2LSGA

Solution structure of the mouse rev1 c-terminal domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords DNA repair protein REV1
publication title Multifaceted recognition of vertebrate Rev1 by translesion polymerases zeta and kappa.
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsgA00
4GK0E 3VU7H 2LSGA 4BA9A 2LSYA 2LSIA 4EXTA 2LSKA 4GK5E 4FJOA 2LSJA 2N1GA
chains in the Genus database with same CATH superfamily
2YN6A 4UVBB 5HEOA 2VQFT 1I94T 1KK7A 4B3ST 4YTMA 4IE7A 3PUWF 3L39A 2CM0A 4P1NA 3KBTA 2XQYA 1N34T 3P50A 4ADZA 2EHOA 4ASKA 3ZT5A 3KBUA 2WWVA 1BR0A 2C5IT 1NENA 4LF5T 2LE8A 3UTKA 2PBIA 1ZEEA 4LFBT 2BDEA 5HXRA 2K48A 3EVYA 2A9UA 4KX6A 5HEUA 3ZT7A 4TNWA 3TLVA 4UEMA 5BMVE 2HN1A 4DR5T 2QVAA 1YW0A 4IGUA 2LHNA 3N2KE 4AQGA 4U2ZA 1UX5A 1WCRA 3AAEB 2IUBA 3K8PC 4HWCA 4OHFA 5A1LA 3RYIE 1UK5A 5AQFB 3JADA 2F4VT 2YINA 2ODUA 2DL1A 3HKCE 4DNDA 4NUUA 1LKXA 3HKDE 2L9QA 5EZYE 3RX6A 4ZI3D 2Q9QC 3DJBA 2RP4A 1NAFA 2H7OA 2ZM2A 1ZOYA 3MJXA 3M3ZB 4DIDB 3O4XE 1HS7A 2L8KA 2CA5A 4G63A 3NRYA 5FXVA 2A3DA 3PUXF 2XJ7A 3IEEA 3FZLB 5M4YA 5HEGA 1DU2A 5FY1A 4DR6T 2W2UA 3KV9A 2WU2A 4XBFB 5F8PA 3H3MA 3R84B 4LMLA 3ZKRA 3RKOA 3GA8A 1UURA 3AE2A 3H3AA 2WBLA 1IZNB 3AB3B 3U78A 2AE9A 1D0ZA 4ZZCA 4XAXB 4DR4T 3HKEE 5C2TA 3MZKB 4AKHA 4HN9A 3NZPA 4MFRA 3TLTA 2JJ9A 5LG4A 1NEKA 4DV4T 1XWMA 4YHJA 3AAAB 5L3FB 2ZLYA 4ILAA 5FVKA 1BR4A 4U31A 3A7MA 2N1GA 1W9RA 3M65A 3I1AA 5L3BB 5H6QB 3IHRA 2B1EA 4O4IE 2D0UA 4A98A 5GONE 2DNXA 2M67A 2X0LB 5CA0E 2V7JA 3BQIA 2WM9A 5L2LA 4J2CA 1D0XA 5JVDE 2W4XA 2KXPB 4HGAA 4B3RT 2V7MA 2V6XA 4ZI3C 2MPKA 5L3EB 4QH5A 2XQ4A 4YTNA 4K0KT 3AE6A 3MK7C 2KZ7B 4DBQA 2BS3A 5LHHB 5JDFA 3N9NA 2H7VC 1IJ6A 4TV9E 3ZCIA 1N33T 2JMHA 3L8RA 4YHHT 4GK0E 4YSXA 4ZHQE 3W15B 3ZYKA 3VHLA 4ZI2D 3ESLA 1I6ZA 2JQHA 2MYSA 4CXWA 3B5MA 3UU4A 3L09A 2E9XD 1U4QA 2K9AA 4L5GA 5AQQB 4YSZA 4DR1T 3UUMA 3N5LA 2E9XB 5IWAT 4EB6E 4PK6A 1QSDA 3CX6B 3ZJ2A 4F6RC 2KLQA 4L0RA 4PJLA 4AQYT 4QH1A 4CI2B 4P0AA 2PTFA 4UVCB 3X1DA 2XQ3A 4LF4T 2X9HA 2KINB 4YFSA 5L3CB 5JRCB 4ISSA 4IDNA 1X9BA 4U72A 3ZEFB 2XAHB 5AQKB 3T1HT 4HWIB 1LVKA 3J7Yq 1ZKEA 3BQLA 3N9LA 4HFDA 2LT3A 5LGTB 3EI0A 5AQSB 2IAKA 4HFEA 4DR3T 3V5UA 3E08A 4LMKA 3OPCA 2UXXB 3AE4A 5FMNA 4HFCA 2XAGB 2BBHA 2D2SA 5ABFB 2IW5B 3KINB 1HX1B 3RI5A 2UUAT 5LYJE 4IL9A 4QHOA 3UFGA 1D1AA 4I4TE 2LLYA 4DR2T 2C5JA 3A8YC 3AE8A 4OYKA 2V5CA 2LJLA 2B76A 2Y48B 2FUPA 1SHZC 3VR9A 4CXXA 5LGNB 4JI2T 4GYRA 3AE1A 3RIAA 4EV6A 1B7TA 3P4RA 1U5PA 3OTOT 2A2FX 2MAWA 1G73A 4QXHB 3PTRB 3QK6A 1KNRA 4BA9A 4HTEA 1XNQT 3PU3A 2N9DA 3CIRA 2BS4A 1E1HB 1MNEA 2LOPA 1YQ4A 4UVAB 2HN2A 2DWGA 2X67A 2WS3A 4KP3C 2YDRA 3ZN0B 4PAGA 2IIUA 4TUYE 4V1Av 4OX9T 3AXJB 4LF8T 4GKKT 2H89A 3GMIA 4QXCB 2WDRA 2XM2A 1VOMA 2LKHA 2VVNA 3ZC1A 1KF6A 4IE6A 3AA0B 4ILCA 1EZ3A 5HYAA 4P0BA 5HWYA 2V5DA 4HWDA 2X9WA 4MLKA 3AEAA 1KFYA 1MMDA 4JI3T 3CX7B 1M62A 1OEDB 4PJNA 2W00A 5DQWA 4U7IA 2XM1A 4JI0T 4ZEYA 4ZS2A 2VKHA 3NWIA 2XZEA 4EGWA 1JNZA 4PK4A 3FZKB 2X51A 1JNRA 4HWFA 2M6BA 4X1YE 2CEAA 3FXEB 2DCFA 2YU2A 2E5VA 2ZM0A 3VR8A 4EEBA 4KUMB 2LM2A 3LK3B 2VL0A 2FJDA 4UXNB 3EDUA 2VKOA 2OA5A 3I0QA 3Q5WA 3ZPOA 3S4UA 2UXDT 2UU9T 3PJAA 4GYSA 1QUUA 2LKGA 2XAFB 4UF0B 2W66A 3ETUA 3CX8B 4L9IA 4A5XA 1D1CA 2XAQB 2JRKA 2BVMA 2EHOD 4HWHA 2XY8B 4ZOLE 2Q9QA 5HEJA 1W09A 3FHNA 4U33A 4YSYA 2EHOB 3KV4A 1YXRA 4H9NC 4B3MT 3TLUA 2XQ9A 2DHRA 5LHIB 2YK0A 3ZLIA 3VRAA 3QB5A 1HFAA 4O2BE 1XMOT 1US7B 2WSSV 3GWHA 3UU8A 3UT5E 2XHEB 3UU3A 3WAKA 5C3JA 4CXYA 2JMKA 2KWIB 4TNVA 3AE5A 4UV8B 4PFOA 2X9XA 5J1GA 3OJAA 2AXDS 2ZM6T 4PJMA 5LGUB 4AQFC 1IJ5A 1IBKT 4CN4A 2CWOA 3LG7A 3KVBA 4A56A 3KFWX 3RRWA 3J9X1 1V9DA 3SFDA 4CN6A 4UV9B 3RYFE 5LBQB 5FVLA 2BG9C 1S94A 3C50A 4IHJE 3ZC0A 2KWHA 4IL4A 1H7CA 2X66A 4DO0A 4CZZB 3R6NA 1HNWT 1UGOA 4ISTA 3ZYMA 2QGSA 3PUVF 4U74A 5L3GB 4MBQA 3WAJA 4DV3T 4IDPA 2NR4A 5JDHA 3QC9A 4YJ3E 1T7SA 2NWBA 2NW9A 4UR9A 4QX7B 3UFEA 2WCAA 5FKYA 4JI5T 2H88A 4CN1A 4PJJA 2V7KA 5ADXL 1KEYA 2KNDA 3CQGB 3LBXA 4A97A 2JIWA 2H3RA 5LG3A 2VVSA 4YJ2E 2XTLA 3RIUA 3SFEA 2LRKA 3AA6B 4EOZB 3PUZF 3QNUA 5AQTB 4DVDA 4Z90A 5HXCA 4IE4A 5CGMA 3RYCE 3CQCB 3N9MA 3B13A 3UUBA 2W0GA 1T72A 2V1DB 5AQOB 4WYVA 2ACZA 4EEDA 2OLTA 5HCJA 2FJAA 2RPAA 5KXJA 2CPTA 2LEHA 1VCSA 1E7PA 3C64A 4YY3T 3Q2MA 2NOXA 3O1HA 4E7SA 5L4EA 