin nombre virus
molecule tags Viral protein
molecule keywords Nucleocapsid protein
total genus 35
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ic9A00
2IC9A 2K48A 2IC6A 2C5KT 4B6XA 3FXDB 3MXZA 3CKDA 1Z0PA 1LVFA 2KWHA 4J2CA 2X9YA 3TKLB 4DNDA 3QUJA 2G0UA 3FXEB 2CA5A 2KWIB 3QK6A 4FI5A 1QSDA 2X9XA 2XTLA 1H7CA 2C5JA 3S4UA 2MBGA 4CQIA 3N5LA 1ZKEA 1IJ6A 2C5IT 2X9WA 1IJ5A 3CVRA 4L0RA 1LRZA 4EYYR 3L3PA 3P7IA
chains in the Genus database with same CATH superfamily
2X66A 3IEEA 2VASA 4X5TA 5LGNB 4JV5T 1YKEB 3JC6D 4HFIA 4ADZA 2LSIA 3MZKB 2UXDT 2DWKA 2OA5A 2XQ9A 2BKPA 3HKCE 3I9WA 3MXZA 3C51A 1JNRA 3EDUA 2L9QA 3MJXA 4J2CA 5LHIB 2E2AA 3A5XA 5LMUT 2B1EA 4B3MT 3V5SA 3ZT7A 3Q5EA 4P0BA 5LHHB 4GK0E 4PK6A 4IT4A 4H9PC 1DU2A 5L47A 4DUZT 4WZXA 3AE5A 5J2TE 4IDOA 2DI4A 2CWOA 2H3RA 1WFDA 3J9X1 2XQ7A 5ABFB 4TWFA 1MMAA 1J5ET 3OYXA 3PUAA 4L5GA 2VWAA 4AKRB 5JDGA 3ZC0A 2FJDA 2GK9A 2XZEA 3DJBA 4WBOA 5DJQC 4AISA 3CVRA 2DCFA 2FJEA 3K8PC 2HPJA 3ZMZB 3PUSA 2UXBT 2XQ4A 1AJ3A 2KT9A 2CMRA 3OBVE 3RQWA 5HXSA 2KXPB 2QYWA 3ABVA 3N9QA 3O1IA 4OYJA 2LLYA 2VQFT 1WRDA 3CMLA 3KV4A 2LT3A 3Q5DA 2V7KA 4NUUA 1IAPA 4O2AE 4UV8B 1CHUA 5GONE 1WR0A 4BA9A 3RYHE 4JLEA 5JTGA 2NOXA 2X68A 3RIUC 5HWXA 4H9RC 1HNWT 2CHNA 1LKXA 3ZSSA 2CPTA 2E5VA 1QSDA 1FIOA 1UUSA 2PG8A 2XTLA 4P1NA 1SE7A 3S4UA 4KMCA 2W2UA 3WAJA 1M7KA 2E9XC 4EAHA 4K0KT 3AAIA 2BG9C 3C50A 3LK42 3MKDA 5FVLA 3N2OA 2VL8A 3NBXX 3LK2B 2MPKA 5LBMA 2W67A 4TN7B 2NTXA 2WU2A 3O4XE 4LMLA 5LG3A 4YJ2E 3J7Yq 3P7IA 3QNUA 4DMVA 1UX5A 2WWUA 2KNDA 3UFEA 4UEMA 3UU4A 4PAGA 2PFVA 1KEYA 4CXYA 3EABA 3PU3A 2Y6XA 3ZMSB 4LF5T 1M62A 3RLFF 2CXFA 3PUGA 1N32T 4JI7T 3AXJA 3AE2A 2VKHA 2WS3A 4PJJA 3TLVA 1N33T 3N9LA 4CXXA 3CX6B 4CN6A 3OTOT 4ZHQE 3CK6A 4NXMT 4U7IA 3UFGA 2WY2A 5HXRA 1HX8A 3PJAA 4TNWA 2K3WA 1UX4A 3SRZA 4WBNE 2A9UA 3CPZA 5JR9A 5CFBA 1ZHCA 3RX6A 1G8XA 2ES0A 4C90A 3ZEFB 2XM1A 2CLYC 3N5LA 3ZMTB 2WDVA 2BG9E 5JDQA 2ZM2A 4HKAA 2J1DG 3PE0A 5FY7A 4F6RC 3ZKRA 2I0MA 3AA6B 4ANJA 3N9OA 2N9DA 4U7YA 5AQGB 2N2NA 3UT5E 3DP7A 4YSYA 4DO0A 2UU9T 4KP3C 3ZYMA 3E22E 3OVUA 2BS4A 2EHOA 4OYKA 5FNVE 5HCMA 3RKOA 3VR9A 4Z90A 1EZ3A 4TZ4C 4ZZBA 4BJNA 2WZHA 3RPUA 5L4HA 1U4QA 3X1DA 2VB6A 5ABEA 4DR5T 4H9OC 2QA7A 2R6GF 5IUXA 2IW5B 1IBKT 5CA1E 4LF6T 2QRXA 2BG9A 2LHRA 4MLKA 2V26A 3PV0F 5EK4A 2XHEB 2JMKA 1XDOA 3C4WA 2NTYA 5FKYA 2IDOB 2EHOD 5AQHB 4YHJA 2UXXB 1HCIA 2JQHA 2Y8DA 2WSSV 5FL0A 3UU8A 4EOZB 5LHGB 4I55E 4AQYT 4B3RT 1LVKA 2BKOA 2CM0A 2KLQA 3KBTA 1HG5A 2VKJA 3P4QA 5HCJA 4IDQA 5J1GA 4YTPA 3ONJA 3PUZF 3AEEA 2YINA 4LMKA 4DMWA 5LG4A 4DV0T 2J4GA 3WI3A 4HFEA 2CCQA 4GYRA 1YQ4A 3AE7A 4A5XA 3ZCIA 3ZMVB 4YT0A 4B6XA 3AECA 5LOVE 2LOPA 3PUYF 2WDQA 2MTQA 1D1AA 4IE0A 3RIAA 1ZP0A 4ILAA 2ACZA 3B13A 5LJNA 5ETWA 3QB5K 5KXJA 1LVFA 3ZT5A 2WQYA 5FY0A 2VQET 2LSGA 4IE7A 3TKLB 4YXDA 4EYUA 4DV2T 1WR6A 2LHNA 4DR7T 1QLBA 2VKOA 2CA5A 2XQ8A 2ZMAA 5LXTE 2CRBA 4DR3T 2K5BB 4I0UA 4DV1T 2MAWA 4HGAA 1H7CA 4H9NC 4QH4A 2OV9A 5JRCA 4IDZA 3NRXA 3UULA 3TLWA 1XDPA 5L2LA 3P4WA 4AQFA 4V1Av 3FBLA 2V7IA 3K1SA 2XY8B 2A3DA 2FUPA 1UCUA 2JRKA 3BQKA 3GMIA 2KSRA 3P4SA 4ZI2C 4L0RA 4XZCA 2LRLA 3Q2MA 4JI2T 5HXEA 3P50A 3O9XA 4DIDB 2IHR1 3SWHA 3TLUA 2C5KT 2I6HA 3H37A 2B76A 3R84B 1MIWA 3CQCB 1NENA 1MMDA 1VOMA 5A1LA 2CEAA 3RRCA 3GA8A 1XMOT 1FJGT 5AQSB 1HNZT 4FJOA 1Z8UA 1G73A 5AQIB 2D2SA 5TAOA 3AE9A 2NW7A 3AE6A 4H9SE 4U72A 4AQFC 3JADA 5HXHA 4B3ST 4LF9T 5J2UE 4JUYA 3ESLA 3Q5WA 3FZMB 2CHOA 2Y48B 3AA1B 3C98B 2E9XB 3UUNA 4OFZA 2BG9B 4H9QC 4JBWF 2XAFB 4JI0T 3OYZA 3HA4A 5HEOA 2L8KA 3AA0B 2W00A 2X0LB 2W0GA 3B57A 3N2GE 1IJ5A 4ERRA 5C8YE 3KVAA 3K3QC 4QHOA 3HKEE 1N34T 4DUYT 5HWYA 4PJLA 1E7PA 4WNKA 3OPCA 2K48A 5DQVA 4MFRA 3RGLA 3VRAA 2AE9A 4ZI7E 3CX7B 2BBJA 3UU6A 2XQYA 1CUNA 4BJMA 5HEGA 4EB6E 2H89A 5JH7E 1BR2A 3HKDE 2V1DB 5F8PA 5FY1A 3NVOA 3I9YA 5L3FB 3PJAJ 3W15B 3AEFA 2VVNA 3AVRA 2LSKA 5JDNA 3PUXF 2YN6A 4YLHA 2XSAA 3L09A 2JQQA 2XAQB 2W63A 3LBXB 1X9BA 2CE7A 3PURA 2E5LT 3U78A 4NXNT 2D0TA 4U33A 4UR9A 4AKLA 4ZEYA 2JIWA 4LF7T 2LRKA 4PK5A 4DR1T 1FMWA 5LBQB 3QC9A 4MALA 3AEAA 4ZOLE 1HG2A 2UXNB 3FB2A 3JCFA 2KMFA 2QGSA 1HFAA 2FJBA 4O2BE 4A97A 3IA3A 3ZN1B 2WM9A 1FEWA 2BBHA 3EI0A 5AQJB 2BS3A 3AVSA 2K24A 3C64A 4QXBB 2WDRA 4WW0A 4X1KE 1Y64B 2DHRA 3AB3B 2SPCA 3E0ZA 1YW0A 4DVDA 2XAGB 2XAJB 4DV4T 4PNIA 5E0OA 2V5DA 5LJMA 1WLXA 2VKDA 