2IC9A

The coiled-coil domain (residues 1-93) structure of the sin nombre virus nucleocapsid protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
74
structure length
74
Chain Sequence
MSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Nucleocapsid protein
publication title The Coiled-coil Domain Structure of the Sin Nombre Virus Nucleocapsid Protein.
pubmed doi rcsb
source organism Sin nombre virus
total genus 35
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ic9A00
3MXZA 4J2CA 2XTLA 2IC6A 2CA5A 2KWIB 2IC9A 1Z0PA 4FI5A 3FXEB 2G0UA 2MBGA 2KWHA 2C5IT 3CKDA 1IJ5A 4CQIA 2X9YA 2X9XA 3L3PA 1LRZA 3QUJA 4DNDA 2C5KT 4B6XA 1IJ6A 2K48A 2X9WA 1LVFA 3FXDB 3QK6A 4EYYR 1ZKEA 3S4UA 3TKLB 3N5LA 1H7CA 3CVRA 4L0RA 1QSDA 3P7IA 2C5JA
chains in the Genus database with same CATH superfamily
5HXCA 3C51A 2K3WA 2CBJA 4IDNA 3GMIA 2UU9T 3UU5A 4WBNE 3KV4A 2LSIA 3QB5K 3L3PA 4X1KE 4AQFA 3AAIA 3JAEA 1IBMT 1WYCA 4UVAB 5CGMA 3FXDB 1HNWT 3AEAA 2E2AA 3M3ZB 5HXHA 4TWDA 3AEBA 4QX7B 2V6YB 1I6ZA 5ABEA 2C5KT 2X0LB 2X66A 1NENA 2LSKA 4I4TE 2LKGA 5AQJB 3S4UA 4X1YE 3IEEA 1I94T 4CQIA 3JC6D 2X0YA 4YSXA 3O4XE 2BZBA 5HCMA 3I0QA 3I9YA 1ZEEA 2NW7A 2WB5A 1NAFA 3CX8B 3RGLA 3Q5DA 2C5JA 4AKLA 3PUAA 4P0AA 3AE4A 4LFBT 3SS1A 4H9NC 2XSAA 3F2EA 1M7KA 2X9HA 3N2KE 1OEDC 1KNZA 2XZEA 4X64T 5FXZA 3PUYF 2BKOA 4JI1T 3L39A 3VRBA 3Q2MA 2X9YA 2F4VT 2UXDT 2JQKA 2LM9A 4DV2T 2KZ7B 1HCIA 4PFOA 4QHOA 5KX5E 3MZKB 4EOZB 4X62T 2LRLA 3TLWA 2MAWA 4DV0T 3KV5A 3LDQB 3OYZA 4UEMA 1HR0T 5J2UE 4OFZA 1LRZA 3LK2B 5IUXA 3AEEA 2NR4A 3E08A 4O4LE 2IW5B 4PJNA 4JI8T 1LVKA 1IBKT 2CHNA 5AQFB 5AQIB 4IDPA 2IC6A 3QNUA 1KF6A 2CLYB 2UUCT 3LFMA 4HFHA 1UX4A 4TX5A 3AA1B 1YKEB 5HWYA 3UT5E 4KX6A 4TZ4C 2DWKA 3K1SA 4AISA 5AQHB 2X68A 3PJAJ 4K0UA 3HKDE 4YSYA 2WMNA 2D5UA 4ILCA 4JI2T 5JDMA 1YQ3A 4ZI2C 3RLFF 2DI4A 5LBMA 4YTMA 2FJAA 1G73A 3HKCE 3V5SA 2EHOA 2K48A 3AE6A 3UQ4A 4WNKA 2XQ6A 4C91A 3ONJA 4IT4A 2K5BB 2WMOA 4LF9T 2XAGB 4KHZF 1YW0A 2WS3A 2CE7A 2WAUA 2V1DB 1ZP0A 4ZEYA 4LF7T 2CEAA 4NPPA 4DV6T 1E7PA 5AQNB 3EHZA 4LMKA 3QB5A 3U78A 3RYIE 4PJJA 3EDUA 4QXBB 3RYCE 4KP3C 4O4IE 3JAFA 4TUYE 2LHNA 4IDOA 2W61A 5LBQB 2WCAA 1WFDA 3VR8A 2V7LA 3ETUA 1VCSA 4ZI2D 2E9XA 3W15B 1UX5A 2PTFA 3TLSA 2B1EA 3FZFB 4NUVA 1UGOA 5LJNA 3PV0F 3ZC0A 4KBMB 5LXTE 3U3IA 5LCYA 3ZMZB 1FMVA 4XAXB 1N33T 4HWCA 4ZHQE 4UV9B 3WAKA 3PUWF 2LEHA 1X9BA 2CXFA 4HGAA 2WQYA 2A9UA 5M4YA 2HHHT 3E22E 2KSRA 1KFYA 2C0SA 3AA7B 3O9XA 3FB2A 1IZNB 2EHOB 4E7SA 2C5IT 2LRKA 2ODUA 2A2FX 1MMDA 1M62A 5BMVE 3ZYMA 2KT9A 2JIWA 5L4EA 4JI3T 3ESLA 5JVDE 1MNDA 2XAQB 2XSBA 4Q25A 3RIUC 2W67A 4PK6A 2JQQA 5L3EB 2M6BA 3RKOA 1OWAA 4BJNA 3FHNA 2MYSA 2CM0A 2YKSA 1G8XA 3GWHA 4TNWA 3DJBA 4JEHB 2YU1A 4H9PC 4K0KT 2QRXA 4PJMA 2VQET 3P50A 4AXPA 1N34T 4JLEA 1ZV4X 4BJMA 3N9OA 1VCTA 4L5GA 4ZI7E 4X65T 3PU8A 2BG9A 4HFEA 4ILBA 2K24A 4L0RA 2IAKA 2VWAA 3RC8A 4C90A 1D1CA 1Z0PA 2E9XB 3P8CD 5JDQA 2MOZA 3OTOT 3CIRA 3M65A 4TN7B 2QVAA 2BKNA 3ZSTA 1QUUA 3NBXX 4AQFC 2VASA 4PAGA 2XQ5A 3AAEB 5IHYA 5AFUL 3BQIA 1MIWA 5H6RB 1YKHB 3J9X1 3RI5A 2LSJA 4DR6T 3TLTA 4MBQA 3PUSA 2BVLA 2M6IA 1SUMB 5LMNT 5DJQC 2CLYC 2YINA 3K3OA 2XUEA 1T8BA 2I59A 2VB6A 4PK5A 2YU2A 4X5TA 4U2ZA 3MJXA 2JQ9A 4LMJA 2CXDA 2XAFB 1XDPA 4A5XA 4IE0A 1HG2A 5FP3A 4HTEA 1T7SA 1JNZA 3OVUA 3N9LA 3ZMVB 4JI4T 2UUBT 5J0ZA 4TNVA 5LMUT 4YLHA 3B13A 4AIUA 2A3DA 2ACXA 2MTQA 5LHHB 3PUQA 5DQVA 4DR7T 3ZSSA 3NZPA 2PG8A 2XQ8A 3GA8A 4GKKT 3ZCJA 4DR4T 2NW9A 4N78D 4ZI3C 2XJ7A 2HN2A 4NXMT 2QA7A 3AA0B 4UELA 3CQGB 4F8HA 1BR1A 2P9BA 4PK4A 4HFDA 5ABGA 4EEDA 2RP4A 4PW8A 2IUBA 2XQAA 5EZYE 2L8KA 3JC6C 3UU8A 2WP9A 3K3NA 1J5WA 5FY7A 3X1DA 4U31A 3Q5EA 2IDOB 3ZT7A 3FBLA 3N2GE 1SE7A 4DV5T 4H63H 4HFIA 3KV9A 2SPCA 4CXYA 3PDYA 1VOMA 2L3LA 3P4SA 3TLUA 2XAHB 4WW0A 5E0OA 2W2UA 2W66A 4GYSA 4I43B 3RRWA 2XM2A 2J47A 3PUVF 4ILAA 1HNZT 3EUHA 5AQSB 4O2BE 5DQWA 4DV1T 1FMWA 5AQRB 3T8OA 3KVAA 2KNDA 3NRXA 2I0MA 4EYYR 5LJMA 4LMLA 3RQWA 3CX6B 5GONE 4DR2T 3H3AA 4ZI3D 5L3DB 4L9IA 3FBZA 1UUSA 4IE6A 3RC3A 3ANWA 4CXXA 4AKHA 1LKXA 5FKYA 2UXXB 3AAAB 3TLVA 2EHOC 2ODVA 2V6XA 4IE7A 2WBLA 1U4QA 4LFAT 2NWBA 5BR8T 3J7Yq 1OEDE 1J1JA 3AECA 5FVKA 1SA0E 2QYWA 4DV4T 1BR2A 3DP7A 2UXNB 5F5WA 3ZMSB 4KI0F 3NRYA 2MPKA 3PU3A 4AQGA 4HEAA 3CKDA 5AQTB 4MLKA 2ZM2A 3KV6A 4DVDA 3N9NA 3V5UA 4ASKA 3AEDA 1X79A 5JR9A 5KXJA 4ZS3A 2WDQA 2YK0A 1XDOA 4H9SE 3AB3B 