4NUVA 2BS2A 2CWYA 5CB4E 2V26A 1YQ3A 4GOUA 2UXCT 3A5XA 1J5WA 5EK3A 1W0BA 3UULA 3JC6D 4ZS3A 3ZMVB 2VK9A 4PW8A 2CBIA 5HXHA 4JYAT 4YXDA 2A72A 2ZMAA 2XSBA 5JR9B 5LNKA 3UU5A 5JDLA 2WAUA 2UXBT 5JR9A 4CQIA 4HKAA 4JEUB 4TWHA 4WBOA 5LJNA 3O1IA 1IBLT 4QH4A 5CFBA 4HFVA 5KMGP 3C98B 3PUGA 3CKDA 3P4QA 4E7ZA 3C4ZA 5JDMA 2WB5A 3K1SA 2PG8A 5HXSA 5AQHB 3AE7A 4C90A 4UELA 3PE0A 1FMVA 3EUHA 2W67A 3NRXA 2IHR1 2GK9A 3AVSA 1HG2A 3CWZB 2BKNA 1HG5A 3EDVA 2CRBA 4H9SE 5AQIB 3AE3A 3WI3A 4I43B 1BR1A 3OVUA 3I0OA 4DUYT 1N36T 3F31A 5AQJB 2YDSA 4KHPT 1AJ3A 3N9PA 1XNRT 1XMQT 4MALA 3VKGA 3E0ZA 2UXNB 2J4GA 3ANWB 1GQEA 2V7LA 5ABGA 3ANWA 2C5KT 4H9OC 3EHZA 3ONLC 3PUSA 2LSJA 4ZZBA 2MOZA 2CLYB 3RH3A 4QX8B 5JDQA 1ZV4X 3SOLA 1OWAA 4BJMA 4Z8XA 3CMLA 3UQ7A 1HR0T 3K3QC 1MMNA 5DABA 5AQGB 4H9QC 2V6YA 1E2AA 4Q25A 2N2NA 4WNKA 5J0ZA 3LFMA 4ANJA 5LOVE 5AQRB 3C51A 4AKRB 4K0UA 4ZI7E 5BR8T 3N9QA 2YDQA 2QA7A 4XZCA 4H9PC 3RC8A 4ZI2C 3FZMB 4NXNT 4X20E 4HFHA 4G2AA 2BBJA 2LSKA 2E9XC 3FBZA 3AEBA 4GIWA 1R8IA 5DJQC 2X9YA 2PJQA 4JEHB 4BAYB 4COFA 2X0HA 3ZMZB 2QYWA 5HEHA 3ZJ1A 4KI0F 3ZSSA 1MNDA 4LFAT 4CI3B 2VKJA 3FZHB 5EK4A 2Z6EA 4IDQA 1KNZA 2E5LT 3P4PA 3PDYA 3KVAA 1UX4A 4O4LE 1MIVA 5JQGE 5AFUL 1KNPA 4GKJT 4OFZA 4AIUA 5IUXA 3MA9A 2WWUA 5FNVE 4X64T 4FJOA 2NTYA 1FIOA 3UUXB 3ETVA 2WDVA 3PURA 4ILUA 3NKZA 3N9OA 5L47A 4PK5A 4DBRA 5FXWA 5FP3A 4Z91A 4H63H 2VURA 4HFIA 3MXZA 3OBVE 5LA6E 3UQ4A 3P8CD 3GN5B 4AQFA 5C8YE 2LSYA 1T8BA 2FJEA 4F8HA 3B57A 3GN5A 2DLRA 4X5TA 5ABEA 1BR2A 5EK2A 2UUBT 1CUNA 2LOSA 2WP9A 2M6IA 3RQWA 1N32T 4O2AE 4I55E 3SRZA 3D0TA 4TWFA 5CJ5A 1LRZA 2NW8A 4UIGA 3JAFA 5HWXA 1D0YA 5ETWA 2Q9QD 1CHUA 2BG9A 2Q9QB 3K3NA 2I0MA 2BG9E 2KMFA 2YEVC 4NPPA 1SA0E 1NWMX 3FZFB 5KX5E 3NBXX 5E0OA 2CE7A 3DTOA 4EZHA 4C91A 5FXXA 3HI2A 2W62A 1SE7A 1Z0PA 2YOEA 3DP7A 3RPUA 2KT9A 3AEFA 4DV5T 3ZMTB 4I50E 2V8SV 3P4SA 3C4WA 3OYZA 4N78D 1OEDC 3T1YT 3HR0A 4P09A 2VKDA 2CBJA 3VKHA 1XZYA 5CA1E 4H9RC 4WW0A 2X68A 2V7IA 3TLSA 3ZT6A 5F3JA 3N2GE 1WFDA 4X1KE 3G06A 4NXMT 2ES0A 4JI7T 3K3OA 2HPLA 2Y6XA 2E2AA 4JLEA 2J1DG 3AEEA 4DV6T 1HNXT 4AI6A 3IF8B 4HE8A 3ZN1B 4IREA 5FXZA 3RHWA 2FJBA 3OYXA 1MIWA 2HPJA 4YLHA 1VCTA 2WMOA 4FI5A 3L3PA 4DV1T 4EYYR 4BJNA 4JI8T 1Z8UA 4DUZT 4ZXLA 4ILBA 1HX8A 1Y64B 2XASB 1HF8A 4IE5A 2UUCT 4WZXA 3ONXA 4TZ4C 1ZHCA 3QB5K 1MIYA 1WYCA 2EHOC 3UUNA 3UU6A 4YT0A 3AA1B 1FEWA 4O8SA 2QRXA 3LK2B 3P4WA 4LFCT 1S35A 5JDGA 3LBXB 2CHNA 4NIQA 4DMWA 3ZSTA 4DMVA 4ERRA 1YD8G 2BKPA 1YKHB 3NZQA 3CVRA 5AQVB 3RF1A 3KV5A 5LBMA 3P7IA 3TKLB 2LSIA 3EABA 4OK0A 3ZMUB 1Y01A 3U3IA 2K5BB 3I9WA 3RC3A 3O9XA 4DV7T 3FB2A 3AA7B 2CMRA 1WRDA 1WR0A 3C4XA 5FY7A 5LP6E 3ZYLA 2D0TA 2IMLA 2XAJB 5LMNT 2WZIA 4IIJE 4OYJA 2X0YA 2WU5A 3HL6A 4X1IE 3AEGA 3ABVA 4EZ4A 4AXPA 4U7YA 3PUYF 3AAIA 2IDOB 4O4JE 5HAXA 1IAPA 1MMAA 4HEAA 2K3WA 5IHYA 5LXTE 3OKQA 2XPKA 3F57A 2VASA 4TX5A 5FL1A 2CXFA 3RYHE 2W61A 5AQMB 5LJMA 5F5WA 4EYUA 2WZHA 1UCUA 3NVOA 2K24A 4GK5E 5FL0A 3AEDA 5LMUT 3CQXC 3JAEA 2LRLA 1G8XA 2CXDA 3E22E 3RIUC 3LK42 3BK9A 2MTQA 2YU1A 2LM9A 3MKDA 4PNIA 2BVLA 3AECA 2CCQA 3RIFA 2VQET 4B3TT 2OV9A 4HFBA 5AQUB 2BZBA 4M1PA 1D1BA 5TAOA 1FMWA 2SPCA 5J2UE 3RRCA 4QXBB 2NP9A 4X65T 2DI4A 4LF7T 2W63A 2RA1A 5LB7B 1M7KA 3VRBA 1W0AA 2E9XA 3KDSE 4PFPA 3LDQB 2L3LA 1XDPA 3IA3A 3QUJA 5JREA 4LF9T 3Q5DA 3T8OA 1HTJF 3PUQA 5AQNB 5LHGB 2WY2A 2I6HA 3RQUA 5HXEA 5JRCA 2HH7A 5L3DB 4IDZA 3Q5XA 4DR7T 2PFVA 4U2YA 2Y8DA 2LHRA 4QKNA 3ZMSB 3JC6C 1HNZT 2CXLA 4JI4T 2JQKA 4TV8E 4JBWF 1HCIA 4AKIA 3ONJA 3RLFF 4U3CA 1YKEB 5KDMC 1XDOA 5JR9C 3CPZA 4H63V 2V6YB 2J47A 1ZP0A 3PUAA 2I59A 2JPFA 2XSAA 3TLWA 1WYBA 2ACXA 2WMNA 3AE9A 4MHCA 3PU8A 5LCYA 3PJAJ 5IYZE 2IC6A 5JDNA 5ABFA 1FJGT 4TN7B 2LSGA 3RGLA 4JUYA 1J5ET 4EAHA 4DV2T 4IDOA 2J62A 2R6GF 4X62T 1SUMB 2IC9A 5DQVA 4DV0T 2P9BA 4YTPA 4CI1B 3LJCA 3F2EA 3FBLA 2MBGA 3SWHA 4JV5T 2D5UA 5ABHA 4AKGA 2VL8A 1WLXA 4EXTA 5FY0A 3H37A 4I0UA 2C0SA 4JI1T 4KMCA 2YKSA 3HKBE 4O4HE 2KSRA 2XQ6A 4EIWA 2XQ8A 3QOFA 4JI6T 2NW7A 1VRBA 4TWDA 5AQLB 1X79A 3AXJA 2WQYA 2VB6A 2G0UA 2XQ7A 5FYMA 4B6XA 2NTXA 2XUEA 4AKLA 2VWAA 3FXDB 2HHHT 2XQAA 2CLYC 2FBWA 5H6RB 5AQPB 1MMGA 3Q9DA 3O1JA 3I9YA 4IE0A 3IBPA 2WDQA 1UUSA 3ZCJA 2BKOA 5JTGA 1OXZA 1OEDA 2XQ5A 1T98A 2JQQA 1WR6A 4KBMB 5JH7E 1OEDE 4AISA 3VU7H 2E8IA 1J1JA 3N2OA 2CHOA 1O3XA 3HA4A 4IT4A 3EAMA 4QWNB 3MACA 3PV0F 3KV6A 1QLBA 2ODVA 3CK6A 1L0VA 3SS1A 2D9DA 5L4HA 1LVFA 3LSVA 3Q5EA 4WBNE 3JCFA 4LMJA 2BG9B 5J2TE 2JQ9A 3V5SA 4KHZF 3RKGA 3AVRA 1IBMT 2ZM8A 4UF0A 5HCMA 4X66T 4LF6T 3BQKA 2DWKA
