2LSGA

Solution structure of the mouse rev1 c-terminal domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
b'AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein REV1
publication title Multifaceted recognition of vertebrate Rev1 by translesion polymerases zeta and kappa.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsgA00
2LSKA 4GK5E 2LSGA 2LSIA 4BA9A 3VU7H 2LSJA 2LSYA 4FJOA 4EXTA 2N1GA 4GK0E
chains in the Genus database with same CATH superfamily
1T72A 3UU4A 2I6HA 4NXMT 3KVAA 2A3DA 3ZC1A 1ZKEA 2H7OA 1YKEB 1HS7A 2KZ7B 2XTLA 2N1GA 2M6BA 2RA1A 2MOZA 2VKOA 3ZSTA 4X66T 4UR9A 3CMLA 2C5JA 4UV9B 4X1IE 4GKKT 4EYYR 3ZN1B 4AISA 2VASA 2LJLA 1KNRA 2LEHA 1LVKA 1WLXA 2V7JA 3LBXA 1OEDB 3UUBA 3RRWA 1I94T 4KHPT 2LOPA 4A56A 3UQ7A 4U2ZA 3V5SA 4UXNB 3KV6A 4MHCA 5AQNB 3RF1A 3FBLA 1JNZA 3Q2MA 2E8IA 4EEDA 2V7IA 3AEGA 2CPTA 3AXJB 3HI2A 5BMVE 3CWZB 2NWBA 2X9YA 2B1EA 5HXHA 4DMWA 2W63A 4O4HE 2X9XA 5DQWA 2E5LT 2W67A 1ZHCA 3NVOA 4QXCB 4B3RT 2EHOA 1WRDA 5L2LA 4EEBA 4I55E 3T1HT 2W0GA 4YJ3E 2JMHA 4DR7T 3MA9A 4B3ST 1GQEA 5A1LA 2WSSV 1UURA 4DV3T 4JI0T 2JQQA 1N36T 4N78D 2PG8A 3G06A 2CRBA 2IUBA 4DUYT 5EK2A 1M62A 3Q5DA 4U7IA 1SE7A 2IAKA 4UEMA 5FP3A 1ZV4X 2XAFB 2M6IA 2OA5A 4JI8T 4UF0B 1X79A 2XQ8A 4ZZBA 4PFPA 3ZEFB 4TN7B 5E0OA 3GMIA 5C2TA 3GA8A 4X65T 2BVMA 3EUHA 4DV6T 4P0AA 4LMKA 2YN6A 4IDOA 5J2TE 2KNDA 3RIUA 3VR8A 3RIFA 4PK5A 5JR9B 1XNRT 4HWHA 3JADA 4YTMA 2XZEA 2XAJB 4X64T 5HWXA 2NOXA 2EHOD 3A8YC 3AE2A 3K3QC 4AIUA 3RQWA 4QX8B 1XWMA 1I6ZA 3KDSE 3L39A 2IMLA 4JI5T 4WBOA 3TLSA 1T7SA 4ERRA 3QC9A 2WDRA 4CZZB 1WCRA 5LA6E 4DR2T 3RH3A 2CA5A 4YFSA 2XASB 1D0ZA 3FBZA 5AQJB 3RKGA 4OYJA 5EK4A 4CXWA 5CA1E 1J5ET 1YKHB 3AVRA 3ANWA 3QK6A 4P09A 3AA0B 3WAKA 4JV5T 1DU2A 1WFDA 4EOZB 2F4VT 4ASKA 3AE3A 5FXVA 5H6QB 3VKGA 3LJCA 2DL1A 4PK4A 5ABFB 2KWHA 3QOFA 2UU9T 2XHEB 3AA7B 4B3MT 3OJAA 5EZYE 2CE7A 3MACA 4ZI2C 4I4TE 2X66A 3Q9DA 4H9SE 4IT4A 4ZEYA 3J7Yq 1T8BA 4V1Av 2PFVA 4IE6A 2D5UA 3AE4A 3OBVE 2UUCT 4YJ2E 3JAFA 2YEVC 3M3ZB 4Z8XA 3K8PC 5FL0A 4HFDA 1QSDA 1UGOA 3VR9A 2HHHT 4DR5T 1ZEEA 4F6RC 1EZ3A 1HX1B 5BR8T 1OWAA 3AEBA 2MBGA 3MXZA 2GK9A 3Q5WA 2X0HA 3TKLB 2WU2A 3AEAA 3CQCB 2X9WA 1W0AA 1FEWA 4IDQA 2DLRA 2Z6EA 5LB7B 4AKHA 4O8SA 4LF8T 2QVAA 4OYKA 2KT9A 1BR4A 2BG9E 4JBWF 4HFHA 2V7MA 5LJNA 2CHOA 4EZ4A 3ETVA 3SOLA 5IYZE 1G8XA 1YQ3A 5KX5E 3P8CD 5AQUB 4JI4T 5HCJA 2X67A 1UCUA 2WAUA 5KXJA 4XZCA 3DP7A 2D2SA 3UULA 1D1CA 5LBMA 4HWCA 3GN5A 2VB6A 5FNVE 2X0YA 3B13A 2FUPA 3SFEA 5ABEA 3SS1A 4IIJE 5L3CB 2I0MA 4ADZA 2DWKA 2CHNA 3ZT6A 1N32T 5AQLB 2VKJA 3SRZA 2CXLA 5IWAT 4KP3C 5F5WA 3A7MA 1WYBA 3AEEA 3N9PA 5HXEA 4LF4T 4LFCT 1HX8A 2LKGA 4JI2T 5AQIB 4DV7T 5LBQB 2BKOA 2K5BB 3ONXA 4YHHT 3RYHE 2BS3A 3RLFF 4K0KT 2W66A 2LSJA 3GWHA 4TWHA 4PJNA 2FJEA 2LT3A 2BKNA 4FI5A 5HEGA 2C5KT 3H3MA 4EB6E 2VL8A 4IE0A 4JYAT 2JQKA 3RYCE 3K1SA 5HAXA 4QXHB 3UT5E 4IL9A 4H63V 4TUYE 2EHOB 5AQVB 3O1JA 3QUJA 2JIWA 4AI6A 2BKPA 4X20E 4MFRA 5EK3A 1UX4A 