2LSGA

Solution structure of the mouse rev1 c-terminal domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multifaceted recognition of vertebrate Rev1 by translesion polymerases zeta and kappa.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords DNA repair protein REV1
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsgA00
2LSYA 2LSIA 2LSJA 4GK5E 3VU7H 4FJOA 4BA9A 2LSGA 4GK0E 2N1GA 4EXTA 2LSKA
chains in the Genus database with same CATH superfamily
4HGAA 1E1HB 1CHUA 2RA1A 3B13A 3MZKB 4LF7T 1I94T 2H7VC 3ETUA 4AISA 4ASKA 2PTFA 2V7IA 4LFCT 1WR6A 1FJGT 3RYCE 4GKKT 3AVRA 1U5PA 4MHCA 4A56A 5LCYA 4QHOA 4C91A 2L9QA 3ONXA 4JBWF 2IAKA 3Q5XA 2UXDT 2A9UA 2LRLA 2WZIA 3MJXA 5LGNB 1W09A 4B3RT 3CX8B 2UXNB 2V7LA 3KINB 2CHOA 1ZHCA 3M3ZB 2I6HA 1MIVA 1YKHB 3A5XA 3ZMZB 3PUWF 5J2TE 2M6BA 4PJMA 4DR1T 2LT3A 2WWUA 2CHNA 2CWYA 3AA1B 2BZBA 5LG3A 3PTRB 1R8IA 3Q5EA 5JDMA 2WB5A 3MK7C 4CXWA 4DBRA 2VASA 3ETVA 3I1AA 4ILBA 4XZCA 2XUEA 3BQIA 4Z8XA 3RKGA 3ZYMA 2DI4A 4YSXA 1XMQT 4LFBT 2H7OA 2A2FX 3H3AA 5HCMA 1CUNA 3RYHE 3X1DA 4DMVA 4I43B 3ZN0B 3I0OA 1BR2A 3PV0F 5FXZA 4FI5A 4ISTA 4HFVA 3P4PA 3M65A 4DV3T 3L3PA 3OBVE 3RF1A 3AE8A 4JLEA 5AQMB 5HXRA 5L3BB 2V7JA 3RIUC 2K9AA 3QK6A 3P4WA 4E7SA 2FJBA 4QXHB 1MMGA 3C98B 2C5JA 3ZKRA 3ZPOA 4U31A 2CEAA 5FMNA 3O9XA 2ZM8A 3ONLC 4HFIA 3N5LA 4JI6T 3RH3A 3Q9DA 2NWBA 2XAQB 3KDSE 2VKOA 3DP7A 3KV6A 2CCQA 3ESLA 5LGUB 2CLYB 1UGOA 2EHOB 2J62A 3LJCA 4HFHA 5L3GB 2HHHT 1HFAA 2X9XA 2SPCA 3D0TA 4IDNA 1O3XA 4JI4T 3B5MA 3NRYA 4GKJT 1HG2A 2LHNA 1SE7A 4QXBB 3AE6A 4J2CA 4XAXB 4TWHA 1WCRA 4A5XA 4YSZA 1I6ZA 3C50A 3R6NA 2HPJA 1MMAA 4MFRA 4EEDA 1VOMA 3SWHA 3NKZA 1KNRA 5JR9A 4COFA 1YQ3A 1QLBA 2QVAA 2NW9A 3VRBA 2VQET 1WYBA 4H63H 4HFBA 2WAUA 4AKGA 3AEAA 4DV1T 1UK5A 1W9RA 4OK0A 1LVFA 1OEDA 2GK9A 4NPPA 5HXCA 5FXXA 4TX5A 1N34T 2D2SA 2WCAA 2XQAA 4OHFA 5FXVA 3DTOA 3QNUA 2YKSA 4P1NA 4LF4T 3GMIA 2XTLA 4PK5A 1D0ZA 3WAJA 5AQFB 2G0UA 4GOUA 2KMFA 2DL1A 3CWZB 3N2OA 3RRWA 2FJEA 2HH7A 3AE5A 5JDLA 4LMLA 5LG4A 5L47A 4PNIA 4O8SA 2V6YB 1SA0E 4CI3B 3FBZA 3UU3A 1IJ5A 1H7CA 4NUVA 4ZI3D 4UVAB 3PUSA 1SUMB 4IREA 4DR2T 4HFCA 2QRXA 2X9WA 3LSVA 2MPKA 4IDZA 3OYZA 1ZKEA 2WM9A 1HNWT 5KX5E 3ABVA 4HTEA 4IE6A 1IZNB 1IBLT 1BR1A 5DJQC 4WBNE 4HFEA 4TN7B 3I9YA 1VRBA 2YK0A 3KVBA 3PURA 3PUZF 5DQWA 3LBXA 5LBMA 3KV9A 1OEDB 5LJNA 2QA7A 2YDSA 2BDEA 4ZHQE 2N1GA 4H9PC 4LMKA 4JI5T 4X5TA 3ZT7A 3JADA 1G8XA 2CLYC 2CA5A 2LSGA 5JREA 3AE1A 4I50E 2BBHA 1MIWA 4UXNB 2NTXA 3PU8A 3P50A 5ABHA 3U78A 3PJAA 1XDPA 4PFPA 2B76A 5HEHA 3AAEB 1W0BA 4EV6A 4YT0A 2Z6EA 3HKEE 4CZZB 3HI2A 2B1EA 2V5CA 2VQFT 2BS3A 4NXNT 3LBXB 3K3QC 5J2UE 4XBFB 4C90A 2XM2A 3AXJA 4LF5T 2JRKA 4G2AA 4B3ST 5AQLB 2XAJB 2XHEB 4PK4A 5H6QB 4DR6T 3N2KE 2K3WA 3CQXC 3RIAA 1S94A 2LJLA 3JAEA 4EZ4A 3FZHB 4TNVA 1YD8G 2KXPB 5LOVE 5ABGA 2WBLA 5L4EA 5LXTE 3PE0A 1X9BA 4H9NC 2BKPA 3UT5E 3HL6A 1HTJF 3VR8A 2W00A 2J1DG 2KZ7B 2XQ9A 1OWAA 2NOXA 4LMJA 2KINB 3H37A 5L3EB 1MIYA 2DHRA 1VCTA 5A1LA 4YFSA 4EYUA 3PDYA 1G73A 3UU4A 4KI0F 2MBGA 4AQYT 1E7PA 3N2GE 1HF8A 2K24A 2HPLA 3NWIA 5AQVB 4OYKA 4HN9A 3VRAA 2D0TA 3F57A 4EYYR 2E9XC 2Q9QB 4X62T 3QC9A 3T1HT 2Y48B 3IA3A 3UU6A 2IC6A 4MBQA 1V9DA 3L39A 1BR4A 4JI3T 2IDOB 2LOPA 3LK42 2WWVA 3GN5A 2WY2A 5HWYA 1W0AA 5LMNT 3EDVA 4DUZT 4WYVA 5EK4A 4TNWA 4IL9A 3ZJ1A 5LHHB 4TWFA 2A72A 2BKNA 2K5BB 3AA7B 1KNZA 1ZOYA 5HEUA 4BJMA 2XJ7A 5HXHA 5HWXA 1XDOA 3G06A 4O4HE 4YTNA 5JR9B 3RYFE 2BVMA 3RQUA 2UXCT 2KT9A 1NWMX 4FJOA 3BK9A 2XASB 2X9HA 5CGMA 1UX4A 3WAKA 5FVKA 3FZLB 5KXJA 2V26A 1M62A 3AE4A 3OYXA 4QH4A 3P4QA 3A7MA 3L09A 2X68A 4ZZCA 1M7KA 2ZM0A 3AB3B 2ZMAA 3ZT5A 4CI2B 2YEVC 3HKDE 1YKEB 1FMWA 2BKOA 3PUQA 3KFWX 4P0BA 5IYZE 2LSYA 3RX6A 3S4UA 1YQ4A 2JQQA 2X0YA 3LG7A 4IDPA 4P09A 4O4IE 5FY7A 4JI2T 2QYWA 2NP9A 3F31A 5EZYE 3SS1A 5HCJA 3W15B 4DMWA 4DUYT 1NENA 2WP9A 4ZI2C 4I0UA 1GQEA 2N9DA 4UIGA 4DV7T 1T8BA 2E5LT 1Z0PA 2XSAA 2VWAA 2I0MA 2XQYA 5FNVE 5L3DB 1T72A 3EUHA 3C4WA 1HX1B 4QH5A 5AQGB 1NEKA 4G63A 3RLFF 4DNDA 2VL8A 4PAGA 5HAXA 2E5VA 3RHWA 3JCFA 4M1PA 2AE9A 3UTKA 4AKRB 5ADXL 3C4XA 4O4JE 4WZXA 1FIOA 5EK3A 3TLTA 1BR0A 1HG5A 2EHOC 4H9SE 1E2AA 3AEFA 1DU2A 4EB6E 4KHPT 3ZC1A 4KX6A 5DABA 3ZEFB 2OLTA 2PJQA 5LB7B 2UXBT 2VKHA 5ABEA 4LF8T 4AQFA 3PUYF 4NIQA 3H3MA 3DJBA 4IHJE 3FXEB 4U2ZA 3ZT6A 4X65T 