3D0TA 2WU2A 4QH5A 5FY0A 3MACA 3O1HA 3TKLB 4CZZB 5JRCA 4I55E 2E9XC 5JDFA 2DLRA 2EHOD 1S35A 2E5LT 1DU2A 2XQ9A 3ZMTB 5A1LA 3C64A 4EAHA 3WI3A 3ZN1B 5AQGB 4DMWA 2VKHA 3KVBA 5C3JA 3H3MA 4QWNB 3A8YC 3SFDA 2ZLYA 4HWFA 3ANWB 3RHWA 3A5XA 3QUJA 2VVSA 4DIDB 2WWVA 4HE8A 5JTGA 3C98B 2XY8B 2V7JA 5KDMC 1VRBA 3LK3B 4WYVA 5LHGB 3PUXF 2JPFA 4IDQA 4UXNB 2JJ9A 2PJQA 4A97A 4EEBA 4JEUB 5EK4A 2PBIA 2LT3A 4BAYB 2N1GA 5FXWA 5AQMB 3O1JA 3AE5A 1MIVA 2JRKA 3AEFA 4DV3T 4JI0T 2OA5A 4HWIB 2CA5A 2E9XD 1YQ4A 2XM1A 4H9RC 5JR9B 2YOEA 5HWXA 5JH7E 5LG4A 2N2NA 4XZCA 5JDLA 2KMFA 1B7TA 2VL0A 1H7CA 1SHZC 4JI7T 2BG9C 3UU4A 3P4WA 4UVBB 2WSSV 2E8IA 5JRCB 4YHHT 3AXJA 4OK0A 4AQYT 3QC9A 4AI6A 3C4WA 3AE8A 2D9DA 5FNVE 5LGNB 5HCJA 4TWHA 2H3RA 1OEDA 2Q9QA 4GIWA 1UCUA 4TV9E 3C4XA 4YJ2E 4QH4A 5C8YE 2X9WA 3SFEA 1WR6A 4MFRA 1WYBA 1HX1B 5DABA 2NOXA 3SOLA 1XNRT 4BA9A 1XWMA 4DR5T 2FJEA 4KMCA 3CMLA 4U72A 4UF0A 2BS3A 3O1IA 4U74A 4LF5T 4O4HE 2LM2A 3P7IA 4UR9A 1GQEA 2LOPA 4H9OC 4CI1B 3RF1A 1N32T 1HFAA 4A56A 3KBTA 2DNXA 4NIQA 4B6XA 2V26A 1W9RA 3LK42 4AKRB 2D0TA 5ETWA 4YJ3E 2V7KA 3PURA 4X66T 5IWAT 1CUNA 4FJOA 4O8SA 2IIUA 4U7YA 2VKOA 4DMVA 5F3JA 1IAPA 3MK7C 4ZOLE 2UXBT 5FYMA 5L3GB 1MIYA 4ZZBA 1Y64B 3AXJB 2AXDS 2L9QA 3AE3A 2X67A 3NKZA 2JMHA 2FUPA 1MMGA 1XMOT 2ZM0A 1ZKEA 1HS7A 4ISTA 5HEGA 3UUNA 1OEDB 2Q9QB 1KEYA 2HH7A 4WBOA 4ANJA 2LKHA 2DHRA 5JQGE 3P4RA 2DCFA 4FI5A 2CPTA 4IE4A 5AQOB 4JV5T 2CWYA 2IMLA 2WDVA 5JREA 1U5PA 4HKAA 4QXCB 3ONLC 5HEJA 4F6RC 2W4XA 3EABA 4UF0B 2W63A 2Y48B 2KWHA 1MNEA 4DO0A 1FEWA 2Z6EA 2CWOA 1AJ3A 5LB7B 4IGUA 5L4HA 4AKGA 3HKBE 4I0UA 4G2AA 1D0YA 2LJLA 3K8PC 2CHOA 1NEKA 2YN6A 4XBFB 4X20E 4DV7T 3RX6A 3E0ZA 2VL8A 3QK6A 2LHRA 3N2OA 1EZ3A 3L09A 2I6HA 4OYJA 4GK0E 3I1AA 4X1IE 3FXEB 2W00A 3VKGA 2CCQA 2BS4A 1MMAA 3ZN0B 3ZMUB 2V5DA 2W0GA 4IE5A 4YT0A 5C2TA 4G63A 3NWIA 1HF8A 2XTLA 2V7MA 3LBXA 3FZLB 5JR9C 3UU6A 2ES0A 3A7MA 4NUUA 3EDVA 4GOUA 3N9MA 3Q5WA 3PUGA 4OHFA 3ZC1A 1ZOYA 4Z91A 2LSYA 2V7IA 2A72A 2H7OA 2CRBA 1FIOA 1O3XA 4O2AE 2GK9A 5LP6E 3PJAA 4IHJE 3NVOA 4CI2B 3ZYKA 1UK5A 1QLBA 4P09A 3ZJ2A 5FL1A 4JI6T 1HX8A 4HFBA 2CMRA 5JDGA 3RPUA 4YHJA 1D1BA 4DNDA 5FXXA 2XQ4A 4COFA 2PFVA 4JUYA 3VU7H 4LF4T 4KUMB 5AQVB 4QX8B 4U7IA 4PJLA 3B5MA 2M67A 2X0HA 1YXRA 3C4ZA 2JMKA 4ZXLA 2FBWA 2H89A 4CXWA 5FY1A 1W09A 3UUBA 2WM9A 4EYUA 3T1YT 5LYJE 3R6NA 1IBLT 3WAJA 4EV6A 3FZMB 3SWHA 3KINB 4EIWA 4HN9A 3LBXB 5FMNA 3PUZF 5LNKA 3OJAA 4HWDA 4IIJE 4B3MT 3OKQA 3HI2A 2H7VC 2VURA 4B3TT 2HPJA 3GN5B 3Q5XA 4O4JE 3EAMA 5EK2A 4IDZA 1D1AA 3AA6B 3H37A 2Y8DA 3AE7A 5L47A 4NXNT 2UXCT 2J1DG 1US7B 3T1HT 3VR9A 2OLTA 3UULA 3PE0A 3B57A 2Q9QC 5HXSA 4JYAT 4GK5E 4PNIA 5CB4E 1BR4A 3IF8B 3ZT5A 3ONXA 3Q9DA 5HXRA 4YY3T 5EK3A 3CQCB 4QKNA 4GKJT 3I0OA 3N9PA 2BKPA 2XHEB 2CXLA 3CX7B 3F57A 2VVNA 1KK7A 5FL0A 2WDRA 3N9QA 1R8IA 3AE1A 4YSZA 3IA3A 2NW8A 3ZPOA 2VKDA 4CN1A 3IHRA 4EZHA 4HWHA 4YFSA 5CA1E 2YDQA 3BK9A 1KNRA 2RA1A 1HNXT 3ZJ1A 1FJGT 3VRAA 4TWFA 2BVMA 4HFVA 3LSVA 5LG3A 2NTYA 1J5ET 5ABFA 2J62A 2NP9A 3RYFE 2BG9E 4EZ4A 3LJCA 3KBUA 3EVYA 2LE8A 5J2TE 2Q9QD 3RH3A 2BBJA 1ZHCA 2CBIA 2WU5A 3CPZA 5F8PA 1D0ZA 4IL9A 3AVSA 2YEVC 1E2AA 1Y01A 3PTRB 5FVLA 2D2SA 5CA0E 5KMGP 3OBVE 5HAXA 3MA9A 3FZKB 3KDSE 5JDHA 1HG5A 3VKHA 2XAJB 3AE9A 4DBRA 2WY2A 2ACZA 4MALA 3OYXA 2D0UA 3I9WA 1T72A 3F31A 4LFCT 2J4GA 2BDEA 4EGWA 3UUMA 5CJ5A 5L3CB 4DR3T 3G06A 4Z8XA 1L0VA 1E1HB 4ZZCA 1CHUA 2ZM8A 2XQ3A 2VK9A 3AVRA 2VQFT 3L8RA 3RRCA 2BS2A 3RYHE 2R6GF 4U3CA 4OX9T 2UUAT 2AE9A 4Z90A 5AQLB 2WZHA 3ABVA 2K9AA 2E5VA 3N5LA 5JDNA 3BQLA 2YDSA 5ABFB 1V9DA 3P4PA 2XPKA 5J1GA 2ZM6T 3CQXC 2X51A 4M1PA 3SRZA 4UV8B 4KHPT 3DTOA 2HN1A 3ETVA 2XQYA 5H6QB 4P0BA 4EXTA 1XMQT 3NZQA 4IL4A 1WRDA 3ZYLA 5LHIB 1WLXA 2V5CA 3UUXB 5LGUB 3P4QA 4IREA 3HR0A 4DBQA 5L3BB 3HA4A 2RPAA 3QOFA 3C50A 2KLQA 5HXEA 2FJBA 5FXVA 3HL6A 4HFCA 2LSGA 2N9DA 4JI5T 2H88A 2FJDA 5HYAA 4ERRA 4P1NA 3FZHB 3K3QC 4YTNA 2IHR1 2QGSA 3JADA 1BR0A 4EB6E 1IJ6A 4ZS2A 3KFWX 3UU3A 5TAOA 3JCFA 2XASB 5HEOA 3ZCIA 4LF8T 2IC9A 2XQ7A 5AQUB 2LOSA 2MBGA 3UFEA 4V1Av 4H63V 1XZYA 2YDRA 4JBWF 4TV8E 4AKIA 3CWZB 3ZT6A 5LOVE 5CFBA 2WWUA 3RIAA 1T98A 4E7ZA 3IBPA 2HPLA 4UVCB 1XNQT 4WZXA 3RQUA 4GYRA 5L2LA 4UIGA 1LVFA 2Y6XA 3BQKA 5AQQB 2DWGA 1Z8UA 5LA6E 3UTKA 1QSDA 1HTJF 3OPCA 2ZMAA 1W0BA 4MHCA 5ADXL 2X9XA 2WZIA 5AQKB 4PFPA 4DUYT 1YD8G 5AQPB 2OV9A 3ZLIA 1WCRA 2B76A 4CN6A 1NWMX 4CI3B 3R84B 3UFGA 3HKEE 2KXPB 4LF6T 2LLYA 4ADZA 5IYZE 5L3FB 2V6YA 4A98A 3AE2A 3ZEFB 4ILUA 3EI0A 4U2YA 1MMNA 3MXZA 4YTPA 2NTXA 4QXHB 2V8SV 1KNPA 2DL1A 3VHLA 1N36T 4U33A 3UQ7A 4YXDA 3GN5A 4CN4A 3CVRA 2JQHA 3RIUA 1UURA 4DR1T 2KWIB 1W0AA 4DUZT 1D0XA 2BG9B 4OYKA 3ZKRA 1IJ5A 1S94A 2VKJA 3AEGA 4ISSA 3RKGA 2BBHA 5HEUA 3RIFA 3CK6A 4J2CA 2KINB 2G0UA 5LGTB 4I50E 5ABHA 1OXZA 1JNRA 4QH1A 4B3ST 3MKDA 4B3RT 4H9QC 3LG7A 1WR0A 5HEHA 2W62A