1FJGT 1UX5A 5FMNA 2W4XA 2WWUA 4HGAA 4CN6A 4GIWA 2RP4A 3ZJ2A 4PAGA 2W2UA 5LG3A 2BS4A 4YTPA 3AA1B 4YSXA 2WQYA 2YU2A 1IJ6A 4GK0E 5AQKB 4LF7T 4HKAA 1VCTA 2XM1A 1D0XA 2L8KA 3VKHA 2CLYC 3KFWX 4AQYT 3W15B 3L3PA 2V6YA 3NKZA 3KV9A 4LF5T 3RPUA 2VL0A 3OYXA 3UUXB 2ODUA 4ISTA 4AKIA 4I50E 3C64A 3P4SA 2FBWA 5J0ZA 4NXNT 2ZMAA 3MJXA 3FXEB 3IEEA 3JC6D 3EVYA 3ZYLA 2LSYA 4OHFA 2YDRA 3R6NA 2WM9A 3ESLA 3WAJA 3OVUA 3RGLA 5FVLA 4A97A 4DR6T 4COFA 2J4GA 2JRKA 2I59A 4QH5A 2E9XD 4M1PA 4DR1T 2ODVA 5CJ5A 2X0LB 5ETWA 2JPFA 2D0TA 1CUNA 1Y01A 5JH7E 1W9RA 4JI6T 4O4JE 2VQFT 5DQVA 5CFBA 1LKXA 4YXDA 3PURA 2C0SA 3MZKB 5LGTB 2X9HA 1OEDC 5CA0E 4HFEA 1WR6A 4CN4A 4HEAA 4IDNA 3RC3A 2BBHA 5ABGA 2D0UA 1BR1A 2CM0A 3B57A 4A5XA 2JQHA 4QXBB 3IHRA 4ILUA 3ANWB 2XAGB 2N9DA 5FXZA 2ACZA 3X1DA 1FMWA 2H88A 3PUAA 3O9XA 2R6GF 5TAOA 2WB5A 3CX6B 3PUWF 5CGMA 1MMDA 2YOEA 4ILCA 4HFIA 1HFAA 1N33T 4YT0A 3Q5XA 4NPPA 3ZYMA 5AQTB 2PBIA 3M65A 3AE8A 3P4PA 2UXBT 5L3EB 3UFGA 2JQ9A 3I0OA 3ZKRA 2VWAA 3ONJA 4P0BA 3AE5A 1WYCA 3C50A 4ILBA 1O3XA 5JDQA 4DMVA 5FY1A 3PJAA 5IHYA 4DR3T 4MALA 2V7LA 1SUMB 4B6XA 1LRZA 2CEAA 1T98A 4EXTA 1XDOA 3FZLB 1OEDE 5JDNA 2A72A 4CI2B 5HXRA 2XQ5A 5HEJA 2V5CA 2XPKA 4IE5A 4HWDA 1BR0A 2WY2A 4WYVA 3PUQA 4TWFA 5LNKA 2W00A 1ZOYA 4YTNA 3ZT7A 3ZN0B 1HTJF 2HPLA 2QRXA 2XM2A 2ZM6T 1IJ5A 5AQPB 3AE9A 1YQ4A 4CN1A 1XDPA 4YY3T 5HYAA 4F8HA 3CPZA 3HKEE 4U74A 2CXDA 2WCAA 2XQ4A 3FZMB 2VVSA 3RQUA 4DVDA 3TLVA 4PJJA 2WDVA 2NP9A 2XQ3A 4EZHA 3ZMVB 1MMGA 2YU1A 3UU6A 2Q9QB 3JAEA 3MK7C 2V8SV 1MIYA 3OPCA 5HEUA 2XQ7A 5JR9C 4L5GA 2WZIA 5FXXA 2KINB 2KWIB 4BA9A 3CIRA 3RC8A 4PW8A 3ZJ1A 5HEOA 4OK0A 2Y8DA 3LK42 3PUXF 4CI3B 1FIOA 5LG4A 4KMCA 2L3LA 4ZXLA 3ONLC 4PJLA 3I1AA 1NWMX 1U4QA 4ZOLE 1G73A 2E2AA 3I0QA 3UUMA 2DCFA 3AAAB 2BG9C 4DBRA 4ANJA 5L3BB 4DV4T 2W61A 1YW0A 4WNKA 3VRBA 4X5TA 2DI4A 1FMVA 2E9XB 1MMAA 3FZKB 5FL1A 2LSGA 5JDGA 3N5LA 3ABVA 1HNZT 3RRCA 2BVLA 2LM2A 3ZPOA 2IW5B 2NR4A 4P1NA 2NTXA 1VOMA 5ADXL 3HKCE 2WMNA 2NW9A 1SA0E 1NEKA 3TLTA 4LFBT 2WP9A 2OLTA 5AQSB 3PTRB 2B76A 2E5VA 4UF0A 4X1YE 3VU7H 5LP6E 5FXWA 1W09A 5FYMA 3PUZF 3F2EA 4AQGA 1X9BA 5L47A 1HG5A 2LLYA 3N9NA 3PE0A 4WW0A 4O2AE 1IAPA 4DUZT 2LE8A 2FJDA 4C91A 1HR0T 5J1GA 2A2FX 4AKGA 3DTOA 3N2KE 4QH4A 2IDOB 3RYIE 2LHRA 5IUXA 2K48A 3LFMA 4JEUB 5JR9A 3KBUA 3C98B 5AQGB 5LOVE 1S35A 5L4HA 3KV4A 3IF8B 2XSBA 3AE6A 5LGUB 1KFYA 4HFCA 3CQGB 4HWIB 3LBXB 1YXRA 2WWVA 3HR0A 2ZM8A 4TWDA 2DHRA 2NW8A 4U31A 2V26A 2C5IT 2XQ6A 3FZHB 2V6XA 2RPAA 3SWHA 4BJNA 3OKQA 1Z8UA 2BG9A 1XMOT 3ZLIA 1HNWT 2LOSA 4WZXA 3C4XA 5M4YA 3ZMSB 1BR2A 5AQHB 4H9OC 2UXXB 2NTYA 3UUNA 5L3FB 4KHZF 4PNIA 3N2OA 5JDMA 3WI3A 3RKOA 3FHNA 1KEYA 4QKNA 4U2YA 3NRXA 4JI1T 2G0UA 3KBTA 3H3AA 4O4IE 1MIWA 2XAQB 3L8RA 2ZM2A 2D9DA 3V5UA 4TV8E 4U3CA 2XQAA 5GONE 3S4UA 4EAHA 3EAMA 3AA6B 2WBLA 3E0ZA 1E7PA 5LJMA 5H6RB 5AQFB 2Y6XA 4U72A 3LDQB 1JNRA 3C4ZA 3RYFE 4AKRB 3BQKA 4U33A 1J5WA 4X62T 4EYUA 2IC9A 4ILAA 4UV8B 3QNUA 1US7B 4GKJT 2CMRA 3AAEB 2ZLYA 