5LNKA 4A98A 3LDQB 4I4TE 1WR0A 1UCUA 5AQNB 1UUSA 2XSBA 4X1IE 3EDUA 4GIWA 4DR7T 3N9LA 2L8KA 5FL0A 4PFOA 3RKOA 3SFEA 3HKBE 4JV5T 4BA9A 1MNDA 4DV5T 5AQUB 2XZEA 4WBOA 4YY3T 2UUCT 2WMNA 3PUAA 3C64A 3FZKB 2W63A 4ISSA 4CN1A 4EOZB 5J0ZA 5L2LA 2UUBT 5FP3A 4PK6A 2BG9C 3VU7H 2W61A 3EHZA 3PUXF 4HFDA 3ZYLA 3ZSSA 4UV9B 4EZHA 5LJMA 2WQYA 2N2NA 2LOSA 2LSJA 4WNKA 5BR8T 2VKDA 2XQ8A 4CXXA 5LBQB 3AE2A 5FY1A 4B3TT 2JIWA 5CJ5A 4I55E 2FJDA 3AAAB 5HXEA 1U4QA 2BS2A 5CA1E 2LM2A 2E9XB 2Q9QC 3ZSTA 4OX9T 2OA5A 2K48A 2P9BA 2V5DA 4JEHB 3RI5A 3UQ4A 5ABFA 4CI1B 1T98A 4TV9E 2W66A 3ZC0A 3CK6A 3SOLA 1OEDE 3JC6D 3AEGA 3LK2B 2ODUA 2WSSV 2YDRA 3ZMUB 3ZLIA 1KF6A 3GWHA 4U33A 3CPZA 2BG9B 4V1Av 2KLQA 2IHR1 5EK2A 3T8OA 4L0RA 2Q9QD 4H9OC 4IE7A 4PJLA 2UU9T 5FY0A 3AA0B 4IE0A 4TV8E 3CX7B 4F8HA 4JI8T 3J9X1 2X0LB 4HWDA 2ZM6T 4AKHA 4X1YE 3NBXX 3AEEA 1KK7A 2CE7A 2BVLA 2DLRA 2IC9A 4DV4T 1NAFA 3MACA 4ZS2A 5AQTB 4ZXLA 3QUJA 2DWGA 2VL0A 3P8CD 2LLYA 2PBIA 4GK5E 3OKQA 3ZJ2A 4EAHA 4AI6A 1MNEA 3FHNA 1LRZA 3VKHA 3FZFB 1IAPA 3KVAA 1D0YA 2MAWA 2VVNA 3P7IA 5LYJE 1HR0T 5HEGA 4YSYA 1WFDA 1B7TA 2JPFA 3AE7A 3FZMB 3RYIE 5L3CB 4X66T 3NZQA 3Q5WA 4IIJE 4ZI7E 3Q2MA 4L9IA 2D9DA 3ZCIA 3I9WA 2LSKA 3KV5A 2E9XA 5JRCA 2HN2A 4QH1A 3SFDA 5KMGP 4P0AA 5AQOB 4QKNA 2H89A 4MALA 4YLHA 4PJJA 4YTPA 4U7IA 2YU1A 4HWFA 2WDQA 3AE3A 3ANWB 2D5UA 4Q25A 5JVDE 5HXSA 3ZN1B 5JDGA 3P4SA 1N32T 2MTQA 2XQ6A 3SRZA 3VHLA 5AQJB 4A97A 2ZLYA 2DNXA 2LRKA 4H9QC 3L8RA 4UELA 5AQIB 4ADZA 4GK0E 2CRBA 5F8PA 4DR5T 3AECA 4DR3T 4BJNA 2EHOD 1QUUA 2VKJA 4KUMB 4E7ZA 5AQKB 1JNRA 2PG8A 5L3FB 3EAMA 5C8YE 2WMOA 2C0SA 4B6XA 3IBPA 3MKDA 3EI0A 3K3NA 3NRXA 4U3CA 3CQGB 2ACXA 4HWHA 4N78D 3MXZA 4AXPA 3K8PC 5AQSB 3UU8A 4AKLA 5BMVE 2W0GA 1OXZA 3CIRA 3IF8B 4UEMA 3AVSA 3UFGA 5C3JA 5F3JA 3ZYKA 3T1YT 1J5ET 1HS7A 2E2AA 4KHZF 5TAOA 2R6GF 3HKCE 4ILAA 2CM0A 3LFMA 3AXJB 4LFAT 3AA6B 3ZMSB 4ILCA 5JDHA 4U7YA 1D1CA 2CXDA 2JMKA 2UXXB 5J1GA 2AXDS 3A8YC 4DV0T 2WDVA 3AAIA 5HEJA 2X51A 3KV4A 4IDQA 3VKGA 1KFYA 2JQKA 4HE8A 3RIUA 2W62A 3WI3A 1D0XA 1ZP0A 2BG9E 5LHGB 3OTOT 5C2TA 5JTGA 4JI1T 2XAGB 2XM1A 4PJNA 3V5SA 2Y8DA 2YN6A 5HEOA 2X67A 2DWKA 2Q9QA 3MA9A 1IBKT 1XWMA 2LHRA 4UVBB 4Z91A 1HCIA 1WLXA 3O1JA 5KDMC 2UUAT 3EABA 3PUVF 4YXDA 1N33T 3ONJA 4IL4A 1US7B 2YINA 1J1JA 3AE9A 4U74A 4PW8A 5LMUT 2JQHA 1QSDA 5LGTB 3EVYA 2LEHA 4U72A 1XNQT 4AIUA 3CX6B 5FXWA 3C51A 5JDFA 1WYCA 2H3RA 3NZPA 4EIWA 2JJ9A 2XAHB 3FBLA 4ERRA 1MMDA 2LE8A 4Z90A 1FMVA 4CXYA 2W4XA 2X66A 1LKXA 4YJ3E 2ZM2A 2JMHA 2V1DB 4DV6T 1J5WA 5H6RB 1AJ3A 2CBIA 5AQPB 5FVLA 4B3MT 5JRCB 1UX5A 4O2AE 4EXTA 1D1BA 4GYRA 1Y64B 2XQ4A 3E22E 3OVUA 3C4ZA 3QB5K 4KMCA 3PUGA 4UF0B 1YW0A 5CFBA 4YHHT 2V7KA 3TLUA 1MMNA 2NW7A 4OYJA 4H63V 5AQQB 3UUBA 1OEDC 2KNDA 2BG9A 3GA8A 3B57A 3AEBA 3E0ZA 3N9NA 1UURA 4K0UA 2J47A 4QXCB 2KWIB 3TLVA 2YU2A 2CWOA 1IBMT 4LF6T 2XY8B 1EZ3A 5LP6E 3UUXB 2IIUA 1LVKA 1HX8A 2WZHA 3UQ7A 2M67A 2MYSA 4DBQA 2ACZA 3FXDB 4LF9T 4NXMT 2IMLA 2JQ9A 3KBUA 4UR9A 2VURA 3J7Yq 2J4GA 4O4LE 4IE5A 2E8IA 4YHJA 5DQVA 2WU5A 2IW5B 3RRCA 3PJAJ 5IUXA 3I0QA 4IT4A 4YTMA 2CPTA 4ZEYA 5CA0E 3JAFA 2V6YA 2X9YA 3CMLA 2V7MA 3FB2A 1KEYA 4IGUA 4K0KT 4JI7T 2QGSA 3O1IA 4X1KE 2NW8A 5FKYA 2BBJA 4HEAA 5CB4E 3U3IA 3UU5A 4UVCB 4EGWA 1XNRT 3F2EA 2ES0A 2RPAA 4CN4A 4GYSA 3RGLA 4UF0A 5JDQA 2W2UA 3ANWA 4ANJA 2FUPA 4QX7B 4DR4T 3K1SA 1X79A 2NR4A 4U2YA 1S35A 2OV9A 2LKGA 4QX8B 5AQHB 3R84B 2XPKA 3BQKA 3QOFA 2BS4A 2C5IT 4MLKA 4HWIB 4UV8B 5LA6E 1L0VA 4KBMB 1JNZA 3Q5DA 2F4VT 1Y01A 3LK3B 3UULA 2V8SV 1XMOT 4TUYE 5FYMA 2CBJA 2X0HA 4ZI2D 2FJAA 3AEDA 3O1HA 4DVDA 4ZI3C 2VVSA 4F6RC 3TKLB 2L3LA 1HNXT 4JUYA 1KNPA 2VK9A 2KWHA 2V6XA 2WS3A 3K3OA 5JDNA 4DV2T 3N9PA 2WU2A 2RP4A 1HNZT 4EEBA 4JI0T 1D1AA 4O2BE 4ZOLE 5IHYA 4YJ2E 3V5UA 5HYAA 5GONE 4NUUA 3VR9A 2PFVA 1VCSA 2XQ3A 1N36T 3BQLA 1SHZC 4ILUA 4QWNB 1ZV4X 4X20E 3TLSA 3UUNA 4BAYB 1IJ6A 3RC3A 2LM9A 4CN6A 5E0OA 3N9OA 2LKHA 2H88A 3RQWA 2XQ7A 2D0UA 2HN1A 4DO0A 1XZYA 5FL1A 2MOZA 1YXRA 2FBWA 1Z8UA 2Y6XA 5M4YA 3IHRA 3N9MA 3O4XE 2ODVA 2M6IA 3NVOA 5JH7E 2XAFB 4AKIA 2I59A 3HA4A 3CKDA 3HR0A 4ZZBA 3PU3A 5ETWA 3RC8A 5JR9C 3IEEA 2VB6A 4X64T 2CXLA 4HKAA 3GN5B 2KSRA 4IDOA 5AFUL 2EHOA 1ZEEA 5JQGE 1T7SA 4OFZA 2LSIA 2C5KT 3QB5A 4TWDA 3ZMTB 4CQIA 4KP3C 4ZS3A 3CQCB 3N9QA 2DCFA 4AQGA 3OJAA 3P4RA 4L5GA 2XQ5A 2WDRA 4IE4A 4WW0A 3UUMA 2CXFA 3ZMVB 5IWAT 3CVRA 5ABFB 5LHIB 1WRDA 2W67A 3E08A 2CMRA 3TLWA 3OPCA 5L4HA 3RIFA 2IUBA 2YOEA 4DIDB 5AQRB 4H9RC 4HWCA 3ZCJA 1FEWA 4JYAT 3JC6C 2YDQA 2E9XD 4JEUB 3RPUA 4TZ4C 2A3DA 3UFEA 3KBTA 5F5WA 2NTYA 4AQFC