chains in the Genus database with same CATH topology
3N9QA 4PAGA 3C51A 5HXCA 2NW8A 3SOLA 3AAEB 3ZPOA 3GMIA 5IHYA 5AFUL 3BQIA 4BA9A 1MIWA 2VKDA 5H6RB 1YKHB 3J9X1 4WBNE 3IHRA 4EZHA 3KV4A 2LSIA 4YFSA 3L3PA 4X1KE 4AQFA 5CA1E 3AAIA 2LSJA 4KMCA 3CMLA 4U72A 4UF0A 1WYCA 4MBQA 4UVAB 3BK9A 2RA1A 3FXDB 3O1IA 4U74A 3PUSA 3ZJ1A 2BVLA 4O4HE 3P7IA 2CLYC 5DJQC 2BVMA 5HXHA 2YINA 4HFVA 2LOPA 2XUEA 3K3OA 4H9OC 2I59A 2VB6A 4PK5A 4QX7B 4CI1B 2NTYA 2YU2A 1HFAA 3MJXA 4A56A 3KBTA 2DNXA 2C5KT 2NP9A 2CXDA 2X0LB 2X66A 2XAFB 4B6XA 2V26A 2LSKA 3RYFE 3LK42 1HG2A 4IE0A 5FP3A 4AKRB 4EZ4A 3LJCA 2D0TA 4HTEA 5ETWA 4YJ3E 2V7KA 3PURA 4I4TE 3KBUA 3S4UA 3EVYA 3N9LA 4X1YE 2LE8A 5J2TE 2Q9QD 3ZMVB 1CUNA 4FJOA 3IEEA 3RH3A 4YLHA 3B13A 4O8SA 1ZHCA 4CQIA 3CPZA 3JC6D 2A3DA 2ACXA 2MTQA 3O4XE 5F8PA 1D0ZA 2BZBA 3AVSA 2YEVC 5LHHB 2VKOA 3PUQA 4DMVA 3PTRB 5DQVA 5F3JA 2D2SA 1IAPA 3I0QA 3I9YA 3MK7C 5CA0E 4ZOLE 5KMGP 1ZEEA 3OBVE 2NW7A 5FYMA 5HAXA 1NAFA 3CX8B 5L3GB 3NZPA 2PG8A 3GA8A 1MIYA 3MA9A 2C5JA 3ZCJA 3KDSE 2NW9A 4AKLA 4N78D 5JDHA 4ZI3C 3PUAA 4P0AA 1HG5A 1Y64B 3VKHA 2L9QA 2XAJB 2QA7A 3AA0B 2X67A 3SS1A 4MALA 4DBRA 3OYXA 2D0UA 3I9WA 4H9NC 4UELA 2JMHA 3F2EA 1MMGA 3F31A 3CQGB 2X9HA 1BR1A 2P9BA 3N2KE 4PK4A 2ZM0A 1ZKEA 1HS7A 2BDEA 1KNZA 4ISTA 2RP4A 4PW8A 3UUNA 2Q9QB 5FXZA 2HH7A 4WBOA 3UUMA 5L3CB 5EZYE 4ANJA 2L8KA 3JC6C 4Z8XA 2DHRA 5JQGE 3K3NA 2DCFA 4FI5A 1E1HB 3Q2MA 5FY7A 2X9YA 4IE4A 2ZM8A 2CWYA 3FBLA 3N2GE 2LM9A 4H63H 3KV9A 2SPCA 2KZ7B 4CXYA 1HCIA 3PDYA 4PFOA 2VK9A 5JREA 1U5PA 1VOMA 4QHOA 4HKAA 5KX5E 2L3LA 2XAHB 4QXCB 4WW0A 3MZKB 4EOZB 5E0OA 3AVRA 3KV5A 4GYSA 3OYZA 4I43B 3RRCA 4UEMA 4F6RC 4UF0B 5J2UE 2W63A 2Y48B 3RRWA 3RYHE 2KWHA 1MNEA 4DO0A 3EUHA 4OFZA 1LRZA 3LK2B 1FEWA 4O2BE 5DQWA 2Z6EA 1FMWA 2CWOA 1AJ3A 3T8OA 3KVAA 3E08A 4O4LE 2K9AA 2KNDA 3NRXA 2IW5B 4EYYR 4IGUA 4PJNA 3N5LA 5JDNA 1LVKA 3BQLA 5LJMA 4AKGA 3HKBE 1V9DA 5J1GA 4G2AA 3CQXC 2IC6A 1D0YA 2X51A 4M1PA 2CLYB 2LJLA 3CX6B 3SRZA 3K8PC 5GONE 3LFMA 4UV8B 1UX4A 3H3AA 4TX5A 3AA1B 4ZI3D 5L3DB 3DTOA 4L9IA 1YKEB 3ETVA 2XQYA 5HWYA 3UT5E 3FBZA 4TZ4C 5H6QB 2DWKA 4P0BA 4XBFB 4X20E 4IE6A 4EXTA 3RC3A 3RX6A 3E0ZA 2VL8A 3ANWA 3NZQA 3QK6A 4CXXA 1WRDA 2X68A 3ZYLA 5LHIB 1WLXA 4K0UA 1LKXA 3HKDE 4AKHA 2WMNA 2D5UA 2UXXB 3UUXB 3AAAB 5LGUB 2LHRA 3N2OA 2EHOC 2ODVA 1EZ3A 4IE7A 3HR0A 2WBLA 1U4QA 3L09A 4DBQA 4OYJA 4GK0E 3I1AA 4X1IE 5JDMA 3FXEB 5L3BB 2NWBA 4ZI2C 3J7Yq 3HA4A 2W00A 3VKGA 2CCQA 3C50A 2KLQA 5HXEA 2DI4A 1MMAA 5LBMA 1SA0E 3HL6A 5FXVA 3ZN0B 2LSGA 2N9DA 1G73A 3HKCE 3V5SA 2EHOA 2K48A 3ZMUB 1BR2A 3DP7A 2UXNB 2W0GA 4IE5A 5HYAA 4WNKA 4G63A 3ZMSB 4ERRA 1HF8A 2XTLA 4C91A 3NRYA 3K3QC 3PU3A 2V7MA 3LBXA 4AQGA 4HEAA 5JR9C 3CKDA 2K5BB 2WMOA 2QGSA 2ES0A 4NUUA 3EDVA 2XAGB 4MLKA 4GOUA 2ZM2A 1BR0A 4EB6E 3KV6A 1IJ6A 4ZS2A 3KFWX 5TAOA 4DVDA 3N9MA 3N9NA 3V5UA 4ASKA 1YW0A 3Q5WA 3PUGA 2XASB 4OHFA 3ZC1A 2CE7A 2WAUA 2V1DB 2LSYA 1X79A 5JR9A 4ZS3A 3ZCIA 2YK0A 2V7IA 2CEAA 2IC9A 4H9SE 2A72A 2H7OA 2LOSA 3AB3B 2MBGA 1FIOA 1O3XA 3UFEA 3D0TA 4O2AE 2GK9A 5LP6E 4V1Av 4H63V 5FY0A 4IHJE 3MACA 3O1HA 3U78A 4CI2B 3ZYKA 3RYIE 4PJJA 4P09A 3ZJ2A 3EDUA 4QXBB 3TKLB 4TV8E 1HX8A 4CZZB 3RYCE 4KP3C 4AKIA 5JRCA 4O4IE 4I55E 2CMRA 2E9XC 3CWZB 5JDGA 4TUYE 5LOVE 2WWUA 3RPUA 2LHNA 2W61A 1T98A 2DLRA 5JDFA 2EHOD 4E7ZA 5LBQB 3IBPA 4YHJA 1S35A 2HPLA 4UVCB 1D1BA 2V7LA 4DNDA 3ETUA 3ZMTB 4ZI2D 4GYRA 2E9XA 3W15B 5A1LA 1UX5A 5FXXA 5L2LA 4UIGA 3C64A 5DABA 4EAHA 1LVFA 2PFVA 4JUYA 3VU7H 2Y6XA 3WI3A 3ZN1B 3BQKA 2DWGA 2B1EA 2VKHA 4DMWA 3KVBA 5LA6E 3UTKA 1QSDA 4KUMB 4NUVA 1HTJF 5LJNA 2ZMAA 4QX8B 4PJLA 4QWNB 2M67A 3ZC0A 4KBMB 5LXTE 4MHCA 2ZLYA 3U3IA 5LCYA 5ADXL 3ANWB 3ZMZB 1FMVA 2X9XA 3A5XA 4XAXB 3C4ZA 3QUJA 4ZHQE 4UV9B 2JMKA 4PFPA 4HE8A 3WAKA 1YD8G 2LEHA 2CXFA 4HGAA 3ZLIA 4CXWA 5FY1A 5M4YA 3C98B 3E22E 2V7JA 5KDMC 1VRBA 3AA7B 2C0SA 3LK3B 5LHGB 3O9XA 2WM9A 1NWMX 3FB2A 4CI3B 3R84B 4EYUA 2JPFA 5LYJE 1IZNB 3R6NA 4UXNB 3WAJA 