1D1BA 3H3MA 3EAMA 5AQTB 4EXTA 3UU5A 2A2FX 3FBZA 5IWAT 4PFPA 3KV5A 4HE8A 5AQVB 1UK5A 1VRBA 4HFBA 5AQNB 2DLRA 3UQ4A 3SFEA 1NWMX 2D0UA 3PUVF 4DBRA 3MA9A 5AQFB 1UURA 4IDNA 3VRBA 3RKGA 4AIUA 5EK2A 1XMQT 3RC8A 4ISTA 4JYAT 4CXWA 5JR9B 4MBQA 4WYVA 3RYIE 3P4PA 2LSYA 2NW8A 2V8SV 2A72A 4JEUB 2VL0A 4DBQA 2V6XA 4DV7T 1HNXT 2YEVC 3CWZB 3DTOA 4DV3T 4CZZB 1OEDB 2DWGA 2XQAA 5L3GB 2UUAT 4JI5T 4LFAT 4IIJE 2LOSA 4ILCA 2ZLYA 4JI3T 3AAAB 4G63A 3A7MA 4YHHT 2Z6EA 5F5WA 4ZI3D 4O4JE 4YJ3E 1OWAA 5JREA 5EK3A 4LFCT 2BZBA 3PUWF 1L0VA 5HYAA 3CKDA 4QWNB 4AQGA 2UUBT 2XQ6A 1QUUA 4IL9A 5IHYA 3RC3A 5LNKA 4DNDA 4UF0A 4XBFB 3EHZA 2WWVA 3RQUA 3GN5B 2X9HA 4F8HA 2MOZA 3N9MA 1E1HB 1T7SA 3JAEA 4UXNB 5FYMA 1KNPA 1HF8A 2HN1A 2KWIB 3VKHA 3AEGA 4FI5A 1YKHB 3UUMA 2X67A 4U74A 5JVDE 3ZSTA 2X9XA 3EDVA 2F4VT 5JDFA 4P0AA 2HN2A 2YDRA 4HFDA 4EV6A 3ANWB 4TV9E 3LBXA 2WMOA 4CI2B 3NRYA 4EGWA 4E7ZA 1HTJF 3P4RA 4YFSA 5LGUB 3AXJB 2YU1A 1NEKA 4TUYE 2W4XA 4PW8A 3WAKA 5M4YA 3L8RA 2CXDA 1BR1A 4QH1A 4UV9B 1MNDA 4I50E 4IE6A 3RH3A 2LEHA 5F3JA 4HTEA 1MNEA 1D0YA 1WYCA 3FXDB 3O1HA 3IBPA 3M3ZB 4HFCA 3RYCE 3RIFA 4HEAA 4YSXA 4X66T 1BR0A 3ETUA 3VHLA 2N1GA 2KWHA 3AAEB 3CIRA 3QOFA 1N36T 2BVLA 5KX5E 2DNXA 4PK4A 2XQ5A 1WCRA 1YQ3A 4DV6T 1XNQT 3C4XA 4EEBA 2NP9A 4EEDA 1XNRT 2E9XA 2V7LA 4K0UA 3ZT6A 2IUBA 4HN9A 4Z8XA 2MBGA 4BAYB 5ABFA 4ZI3C 5ABGA 4O4IE 5FXZA 3R6NA 5LYJE 1GQEA 3ZJ2A 4U2ZA 4I4TE 3AE3A 4B3TT 2V7MA 2CBJA 1W0AA 2DL1A 4OHFA 4PJMA 3AEBA 1LRZA 1I94T 5LB7B 1FMVA 2RPAA 4UVCB 5JDLA 5AQMB 4HWCA 3TLTA 3OKQA 4H63H 1YXRA 4IDPA 2IAKA 4ZS3A 5HXCA 3UU3A 4GKKT 3KVBA 5JRCB 2XM2A 4GIWA 1KK7A 2KINB 3KV6A 1S94A 4QKNA 4X20E 4ZXLA 5FXVA 4COFA 2XUEA 4P09A 4M1PA 4ZS2A 5L3DB 3TLSA 2LJLA 3OJAA 2FBWA 3BQLA 2G0UA 2H88A 3B5MA 3QUJA 2AXDS 5FMNA 1MMGA 3ZLIA 5AFUL 3QK6A 5JDMA 3ANWA 4YY3T 3PTRB 2E9XD 2FJAA 2ODUA 3LSVA 4YTMA 2H7VC 5BR8T 2I59A 1T72A 1ZV4X 4KHZF 4QX8B 2LM9A 1ZKEA 4N78D 4U31A 3EVYA 4XAXB 2JQKA 5EZYE 4KBMB 4LF8T 3GN5A 5LGTB 4JI1T 2CXLA 3M65A 2WCAA 3LK3B 3JAFA 1BR4A 1IZNB 2WZIA 2LKGA 3NZPA 4EYYR 5L3BB 3ZC1A 4JI6T 4H63V 5FXWA 4HFVA 2D5UA 1E2AA 2D9DA 2EHOB 4CI1B 2ODVA 3VR8A 5L3CB 5CGMA 2BS2A 2V6YB 2XSBA 4JEHB 1D0ZA 3P8CD 1SUMB 5LMNT 4OX9T 3U3IA 3I0QA 4PJNA 5J0ZA 2BDEA 2RA1A 2YDQA 4HFHA 4IGUA 5AQQB 1W0BA 3A8YC 4ISSA 3AE8A 1KNRA 4E7SA 4C91A 4TWHA 2W66A 3F57A 1UGOA 1ZOYA 4U3CA 4KX6A 1W9RA 3QB5A 5AQRB 3ETVA 2X0HA 4L9IA 4IE4A 2NW9A 4YSZA 3HKBE 1V9DA 5JR9C 2KZ7B 1OEDE 1ZEEA 3F2EA 2M67A 3Q5XA 4GKJT 2H7OA 1IJ6A 1HX1B 2X0YA 3KBUA 2V5CA 2WP9A 4ILBA 3ZYKA 2E8IA 1SHZC 1OEDC 1Y01A 2LM2A 2PJQA 4I43B 3RIUA 5FL1A 3UUBA 3AE4A 4Q25A 3UUXB 4JI8T 2VVSA 3HI2A 2LKHA 2CBIA 3LFMA 3FZKB 4KUMB 4UF0B 4NIQA 2EHOC 3VKGA 1HS7A 3FZFB 4UVAB 2M6IA 4DR2T 4HWIB 2XASB 3I1AA 3T1YT 3BQIA 4NUVA 2X9YA 1O3XA 4QX7B 5HAXA 3UTKA 4ZZCA 1HR0T 2BKNA 1I6ZA 2ACXA 5LA6E 3FXEB 4KHPT 5DQWA 2UUCT 3RRWA 4AKGA 3E08A 2OLTA 5IYZE 4Z91A 2UXCT 3ZN0B 2C5JA 1OXZA 3T8OA 4CQIA 4JI4T 3F31A 4TNVA 3RHWA 3UQ7A 2VK9A 2IMLA 5ABHA 2C0SA 2IIUA 2WU5A 3AA7B 3N9PA 4HWDA 3SS1A 3ZPOA 3FZLB 2XAHB 2WMNA 2X9WA 1SA0E 2QVAA 5FP3A 2YDSA 3RYFE 4EZ4A 4X1YE 5JQGE 4LF4T 4G2AA 3KINB 3N2KE 2JQ9A 1MIYA 4CN1A 5HEJA 3L39A 4GK5E 4IL4A 3SFDA 1J5WA 3O1JA 5FVKA 5AQUB 2YKSA 4X62T 3NWIA 3H3AA 3KFWX 5ADXL 3AEDA 5C2TA 3K3OA 5H6RB 2WAUA 1IBMT 2JJ9A 2BVMA 3LG7A 3FZHB 4IE5A 4O8SA 4UELA 5JDHA 3N9NA 2V6YA 3IHRA 4NPPA 2NWBA 3KV9A 5KDMC 1R8IA 4TV8E 4X65T 2WBLA 4ZI2D 5AQPB 2JPFA 3FHNA 1MIVA 3ONLC 3RF1A 2Q9QD 4O4HE 1WYBA 4QXHB 2ZM0A 5AQOB 3GWHA 5C3JA 5HEUA 4QXCB 2LE8A 2YK0A 1KFYA 2J47A 2V7JA 3IF8B 2XPKA 3PU8A 3HR0A 4DR6T 2ZM6T 3ZCJA 4LMJA 2W61A 2YU2A 5FXXA 2Q9QC 2IC6A 1JNZA 1VCTA 1XZYA 4UIGA 2J62A 4HWHA 5CA0E 1D0XA 3HL6A 2HPLA 1Z0PA 3ZYLA 3SOLA 2L3LA 4AKIA 4ILUA 2HHHT 3LJCA 3V5UA 1J1JA 4KI0F 5LCYA 3G06A 2VURA 4U2YA 5L3EB 3CQGB 3K3NA 4GOUA 4A98A 4OK0A 4YTNA 5L4EA 4EZHA 2K9AA 3NKZA 1U5PA 1XWMA 3MK7C 2XJ7A 4TX5A 4HWFA 1B7TA 2PBIA 4AI6A 2WB5A 4ASKA 2CLYB 4IREA 5LP6E 4AXPA 4DV5T 3CX8B 3VU7H 3ZMUB 1KF6A 1OEDA 3EUHA 5CB4E 2W62A 2ZM8A 1KNZA 1MMNA 2PTFA 5BMVE 3CQXC 3PDYA 2Q9QB 2P9BA 1IBLT 4O4LE 1S35A 2IC9A 2RP4A 3NZQA 4IHJE 3BK9A 4CI3B 1T8BA 4EIWA 2CWYA 2X51A 3JC6C 4DR4T 3RI5A 3PUQA 4TWDA 1W09A 2M6BA 3T1HT 2NR4A 3I0OA 5AQKB 1VCSA 5DABA 5H6QB 4LFBT 2JMHA 3ONXA 1US7B 1YD8G 3Q9DA 3KDSE 4A56A 4PFOA 1D1CA 3MACA 3C4ZA 4GYSA 2YOEA 4X64T 3AE1A 5HEHA 5AQLB 4QH5A 2Q9QA 3D0TA 1NAFA 2C5IT 4UVBB 4CN4A 1X79A 4X1IE 2LSJA 5CJ5A 5KMGP 4AKHA 3ZJ1A 2XQ3A 3LDQB 2MYSA 3L3PA 4MHCA 1T98A 2HH7A