chains in the Genus database with same CATH topology
4HGAA 1E1HB 2RA1A 3B13A 3MZKB 2H7VC 3ETUA 4ASKA 2V7IA 1WR6A 3RYCE 3AVRA 1U5PA 4MHCA 4A56A 5LCYA 4QHOA 4C91A 2L9QA 3ONXA 2IAKA 3Q5XA 3MJXA 5LGNB 3CX8B 2UXNB 2V7LA 3KINB 1ZHCA 3A5XA 1MIVA 1YKHB 3ZMZB 5J2TE 4PJMA 2LT3A 2WWUA 2CWYA 3AA1B 2BZBA 3PTRB 5JDMA 3MK7C 5L2LA 4CXWA 4DBRA 2VASA 3ETVA 3I1AA 4XZCA 3ZYMA 2XUEA 3BQIA 4Z8XA 3RC8A 2DI4A 2H7OA 2A2FX 3H3AA 3RYHE 1CUNA 4DMVA 4I43B 3ZN0B 3I0OA 1BR2A 5FXZA 4FI5A 4ISTA 4HFVA 3M65A 3L3PA 3OBVE 5L3BB 4JLEA 5HXRA 2V7JA 2K9AA 3QK6A 4E7SA 4QXHB 1MMGA 3C98B 2C5JA 3ZPOA 2CEAA 5FMNA 3O9XA 2ZM8A 3N5LA 3RH3A 3Q9DA 2NWBA 2XAQB 3KDSE 2VKOA 3DP7A 3KV6A 2CCQA 3ESLA 5LGUB 2CLYB 5L3GB 2EHOB 3LJCA 1HFAA 2X9XA 2SPCA 3D0TA 1O3XA 3NRYA 1HG2A 2LHNA 4QXBB 4XAXB 4J2CA 3C50A 3R6NA 2HPJA 1MMAA 4MFRA 1VOMA 3SWHA 5JR9A 2NW9A 1WYBA 4H63H 2WAUA 4AKGA 4OK0A 1LVFA 2GK9A 5HXCA 5FXXA 4TX5A 2D2SA 4OHFA 5FXVA 3DTOA 3GMIA 2XTLA 4PK5A 1D0ZA 3WAJA 2G0UA 4GOUA 2KMFA 3N2OA 3CWZB 3RRWA 2HH7A 5JDLA 5LG4A 4PNIA 4O8SA 1SA0E 4CI3B 3FBZA 1IJ5A 1H7CA 4NUVA 4ZI3D 4UVAB 3PUSA 2X9WA 4IDZA 3OYZA 1ZKEA 2WM9A 5KX5E 4HTEA 4IE6A 1IZNB 1BR1A 5DJQC 4WBNE 4TN7B 3I9YA 1VRBA 2YK0A 3KVBA 3PURA 5DQWA 3LBXA 5LBMA 3KV9A 5LJNA 2QA7A 2BDEA 4ZHQE 2N1GA 4H9PC 1G8XA 2CLYC 2CA5A 2LSGA 5JREA 4UXNB 4I50E 1MIWA 2NTXA 3PU8A 3U78A 4PFPA 3AAEB 2Z6EA 3HKEE 4CZZB 3HI2A 2B1EA 3LBXB 3K3QC 5J2UE 4C90A 2JRKA 4G2AA 2XAJB 2XHEB 4PK4A 5H6QB 3N2KE 3CQXC 1S94A 2LJLA 1YD8G 2KXPB 5LOVE 2WBLA 5LXTE 3PE0A 4H9NC 3UT5E 3HL6A 1HTJF 2W00A 2J1DG 2KZ7B 1OWAA 2NOXA 2KINB 3H37A 5L3EB 1MIYA 2DHRA 5A1LA 4YFSA 4EYUA 3PDYA 1G73A 2MBGA 3N2GE 1HF8A 2K24A 2HPLA 4OYKA 4HN9A 2D0TA 3F57A 4EYYR 2E9XC 2Q9QB 3QC9A 2Y48B 2IC6A 4MBQA 1V9DA 1BR4A 2LOPA 3LK42 3GN5A 5HWYA 3EDVA 5EK4A 3ZJ1A 5LHHB 2A72A 1KNZA 2K5BB 3AA7B 4BJMA 5HXHA 5HWXA 4O4HE 5JR9B 3RYFE 2BVMA 4XBFB 2KT9A 1NWMX 4FJOA 3BK9A 2XASB 2X9HA 1UX4A 3WAKA 2V26A 3OYXA 3L09A 2X68A 2ZM0A 3AB3B 2ZMAA 4CI2B 4EB6E 2YEVC 3HKDE 1YKEB 1FMWA 3PUQA 4P0BA 3KFWX 5IYZE 3RX6A 2LSYA 3S4UA 2JQQA 3LG7A 5FY7A 4P09A 4O4IE 2NP9A 3F31A 5EZYE 3SS1A 4DMWA 3W15B 4ZI2C 2N9DA 4UIGA 1Z0PA 2VWAA 5FNVE 2XQYA 5L3DB 3EUHA 3C4WA 4G63A 4DNDA 2VL8A 4PAGA 5HAXA 3UTKA 4M1PA 5ADXL 4AKRB 3C4XA 4O4JE 1BR0A 1FIOA 5EK3A 1HG5A 2EHOC 4H9SE 3ZC1A 5DABA 3ZEFB 2PJQA 2VKHA 4AQFA 3DJBA 4IHJE 3FXEB 5LNKA 4I4TE 1UCUA 4X1IE 3EDUA 4GIWA 3N9LA 2L8KA 3RKOA 4PFOA 3HKBE 4BA9A 1MNDA 4WBOA 2WMNA 3PUAA 3C64A 2W63A 4ISSA 4EOZB 5FP3A 4PK6A 3VU7H 2W61A 3ZYLA 5LJMA 4EZHA 4UV9B 2N2NA 2LOSA 2LSJA 4WNKA 2VKDA 4CXXA 5LBQB 5FY1A 4I55E 3AAAB 5HXEA 1U4QA 5CA1E 2E9XB 2Q9QC 2OA5A 2K48A 2P9BA 4JEHB 4CI1B 1T98A 4TV9E 3ZC0A 3SOLA 3JC6D 3LK2B 3ZMUB 2ODUA 2WSSV 3ZLIA 3GWHA 3CPZA 4V1Av 2KLQA 5EK2A 3T8OA 4L0RA 2Q9QD 4H9OC 4IE7A 4PJLA 5FY0A 3AA0B 4IE0A 4TV8E 3CX7B 3J9X1 2X0LB 4AKHA 4X1YE 3NBXX 1KK7A 2CE7A 2BVLA 2DLRA 2IC9A 1NAFA 3MACA 4ZS2A 3QUJA 2DWGA 3P8CD 4GK5E 2PBIA 3ZJ2A 4AI6A 3OKQA 4EAHA 1MNEA 3FHNA 1LRZA 3VKHA 1IAPA 3KVAA 1D0YA 5LYJE 3P7IA 1B7TA 2JPFA 3RYIE 5L3CB 3NZQA 3Q5WA 4IIJE 4ZI7E 3Q2MA 4L9IA 3ZCIA 3I9WA 2LSKA 3KV5A 2E9XA 5JRCA 5KMGP 4P0AA 4QKNA 4MALA 4YLHA 4PJJA 2YU1A 3ANWB 5JVDE 2D5UA 5HXSA 3ZN1B 5JDGA 2MTQA 3VHLA 3SRZA 2ZLYA 2DNXA 4H9QC 4UELA 4ADZA 4GK0E 5F8PA 4BJNA 2EHOD 1QUUA 2VKJA 4KUMB 4E7ZA 5L3FB 2PG8A 5C8YE 2WMOA 2C0SA 4B6XA 3IBPA 3MKDA 3K3NA 3NRXA 3CQGB 2ACXA 4N78D 4AXPA 3MXZA 3K8PC 4AKLA 5BMVE 2W0GA 1OXZA 3IF8B 4UEMA 5F3JA 3AVSA 1HS7A 3ZYKA 5TAOA 3HKCE 2CM0A 3LFMA 3AA6B 3ZMSB 5JDHA 1D1CA 2CXDA 2JMKA 2UXXB 5J1GA 3AAIA 2X51A 3KV4A 3VKGA 4HE8A 2W62A 3WI3A 1D0XA 5LHGB 2XAGB 4PJNA 3V5SA 2Y8DA 2X67A 2DWKA 2Q9QA 3MA9A 2LHRA 4UVBB 1HCIA 1WLXA 3O1JA 5KDMC 1US7B 2YINA 4U74A 4PW8A 1QSDA 5LGTB 3EVYA 2LEHA 4U72A 3CX6B 5FXWA 3C51A 5JDFA 1WYCA 2H3RA 3NZPA 4EIWA 2JJ9A 2XAHB 3FBLA 4ERRA 1MMDA 2LE8A 1FMVA 4CXYA 2X66A 1LKXA 4YJ3E 2ZM2A 2JMHA 2V1DB 1AJ3A 5H6RB 5JRCB 1UX5A 4O2AE 4EXTA 1D1BA 4GYRA 1Y64B 3E22E 4DO0A 3C4ZA 4KMCA 4UF0B 3PUGA 1YW0A 2V7KA 1MMNA 2NW7A 4OYJA 4H63V 2KNDA 