2LSGA

Solution structure of the mouse rev1 c-terminal domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein REV1
publication title Multifaceted recognition of vertebrate Rev1 by translesion polymerases zeta and kappa.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsgA00
2LSGA 2LSKA 4FJOA 2LSIA 4GK0E 4EXTA 2N1GA 2LSYA 2LSJA 4GK5E 3VU7H 4BA9A
chains in the Genus database with same CATH superfamily
3P50A 3VKGA 2XQAA 1MNDA 2V6XA 4I55E 1ZP0A 2VURA 4EEDA 4EYUA 3UU6A 4GK0E 2W0GA 1U4QA 3UQ4A 2E8IA 3PTRB 5BMVE 2XY8B 5F8PA 4DR1T 4ERRA 1YKEB 2DLRA 3FHNA 2H88A 4BAYB 1QUUA 5LBMA 3UT5E 1IZNB 3ZMTB 2W67A 5FKYA 5HCMA 1UK5A 5FXXA 3UUBA 4JI3T 5CA1E 2M6BA 1LVKA 4O4JE 2LSGA 4P0BA 1T7SA 4L5GA 4KX6A 3AEDA 4YSXA 5JVDE 4Q25A 2YOEA 1KFYA 3Q5EA 3LG7A 2DWGA 4DR6T 1ZV4X 3ZYKA 3RC3A 4DVDA 2VB6A 5HXSA 3C98B 4HFVA 3L09A 1OEDC 2Z6EA 4PFOA 3KVAA 4V1Av 1U5PA 4UIGA 4DMWA 1T72A 4O4LE 4QH5A 2JQHA 3OTOT 3AE1A 4GIWA 3GN5B 3AE5A 4IE5A 4JI1T 4DR2T 4X66T 3AE7A 3P4QA 3Q5DA 4X62T 4CXXA 2YEVC 3ONJA 1BR1A 2X9XA 4OFZA 4LMJA 2QA7A 1BR4A 2QYWA 1D1AA 1N32T 2CXDA 2BKOA 4ZS3A 1I94T 4QHOA 2D0UA 2PJQA 2YN6A 2W2UA 1S94A 4DUYT 2RP4A 1LKXA 3ONXA 5JDNA 1XNRT 4DIDB 2XASB 4QX8B 3N2KE 1SUMB 3OYXA 4ILUA 4TV9E 4UELA 1WLXA 2WB5A 4YFSA 3LFMA 1VRBA 2XPKA 2RPAA 4LF7T 2WQYA 1XMQT 2LT3A 5FL1A 5JRCA 2MTQA 3FZFB 3BQKA 5HXRA 4AKIA 2HN2A 4Z91A 3R84B 4ZZBA 2XQYA 3CX6B 3ZMZB 5AQHB 3JC6C 3MJXA 2ZM8A 4TUYE 3KV5A 2V5CA 3ZC1A 4LFBT 3VRAA 2W62A 2X0YA 1CHUA 4MHCA 5ABEA 4JI0T 4GKJT 4AKRB 2XSBA 3P4WA 4DV2T 2BZBA 3BQIA 4TV8E 3CIRA 3J7Yq 2OA5A 1MIWA 4ILBA 2H3RA 2LSIA 2X0HA 4CI3B 2XZEA 1YQ3A 3RYCE 2LRLA 4LFAT 2X9WA 3I1AA 2FJEA 3RKOA 3PU3A 1HCIA 3PUWF 3RRWA 2UUCT 4OYKA 1MMNA 1VOMA 2V7MA 4DUZT 3RH3A 4F8HA 3SS1A 1BR2A 3KV9A 1US7B 2WMOA 3AAEB 3RI5A 3JADA 3AB3B 4AKGA 3NKZA 1B7TA 4UXNB 4H9PC 3ANWB 5CB4E 5L4EA 4LFCT 2M6IA 4H63H 5LMNT 3KBTA 2JIWA 4HFDA 3JAEA 3N9LA 4AQFC 5ABHA 2L9QA 4OX9T 2NW7A 5FL0A 4DO0A 5JDGA 2WZHA 2XQ5A 5CA0E 2X9HA 4NIQA 4HWDA 5HXHA 2UXXB 1E1HB 2PFVA 5HCJA 4WBNE 4OK0A 2ODVA 1KF6A 3LK3B 3VR8A 5EK4A 5JDFA 2XAGB 5AQKB 1QSDA 3H3MA 3ZJ2A 2E9XB 1J5WA 4KMCA 3S4UA 2GK9A 4ZI7E 3TLTA 3ZMVB 5FY7A 5IHYA 3HR0A 2LOPA 4Z90A 5CJ5A 2XM2A 4HFBA 2LJLA 2NW8A 1OWAA 3AVSA 2BS3A 2D5UA 3K3QC 5AQRB 2Q9QA 2MPKA 3IHRA 4CN4A 1HR0T 5F3JA 1UURA 3AE4A 5L47A 5HAXA 5AQNB 4EZ4A 4P0AA 2X0LB 5A1LA 4IIJE 3GMIA 2UXDT 4ZI3D 1KEYA 3FZHB 4WW0A 4I0UA 2VKHA 2ES0A 3VKHA 3WAKA 3NVOA 1MMDA 4P09A 3SFDA 3FBLA 1D1BA 2WMNA 3ZKRA 3ZT7A 5EK2A 5L3FB 3TKLB 1BR0A 4COFA 5ETWA 3BQLA 2IUBA 1R8IA 5LCYA 5L4HA 2CHNA 5HWXA 3UU8A 3PUGA 2KZ7B 5FYMA 3H37A 4GYSA 3OVUA 4DV5T 4UVCB 5JR9B 1WYCA 2X67A 4IREA 3RIUC 4ISTA 3W15B 4X64T 5AQLB 4AQYT 5IWAT 4IDPA 3P4RA 4ANJA 5JH7E 1WYBA 5JDHA 3ZLIA 1Y64B 2ODUA 3RIFA 4U2YA 5CGMA 3L3PA 4MBQA 5LYJE 4EAHA 4EB6E 4BA9A 5LMUT 4AISA 5LGNB 4WBOA 3RQUA 1MIVA 2DHRA 3X1DA 4I4TE 1G8XA 1UCUA 3ONLC 4DV3T 3UUMA 4TWFA 5M4YA 2WM9A 4PJNA 3CX8B 4C91A 2QRXA 5FY1A 4X1IE 4PK6A 2YKSA 1KK7A 4N78D 1SHZC 2LEHA 1L0VA 2ZM0A 4B3MT 3FXEB 5LHHB 2H7OA 4IHJE 5FNVE 2YK0A 3PV0F 5AQUB 3UU3A 3K3OA 3VHLA 4IL4A 3N9QA 3CQCB 3O4XE 2HH7A 3CMLA 5BR8T 5J2TE 3HL6A 4NUVA 3SWHA 2LM2A 1FEWA 2ZMAA 3F31A 2J4GA 2BDEA 4QXHB 4ZZCA 1DU2A 1M62A 3V5UA 3EDVA 3KINB 4GOUA 5AQSB 2E9XC 3AA6B 1D0YA 2DWKA 2CM0A 1D0XA 2VKOA 1UX4A 5KMGP 3OYZA 3RF1A 3ZEFB 2LSYA 3VR9A 1E2AA 3PU8A 4CN1A 4AKHA 2ZLYA 4LMKA 1W09A 4U7IA 2W63A 5H6RB 1S35A 2BG9B 2E5VA 4L0RA 3UU5A 2E2AA 2BBHA 3ZMSB 3UU4A 4HWIB 4U33A 2W61A 5ADXL 3PUAA 3HI2A 1UUSA 1YXRA 1JNRA 5DJQC 3ANWA 4IGUA 2ACXA 3MKDA 4EGWA 3ZSSA 2LRKA 1ZEEA 5FXWA 3KV6A 3EHZA 2KLQA 1HNXT 2UU9T 3PURA 4H9SE 3AEGA 3RQWA 3RHWA 3DJBA 3DP7A 4HTEA 4P1NA 5AQFB 2EHOD 2D2SA 3PE0A 1YKHB 5LXTE 4IDNA 2J1DG 3HKBE 3A8YC 3G06A 3N2GE 2X9YA 3QC9A 3OPCA 3AE8A 2E9XA 2CBIA 2OLTA 4PK4A 5KX5E 4HFHA 3CPZA 4LF5T 5L3DB 2BVMA 2MOZA 2F4VT 3CX7B 4ZI2D 4H9RC 2I59A 3T1YT 2P9BA 3Q5WA 2KMFA 4CI1B 1HNWT 4YHHT 2WDVA 4JI2T 2WDRA 3ABVA 2NW9A 1Z0PA 5L3CB 2AXDS 3NZQA 4EZHA 2DI4A 2VQFT 3RIAA 4XBFB 3L8RA 1IBKT 3UFEA 4PFPA 2WAUA 2CLYC 4AIUA 3C4ZA 2WU2A 2J47A 4NXNT 4UR9A 3LJCA 4GK5E 4YXDA 2LKHA 4A56A 3IA3A 4L9IA 3ZJ1A 4DR3T 5LBQB 4U74A 1G73A 3MK7C 4YSYA 3B57A 3RLFF 4ZEYA 2EHOB 3NRXA 3N5LA 3AE6A 4A98A 3ZC0A 3AE9A 5JR9A 1N34T 5JDLA 