chains in the Genus database with same CATH topology
2X66A 3IEEA 2VASA 5LGNB 1YKEB 3JC6D 4ADZA 2LSIA 3MZKB 2DWKA 2OA5A 3I9WA 3HKCE 3MXZA 3C51A 3EDUA 2L9QA 3MJXA 4J2CA 5LHIB 3A5XA 2B1EA 3V5SA 4P0BA 5LHHB 4GK0E 4PK6A 4H9PC 5J2TE 2DI4A 2CWOA 2H3RA 3J9X1 1MMAA 3OYXA 3PUAA 4L5GA 2VWAA 4AKRB 5JDGA 3ZC0A 2GK9A 4WBOA 3DJBA 5DJQC 3CVRA 2DCFA 3K8PC 2HPJA 3ZMZB 3PUSA 1AJ3A 2KT9A 2CMRA 3OBVE 5HXSA 2KXPB 3N9QA 3O1IA 4OYJA 1WRDA 3CMLA 3KV4A 2LT3A 4NUUA 2V7KA 4O2AE 1IAPA 4UV8B 5GONE 4BA9A 3RYHE 4JLEA 2NOXA 2X68A 5HWXA 4H9RC 1LKXA 1QSDA 1FIOA 2PG8A 2XTLA 3S4UA 4KMCA 3WAJA 2E9XC 4EAHA 3AAIA 3C50A 3LK42 3MKDA 3N2OA 2VL8A 3NBXX 3LK2B 5LBMA 4TN7B 2NTXA 3O4XE 4YJ2E 3J7Yq 3P7IA 4DMVA 1UX5A 2WWUA 2KNDA 3UFEA 4UEMA 4PAGA 2PFVA 3PU3A 2Y6XA 3ZMSB 2CXFA 3PUGA 2VKHA 4PJJA 3N9LA 4CXXA 3CX6B 4ZHQE 5HXRA 1HX8A 3SRZA 1UX4A 4WBNE 3CPZA 5JR9A 1ZHCA 3RX6A 1G8XA 2ES0A 4C90A 3ZEFB 3N5LA 2CLYC 3ZMTB 5JDQA 2ZM2A 4HKAA 2J1DG 3PE0A 5FY7A 4F6RC 3AA6B 4ANJA 3N9OA 2N9DA 2N2NA 3UT5E 3DP7A 4DO0A 4KP3C 3ZYMA 3E22E 2EHOA 4OYKA 5FNVE 3RKOA 1EZ3A 4TZ4C 4BJNA 3RPUA 1U4QA 2VB6A 4H9OC 2QA7A 2IW5B 5CA1E 2LHRA 4MLKA 2V26A 5EK4A 2XHEB 2JMKA 3C4WA 3RC8A 2NTYA 3RC3A 5LGTB 2EHOD 4EOZB 4YHJA 1HCIA 2UXXB 2Y8DA 2WSSV 5LHGB 4I55E 1LVKA 3KBTA 2CM0A 2KLQA 5J1GA 1HG5A 2VKJA 3ZCIA 5LG4A 2YINA 4DMWA 3WI3A 2CCQA 4GYRA 3ZMVB 4B6XA 5LOVE 2LOPA 4IE0A 2MTQA 1D1AA 5LJNA 3B13A 5ETWA 1LVFA 5FY0A 2LSGA 4IE7A 3TKLB 4EYUA 1WR6A 2LHNA 2VKOA 2CA5A 2ZMAA 5LXTE 2K5BB 4HGAA 1H7CA 4H9NC 5JRCA 4IDZA 3NRXA 3UULA 4AQFA 4V1Av 3FBLA 2V7IA 3BQKA 2A3DA 1UCUA 2JRKA 3GMIA 4ZI2C 4L0RA 4XZCA 3Q2MA 3O9XA 3SWHA 2C5KT 3H37A 3R84B 1MIWA 3CQCB 5A1LA 1MMDA 1VOMA 2CEAA 3RRCA 3GA8A 4FJOA 1G73A 2D2SA 5TAOA 2NW7A 4AQFC 4H9SE 4U72A 5HXHA 5J2UE 4JUYA 3ESLA 3Q5WA 2Y48B 3AA1B 3C98B 2E9XB 3UUNA 4OFZA 4H9QC 2XAFB 3OYZA 3HA4A 2L8KA 3AA0B 2W00A 2X0LB 2W0GA 3B57A 3N2GE 1IJ5A 4ERRA 5C8YE 3KVAA 3K3QC 4QHOA 3HKEE 5HWYA 4PJLA 4WNKA 2K48A 5DQVA 4MFRA 4ZI7E 3CX7B 2XQYA 1CUNA 4BJMA 4EB6E 5JH7E 1BR2A 3HKDE 2V1DB 5F8PA 5FY1A 3I9YA 3W15B 3AVRA 5JDNA 2LSKA 4YLHA 3L09A 2JQQA 2XAQB 2W63A 3LBXB 3PURA 2CE7A 3U78A 2D0TA 4AKLA 4PK5A 1FMWA 5LBQB 3QC9A 4MALA 4ZOLE 1HG2A 3FB2A 2UXNB 2KMFA 2QGSA 1HFAA 4O2BE 5L3FB 3ZN1B 2WM9A 1FEWA 4DBRA 3AVSA 4WW0A 2K24A 3C64A 4QXBB 4X1KE 4CXYA 1Y64B 2DHRA 3AB3B 2SPCA 3E0ZA 1YW0A 4DVDA 2XAGB 2XAJB 4PNIA 5E0OA 5LJMA 1WLXA 2VKDA 1D1BA 4EXTA 2A2FX 3FBZA 4PFPA 3KV5A 4HE8A 1VRBA 2DLRA 1NWMX 2D0UA 3MA9A 5EK2A 4ISTA 4CXWA 5JR9B 4MBQA 3RYIE 4DBQA 2LSYA 2NW8A 4JEUB 2A72A 2YEVC 3CWZB 3DTOA 4CZZB 2DWGA 5L3GB 4IIJE 2LOSA 2ZLYA 3AAAB 4G63A 2Z6EA 4ZI3D 4O4JE 4YJ3E 1OWAA 5JREA 5EK3A 2BZBA 5HYAA 3CKDA 4QWNB 4AQGA 5IHYA 1QUUA 4XBFB 5LNKA 4DNDA 4UF0A 3GN5B 2X9HA 2MOZA 3N9MA 1E1HB 5FYMA 4UXNB 5JQGE 1HF8A 3VKHA 2KWIB 4FI5A 1YKHB 3UUMA 2X67A 4U74A 5JVDE 2X9XA 3EDVA 5JDFA 4P0AA 3ANWB 4TV9E 3LBXA 2WMOA 4CI2B 3NRYA 4E7ZA 1HTJF 4YFSA 5LGUB 2YU1A 4TUYE 4PW8A 3WAKA 5M4YA 4UV9B 2CXDA 1BR1A 1MNDA 4I50E 4IE6A 3RH3A 2LEHA 5F3JA 4HTEA 1MNEA 1D0YA 1WYCA 3FXDB 3O1HA 3IBPA 5L2LA 3RYCE 4HEAA 1BR0A 3ETUA 3VHLA 2N1GA 2KWHA 3AAEB 2BVLA 5KX5E 2DNXA 4PK4A 3C4XA 2NP9A 2E9XA 2V7LA 4K0UA 4HN9A 4Z8XA 2MBGA 4BAYB 4ZI3C 4O4IE 5FXZA 3R6NA 3ZJ2A 4I4TE 2V7MA 4OHFA 4PJMA 1LRZA 1FMVA 4UVCB 5JDLA 3OKQA 4H63H 5HXCA 2IAKA 4ZS3A 5JRCB 3KVBA 4GIWA 1KK7A 2KINB 3KV6A 1S94A 4QKNA 4X20E 5FXVA 2XUEA 4P09A 4M1PA 4ZS2A 5L3DB 4C91A 2LJLA 3OJAA 3QUJA 3BQLA 2G0UA 3ZLIA 5AFUL 5JDMA 5FMNA 1MMGA 3QK6A 3ANWA 3PTRB 2E9XD 2ODUA 2H7VC 1ZV4X 2I59A 4QX8B 2LM9A 1ZKEA 4N78D 4XAXB 3EVYA 5EZYE 5HXEA 4KBMB 3GN5A 2CXLA 3M65A 3LK3B 3NZPA 1BR4A 1IZNB 5L3BB 4EYYR 3ZC1A 4H63V 5FXWA 4HFVA 2D5UA 2EHOB 4CI1B 2ODVA 5L3CB 4JEHB 1D0ZA 3P8CD 3U3IA 3I0QA 4PJNA 2BDEA 2RA1A 4E7SA 4ZI2D 4IGUA 4ISSA 3F57A 2NW9A 3ETVA 4L9IA 4IE4A 5JR9C 3HKBE 1V9DA 2KZ7B 3F2EA 1ZEEA 3Q5XA 2M67A 2H7OA 1IJ6A 3KBUA 3ZYKA 5LYJE 2E8IA 1SHZC 4I43B 2PJQA 3UUXB 3HI2A 4UF0B 3LFMA 4KUMB 2EHOC 3VKGA 1HS7A 4UVAB 2XASB 3I1AA 3BQIA 4NUVA 2X9YA 1O3XA 4QX7B 5HAXA 3UTKA 2ACXA 5LA6E 3FXEB 5DQWA 3RRWA 3E08A 5IYZE 3ZN0B 2C5JA 1OXZA 3T8OA 4CQIA 3F31A 2VK9A 2C0SA 3AA7B 