2JJ9A 2EHOB 2PJQA 4E7SA 3HKEE 2KXPB 2C5IT 4JEUB 2ODUA 2A2FX 4ADZA 5EK4A 2PBIA 1MMDA 2LT3A 4BAYB 3SWHA 5IYZE 2N1GA 5FXWA 5L3FB 3O1JA 1MIVA 2JRKA 3KINB 4EIWA 5BMVE 4HN9A 3ZEFB 3ZYMA 3LBXB 5FMNA 2KT9A 5LNKA 4ILUA 2OA5A 3OJAA 1MMNA 3MXZA 4IIJE 3ESLA 5JVDE 1MNDA 2CA5A 2NTXA 2E9XD 2XAQB 3OKQA 4QXHB 3HI2A 2H7VC 4H9RC 2HPJA 4PK6A 3GN5B 3Q5XA 3VHLA 2JQQA 5L3EB 4O4JE 5JR9B 5HWXA 5LG4A 3RKOA 5JH7E 1OWAA 4BJNA 2N2NA 4IDZA 4XZCA 5EK2A 5JDLA 2KMFA 1D1AA 2MYSA 1B7TA 3FHNA 3AA6B 3H37A 3GN5A 2CM0A 1H7CA 2Y8DA 3CVRA 1G8XA 3GWHA 1SHZC 3DJBA 4JEHB 2YU1A 4H9PC 2KWIB 4PJMA 1D0XA 2J1DG 4OYKA 1US7B 4UVBB 4AXPA 1IJ5A 4JLEA 1ZV4X 1S94A 3UULA 2WSSV 2E8IA 2VKJA 3PE0A 4ISSA 5JRCB 4OK0A 4BJMA 3N9OA 3B57A 3QC9A 4L5GA 4ZI7E 3PU8A 2Q9QC 4AI6A 3C4WA 5HXSA 4GK5E 2K24A 4L0RA 5FNVE 4PNIA 5CB4E 1BR4A 2IAKA 2VWAA 4J2CA 5LGNB 3RC8A 3IF8B 1D1CA 4C90A 3ONXA 1Z0PA 2E9XB 3Q9DA 2KINB 3P8CD 5HXRA 5JDQA 2G0UA 5LGTB 4I50E 2H3RA 1OXZA 2Q9QA 2MOZA 5EK3A 3CQCB 4GIWA 1UCUA 4TV9E 3M65A 4QKNA 3C4XA 4TN7B 4YJ2E 3I0OA 3MKDA 3N9PA 5C8YE 2X9WA 4H9QC 1QUUA 3NBXX 1WR6A 3LG7A 4MFRA 2XHEB 4AQFC 2CXLA 3CX7B 3F57A 2VASA 2W62A 1WYBA 1KK7A 2NOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXZ A;  4J2C A;  2XTL A;  2IC6 A;  2CA5 A;  2KWI B;  2IC9 A;  1Z0P A;  4FI5 A;  3FXE B;  2G0U A;  2MBG A;  2KWH A;  2C5I T;  3CKD A;  1IJ5 A;  4CQI A;  2X9Y A;  2X9X A;  3L3P A;  1LRZ A;  3QUJ A;  4DND A;  2C5K T;  4B6X A;  1IJ6 A;  2K48 A;  2X9W A;  1LVF A;  3FXD B;  3QK6 A;  4EYY R;  1ZKE A;  3S4U A;  3TKL B;  3N5L A;  1H7C A;  3CVR A;  4L0R A;  1QSD A;  3P7I A;  2C5J A; 
#chains in the Genus database with same CATH topology
 5HXC A;  3C51 A;  2K3W A;  2CBJ A;  4IDN A;  3GMI A;  2UU9 T;  3UU5 A;  4WBN E;  3KV4 A;  2LSI A;  3QB5 K;  3L3P A;  4X1K E;  4AQF A;  3AAI A;  3JAE A;  1IBM T;  1WYC A;  4UVA B;  5CGM A;  3FXD B;  1HNW T;  3AEA A;  2E2A A;  3M3Z B;  5HXH A;  4TWD A;  3AEB A;  4QX7 B;  2V6Y B;  1I6Z A;  5ABE A;  2C5K T;  2X0L B;  2X66 A;  1NEN A;  2LSK A;  4I4T E;  2LKG A;  5AQJ B;  3S4U A;  4X1Y E;  3IEE A;  1I94 T;  4CQI A;  3JC6 D;  2X0Y A;  4YSX A;  3O4X E;  2BZB A;  5HCM A;  3I0Q A;  3I9Y A;  1ZEE A;  2NW7 A;  2WB5 A;  1NAF A;  3CX8 B;  3RGL A;  3Q5D A;  2C5J A;  4AKL A;  3PUA A;  4P0A A;  3AE4 A;  4LFB T;  3SS1 A;  4H9N C;  2XSA A;  3F2E A;  1M7K A;  2X9H A;  3N2K E;  1OED C;  1KNZ A;  2XZE A;  4X64 T;  5FXZ A;  3PUY F;  2BKO A;  4JI1 T;  3L39 A;  3VRB A;  3Q2M A;  2X9Y A;  2F4V T;  2UXD T;  2JQK A;  2LM9 A;  4DV2 T;  2KZ7 B;  1HCI A;  4PFO A;  4QHO A;  5KX5 E;  3MZK B;  4EOZ B;  4X62 T;  2LRL A;  3TLW A;  2MAW A;  4DV0 T;  3KV5 A;  3LDQ B;  3OYZ A;  4UEM A;  1HR0 T;  5J2U E;  4OFZ A;  1LRZ A;  3LK2 B;  5IUX A;  3AEE A;  2NR4 A;  3E08 A;  4O4L E;  2IW5 B;  4PJN A;  4JI8 T;  1LVK A;  1IBK T;  2CHN A;  5AQF B;  5AQI B;  4IDP A;  2IC6 A;  3QNU A;  1KF6 A;  2CLY B;  2UUC T;  3LFM A;  4HFH A;  1UX4 A;  4TX5 A;  3AA1 B;  1YKE B;  5HWY A;  3UT5 E;  4KX6 A;  4TZ4 C;  2DWK A;  3K1S A;  4AIS A;  5AQH B;  2X68 A;  3PJA J;  4K0U A;  3HKD E;  4YSY A;  2WMN A;  2D5U A;  4ILC A;  4JI2 T;  5JDM A;  1YQ3 A;  4ZI2 C;  3RLF F;  2DI4 A;  5LBM A;  4YTM A;  2FJA A;  1G73 A;  3HKC E;  3V5S A;  2EHO A;  2K48 A;  3AE6 A;  3UQ4 A;  4WNK A;  2XQ6 A;  4C91 A;  3ONJ A;  4IT4 A;  2K5B B;  2WMO A;  4LF9 T;  2XAG B;  4KHZ F;  1YW0 A;  2WS3 A;  2CE7 A;  2WAU A;  2V1D B;  1ZP0 A;  4ZEY A;  4LF7 T;  2CEA A;  4NPP A;  4DV6 T;  1E7P A;  5AQN B;  3EHZ A;  4LMK A;  3QB5 A;  3U78 A;  3RYI E;  4PJJ A;  3EDU A;  4QXB B;  3RYC E;  4KP3 C;  4O4I E;  3JAF A;  4TUY E;  2LHN A;  4IDO A;  2W61 A;  5LBQ B;  2WCA A;  1WFD A;  3VR8 A;  2V7L A;  3ETU A;  1VCS A;  4ZI2 D;  2E9X A;  3W15 B;  1UX5 A;  2PTF A;  3TLS A;  2B1E A;  3FZF B;  4NUV A;  1UGO A;  5LJN A;  3PV0 F;  3ZC0 A;  4KBM B;  5LXT E;  3U3I A;  5LCY A;  3ZMZ B;  1FMV A;  4XAX B;  1N33 T;  4HWC A;  4ZHQ E;  4UV9 B;  3WAK A;  3PUW F;  2LEH A;  1X9B A;  2CXF A;  4HGA A;  2WQY A;  2A9U A;  5M4Y A;  2HHH T;  3E22 E;  2KSR A;  1KFY A;  2C0S A;  3AA7 B;  3O9X A;  3FB2 A;  1IZN B;  2EHO B;  4E7S A;  2C5I T;  2LRK A;  2ODU A;  2A2F X;  1MMD A;  1M62 A;  5BMV E;  3ZYM A;  2KT9 A;  2JIW A;  5L4E A;  4JI3 T;  3ESL A;  5JVD E;  1MND A;  2XAQ B;  2XSB A;  4Q25 A;  3RIU C;  2W67 A;  4PK6 A;  2JQQ A;  5L3E B;  