chains in the Genus database with same CATH topology
1G73A 4UVBB 4DMWA 4C90A 1KK7A 4QXHB 4UELA 3PE0A 1FMVA 3PTRB 4DMVA 3QK6A 4IE7A 4ERRA 4BA9A 3EUHA 4HTEA 3PU3A 1YD8G 3NZQA 1YKHB 2CM0A 2N9DA 3CVRA 3NRXA 2GK9A 3AVSA 3KBTA 1HG2A 2XQYA 1E1HB 3CWZB 1MNEA 2LOPA 3KV5A 4UVAB 5LBMA 3P7IA 3TKLB 1HG5A 2DWGA 4ADZA 2EHOA 4ASKA 3EDVA 3KBUA 2X67A 2LSIA 4H9SE 4KP3C 1BR0A 3ZN0B 2C5IT 4OK0A 3ZMUB 4PAGA 2LE8A 3WI3A 4TUYE 4V1Av 3UTKA 4I43B 2PBIA 3U3IA 2K5BB 1ZEEA 1BR1A 3I9WA 2BDEA 3GMIA 4QXCB 3RC3A 5HXRA 3O9XA 3I0OA 1VOMA 2K48A 3EVYA 3F31A 3FB2A 3ZC1A 3AA7B 4IE6A 2CMRA 3AA0B 1WRDA 1EZ3A 1AJ3A 4UEMA 4P0BA 3N9PA 5HYAA 3C4XA 5BMVE 5HWYA 5FY7A 4MALA 2X9WA 5LP6E 4MLKA 3ZYLA 1YW0A 4IGUA 1MMDA 3VKGA 3CX7B 2LHNA 2D0TA 3E0ZA 2UXNB 3N2KE 4AQGA 2XAJB 3ANWB 4PJNA 1UX5A 2W00A 3AAEB 5DQWA 2V7LA 3ANWA 4IIJE 2C5KT 4ZS2A 3K8PC 2VKHA 4H9OC 4OYJA 4OHFA 5A1LA 3PUSA 2LSJA 3HL6A 4X1IE 3RYIE 4EZ4A 2MOZA 4AXPA 2CLYB 3RH3A 4PK4A 2YINA 2X51A 2ODUA 4QX8B 5JDQA 3AAIA 4X1YE 2CEAA 1ZV4X 3FXEB 3SOLA 2DCFA 3HKCE 4O4JE 5HAXA 1OWAA 4BJMA 4Z8XA 4DNDA 4NUUA 1IAPA 1MMAA 1LKXA 2YU2A 3HKDE 2ZM0A 3CMLA 4HEAA 5IHYA 2L9QA 5LXTE 3OKQA 5EZYE 4KUMB 3LK3B 3K3QC 3F57A 1MMNA 2VASA 5DABA 3RX6A 4TX5A 4ZI3D 4UXNB 4H9QC 2CXFA 2Q9QC 3EDUA 3RYHE 2W61A 5LJMA 3DJBA 2VKOA 2RP4A 2OA5A 1NAFA 4EYUA 2H7OA 2ZM2A 2N2NA 3I0QA 4WNKA 3MJXA 3Q5WA 1UCUA 2K24A 3ZPOA 4GK5E 3LFMA 3S4UA 4ANJA 5LOVE 3C51A 4GYSA 3O4XE 1HS7A 4AKRB 1QUUA 2XAFB 3CQXC 4K0UA 4UF0B 4ZI7E 2L8KA 2CA5A 3N9QA 4G63A 2QA7A 4XZCA 3ETUA 1G8XA 4H9PC 3RC8A 3NRYA 3CX8B 2CXDA 4ZI2C 3E22E 3LK42 4L9IA 5FXVA 4X20E 2A3DA 3BK9A 2MTQA 1D1CA 2YU1A 2LM9A 3IEEA 4G2AA 2XAQB 5M4YA 2LSKA 3MKDA 2JRKA 4PNIA 2BVLA 2E9XC 2CCQA 2BVMA 2EHOD 3FBZA 5FY1A 4GIWA 4ZOLE 5DJQC 2Q9QA 2X9YA 3FHNA 2BZBA 2EHOB 2PJQA 3KV4A 3KV9A 4H9NC 4JEHB 4BAYB 4M1PA 1D1BA 5TAOA 4XBFB 1FMWA 3ZMZB 5F8PA 2SPCA 3ZJ1A 5J2UE 3RRCA 4QXBB 3R84B 2NP9A 3RKOA 3GA8A 2DHRA 5LHIB 2YK0A 3H3AA 3ZLIA 2WBLA 2DI4A 1IZNB 3AB3B 1MNDA 2W63A 3U78A 4CI3B 2VKJA 2RA1A 1D0ZA 1HFAA 5EK4A 2Z6EA 4O2BE 2E9XA 1KNZA 4XAXB 3HKEE 1US7B 3PDYA 2PG8A 2WSSV 3KDSE 3KVAA 3GWHA 1UX4A 4PFPA 4O4LE 2L3LA 3UT5E 2XHEB 1MIVA 3WAKA 3MZKB 5JQGE 4CXYA 5AFUL 2JMKA 4AKHA 2KWIB 4HN9A 3QUJA 4UV8B 3NZPA 4MFRA 4PFOA 4OFZA 5JREA 2X9XA 3MA9A 2JJ9A 5JDGA 5LG4A 2WWUA 5FNVE 4YHJA 5J1GA 3OJAA 3T8OA 4FJOA 1HTJF 3AAAB 5L3FB 2ZLYA 2NTYA 3PUQA 4PJMA 5LGUB 4AQFC 1BR4A 1FIOA 3UUXB 1IJ5A 5LHGB 2N1GA 3ETVA 2CWOA 3LG7A 3I1AA 3M65A 5L3BB 5HXEA 3PURA 4ILUA 3KVBA 5JRCA 2HH7A 3N9OA 5L3DB 4IDZA 5H6QB 3IHRA 3Q5XA 4A56A 4PK5A 2B1EA 4O4IE 2D0UA 4DBRA 2PFVA 5FXWA 3KFWX 5FP3A 3RRWA 2Y8DA 2LHRA 4QKNA 3ZMSB 3JC6C 4H63H 2A2FX 5GONE 2DNXA 2CXLA 2M67A 2X0LB 4TV8E 1V9DA 3J9X1 5CA0E 2V7JA 3MXZA 3BQIA 2WM9A 5L2LA 3OBVE 5LA6E 4UV9B 1HCIA 4J2CA 4AKIA 3RYFE 1D0XA 1YKEB 5JVDE 5LBQB 5KDMC 3P8CD 5JR9C 2KXPB 4HGAA 3CPZA 4H63V 2V7MA 4ZI3C 3GN5B 1S94A 4AQFA 5L3EB 5C8YE 2LSYA 3PUAA 3B57A 2I59A 3GN5A 3C50A 2JPFA 2DLRA 4IHJE 3ZC0A 1WYBA 2KWHA 1BR2A 5EK2A 2ACXA 2WMNA 4MHCA 1CUNA 2LOSA 3PU8A 4O2AE 1H7CA 2X66A 4DO0A 5LCYA 4CZZB 4I55E 3SRZA 3D0TA 5IYZE 3MK7C 2IC6A 2KZ7B 5JDNA 4DBQA 3R6NA 5ADXL 1LRZA 2NW8A 4ISTA 3ZYMA 4TN7B 4UIGA 5HWXA 2LSGA 1D0YA 2QGSA 5ETWA 2Q9QD 4JUYA 5LHHB 4EAHA 5JDFA 3N9NA 4U74A 2H7VC 4MBQA 5L3GB 3WAJA 1IJ6A 2Q9QB 4TV9E 3ZCIA 3K3NA 5JDHA 3QC9A 2JMHA 4GK0E 2KMFA 4YJ3E 2YEVC 2NWBA 2NW9A 1SA0E 4ZHQE 2IC9A 5DQVA 4QX7B 3W15B 3UFEA 1NWMX 2P9BA 3ZYKA 4CI1B 5KX5E 3NBXX 3VHLA 3LJCA 4ZI2D 4PJJA 5E0OA 2CE7A 2V7KA 3ESLA 3F2EA 3FBLA 2MBGA 2D5UA 3DTOA 3SWHA 4EZHA 4C91A 2KNDA 3CQGB 3LBXA 2MYSA 5FXXA 4CXWA 4AKGA 2H3RA 3HI2A 2VL8A 3L09A 2E9XD 1U4QA 2K9AA 4YJ2E 1WLXA 2W62A 4EXTA 2XTLA 4L5GA 1Z0PA 3AA6B 3UUMA 3N5LA 2E9XB 3DP7A 5FY0A 3RPUA 3H37A 4EOZB 2KT9A 4EB6E 3ZMTB 2C0SA 4I50E 4KMCA 4DVDA 4PK6A 3HKBE 1QSDA 4O4HE 5HXCA 3C4WA 4EIWA 4IE4A 3CX6B 3ZJ2A 4F6RC 2KLQA 3OYZA 4L0RA 4N78D 2NW7A 4PJLA 1VRBA 3RYCE 3CQCB 3N9MA 4CI2B 1X79A 4P0AA 3HR0A 3B13A 4P09A 2VKDA 2W0GA 4UVCB 2V1DB 3VKHA 2VB6A 2G0UA 2X9HA 5FYMA 5CA1E 4H9RC 4B6XA 2KINB 