3N9PA 3SS1A 3ZPOA 2XAHB 2WMNA 2X9WA 1SA0E 5FP3A 3RYFE 4EZ4A 4X1YE 4G2AA 3KINB 3N2KE 1MIYA 4GK5E 3O1JA 3H3AA 3KFWX 5ADXL 3K3OA 5H6RB 2WAUA 2JJ9A 2BVMA 3LG7A 4IE5A 4O8SA 4UELA 5JDHA 5KDMC 3N9NA 3IHRA 2NWBA 3KV9A 4TV8E 2WBLA 2JPFA 3FHNA 1MIVA 2Q9QD 4O4HE 1WYBA 4QXHB 2ZM0A 3GWHA 4QXCB 2LE8A 2YK0A 2V7JA 3IF8B 3PU8A 3HR0A 3ZCJA 2W61A 2YU2A 5FXXA 2Q9QC 2IC6A 4UIGA 5CA0E 1D0XA 3HL6A 2HPLA 1Z0PA 3ZYLA 3SOLA 2L3LA 4AKIA 4ILUA 3LJCA 3V5UA 5LCYA 5L3EB 3CQGB 3K3NA 4GOUA 4OK0A 4EZHA 2K9AA 1U5PA 4TX5A 3MK7C 4AI6A 1B7TA 2PBIA 4ASKA 2CLYB 5LP6E 4AXPA 3CX8B 3VU7H 3ZMUB 1KNZA 3EUHA 5CB4E 4AKGA 2W62A 2ZM8A 1MMNA 5BMVE 3CQXC 3PDYA 2Q9QB 2P9BA 4O4LE 1S35A 2IC9A 2RP4A 3NZQA 4IHJE 3BK9A 4CI3B 4EIWA 2CWYA 2X51A 3JC6C 3PUQA 3I0OA 5DABA 5H6QB 2JMHA 3ONXA 1US7B 1YD8G 3Q9DA 3KDSE 4A56A 4PFOA 1D1CA 3MACA 3C4ZA 4GYSA 4UVBB 2Q9QA 3D0TA 1NAFA 2C5IT 5KMGP 1X79A 4X1IE 2LSJA 4AKHA 3ZJ1A 2MYSA 3L3PA 4MHCA 1T98A 2HH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IC9 A;  2K48 A;  2IC6 A;  2C5K T;  4B6X A;  3FXD B;  3MXZ A;  3CKD A;  1Z0P A;  1LVF A;  2KWH A;  4J2C A;  2X9Y A;  3TKL B;  4DND A;  3QUJ A;  2G0U A;  3FXE B;  2CA5 A;  2KWI B;  3QK6 A;  4FI5 A;  1QSD A;  2X9X A;  2XTL A;  1H7C A;  2C5J A;  3S4U A;  2MBG A;  4CQI A;  3N5L A;  1ZKE A;  1IJ6 A;  2C5I T;  2X9W A;  1IJ5 A;  3CVR A;  4L0R A;  1LRZ A;  4EYY R;  3L3P A;  3P7I A; 
#chains in the Genus database with same CATH topology
 2X66 A;  3IEE A;  2VAS A;  4X5T A;  5LGN B;  4JV5 T;  1YKE B;  3JC6 D;  4HFI A;  4ADZ A;  2LSI A;  3MZK B;  2UXD T;  2DWK A;  2OA5 A;  2XQ9 A;  2BKP A;  3HKC E;  3I9W A;  3MXZ A;  3C51 A;  1JNR A;  3EDU A;  2L9Q A;  3MJX A;  4J2C A;  5LHI B;  2E2A A;  3A5X A;  5LMU T;  2B1E A;  4B3M T;  3V5S A;  3ZT7 A;  3Q5E A;  4P0B A;  5LHH B;  4GK0 E;  4PK6 A;  4IT4 A;  4H9P C;  1DU2 A;  5L47 A;  4DUZ T;  4WZX A;  3AE5 A;  5J2T E;  4IDO A;  2DI4 A;  2CWO A;  2H3R A;  1WFD A;  3J9X 1;  2XQ7 A;  5ABF B;  4TWF A;  1MMA A;  1J5E T;  3OYX A;  3PUA A;  4L5G A;  2VWA A;  4AKR B;  5JDG A;  3ZC0 A;  2FJD A;  2GK9 A;  2XZE A;  3DJB A;  4WBO A;  5DJQ C;  4AIS A;  3CVR A;  2DCF A;  2FJE A;  3K8P C;  2HPJ A;  3ZMZ B;  3PUS A;  2UXB T;  2XQ4 A;  1AJ3 A;  2KT9 A;  2CMR A;  3OBV E;  3RQW A;  5HXS A;  2KXP B;  2QYW A;  3ABV A;  3N9Q A;  3O1I A;  4OYJ A;  2LLY A;  2VQF T;  1WRD A;  3CML A;  3KV4 A;  2LT3 A;  3Q5D A;  2V7K A;  4NUU A;  1IAP A;  4O2A E;  4UV8 B;  1CHU A;  5GON E;  1WR0 A;  4BA9 A;  3RYH E;  4JLE A;  5JTG A;  2NOX A;  2X68 A;  3RIU C;  5HWX A;  4H9R C;  1HNW T;  2CHN A;  1LKX A;  3ZSS A;  2CPT A;  2E5V A;  1QSD A;  1FIO A;  1UUS A;  2PG8 A;  2XTL A;  4P1N A;  1SE7 A;  3S4U A;  4KMC A;  2W2U A;  3WAJ A;  1M7K A;  2E9X C;  4EAH A;  4K0K T;  3AAI A;  2BG9 C;  3C50 A;  3LK4 2;  3MKD A;  5FVL A;  3N2O A;  2VL8 A;  3NBX X;  3LK2 B;  2MPK A;  5LBM A;  2W67 A;  4TN7 B;  2NTX A;  2WU2 A;  3O4X E;  4LML A;  5LG3 A;  4YJ2 E;  3J7Y q;  3P7I A;  3QNU A;  4DMV A;  1UX5 A;  2WWU A;  2KND A;  3UFE A;  4UEM A;  3UU4 A;  4PAG A;  2PFV A;  1KEY A;  4CXY A;  3EAB A;  3PU3 A;  2Y6X A;  3ZMS B;  4LF5 T;  1M62 A;  3RLF F;  2CXF A;  3PUG A;  1N32 T;  4JI7 T;  3AXJ A;  3AE2 A;  2VKH A;  2WS3 A;  4PJJ A;  3TLV A;  1N33 T;  3N9L A;  4CXX A;  3CX6 B;  4CN6 A;  3OTO T;  4ZHQ E;  3CK6 A;  4NXM T;  4U7I A;  3UFG A;  2WY2 A;  5HXR A;  1HX8 A;  3PJA A;  4TNW A;  2K3W A;  1UX4 A;  3SRZ A;  4WBN E;  2A9U A;  3CPZ A;  5JR9 A;  5CFB A;  1ZHC A;  3RX6 A;  1G8X A;  2ES0 A;  4C90 A;  3ZEF B;  2XM1 A;  2CLY C;  3N5L A;  3ZMT B;  2WDV A;  2BG9 E;  5JDQ A;  2ZM2 A;  4HKA A;  2J1D G;  3PE0 A;  5FY7 A;  4F6R C;  3ZKR A;  2I0M A;  3AA6 B;  4ANJ A;  3N9O A;  2N9D A;  4U7Y A;  5AQG B;  2N2N A;  3UT5 E;  3DP7 A;  4YSY A;  4DO0 A;  2UU9 T;  4KP3 C;  3ZYM A;  3E22 E;  3OVU A;  2BS4 A;  2EHO A;  4OYK A;  5FNV E;  5HCM A;  3RKO A;  3VR9 A;  4Z90 A;  1EZ3 A;  4TZ4 C;  4ZZB A;  4BJN A;  2WZH A;  3RPU A;  5L4H A;  1U4Q A;  3X1D A;  2VB6 A;  5ABE A;  4DR5 T;  4H9O C;  2QA7 A;  2R6G F;  5IUX A;  2IW5 B;  1IBK T;  5CA1 E;  4LF6 T;  2QRX A;  2BG9 A;  2LHR A;  4MLK A;  2V26 A;  3PV0 F;  5EK4 A;  2XHE B;  2JMK A;  1XDO A;  3C4W A;  2NTY A;  5FKY A;  2IDO B;  2EHO D;  5AQH B;  4YHJ A;  2UXX B;  1HCI A;  2JQH A;  2Y8D A;  2WSS V;  