2Q9QC 4PJMA 5JDMA 2V7LA 2FJDA 1NAFA 3P7IA 1HFAA 3OKQA 4NPPA 4CXYA 3O1JA 2XM1A 2JQ9A 1LRZA 3I0OA 2X51A 3AEFA 2BVLA 3EAMA 1WCRA 5KXJA 4HFCA 1J5ET 1HG5A 2MAWA 3NRYA 3F2EA 4IDZA 1VCSA 2XQ9A 3SRZA 3AXJB 4X1YE 3N2OA 4JV5T 2CXLA 2CHOA 2H89A 2R6GF 4U2ZA 1IBMT 4PAGA 3O1HA 3IEEA 4OHFA 5FVLA 3PJAJ 2J62A 2BG9E 4I43B 2JJ9A 5HEUA 4K0KT 4DBRA 4CQIA 2JMKA 4DV6T 2XQ3A 3PJAA 4GYRA 2K9AA 5FMNA 1FJGT 2VVSA 1W0AA 3AAAB 5HEGA 4TNVA 1NEKA 4EIWA 3UULA 3QNUA 2V5DA 1ZKEA 4KI0F 1I6ZA 1V9DA 4HEAA 4O4HE 3FBZA 3A5XA 5C2TA 3PDYA 3B5MA 1MMGA 4DR7T 3QOFA 3PUYF 3AA1B 5AQIB 1Y01A 1HX8A 5FVKA 5C3JA 3U3IA 1O3XA 3AEAA 2LLYA 2UXNB 1HG2A 2LM9A 4HKAA 4BJNA 4EV6A 2D0TA 4QH4A 4QXBB 5FXVA 5HEOA 5JDQA 3K8PC 1T98A 2QVAA 4DV0T 5DQVA 2E5LT 2C5JA 3PUVF 2WY2A 2HN1A 3PUQA 1HS7A 2M67A 2UUAT 3FB2A 2K48A 3E08A 3JC6D 2MYSA 2B1EA 1OEDB 5J0ZA 1ZHCA 3QK6A 2NTYA 2BG9A 2OV9A 5L3GB 3P4SA 3BK9A 2VWAA 2NR4A 1XWMA 2A9UA 2KWHA 1VCTA 2V7IA 2IMLA 4G63A 2K5BB 4EEBA 4A97A 2XQ4A 2CBJA 2KSRA 2BS2A 3MA9A 2HPLA 4UVBB 4YJ3E 3GN5A 2Y48B 1KNRA 3WI3A 4IDQA 5JQGE 4E7SA 2XJ7A 3CVRA 5LGUB 5AFUL 1IJ5A 1CUNA 1Z8UA 4CXWA 4YSZA 3P4PA 4QXCB 1WFDA 3LSVA 4M1PA 5LGTB 4TZ4C 4U7YA 4C90A 5ABFB 5LG3A 1FMVA 3IBPA 2JPFA 5EK3A 4NXMT 4WZXA 3U78A 3M3ZB 3K1SA 4O2AE 3FXDB 3AA7B 4YY3T 4FJOA 3ZCIA 1HF8A 4U31A 2X68A 4BJMA 2BKNA 3CWZB 5HXCA 4HN9A 4DV7T 2Y6XA 3I0QA 2KNDA 2JQKA 2WCAA 1N36T 1W0BA 4ZHQE 2NP9A 5HEJA 4U72A 4NUUA 3KBUA 4CI2B 4HWFA 2CEAA 4O2BE 5HWYA 5HEHA 4JI7T 3HKEE 1XNQT 4CZZB 3MZKB 3KVBA 3K3NA 2XAFB 1X9BA 4HWCA 4MALA 3I9WA 1XDPA 4YLHA 2D9DA 4H9OC 4G2AA 3NBXX 5IYZE 2BS4A 3AE3A 3M65A 2IC9A 4OYJA 1N33T 3PUXF 3A7MA 3H3AA 2WWVA 1UGOA 2VL8A 4GKKT 3RYIE 3JAFA 3FZMB 5HXEA 3LBXB 3E0ZA 3ESLA 1KNZA 3JCFA 4IE4A 2EHOA 3ZMUB 2IAKA 4PNIA 3FZKB 4JEUB 3T1HT 5GONE 4ZOLE 4JI4T 1T8BA 3EI0A 3DTOA 2YU2A 1IBLT 2YDQA 4EOZB 3CK6A 3CKDA 4HE8A 1FIOA 2X66A 3QUJA 2IDOB 3RPUA 1GQEA 4WYVA 4IL9A 5DABA 2CCQA 5L3BB 5HYAA 1IAPA 3AXJA 4ILCA 3ZYLA 2JQQA 5FY0A 2FUPA 3T8OA 2YDRA 2LHNA 4E7ZA 3RC8A 2FJAA 1OEDE 1YQ4A 4EYYR 4HFIA 2KINB 3FZLB 4X65T 4ZXLA 3GA8A 3IF8B 3SOLA 2WWUA 4AQGA 1KNPA 4EXTA 3ZT5A 4LF4T 5LHIB 4LF6T 4KHZF 2B76A 3Q5XA 4ADZA 2CWOA 5JR9C 2V7KA 4Z8XA 4I50E 4HGAA 2IHR1 4FI5A 2CWYA 3L39A 2VQET 3ZYMA 3O1IA 2VASA 1SE7A 4AI6A 2CE7A 3N9PA 2XAQB 3I9YA 2I0MA 2V6YB 4A5XA 3OBVE 3HA4A 3EDUA 2JMHA 3ZSTA 3TLUA 3RYFE 2A72A 2JRKA 2N9DA 5LB7B 5AQPB 4ISSA 3VRBA 2CRBA 2I6HA 3ZT6A 2A3DA 5J1GA 4ZI3C 1IJ6A 4ASKA 2DCFA 2LKGA 4IDOA 4J2CA 4JLEA 2V7JA 3F57A 4UF0B 2PTFA 2W4XA 2LOSA 2XQ7A 2K24A 2UXBT 2K3WA 4UEMA 3VU7H 2UUBT 3LK2B 2G0UA 2ZM2A 1WR6A 2YINA 1D0ZA 4JI8T 1W9RA 2WSSV 4CN6A 4B6XA 3ETUA 1OEDA 2MBGA 1MMAA 2WDQA 4IE0A 4TWDA 1HX1B 1WR0A 3OJAA 5JREA 4YJ2E 1SA0E 4QKNA 1EZ3A 3ZCJA 2E9XD 2KT9A 3ETVA 3QB5K 1XZYA 2C5IT 2XTLA 3NZPA 1YW0A 3PUZF 4PW8A 3C64A 3AE2A 3KV4A 4PK5A 4DV1T 3QB5A 4PJJA 2NWBA 4HWHA 4DMVA 2FJBA 3E22E 4QX7B 4IE6A 5KDMC 4LMLA 5ABFA 4IE7A 3C50A 3MACA 2HPJA 4TX5A 2VKJA 2RA1A 2V26A 1M7KA 4KHPT 2BG9C 2NOXA 2WBLA 1MNEA 3CQGB 1YD8G 5LNKA 3RGLA 3UTKA 4LF8T 5LP6E 4QH1A 2XQ8A 3HKDE 5AQQB 4TNWA 3ZN0B 1AJ3A 2IC6A 2YU1A 2XSAA 4PJLA 2HHHT 1OXZA 4X20E 3AVRA 1UX5A 4H63V 5E0OA 2WZIA 3J9X1 2ZM6T 4XAXB 2L3LA 1JNZA 3PUSA 4K0UA 3RKGA 1XMOT 4DV4T 1NENA 2V1DB 4DNDA 2LE8A 3RX6A 3LDQB 5AQJB 5H6QB 2IIUA 4U3CA 2BBJA 5DQWA 3TLSA 4ILAA 3B13A 4F6RC 4AXPA 4HFEA 2NTXA 2N1GA 5JRCB 4B3TT 3SFEA 4B3RT 2DNXA 3NWIA 3AAIA 4KP3C 2QGSA 4JUYA 3LBXA 3AA0B 5TAOA 4B3ST 4YHJA 4AKLA 2AE9A 2XQ6A 2YDSA 4DR4T 3EVYA 2WP9A 4TWHA 5LJMA 2XAJB 4MLKA 4DR5T 4YT0A 4TN7B 2C0SA 5AQTB 2WS3A 3GWHA 4X1KE 3ZN1B 5JTGA 3EABA 5LG4A 4LF9T 1FMWA 3TLWA 2XHEB 4UV8B 4AQFA 4XZCA 3HKCE 2KWIB 2H7VC 4KUMB 1MIYA 4YTNA 2UXCT 1WRDA 3C4WA 2VK9A 2W00A 2LSJA 1J1JA 4YTMA 4DBQA 3RYHE 2VKDA 5CFBA 2Q9QD 4JYAT 4JI6T 4JBWF 4X5TA 3UFGA 3Q9DA 2PBIA 4IT4A 4UVAB 5LA6E 2EHOC 5J2UE 1X79A 3KDSE 3MXZA 3Q2MA 4H9QC 3EUHA 2FBWA 5LOVE 2KXPB 2C5KT 2VVNA 3CQXC 5IUXA 3D0TA 2SPCA 5FXZA 2L8KA 5LHGB 5AQGB 5AQOB 2CPTA 1D1CA 2V6YA 3O9XA 4KBMB 4YTPA 1H7CA 2V8SV 5L3EB 2LSKA 4ZI2C 2CXFA 4WNKA 3AEEA 2A2FX 1ZOYA 4JEHB 5L2LA 4UV9B 2N2NA 2XAHB 4MFRA 3V5SA 5FP3A 1NWMX 5C8YE 2XUEA 4H9NC 3P8CD 3RRCA 1XDOA 2CLYB 5EZYE 3WAJA 3LK42 4ZS2A 3KFWX 2LHRA 4JI5T 3AEBA 5AQVB 2BKPA 3N9NA 3UQ7A 4O4IE 3AECA 4UF0A 3TLVA 3UUNA 3ZPOA 2CA5A 2WU5A 5AQMB 3C4XA 1LVFA 3C51A 5F5WA 2PG8A 2DL1A 2ACZA 5LJNA 2IW5B 1HNZT 1E7PA 2Q9QB 3RIUA 3UUXB 3N9MA 3N9OA 1HTJF 2Y8DA 4O8SA 2VL0A 3R6NA 2CMRA 2W66A 4QWNB 5ABGA 1QLBA