3GA8A 4K0UA 3B57A 3E0ZA 5LHIB 3N9NA 4QXCB 2KWIB 2YU2A 2CWOA 1EZ3A 5LP6E 3UUXB 1LVKA 1HX8A 2M67A 2MYSA 4DBQA 3FXDB 3KBUA 3J7Yq 4O4LE 4IE5A 2E8IA 4YHJA 5DQVA 2IW5B 3RRCA 3I0QA 5CA0E 3FB2A 2X9YA 3CMLA 2V7MA 4IGUA 2QGSA 3O1IA 4X1KE 2NW8A 4HEAA 3U3IA 4UVCB 3F2EA 2ES0A 4GYSA 4UF0A 5JDQA 3ANWA 4ANJA 4QX7B 1X79A 1S35A 3R84B 4QX8B 3BQKA 4MLKA 2C5IT 4UV8B 5LA6E 4KBMB 3LK3B 3UULA 4TUYE 5FYMA 4ZI2D 4DVDA 3O1HA 4ZI3C 4F6RC 3TKLB 2L3LA 4JUYA 2VK9A 2KWHA 3K3OA 5JDNA 3N9PA 2RP4A 1D1AA 4O2BE 4ZOLE 5IHYA 4YJ2E 3V5UA 5HYAA 5GONE 4NUUA 2PFVA 3BQLA 1SHZC 4ILUA 4QWNB 1ZV4X 4X20E 3UUNA 4BAYB 1IJ6A 3RC3A 2LM9A 5E0OA 3N9OA 2D0UA 2MOZA 2Y6XA 5M4YA 3IHRA 3N9MA 3O4XE 2ODVA 4AKIA 5JH7E 2XAFB 2I59A 3HA4A 3CKDA 3HR0A 3PU3A 5ETWA 5JR9C 3IEEA 2VB6A 2CXLA 4HKAA 3GN5B 5AFUL 2EHOA 1ZEEA 5JQGE 4OFZA 2LSIA 2C5KT 3ZMTB 4CQIA 4KP3C 4ZS3A 3CQCB 3N9QA 2DCFA 4AQGA 3OJAA 4L5GA 3UUMA 4WW0A 3ZMVB 4IE4A 4EZ4A 2CXFA 3CVRA 1WRDA 3E08A 2CMRA 4H9RC 3ZCJA 1FEWA 3JC6C 2E9XD 4JEUB 3RPUA 4TZ4C 2A3DA 3UFEA 3KBTA 5CB4E 2NTYA 4AQFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSY A;  2LSI A;  2LSJ A;  4GK5 E;  3VU7 H;  4FJO A;  4BA9 A;  2LSG A;  4GK0 E;  2N1G A;  4EXT A;  2LSK A; 
#chains in the Genus database with same CATH topology
 4HGA A;  1E1H B;  1CHU A;  2RA1 A;  3B13 A;  3MZK B;  4LF7 T;  1I94 T;  2H7V C;  3ETU A;  4AIS A;  4ASK A;  2PTF A;  2V7I A;  4LFC T;  1WR6 A;  1FJG T;  3RYC E;  4GKK T;  3AVR A;  1U5P A;  4MHC A;  4A56 A;  5LCY A;  4QHO A;  4C91 A;  2L9Q A;  3ONX A;  4JBW F;  2IAK A;  3Q5X A;  2UXD T;  2A9U A;  2LRL A;  2WZI A;  3MJX A;  5LGN B;  1W09 A;  4B3R T;  3CX8 B;  2UXN B;  2V7L A;  3KIN B;  2CHO A;  1ZHC A;  3M3Z B;  2I6H A;  1MIV A;  1YKH B;  3A5X A;  3ZMZ B;  3PUW F;  5J2T E;  2M6B A;  4PJM A;  4DR1 T;  2LT3 A;  2WWU A;  2CHN A;  2CWY A;  3AA1 B;  2BZB A;  5LG3 A;  3PTR B;  1R8I A;  3Q5E A;  5JDM A;  2WB5 A;  3MK7 C;  4CXW A;  4DBR A;  2VAS A;  3ETV A;  3I1A A;  4ILB A;  4XZC A;  2XUE A;  3BQI A;  4Z8X A;  3RKG A;  3ZYM A;  2DI4 A;  4YSX A;  1XMQ T;  4LFB T;  2H7O A;  2A2F X;  3H3A A;  5HCM A;  1CUN A;  3RYH E;  3X1D A;  4DMV A;  4I43 B;  3ZN0 B;  3I0O A;  1BR2 A;  3PV0 F;  5FXZ A;  4FI5 A;  4IST A;  4HFV A;  3P4P A;  3M65 A;  4DV3 T;  3L3P A;  3OBV E;  3RF1 A;  3AE8 A;  4JLE A;  5AQM B;  5HXR A;  5L3B B;  2V7J A;  3RIU C;  2K9A A;  3QK6 A;  3P4W A;  4E7S A;  2FJB A;  4QXH B;  1MMG A;  3C98 B;  2C5J A;  3ZKR A;  3ZPO A;  4U31 A;  2CEA A;  5FMN A;  3O9X A;  2ZM8 A;  3ONL C;  4HFI A;  3N5L A;  4JI6 T;  3RH3 A;  3Q9D A;  2NWB A;  2XAQ B;  3KDS E;  2VKO A;  3DP7 A;  3KV6 A;  2CCQ A;  3ESL A;  5LGU B;  2CLY B;  1UGO A;  2EHO B;  2J62 A;  3LJC A;  4HFH A;  5L3G B;  2HHH T;  1HFA A;  2X9X A;  2SPC A;  3D0T A;  4IDN A;  1O3X A;  4JI4 T;  3B5M A;  3NRY A;  4GKJ T;  1HG2 A;  2LHN A;  1SE7 A;  4QXB B;  3AE6 A;  4J2C A;  4XAX B;  4TWH A;  1WCR A;  4A5X A;  4YSZ A;  1I6Z A;  3C50 A;  3R6N A;  2HPJ A;  1MMA A;  4MFR A;  4EED A;  1VOM A;  3SWH A;  3NKZ A;  1KNR A;  5JR9 A;  4COF A;  1YQ3 A;  1QLB A;  2QVA A;  2NW9 A;  3VRB A;  2VQE T;  1WYB A;  4H63 H;  4HFB A;  2WAU A;  4AKG A;  3AEA A;  4DV1 T;  1UK5 A;  1W9R A;  4OK0 A;  1LVF A;  1OED A;  2GK9 A;  4NPP A;  5HXC A;  5FXX A;  4TX5 A;  1N34 T;  2D2S A;  2WCA A;  2XQA A;  4OHF A;  5FXV A;  3DTO A;  3QNU A;  2YKS A;  4P1N A;  4LF4 T;  3GMI A;  2XTL A;  4PK5 A;  1D0Z A;  3WAJ A;  5AQF B;  2G0U A;  4GOU A;  2KMF A;  2DL1 A;  3CWZ B;  3N2O A;  3RRW A;  2FJE A;  2HH7 A;  3AE5 A;  5JDL A;  4LML A;  5LG4 A;  5L47 A;  4PNI A;  4O8S A;  2V6Y B;  1SA0 E;  4CI3 B;  3FBZ A;  3UU3 A;  1IJ5 A;  1H7C A;  4NUV A;  4ZI3 D;  4UVA B;  3PUS A;  1SUM B;  4IRE A;  4DR2 T;  4HFC A;  2QRX A;  2X9W A;  3LSV A;  2MPK A;  4IDZ A;  3OYZ A;  1ZKE A;  2WM9 A;  1HNW T;  5KX5 E;  3ABV A;  4HTE A;  4IE6 A;  1IZN B;  1IBL T;  1BR1 A;  5DJQ C;  4WBN E;  4HFE A;  4TN7 B;  3I9Y A;  1VRB A;  2YK0 A;  3KVB A;  3PUR A;  3PUZ F;  5DQW A;  3LBX A;  5LBM A;  3KV9 A;  1OED B;  5LJN A;  2QA7 A;  2YDS A;  2BDE A;  4ZHQ E;  2N1G A;  4H9P C;  4LMK A;  4JI5 T;  4X5T A;  3ZT7 A;  3JAD A;  1G8X A;  2CLY C;  2CA5 A;  2LSG A;  5JRE A;  3AE1 A;  4I50 E;  2BBH A;  1MIW A;  4UXN B;  2NTX A;  3PU8 A;  3P50 A;  