2X68A 2NTXA 4WW0A 4YFSA 2V7IA 2XUEA 5L3CB 5JRCB 4AKLA 4ISSA 5F3JA 2VWAA 3FXDB 3N2GE 2LEHA 4X1KE 2CLYC 5H6RB 2ES0A 1MMGA 3C64A 3Q9DA 4U72A 3ZEFB 3O1JA 3I9YA 4IE0A 2XAHB 2HPLA 2Y6XA 3IBPA 3K3OA 3Q2MA 4JLEA 2J1DG 1LVKA 2NOXA 3O1HA 4E7SA 3J7Yq 1ZKEA 3ZCJA 4AI6A 3BQLA 3IF8B 1OXZA 3N9LA 4HE8A 4NUVA 5CB4E 2CWYA 3ZN1B 2LT3A 5FXZA 5LGTB 2V26A 1T98A 2IAKA 2JQQA 4GOUA 1WR6A 4KBMB 5JH7E 3A5XA 3OYXA 1MIWA 3V5UA 3VU7H 2E8IA 3E08A 2HPJA 3N2OA 4YLHA 2WMOA 1O3XA 4FI5A 3L3PA 5EK3A 2UXXB 3UULA 3JC6D 4ZS3A 4BJNA 5FMNA 3ZMVB 4EYYR 2VK9A 3HA4A 4QWNB 3MACA 2XAGB 3KV6A 4PW8A 2ODVA 1HX8A 2D2SA 5HXHA 3SS1A 1LVFA 1Y64B 3KINB 2IW5B 2XASB 5LYJE 2A72A 1HF8A 4QHOA 4WBNE 2ZMAA 4IE5A 3ONXA 1D1AA 5JR9B 5J2TE 4TZ4C 4I4TE 1ZHCA 5LNKA 1MIYA 2C5JA 5JDLA 2WAUA 1WYCA 5JR9A 3V5SA 4OYKA 4CQIA 2LJLA 4HKAA 2EHOC 4JEUB 4WBOA 3UUNA 2Y48B 1SHZC 3AA1B 1FEWA 3AVRA 5LJNA 3O1IA 4O8SA 4CXXA 5LGNB 4HFVA 4GYRA 5KMGP 2ZM8A 3C98B 3PUGA 3CKDA 4UF0A 4E7ZA 3LK2B 1B7TA 3C4ZA 5JDMA 1S35A 1U5PA 3BQKA 5HXSA 3LBXB 2DWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GK0 E;  3VU7 H;  2LSG A;  4BA9 A;  2LSY A;  2LSI A;  4EXT A;  2LSK A;  4GK5 E;  4FJO A;  2LSJ A;  2N1G A; 
#chains in the Genus database with same CATH topology
 2YN6 A;  4UVB B;  5HEO A;  2VQF T;  1I94 T;  1KK7 A;  4B3S T;  4YTM A;  4IE7 A;  3PUW F;  3L39 A;  2CM0 A;  4P1N A;  3KBT A;  2XQY A;  1N34 T;  3P50 A;  4ADZ A;  2EHO A;  4ASK A;  3ZT5 A;  3KBU A;  2WWV A;  1BR0 A;  2C5I T;  1NEN A;  4LF5 T;  2LE8 A;  3UTK A;  2PBI A;  1ZEE A;  4LFB T;  2BDE A;  5HXR A;  2K48 A;  3EVY A;  2A9U A;  4KX6 A;  5HEU A;  3ZT7 A;  4TNW A;  3TLV A;  4UEM A;  5BMV E;  2HN1 A;  4DR5 T;  2QVA A;  1YW0 A;  4IGU A;  2LHN A;  3N2K E;  4AQG A;  4U2Z A;  1UX5 A;  1WCR A;  3AAE B;  2IUB A;  3K8P C;  4HWC A;  4OHF A;  5A1L A;  3RYI E;  1UK5 A;  5AQF B;  3JAD A;  2F4V T;  2YIN A;  2ODU A;  2DL1 A;  3HKC E;  4DND A;  4NUU A;  1LKX A;  3HKD E;  2L9Q A;  5EZY E;  3RX6 A;  4ZI3 D;  2Q9Q C;  3DJB A;  2RP4 A;  1NAF A;  2H7O A;  2ZM2 A;  1ZOY A;  3MJX A;  3M3Z B;  4DID B;  3O4X E;  1HS7 A;  2L8K A;  2CA5 A;  4G63 A;  3NRY A;  5FXV A;  2A3D A;  3PUX F;  2XJ7 A;  3IEE A;  3FZL B;  5M4Y A;  5HEG A;  1DU2 A;  5FY1 A;  4DR6 T;  2W2U A;  3KV9 A;  2WU2 A;  4XBF B;  5F8P A;  3H3M A;  3R84 B;  4LML A;  3ZKR A;  3RKO A;  3GA8 A;  1UUR A;  3AE2 A;  3H3A A;  2WBL A;  1IZN B;  3AB3 B;  3U78 A;  2AE9 A;  1D0Z A;  4ZZC A;  4XAX B;  4DR4 T;  3HKE E;  5C2T A;  3MZK B;  4AKH A;  4HN9 A;  3NZP A;  4MFR A;  3TLT A;  2JJ9 A;  5LG4 A;  1NEK A;  4DV4 T;  1XWM A;  4YHJ A;  3AAA B;  5L3F B;  2ZLY A;  4ILA A;  5FVK A;  1BR4 A;  4U31 A;  3A7M A;  2N1G A;  1W9R A;  3M65 A;  3I1A A;  5L3B B;  5H6Q B;  3IHR A;  2B1E A;  4O4I E;  2D0U A;  4A98 A;  5GON E;  2DNX A;  2M67 A;  2X0L B;  5CA0 E;  2V7J A;  3BQI A;  2WM9 A;  5L2L A;  4J2C A;  1D0X A;  5JVD E;  2W4X A;  2KXP B;  4HGA A;  4B3R T;  2V7M A;  2V6X A;  4ZI3 C;  2MPK A;  5L3E B;  4QH5 A;  2XQ4 A;  4YTN A;  4K0K T;  3AE6 A;  3MK7 C;  2KZ7 B;  4DBQ A;  2BS3 A;  5LHH B;  5JDF A;  3N9N A;  2H7V C;  1IJ6 A;  4TV9 E;  3ZCI A;  1N33 T;  2JMH A;  3L8R A;  4YHH T;  4GK0 E;  4YSX A;  4ZHQ E;  3W15 B;  3ZYK A;  3VHL A;  4ZI2 D;  3ESL A;  1I6Z A;  2JQH A;  2MYS A;  4CXW A;  3B5M A;  3UU4 A;  3L09 A;  2E9X D;  1U4Q A;  2K9A A;  4L5G A;  5AQQ B;  4YSZ A;  4DR1 T;  3UUM A;  3N5L A;  2E9X B;  5IWA T;  4EB6 E;  4PK6 A;  1QSD A;  3CX6 B;  3ZJ2 A;  4F6R C;  2KLQ A;  4L0R A;  4PJL A;  4AQY T;  4QH1 A;  4CI2 B;  4P0A A;  2PTF A;  4UVC B;  3X1D A;  2XQ3 A;  4LF4 T;  2X9H A;  2KIN B;  4YFS A;  5L3C B;  5JRC B;  4ISS A;  4IDN A;  1X9B A;  4U72 A;  3ZEF B;  2XAH B;  5AQK B;  3T1H T;  4HWI B;  1LVK A;  3J7Y q;  1ZKE A;  3BQL A;  3N9L A;  4HFD A;  2LT3 A;  5LGT B;  3EI0 A;  5AQS B;  2IAK A;  4HFE A;  4DR3 T;  3V5U A;  3E08 A;  4LMK A;  3OPC A;  2UXX B;  3AE4 A;  5FMN A;  4HFC A;  2XAG B;  2BBH A;  2D2S A;  5ABF B;  2IW5 B;  3KIN B;  1HX1 B;  3RI5 A;  2UUA T;  5LYJ E;  4IL9 A;  4QHO A;  3UFG A;  1D1A A;  4I4T E;  2LLY A;  4DR2 T;  2C5J A;  3A8Y C;  3AE8 A;  4OYK A;  2V5C A;  2LJL A;  2B76 A;  2Y48 B;  2FUP A;  1SHZ C;  3VR9 A;  4CXX A;  5LGN B;  4JI2 T;  4GYR A;  3AE1 A;  3RIA A;  4EV6 A;  1B7T A;  