2M6B A;  3RKO A;  1OWA A;  4BJN A;  3FHN A;  2MYS A;  2CM0 A;  2YKS A;  1G8X A;  3GWH A;  4TNW A;  3DJB A;  4JEH B;  2YU1 A;  4H9P C;  4K0K T;  2QRX A;  4PJM A;  2VQE T;  3P50 A;  4AXP A;  1N34 T;  4JLE A;  1ZV4 X;  4BJM A;  3N9O A;  1VCT A;  4L5G A;  4ZI7 E;  4X65 T;  3PU8 A;  2BG9 A;  4HFE A;  4ILB A;  2K24 A;  4L0R A;  2IAK A;  2VWA A;  3RC8 A;  4C90 A;  1D1C A;  1Z0P A;  2E9X B;  3P8C D;  5JDQ A;  2MOZ A;  3OTO T;  3CIR A;  3M65 A;  4TN7 B;  2QVA A;  2BKN A;  3ZST A;  1QUU A;  3NBX X;  4AQF C;  2VAS A;  4PAG A;  2XQ5 A;  3AAE B;  5IHY A;  5AFU L;  3BQI A;  1MIW A;  5H6R B;  1YKH B;  3J9X 1;  3RI5 A;  2LSJ A;  4DR6 T;  3TLT A;  4MBQ A;  3PUS A;  2BVL A;  2M6I A;  1SUM B;  5LMN T;  5DJQ C;  2CLY C;  2YIN A;  3K3O A;  2XUE A;  1T8B A;  2I59 A;  2VB6 A;  4PK5 A;  2YU2 A;  4X5T A;  4U2Z A;  3MJX A;  2JQ9 A;  4LMJ A;  2CXD A;  2XAF B;  1XDP A;  4A5X A;  4IE0 A;  1HG2 A;  5FP3 A;  4HTE A;  1T7S A;  1JNZ A;  3OVU A;  3N9L A;  3ZMV B;  4JI4 T;  2UUB T;  5J0Z A;  4TNV A;  5LMU T;  4YLH A;  3B13 A;  4AIU A;  2A3D A;  2ACX A;  2MTQ A;  5LHH B;  3PUQ A;  5DQV A;  4DR7 T;  3ZSS A;  3NZP A;  2PG8 A;  2XQ8 A;  3GA8 A;  4GKK T;  3ZCJ A;  4DR4 T;  2NW9 A;  4N78 D;  4ZI3 C;  2XJ7 A;  2HN2 A;  4NXM T;  2QA7 A;  3AA0 B;  4UEL A;  3CQG B;  4F8H A;  1BR1 A;  2P9B A;  4PK4 A;  4HFD A;  5ABG A;  4EED A;  2RP4 A;  4PW8 A;  2IUB A;  2XQA A;  5EZY E;  2L8K A;  3JC6 C;  3UU8 A;  2WP9 A;  3K3N A;  1J5W A;  5FY7 A;  3X1D A;  4U31 A;  3Q5E A;  2IDO B;  3ZT7 A;  3FBL A;  3N2G E;  1SE7 A;  4DV5 T;  4H63 H;  4HFI A;  3KV9 A;  2SPC A;  4CXY A;  3PDY A;  1VOM A;  2L3L A;  3P4S A;  3TLU A;  2XAH B;  4WW0 A;  5E0O A;  2W2U A;  2W66 A;  4GYS A;  4I43 B;  3RRW A;  2XM2 A;  2J47 A;  3PUV F;  4ILA A;  1HNZ T;  3EUH A;  5AQS B;  4O2B E;  5DQW A;  4DV1 T;  1FMW A;  5AQR B;  3T8O A;  3KVA A;  2KND A;  3NRX A;  2I0M A;  4EYY R;  5LJM A;  4LML A;  3RQW A;  3CX6 B;  5GON E;  4DR2 T;  3H3A A;  4ZI3 D;  5L3D B;  4L9I A;  3FBZ A;  1UUS A;  4IE6 A;  3RC3 A;  3ANW A;  4CXX A;  4AKH A;  1LKX A;  5FKY A;  2UXX B;  3AAA B;  3TLV A;  2EHO C;  2ODV A;  2V6X A;  4IE7 A;  2WBL A;  1U4Q A;  4LFA T;  2NWB A;  5BR8 T;  3J7Y q;  1OED E;  1J1J A;  3AEC A;  5FVK A;  1SA0 E;  2QYW A;  4DV4 T;  1BR2 A;  3DP7 A;  2UXN B;  5F5W A;  3ZMS B;  4KI0 F;  3NRY A;  2MPK A;  3PU3 A;  4AQG A;  4HEA A;  3CKD A;  5AQT B;  4MLK A;  2ZM2 A;  3KV6 A;  4DVD A;  3N9N A;  3V5U A;  4ASK A;  3AED A;  1X79 A;  5JR9 A;  5KXJ A;  4ZS3 A;  2WDQ A;  2YK0 A;  1XDO A;  4H9S E;  3AB3 B;  3D0T A;  2WU2 A;  4QH5 A;  5FY0 A;  3MAC A;  3O1H A;  3TKL B;  4CZZ B;  5JRC A;  4I55 E;  2E9X C;  5JDF A;  2DLR A;  2EHO D;  1S35 A;  2E5L T;  1DU2 A;  2XQ9 A;  3ZMT B;  5A1L A;  3C64 A;  4EAH A;  3WI3 A;  3ZN1 B;  5AQG B;  4DMW A;  2VKH A;  3KVB A;  5C3J A;  3H3M A;  4QWN B;  3A8Y C;  3SFD A;  2ZLY A;  4HWF A;  3ANW B;  3RHW A;  3A5X A;  3QUJ A;  2VVS A;  4DID B;  2WWV A;  4HE8 A;  5JTG A;  3C98 B;  2XY8 B;  2V7J A;  5KDM C;  1VRB A;  3LK3 B;  4WYV A;  5LHG B;  3PUX F;  2JPF A;  4IDQ A;  4UXN B;  2JJ9 A;  2PJQ A;  4A97 A;  4EEB A;  4JEU B;  5EK4 A;  2PBI A;  2LT3 A;  4BAY B;  2N1G A;  5FXW A;  5AQM B;  3O1J A;  3AE5 A;  1MIV A;  2JRK A;  3AEF A;  4DV3 T;  4JI0 T;  2OA5 A;  4HWI B;  2CA5 A;  2E9X D;  1YQ4 A;  2XM1 A;  4H9R C;  5JR9 B;  2YOE A;  5HWX A;  5JH7 E;  5LG4 A;  2N2N A;  4XZC A;  5JDL A;  2KMF A;  1B7T A;  2VL0 A;  1H7C A;  1SHZ C;  4JI7 T;  2BG9 C;  3UU4 A;  3P4W A;  4UVB B;  2WSS V;  2E8I A;  5JRC B;  4YHH T;  3AXJ A;  4OK0 A;  4AQY T;  3QC9 A;  4AI6 A;  3C4W A;  3AE8 A;  2D9D A;  5FNV E;  5LGN B;  5HCJ A;  4TWH A;  2H3R A;  1OED A;  2Q9Q A;  4GIW A;  1UCU A;  4TV9 E;  3C4X A;  4YJ2 E;  4QH4 A;  5C8Y E;  2X9W A;  3SFE A;  1WR6 A;  4MFR A;  1WYB A;  1HX1 B;  5DAB A;  2NOX A;  3SOL A;  1XNR T;  4BA9 A;  1XWM A;  4DR5 T;  2FJE A;  4KMC A;  3CML A;  4U72 A;  4UF0 A;  2BS3 A;  3O1I A;  4U74 A;  4LF5 T;  4O4H E;  2LM2 A;  3P7I A;  4UR9 A;  1GQE A;  2LOP A;  4H9O C;  4CI1 B;  3RF1 A;  1N32 T;  1HFA A;  4A56 A;  3KBT A;  2DNX A;  4NIQ A;  4B6X A;  2V26 A;  1W9R A;  3LK4 2;  4AKR B;  2D0T A;  5ETW A;  4YJ3 E;  2V7K A;  3PUR A;  4X66 T;  5IWA T;  1CUN A;  4FJO A;  4O8S A;  2IIU A;  4U7Y A;  2VKO A;  4DMV A;  5F3J A;  1IAP A;  3MK7 C;  4ZOL E;  