chains in the Genus database with same CATH topology
3RYFE 1WYCA 2X67A 2JMKA 2A72A 4ISTA 3W15B 3VKGA 1MNDA 2JRKA 2N9DA 4I55E 4GYRA 2K9AA 4ISSA 5FMNA 4EYUA 4GK0E 2A3DA 5J1GA 3AAAB 2W0GA 1U4QA 1IJ6A 4ZI3C 2E8IA 4ASKA 2DCFA 4J2CA 4ANJA 5JH7E 4JLEA 2V7JA 3F57A 3PTRB 4UF0B 1WYBA 5BMVE 5F8PA 5JDHA 3ZLIA 1Y64B 4ERRA 1YKEB 2ODUA 2DLRA 4EIWA 3FHNA 3UULA 2LOSA 4BAYB 1QUUA 5LBMA 3L3PA 3UT5E 2K24A 1IZNB 4MBQA 5LYJE 4UEMA 3ZMTB 3VU7H 4EAHA 4EB6E 4BA9A 3LK2B 2G0UA 2ZM2A 5FXXA 5LGNB 1WR6A 2YINA 1ZKEA 1D0ZA 4WBOA 5CA1E 1LVKA 1MIVA 4O4JE 2DHRA 1V9DA 2LSGA 4HEAA 4P0AA 4O4HE 2WSSV 4P0BA 4I4TE 1G8XA 3FBZA 4L5GA 1UCUA 4B6XA 3UUMA 3A5XA 5JVDE 3ETUA 5M4YA 2WM9A 3PDYA 3LG7A 1MMGA 2MBGA 4PJNA 2DWGA 1MMAA 1ZV4X 4IE0A 3ZYKA 3CX8B 3RC3A 4DVDA 4C91A 5FY1A 2VB6A 5HXSA 3AA1B 4X1IE 3C98B 1HX8A 4PK6A 1KK7A 3OJAA 4HFVA 5JREA 3L09A 4YJ2E 1SA0E 2Z6EA 3KVAA 4N78D 1EZ3A 4QKNA 4PFOA 4V1Av 1U5PA 4UIGA 4DMWA 1SHZC 2LEHA 3ZCJA 4O4LE 3U3IA 2ZM0A 2E9XD 1O3XA 2KT9A 2UXNB 3ETVA 1HG2A 2LM9A 4HKAA 4BJNA 4GIWA 3GN5B 3FXEB 4IE5A 5LHHB 2H7OA 2C5IT 4IHJE 2D0TA 2YK0A 4QXBB 5FNVE 5FXVA 2XTLA 3NZPA 1YW0A 4CXXA 5JDQA 3K8PC 1T98A 2YEVC 4PW8A 1BR1A 3C64A 2X9XA 4OFZA 3KV4A 4PK5A 2QA7A 5DQVA 1BR4A 2C5JA 3K3OA 3VHLA 4PJJA 1D1AA 3N9QA 2NWBA 4DMVA 3PUQA 3CQCB 2CXDA 4ZS3A 1HS7A 2M67A 3E22E 4QHOA 3FB2A 2K48A 3E08A 3JC6D 2D0UA 3O4XE 2HH7A 2MYSA 2PJQA 4QX7B 4IE6A 3CMLA 5KDMC 2B1EA 1S94A 2RP4A 1LKXA 5J2TE 3HL6A 1ZHCA 3QK6A 4IE7A 2NTYA 3ONXA 4NUVA 5L3GB 3C50A 3MACA 5JDNA 3SWHA 2HPJA 2XASB 3BK9A 1FEWA 2ZMAA 4TX5A 4QX8B 2VKJA 2VWAA 3F31A 2RA1A 3N2KE 2BDEA 2V26A 3OYXA 4QXHB 2KWHA 4ILUA 2V7IA 4TV9E 3V5UA 4UELA 2NOXA 3EDVA 1WLXA 3KINB 2WBLA 4YFSA 1MNEA 3LFMA 4G63A 1VRBA 2K5BB 1YD8G 3CQGB 4GOUA 5LNKA 2E9XC 3AA6B 3UTKA 1D0YA 5LP6E 2DWKA 2LT3A 2HPLA 2CM0A 3MA9A 4UVBB 4YJ3E 3HKDE 3GN5A 2Y48B 1D0XA 5JRCA 2VKOA 1UX4A 3ZN0B 2MTQA 3WI3A 1AJ3A 5JQGE 4E7SA 5KMGP 3OYZA 3ZEFB 3BQKA 2LSYA 3CVRA 2YU1A 2IC6A 5HXRA 4PJLA 5LGUB 3PU8A 4AKIA 4AKHA 5AFUL 1IJ5A 1CUNA 1OXZA 2ZLYA 4X20E 3AVRA 4CXWA 1UX5A 3R84B 4H63V 2XQYA 4QXCB 3CX6B 5E0OA 4M1PA 4TZ4C 5LGTB 3J9X1 2W63A 3ZMZB 5H6RB 4C90A 3JC6C 1FMVA 1S35A 2JPFA 3IBPA 5EK3A 3MJXA 4L0RA 3U78A 4XAXB 2ZM8A 4TUYE 2L3LA 3KV5A 3ZC1A 3PUSA 4K0UA 2W62A 4MHCA 4O2AE 3ZMSB 2V1DB 3FXDB 4DNDA 2LE8A 3AA7B 3RX6A 4FJOA 2W61A 3ZCIA 1HF8A 5H6QB 5ADXL 3PUAA 3HI2A 5DQWA 4AKRB 5DJQC 3ANWA 3B13A 4IGUA 2BZBA 3BQIA 4TV8E 2ACXA 3MKDA 4F6RC 4AXPA 2X68A 3J7Yq 2NTXA 2N1GA 4BJMA 2OA5A 5JRCB 1MIWA 3CWZB 5HXCA 1ZEEA 2DNXA 2H3RA 5FXWA 2LSIA 3AAIA 4HN9A 3KV6A 4CI3B 4KP3C 2QGSA 4JUYA 2KLQA 3RYCE 2Y6XA 3I0QA 3LBXA 3AA0B 2KNDA 5TAOA 4YHJA 3PURA 4AKLA 4ZHQE 2NP9A 2X9WA 4U72A 3I1AA 4H9SE 3RKOA 4NUUA 3PU3A 1HCIA 3DJBA 3DP7A 3KBUA 3RRWA 4HTEA 4CI2B 3EVYA 2CEAA 2EHOD 5LJMA 4OYKA 4O2BE 1MMNA 5HWYA 2XAJB 4MLKA 1VOMA 2V7MA 2D2SA 3PE0A 1YKHB 4TN7B 5LXTE 2C0SA 3HKEE 3RH3A 3SS1A 4CZZB 3MZKB 3GWHA 1BR2A 2J1DG 3KVBA 4X1KE 3KV9A 3K3NA 2XAFB 3HKBE 3N2GE 1US7B 2X9YA 4MALA 2WMOA 3I9WA 3AAEB 4YLHA 4H9OC 4G2AA 3NBXX 3AB3B 5IYZE 3QC9A 3ZN1B 4AKGA 3M65A 5LG4A 4UXNB 1B7TA 2E9XA 2IC9A 4OYJA 4H9PC 3ANWB 1FMWA 5CB4E 4PK4A 5KX5E 2XHEB 3CPZA 4UV8B 4AQFA 4XZCA 5L3DB 3HKCE 2BVMA 2KWIB 4H63H 3H3AA 2H7VC 2MOZA 4KUMB 1MIYA 3KBTA 2VL8A 3CX7B 1WRDA 3C4WA 3RYIE 2VK9A 2W00A 2LSJA 5HXEA 4ZI2D 4H9RC 2I59A 3N9LA 4DBQA 2P9BA 3E0ZA 3ESLA 3LBXB 3Q5WA 3RYHE 4AQFC 2KMFA 1KNZA 2L9QA 2VKDA 2NW7A 2Q9QD 4CI1B 4IE4A 2EHOA 3ZMUB 2IAKA 4DO0A 5JDGA 4PNIA 4JEUB 5CA0E 2NW9A 1Z0PA 5L3CB 2X9HA 5GONE 5HXHA 4ZOLE 3Q9DA 2PBIA 2UXXB 3NZQA 4EZHA 4UVAB 1E1HB 5LA6E 2DI4A 2EHOC 3DTOA 2PFVA 2YU2A 5J2UE 1X79A 4XBFB 4WBNE 4OK0A 2ODVA 3KDSE 3MXZA 3LK3B 3Q2MA 5EK4A 5JDFA 3CKDA 4HE8A 1FIOA 2X66A 4EOZB 2XAGB 1QSDA 3QUJA 3UFEA 3ZJ2A 4PFPA 2WAUA 2CLYC 3C4ZA 4H9QC 2E9XB 3EUHA 4KMCA 5LOVE 2KXPB 3RPUA 3S4UA 2GK9A 4ZI7E 2C5KT 3CQXC 5DABA 2CCQA 3D0TA 5FY7A 2SPCA 3ZMVB 5FXZA 5HYAA 5L3BB 3LJCA 1IAPA 2L8KA 5IHYA 5LHGB 3HR0A 4GK5E 2LOPA 4A56A 1D1CA 3ZYLA 2LJLA 2JQQA 2NW8A 4L9IA 5FY0A 3ZJ1A 1OWAA 3AVSA 5LBQB 3T8OA 2D5UA 4U74A 2LHNA 