3P4R A;  1U5P A;  3OTO T;  2A2F X;  2MAW A;  1G73 A;  4QXH B;  3PTR B;  3QK6 A;  1KNR A;  4BA9 A;  4HTE A;  1XNQ T;  3PU3 A;  2N9D A;  3CIR A;  2BS4 A;  1E1H B;  1MNE A;  2LOP A;  1YQ4 A;  4UVA B;  2HN2 A;  2DWG A;  2X67 A;  2WS3 A;  4KP3 C;  2YDR A;  3ZN0 B;  4PAG A;  2IIU A;  4TUY E;  4V1A v;  4OX9 T;  3AXJ B;  4LF8 T;  4GKK T;  2H89 A;  3GMI A;  4QXC B;  2WDR A;  2XM2 A;  1VOM A;  2LKH A;  2VVN A;  3ZC1 A;  1KF6 A;  4IE6 A;  3AA0 B;  4ILC A;  1EZ3 A;  5HYA A;  4P0B A;  5HWY A;  2V5D A;  4HWD A;  2X9W A;  4MLK A;  3AEA A;  1KFY A;  1MMD A;  4JI3 T;  3CX7 B;  1M62 A;  1OED B;  4PJN A;  2W00 A;  5DQW A;  4U7I A;  2XM1 A;  4JI0 T;  4ZEY A;  4ZS2 A;  2VKH A;  3NWI A;  2XZE A;  4EGW A;  1JNZ A;  4PK4 A;  3FZK B;  2X51 A;  1JNR A;  4HWF A;  2M6B A;  4X1Y E;  2CEA A;  3FXE B;  2DCF A;  2YU2 A;  2E5V A;  2ZM0 A;  3VR8 A;  4EEB A;  4KUM B;  2LM2 A;  3LK3 B;  2VL0 A;  2FJD A;  4UXN B;  3EDU A;  2VKO A;  2OA5 A;  3I0Q A;  3Q5W A;  3ZPO A;  3S4U A;  2UXD T;  2UU9 T;  3PJA A;  4GYS A;  1QUU A;  2LKG A;  2XAF B;  4UF0 B;  2W66 A;  3ETU A;  3CX8 B;  4L9I A;  4A5X A;  1D1C A;  2XAQ B;  2JRK A;  2BVM A;  2EHO D;  4HWH A;  2XY8 B;  4ZOL E;  2Q9Q A;  5HEJ A;  1W09 A;  3FHN A;  4U33 A;  4YSY A;  2EHO B;  3KV4 A;  1YXR A;  4H9N C;  4B3M T;  3TLU A;  2XQ9 A;  2DHR A;  5LHI B;  2YK0 A;  3ZLI A;  3VRA A;  3QB5 A;  1HFA A;  4O2B E;  1XMO T;  1US7 B;  2WSS V;  3GWH A;  3UU8 A;  3UT5 E;  2XHE B;  3UU3 A;  3WAK A;  5C3J A;  4CXY A;  2JMK A;  2KWI B;  4TNV A;  3AE5 A;  4UV8 B;  4PFO A;  2X9X A;  5J1G A;  3OJA A;  2AXD S;  2ZM6 T;  4PJM A;  5LGU B;  4AQF C;  1IJ5 A;  1IBK T;  4CN4 A;  2CWO A;  3LG7 A;  3KVB A;  4A56 A;  3KFW X;  3RRW A;  3J9X 1;  1V9D A;  3SFD A;  4CN6 A;  4UV9 B;  3RYF E;  5LBQ B;  5FVL A;  2BG9 C;  1S94 A;  3C50 A;  4IHJ E;  3ZC0 A;  2KWH A;  4IL4 A;  1H7C A;  2X66 A;  4DO0 A;  4CZZ B;  3R6N A;  1HNW T;  1UGO A;  4IST A;  3ZYM A;  2QGS A;  3PUV F;  4U74 A;  5L3G B;  4MBQ A;  3WAJ A;  4DV3 T;  4IDP A;  2NR4 A;  5JDH A;  3QC9 A;  4YJ3 E;  1T7S A;  2NWB A;  2NW9 A;  4UR9 A;  4QX7 B;  3UFE A;  2WCA A;  5FKY A;  4JI5 T;  2H88 A;  4CN1 A;  4PJJ A;  2V7K A;  5ADX L;  1KEY A;  2KND A;  3CQG B;  3LBX A;  4A97 A;  2JIW A;  2H3R A;  5LG3 A;  2VVS A;  4YJ2 E;  2XTL A;  3RIU A;  3SFE A;  2LRK A;  3AA6 B;  4EOZ B;  3PUZ F;  3QNU A;  5AQT B;  4DVD A;  4Z90 A;  5HXC A;  4IE4 A;  5CGM A;  3RYC E;  3CQC B;  3N9M A;  3B13 A;  3UUB A;  2W0G A;  1T72 A;  2V1D B;  5AQO B;  4WYV A;  2ACZ A;  4EED A;  2OLT A;  5HCJ A;  2FJA A;  2RPA A;  5KXJ A;  2CPT A;  2LEH A;  1VCS A;  1E7P A;  3C64 A;  4YY3 T;  3Q2M A;  2NOX A;  3O1H A;  4E7S A;  5L4E A;  4NUV A;  2BS2 A;  2CWY A;  5CB4 E;  2V26 A;  1YQ3 A;  4GOU A;  2UXC T;  3A5X A;  1J5W A;  5EK3 A;  1W0B A;  3UUL A;  3JC6 D;  4ZS3 A;  3ZMV B;  2VK9 A;  4PW8 A;  2CBI A;  5HXH A;  4JYA T;  4YXD A;  2A72 A;  2ZMA A;  2XSB A;  5JR9 B;  5LNK A;  3UU5 A;  5JDL A;  2WAU A;  2UXB T;  5JR9 A;  4CQI A;  4HKA A;  4JEU B;  4TWH A;  4WBO A;  5LJN A;  3O1I A;  1IBL T;  4QH4 A;  5CFB A;  4HFV A;  5KMG P;  3C98 B;  3PUG A;  3CKD A;  3P4Q A;  4E7Z A;  3C4Z A;  5JDM A;  2WB5 A;  3K1S A;  2PG8 A;  5HXS A;  5AQH B;  3AE7 A;  4C90 A;  4UEL A;  3PE0 A;  1FMV A;  3EUH A;  2W67 A;  3NRX A;  2IHR 1;  2GK9 A;  3AVS A;  1HG2 A;  3CWZ B;  2BKN A;  1HG5 A;  3EDV A;  2CRB A;  4H9S E;  5AQI B;  3AE3 A;  3WI3 A;  4I43 B;  1BR1 A;  3OVU A;  3I0O A;  4DUY T;  1N36 T;  3F31 A;  5AQJ B;  2YDS A;  4KHP T;  1AJ3 A;  3N9P A;  1XNR T;  1XMQ T;  4MAL A;  3VKG A;  3E0Z A;  2UXN B;  2J4G A;  3ANW B;  1GQE A;  2V7L A;  5ABG A;  3ANW A;  2C5K T;  4H9O C;  3EHZ A;  3ONL C;  3PUS A;  2LSJ A;  4ZZB A;  2MOZ A;  2CLY B;  3RH3 A;  4QX8 B;  5JDQ A;  1ZV4 X;  3SOL A;  1OWA A;  4BJM A;  4Z8X A;  3CML A;  3UQ7 A;  1HR0 T;  3K3Q C;  1MMN A;  5DAB A;  5AQG B;  4H9Q C;  2V6Y A;  1E2A A;  4Q25 A;  2N2N A;  4WNK A;  5J0Z A;  3LFM A;  4ANJ A;  5LOV E;  5AQR B;  3C51 A;  4AKR B;  4K0U A;  4ZI7 E;  5BR8 T;  3N9Q A;  2YDQ A;  2QA7 A;  4XZC A;  4H9P C;  3RC8 A;  4ZI2 C;  3FZM B;  4NXN T;  4X20 E;  4HFH A;  4G2A A;  2BBJ A;  2LSK A;  2E9X C;  3FBZ A;  3AEB A;  4GIW A;  1R8I A;  5DJQ C;  2X9Y A;  2PJQ A;  4JEH B;  4BAY