4DIDB 4IL4A 4NIQA 4UIGA 2HN2A 5DABA 1VCSA 5ABHA 3ETUA 1IBLT 5HXCA 3K3OA 5LMUT 3CVRA 4QWNB 1YD8G 5JRCA 2ES0A 2UXDT 2CCQA 4GOUA 5F8PA 5LHHB 2MPKA 3J9X1 3ZMUB 3IA3A 3AVSA 3P4WA 3T1YT 3IBPA 4ZI2D 1KNPA 3P4QA 4IHJE 1ZP0A 4YSZA 1R8IA 3T8OA 1XMQT 4XAXB 1D1AA 4H63H 5DJQC 5JDFA 2XY8B 3TLWA 4HWFA 4TX5A 3CKDA 3R84B 3RIUC 4GK5E 5AQOB 4JI3T 3N9QA 4HN9A 2IC6A 4HFBA 1AJ3A 4IGUA 4ZI3C 4AXPA 2WU5A 4CQIA 3A5XA 4U7YA 3KINB 4IDPA 4EGWA 2BZBA 4C90A 5L3DB 4FJOA 3N9OA 5HEHA 3NRYA 4KUMB 3ZT5A 2ACXA 1HCIA 2YKSA 1UUSA 3HL6A 3C4WA 2V1DB 4XBFB 3ZCIA 2WMOA 3NZQA 4Z91A 2QGSA 2VVNA 3F57A 2BBJA 3HKDE 4Z90A 2WZHA 2H7VC 1XNQT 3QB5A 2PTFA 3RI5A 4E7ZA 3ZMTB 4QH1A 3Q5EA 2VURA 4JUYA 4A98A 4EIWA 5AQRB 5HXSA 5HCMA 1SHZC 3O1HA 5FKYA 4H9RC 4H9QC 4YLHA 4LF6T 2M67A 4DV1T 4DV5T 4UELA 2LSIA 4DR4T 1D0YA 4J2CA 2UUAT 4TNWA 2YDQA 5FY0A 3ZSSA 4KBMB 4JI7T 4QHOA 2XQ9A 3EI0A 4YHJA 1W0BA 3RHWA 2K24A 3JCFA 4HFVA 4TZ4C 4JLEA 3NZPA 3LK3B 3P4RA 2UXNB 2H89A 1LVFA 2BDEA 1VRBA 4TNVA 4LFAT 3EHZA 4ZI7E 3NWIA 3GN5B 2A9UA 1OEDA 1U5PA 3OYZA 2P9BA 3PU3A 3TLUA 5JVDE 2LRKA 3I9YA 4TV9E 3F31A 1HG2A 1NENA 3OTOT 5AQMB 3E22E 2J1DG 2YINA 4LMLA 4ZS2A 2Q9QC 1MIVA 2VKHA 2HPJA 3E08A 4NUUA 4OFZA 4G2AA 1IZNB 2MAWA 3I9WA 3AXJA 3EDVA 2CXFA 2CWYA 3BQIA 1L0VA 1IBKT 1HNXT 5CB4E 4GYSA 4OX9T 3B5MA 2WDQA 2XSAA 3PU8A 2YDSA 4IREA 2K9AA 2NW7A 2BG9B 2V7KA 3UQ4A 1KF6A 3CK6A 2XUEA 4BAYB 2KMFA 3AEFA 3FXDB 4E7SA 1E2AA 2L9QA 5L3GB 4IE7A 3PUVF 4DV0T 3U78A 2N2NA 2CBIA 3JC6C 4NUVA 2DNXA 3KVBA 2MYSA 5LGNB 3LK2B 2W62A 3UFEA 5JDHA 1Z0PA 4G63A 2J62A 3AB3B 4ISSA 5AFUL 4DO0A 3AECA 4UVAB 3CX8B 3EABA 1QUUA 2LSKA 1NAFA 2E9XC 2OV9A 4O2BE 4ZS3A 1KK7A 4L9IA 3AE7A 3UU8A 2UXCT 1S94A 1N34T 4B3TT 3PDYA 2H3RA 3ZMZB 4AQFC 3HKBE 1M7KA 3SFDA 1IBMT 2LKHA 1MNEA 2HH7A 5C3JA 5JREA 4ZI3D 1B7TA 2UUBT 3DJBA 2V6YB 2FJAA 2IIUA 3FZFB 4ZHQE 4CXYA 3ZC0A 3VHLA 3L09A 5LMNT 3VRAA 4X1KE 3HA4A 3N9LA 4PFOA 3RX6A 5FVKA 4JEHB 1HF8A 2CBJA 5LYJE 2XJ7A 5JRCB 2LHNA 4KX6A 2QYWA 2LM9A 4K0UA 3C51A 1XZYA 5LXTE 4MBQA 3N9MA 1E1HB 2HN1A 2V5DA 2CWOA 3ZYKA 2QA7A 2VQET 3RIAA 4IE4A 4QX7B 4AKLA 5JTGA 3ZCJA 3O4XE 3U3IA 1V9DA 2Q9QA 4LF9T 5KDMC 1MMNA 4IDZA 4UVBB 4I0UA 4H9PC 4H9NC 3P50A 3N2GE 4DV2T 1D1BA 4I43B 3MKDA 3BK9A 3O1IA 1WR0A 2X51A 2X68A 4ZZCA 3FB2A 5J2UE 2PJQA 3UU5A 3PV0F 3PJAJ 4UVCB 3UTKA 3QB5K 5JDLA 4GYRA 3PUGA 4EV6A 1UK5A 3BQLA 3AAIA 1CHUA 5ABFA 1Y64B 2MTQA 2YK0A 5HWYA 3LG7A 4PJMA 4HTEA 2SPCA 2XQYA 3UU3A 4MLKA 2DWGA 5LCYA 2E9XA 3PUSA 5FY7A 1QLBA 2K3WA 3NBXX 5JQGE 2KSRA 3AE1A 3CX7B 4CXXA 5L4EA 5C8YE 4AQFA 2KLQA 3KV5A 2EHOC 2VKDA 3CQXC 1J1JA 2CLYB 5KMGP 2J47A 5LHGB 3P7IA 2VK9A 4LMJA 2FJBA 2Y48B 4WBNE 1OXZA 4CI1B 3PUYF 4PK6A 2AE9A 4HE8A 4DNDA 2WS3A 2LRLA 5F3JA 2Q9QD 4YSYA 1H7CA 2AXDS 3H37A 3EDUA 2JMKA 1KNZA 2IHR1 2JJ9A 1MNDA 3K3NA 3LSVA 4O4LE 3AEDA 2ZM0A 4L0RA 4DBQA 2KXPB 2XAHB 4KI0F 4BJMA 3D0TA 4Q25A 5AQQB 2BS2A 5LHIB
chains in the Genus database with same CATH topology