3K3QC 1G73A 4E7ZA 3O9XA 2Q9QA 3MK7C 4KBMB 1H7CA 3RC8A 5L3EB 2LSKA 3B57A 4EYYR 3IHRA 4ZI2C 2KINB 2CXFA 2EHOB 3GA8A 4WNKA 5F3JA 3NRXA 3N5LA 2A2FX 3ZC0A 3IF8B 4JEHB 5L2LA 5HAXA 5JR9A 4UV9B 2N2NA 2XAHB 3SOLA 4MFRA 3V5SA 5JDLA 2WWUA 4AQGA 5FP3A 4EZ4A 2Q9QC 4PJMA 5JDMA 2V7LA 1NWMX 4EXTA 5C8YE 1NAFA 2XUEA 4H9NC 2X0LB 3P7IA 3P8CD 3RRCA 5A1LA 4IIJE 1HFAA 2CLYB 3OKQA 5EZYE 4CXYA 5LHIB 3O1JA 3GMIA 3WAJA 4ZI3D 3LK42 3Q5XA 4WW0A 4ZS2A 4ADZA 1LRZA 3KFWX 3I0OA 2LHRA 2VKHA 2CWOA 2X51A 2ES0A 5JR9C 2V7KA 3VKHA 2BVLA 4Z8XA 4I50E 3N9NA 3WAKA 4HGAA 1HG5A 4O4IE 4FI5A 1MMDA 2CWYA 4UF0A 3UUNA 3NRYA 3F2EA 3ZPOA 4P09A 3ZYMA 3FBLA 1D1BA 2WMNA 2CA5A 4IDZA 3O1IA 2VASA 4AI6A 3C4XA 2CE7A 3N9PA 5EK2A 1LVFA 3SRZA 2XAQB 4X1YE 3C51A 2PG8A 3N2OA 5L3FB 3TKLB 1BR0A 2CXLA 3I9YA 5ETWA 3BQLA 5LCYA 5LJNA 3OBVE 3HA4A 2IW5B 2Q9QB 3UUXB 3EDUA 4PAGA 5HWXA 2JMHA 3N9MA 3PUGA 3N9OA 1HTJF 3O1HA 2KZ7B 5FYMA 2Y8DA 4O8SA 3H37A 3IEEA 4GYSA 4OHFA 3R6NA 2CMRA 4I43B 2JJ9A 4DBRA 4QWNB 4UVCB 4CQIA 5JR9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSG A;  2LSK A;  4FJO A;  2LSI A;  4GK0 E;  4EXT A;  2N1G A;  2LSY A;  2LSJ A;  4GK5 E;  3VU7 H;  4BA9 A; 
#chains in the Genus database with same CATH topology
 3P50 A;  3VKG A;  2XQA A;  1MND A;  2V6X A;  4I55 E;  1ZP0 A;  2VUR A;  4EED A;  4EYU A;  3UU6 A;  4GK0 E;  2W0G A;  1U4Q A;  3UQ4 A;  2E8I A;  3PTR B;  5BMV E;  2XY8 B;  5F8P A;  4DR1 T;  4ERR A;  1YKE B;  2DLR A;  3FHN A;  2H88 A;  4BAY B;  1QUU A;  5LBM A;  3UT5 E;  1IZN B;  3ZMT B;  2W67 A;  5FKY A;  5HCM A;  1UK5 A;  5FXX A;  3UUB A;  4JI3 T;  5CA1 E;  2M6B A;  1LVK A;  4O4J E;  2LSG A;  4P0B A;  1T7S A;  4L5G A;  4KX6 A;  3AED A;  4YSX A;  5JVD E;  4Q25 A;  2YOE A;  1KFY A;  3Q5E A;  3LG7 A;  2DWG A;  4DR6 T;  1ZV4 X;  3ZYK A;  3RC3 A;  4DVD A;  2VB6 A;  5HXS A;  3C98 B;  4HFV A;  3L09 A;  1OED C;  2Z6E A;  4PFO A;  3KVA A;  4V1A v;  1U5P A;  4UIG A;  4DMW A;  1T72 A;  4O4L E;  4QH5 A;  2JQH A;  3OTO T;  3AE1 A;  4GIW A;  3GN5 B;  3AE5 A;  4IE5 A;  4JI1 T;  4DR2 T;  4X66 T;  3AE7 A;  3P4Q A;  3Q5D A;  4X62 T;  4CXX A;  2YEV C;  3ONJ A;  1BR1 A;  2X9X A;  4OFZ A;  4LMJ A;  2QA7 A;  1BR4 A;  2QYW A;  1D1A A;  1N32 T;  2CXD A;  2BKO A;  4ZS3 A;  1I94 T;  4QHO A;  2D0U A;  2PJQ A;  2YN6 A;  2W2U A;  1S94 A;  4DUY T;  2RP4 A;  1LKX A;  3ONX A;  5JDN A;  1XNR T;  4DID B;  2XAS B;  4QX8 B;  3N2K E;  1SUM B;  3OYX A;  4ILU A;  4TV9 E;  4UEL A;  1WLX A;  2WB5 A;  4YFS A;  3LFM A;  1VRB A;  2XPK A;  2RPA A;  4LF7 T;  2WQY A;  1XMQ T;  2LT3 A;  5FL1 A;  5JRC A;  2MTQ A;  3FZF B;  3BQK A;  5HXR A;  4AKI A;  2HN2 A;  4Z91 A;  3R84 B;  4ZZB A;  2XQY A;  3CX6 B;  3ZMZ B;  5AQH B;  3JC6 C;  3MJX A;  2ZM8 A;  4TUY E;  3KV5 A;  2V5C A;  3ZC1 A;  4LFB T;  3VRA A;  2W62 A;  2X0Y A;  1CHU A;  4MHC A;  5ABE A;  4JI0 T;  4GKJ T;  4AKR B;  2XSB A;  3P4W A;  4DV2 T;  2BZB A;  3BQI A;  4TV8 E;  3CIR A;  3J7Y q;  2OA5 A;  1MIW A;  4ILB A;  2H3R A;  2LSI A;  2X0H A;  4CI3 B;  2XZE A;  1YQ3 A;  3RYC E;  2LRL A;  4LFA T;  2X9W A;  3I1A A;  2FJE A;  3RKO A;  3PU3 A;  1HCI A;  3PUW F;  3RRW A;  2UUC T;  4OYK A;  1MMN A;  1VOM A;  2V7M A;  4DUZ T;  3RH3 A;  4F8H A;  3SS1 A;  1BR2 A;  3KV9 A;  1US7 B;  2WMO A;  3AAE B;  3RI5 A;  3JAD A;  3AB3 B;  4AKG A;  3NKZ A;  1B7T A;  4UXN B;  4H9P C;  3ANW B;  5CB4 E;  5L4E A;  4LFC T;  2M6I A;  4H63 H;  5LMN T;  3KBT A;  2JIW A;  4HFD A;  3JAE A;  3N9L A;  4AQF C;  5ABH A;  2L9Q A;  4OX9 T;  2NW7 A;  5FL0 A;  4DO0 A;  5JDG A;  2WZH A;  2XQ5 A;  5CA0 E;  2X9H A;  4NIQ A;  4HWD A;  5HXH A;  2UXX B;  1E1H B;  2PFV A;  5HCJ A;  4WBN E;  4OK0 A;  2ODV A;  1KF6 A;  3LK3 B;  3VR8 A;  5EK4 A;  5JDF A;  2XAG B;  5AQK B;  1QSD A;  3H3M A;  3ZJ2 A;  2E9X B;  1J5W A;  4KMC A;  3S4U A;  2GK9 A;  4ZI7 E;  3TLT A;  3ZMV B;  5FY7 A;  5IHY A;  3HR0 A;  2LOP A;  4Z90 A;  5CJ5 A;  2XM2 A;  4HFB A;  2LJL A;  2NW8 A;  1OWA A;  3AVS A;  2BS3 A;  2D5U A;  3K3Q C;  5AQR B;  2Q9Q A;  2MPK A;  3IHR A;  4CN4 A;  1HR0 T;  5F3J A;  1UUR A;  3AE4 A;  5L47 A;  5HAX A;  5AQN B;  4EZ4 A;  4P0A A;  2X0L B;  5A1L A;  4IIJ E;  3GMI A;  2UXD T;  4ZI3 D;  1KEY A;  3FZH B;  4WW0 A;  4I0U A;  2VKH A;  2ES0 A;  3VKH A;  3WAK A;  3NVO A;  