5FL0 A;  3UU8 A;  4EOZ B;  5LHG B;  4I55 E;  4AQY T;  4B3R T;  1LVK A;  2BKO A;  2CM0 A;  2KLQ A;  3KBT A;  1HG5 A;  2VKJ A;  3P4Q A;  5HCJ A;  4IDQ A;  5J1G A;  4YTP A;  3ONJ A;  3PUZ F;  3AEE A;  2YIN A;  4LMK A;  4DMW A;  5LG4 A;  4DV0 T;  2J4G A;  3WI3 A;  4HFE A;  2CCQ A;  4GYR A;  1YQ4 A;  3AE7 A;  4A5X A;  3ZCI A;  3ZMV B;  4YT0 A;  4B6X A;  3AEC A;  5LOV E;  2LOP A;  3PUY F;  2WDQ A;  2MTQ A;  1D1A A;  4IE0 A;  3RIA A;  1ZP0 A;  4ILA A;  2ACZ A;  3B13 A;  5LJN A;  5ETW A;  3QB5 K;  5KXJ A;  1LVF A;  3ZT5 A;  2WQY A;  5FY0 A;  2VQE T;  2LSG A;  4IE7 A;  3TKL B;  4YXD A;  4EYU A;  4DV2 T;  1WR6 A;  2LHN A;  4DR7 T;  1QLB A;  2VKO A;  2CA5 A;  2XQ8 A;  2ZMA A;  5LXT E;  2CRB A;  4DR3 T;  2K5B B;  4I0U A;  4DV1 T;  2MAW A;  4HGA A;  1H7C A;  4H9N C;  4QH4 A;  2OV9 A;  5JRC A;  4IDZ A;  3NRX A;  3UUL A;  3TLW A;  1XDP A;  5L2L A;  3P4W A;  4AQF A;  4V1A v;  3FBL A;  2V7I A;  3K1S A;  2XY8 B;  2A3D A;  2FUP A;  1UCU A;  2JRK A;  3BQK A;  3GMI A;  2KSR A;  3P4S A;  4ZI2 C;  4L0R A;  4XZC A;  2LRL A;  3Q2M A;  4JI2 T;  5HXE A;  3P50 A;  3O9X A;  4DID B;  2IHR 1;  3SWH A;  3TLU A;  2C5K T;  2I6H A;  3H37 A;  2B76 A;  3R84 B;  1MIW A;  3CQC B;  1NEN A;  1MMD A;  1VOM A;  5A1L A;  2CEA A;  3RRC A;  3GA8 A;  1XMO T;  1FJG T;  5AQS B;  1HNZ T;  4FJO A;  1Z8U A;  1G73 A;  5AQI B;  2D2S A;  5TAO A;  3AE9 A;  2NW7 A;  3AE6 A;  4H9S E;  4U72 A;  4AQF C;  3JAD A;  5HXH A;  4B3S T;  4LF9 T;  5J2U E;  4JUY A;  3ESL A;  3Q5W A;  3FZM B;  2CHO A;  2Y48 B;  3AA1 B;  3C98 B;  2E9X B;  3UUN A;  4OFZ A;  2BG9 B;  4H9Q C;  4JBW F;  2XAF B;  4JI0 T;  3OYZ A;  3HA4 A;  5HEO A;  2L8K A;  3AA0 B;  2W00 A;  2X0L B;  2W0G A;  3B57 A;  3N2G E;  1IJ5 A;  4ERR A;  5C8Y E;  3KVA A;  3K3Q C;  4QHO A;  3HKE E;  1N34 T;  4DUY T;  5HWY A;  4PJL A;  1E7P A;  4WNK A;  3OPC A;  2K48 A;  5DQV A;  4MFR A;  3RGL A;  3VRA A;  2AE9 A;  4ZI7 E;  3CX7 B;  2BBJ A;  3UU6 A;  2XQY A;  1CUN A;  4BJM A;  5HEG A;  4EB6 E;  2H89 A;  5JH7 E;  1BR2 A;  3HKD E;  2V1D B;  5F8P A;  5FY1 A;  3NVO A;  3I9Y A;  5L3F B;  3PJA J;  3W15 B;  3AEF A;  2VVN A;  3AVR A;  2LSK A;  5JDN A;  3PUX F;  2YN6 A;  4YLH A;  2XSA A;  3L09 A;  2JQQ A;  2XAQ B;  2W63 A;  3LBX B;  1X9B A;  2CE7 A;  3PUR A;  2E5L T;  3U78 A;  4NXN T;  2D0T A;  4U33 A;  4UR9 A;  4AKL A;  4ZEY A;  2JIW A;  4LF7 T;  2LRK A;  4PK5 A;  4DR1 T;  1FMW A;  5LBQ B;  3QC9 A;  4MAL A;  3AEA A;  4ZOL E;  1HG2 A;  2UXN B;  3FB2 A;  3JCF A;  2KMF A;  2QGS A;  1HFA A;  2FJB A;  4O2B E;  4A97 A;  3IA3 A;  3ZN1 B;  2WM9 A;  1FEW A;  2BBH A;  3EI0 A;  5AQJ B;  2BS3 A;  3AVS A;  2K24 A;  3C64 A;  4QXB B;  2WDR A;  4WW0 A;  4X1K E;  1Y64 B;  2DHR A;  3AB3 B;  2SPC A;  3E0Z A;  1YW0 A;  4DVD A;  2XAG B;  2XAJ B;  4DV4 T;  4PNI A;  5E0O A;  2V5D A;  5LJM A;  1WLX A;  2VKD A;  1D1B A;  3H3M A;  3EAM A;  5AQT B;  4EXT A;  3UU5 A;  2A2F X;  3FBZ A;  5IWA T;  4PFP A;  3KV5 A;  4HE8 A;  5AQV B;  1UK5 A;  1VRB A;  4HFB A;  5AQN B;  2DLR A;  3UQ4 A;  3SFE A;  1NWM X;  2D0U A;  3PUV F;  4DBR A;  3MA9 A;  5AQF B;  1UUR A;  4IDN A;  3VRB A;  3RKG A;  4AIU A;  5EK2 A;  1XMQ T;  3RC8 A;  4IST A;  4JYA T;  4CXW A;  5JR9 B;  4MBQ A;  4WYV A;  3RYI E;  3P4P A;  2LSY A;  2NW8 A;  2V8S V;  2A72 A;  4JEU B;  2VL0 A;  4DBQ A;  2V6X A;  4DV7 T;  1HNX T;  2YEV C;  3CWZ B;  3DTO A;  4DV3 T;  4CZZ B;  1OED B;  2DWG A;  2XQA A;  5L3G B;  2UUA T;  4JI5 T;  4LFA T;  4IIJ E;  2LOS A;  4ILC A;  2ZLY A;  4JI3 T;  3AAA B;  4G63 A;  3A7M A;  4YHH T;  2Z6E A;  5F5W A;  4ZI3 D;  4O4J E;  4YJ3 E;  1OWA A;  5JRE A;  5EK3 A;  4LFC T;  2BZB A;  3PUW F;  1L0V A;  5HYA A;  3CKD A;  4QWN B;  4AQG A;  2UUB T;  2XQ6 A;  1QUU A;  4IL9 A;  5IHY A;  3RC3 A;  5LNK A;  4DND A;  4UF0 A;  4XBF B;  3EHZ A;  2WWV A;  3RQU A;  3GN5 B;  2X9H A;  4F8H A;  2MOZ A;  3N9M A;  1E1H B;  1T7S A;  3JAE A;  4UXN B;  5FYM A;  1KNP A;  1HF8 A;  2HN1 A;  2KWI B;  3VKH A;  3AEG A;  4FI5 A;  1YKH B;  3UUM A;  2X67 A;  4U74 A;  5JVD E;  3ZST A;  2X9X A;  3EDV A;  2F4V T;  5JDF A;  4P0A A;  2HN2 A;  2YDR A;  4HFD A;  4EV6 A;  3ANW B;  4TV9 E;  3LBX A;  2WMO A;  4CI2 B;  3NRY A;  4EGW A;  4E7Z A;  1HTJ F;  3P4R A;  4YFS A;  5LGU B;  3AXJ B;  2YU1 A;  1NEK A;  4TUY E;  2W4X A;  4PW8 