4ADZA 2DCFA 2DWKA 3AAAB 4JUYA 4DBRA 3KVAA 2VKJA 3SRZA 4ANJA 2CXLA 2A3DA 2W61A 3ZC1A 4EIWA 4KP3C 5L3BB 1YW0A 1ZKEA 2H7OA 4WNKA 5HXSA 1YKEB 1WYBA 3N9PA 1HS7A 5HXEA 2KZ7B 2XTLA 2DI4A 2N1GA 1FMVA 1SHZC 1MMAA 2E9XB 1HX8A 3O1HA 2RA1A 2LSGA 4H9RC 5JDGA 2MOZA 3N5LA 4H9QC 5LBQB 4YLHA 2VKOA 2K5BB 2M67A 3ONXA 3RRCA 2BVLA 4UELA 2LSIA 3RYHE 2LSJA 3ZPOA 1D0YA 3GWHA 3CMLA 2IW5B 4J2CA 2C5JA 4UV9B 2NTXA 1VOMA 5ADXL 4X1IE 3HKCE 4EYYR 3ZN1B 2VASA 2LJLA 2WMNA 4PJNA 2NW9A 2LEHA 2LT3A 1SA0E 5FY0A 4FI5A 2C5KT 4KBMB 4EB6E 2VL8A 1LVKA 1WLXA 2V7JA 3LBXA 4IE0A 4QHOA 3RRWA 4YHJA 2LOPA 4A56A 3PTRB 3V5SA 4UXNB 4UF0A 2K24A 3KV6A 4MHCA 4HFVA 3RYCE 4X1YE 4TZ4C 5HAXA 4QXHB 3FBLA 3UT5E 3VU7H 5LP6E 5FXWA 4JLEA 3NZPA 3LK3B 2UXNB 3Q2MA 1LVFA 4H63V 2E8IA 4TUYE 5FYMA 2EHOB 2BDEA 3O1JA 2V7IA 1VRBA 3QUJA 4AI6A 3F2EA 4AQGA 4X20E 4MFRA 3HI2A 4ZI7E 5BMVE 3CWZB 1HG5A 5EK3A 2NWBA 2X9YA 1UX4A 2B1EA 3GN5B 5HXHA 4DMWA 1U5PA 3N9NA 2W63A 1UX5A 5FMNA 4O4HE 3OYZA 3PE0A 4WW0A 2P9BA 2X9XA 3PU3A 2WWUA 5DQWA 4O2AE 1IAPA 5JVDE 4HGAA 4GIWA 2LE8A 2RP4A 3ZJ2A 4PAGA 4C91A 3I9YA 4TV9E 3F31A 1HG2A 5J1GA 2A2FX 3AA1B 1ZHCA 4QXCB 4AKGA 3DTOA 2YU2A 1IJ6A 3E22E 3N2KE 2J1DG 4GK0E 2YINA 2EHOA 1WRDA 5L2LA 4ZS2A 2Q9QC 4I55E 1MIVA 3RYIE 2W0GA 2LHRA 2HPJA 2K48A 2VKHA 3E08A 4NUUA 4HKAA 4OFZA 4G2AA 3LFMA 4JEUB 1D0XA 1IZNB 2L8KA 3I9WA 3C98B 3EDVA 3KBUA 2CXFA 5JR9A 3VKHA 2CWYA 3BQIA 5LOVE 4YJ3E 2CLYC 2JMHA 3MA9A 5CB4E 3KFWX 4GYSA 1S35A 3W15B 3L3PA 3PU8A 5A1LA 3KV9A 3KV4A 2WSSV 3RPUA 2K9AA 3IF8B 2NW7A 2V7KA 3OYXA 2JQQA 3UUXB 4N78D 2ODUA 2PG8A 4ISTA 5LGUB 2XUEA 4AKIA 4I50E 3C64A 4BAYB 3CQGB 5EK2A 2KMFA 3FXDB 4E7SA 2IAKA 2L9QA 5L3GB 3LBXB 4IE7A 4UEMA 5FP3A 3HR0A 2ZM8A 1ZV4X 2ZMAA 3MJXA 2XAFB 3FXEB 3IEEA 2OA5A 3U78A 2DHRA 3JC6D 2NW8A 3EVYA 3ZYLA 2N2NA 4UF0B 1X79A 2LSYA 3JC6C 4NUVA 4OHFA 2V26A 2DNXA 2C5IT 3KVBA 2MYSA 3R6NA 5LGNB 3LK2B 2WM9A 3SWHA 4BJNA 3OKQA 3ESLA 3WAJA 2W62A 3UFEA 4PFPA 3ZEFB 4TN7B 5E0OA 5JDHA 1Z0PA 4G63A 3GMIA 3AB3B 4ISSA 3ZLIA 5AFUL 2JRKA 4DO0A 2I59A 4UVAB 3CX8B 3GA8A 2LOSA 2E9XD 1QUUA 2LSKA 3C4XA 1NAFA 4M1PA 2E9XC 5M4YA 4O2BE 3ZMSB 1BR2A 4ZS3A 1KK7A 4L9IA 2BVMA 3EUHA 4H9OC 2UXXB 4P0AA 2NTYA 3UUNA 2ODVA 5L3FB 1S94A 5J2TE 2X0LB 4PNIA 5ETWA 3N2OA 3PDYA 2KNDA 5JDMA 3WI3A 2H3RA 3RKOA 2JPFA 3FHNA 2D0TA 1CUNA 3ZMZB 4AQFC 5JH7E 4QKNA 3HKBE 4O4JE 5DQVA 1LKXA 3NRXA 3PURA 2C0SA 2G0UA 3MZKB 4PK5A 1MNEA 2HH7A 3KBTA 5JR9B 5LGTB 3H3AA 4O4IE 2X9HA 5CA0E 5JREA 1MIWA 2XAQB 4ZI3D 1B7TA 2ZM2A 1WR6A 3DJBA 3V5UA 4TV8E 4HEAA 3RC3A 5GONE 3S4UA 2XAJB 4EAHA 4ZHQE 4CXYA 3AA6B 3VHLA 3ZC0A 2WBLA 3E0ZA 2D0UA 3L09A 5HWXA 1BR1A 2CM0A 3B57A 2NOXA 5LJMA 2EHOD 4QXBB 3IHRA 4ILUA 5H6RB 3ANWB 2XAGB 3K3QC 2N9DA 4X1KE 3HA4A 5FXZA 3N9LA 4PFOA 3RX6A 2Y6XA 1FMWA 4QX8B 3KDSE 1HF8A 3PUAA 4JEHB 4U72A 5TAOA 3O9XA 5LYJE 5JRCB 2LHNA 3C4ZA 3RYFE 4AKRB 2LM9A 3BQKA 4K0UA 4WBOA 3CX6B 4EYUA 4ERRA 3C51A 1MMDA 3QC9A 5LXTE 4CZZB 4MBQA 2IC9A 1HFAA 4UV8B 3N9MA 3Q5XA 1E1HB 5LA6E 1US7B 2CWOA 3ZYMA 