1MMD A;  4P09 A;  3SFD A;  3FBL A;  1D1B A;  2WMN A;  3ZKR A;  3ZT7 A;  5EK2 A;  5L3F B;  3TKL B;  1BR0 A;  4COF A;  5ETW A;  3BQL A;  2IUB A;  1R8I A;  5LCY A;  5L4H A;  2CHN A;  5HWX A;  3UU8 A;  3PUG A;  2KZ7 B;  5FYM A;  3H37 A;  4GYS A;  3OVU A;  4DV5 T;  4UVC B;  5JR9 B;  1WYC A;  2X67 A;  4IRE A;  3RIU C;  4IST A;  3W15 B;  4X64 T;  5AQL B;  4AQY T;  5IWA T;  4IDP A;  3P4R A;  4ANJ A;  5JH7 E;  1WYB A;  5JDH A;  3ZLI A;  1Y64 B;  2ODU A;  3RIF A;  4U2Y A;  5CGM A;  3L3P A;  4MBQ A;  5LYJ E;  4EAH A;  4EB6 E;  4BA9 A;  5LMU T;  4AIS A;  5LGN B;  4WBO A;  3RQU A;  1MIV A;  2DHR A;  3X1D A;  4I4T E;  1G8X A;  1UCU A;  3ONL C;  4DV3 T;  3UUM A;  4TWF A;  5M4Y A;  2WM9 A;  4PJN A;  3CX8 B;  4C91 A;  2QRX A;  5FY1 A;  4X1I E;  4PK6 A;  2YKS A;  1KK7 A;  4N78 D;  1SHZ C;  2LEH A;  1L0V A;  2ZM0 A;  4B3M T;  3FXE B;  5LHH B;  2H7O A;  4IHJ E;  5FNV E;  2YK0 A;  3PV0 F;  5AQU B;  3UU3 A;  3K3O A;  3VHL A;  4IL4 A;  3N9Q A;  3CQC B;  3O4X E;  2HH7 A;  3CML A;  5BR8 T;  5J2T E;  3HL6 A;  4NUV A;  3SWH A;  2LM2 A;  1FEW A;  2ZMA A;  3F31 A;  2J4G A;  2BDE A;  4QXH B;  4ZZC A;  1DU2 A;  1M62 A;  3V5U A;  3EDV A;  3KIN B;  4GOU A;  5AQS B;  2E9X C;  3AA6 B;  1D0Y A;  2DWK A;  2CM0 A;  1D0X A;  2VKO A;  1UX4 A;  5KMG P;  3OYZ A;  3RF1 A;  3ZEF B;  2LSY A;  3VR9 A;  1E2A A;  3PU8 A;  4CN1 A;  4AKH A;  2ZLY A;  4LMK A;  1W09 A;  4U7I A;  2W63 A;  5H6R B;  1S35 A;  2BG9 B;  2E5V A;  4L0R A;  3UU5 A;  2E2A A;  2BBH A;  3ZMS B;  3UU4 A;  4HWI B;  4U33 A;  2W61 A;  5ADX L;  3PUA A;  3HI2 A;  1UUS A;  1YXR A;  1JNR A;  5DJQ C;  3ANW A;  4IGU A;  2ACX A;  3MKD A;  4EGW A;  3ZSS A;  2LRK A;  1ZEE A;  5FXW A;  3KV6 A;  3EHZ A;  2KLQ A;  1HNX T;  2UU9 T;  3PUR A;  4H9S E;  3AEG A;  3RQW A;  3RHW A;  3DJB A;  3DP7 A;  4HTE A;  4P1N A;  5AQF B;  2EHO D;  2D2S A;  3PE0 A;  1YKH B;  5LXT E;  4IDN A;  2J1D G;  3HKB E;  3A8Y C;  3G06 A;  3N2G E;  2X9Y A;  3QC9 A;  3OPC A;  3AE8 A;  2E9X A;  2CBI A;  2OLT A;  4PK4 A;  5KX5 E;  4HFH A;  3CPZ A;  4LF5 T;  5L3D B;  2BVM A;  2MOZ A;  2F4V T;  3CX7 B;  4ZI2 D;  4H9R C;  2I59 A;  3T1Y T;  2P9B A;  3Q5W A;  2KMF A;  4CI1 B;  1HNW T;  4YHH T;  2WDV A;  4JI2 T;  2WDR A;  3ABV A;  2NW9 A;  1Z0P A;  5L3C B;  2AXD S;  3NZQ A;  4EZH A;  2DI4 A;  2VQF T;  3RIA A;  4XBF B;  3L8R A;  1IBK T;  3UFE A;  4PFP A;  2WAU A;  2CLY C;  4AIU A;  3C4Z A;  2WU2 A;  2J47 A;  4NXN T;  4UR9 A;  3LJC A;  4GK5 E;  4YXD A;  2LKH A;  4A56 A;  3IA3 A;  4L9I A;  3ZJ1 A;  4DR3 T;  5LBQ B;  4U74 A;  1G73 A;  3MK7 C;  4YSY A;  3B57 A;  3RLF F;  4ZEY A;  2EHO B;  3NRX A;  3N5L A;  3AE6 A;  4A98 A;  3ZC0 A;  3AE9 A;  5JR9 A;  1N34 T;  5JDL A;  2Q9Q C;  4PJM A;  5JDM A;  2V7L A;  2FJD A;  1NAF A;  3P7I A;  1HFA A;  3OKQ A;  4NPP A;  4CXY A;  3O1J A;  2XM1 A;  2JQ9 A;  1LRZ A;  3I0O A;  2X51 A;  3AEF A;  2BVL A;  3EAM A;  1WCR A;  5KXJ A;  4HFC A;  1J5E T;  1HG5 A;  2MAW A;  3NRY A;  3F2E A;  4IDZ A;  1VCS A;  2XQ9 A;  3SRZ A;  3AXJ B;  4X1Y E;  3N2O A;  4JV5 T;  2CXL A;  2CHO A;  2H89 A;  2R6G F;  4U2Z A;  1IBM T;  4PAG A;  3O1H A;  3IEE A;  4OHF A;  5FVL A;  3PJA J;  2J62 A;  2BG9 E;  4I43 B;  2JJ9 A;  5HEU A;  4K0K T;  4DBR A;  4CQI A;  2JMK A;  4DV6 T;  2XQ3 A;  3PJA A;  4GYR A;  2K9A A;  5FMN A;  1FJG T;  2VVS A;  1W0A A;  3AAA B;  5HEG A;  4TNV A;  1NEK A;  4EIW A;  3UUL A;  3QNU A;  2V5D A;  1ZKE A;  4KI0 F;  1I6Z A;  1V9D A;  4HEA A;  4O4H E;  3FBZ A;  3A5X A;  5C2T A;  3PDY A;  3B5M A;  1MMG A;  4DR7 T;  3QOF A;  3PUY F;  3AA1 B;  5AQI B;  1Y01 A;  1HX8 A;  5FVK A;  5C3J A;  3U3I A;  1O3X A;  3AEA A;  2LLY A;  2UXN B;  1HG2 A;  2LM9 A;  4HKA A;  4BJN A;  4EV6 A;  2D0T A;  4QH4 A;  4QXB B;  5FXV A;  5HEO A;  5JDQ A;  3K8P C;  1T98 A;  2QVA A;  4DV0 T;  5DQV A;  2E5L T;  2C5J A;  3PUV F;  2WY2 A;  2HN1 A;  3PUQ A;  1HS7 A;  2M67 A;  2UUA T;  3FB2 A;  2K48 A;  3E08 A;  3JC6 D;  2MYS A;  2B1E A;  1OED B;  5J0Z A;  1ZHC A;  3QK6 A;  2NTY A;  2BG9 A;  2OV9 A;  5L3G B;  3P4S A;  3BK9 A;  2VWA A;  2NR4 A;  1XWM A;  2A9U A;  2KWH A;  1VCT A;  2V7I A;  2IML A;  4G63 A;  2K5B B;  4EEB A;  4A97 A;  2XQ4 A;  2CBJ A;  2KSR A;  2BS2 A;  3MA9 A;  2HPL A;  4UVB B;  4YJ3 E;  3GN5 A;  2Y48 