2UXB T;  5FYM A;  5L3G B;  1MIY A;  4ZZB A;  1Y64 B;  3AXJ B;  2AXD S;  2L9Q A;  3AE3 A;  2X67 A;  3NKZ A;  2JMH A;  2FUP A;  1MMG A;  1XMO T;  2ZM0 A;  1ZKE A;  1HS7 A;  4IST A;  5HEG A;  3UUN A;  1OED B;  2Q9Q B;  1KEY A;  2HH7 A;  4WBO A;  4ANJ A;  2LKH A;  2DHR A;  5JQG E;  3P4R A;  2DCF A;  4FI5 A;  2CPT A;  4IE4 A;  5AQO B;  4JV5 T;  2CWY A;  2IML A;  2WDV A;  5JRE A;  1U5P A;  4HKA A;  4QXC B;  3ONL C;  5HEJ A;  4F6R C;  2W4X A;  3EAB A;  4UF0 B;  2W63 A;  2Y48 B;  2KWH A;  1MNE A;  4DO0 A;  1FEW A;  2Z6E A;  2CWO A;  1AJ3 A;  5LB7 B;  4IGU A;  5L4H A;  4AKG A;  3HKB E;  4I0U A;  4G2A A;  1D0Y A;  2LJL A;  3K8P C;  2CHO A;  1NEK A;  2YN6 A;  4XBF B;  4X20 E;  4DV7 T;  3RX6 A;  3E0Z A;  2VL8 A;  3QK6 A;  2LHR A;  3N2O A;  1EZ3 A;  3L09 A;  2I6H A;  4OYJ A;  4GK0 E;  3I1A A;  4X1I E;  3FXE B;  2W00 A;  3VKG A;  2CCQ A;  2BS4 A;  1MMA A;  3ZN0 B;  3ZMU B;  2V5D A;  2W0G A;  4IE5 A;  4YT0 A;  5C2T A;  4G63 A;  3NWI A;  1HF8 A;  2XTL A;  2V7M A;  3LBX A;  3FZL B;  5JR9 C;  3UU6 A;  2ES0 A;  3A7M A;  4NUU A;  3EDV A;  4GOU A;  3N9M A;  3Q5W A;  3PUG A;  4OHF A;  3ZC1 A;  1ZOY A;  4Z91 A;  2LSY A;  2V7I A;  2A72 A;  2H7O A;  2CRB A;  1FIO A;  1O3X A;  4O2A E;  2GK9 A;  5LP6 E;  3PJA A;  4IHJ E;  3NVO A;  4CI2 B;  3ZYK A;  1UK5 A;  1QLB A;  4P09 A;  3ZJ2 A;  5FL1 A;  4JI6 T;  1HX8 A;  4HFB A;  2CMR A;  5JDG A;  3RPU A;  4YHJ A;  1D1B A;  4DND A;  5FXX A;  2XQ4 A;  4COF A;  2PFV A;  4JUY A;  3VU7 H;  4LF4 T;  4KUM B;  5AQV B;  4QX8 B;  4U7I A;  4PJL A;  3B5M A;  2M67 A;  2X0H A;  1YXR A;  3C4Z A;  2JMK A;  4ZXL A;  2FBW A;  2H89 A;  4CXW A;  5FY1 A;  1W09 A;  3UUB A;  2WM9 A;  4EYU A;  3T1Y T;  5LYJ E;  3R6N A;  1IBL T;  3WAJ A;  4EV6 A;  3FZM B;  3SWH A;  3KIN B;  4EIW A;  4HN9 A;  3LBX B;  5FMN A;  3PUZ F;  5LNK A;  3OJA A;  4HWD A;  4IIJ E;  4B3M T;  3OKQ A;  3HI2 A;  2H7V C;  2VUR A;  4B3T T;  2HPJ A;  3GN5 B;  3Q5X A;  4O4J E;  3EAM A;  5EK2 A;  4IDZ A;  1D1A A;  3AA6 B;  3H37 A;  2Y8D A;  3AE7 A;  5L47 A;  4NXN T;  2UXC T;  2J1D G;  1US7 B;  3T1H T;  3VR9 A;  2OLT A;  3UUL A;  3PE0 A;  3B57 A;  2Q9Q C;  5HXS A;  4JYA T;  4GK5 E;  4PNI A;  5CB4 E;  1BR4 A;  3IF8 B;  3ZT5 A;  3ONX A;  3Q9D A;  5HXR A;  4YY3 T;  5EK3 A;  3CQC B;  4QKN A;  4GKJ T;  3I0O A;  3N9P A;  2BKP A;  2XHE B;  2CXL A;  3CX7 B;  3F57 A;  2VVN A;  1KK7 A;  5FL0 A;  2WDR A;  3N9Q A;  1R8I A;  3AE1 A;  4YSZ A;  3IA3 A;  2NW8 A;  3ZPO A;  2VKD A;  4CN1 A;  3IHR A;  4EZH A;  4HWH A;  4YFS A;  5CA1 E;  2YDQ A;  3BK9 A;  1KNR A;  2RA1 A;  1HNX T;  3ZJ1 A;  1FJG T;  3VRA A;  4TWF A;  2BVM A;  4HFV A;  3LSV A;  5LG3 A;  2NTY A;  1J5E T;  5ABF A;  2J62 A;  2NP9 A;  3RYF E;  2BG9 E;  4EZ4 A;  3LJC A;  3KBU A;  3EVY A;  2LE8 A;  5J2T E;  2Q9Q D;  3RH3 A;  2BBJ A;  1ZHC A;  2CBI A;  2WU5 A;  3CPZ A;  5F8P A;  1D0Z A;  4IL9 A;  3AVS A;  2YEV C;  1E2A A;  1Y01 A;  3PTR B;  5FVL A;  2D2S A;  5CA0 E;  5KMG P;  3OBV E;  5HAX A;  3MA9 A;  3FZK B;  3KDS E;  5JDH A;  1HG5 A;  3VKH A;  2XAJ B;  3AE9 A;  4DBR A;  2WY2 A;  2ACZ A;  4MAL A;  3OYX A;  2D0U A;  3I9W A;  1T72 A;  3F31 A;  4LFC T;  2J4G A;  2BDE A;  4EGW A;  3UUM A;  5CJ5 A;  5L3C B;  4DR3 T;  3G06 A;  4Z8X A;  1L0V A;  1E1H B;  4ZZC A;  1CHU A;  2ZM8 A;  2XQ3 A;  2VK9 A;  3AVR A;  2VQF T;  3L8R A;  3RRC A;  2BS2 A;  3RYH E;  2R6G F;  4U3C A;  4OX9 T;  2UUA T;  2AE9 A;  4Z90 A;  5AQL B;  2WZH A;  3ABV A;  2K9A A;  2E5V A;  3N5L A;  5JDN A;  3BQL A;  2YDS A;  5ABF B;  1V9D A;  3P4P A;  2XPK A;  5J1G A;  2ZM6 T;  3CQX C;  2X51 A;  4M1P A;  3SRZ A;  4UV8 B;  4KHP T;  3DTO A;  2HN1 A;  3ETV A;  2XQY A;  5H6Q B;  4P0B A;  4EXT A;  1XMQ T;  3NZQ A;  4IL4 A;  1WRD A;  3ZYL A;  5LHI B;  1WLX A;  2V5C A;  3UUX B;  5LGU B;  3P4Q A;  4IRE A;  3HR0 A;  4DBQ A;  5L3B B;  3HA4 A;  2RPA A;  3QOF A;  3C50 A;  2KLQ A;  5HXE A;  2FJB A;  5FXV A;  3HL6 A;  4HFC A;  2LSG A;  2N9D A;  4JI5 T;  2H88 A;  2FJD A;  5HYA A;  4ERR A;  4P1N A;  3FZH B;  3K3Q C;  4YTN A;  2IHR 1;  2QGS A;  3JAD A;  1BR0 A;  4EB6 E;  1IJ6 A;  4ZS2 A;  3KFW X;  3UU3 A;  5TAO A;  3JCF A;  2XAS B;  5HEO A;  3ZCI A;  4LF8 T;  2IC9 A;  2XQ7 A;  5AQU B;  2LOS A;  2MBG A;  3UFE A;  4V1A v;  4H63 V;  1XZY A;  2YDR A;  4JBW F;  4TV8 E;  4AKI A;  3CWZ B;  3ZT6 A;  5LOV E;  5CFB A;  