A;  3WAK A;  5M4Y A;  3L8R A;  2CXD A;  1BR1 A;  4QH1 A;  4UV9 B;  1MND A;  4I50 E;  4IE6 A;  3RH3 A;  2LEH A;  5F3J A;  4HTE A;  1MNE A;  1D0Y A;  1WYC A;  3FXD B;  3O1H A;  3IBP A;  3M3Z B;  4HFC A;  3RYC E;  3RIF A;  4HEA A;  4YSX A;  4X66 T;  1BR0 A;  3ETU A;  3VHL A;  2N1G A;  2KWH A;  3AAE B;  3CIR A;  3QOF A;  1N36 T;  2BVL A;  5KX5 E;  2DNX A;  4PK4 A;  2XQ5 A;  1WCR A;  1YQ3 A;  4DV6 T;  1XNQ T;  3C4X A;  4EEB A;  2NP9 A;  4EED A;  1XNR T;  2E9X A;  2V7L A;  4K0U A;  3ZT6 A;  2IUB A;  4HN9 A;  4Z8X A;  2MBG A;  4BAY B;  5ABF A;  4ZI3 C;  5ABG A;  4O4I E;  5FXZ A;  3R6N A;  5LYJ E;  1GQE A;  3ZJ2 A;  4U2Z A;  4I4T E;  3AE3 A;  4B3T T;  2V7M A;  2CBJ A;  1W0A A;  2DL1 A;  4OHF A;  4PJM A;  3AEB A;  1LRZ A;  1I94 T;  5LB7 B;  1FMV A;  2RPA A;  4UVC B;  5JDL A;  5AQM B;  4HWC A;  3TLT A;  3OKQ A;  4H63 H;  1YXR A;  4IDP A;  2IAK A;  4ZS3 A;  5HXC A;  3UU3 A;  4GKK T;  3KVB A;  5JRC B;  2XM2 A;  4GIW A;  1KK7 A;  2KIN B;  3KV6 A;  1S94 A;  4QKN A;  4X20 E;  4ZXL A;  5FXV A;  4COF A;  2XUE A;  4P09 A;  4M1P A;  4ZS2 A;  5L3D B;  3TLS A;  2LJL A;  3OJA A;  2FBW A;  3BQL A;  2G0U A;  2H88 A;  3B5M A;  3QUJ A;  2AXD S;  5FMN A;  1MMG A;  3ZLI A;  5AFU L;  3QK6 A;  5JDM A;  3ANW A;  4YY3 T;  3PTR B;  2E9X D;  2FJA A;  2ODU A;  3LSV A;  4YTM A;  2H7V C;  5BR8 T;  2I59 A;  1T72 A;  1ZV4 X;  4KHZ F;  4QX8 B;  2LM9 A;  1ZKE A;  4N78 D;  4U31 A;  3EVY A;  4XAX B;  2JQK A;  5EZY E;  4KBM B;  4LF8 T;  3GN5 A;  5LGT B;  4JI1 T;  2CXL A;  3M65 A;  2WCA A;  3LK3 B;  3JAF A;  1BR4 A;  1IZN B;  2WZI A;  2LKG A;  3NZP A;  4EYY R;  5L3B B;  3ZC1 A;  4JI6 T;  4H63 V;  5FXW A;  4HFV A;  2D5U A;  1E2A A;  2D9D A;  2EHO B;  4CI1 B;  2ODV A;  3VR8 A;  5L3C B;  5CGM A;  2BS2 A;  2V6Y B;  2XSB A;  4JEH B;  1D0Z A;  3P8C D;  1SUM B;  5LMN T;  4OX9 T;  3U3I A;  3I0Q A;  4PJN A;  5J0Z A;  2BDE A;  2RA1 A;  2YDQ A;  4HFH A;  4IGU A;  5AQQ B;  1W0B A;  3A8Y C;  4ISS A;  3AE8 A;  1KNR A;  4E7S A;  4C91 A;  4TWH A;  2W66 A;  3F57 A;  1UGO A;  1ZOY A;  4U3C A;  4KX6 A;  1W9R A;  3QB5 A;  5AQR B;  3ETV A;  2X0H A;  4L9I A;  4IE4 A;  2NW9 A;  4YSZ A;  3HKB E;  1V9D A;  5JR9 C;  2KZ7 B;  1OED E;  1ZEE A;  3F2E A;  2M67 A;  3Q5X A;  4GKJ T;  2H7O A;  1IJ6 A;  1HX1 B;  2X0Y A;  3KBU A;  2V5C A;  2WP9 A;  4ILB A;  3ZYK A;  2E8I A;  1SHZ C;  1OED C;  1Y01 A;  2LM2 A;  2PJQ A;  4I43 B;  3RIU A;  5FL1 A;  3UUB A;  3AE4 A;  4Q25 A;  3UUX B;  4JI8 T;  2VVS A;  3HI2 A;  2LKH A;  2CBI A;  3LFM A;  3FZK B;  4KUM B;  4UF0 B;  4NIQ A;  2EHO C;  3VKG A;  1HS7 A;  3FZF B;  4UVA B;  2M6I A;  4DR2 T;  4HWI B;  2XAS B;  3I1A A;  3T1Y T;  3BQI A;  4NUV A;  2X9Y A;  1O3X A;  4QX7 B;  5HAX A;  3UTK A;  4ZZC A;  1HR0 T;  2BKN A;  1I6Z A;  2ACX A;  5LA6 E;  3FXE B;  4KHP T;  5DQW A;  2UUC T;  3RRW A;  4AKG A;  3E08 A;  2OLT A;  5IYZ E;  4Z91 A;  2UXC T;  3ZN0 B;  2C5J A;  1OXZ A;  3T8O A;  4CQI A;  4JI4 T;  3F31 A;  4TNV A;  3RHW A;  3UQ7 A;  2VK9 A;  2IML A;  5ABH A;  2C0S A;  2IIU A;  2WU5 A;  3AA7 B;  3N9P A;  4HWD A;  3SS1 A;  3ZPO A;  3FZL B;  2XAH B;  2WMN A;  2X9W A;  1SA0 E;  2QVA A;  5FP3 A;  2YDS A;  3RYF E;  4EZ4 A;  4X1Y E;  5JQG E;  4LF4 T;  4G2A A;  3KIN B;  3N2K E;  2JQ9 A;  1MIY A;  4CN1 A;  5HEJ A;  3L39 A;  4GK5 E;  4IL4 A;  3SFD A;  1J5W A;  3O1J A;  5FVK A;  5AQU B;  2YKS A;  4X62 T;  3NWI A;  3H3A A;  3KFW X;  5ADX L;  3AED A;  5C2T A;  3K3O A;  5H6R B;  2WAU A;  1IBM T;  2JJ9 A;  2BVM A;  3LG7 A;  3FZH B;  4IE5 A;  4O8S A;  4UEL A;  5JDH A;  3N9N A;  2V6Y A;  3IHR A;  4NPP A;  2NWB A;  3KV9 A;  5KDM C;  1R8I A;  4TV8 E;  4X65 T;  2WBL A;  4ZI2 D;  5AQP B;  2JPF A;  3FHN A;  1MIV A;  3ONL C;  3RF1 A;  2Q9Q D;  4O4H E;  1WYB A;  4QXH B;  2ZM0 A;  5AQO B;  3GWH A;  5C3J A;  5HEU A;  4QXC B;  2LE8 A;  2YK0 A;  1KFY A;  2J47 A;  2V7J A;  3IF8 B;  2XPK A;  3PU8 A;  3HR0 A;  4DR6 T;  2ZM6 T;  3ZCJ A;  4LMJ A;  2W61 A;  2YU2 A;  5FXX A;  2Q9Q C;  2IC6 A;  1JNZ A;  1VCT A;  1XZY A;  4UIG A;  2J62 A;  4HWH A;  5CA0 E;  1D0X A;  3HL6 A;  2HPL A;  1Z0P A;  3ZYL A;  3SOL A;  2L3L A;  4AKI A;  4ILU A;  2HHH T;  3LJC A;  3V5U A;  1J1J A;  4KI0 F;  5LCY A;  3G06 A;  2VUR A;  4U2Y A;  5L3E B;  3CQG B;  3K3N A;  4GOU A;  4A98 A;  4OK0 A;  4YTN A;  5L4E