2CMRA 2PBIA 3RH3A 3M65A 3ZYKA 3AAEB 2CA5A 2QA7A 4YFSA 2XASB 2ZLYA 4IE4A 4QX7B 1D0ZA 3FBZA 4AKLA 4OYJA 5EK4A 4CXWA 4UIGA 5L3EB 5CA1E 5DABA 3ZCJA 1YKHB 3AVRA 3ANWA 3ETUA 3O4XE 3QK6A 4P09A 3I0OA 5HXCA 2VWAA 3U3IA 3K3OA 1V9DA 2Q9QA 4P0BA 3AA0B 3WAKA 5KDMC 3CVRA 1MMNA 1WYCA 4IDZA 4QWNB 4UVBB 4EOZB 4H9PC 4H9NC 3C50A 1YD8G 1O3XA 3N2GE 4ASKA 5JDQA 5FXVA 4DMVA 2ES0A 5FY1A 5JRCA 5IHYA 2CCQA 5H6QB 1D1BA 4GOUA 4MALA 4I43B 5F8PA 5LHHB 3VKGA 2V7LA 3LJCA 4PK4A 4B6XA 1LRZA 2KWHA 3MKDA 3BK9A 2CEAA 3O1IA 1T98A 3J9X1 3ZMUB 4EXTA 2X51A 3AVSA 2XHEB 3IBPA 3AA7B 2X68A 3FB2A 3OJAA 4ZI2D 5J2UE 5JDNA 5EZYE 2PJQA 2A72A 4CI2B 5HXRA 2CE7A 3MACA 4ZI2C 4IHJE 4I4TE 2X66A 3Q9DA 4UVCB 4H9SE 3T8OA 3UTKA 4IE5A 3J7Yq 4V1Av 1BR0A 4XAXB 1D1AA 2PFVA 4H63H 5DJQC 5JDLA 4GYRA 5JDFA 4IE6A 2D5UA 3PUQA 5LNKA 3PUGA 3OBVE 2W00A 3BQLA 4YJ2E 3ZN0B 1HTJF 4TX5A 3AAIA 3CKDA 2HPLA 3R84B 1Y64B 2MTQA 2YEVC 1IJ5A 2YK0A 4GK5E 4Z8XA 5HWYA 3K8PC 3LG7A 4PJMA 4HTEA 2SPCA 2XQYA 1QSDA 5HYAA 1ZEEA 4MLKA 4F6RC 1EZ3A 2DWGA 1OWAA 3N9QA 3CPZA 3HKEE 4HN9A 4U74A 2CXDA 5LCYA 2IC6A 3MXZA 2E9XA 2GK9A 3PUSA 3Q5WA 5FY7A 2MBGA 3TKLB 4DVDA 1AJ3A 4IGUA 4ZI3C 3NBXX 4AXPA 4PJJA 5JQGE 3CQCB 2X9WA 2NP9A 4CQIA 1FEWA 3CX7B 3A5XA 2DLRA 4CXXA 4EZHA 3KINB 2Z6EA 5C8YE 4AQFA 2KLQA 3KV5A 2EHOC 2VKDA 3ZMVB 1MMGA 2YU1A 4AKHA 3CQXC 2Q9QB 2BZBA 4O8SA 4C90A 3MK7C 1MIYA 5L3DB 5JR9C 4L5GA 2CLYB 4FJOA 5KMGP 4OYKA 2KT9A 1BR4A 5LHGB 3P7IA 3N9OA 2VK9A 3NRYA 2V7MA 4KUMB 5FXXA 2ACXA 1HCIA 2KINB 2Y48B 1OXZA 4WBNE 2KWIB 4CI1B 5LJNA 4BA9A 4PK6A 4EZ4A 4HE8A 4DNDA 3HL6A 3RC8A 5F3JA 3ETVA 4PW8A 3SOLA 5IYZE 1G8XA 3ZJ1A 2Q9QD 2V1DB 3C4WA 4XBFB 3ZCIA 1H7CA 2WMOA 4OK0A 5KX5E 3NZQA 3P8CD 3H37A 2Y8DA 3LK42 3EDUA 2JMKA 1KNZA 2X67A 1UCUA 2WAUA 2QGSA 4CI3B 4XZCA 1FIOA 3F57A 3DP7A 2D2SA 3UULA 2JJ9A 5LG4A 1D1CA 1MNDA 2L3LA 3K3NA 4KMCA 5LBMA 3HKDE 3GN5A 4O4LE 2VB6A 4PJLA 5FNVE 3B13A 2ZM0A 3I1AA 2H7VC 1NWMX 1U4QA 4ZOLE 1G73A 4L0RA 4DBQA 3SS1A 4IIJE 2KXPB 2XAHB 5L3CB 3I0QA 4E7ZA 3ZMTB 4BJMA 3D0TA 3UUMA 5LHIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSK A;  4GK5 E;  2LSG A;  2LSI A;  4BA9 A;  3VU7 H;  2LSJ A;  2LSY A;  4FJO A;  4EXT A;  2N1G A;  4GK0 E; 
#chains in the Genus database with same CATH topology
 1T72 A;  3UU4 A;  2I6H A;  4NXM T;  3KVA A;  2A3D A;  3ZC1 A;  1ZKE A;  2H7O A;  1YKE B;  1HS7 A;  2KZ7 B;  2XTL A;  2N1G A;  2M6B A;  2RA1 A;  2MOZ A;  2VKO A;  3ZST A;  4X66 T;  4UR9 A;  3CML A;  2C5J A;  4UV9 B;  4X1I E;  4GKK T;  4EYY R;  3ZN1 B;  4AIS A;  2VAS A;  2LJL A;  1KNR A;  2LEH A;  1LVK A;  1WLX A;  2V7J A;  3LBX A;  1OED B;  3UUB A;  3RRW A;  1I94 T;  4KHP T;  2LOP A;  4A56 A;  3UQ7 A;  4U2Z A;  3V5S A;  4UXN B;  3KV6 A;  4MHC A;  5AQN B;  3RF1 A;  3FBL A;  1JNZ A;  3Q2M A;  2E8I A;  4EED A;  2V7I A;  3AEG A;  2CPT A;  3AXJ B;  3HI2 A;  5BMV E;  3CWZ B;  2NWB A;  2X9Y A;  2B1E A;  5HXH A;  4DMW A;  2W63 A;  4O4H E;  2X9X A;  5DQW A;  2E5L T;  