B;  1KNR A;  3WI3 A;  4IDQ A;  5JQG E;  4E7S A;  2XJ7 A;  3CVR A;  5LGU B;  5AFU L;  1IJ5 A;  1CUN A;  1Z8U A;  4CXW A;  4YSZ A;  3P4P A;  4QXC B;  1WFD A;  3LSV A;  4M1P A;  5LGT B;  4TZ4 C;  4U7Y A;  4C90 A;  5ABF B;  5LG3 A;  1FMV A;  3IBP A;  2JPF A;  5EK3 A;  4NXM T;  4WZX A;  3U78 A;  3M3Z B;  3K1S A;  4O2A E;  3FXD B;  3AA7 B;  4YY3 T;  4FJO A;  3ZCI A;  1HF8 A;  4U31 A;  2X68 A;  4BJM A;  2BKN A;  3CWZ B;  5HXC A;  4HN9 A;  4DV7 T;  2Y6X A;  3I0Q A;  2KND A;  2JQK A;  2WCA A;  1N36 T;  1W0B A;  4ZHQ E;  2NP9 A;  5HEJ A;  4U72 A;  4NUU A;  3KBU A;  4CI2 B;  4HWF A;  2CEA A;  4O2B E;  5HWY A;  5HEH A;  4JI7 T;  3HKE E;  1XNQ T;  4CZZ B;  3MZK B;  3KVB A;  3K3N A;  2XAF B;  1X9B A;  4HWC A;  4MAL A;  3I9W A;  1XDP A;  4YLH A;  2D9D A;  4H9O C;  4G2A A;  3NBX X;  5IYZ E;  2BS4 A;  3AE3 A;  3M65 A;  2IC9 A;  4OYJ A;  1N33 T;  3PUX F;  3A7M A;  3H3A A;  2WWV A;  1UGO A;  2VL8 A;  4GKK T;  3RYI E;  3JAF A;  3FZM B;  5HXE A;  3LBX B;  3E0Z A;  3ESL A;  1KNZ A;  3JCF A;  4IE4 A;  2EHO A;  3ZMU B;  2IAK A;  4PNI A;  3FZK B;  4JEU B;  3T1H T;  5GON E;  4ZOL E;  4JI4 T;  1T8B A;  3EI0 A;  3DTO A;  2YU2 A;  1IBL T;  2YDQ A;  4EOZ B;  3CK6 A;  3CKD A;  4HE8 A;  1FIO A;  2X66 A;  3QUJ A;  2IDO B;  3RPU A;  1GQE A;  4WYV A;  4IL9 A;  5DAB A;  2CCQ A;  5L3B B;  5HYA A;  1IAP A;  3AXJ A;  4ILC A;  3ZYL A;  2JQQ A;  5FY0 A;  2FUP A;  3T8O A;  2YDR A;  2LHN A;  4E7Z A;  3RC8 A;  2FJA A;  1OED E;  1YQ4 A;  4EYY R;  4HFI A;  2KIN B;  3FZL B;  4X65 T;  4ZXL A;  3GA8 A;  3IF8 B;  3SOL A;  2WWU A;  4AQG A;  1KNP A;  4EXT A;  3ZT5 A;  4LF4 T;  5LHI B;  4LF6 T;  4KHZ F;  2B76 A;  3Q5X A;  4ADZ A;  2CWO A;  5JR9 C;  2V7K A;  4Z8X A;  4I50 E;  4HGA A;  2IHR 1;  4FI5 A;  2CWY A;  3L39 A;  2VQE T;  3ZYM A;  3O1I A;  2VAS A;  1SE7 A;  4AI6 A;  2CE7 A;  3N9P A;  2XAQ B;  3I9Y A;  2I0M A;  2V6Y B;  4A5X A;  3OBV E;  3HA4 A;  3EDU A;  2JMH A;  3ZST A;  3TLU A;  3RYF E;  2A72 A;  2JRK A;  2N9D A;  5LB7 B;  5AQP B;  4ISS A;  3VRB A;  2CRB A;  2I6H A;  3ZT6 A;  2A3D A;  5J1G A;  4ZI3 C;  1IJ6 A;  4ASK A;  2DCF A;  2LKG A;  4IDO A;  4J2C A;  4JLE A;  2V7J A;  3F57 A;  4UF0 B;  2PTF A;  2W4X A;  2LOS A;  2XQ7 A;  2K24 A;  2UXB T;  2K3W A;  4UEM A;  3VU7 H;  2UUB T;  3LK2 B;  2G0U A;  2ZM2 A;  1WR6 A;  2YIN A;  1D0Z A;  4JI8 T;  1W9R A;  2WSS V;  4CN6 A;  4B6X A;  3ETU A;  1OED A;  2MBG A;  1MMA A;  2WDQ A;  4IE0 A;  4TWD A;  1HX1 B;  1WR0 A;  3OJA A;  5JRE A;  4YJ2 E;  1SA0 E;  4QKN A;  1EZ3 A;  3ZCJ A;  2E9X D;  2KT9 A;  3ETV A;  3QB5 K;  1XZY A;  2C5I T;  2XTL A;  3NZP A;  1YW0 A;  3PUZ F;  4PW8 A;  3C64 A;  3AE2 A;  3KV4 A;  4PK5 A;  4DV1 T;  3QB5 A;  4PJJ A;  2NWB A;  4HWH A;  4DMV A;  2FJB A;  3E22 E;  4QX7 B;  4IE6 A;  5KDM C;  4LML A;  5ABF A;  4IE7 A;  3C50 A;  3MAC A;  2HPJ A;  4TX5 A;  2VKJ A;  2RA1 A;  2V26 A;  1M7K A;  4KHP T;  2BG9 C;  2NOX A;  2WBL A;  1MNE A;  3CQG B;  1YD8 G;  5LNK A;  3RGL A;  3UTK A;  4LF8 T;  5LP6 E;  4QH1 A;  2XQ8 A;  3HKD E;  5AQQ B;  4TNW A;  3ZN0 B;  1AJ3 A;  2IC6 A;  2YU1 A;  2XSA A;  4PJL A;  2HHH T;  1OXZ A;  4X20 E;  3AVR A;  1UX5 A;  4H63 V;  5E0O A;  2WZI A;  3J9X 1;  2ZM6 T;  4XAX B;  2L3L A;  1JNZ A;  3PUS A;  4K0U A;  3RKG A;  1XMO T;  4DV4 T;  1NEN A;  2V1D B;  4DND A;  2LE8 A;  3RX6 A;  3LDQ B;  5AQJ B;  5H6Q B;  2IIU A;  4U3C A;  2BBJ A;  5DQW A;  3TLS A;  4ILA A;  3B13 A;  4F6R C;  4AXP A;  4HFE A;  2NTX A;  2N1G A;  5JRC B;  4B3T T;  3SFE A;  4B3R T;  2DNX A;  3NWI A;  3AAI A;  4KP3 C;  2QGS A;  4JUY A;  3LBX A;  3AA0 B;  5TAO A;  4B3S T;  4YHJ A;  4AKL A;  2AE9 A;  2XQ6 A;  2YDS A;  4DR4 T;  3EVY A;  2WP9 A;  4TWH A;  5LJM A;  2XAJ B;  4MLK A;  4DR5 T;  4YT0 A;  4TN7 B;  2C0S A;  5AQT B;  2WS3 A;  3GWH A;  4X1K E;  3ZN1 B;  5JTG A;  3EAB A;  5LG4 A;  4LF9 T;  1FMW A;  3TLW A;  2XHE B;  4UV8 B;  4AQF A;  4XZC A;  3HKC E;  2KWI B;  2H7V C;  4KUM B;  1MIY A;  4YTN A;  2UXC T;  1WRD A;  3C4W A;  2VK9 A;  2W00 A;  2LSJ A;  1J1J A;  4YTM A;  4DBQ A;  3RYH E;  2VKD A;  5CFB A;  2Q9Q D;  4JYA T;  4JI6 T;  4JBW F;  4X5T A;  3UFG A;  3Q9D A;  2PBI A;  4IT4 A;  4UVA B;  5LA6 E;  2EHO C;  5J2U E;  1X79 A;  3KDS E;  3MXZ A;  3Q2M A;  4H9Q C;  3EUH