B;  4COF A;  2X0H A;  3ZMZ B;  2QYW A;  5HEH A;  3ZJ1 A;  4KI0 F;  3ZSS A;  1MND A;  4LFA T;  4CI3 B;  2VKJ A;  3FZH B;  5EK4 A;  2Z6E A;  4IDQ A;  1KNZ A;  2E5L T;  3P4P A;  3PDY A;  3KVA A;  1UX4 A;  4O4L E;  1MIV A;  5JQG E;  5AFU L;  1KNP A;  4GKJ T;  4OFZ A;  4AIU A;  5IUX A;  3MA9 A;  2WWU A;  5FNV E;  4X64 T;  4FJO A;  2NTY A;  1FIO A;  3UUX B;  3ETV A;  2WDV A;  3PUR A;  4ILU A;  3NKZ A;  3N9O A;  5L47 A;  4PK5 A;  4DBR A;  5FXW A;  5FP3 A;  4Z91 A;  4H63 H;  2VUR A;  4HFI A;  3MXZ A;  3OBV E;  5LA6 E;  3UQ4 A;  3P8C D;  3GN5 B;  4AQF A;  5C8Y E;  2LSY A;  1T8B A;  2FJE A;  4F8H A;  3B57 A;  3GN5 A;  2DLR A;  4X5T A;  5ABE A;  1BR2 A;  5EK2 A;  2UUB T;  1CUN A;  2LOS A;  2WP9 A;  2M6I A;  3RQW A;  1N32 T;  4O2A E;  4I55 E;  3SRZ A;  3D0T A;  4TWF A;  5CJ5 A;  1LRZ A;  2NW8 A;  4UIG A;  3JAF A;  5HWX A;  1D0Y A;  5ETW A;  2Q9Q D;  1CHU A;  2BG9 A;  2Q9Q B;  3K3N A;  2I0M A;  2BG9 E;  2KMF A;  2YEV C;  4NPP A;  1SA0 E;  1NWM X;  3FZF B;  5KX5 E;  3NBX X;  5E0O A;  2CE7 A;  3DTO A;  4EZH A;  4C91 A;  5FXX A;  3HI2 A;  2W62 A;  1SE7 A;  1Z0P A;  2YOE A;  3DP7 A;  3RPU A;  2KT9 A;  3AEF A;  4DV5 T;  3ZMT B;  4I50 E;  2V8S V;  3P4S A;  3C4W A;  3OYZ A;  4N78 D;  1OED C;  3T1Y T;  3HR0 A;  4P09 A;  2VKD A;  2CBJ A;  3VKH A;  1XZY A;  5CA1 E;  4H9R C;  4WW0 A;  2X68 A;  2V7I A;  3TLS A;  3ZT6 A;  5F3J A;  3N2G E;  1WFD A;  4X1K E;  3G06 A;  4NXM T;  2ES0 A;  4JI7 T;  3K3O A;  2HPL A;  2Y6X A;  2E2A A;  4JLE A;  2J1D G;  3AEE A;  4DV6 T;  1HNX T;  4AI6 A;  3IF8 B;  4HE8 A;  3ZN1 B;  4IRE A;  5FXZ A;  3RHW A;  2FJB A;  3OYX A;  1MIW A;  2HPJ A;  4YLH A;  1VCT A;  2WMO A;  4FI5 A;  3L3P A;  4DV1 T;  4EYY R;  4BJN A;  4JI8 T;  1Z8U A;  4DUZ T;  4ZXL A;  4ILB A;  1HX8 A;  1Y64 B;  2XAS B;  1HF8 A;  4IE5 A;  2UUC T;  4WZX A;  3ONX A;  4TZ4 C;  1ZHC A;  3QB5 K;  1MIY A;  1WYC A;  2EHO C;  3UUN A;  3UU6 A;  4YT0 A;  3AA1 B;  1FEW A;  4O8S A;  2QRX A;  3LK2 B;  3P4W A;  4LFC T;  1S35 A;  5JDG A;  3LBX B;  2CHN A;  4NIQ A;  4DMW A;  3ZST A;  4DMV A;  4ERR A;  1YD8 G;  2BKP A;  1YKH B;  3NZQ A;  3CVR A;  5AQV B;  3RF1 A;  3KV5 A;  5LBM A;  3P7I A;  3TKL B;  2LSI A;  3EAB A;  4OK0 A;  3ZMU B;  1Y01 A;  3U3I A;  2K5B B;  3I9W A;  3RC3 A;  3O9X A;  4DV7 T;  3FB2 A;  3AA7 B;  2CMR A;  1WRD A;  1WR0 A;  3C4X A;  5FY7 A;  5LP6 E;  3ZYL A;  2D0T A;  2IML A;  2XAJ B;  5LMN T;  2WZI A;  4IIJ E;  4OYJ A;  2X0Y A;  2WU5 A;  3HL6 A;  4X1I E;  3AEG A;  3ABV A;  4EZ4 A;  4AXP A;  4U7Y A;  3PUY F;  3AAI A;  2IDO B;  4O4J E;  5HAX A;  1IAP A;  1MMA A;  4HEA A;  2K3W A;  5IHY A;  5LXT E;  3OKQ A;  2XPK A;  3F57 A;  2VAS A;  4TX5 A;  5FL1 A;  2CXF A;  3RYH E;  2W61 A;  5AQM B;  5LJM A;  5F5W A;  4EYU A;  2WZH A;  1UCU A;  3NVO A;  2K24 A;  4GK5 E;  5FL0 A;  3AED A;  5LMU T;  3CQX C;  3JAE A;  2LRL A;  1G8X A;  2CXD A;  3E22 E;  3RIU C;  3LK4 2;  3BK9 A;  2MTQ A;  2YU1 A;  2LM9 A;  3MKD A;  4PNI A;  2BVL A;  3AEC A;  2CCQ A;  3RIF A;  2VQE T;  4B3T T;  2OV9 A;  4HFB A;  5AQU B;  2BZB A;  4M1P A;  1D1B A;  5TAO A;  1FMW A;  2SPC A;  5J2U E;  3RRC A;  4QXB B;  2NP9 A;  4X65 T;  2DI4 A;  4LF7 T;  2W63 A;  2RA1 A;  5LB7 B;  1M7K A;  3VRB A;  1W0A A;  2E9X A;  3KDS E;  4PFP A;  3LDQ B;  2L3L A;  1XDP A;  3IA3 A;  3QUJ A;  5JRE A;  4LF9 T;  3Q5D A;  3T8O A;  1HTJ F;  3PUQ A;  5AQN B;  5LHG B;  2WY2 A;  2I6H A;  3RQU A;  5HXE A;  5JRC A;  2HH7 A;  5L3D B;  4IDZ A;  3Q5X A;  4DR7 T;  2PFV A;  4U2Y A;  2Y8D A;  2LHR A;  4QKN A;  3ZMS B;  3JC6 C;  1HNZ T;  2CXL A;  4JI4 T;  2JQK A;  4TV8 E;  4JBW F;  1HCI A;  4AKI A;  3ONJ A;  3RLF F;  4U3C A;  1YKE B;  5KDM C;  1XDO A;  5JR9 C;  3CPZ A;  4H63 V;  2V6Y B;  2J47 A;  1ZP0 A;  3PUA A;  2I59 A;  2JPF A;  2XSA A;  3TLW A;  1WYB A;  2ACX A;  2WMN A;  3AE9 A;  4MHC A;  3PU8 A;  5LCY A;  3PJA J;  5IYZ E;  2IC6 A;  5JDN A;  5ABF A;  1FJG T;  4TN7 B;  2LSG A;  3RGL A;  4JUY A;  1J5E T;  4EAH A;  4DV2 T;  4IDO A;  2J62 A;  2R6G F;  4X62 T;  1SUM B;  2IC9 A;  5DQV A;  4DV0 T;  2P9B A;  4YTP A;  4CI1 B;  3LJC A;  3F2E A;  3FBL A;  2MBG A;  3SWH A;  4JV5 T;  2D5U A;  5ABH A;  4AKG A;  2VL8 A;  1WLX A;  4EXT A;  5FY0 A;  3H37 A;  4I0U A;  2C0S A;  4JI1 T;  4KMC A;  