2W67 A;  1ZHC A;  3NVO A;  4QXC B;  4B3R T;  2EHO A;  1WRD A;  5L2L A;  4EEB A;  4I55 E;  3T1H T;  2W0G A;  4YJ3 E;  2JMH A;  4DR7 T;  3MA9 A;  4B3S T;  1GQE A;  5A1L A;  2WSS V;  1UUR A;  4DV3 T;  4JI0 T;  2JQQ A;  1N36 T;  4N78 D;  2PG8 A;  3G06 A;  2CRB A;  2IUB A;  4DUY T;  5EK2 A;  1M62 A;  3Q5D A;  4U7I A;  1SE7 A;  2IAK A;  4UEM A;  5FP3 A;  1ZV4 X;  2XAF B;  2M6I A;  2OA5 A;  4JI8 T;  4UF0 B;  1X79 A;  2XQ8 A;  4ZZB A;  4PFP A;  3ZEF B;  4TN7 B;  5E0O A;  3GMI A;  5C2T A;  3GA8 A;  4X65 T;  2BVM A;  3EUH A;  4DV6 T;  4P0A A;  4LMK A;  2YN6 A;  4IDO A;  5J2T E;  2KND A;  3RIU A;  3VR8 A;  3RIF A;  4PK5 A;  5JR9 B;  1XNR T;  4HWH A;  3JAD A;  4YTM A;  2XZE A;  2XAJ B;  4X64 T;  5HWX A;  2NOX A;  2EHO D;  3A8Y C;  3AE2 A;  3K3Q C;  4AIU A;  3RQW A;  4QX8 B;  1XWM A;  1I6Z A;  3KDS E;  3L39 A;  2IML A;  4JI5 T;  4WBO A;  3TLS A;  1T7S A;  4ERR A;  3QC9 A;  2WDR A;  4CZZ B;  1WCR A;  5LA6 E;  4DR2 T;  3RH3 A;  2CA5 A;  4YFS A;  2XAS B;  1D0Z A;  3FBZ A;  5AQJ B;  3RKG A;  4OYJ A;  5EK4 A;  4CXW A;  5CA1 E;  1J5E T;  1YKH B;  3AVR A;  3ANW A;  3QK6 A;  4P09 A;  3AA0 B;  3WAK A;  4JV5 T;  1DU2 A;  1WFD A;  4EOZ B;  2F4V T;  4ASK A;  3AE3 A;  5FXV A;  5H6Q B;  3VKG A;  3LJC A;  2DL1 A;  4PK4 A;  5ABF B;  2KWH A;  3QOF A;  2UU9 T;  2XHE B;  3AA7 B;  4B3M T;  3OJA A;  5EZY E;  2CE7 A;  3MAC A;  4ZI2 C;  4I4T E;  2X66 A;  3Q9D A;  4H9S E;  4IT4 A;  4ZEY A;  3J7Y q;  1T8B A;  4V1A v;  2PFV A;  4IE6 A;  2D5U A;  3AE4 A;  3OBV E;  2UUC T;  4YJ2 E;  3JAF A;  2YEV C;  3M3Z B;  4Z8X A;  3K8P C;  5FL0 A;  4HFD A;  1QSD A;  1UGO A;  3VR9 A;  2HHH T;  4DR5 T;  1ZEE A;  4F6R C;  1EZ3 A;  1HX1 B;  5BR8 T;  1OWA A;  3AEB A;  2MBG A;  3MXZ A;  2GK9 A;  3Q5W A;  2X0H A;  3TKL B;  2WU2 A;  3AEA A;  3CQC B;  2X9W A;  1W0A A;  1FEW A;  4IDQ A;  2DLR A;  2Z6E A;  5LB7 B;  4AKH A;  4O8S A;  4LF8 T;  2QVA A;  4OYK A;  2KT9 A;  1BR4 A;  2BG9 E;  4JBW F;  4HFH A;  2V7M A;  5LJN A;  2CHO A;  4EZ4 A;  3ETV A;  3SOL A;  5IYZ E;  1G8X A;  1YQ3 A;  5KX5 E;  3P8C D;  5AQU B;  4JI4 T;  5HCJ A;  2X67 A;  1UCU A;  2WAU A;  5KXJ A;  4XZC A;  3DP7 A;  2D2S A;  3UUL A;  1D1C A;  5LBM A;  4HWC A;  3GN5 A;  2VB6 A;  5FNV E;  2X0Y A;  3B13 A;  2FUP A;  3SFE A;  5ABE A;  3SS1 A;  4IIJ E;  5L3C B;  2I0M A;  4ADZ A;  2DWK A;  2CHN A;  3ZT6 A;  1N32 T;  5AQL B;  2VKJ A;  3SRZ A;  2CXL A;  5IWA T;  4KP3 C;  5F5W A;  3A7M A;  1WYB A;  3AEE A;  3N9P A;  5HXE A;  4LF4 T;  4LFC T;  1HX8 A;  2LKG A;  4JI2 T;  5AQI B;  4DV7 T;  5LBQ B;  2BKO A;  2K5B B;  3ONX A;  4YHH T;  3RYH E;  2BS3 A;  3RLF F;  4K0K T;  2W66 A;  2LSJ A;  3GWH A;  4TWH A;  4PJN A;  2FJE A;  2LT3 A;  2BKN A;  4FI5 A;  5HEG A;  2C5K T;  3H3M A;  4EB6 E;  2VL8 A;  4IE0 A;  4JYA T;  2JQK A;  3RYC E;  3K1S A;  5HAX A;  4QXH B;  3UT5 E;  4IL9 A;  4H63 V;  4TUY E;  2EHO B;  5AQV B;  3O1J A;  3QUJ A;  2JIW A;  4AI6 A;  2BKP A;  4X20 