5ABH A;  3U78 A;  3PJA A;  1XDP A;  4PFP A;  2B76 A;  5HEH A;  3AAE B;  1W0B A;  4EV6 A;  4YT0 A;  2Z6E A;  3HKE E;  4CZZ B;  3HI2 A;  2B1E A;  2V5C A;  2VQF T;  2BS3 A;  4NXN T;  3LBX B;  3K3Q C;  5J2U E;  4XBF B;  4C90 A;  2XM2 A;  3AXJ A;  4LF5 T;  2JRK A;  4G2A A;  4B3S T;  5AQL B;  2XAJ B;  2XHE B;  4PK4 A;  5H6Q B;  4DR6 T;  3N2K E;  2K3W A;  3CQX C;  3RIA A;  1S94 A;  2LJL A;  3JAE A;  4EZ4 A;  3FZH B;  4TNV A;  1YD8 G;  2KXP B;  5LOV E;  5ABG A;  2WBL A;  5L4E A;  5LXT E;  3PE0 A;  1X9B A;  4H9N C;  2BKP A;  3UT5 E;  3HL6 A;  1HTJ F;  3VR8 A;  2W00 A;  2J1D G;  2KZ7 B;  2XQ9 A;  1OWA A;  2NOX A;  4LMJ A;  2KIN B;  3H37 A;  5L3E B;  1MIY A;  2DHR A;  1VCT A;  5A1L A;  4YFS A;  4EYU A;  3PDY A;  1G73 A;  3UU4 A;  4KI0 F;  2MBG A;  4AQY T;  1E7P A;  3N2G E;  1HF8 A;  2K24 A;  2HPL A;  3NWI A;  5AQV B;  4OYK A;  4HN9 A;  3VRA A;  2D0T A;  3F57 A;  4EYY R;  2E9X C;  2Q9Q B;  4X62 T;  3QC9 A;  3T1H T;  2Y48 B;  3IA3 A;  3UU6 A;  2IC6 A;  4MBQ A;  1V9D A;  3L39 A;  1BR4 A;  4JI3 T;  2IDO B;  2LOP A;  3LK4 2;  2WWV A;  3GN5 A;  2WY2 A;  5HWY A;  1W0A A;  5LMN T;  3EDV A;  4DUZ T;  4WYV A;  5EK4 A;  4TNW A;  4IL9 A;  3ZJ1 A;  5LHH B;  4TWF A;  2A72 A;  2BKN A;  2K5B B;  3AA7 B;  1KNZ A;  1ZOY A;  5HEU A;  4BJM A;  2XJ7 A;  5HXH A;  5HWX A;  1XDO A;  3G06 A;  4O4H E;  4YTN A;  5JR9 B;  3RYF E;  2BVM A;  3RQU A;  2UXC T;  2KT9 A;  1NWM X;  4FJO A;  3BK9 A;  2XAS B;  2X9H A;  5CGM A;  1UX4 A;  3WAK A;  5FVK A;  3FZL B;  5KXJ A;  2V26 A;  1M62 A;  3AE4 A;  3OYX A;  4QH4 A;  3P4Q A;  3A7M A;  3L09 A;  2X68 A;  4ZZC A;  1M7K A;  2ZM0 A;  3AB3 B;  2ZMA A;  3ZT5 A;  4CI2 B;  2YEV C;  3HKD E;  1YKE B;  1FMW A;  2BKO A;  3PUQ A;  3KFW X;  4P0B A;  5IYZ E;  2LSY A;  3RX6 A;  3S4U A;  1YQ4 A;  2JQQ A;  2X0Y A;  3LG7 A;  4IDP A;  4P09 A;  4O4I E;  5FY7 A;  4JI2 T;  2QYW A;  2NP9 A;  3F31 A;  5EZY E;  3SS1 A;  5HCJ A;  3W15 B;  4DMW A;  4DUY T;  1NEN A;  2WP9 A;  4ZI2 C;  4I0U A;  1GQE A;  2N9D A;  4UIG A;  4DV7 T;  1T8B A;  2E5L T;  1Z0P A;  2XSA A;  2VWA A;  2I0M A;  2XQY A;  5FNV E;  5L3D B;  1T72 A;  3EUH A;  3C4W A;  1HX1 B;  4QH5 A;  5AQG B;  1NEK A;  4G63 A;  3RLF F;  4DND A;  2VL8 A;  4PAG A;  5HAX A;  2E5V A;  3RHW A;  3JCF A;  4M1P A;  2AE9 A;  3UTK A;  4AKR B;  5ADX L;  3C4X A;  4O4J E;  4WZX A;  1FIO A;  5EK3 A;  3TLT A;  1BR0 A;  1HG5 A;  2EHO C;  4H9S E;  1E2A A;  3AEF A;  1DU2 A;  4EB6 E;  4KHP T;  3ZC1 A;  4KX6 A;  5DAB A;  3ZEF B;  2OLT A;  2PJQ A;  5LB7 B;  2UXB T;  2VKH A;  5ABE A;  4LF8 T;  4AQF A;  3PUY F;  4NIQ A;  3H3M A;  3DJB A;  4IHJ E;  3FXE B;  4U2Z A;  3ZT6 A;  4X65 T;  5LNK A;  4A98 A;  3LDQ B;  4I4T E;  1WR0 A;  1UCU A;  5AQN B;  1UUS A;  2XSB A;  4X1I E;  3EDU A;  4GIW A;  4DR7 T;  3N9L A;  2L8K A;  5FL0 A;  4PFO A;  3RKO A;  3SFE A;  3HKB E;  4JV5 T;  4BA9 A;  1MND A;  4DV5 T;  5AQU B;  2XZE A;  4WBO A;  4YY3 T;  2UUC T;  2WMN A;  3PUA A;  3C64 A;  3FZK B;  2W63 A;  4ISS A;  4CN1 A;  4EOZ B;  5J0Z A;  5L2L A;  2UUB T;  5FP3 A;  4PK6 A;  2BG9 C;  3VU7 H;  2W61 A;  3EHZ A;  3PUX F;  4HFD A;  3ZYL A;  3ZSS A;  4UV9 B;  4EZH A;  5LJM A;  2WQY A;  2N2N A;  2LOS A;  2LSJ A;  4WNK A;  5BR8 T;  2VKD A;  2XQ8 A;  4CXX A;  5LBQ B;  3AE2 A;  5FY1 A;  4B3T T;  2JIW A;  5CJ5 A;  4I55 E;  2FJD A;  3AAA B;  5HXE A;  1U4Q A;  2BS2 A;  5CA1 E;  2LM2 A;  2E9X B;  2Q9Q C;  3ZST A;  4OX9 T;  2OA5 A;  2K48 A;  2P9B A;  2V5D A;  4JEH B;  3RI5 A;  3UQ4 A;  5ABF A;  4CI1 B;  1T98 A;  4TV9 E;  2W66 A;  3ZC0 A;  3CK6 A;  3SOL A;  1OED E;  3JC6 D;  3AEG A;  3LK2 B;  2ODU A;  2WSS V;  2YDR A;  3ZMU B;  3ZLI A;  1KF6 A;  3GWH A;  4U33 A;  3CPZ A;  2BG9 B;  4V1A v;  2KLQ A;  2IHR 1;  5EK2 A;  3T8O A;  4L0R A;  2Q9Q D;  4H9O C;  4IE7 A;  4PJL A;  2UU9 T;  5FY0 A;  3AA0 B;  4IE0 A;  4TV8 E;  3CX7 B;  4F8H A;  4JI8 T;  3J9X 1;  2X0L B;  4HWD A;  2ZM6 T;  4AKH A;  4X1Y E;  3NBX X;  3AEE A;  1KK7 A;  2CE7 A;  2BVL A;  2DLR A;  2IC9 A;  4DV4 T;  1NAF A;  3MAC A;  4ZS2 A;  5AQT B;  4ZXL A;  3QUJ A;  2DWG A;  2VL0 A;  3P8C D;  2LLY A;  2PBI A;  4GK5 E;  3OKQ A;  3ZJ2 A;  4EAH A;  4AI6 A;  1MNE A;  3FHN A;  1LRZ A;  3VKH A;  3FZF B;  1IAP A;  3KVA A;  1D0Y A;  2MAW A;  2VVN A;  3P7I A;  