A;  2FBW A;  5LOV E;  2KXP B;  2C5K T;  2VVN A;  3CQX C;  5IUX A;  3D0T A;  2SPC A;  5FXZ A;  2L8K A;  5LHG B;  5AQG B;  5AQO B;  2CPT A;  1D1C A;  2V6Y A;  3O9X A;  4KBM B;  4YTP A;  1H7C A;  2V8S V;  5L3E B;  2LSK A;  4ZI2 C;  2CXF A;  4WNK A;  3AEE A;  2A2F X;  1ZOY A;  4JEH B;  5L2L A;  4UV9 B;  2N2N A;  2XAH B;  4MFR A;  3V5S A;  5FP3 A;  1NWM X;  5C8Y E;  2XUE A;  4H9N C;  3P8C D;  3RRC A;  1XDO A;  2CLY B;  5EZY E;  3WAJ A;  3LK4 2;  4ZS2 A;  3KFW X;  2LHR A;  4JI5 T;  3AEB A;  5AQV B;  2BKP A;  3N9N A;  3UQ7 A;  4O4I E;  3AEC A;  4UF0 A;  3TLV A;  3UUN A;  3ZPO A;  2CA5 A;  2WU5 A;  5AQM B;  3C4X A;  1LVF A;  3C51 A;  5F5W A;  2PG8 A;  2DL1 A;  2ACZ A;  5LJN A;  2IW5 B;  1HNZ T;  1E7P A;  2Q9Q B;  3RIU A;  3UUX B;  3N9M A;  3N9O A;  1HTJ F;  2Y8D A;  4O8S A;  2VL0 A;  3R6N A;  2CMR A;  2W66 A;  4QWN B;  5ABG A;  1QLB A; 
#chains in the Genus database with same CATH homology
 3RYF E;  1WYC A;  2X67 A;  2JMK A;  2A72 A;  4IST A;  3W15 B;  3VKG A;  1MND A;  2JRK A;  2N9D A;  4I55 E;  4GYR A;  2K9A A;  4ISS A;  5FMN A;  4EYU A;  4GK0 E;  2A3D A;  5J1G A;  3AAA B;  2W0G A;  1U4Q A;  1IJ6 A;  4ZI3 C;  2E8I A;  4ASK A;  2DCF A;  4J2C A;  4ANJ A;  5JH7 E;  4JLE A;  2V7J A;  3F57 A;  3PTR B;  4UF0 B;  1WYB A;  5BMV E;  5F8P A;  5JDH A;  3ZLI A;  1Y64 B;  4ERR A;  1YKE B;  2ODU A;  2DLR A;  4EIW A;  3FHN A;  3UUL A;  2LOS A;  4BAY B;  1QUU A;  5LBM A;  3L3P A;  3UT5 E;  2K24 A;  1IZN B;  4MBQ A;  5LYJ E;  4UEM A;  3ZMT B;  3VU7 H;  4EAH A;  4EB6 E;  4BA9 A;  3LK2 B;  2G0U A;  2ZM2 A;  5FXX A;  5LGN B;  1WR6 A;  2YIN A;  1ZKE A;  1D0Z A;  4WBO A;  5CA1 E;  1LVK A;  1MIV A;  4O4J E;  2DHR A;  1V9D A;  2LSG A;  4HEA A;  4P0A A;  4O4H E;  2WSS V;  4P0B A;  4I4T E;  1G8X A;  3FBZ A;  4L5G A;  1UCU A;  4B6X A;  3UUM A;  3A5X A;  5JVD E;  3ETU A;  5M4Y A;  2WM9 A;  3PDY A;  3LG7 A;  1MMG A;  2MBG A;  4PJN A;  2DWG A;  1MMA A;  1ZV4 X;  4IE0 A;  3ZYK A;  3CX8 B;  3RC3 A;  4DVD A;  4C91 A;  5FY1 A;  2VB6 A;  5HXS A;  3AA1 B;  4X1I E;  3C98 B;  1HX8 A;  4PK6 A;  1KK7 A;  3OJA A;  4HFV A;  5JRE A;  3L09 A;  4YJ2 E;  1SA0 E;  2Z6E A;  3KVA A;  4N78 D;  1EZ3 A;  4QKN A;  4PFO A;  4V1A v;  1U5P A;  4UIG A;  4DMW A;  1SHZ C;  2LEH A;  3ZCJ A;  4O4L E;  3U3I A;  2ZM0 A;  2E9X D;  1O3X A;  2KT9 A;  2UXN B;  3ETV A;  1HG2 A;  2LM9 A;  4HKA A;  4BJN A;  4GIW A;  3GN5 B;  3FXE B;  4IE5 A;  5LHH B;  2H7O A;  2C5I T;  4IHJ E;  2D0T A;  2YK0 A;  4QXB B;  5FNV E;  5FXV A;  2XTL A;  3NZP A;  1YW0 A;  4CXX A;  5JDQ A;  3K8P C;  1T98 A;  2YEV C;  4PW8 A;  1BR1 A;  3C64 A;  2X9X A;  4OFZ A;  3KV4 A;  4PK5 A;  2QA7 A;  5DQV A;  1BR4 A;  2C5J A;  3K3O A;  3VHL A;  4PJJ A;  1D1A A;  3N9Q A;  2NWB A;  4DMV A;  3PUQ A;  3CQC B;  2CXD A;  4ZS3 A;  1HS7 A;  2M67 A;  3E22 E;  4QHO A;  3FB2 A;  2K48 A;  3E08 A;  3JC6 D;  2D0U A;  3O4X E;  2HH7 A;  2MYS A;  2PJQ A;  4QX7 B;  4IE6 A;  3CML A;  5KDM C;  2B1E A;  1S94 A;  2RP4 A;  1LKX A;  5J2T E;  3HL6 A;  1ZHC A;  3QK6 A;  4IE7 A;  2NTY A;  3ONX A;  4NUV A;  5L3G B;  3C50 A;  3MAC A;  5JDN A;  3SWH A;  2HPJ A;  2XAS B;  3BK9 A;  1FEW A;  2ZMA A;  4TX5 A;  4QX8 B;  2VKJ A;  2VWA A;  3F31 A;  2RA1 A;  3N2K E;  2BDE A;  2V26 A;  3OYX A;  4QXH B;  2KWH A;  4ILU A;  2V7I A;  4TV9 E;  3V5U A;  4UEL A;  2NOX A;  3EDV A;  1WLX A;  3KIN B;  2WBL A;  4YFS A;  1MNE A;  3LFM A;  4G63 A;  1VRB A;  2K5B B;  1YD8 G;  3CQG B;  4GOU A;  5LNK A;  2E9X C;  3AA6 B;  3UTK A;  1D0Y A;  5LP6 E;  2DWK A;  2LT3 A;  2HPL A;  2CM0 A;  3MA9 A;  4UVB B;  4YJ3 E;  3HKD E;  3GN5 A;  2Y48 B;  1D0X A;  5JRC A;  2VKO A;  1UX4 A;  3ZN0 B;  2MTQ A;  3WI3 A;  1AJ3 A;  5JQG E;  4E7S A;  5KMG P;  3OYZ A;  3ZEF B;  3BQK A;  2LSY A;  3CVR A;  2YU1 A;  2IC6 A;  5HXR A;  4PJL A;  5LGU B;  3PU8 A;  4AKI A;  4AKH A;  5AFU L;  1IJ5 A;  1CUN A;  1OXZ A;  2ZLY A;  4X20 E;  3AVR A;  4CXW A;  1UX5 A;  3R84 B;  4H63 V;  2XQY A;  4QXC B;  3CX6 B;  5E0O A;  4M1P A;  4TZ4 C;  5LGT B;  3J9X 1;  2W63 A;  3ZMZ B;  5H6R B;  4C90 A;  3JC6 C;  1FMV A;  1S35 A;  2JPF A;  3IBP A;  5EK3 A;  3MJX A;  4L0R A;  3U78 A;  4XAX B;  2ZM8 A;  4TUY E;  2L3L A;  3KV5 A;  3ZC1 A;  3PUS A;  4K0U A;  2W62 A;  4MHC A;  4O2A