2YKS A;  3HKB E;  4O4H E;  2KSR A;  2XQ6 A;  4EIW A;  2XQ8 A;  3QOF A;  4JI6 T;  2NW7 A;  1VRB A;  4TWD A;  5AQL B;  1X79 A;  3AXJ A;  2WQY A;  2VB6 A;  2G0U A;  2XQ7 A;  5FYM A;  4B6X A;  2NTX A;  2XUE A;  4AKL A;  2VWA A;  3FXD B;  2HHH T;  2XQA A;  2CLY C;  2FBW A;  5H6R B;  5AQP B;  1MMG A;  3Q9D A;  3O1J A;  3I9Y A;  4IE0 A;  3IBP A;  2WDQ A;  1UUS A;  3ZCJ A;  2BKO A;  5JTG A;  1OXZ A;  1OED A;  2XQ5 A;  1T98 A;  2JQQ A;  1WR6 A;  4KBM B;  5JH7 E;  1OED E;  4AIS A;  3VU7 H;  2E8I A;  1J1J A;  3N2O A;  2CHO A;  1O3X A;  3HA4 A;  4IT4 A;  3EAM A;  4QWN B;  3MAC A;  3PV0 F;  3KV6 A;  1QLB A;  2ODV A;  3CK6 A;  1L0V A;  3SS1 A;  2D9D A;  5L4H A;  1LVF A;  3LSV A;  3Q5E A;  4WBN E;  3JCF A;  4LMJ A;  2BG9 B;  5J2T E;  2JQ9 A;  3V5S A;  4KHZ F;  3RKG A;  3AVR A;  1IBM T;  2ZM8 A;  4UF0 A;  5HCM A;  4X66 T;  4LF6 T;  3BQK A;  2DWK A; 
#chains in the Genus database with same CATH homology
 1G73 A;  4UVB B;  4DMW A;  4C90 A;  1KK7 A;  4QXH B;  4UEL A;  3PE0 A;  1FMV A;  3PTR B;  4DMV A;  3QK6 A;  4IE7 A;  4ERR A;  4BA9 A;  3EUH A;  4HTE A;  3PU3 A;  1YD8 G;  3NZQ A;  1YKH B;  2CM0 A;  2N9D A;  3CVR A;  3NRX A;  2GK9 A;  3AVS A;  3KBT A;  1HG2 A;  2XQY A;  1E1H B;  3CWZ B;  1MNE A;  2LOP A;  3KV5 A;  4UVA B;  5LBM A;  3P7I A;  3TKL B;  1HG5 A;  2DWG A;  4ADZ A;  2EHO A;  4ASK A;  3EDV A;  3KBU A;  2X67 A;  2LSI A;  4H9S E;  4KP3 C;  1BR0 A;  3ZN0 B;  2C5I T;  4OK0 A;  3ZMU B;  4PAG A;  2LE8 A;  3WI3 A;  4TUY E;  4V1A v;  3UTK A;  4I43 B;  2PBI A;  3U3I A;  2K5B B;  1ZEE A;  1BR1 A;  3I9W A;  2BDE A;  3GMI A;  4QXC B;  3RC3 A;  5HXR A;  3O9X A;  3I0O A;  1VOM A;  2K48 A;  3EVY A;  3F31 A;  3FB2 A;  3ZC1 A;  3AA7 B;  4IE6 A;  2CMR A;  3AA0 B;  1WRD A;  1EZ3 A;  1AJ3 A;  4UEM A;  4P0B A;  3N9P A;  5HYA A;  3C4X A;  5BMV E;  5HWY A;  5FY7 A;  4MAL A;  2X9W A;  5LP6 E;  4MLK A;  3ZYL A;  1YW0 A;  4IGU A;  1MMD A;  3VKG A;  3CX7 B;  2LHN A;  2D0T A;  3E0Z A;  2UXN B;  3N2K E;  4AQG A;  2XAJ B;  3ANW B;  4PJN A;  1UX5 A;  2W00 A;  3AAE B;  5DQW A;  2V7L A;  3ANW A;  4IIJ E;  2C5K T;  4ZS2 A;  3K8P C;  2VKH A;  4H9O C;  4OYJ A;  4OHF A;  5A1L A;  3PUS A;  2LSJ A;  3HL6 A;  4X1I E;  3RYI E;  4EZ4 A;  2MOZ A;  4AXP A;  2CLY B;  3RH3 A;  4PK4 A;  2YIN A;  2X51 A;  2ODU A;  4QX8 B;  5JDQ A;  3AAI A;  4X1Y E;  2CEA A;  1ZV4 X;  3FXE B;  3SOL A;  2DCF A;  3HKC E;  4O4J E;  5HAX A;  1OWA A;  4BJM A;  4Z8X A;  4DND A;  4NUU A;  1IAP A;  1MMA A;  1LKX A;  2YU2 A;  3HKD E;  2ZM0 A;  3CML A;  4HEA A;  5IHY A;  2L9Q A;  5LXT E;  3OKQ A;  5EZY E;  4KUM B;  3LK3 B;  3K3Q C;  3F57 A;  1MMN A;  2VAS A;  5DAB A;  3RX6 A;  4TX5 A;  4ZI3 D;  4UXN B;  4H9Q C;  2CXF A;  2Q9Q C;  3EDU A;  3RYH E;  2W61 A;  5LJM A;  3DJB A;  2VKO A;  2RP4 A;  2OA5 A;  1NAF A;  4EYU A;  2H7O A;  2ZM2 A;  2N2N A;  3I0Q A;  4WNK A;  3MJX A;  3Q5W A;  1UCU A;  2K24 A;  3ZPO A;  4GK5 E;  3LFM A;  3S4U A;  4ANJ A;  5LOV E;  3C51 A;  4GYS A;  3O4X E;  1HS7 A;  4AKR B;  1QUU A;  2XAF B;  3CQX C;  4K0U A;  4UF0 B;  4ZI7 E;  2L8K A;  2CA5 A;  3N9Q A;  4G63 A;  2QA7 A;  4XZC A;  3ETU A;  1G8X A;  4H9P C;  3RC8 A;  3NRY A;  3CX8 B;  2CXD A;  4ZI2 C;  3E22 E;  3LK4 2;  4L9I A;  5FXV A;  4X20 E;  2A3D A;  3BK9 A;  2MTQ A;  1D1C A;  2YU1 A;  2LM9 A;  3IEE A;  4G2A A;  2XAQ B;  5M4Y A;  2LSK A;  3MKD A;  2JRK A;  4PNI A;  2BVL A;  2E9X C;  2CCQ A;  2BVM A;  2EHO D;  3FBZ A;  5FY1 A;  4GIW A;  4ZOL E;  5DJQ C;  2Q9Q A;  2X9Y A;  3FHN A;  2BZB A;  2EHO B;  2PJQ A;  3KV4 A;  3KV9 A;  4H9N C;  4JEH B;  4BAY B;  4M1P A;  1D1B A;  5TAO A;  4XBF B;  1FMW A;  3ZMZ B;  5F8P A;  2SPC A;  3ZJ1 A;  5J2U E;  3RRC A;  4QXB B;  3R84 B;  2NP9 A;  3RKO A;  3GA8 A;  2DHR A;  5LHI B;  2YK0 A;  3H3A A;  3ZLI A;  2WBL A;  2DI4 A;  1IZN B;  3AB3 B;  1MND A;  2W63 A;  3U78 A;  4CI3 B;  2VKJ A;  2RA1 A;  1D0Z A;  1HFA A;  5EK4 A;  2Z6E A;  4O2B E;  2E9X A;  1KNZ A;  4XAX B;  3HKE E;  1US7 B;  3PDY A;  2PG8 A;  2WSS V;  3KDS E;  3KVA A;  3GWH A;  1UX4 A;  4PFP A;  4O4L E;  2L3L A;  3UT5 E;  2XHE B;  1MIV A;  3WAK A;  3MZK B;  5JQG E;  4CXY A;  5AFU L;  2JMK A;  4AKH A;  2KWI B;  4HN9 A;  3QUJ A;  4UV8 B;  3NZP A;  4MFR A;  4PFO A;  4OFZ A;  5JRE A;  