5LYJ E;  1HR0 T;  5HEG A;  4YSY A;  1WFD A;  1B7T A;  2JPF A;  3AE7 A;  3FZM B;  3RYI E;  5L3C B;  4X66 T;  3NZQ A;  3Q5W A;  4IIJ E;  4ZI7 E;  3Q2M A;  4L9I A;  2D9D A;  3ZCI A;  3I9W A;  2LSK A;  3KV5 A;  2E9X A;  5JRC A;  2HN2 A;  4QH1 A;  3SFD A;  5KMG P;  4P0A A;  5AQO B;  4QKN A;  2H89 A;  4MAL A;  4YLH A;  4PJJ A;  4YTP A;  4U7I A;  2YU1 A;  4HWF A;  2WDQ A;  3AE3 A;  3ANW B;  2D5U A;  4Q25 A;  5JVD E;  5HXS A;  3ZN1 B;  5JDG A;  3P4S A;  1N32 T;  2MTQ A;  2XQ6 A;  3SRZ A;  3VHL A;  5AQJ B;  4A97 A;  2ZLY A;  2DNX A;  2LRK A;  4H9Q C;  3L8R A;  4UEL A;  5AQI B;  4ADZ A;  4GK0 E;  2CRB A;  5F8P A;  4DR5 T;  3AEC A;  4DR3 T;  4BJN A;  2EHO D;  1QUU A;  2VKJ A;  4KUM B;  4E7Z A;  5AQK B;  1JNR A;  2PG8 A;  5L3F B;  3EAM A;  5C8Y E;  2WMO A;  2C0S A;  4B6X A;  3IBP A;  3MKD A;  3EI0 A;  3K3N A;  3NRX A;  4U3C A;  3CQG B;  2ACX A;  4HWH A;  4N78 D;  3MXZ A;  4AXP A;  3K8P C;  5AQS B;  3UU8 A;  4AKL A;  5BMV E;  2W0G A;  1OXZ A;  3CIR A;  3IF8 B;  4UEM A;  3AVS A;  3UFG A;  5C3J A;  5F3J A;  3ZYK A;  3T1Y T;  1J5E T;  1HS7 A;  2E2A A;  4KHZ F;  5TAO A;  2R6G F;  3HKC E;  4ILA A;  2CM0 A;  3LFM A;  3AXJ B;  4LFA T;  3AA6 B;  3ZMS B;  4ILC A;  5JDH A;  4U7Y A;  1D1C A;  2CXD A;  2JMK A;  2UXX B;  5J1G A;  2AXD S;  3A8Y C;  4DV0 T;  2WDV A;  3AAI A;  5HEJ A;  2X51 A;  3KV4 A;  4IDQ A;  3VKG A;  1KFY A;  2JQK A;  4HE8 A;  3RIU A;  2W62 A;  3WI3 A;  1D0X A;  1ZP0 A;  2BG9 E;  5LHG B;  3OTO T;  5C2T A;  5JTG A;  4JI1 T;  2XAG B;  2XM1 A;  4PJN A;  3V5S A;  2Y8D A;  2YN6 A;  5HEO A;  2X67 A;  2DWK A;  2Q9Q A;  3MA9 A;  1IBK T;  1XWM A;  2LHR A;  4UVB B;  4Z91 A;  1HCI A;  1WLX A;  3O1J A;  5KDM C;  2UUA T;  3EAB A;  3PUV F;  4YXD A;  1N33 T;  3ONJ A;  4IL4 A;  1US7 B;  2YIN A;  1J1J A;  3AE9 A;  4U74 A;  4PW8 A;  5LMU T;  2JQH A;  1QSD A;  5LGT B;  3EVY A;  2LEH A;  4U72 A;  1XNQ T;  4AIU A;  3CX6 B;  5FXW A;  3C51 A;  5JDF A;  1WYC A;  2H3R A;  3NZP A;  4EIW A;  2JJ9 A;  2XAH B;  3FBL A;  4ERR A;  1MMD A;  2LE8 A;  4Z90 A;  1FMV A;  4CXY A;  2W4X A;  2X66 A;  1LKX A;  4YJ3 E;  2ZM2 A;  2JMH A;  2V1D B;  4DV6 T;  1J5W A;  5H6R B;  1AJ3 A;  2CBI A;  5AQP B;  5FVL A;  4B3M T;  5JRC B;  1UX5 A;  4O2A E;  4EXT A;  1D1B A;  4GYR A;  1Y64 B;  2XQ4 A;  3E22 E;  3OVU A;  3C4Z A;  3QB5 K;  4KMC A;  3PUG A;  4UF0 B;  1YW0 A;  5CFB A;  4YHH T;  2V7K A;  3TLU A;  1MMN A;  2NW7 A;  4OYJ A;  4H63 V;  5AQQ B;  3UUB A;  1OED C;  2KND A;  2BG9 A;  3GA8 A;  3B57 A;  3AEB A;  3E0Z A;  3N9N A;  1UUR A;  4K0U A;  2J47 A;  4QXC B;  2KWI B;  3TLV A;  2YU2 A;  2CWO A;  1IBM T;  4LF6 T;  2XY8 B;  1EZ3 A;  5LP6 E;  3UUX B;  2IIU A;  1LVK A;  1HX8 A;  2WZH A;  3UQ7 A;  2M67 A;  2MYS A;  4DBQ A;  2ACZ A;  3FXD B;  4LF9 T;  4NXM T;  2IML A;  2JQ9 A;  3KBU A;  4UR9 A;  2VUR A;  3J7Y q;  2J4G A;  4O4L E;  4IE5 A;  2E8I A;  4YHJ A;  5DQV A;  2WU5 A;  2IW5 B;  3RRC A;  3PJA J;  5IUX A;  3I0Q A;  4IT4 A;  4YTM A;  2CPT A;  4ZEY A;  5CA0 E;  3JAF A;  2V6Y A;  2X9Y A;  3CML A;  2V7M A;  3FB2 A;  1KEY A;  4IGU A;  4K0K T;  4JI7 T;  2QGS A;  3O1I A;  4X1K E;  2NW8 A;  5FKY A;  2BBJ A;  4HEA A;  5CB4 E;  3U3I A;  3UU5 A;  4UVC B;  4EGW A;  1XNR T;  3F2E A;  2ES0 A;  2RPA A;  4CN4 A;  4GYS A;  3RGL A;  4UF0 A;  5JDQ A;  2W2U A;  3ANW A;  4ANJ A;  2FUP A;  4QX7 B;  4DR4 T;  3K1S A;  1X79 A;  2NR4 A;  4U2Y A;  1S35 A;  2OV9 A;  2LKG A;  4QX8 B;  5AQH B;  3R84 B;  2XPK A;  3BQK A;  3QOF A;  2BS4 A;  2C5I T;  4MLK A;  4HWI B;  4UV8 B;  5LA6 E;  1L0V A;  4KBM B;  1JNZ A;  3Q5D A;  2F4V T;  1Y01 A;  3LK3 B;  3UUL A;  2V8S V;  1XMO T;  4TUY E;  5FYM A;  2CBJ A;  2X0H A;  4ZI2 D;  2FJA A;  3AED A;  3O1H A;  4DVD A;  4ZI3 C;  2VVS A;  4F6R C;  3TKL B;  2L3L A;  1HNX T;  4JUY A;  1KNP A;  2VK9 A;  2KWH A;  2V6X A;  2WS3 A;  3K3O A;  5JDN A;  4DV2 T;  3N9P A;  2WU2 A;  2RP4 A;  1HNZ T;  4EEB A;  4JI0 T;  1D1A A;  4O2B E;  4ZOL E;  5IHY A;  4YJ2 E;  3V5U A;  5HYA A;  5GON E;  4NUU A;  3VR9 A;  2PFV A;  1VCS A;  2XQ3 A;  1N36 T;  3BQL A;  1SHZ C;  4ILU A;  4QWN B;  1ZV4 X;  4X20 E;  3TLS A;  3UUN A;  4BAY B;  1IJ6 A;  3RC3 A;  2LM9 A;  4CN6 A;  5E0O A;  3N9O A;  2LKH A;  2H88 A;  3RQW A;  2XQ7 A;  2D0U A;  2HN1 A;  4DO0 A;  