A;  4EZH A;  2K9A A;  3NKZ A;  1U5P A;  1XWM A;  3MK7 C;  2XJ7 A;  4TX5 A;  4HWF A;  1B7T A;  2PBI A;  4AI6 A;  2WB5 A;  4ASK A;  2CLY B;  4IRE A;  5LP6 E;  4AXP A;  4DV5 T;  3CX8 B;  3VU7 H;  3ZMU B;  1KF6 A;  1OED A;  3EUH A;  5CB4 E;  2W62 A;  2ZM8 A;  1KNZ A;  1MMN A;  2PTF A;  5BMV E;  3CQX C;  3PDY A;  2Q9Q B;  2P9B A;  1IBL T;  4O4L E;  1S35 A;  2IC9 A;  2RP4 A;  3NZQ A;  4IHJ E;  3BK9 A;  4CI3 B;  1T8B A;  4EIW A;  2CWY A;  2X51 A;  3JC6 C;  4DR4 T;  3RI5 A;  3PUQ A;  4TWD A;  1W09 A;  2M6B A;  3T1H T;  2NR4 A;  3I0O A;  5AQK B;  1VCS A;  5DAB A;  5H6Q B;  4LFB T;  2JMH A;  3ONX A;  1US7 B;  1YD8 G;  3Q9D A;  3KDS E;  4A56 A;  4PFO A;  1D1C A;  3MAC A;  3C4Z A;  4GYS A;  2YOE A;  4X64 T;  3AE1 A;  5HEH A;  5AQL B;  4QH5 A;  2Q9Q A;  3D0T A;  1NAF A;  2C5I T;  4UVB B;  4CN4 A;  1X79 A;  4X1I E;  2LSJ A;  5CJ5 A;  5KMG P;  4AKH A;  3ZJ1 A;  2XQ3 A;  3LDQ B;  2MYS A;  3L3P A;  4MHC A;  1T98 A;  2HH7 A; 
#chains in the Genus database with same CATH homology
 2X66 A;  3IEE A;  2VAS A;  5LGN B;  1YKE B;  3JC6 D;  4ADZ A;  2LSI A;  3MZK B;  2DWK A;  2OA5 A;  3I9W A;  3HKC E;  3MXZ A;  3C51 A;  3EDU A;  2L9Q A;  3MJX A;  4J2C A;  5LHI B;  3A5X A;  2B1E A;  3V5S A;  4P0B A;  5LHH B;  4GK0 E;  4PK6 A;  4H9P C;  5J2T E;  2DI4 A;  2CWO A;  2H3R A;  3J9X 1;  1MMA A;  3OYX A;  3PUA A;  4L5G A;  2VWA A;  4AKR B;  5JDG A;  3ZC0 A;  2GK9 A;  4WBO A;  3DJB A;  5DJQ C;  3CVR A;  2DCF A;  3K8P C;  2HPJ A;  3ZMZ B;  3PUS A;  1AJ3 A;  2KT9 A;  2CMR A;  3OBV E;  5HXS A;  2KXP B;  3N9Q A;  3O1I A;  4OYJ A;  1WRD A;  3CML A;  3KV4 A;  2LT3 A;  4NUU A;  2V7K A;  4O2A E;  1IAP A;  4UV8 B;  5GON E;  4BA9 A;  3RYH E;  4JLE A;  2NOX A;  2X68 A;  5HWX A;  4H9R C;  1LKX A;  1QSD A;  1FIO A;  2PG8 A;  2XTL A;  3S4U A;  4KMC A;  3WAJ A;  2E9X C;  4EAH A;  3AAI A;  3C50 A;  3LK4 2;  3MKD A;  3N2O A;  2VL8 A;  3NBX X;  3LK2 B;  5LBM A;  4TN7 B;  2NTX A;  3O4X E;  4YJ2 E;  3J7Y q;  3P7I A;  4DMV A;  1UX5 A;  2WWU A;  2KND A;  3UFE A;  4UEM A;  4PAG A;  2PFV A;  3PU3 A;  2Y6X A;  3ZMS B;  2CXF A;  3PUG A;  2VKH A;  4PJJ A;  3N9L A;  4CXX A;  3CX6 B;  4ZHQ E;  5HXR A;  1HX8 A;  3SRZ A;  1UX4 A;  4WBN E;  3CPZ A;  5JR9 A;  1ZHC A;  3RX6 A;  1G8X A;  2ES0 A;  4C90 A;  3ZEF B;  3N5L A;  2CLY C;  3ZMT B;  5JDQ A;  2ZM2 A;  4HKA A;  2J1D G;  3PE0 A;  5FY7 A;  4F6R C;  3AA6 B;  4ANJ A;  3N9O A;  2N9D A;  2N2N A;  3UT5 E;  3DP7 A;  4DO0 A;  4KP3 C;  3ZYM A;  3E22 E;  2EHO A;  4OYK A;  5FNV E;  3RKO A;  1EZ3 A;  4TZ4 C;  4BJN A;  3RPU A;  1U4Q A;  2VB6 A;  4H9O C;  2QA7 A;  2IW5 B;  5CA1 E;  2LHR A;  4MLK A;  2V26 A;  5EK4 A;  2XHE B;  2JMK A;  3C4W A;  3RC8 A;  2NTY A;  3RC3 A;  5LGT B;  2EHO D;  4EOZ B;  4YHJ A;  1HCI A;  2UXX B;  2Y8D A;  2WSS V;  5LHG B;  4I55 E;  1LVK A;  3KBT A;  2CM0 A;  2KLQ A;  5J1G A;  1HG5 A;  2VKJ A;  3ZCI A;  5LG4 A;  2YIN A;  4DMW A;  3WI3 A;  2CCQ A;  4GYR A;  3ZMV B;  4B6X A;  5LOV E;  2LOP A;  4IE0 A;  2MTQ A;  1D1A A;  5LJN A;  3B13 A;  5ETW A;  1LVF A;  5FY0 A;  2LSG A;  4IE7 A;  3TKL B;  4EYU A;  1WR6 A;  2LHN A;  2VKO A;  2CA5 A;  2ZMA A;  5LXT E;  2K5B B;  4HGA A;  1H7C A;  4H9N C;  5JRC A;  4IDZ A;  3NRX A;  3UUL A;  4AQF A;  4V1A v;  3FBL A;  2V7I A;  3BQK A;  2A3D A;  1UCU A;  2JRK A;  3GMI A;  4ZI2 C;  4L0R A;  4XZC A;  3Q2M A;  3O9X A;  3SWH A;  2C5K T;  3H37 A;  3R84 B;  1MIW A;  3CQC B;  5A1L A;  1MMD A;  1VOM A;  2CEA A;  3RRC A;  3GA8 A;  4FJO A;  1G73 A;  2D2S A;  5TAO A;  2NW7 A;  4AQF C;  4H9S E;  4U72 A;  5HXH A;  5J2U E;  4JUY A;  3ESL A;  3Q5W A;  2Y48 B;  3AA1 B;  3C98 B;  2E9X B;  3UUN A;  4OFZ A;  4H9Q C;  2XAF B;  3OYZ A;  3HA4 A;  2L8K A;  3AA0 B;  2W00 A;  2X0L B;  2W0G A;  3B57 A;  3N2G E;  1IJ5 A;  4ERR A;  5C8Y E;  3KVA A;  3K3Q C;  4QHO A;  3HKE E;  5HWY A;  4PJL A;  4WNK A;  2K48 A;  5DQV A;  4MFR A;  4ZI7 E;  3CX7 B;  2XQY A;  1CUN A;  4BJM A;  4EB6 E;  5JH7 E;  1BR2 A;  3HKD E;  2V1D B;  5F8P A;  5FY1 A;  3I9Y A;  3W15 B;  3AVR A;  5JDN A;  2LSK A;  4YLH A;  3L09 A;  2JQQ A;  2XAQ B;  2W63 A;  3LBX B;  3PUR A;  2CE7 A;  3U78 A;  2D0T A;  4AKL A;  4PK5 A;  1FMW A;  5LBQ B;  3QC9 A;  4MAL A;  4ZOL E;  1HG2 A;  3FB2 A;  2UXN B;  2KMF A;  2QGS A;  1HFA A;  4O2B E;  5L3F B;  