E;  4MFR A;  5EK3 A;  1UX4 A;  1FJG T;  1UX5 A;  5FMN A;  2W4X A;  2WWU A;  4HGA A;  4CN6 A;  4GIW A;  2RP4 A;  3ZJ2 A;  4PAG A;  2W2U A;  5LG3 A;  2BS4 A;  4YTP A;  3AA1 B;  4YSX A;  2WQY A;  2YU2 A;  1IJ6 A;  4GK0 E;  5AQK B;  4LF7 T;  4HKA A;  1VCT A;  2XM1 A;  1D0X A;  2L8K A;  3VKH A;  2CLY C;  3KFW X;  4AQY T;  3W15 B;  3L3P A;  2V6Y A;  3NKZ A;  3KV9 A;  4LF5 T;  3RPU A;  2VL0 A;  3OYX A;  3UUX B;  2ODU A;  4IST A;  4AKI A;  4I50 E;  3C64 A;  3P4S A;  2FBW A;  5J0Z A;  4NXN T;  2ZMA A;  3MJX A;  3FXE B;  3IEE A;  3JC6 D;  3EVY A;  3ZYL A;  2LSY A;  4OHF A;  2YDR A;  3R6N A;  2WM9 A;  3ESL A;  3WAJ A;  3OVU A;  3RGL A;  5FVL A;  4A97 A;  4DR6 T;  4COF A;  2J4G A;  2JRK A;  2I59 A;  4QH5 A;  2E9X D;  4M1P A;  4DR1 T;  2ODV A;  5CJ5 A;  2X0L B;  5ETW A;  2JPF A;  2D0T A;  1CUN A;  1Y01 A;  5JH7 E;  1W9R A;  4JI6 T;  4O4J E;  2VQF T;  5DQV A;  5CFB A;  1LKX A;  4YXD A;  3PUR A;  2C0S A;  3MZK B;  5LGT B;  2X9H A;  1OED C;  5CA0 E;  4HFE A;  1WR6 A;  4CN4 A;  4HEA A;  4IDN A;  3RC3 A;  2BBH A;  5ABG A;  2D0U A;  1BR1 A;  2CM0 A;  3B57 A;  4A5X A;  2JQH A;  4QXB B;  3IHR A;  4ILU A;  3ANW B;  2XAG B;  2N9D A;  5FXZ A;  2ACZ A;  3X1D A;  1FMW A;  2H88 A;  3PUA A;  3O9X A;  2R6G F;  5TAO A;  2WB5 A;  3CX6 B;  3PUW F;  5CGM A;  1MMD A;  2YOE A;  4ILC A;  4HFI A;  1HFA A;  1N33 T;  4YT0 A;  3Q5X A;  4NPP A;  3ZYM A;  5AQT B;  2PBI A;  3M65 A;  3AE8 A;  3P4P A;  2UXB T;  5L3E B;  3UFG A;  2JQ9 A;  3I0O A;  3ZKR A;  2VWA A;  3ONJ A;  4P0B A;  3AE5 A;  1WYC A;  3C50 A;  4ILB A;  1O3X A;  5JDQ A;  4DMV A;  5FY1 A;  3PJA A;  5IHY A;  4DR3 T;  4MAL A;  2V7L A;  1SUM B;  4B6X A;  1LRZ A;  2CEA A;  1T98 A;  4EXT A;  1XDO A;  3FZL B;  1OED E;  5JDN A;  2A72 A;  4CI2 B;  5HXR A;  2XQ5 A;  5HEJ A;  2V5C A;  2XPK A;  4IE5 A;  4HWD A;  1BR0 A;  2WY2 A;  4WYV A;  3PUQ A;  4TWF A;  5LNK A;  2W00 A;  1ZOY A;  4YTN A;  3ZT7 A;  3ZN0 B;  1HTJ F;  2HPL A;  2QRX A;  2XM2 A;  2ZM6 T;  1IJ5 A;  5AQP B;  3AE9 A;  1YQ4 A;  4CN1 A;  1XDP A;  4YY3 T;  5HYA A;  4F8H A;  3CPZ A;  3HKE E;  4U74 A;  2CXD A;  2WCA A;  2XQ4 A;  3FZM B;  2VVS A;  3RQU A;  4DVD A;  3TLV A;  4PJJ A;  2WDV A;  2NP9 A;  2XQ3 A;  4EZH A;  3ZMV B;  1MMG A;  2YU1 A;  3UU6 A;  2Q9Q B;  3JAE A;  3MK7 C;  2V8S V;  1MIY A;  3OPC A;  5HEU A;  2XQ7 A;  5JR9 C;  4L5G A;  2WZI A;  5FXX A;  2KIN B;  2KWI B;  4BA9 A;  3CIR A;  3RC8 A;  4PW8 A;  3ZJ1 A;  5HEO A;  4OK0 A;  2Y8D A;  3LK4 2;  3PUX F;  4CI3 B;  1FIO A;  5LG4 A;  4KMC A;  2L3L A;  4ZXL A;  3ONL C;  4PJL A;  3I1A A;  1NWM X;  1U4Q A;  4ZOL E;  1G73 A;  2E2A A;  3I0Q A;  3UUM A;  2DCF A;  3AAA B;  2BG9 C;  4DBR A;  4ANJ A;  5L3B B;  4DV4 T;  2W61 A;  1YW0 A;  4WNK A;  3VRB A;  4X5T A;  2DI4 A;  1FMV A;  2E9X B;  1MMA A;  3FZK B;  5FL1 A;  2LSG A;  5JDG A;  3N5L A;  3ABV A;  1HNZ T;  3RRC A;  2BVL A;  2LM2 A;  3ZPO A;  2IW5 B;  2NR4 A;  4P1N A;  2NTX A;  1VOM