1XZY A;  5FL1 A;  2MOZ A;  1YXR A;  2FBW A;  1Z8U A;  2Y6X A;  5M4Y A;  3IHR A;  3N9M A;  3O4X E;  2ODV A;  2M6I A;  3NVO A;  5JH7 E;  2XAF B;  4AKI A;  2I59 A;  3HA4 A;  3CKD A;  3HR0 A;  4ZZB A;  3PU3 A;  5ETW A;  3RC8 A;  5JR9 C;  3IEE A;  2VB6 A;  4X64 T;  2CXL A;  4HKA A;  3GN5 B;  2KSR A;  4IDO A;  5AFU L;  2EHO A;  1ZEE A;  5JQG E;  1T7S A;  4OFZ A;  2LSI A;  2C5K T;  3QB5 A;  4TWD A;  3ZMT B;  4CQI A;  4KP3 C;  4ZS3 A;  3CQC B;  3N9Q A;  2DCF A;  4AQG A;  3OJA A;  3P4R A;  4L5G A;  2XQ5 A;  2WDR A;  4IE4 A;  4WW0 A;  3UUM A;  2CXF A;  3ZMV B;  5IWA T;  3CVR A;  5ABF B;  5LHI B;  1WRD A;  2W67 A;  3E08 A;  2CMR A;  3TLW A;  3OPC A;  5L4H A;  3RIF A;  2IUB A;  2YOE A;  4DID B;  5AQR B;  4H9R C;  4HWC A;  3ZCJ A;  1FEW A;  4JYA T;  3JC6 C;  2YDQ A;  2E9X D;  4JEU B;  3RPU A;  4TZ4 C;  2A3D A;  3UFE A;  3KBT A;  5F5W A;  2NTY A;  4AQF C; 
#chains in the Genus database with same CATH homology
 4HGA A;  1E1H B;  2RA1 A;  3B13 A;  3MZK B;  2H7V C;  3ETU A;  4ASK A;  2V7I A;  1WR6 A;  3RYC E;  3AVR A;  1U5P A;  4MHC A;  4A56 A;  5LCY A;  4QHO A;  4C91 A;  2L9Q A;  3ONX A;  2IAK A;  3Q5X A;  3MJX A;  5LGN B;  3CX8 B;  2UXN B;  2V7L A;  3KIN B;  1ZHC A;  3A5X A;  1MIV A;  1YKH B;  3ZMZ B;  5J2T E;  4PJM A;  2LT3 A;  2WWU A;  2CWY A;  3AA1 B;  2BZB A;  3PTR B;  5JDM A;  3MK7 C;  5L2L A;  4CXW A;  4DBR A;  2VAS A;  3ETV A;  3I1A A;  4XZC A;  3ZYM A;  2XUE A;  3BQI A;  4Z8X A;  3RC8 A;  2DI4 A;  2H7O A;  2A2F X;  3H3A A;  3RYH E;  1CUN A;  4DMV A;  4I43 B;  3ZN0 B;  3I0O A;  1BR2 A;  5FXZ A;  4FI5 A;  4IST A;  4HFV A;  3M65 A;  3L3P A;  3OBV E;  5L3B B;  4JLE A;  5HXR A;  2V7J A;  2K9A A;  3QK6 A;  4E7S A;  4QXH B;  1MMG A;  3C98 B;  2C5J A;  3ZPO A;  2CEA A;  5FMN A;  3O9X A;  2ZM8 A;  3N5L A;  3RH3 A;  3Q9D A;  2NWB A;  2XAQ B;  3KDS E;  2VKO A;  3DP7 A;  3KV6 A;  2CCQ A;  3ESL A;  5LGU B;  2CLY B;  5L3G B;  2EHO B;  3LJC A;  1HFA A;  2X9X A;  2SPC A;  3D0T A;  1O3X A;  3NRY A;  1HG2 A;  2LHN A;  4QXB B;  4XAX B;  4J2C A;  3C50 A;  3R6N A;  2HPJ A;  1MMA A;  4MFR A;  1VOM A;  3SWH A;  5JR9 A;  2NW9 A;  1WYB A;  4H63 H;  2WAU A;  4AKG A;  4OK0 A;  1LVF A;  2GK9 A;  5HXC A;  5FXX A;  4TX5 A;  2D2S A;  4OHF A;  5FXV A;  3DTO A;  3GMI A;  2XTL A;  4PK5 A;  1D0Z A;  3WAJ A;  2G0U A;  4GOU A;  2KMF A;  3N2O A;  3CWZ B;  3RRW A;  2HH7 A;  5JDL A;  5LG4 A;  4PNI A;  4O8S A;  1SA0 E;  4CI3 B;  3FBZ A;  1IJ5 A;  1H7C A;  4NUV A;  4ZI3 D;  4UVA B;  3PUS A;  2X9W A;  4IDZ A;  3OYZ A;  1ZKE A;  2WM9 A;  5KX5 E;  4HTE A;  4IE6 A;  1IZN B;  1BR1 A;  5DJQ C;  4WBN E;  4TN7 B;  3I9Y A;  1VRB A;  2YK0 A;  3KVB A;  3PUR A;  5DQW A;  3LBX A;  5LBM A;  3KV9 A;  5LJN A;  2QA7 A;  2BDE A;  4ZHQ E;  2N1G A;  4H9P C;  1G8X A;  2CLY C;  2CA5 A;  2LSG A;  5JRE A;  4UXN B;  4I50 E;  1MIW A;  2NTX A;  3PU8 A;  3U78 A;  4PFP A;  3AAE B;  2Z6E A;  3HKE E;  4CZZ B;  3HI2 A;  2B1E A;  3LBX B;  3K3Q C;  5J2U E;  4C90 A;  2JRK A;  4G2A A;  2XAJ B;  2XHE B;  4PK4 A;  5H6Q B;  3N2K E;  3CQX C;  1S94 A;  2LJL A;  1YD8 G;  2KXP B;  5LOV E;  2WBL A;  5LXT E;  3PE0 A;  4H9N C;  3UT5 E;  3HL6 A;  1HTJ F;  2W00 A;  2J1D G;  2KZ7 B;  1OWA A;  2NOX A;  2KIN B;  3H37 A;  5L3E B;  1MIY A;  2DHR A;  5A1L A;  4YFS A;  4EYU A;  3PDY A;  1G73 A;  2MBG A;  3N2G E;  1HF8 A;  2K24 A;  2HPL A;  4OYK A;  4HN9 A;  2D0T A;  3F57 A;  4EYY R;  2E9X C;  2Q9Q B;  3QC9 A;  2Y48 B;  2IC6 A;  4MBQ A;  1V9D A;  1BR4 A;  2LOP A;  3LK4 2;  3GN5 A;  5HWY A;  3EDV A;  5EK4 A;  3ZJ1 A;  5LHH B;  2A72 A;  1KNZ A;  2K5B B;  3AA7 B;  4BJM A;  5HXH A;  5HWX A;  4O4H E;  5JR9 B;  3RYF E;  2BVM A;  4XBF B;  2KT9 A;  1NWM X;  4FJO A;  3BK9 A;  2XAS B;  2X9H A;  1UX4 A;  3WAK A;  2V26 A;  3OYX A;  3L09 A;  2X68 A;  2ZM0 A;  3AB3 B;  2ZMA A;  4CI2 B;  4EB6 E;  2YEV C;  3HKD E;  1YKE B;  1FMW A;  3PUQ A;  4P0B A;  3KFW X;  5IYZ E;  3RX6 A;  2LSY A;  3S4U A;  2JQQ A;  3LG7 A;  5FY7 A;  4P09 A;  4O4I E;  2NP9 A;  3F31 A;  5EZY E;  3SS1 A;  4DMW A;  3W15 B;  4ZI2 C;  2N9D A;  4UIG A;  1Z0P A;  2VWA A;  5FNV E;  2XQY A;  5L3D B;  3EUH A;  3C4W A;  4G63 A;  4DND A;  2VL8 A;  4PAG A;  5HAX A;  3UTK A;  4M1P A;  5ADX L;  4AKR B;  3C4X A;  4O4J E;  1BR0 