2WWU A;  3RIA A;  1T98 A;  4E7Z A;  3IBP A;  2HPL A;  4UVC B;  1XNQ T;  4WZX A;  3RQU A;  4GYR A;  5L2L A;  4UIG A;  1LVF A;  2Y6X A;  3BQK A;  5AQQ B;  2DWG A;  1Z8U A;  5LA6 E;  3UTK A;  1QSD A;  1HTJ F;  3OPC A;  2ZMA A;  1W0B A;  4MHC A;  5ADX L;  2X9X A;  2WZI A;  5AQK B;  4PFP A;  4DUY T;  1YD8 G;  5AQP B;  2OV9 A;  3ZLI A;  1WCR A;  2B76 A;  4CN6 A;  1NWM X;  4CI3 B;  3R84 B;  3UFG A;  3HKE E;  2KXP B;  4LF6 T;  2LLY A;  4ADZ A;  5IYZ E;  5L3F B;  2V6Y A;  4A98 A;  3AE2 A;  3ZEF B;  4ILU A;  3EI0 A;  4U2Y A;  1MMN A;  3MXZ A;  4YTP A;  2NTX A;  4QXH B;  2V8S V;  1KNP A;  2DL1 A;  3VHL A;  1N36 T;  4U33 A;  3UQ7 A;  4YXD A;  3GN5 A;  4CN4 A;  3CVR A;  2JQH A;  3RIU A;  1UUR A;  4DR1 T;  2KWI B;  1W0A A;  4DUZ T;  1D0X A;  2BG9 B;  4OYK A;  3ZKR A;  1IJ5 A;  1S94 A;  2VKJ A;  3AEG A;  4ISS A;  3RKG A;  2BBH A;  5HEU A;  3RIF A;  3CK6 A;  4J2C A;  2KIN B;  2G0U A;  5LGT B;  4I50 E;  5ABH A;  1OXZ A;  1JNR A;  4QH1 A;  4B3S T;  3MKD A;  4B3R T;  4H9Q C;  3LG7 A;  1WR0 A;  5HEH A;  2W62 A; 
#chains in the Genus database with same CATH homology
 3N9Q A;  4PAG A;  3C51 A;  5HXC A;  2NW8 A;  3SOL A;  3AAE B;  3ZPO A;  3GMI A;  5IHY A;  5AFU L;  3BQI A;  4BA9 A;  1MIW A;  2VKD A;  5H6R B;  1YKH B;  3J9X 1;  4WBN E;  3IHR A;  4EZH A;  3KV4 A;  2LSI A;  4YFS A;  3L3P A;  4X1K E;  4AQF A;  5CA1 E;  3AAI A;  2LSJ A;  4KMC A;  3CML A;  4U72 A;  4UF0 A;  1WYC A;  4MBQ A;  4UVA B;  3BK9 A;  2RA1 A;  3FXD B;  3O1I A;  4U74 A;  3PUS A;  3ZJ1 A;  2BVL A;  4O4H E;  3P7I A;  2CLY C;  5DJQ C;  2BVM A;  5HXH A;  2YIN A;  4HFV A;  2LOP A;  2XUE A;  3K3O A;  4H9O C;  2I59 A;  2VB6 A;  4PK5 A;  4QX7 B;  4CI1 B;  2NTY A;  2YU2 A;  1HFA A;  3MJX A;  4A56 A;  3KBT A;  2DNX A;  2C5K T;  2NP9 A;  2CXD A;  2X0L B;  2X66 A;  2XAF B;  4B6X A;  2V26 A;  2LSK A;  3RYF E;  3LK4 2;  1HG2 A;  4IE0 A;  5FP3 A;  4AKR B;  4EZ4 A;  3LJC A;  2D0T A;  4HTE A;  5ETW A;  4YJ3 E;  2V7K A;  3PUR A;  4I4T E;  3KBU A;  3S4U A;  3EVY A;  3N9L A;  4X1Y E;  2LE8 A;  5J2T E;  2Q9Q D;  3ZMV B;  1CUN A;  4FJO A;  3IEE A;  3RH3 A;  4YLH A;  3B13 A;  4O8S A;  1ZHC A;  4CQI A;  3CPZ A;  3JC6 D;  2A3D A;  2ACX A;  2MTQ A;  3O4X E;  5F8P A;  1D0Z A;  2BZB A;  3AVS A;  2YEV C;  5LHH B;  2VKO A;  3PUQ A;  4DMV A;  3PTR B;  5DQV A;  5F3J A;  2D2S A;  1IAP A;  3I0Q A;  3I9Y A;  3MK7 C;  5CA0 E;  4ZOL E;  5KMG P;  1ZEE A;  3OBV E;  2NW7 A;  5FYM A;  5HAX A;  1NAF A;  3CX8 B;  5L3G B;  3NZP A;  2PG8 A;  3GA8 A;  1MIY A;  3MA9 A;  2C5J A;  3ZCJ A;  3KDS E;  2NW9 A;  4AKL A;  4N78 D;  5JDH A;  4ZI3 C;  3PUA A;  4P0A A;  1HG5 A;  1Y64 B;  3VKH A;  2L9Q A;  2XAJ B;  2QA7 A;  3AA0 B;  2X67 A;  3SS1 A;  4MAL A;  4DBR A;  3OYX A;  2D0U A;  3I9W A;  4H9N C;  4UEL A;  2JMH A;  3F2E A;  1MMG A;  3F31 A;  3CQG B;  2X9H A;  1BR1 A;  2P9B A;  3N2K E;  4PK4 A;  2ZM0 A;  1ZKE A;  1HS7 A;  2BDE A;  1KNZ A;  4IST A;  2RP4 A;  4PW8 A;  3UUN A;  2Q9Q B;  5FXZ A;  2HH7 A;  4WBO A;  3UUM A;  5L3C B;  5EZY E;  4ANJ A;  2L8K A;  3JC6 C;  4Z8X A;  2DHR A;  5JQG E;  3K3N A;  2DCF A;  4FI5 A;  1E1H B;  3Q2M A;  5FY7 A;  2X9Y A;  4IE4 A;  2ZM8 A;  2CWY A;  3FBL A;  3N2G E;  2LM9 A;  4H63 H;  3KV9 A;  2SPC A;  2KZ7 B;  4CXY A;  1HCI A;  3PDY A;  4PFO A;  2VK9 A;  5JRE A;  1U5P A;  1VOM A;  4QHO A;  4HKA A;  5KX5 E;  2L3L A;  2XAH B;  4QXC B;  4WW0 A;  3MZK B;  4EOZ B;  5E0O A;  3AVR A;  3KV5 A;  4GYS A;  3OYZ A;  4I43 B;  3RRC A;  4UEM A;  4F6R C;  4UF0 B;  5J2U E;  2W63 A;  2Y48 B;  3RRW A;  3RYH E;  2KWH A;  1MNE A;  4DO0 A;  3EUH A;  4OFZ A;  1LRZ A;  3LK2 B;  1FEW A;  4O2B E;  5DQW A;  2Z6E A;  1FMW A;  2CWO A;  1AJ3 A;  3T8O A;  3KVA A;  3E08 A;  4O4L E;  2K9A A;  2KND A;  3NRX A;  2IW5 B;  4EYY R;  4IGU A;  4PJN A;  3N5L A;  5JDN A;  1LVK A;  3BQL A;  5LJM A;  4AKG A;  3HKB E;  1V9D A;  5J1G A;  4G2A A;  3CQX C;  2IC6 A;  1D0Y A;  2X51 A;  4M1P A;  2CLY B;  2LJL A;  3CX6 B;  3SRZ A;  3K8P C;  5GON E;  3LFM A;  4UV8 B;  1UX4 A;  3H3A A;  4TX5 A;  3AA1 B;  4ZI3 D;  5L3D B;  3DTO A;  4L9I A;  1YKE B;  3ETV A;  2XQY A;  5HWY A;  3UT5 E;  3FBZ A;  4TZ4 C;  5H6Q B;  2DWK A;  4P0B A;  4XBF B;  4X20 E;  4IE6 A;  4EXT A;  3RC3 A;  3RX6 A;  3E0Z A;  2VL8 A;  3ANW A;  3NZQ A;  3QK6 A;  4CXX A;  1WRD A;  2X68 A;  3ZYL A;  5LHI B;  1WLX