3ZN1 B;  2WM9 A;  1FEW A;  4DBR A;  3AVS A;  4WW0 A;  2K24 A;  3C64 A;  4QXB B;  4X1K E;  4CXY A;  1Y64 B;  2DHR A;  3AB3 B;  2SPC A;  3E0Z A;  1YW0 A;  4DVD A;  2XAG B;  2XAJ B;  4PNI A;  5E0O A;  5LJM A;  1WLX A;  2VKD A;  1D1B A;  4EXT A;  2A2F X;  3FBZ A;  4PFP A;  3KV5 A;  4HE8 A;  1VRB A;  2DLR A;  1NWM X;  2D0U A;  3MA9 A;  5EK2 A;  4IST A;  4CXW A;  5JR9 B;  4MBQ A;  3RYI E;  4DBQ A;  2LSY A;  2NW8 A;  4JEU B;  2A72 A;  2YEV C;  3CWZ B;  3DTO A;  4CZZ B;  2DWG A;  5L3G B;  4IIJ E;  2LOS A;  2ZLY A;  3AAA B;  4G63 A;  2Z6E A;  4ZI3 D;  4O4J E;  4YJ3 E;  1OWA A;  5JRE A;  5EK3 A;  2BZB A;  5HYA A;  3CKD A;  4QWN B;  4AQG A;  5IHY A;  1QUU A;  4XBF B;  5LNK A;  4DND A;  4UF0 A;  3GN5 B;  2X9H A;  2MOZ A;  3N9M A;  1E1H B;  5FYM A;  4UXN B;  5JQG E;  1HF8 A;  3VKH A;  2KWI B;  4FI5 A;  1YKH B;  3UUM A;  2X67 A;  4U74 A;  5JVD E;  2X9X A;  3EDV A;  5JDF A;  4P0A A;  3ANW B;  4TV9 E;  3LBX A;  2WMO A;  4CI2 B;  3NRY A;  4E7Z A;  1HTJ F;  4YFS A;  5LGU B;  2YU1 A;  4TUY E;  4PW8 A;  3WAK A;  5M4Y A;  4UV9 B;  2CXD A;  1BR1 A;  1MND A;  4I50 E;  4IE6 A;  3RH3 A;  2LEH A;  5F3J A;  4HTE A;  1MNE A;  1D0Y A;  1WYC A;  3FXD B;  3O1H A;  3IBP A;  5L2L A;  3RYC E;  4HEA A;  1BR0 A;  3ETU A;  3VHL A;  2N1G A;  2KWH A;  3AAE B;  2BVL A;  5KX5 E;  2DNX A;  4PK4 A;  3C4X A;  2NP9 A;  2E9X A;  2V7L A;  4K0U A;  4HN9 A;  4Z8X A;  2MBG A;  4BAY B;  4ZI3 C;  4O4I E;  5FXZ A;  3R6N A;  3ZJ2 A;  4I4T E;  2V7M A;  4OHF A;  4PJM A;  1LRZ A;  1FMV A;  4UVC B;  5JDL A;  3OKQ A;  4H63 H;  5HXC A;  2IAK A;  4ZS3 A;  5JRC B;  3KVB A;  4GIW A;  1KK7 A;  2KIN B;  3KV6 A;  1S94 A;  4QKN A;  4X20 E;  5FXV A;  2XUE A;  4P09 A;  4M1P A;  4ZS2 A;  5L3D B;  4C91 A;  2LJL A;  3OJA A;  3QUJ A;  3BQL A;  2G0U A;  3ZLI A;  5AFU L;  5JDM A;  5FMN A;  1MMG A;  3QK6 A;  3ANW A;  3PTR B;  2E9X D;  2ODU A;  2H7V C;  1ZV4 X;  2I59 A;  4QX8 B;  2LM9 A;  1ZKE A;  4N78 D;  4XAX B;  3EVY A;  5EZY E;  5HXE A;  4KBM B;  3GN5 A;  2CXL A;  3M65 A;  3LK3 B;  3NZP A;  1BR4 A;  1IZN B;  5L3B B;  4EYY R;  3ZC1 A;  4H63 V;  5FXW A;  4HFV A;  2D5U A;  2EHO B;  4CI1 B;  2ODV A;  5L3C B;  4JEH B;  1D0Z A;  3P8C D;  3U3I A;  3I0Q A;  4PJN A;  2BDE A;  2RA1 A;  4E7S A;  4ZI2 D;  4IGU A;  4ISS A;  3F57 A;  2NW9 A;  3ETV A;  4L9I A;  4IE4 A;  5JR9 C;  3HKB E;  1V9D A;  2KZ7 B;  3F2E A;  1ZEE A;  3Q5X A;  2M67 A;  2H7O A;  1IJ6 A;  3KBU A;  3ZYK A;  5LYJ E;  2E8I A;  1SHZ C;  4I43 B;  2PJQ A;  3UUX B;  3HI2 A;  4UF0 B;  3LFM A;  4KUM B;  2EHO C;  3VKG A;  1HS7 A;  4UVA B;  2XAS B;  3I1A A;  3BQI A;  4NUV A;  2X9Y A;  1O3X A;  4QX7 B;  5HAX A;  3UTK A;  2ACX A;  5LA6 E;  3FXE B;  5DQW A;  3RRW A;  3E08 A;  5IYZ E;  3ZN0 B;  2C5J A;  1OXZ A;  3T8O A;  4CQI A;  3F31 A;  2VK9 A;  2C0S A;  3AA7 B;  3N9P A;  3SS1 A;  3ZPO A;  2XAH B;  2WMN A;  2X9W A;  1SA0 E;  5FP3 A;  3RYF E;  4EZ4 A;  4X1Y E;  4G2A A;  3KIN B;  3N2K E;  1MIY A;  4GK5 E;  3O1J A;  3H3A A;  3KFW X;  5ADX L;  3K3O A;  5H6R B;  2WAU A;  2JJ9 A;  2BVM A;  3LG7 A;  4IE5 A;  4O8S A;  4UEL A;  5JDH A;  5KDM C;  3N9N A;  3IHR A;  2NWB A;  3KV9 A;  4TV8 E;  2WBL A;  2JPF A;  3FHN A;  1MIV A;  2Q9Q D;  4O4H E;  1WYB A;  4QXH B;  2ZM0 A;  3GWH A;  4QXC B;  2LE8 A;  2YK0 A;  2V7J A;  3IF8 B;  3PU8 A;  3HR0 A;  3ZCJ A;  2W61 A;  2YU2 A;  5FXX A;  2Q9Q C;  2IC6 A;  4UIG A;  5CA0 E;  1D0X A;  3HL6 A;  2HPL A;  1Z0P A;  3ZYL A;  3SOL A;  2L3L A;  4AKI A;  4ILU A;  3LJC A;  3V5U A;  5LCY A;  5L3E B;  3CQG B;  3K3N A;  4GOU A;  4OK0 A;  4EZH A;  2K9A A;  1U5P A;  4TX5 A;  3MK7 C;  4AI6 A;  1B7T A;  2PBI A;  4ASK A;  2CLY B;  5LP6 E;  4AXP A;  3CX8 B;  3VU7 H;  3ZMU B;  1KNZ A;  3EUH A;  5CB4 E;  4AKG A;  2W62 A;  2ZM8 A;  1MMN A;  5BMV E;  3CQX C;  3PDY A;  2Q9Q B;  2P9B A;  4O4L E;  1S35 A;  2IC9 A;  2RP4 A;  3NZQ A;  4IHJ E;  3BK9 A;  4CI3 B;  4EIW A;  2CWY A;  2X51 A;  3JC6 C;  3PUQ A;  3I0O A;  5DAB A;  5H6Q B;  2JMH A;  3ONX A;  1US7 B;  1YD8 G;  3Q9D A;  3KDS E;  4A56 A;  4PFO A;  1D1C A;  3MAC A;  3C4Z A;  4GYS A;  4UVB B;  2Q9Q A;  3D0T A;  1NAF A;  2C5I T;  5KMG P;  1X79 A;  4X1I E;  2LSJ A;  4AKH A;  3ZJ1 A;  2MYS A;  3L3P A;  4MHC A;  1T98 A;  2HH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...