A;  1FIO A;  5EK3 A;  1HG5 A;  2EHO C;  4H9S E;  3ZC1 A;  5DAB A;  3ZEF B;  2PJQ A;  2VKH A;  4AQF A;  3DJB A;  4IHJ E;  3FXE B;  5LNK A;  4I4T E;  1UCU A;  4X1I E;  3EDU A;  4GIW A;  3N9L A;  2L8K A;  3RKO A;  4PFO A;  3HKB E;  4BA9 A;  1MND A;  4WBO A;  2WMN A;  3PUA A;  3C64 A;  2W63 A;  4ISS A;  4EOZ B;  5FP3 A;  4PK6 A;  3VU7 H;  2W61 A;  3ZYL A;  5LJM A;  4EZH A;  4UV9 B;  2N2N A;  2LOS A;  2LSJ A;  4WNK A;  2VKD A;  4CXX A;  5LBQ B;  5FY1 A;  4I55 E;  3AAA B;  5HXE A;  1U4Q A;  5CA1 E;  2E9X B;  2Q9Q C;  2OA5 A;  2K48 A;  2P9B A;  4JEH B;  4CI1 B;  1T98 A;  4TV9 E;  3ZC0 A;  3SOL A;  3JC6 D;  3LK2 B;  3ZMU B;  2ODU A;  2WSS V;  3ZLI A;  3GWH A;  3CPZ A;  4V1A v;  2KLQ A;  5EK2 A;  3T8O A;  4L0R A;  2Q9Q D;  4H9O C;  4IE7 A;  4PJL A;  5FY0 A;  3AA0 B;  4IE0 A;  4TV8 E;  3CX7 B;  3J9X 1;  2X0L B;  4AKH A;  4X1Y E;  3NBX X;  1KK7 A;  2CE7 A;  2BVL A;  2DLR A;  2IC9 A;  1NAF A;  3MAC A;  4ZS2 A;  3QUJ A;  2DWG A;  3P8C D;  4GK5 E;  2PBI A;  3ZJ2 A;  4AI6 A;  3OKQ A;  4EAH A;  1MNE A;  3FHN A;  1LRZ A;  3VKH A;  1IAP A;  3KVA A;  1D0Y A;  5LYJ E;  3P7I A;  1B7T A;  2JPF A;  3RYI E;  5L3C B;  3NZQ A;  3Q5W A;  4IIJ E;  4ZI7 E;  3Q2M A;  4L9I A;  3ZCI A;  3I9W A;  2LSK A;  3KV5 A;  2E9X A;  5JRC A;  5KMG P;  4P0A A;  4QKN A;  4MAL A;  4YLH A;  4PJJ A;  2YU1 A;  3ANW B;  5JVD E;  2D5U A;  5HXS A;  3ZN1 B;  5JDG A;  2MTQ A;  3VHL A;  3SRZ A;  2ZLY A;  2DNX A;  4H9Q C;  4UEL A;  4ADZ A;  4GK0 E;  5F8P A;  4BJN A;  2EHO D;  1QUU A;  2VKJ A;  4KUM B;  4E7Z A;  5L3F B;  2PG8 A;  5C8Y E;  2WMO A;  2C0S A;  4B6X A;  3IBP A;  3MKD A;  3K3N A;  3NRX A;  3CQG B;  2ACX A;  4N78 D;  4AXP A;  3MXZ A;  3K8P C;  4AKL A;  5BMV E;  2W0G A;  1OXZ A;  3IF8 B;  4UEM A;  5F3J A;  3AVS A;  1HS7 A;  3ZYK A;  5TAO A;  3HKC E;  2CM0 A;  3LFM A;  3AA6 B;  3ZMS B;  5JDH A;  1D1C A;  2CXD A;  2JMK A;  2UXX B;  5J1G A;  3AAI A;  2X51 A;  3KV4 A;  3VKG A;  4HE8 A;  2W62 A;  3WI3 A;  1D0X A;  5LHG B;  2XAG B;  4PJN A;  3V5S A;  2Y8D A;  2X67 A;  2DWK A;  2Q9Q A;  3MA9 A;  2LHR A;  4UVB B;  1HCI A;  1WLX A;  3O1J A;  5KDM C;  1US7 B;  2YIN A;  4U74 A;  4PW8 A;  1QSD A;  5LGT B;  3EVY A;  2LEH A;  4U72 A;  3CX6 B;  5FXW A;  3C51 A;  5JDF A;  1WYC A;  2H3R A;  3NZP A;  4EIW A;  2JJ9 A;  2XAH B;  3FBL A;  4ERR A;  1MMD A;  2LE8 A;  1FMV A;  4CXY A;  2X66 A;  1LKX A;  4YJ3 E;  2ZM2 A;  2JMH A;  2V1D B;  1AJ3 A;  5H6R B;  5JRC B;  1UX5 A;  4O2A E;  4EXT A;  1D1B A;  4GYR A;  1Y64 B;  3E22 E;  4DO0 A;  3C4Z A;  4KMC A;  4UF0 B;  3PUG A;  1YW0 A;  2V7K A;  1MMN A;  2NW7 A;  4OYJ A;  4H63 V;  2KND A;  3GA8 A;  4K0U A;  3B57 A;  3E0Z A;  5LHI B;  3N9N A;  4QXC B;  2KWI B;  2YU2 A;  2CWO A;  1EZ3 A;  5LP6 E;  3UUX B;  1LVK A;  1HX8 A;  2M67 A;  2MYS A;  4DBQ A;  3FXD B;  3KBU A;  3J7Y q;  4O4L E;  4IE5 A;  2E8I A;  4YHJ A;  5DQV A;  2IW5 B;  3RRC A;  3I0Q A;  5CA0 E;  3FB2 A;  2X9Y A;  3CML A;  2V7M A;  4IGU A;  2QGS A;  3O1I A;  4X1K E;  2NW8 A;  4HEA A;  3U3I A;  4UVC B;  3F2E A;  2ES0 A;  4GYS A;  4UF0 A;  5JDQ A;  3ANW A;  4ANJ A;  4QX7 B;  1X79 A;  1S35 A;  3R84 B;  4QX8 B;  3BQK A;  4MLK A;  2C5I T;  4UV8 B;  5LA6 E;  4KBM B;  3LK3 B;  3UUL A;  4TUY E;  5FYM A;  4ZI2 D;  4DVD A;  3O1H A;  4ZI3 C;  4F6R C;  3TKL B;  2L3L A;  4JUY A;  2VK9 A;  2KWH A;  3K3O A;  5JDN A;  3N9P A;  2RP4 A;  1D1A A;  4O2B E;  4ZOL E;  5IHY A;  4YJ2 E;  3V5U A;  5HYA A;  5GON E;  4NUU A;  2PFV A;  3BQL A;  1SHZ C;  4ILU A;  4QWN B;  1ZV4 X;  4X20 E;  3UUN A;  4BAY B;  1IJ6 A;  3RC3 A;  2LM9 A;  5E0O A;  3N9O A;  2D0U A;  2MOZ A;  2Y6X A;  5M4Y A;  3IHR A;  3N9M A;  3O4X E;  2ODV A;  4AKI A;  5JH7 E;  2XAF B;  2I59 A;  3HA4 A;  3CKD A;  3HR0 A;  3PU3 A;  5ETW A;  5JR9 C;  3IEE A;  2VB6 A;  2CXL A;  4HKA A;  3GN5 B;  5AFU L;  2EHO A;  1ZEE A;  5JQG E;  4OFZ A;  2LSI A;  2C5K T;  3ZMT B;  4CQI A;  4KP3 C;  4ZS3 A;  3CQC B;  3N9Q A;  2DCF A;  4AQG A;  3OJA A;  4L5G A;  3UUM A;  4WW0 A;  3ZMV B;  4IE4 A;  4EZ4 A;  2CXF A;  3CVR A;  1WRD A;  3E08 A;  2CMR A;  4H9R C;  3ZCJ A;  1FEW A;  3JC6 C;  2E9X D;  4JEU B;  3RPU A;  4TZ4 C;  2A3D A;  3UFE A;  3KBT A;  5CB4 E;  2NTY A;  4AQF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...