E;  3ZMS B;  2V1D B;  3FXD B;  4DND A;  2LE8 A;  3AA7 B;  3RX6 A;  4FJO A;  2W61 A;  3ZCI A;  1HF8 A;  5H6Q B;  5ADX L;  3PUA A;  3HI2 A;  5DQW A;  4AKR B;  5DJQ C;  3ANW A;  3B13 A;  4IGU A;  2BZB A;  3BQI A;  4TV8 E;  2ACX A;  3MKD A;  4F6R C;  4AXP A;  2X68 A;  3J7Y q;  2NTX A;  2N1G A;  4BJM A;  2OA5 A;  5JRC B;  1MIW A;  3CWZ B;  5HXC A;  1ZEE A;  2DNX A;  2H3R A;  5FXW A;  2LSI A;  3AAI A;  4HN9 A;  3KV6 A;  4CI3 B;  4KP3 C;  2QGS A;  4JUY A;  2KLQ A;  3RYC E;  2Y6X A;  3I0Q A;  3LBX A;  3AA0 B;  2KND A;  5TAO A;  4YHJ A;  3PUR A;  4AKL A;  4ZHQ E;  2NP9 A;  2X9W A;  4U72 A;  3I1A A;  4H9S E;  3RKO A;  4NUU A;  3PU3 A;  1HCI A;  3DJB A;  3DP7 A;  3KBU A;  3RRW A;  4HTE A;  4CI2 B;  3EVY A;  2CEA A;  2EHO D;  5LJM A;  4OYK A;  4O2B E;  1MMN A;  5HWY A;  2XAJ B;  4MLK A;  1VOM A;  2V7M A;  2D2S A;  3PE0 A;  1YKH B;  4TN7 B;  5LXT E;  2C0S A;  3HKE E;  3RH3 A;  3SS1 A;  4CZZ B;  3MZK B;  3GWH A;  1BR2 A;  2J1D G;  3KVB A;  4X1K E;  3KV9 A;  3K3N A;  2XAF B;  3HKB E;  3N2G E;  1US7 B;  2X9Y A;  4MAL A;  2WMO A;  3I9W A;  3AAE B;  4YLH A;  4H9O C;  4G2A A;  3NBX X;  3AB3 B;  5IYZ E;  3QC9 A;  3ZN1 B;  4AKG A;  3M65 A;  5LG4 A;  4UXN B;  1B7T A;  2E9X A;  2IC9 A;  4OYJ A;  4H9P C;  3ANW B;  1FMW A;  5CB4 E;  4PK4 A;  5KX5 E;  2XHE B;  3CPZ A;  4UV8 B;  4AQF A;  4XZC A;  5L3D B;  3HKC E;  2BVM A;  2KWI B;  4H63 H;  3H3A A;  2H7V C;  2MOZ A;  4KUM B;  1MIY A;  3KBT A;  2VL8 A;  3CX7 B;  1WRD A;  3C4W A;  3RYI E;  2VK9 A;  2W00 A;  2LSJ A;  5HXE A;  4ZI2 D;  4H9R C;  2I59 A;  3N9L A;  4DBQ A;  2P9B A;  3E0Z A;  3ESL A;  3LBX B;  3Q5W A;  3RYH E;  4AQF C;  2KMF A;  1KNZ A;  2L9Q A;  2VKD A;  2NW7 A;  2Q9Q D;  4CI1 B;  4IE4 A;  2EHO A;  3ZMU B;  2IAK A;  4DO0 A;  5JDG A;  4PNI A;  4JEU B;  5CA0 E;  2NW9 A;  1Z0P A;  5L3C B;  2X9H A;  5GON E;  5HXH A;  4ZOL E;  3Q9D A;  2PBI A;  2UXX B;  3NZQ A;  4EZH A;  4UVA B;  1E1H B;  5LA6 E;  2DI4 A;  2EHO C;  3DTO A;  2PFV A;  2YU2 A;  5J2U E;  1X79 A;  4XBF B;  4WBN E;  4OK0 A;  2ODV A;  3KDS E;  3MXZ A;  3LK3 B;  3Q2M A;  5EK4 A;  5JDF A;  3CKD A;  4HE8 A;  1FIO A;  2X66 A;  4EOZ B;  2XAG B;  1QSD A;  3QUJ A;  3UFE A;  3ZJ2 A;  4PFP A;  2WAU A;  2CLY C;  3C4Z A;  4H9Q C;  2E9X B;  3EUH A;  4KMC A;  5LOV E;  2KXP B;  3RPU A;  3S4U A;  2GK9 A;  4ZI7 E;  2C5K T;  3CQX C;  5DAB A;  2CCQ A;  3D0T A;  5FY7 A;  2SPC A;  3ZMV B;  5FXZ A;  5HYA A;  5L3B B;  3LJC A;  1IAP A;  2L8K A;  5IHY A;  5LHG B;  3HR0 A;  4GK5 E;  2LOP A;  4A56 A;  1D1C A;  3ZYL A;  2LJL A;  2JQQ A;  2NW8 A;  4L9I A;  5FY0 A;  3ZJ1 A;  1OWA A;  3AVS A;  5LBQ B;  3T8O A;  2D5U A;  4U74 A;  2LHN A;  3K3Q C;  1G73 A;  4E7Z A;  3O9X A;  2Q9Q A;  3MK7 C;  4KBM B;  1H7C A;  3RC8 A;  5L3E B;  2LSK A;  3B57 A;  4EYY R;  3IHR A;  4ZI2 C;  2KIN B;  2CXF A;  2EHO B;  3GA8 A;  4WNK A;  5F3J A;  3NRX A;  3N5L A;  2A2F X;  3ZC0 A;  3IF8 B;  4JEH B;  5L2L A;  5HAX A;  5JR9 A;  4UV9 B;  2N2N A;  2XAH B;  3SOL A;  4MFR A;  3V5S A;  5JDL A;  2WWU A;  4AQG A;  5FP3 A;  4EZ4 A;  2Q9Q C;  4PJM A;  5JDM A;  2V7L A;  1NWM X;  4EXT A;  5C8Y E;  1NAF A;  2XUE A;  4H9N C;  2X0L B;  3P7I A;  3P8C D;  3RRC A;  5A1L A;  4IIJ E;  1HFA A;  2CLY B;  3OKQ A;  5EZY E;  4CXY A;  5LHI B;  3O1J A;  3GMI A;  3WAJ A;  4ZI3 D;  3LK4 2;  3Q5X A;  4WW0 A;  4ZS2 A;  4ADZ A;  1LRZ A;  3KFW X;  3I0O A;  2LHR A;  2VKH A;  2CWO A;  2X51 A;  2ES0 A;  5JR9 C;  2V7K A;  3VKH A;  2BVL A;  4Z8X A;  4I50 E;  3N9N A;  3WAK A;  4HGA A;  1HG5 A;  4O4I E;  4FI5 A;  1MMD A;  2CWY A;  4UF0 A;  3UUN A;  3NRY A;  3F2E A;  3ZPO A;  4P09 A;  3ZYM A;  3FBL A;  1D1B A;  2WMN A;  2CA5 A;  4IDZ A;  3O1I A;  2VAS A;  4AI6 A;  3C4X A;  2CE7 A;  3N9P A;  5EK2 A;  1LVF A;  3SRZ A;  2XAQ B;  4X1Y E;  3C51 A;  2PG8 A;  3N2O A;  5L3F B;  3TKL B;  1BR0 A;  2CXL A;  3I9Y A;  5ETW A;  3BQL A;  5LCY A;  5LJN A;  3OBV E;  3HA4 A;  2IW5 B;  2Q9Q B;  3UUX B;  3EDU A;  4PAG A;  5HWX A;  2JMH A;  3N9M A;  3PUG A;  3N9O A;  1HTJ F;  3O1H A;  2KZ7 B;  5FYM A;  2Y8D A;  4O8S A;  3H37 A;  3IEE A;  4GYS A;  4OHF A;  3R6N A;  2CMR A;  4I43 B;  2JJ9 A;  4DBR A;  4QWN B;  4UVC B;  4CQI A;  5JR9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...