2X9X A;  3MA9 A;  2JJ9 A;  5JDG A;  5LG4 A;  2WWU A;  5FNV E;  4YHJ A;  5J1G A;  3OJA A;  3T8O A;  4FJO A;  1HTJ F;  3AAA B;  5L3F B;  2ZLY A;  2NTY A;  3PUQ A;  4PJM A;  5LGU B;  4AQF C;  1BR4 A;  1FIO A;  3UUX B;  1IJ5 A;  5LHG B;  2N1G A;  3ETV A;  2CWO A;  3LG7 A;  3I1A A;  3M65 A;  5L3B B;  5HXE A;  3PUR A;  4ILU A;  3KVB A;  5JRC A;  2HH7 A;  3N9O A;  5L3D B;  4IDZ A;  5H6Q B;  3IHR A;  3Q5X A;  4A56 A;  4PK5 A;  2B1E A;  4O4I E;  2D0U A;  4DBR A;  2PFV A;  5FXW A;  3KFW X;  5FP3 A;  3RRW A;  2Y8D A;  2LHR A;  4QKN A;  3ZMS B;  3JC6 C;  4H63 H;  2A2F X;  5GON E;  2DNX A;  2CXL A;  2M67 A;  2X0L B;  4TV8 E;  1V9D A;  3J9X 1;  5CA0 E;  2V7J A;  3MXZ A;  3BQI A;  2WM9 A;  5L2L A;  3OBV E;  5LA6 E;  4UV9 B;  1HCI A;  4J2C A;  4AKI A;  3RYF E;  1D0X A;  1YKE B;  5JVD E;  5LBQ B;  5KDM C;  3P8C D;  5JR9 C;  2KXP B;  4HGA A;  3CPZ A;  4H63 V;  2V7M A;  4ZI3 C;  3GN5 B;  1S94 A;  4AQF A;  5L3E B;  5C8Y E;  2LSY A;  3PUA A;  3B57 A;  2I59 A;  3GN5 A;  3C50 A;  2JPF A;  2DLR A;  4IHJ E;  3ZC0 A;  1WYB A;  2KWH A;  1BR2 A;  5EK2 A;  2ACX A;  2WMN A;  4MHC A;  1CUN A;  2LOS A;  3PU8 A;  4O2A E;  1H7C A;  2X66 A;  4DO0 A;  5LCY A;  4CZZ B;  4I55 E;  3SRZ A;  3D0T A;  5IYZ E;  3MK7 C;  2IC6 A;  2KZ7 B;  5JDN A;  4DBQ A;  3R6N A;  5ADX L;  1LRZ A;  2NW8 A;  4IST A;  3ZYM A;  4TN7 B;  4UIG A;  5HWX A;  2LSG A;  1D0Y A;  2QGS A;  5ETW A;  2Q9Q D;  4JUY A;  5LHH B;  4EAH A;  5JDF A;  3N9N A;  4U74 A;  2H7V C;  4MBQ A;  5L3G B;  3WAJ A;  1IJ6 A;  2Q9Q B;  4TV9 E;  3ZCI A;  3K3N A;  5JDH A;  3QC9 A;  2JMH A;  4GK0 E;  2KMF A;  4YJ3 E;  2YEV C;  2NWB A;  2NW9 A;  1SA0 E;  4ZHQ E;  2IC9 A;  5DQV A;  4QX7 B;  3W15 B;  3UFE A;  1NWM X;  2P9B A;  3ZYK A;  4CI1 B;  5KX5 E;  3NBX X;  3VHL A;  3LJC A;  4ZI2 D;  4PJJ A;  5E0O A;  2CE7 A;  2V7K A;  3ESL A;  3F2E A;  3FBL A;  2MBG A;  2D5U A;  3DTO A;  3SWH A;  4EZH A;  4C91 A;  2KND A;  3CQG B;  3LBX A;  2MYS A;  5FXX A;  4CXW A;  4AKG A;  2H3R A;  3HI2 A;  2VL8 A;  3L09 A;  2E9X D;  1U4Q A;  2K9A A;  4YJ2 E;  1WLX A;  2W62 A;  4EXT A;  2XTL A;  4L5G A;  1Z0P A;  3AA6 B;  3UUM A;  3N5L A;  2E9X B;  3DP7 A;  5FY0 A;  3RPU A;  3H37 A;  4EOZ B;  2KT9 A;  4EB6 E;  3ZMT B;  2C0S A;  4I50 E;  4KMC A;  4DVD A;  4PK6 A;  3HKB E;  1QSD A;  4O4H E;  5HXC A;  3C4W A;  4EIW A;  4IE4 A;  3CX6 B;  3ZJ2 A;  4F6R C;  2KLQ A;  3OYZ A;  4L0R A;  4N78 D;  2NW7 A;  4PJL A;  1VRB A;  3RYC E;  3CQC B;  3N9M A;  4CI2 B;  1X79 A;  4P0A A;  3HR0 A;  3B13 A;  4P09 A;  2VKD A;  2W0G A;  4UVC B;  2V1D B;  3VKH A;  2VB6 A;  2G0U A;  2X9H A;  5FYM A;  5CA1 E;  4H9R C;  4B6X A;  2KIN B;  2X68 A;  2NTX A;  4WW0 A;  4YFS A;  2V7I A;  2XUE A;  5L3C B;  5JRC B;  4AKL A;  4ISS A;  5F3J A;  2VWA A;  3FXD B;  3N2G E;  2LEH A;  4X1K E;  2CLY C;  5H6R B;  2ES0 A;  1MMG A;  3C64 A;  3Q9D A;  4U72 A;  3ZEF B;  3O1J A;  3I9Y A;  4IE0 A;  2XAH B;  2HPL A;  2Y6X A;  3IBP A;  3K3O A;  3Q2M A;  4JLE A;  2J1D G;  1LVK A;  2NOX A;  3O1H A;  4E7S A;  3J7Y q;  1ZKE A;  3ZCJ A;  4AI6 A;  3BQL A;  3IF8 B;  1OXZ A;  3N9L A;  4HE8 A;  4NUV A;  5CB4 E;  2CWY A;  3ZN1 B;  2LT3 A;  5FXZ A;  5LGT B;  2V26 A;  1T98 A;  2IAK A;  2JQQ A;  4GOU A;  1WR6 A;  4KBM B;  5JH7 E;  3A5X A;  3OYX A;  1MIW A;  3V5U A;  3VU7 H;  2E8I A;  3E08 A;  2HPJ A;  3N2O A;  4YLH A;  2WMO A;  1O3X A;  4FI5 A;  3L3P A;  5EK3 A;  2UXX B;  3UUL A;  3JC6 D;  4ZS3 A;  4BJN A;  5FMN A;  3ZMV B;  4EYY R;  2VK9 A;  3HA4 A;  4QWN B;  3MAC A;  2XAG B;  3KV6 A;  4PW8 A;  2ODV A;  1HX8 A;  2D2S A;  5HXH A;  3SS1 A;  1LVF A;  1Y64 B;  3KIN B;  2IW5 B;  2XAS B;  5LYJ E;  2A72 A;  1HF8 A;  4QHO A;  4WBN E;  2ZMA A;  4IE5 A;  3ONX A;  1D1A A;  5JR9 B;  5J2T E;  4TZ4 C;  4I4T E;  1ZHC A;  5LNK A;  1MIY A;  2C5J A;  5JDL A;  2WAU A;  1WYC A;  5JR9 A;  3V5S A;  4OYK A;  4CQI A;  2LJL A;  4HKA A;  2EHO C;  4JEU B;  4WBO A;  3UUN A;  2Y48 B;  1SHZ C;  3AA1 B;  1FEW A;  3AVR A;  5LJN A;  3O1I A;  4O8S A;  4CXX A;  5LGN B;  4HFV A;  4GYR A;  5KMG P;  2ZM8 A;  3C98 B;  3PUG A;  3CKD A;  4UF0 A;  4E7Z A;  3LK2 B;  1B7T A;  3C4Z A;  5JDM A;  1S35 A;  1U5P A;  3BQK A;  5HXS A;  3LBX B;  2DWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...