A;  4K0U A;  1LKX A;  3HKD E;  4AKH A;  2WMN A;  2D5U A;  2UXX B;  3UUX B;  3AAA B;  5LGU B;  2LHR A;  3N2O A;  2EHO C;  2ODV A;  1EZ3 A;  4IE7 A;  3HR0 A;  2WBL A;  1U4Q A;  3L09 A;  4DBQ A;  4OYJ A;  4GK0 E;  3I1A A;  4X1I E;  5JDM A;  3FXE B;  5L3B B;  2NWB A;  4ZI2 C;  3J7Y q;  3HA4 A;  2W00 A;  3VKG A;  2CCQ A;  3C50 A;  2KLQ A;  5HXE A;  2DI4 A;  1MMA A;  5LBM A;  1SA0 E;  3HL6 A;  5FXV A;  3ZN0 B;  2LSG A;  2N9D A;  1G73 A;  3HKC E;  3V5S A;  2EHO A;  2K48 A;  3ZMU B;  1BR2 A;  3DP7 A;  2UXN B;  2W0G A;  4IE5 A;  5HYA A;  4WNK A;  4G63 A;  3ZMS B;  4ERR A;  1HF8 A;  2XTL A;  4C91 A;  3NRY A;  3K3Q C;  3PU3 A;  2V7M A;  3LBX A;  4AQG A;  4HEA A;  5JR9 C;  3CKD A;  2K5B B;  2WMO A;  2QGS A;  2ES0 A;  4NUU A;  3EDV A;  2XAG B;  4MLK A;  4GOU A;  2ZM2 A;  1BR0 A;  4EB6 E;  3KV6 A;  1IJ6 A;  4ZS2 A;  3KFW X;  5TAO A;  4DVD A;  3N9M A;  3N9N A;  3V5U A;  4ASK A;  1YW0 A;  3Q5W A;  3PUG A;  2XAS B;  4OHF A;  3ZC1 A;  2CE7 A;  2WAU A;  2V1D B;  2LSY A;  1X79 A;  5JR9 A;  4ZS3 A;  3ZCI A;  2YK0 A;  2V7I A;  2CEA A;  2IC9 A;  4H9S E;  2A72 A;  2H7O A;  2LOS A;  3AB3 B;  2MBG A;  1FIO A;  1O3X A;  3UFE A;  3D0T A;  4O2A E;  2GK9 A;  5LP6 E;  4V1A v;  4H63 V;  5FY0 A;  4IHJ E;  3MAC A;  3O1H A;  3U78 A;  4CI2 B;  3ZYK A;  3RYI E;  4PJJ A;  4P09 A;  3ZJ2 A;  3EDU A;  4QXB B;  3TKL B;  4TV8 E;  1HX8 A;  4CZZ B;  3RYC E;  4KP3 C;  4AKI A;  5JRC A;  4O4I E;  4I55 E;  2CMR A;  2E9X C;  3CWZ B;  5JDG A;  4TUY E;  5LOV E;  2WWU A;  3RPU A;  2LHN A;  2W61 A;  1T98 A;  2DLR A;  5JDF A;  2EHO D;  4E7Z A;  5LBQ B;  3IBP A;  4YHJ A;  1S35 A;  2HPL A;  4UVC B;  1D1B A;  2V7L A;  4DND A;  3ETU A;  3ZMT B;  4ZI2 D;  4GYR A;  2E9X A;  3W15 B;  5A1L A;  1UX5 A;  5FXX A;  5L2L A;  4UIG A;  3C64 A;  5DAB A;  4EAH A;  1LVF A;  2PFV A;  4JUY A;  3VU7 H;  2Y6X A;  3WI3 A;  3ZN1 B;  3BQK A;  2DWG A;  2B1E A;  2VKH A;  4DMW A;  3KVB A;  5LA6 E;  3UTK A;  1QSD A;  4KUM B;  4NUV A;  1HTJ F;  5LJN A;  2ZMA A;  4QX8 B;  4PJL A;  4QWN B;  2M67 A;  3ZC0 A;  4KBM B;  5LXT E;  4MHC A;  2ZLY A;  3U3I A;  5LCY A;  5ADX L;  3ANW B;  3ZMZ B;  1FMV A;  2X9X A;  3A5X A;  4XAX B;  3C4Z A;  3QUJ A;  4ZHQ E;  4UV9 B;  2JMK A;  4PFP A;  4HE8 A;  3WAK A;  1YD8 G;  2LEH A;  2CXF A;  4HGA A;  3ZLI A;  4CXW A;  5FY1 A;  5M4Y A;  3C98 B;  3E22 E;  2V7J A;  5KDM C;  1VRB A;  3AA7 B;  2C0S A;  3LK3 B;  5LHG B;  3O9X A;  2WM9 A;  1NWM X;  3FB2 A;  4CI3 B;  3R84 B;  4EYU A;  2JPF A;  5LYJ E;  1IZN B;  3R6N A;  4UXN B;  3WAJ A;  2JJ9 A;  2EHO B;  2PJQ A;  4E7S A;  3HKE E;  2KXP B;  2C5I T;  4JEU B;  2ODU A;  2A2F X;  4ADZ A;  5EK4 A;  2PBI A;  1MMD A;  2LT3 A;  4BAY B;  3SWH A;  5IYZ E;  2N1G A;  5FXW A;  5L3F B;  3O1J A;  1MIV A;  2JRK A;  3KIN B;  4EIW A;  5BMV E;  4HN9 A;  3ZEF B;  3ZYM A;  3LBX B;  5FMN A;  2KT9 A;  5LNK A;  4ILU A;  2OA5 A;  3OJA A;  1MMN A;  3MXZ A;  4IIJ E;  3ESL A;  5JVD E;  1MND A;  2CA5 A;  2NTX A;  2E9X D;  2XAQ B;  3OKQ A;  4QXH B;  3HI2 A;  2H7V C;  4H9R C;  2HPJ A;  4PK6 A;  3GN5 B;  3Q5X A;  3VHL A;  2JQQ A;  5L3E B;  4O4J E;  5JR9 B;  5HWX A;  5LG4 A;  3RKO A;  5JH7 E;  1OWA A;  4BJN A;  2N2N A;  4IDZ A;  4XZC A;  5EK2 A;  5JDL A;  2KMF A;  1D1A A;  2MYS A;  1B7T A;  3FHN A;  3AA6 B;  3H37 A;  3GN5 A;  2CM0 A;  1H7C A;  2Y8D A;  3CVR A;  1G8X A;  3GWH A;  1SHZ C;  3DJB A;  4JEH B;  2YU1 A;  4H9P C;  2KWI B;  4PJM A;  1D0X A;  2J1D G;  4OYK A;  1US7 B;  4UVB B;  4AXP A;  1IJ5 A;  4JLE A;  1ZV4 X;  1S94 A;  3UUL A;  2WSS V;  2E8I A;  2VKJ A;  3PE0 A;  4ISS A;  5JRC B;  4OK0 A;  4BJM A;  3N9O A;  3B57 A;  3QC9 A;  4L5G A;  4ZI7 E;  3PU8 A;  2Q9Q C;  4AI6 A;  3C4W A;  5HXS A;  4GK5 E;  2K24 A;  4L0R A;  5FNV E;  4PNI A;  5CB4 E;  1BR4 A;  2IAK A;  2VWA A;  4J2C A;  5LGN B;  3RC8 A;  3IF8 B;  1D1C A;  4C90 A;  3ONX A;  1Z0P A;  2E9X B;  3Q9D A;  2KIN B;  3P8C D;  5HXR A;  5JDQ A;  2G0U A;  5LGT B;  4I50 E;  2H3R A;  1OXZ A;  2Q9Q A;  2MOZ A;  5EK3 A;  3CQC B;  4GIW A;  1UCU A;  4TV9 E;  3M65 A;  4QKN A;  3C4X A;  4TN7 B;  4YJ2 E;  3I0O A;  3MKD A;  3N9P A;  5C8Y E;  2X9W A;  4H9Q C;  1QUU A;  3NBX X;  1WR6 A;  3LG7 A;  4MFR A;  2XHE B;  4AQF C;  2CXL A;  3CX7 B;  3F57 A;  2VAS A;  2W62 A;  1WYB A;  1KK7 A;  2NOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...