A;  5ADX L;  3HKC E;  2WMN A;  2NW9 A;  1SA0 E;  1NEK A;  3TLT A;  4LFB T;  2WP9 A;  2OLT A;  5AQS B;  3PTR B;  2B76 A;  2E5V A;  4UF0 A;  4X1Y E;  3VU7 H;  5LP6 E;  5FXW A;  1W09 A;  5FYM A;  3PUZ F;  3F2E A;  4AQG A;  1X9B A;  5L47 A;  1HG5 A;  2LLY A;  3N9N A;  3PE0 A;  4WW0 A;  4O2A E;  1IAP A;  4DUZ T;  2LE8 A;  2FJD A;  4C91 A;  1HR0 T;  5J1G A;  2A2F X;  4AKG A;  3DTO A;  3N2K E;  4QH4 A;  2IDO B;  3RYI E;  2LHR A;  5IUX A;  2K48 A;  3LFM A;  4JEU B;  5JR9 A;  3KBU A;  3C98 B;  5AQG B;  5LOV E;  1S35 A;  5L4H A;  3KV4 A;  3IF8 B;  2XSB A;  3AE6 A;  5LGU B;  1KFY A;  4HFC A;  3CQG B;  4HWI B;  3LBX B;  1YXR A;  2WWV A;  3HR0 A;  2ZM8 A;  4TWD A;  2DHR A;  2NW8 A;  4U31 A;  2V26 A;  2C5I T;  2XQ6 A;  3FZH B;  2V6X A;  2RPA A;  3SWH A;  4BJN A;  3OKQ A;  1Z8U A;  2BG9 A;  1XMO T;  3ZLI A;  1HNW T;  2LOS A;  4WZX A;  3C4X A;  5M4Y A;  3ZMS B;  1BR2 A;  5AQH B;  4H9O C;  2UXX B;  2NTY A;  3UUN A;  5L3F B;  4KHZ F;  4PNI A;  3N2O A;  5JDM A;  3WI3 A;  3RKO A;  3FHN A;  1KEY A;  4QKN A;  4U2Y A;  3NRX A;  4JI1 T;  2G0U A;  3KBT A;  3H3A A;  4O4I E;  1MIW A;  2XAQ B;  3L8R A;  2ZM2 A;  2D9D A;  3V5U A;  4TV8 E;  4U3C A;  2XQA A;  5GON E;  3S4U A;  4EAH A;  3EAM A;  3AA6 B;  2WBL A;  3E0Z A;  1E7P A;  5LJM A;  5H6R B;  5AQF B;  2Y6X A;  4U72 A;  3LDQ B;  1JNR A;  3C4Z A;  3RYF E;  4AKR B;  3BQK A;  4U33 A;  1J5W A;  4X62 T;  4EYU A;  2IC9 A;  4ILA A;  4UV8 B;  3QNU A;  1US7 B;  4GKJ T;  2CMR A;  3AAE B;  2ZLY A;  4DID B;  4IL4 A;  4NIQ A;  4UIG A;  2HN2 A;  5DAB A;  1VCS A;  5ABH A;  3ETU A;  1IBL T;  5HXC A;  3K3O A;  5LMU T;  3CVR A;  4QWN B;  1YD8 G;  5JRC A;  2ES0 A;  2UXD T;  2CCQ A;  4GOU A;  5F8P A;  5LHH B;  2MPK A;  3J9X 1;  3ZMU B;  3IA3 A;  3AVS A;  3P4W A;  3T1Y T;  3IBP A;  4ZI2 D;  1KNP A;  3P4Q A;  4IHJ E;  1ZP0 A;  4YSZ A;  1R8I A;  3T8O A;  1XMQ T;  4XAX B;  1D1A A;  4H63 H;  5DJQ C;  5JDF A;  2XY8 B;  3TLW A;  4HWF A;  4TX5 A;  3CKD A;  3R84 B;  3RIU C;  4GK5 E;  5AQO B;  4JI3 T;  3N9Q A;  4HN9 A;  2IC6 A;  4HFB A;  1AJ3 A;  4IGU A;  4ZI3 C;  4AXP A;  2WU5 A;  4CQI A;  3A5X A;  4U7Y A;  3KIN B;  4IDP A;  4EGW A;  2BZB A;  4C90 A;  5L3D B;  4FJO A;  3N9O A;  5HEH A;  3NRY A;  4KUM B;  3ZT5 A;  2ACX A;  1HCI A;  2YKS A;  1UUS A;  3HL6 A;  3C4W A;  2V1D B;  4XBF B;  3ZCI A;  2WMO A;  3NZQ A;  4Z91 A;  2QGS A;  2VVN A;  3F57 A;  2BBJ A;  3HKD E;  4Z90 A;  2WZH A;  2H7V C;  1XNQ T;  3QB5 A;  2PTF A;  3RI5 A;  4E7Z A;  3ZMT B;  4QH1 A;  3Q5E A;  2VUR A;  4JUY A;  4A98 A;  4EIW A;  5AQR B;  5HXS A;  5HCM A;  1SHZ C;  3O1H A;  5FKY A;  4H9R C;  4H9Q C;  4YLH A;  4LF6 T;  2M67 A;  4DV1 T;  4DV5 T;  4UEL A;  2LSI A;  4DR4 T;  1D0Y A;  4J2C A;  2UUA T;  4TNW A;  2YDQ A;  5FY0 A;  3ZSS A;  4KBM B;  4JI7 T;  4QHO A;  2XQ9 A;  3EI0 A;  4YHJ A;  1W0B A;  3RHW A;  2K24 A;  3JCF A;  4HFV A;  4TZ4 C;  4JLE A;  3NZP A;  3LK3 B;  3P4R A;  2UXN B;  2H89 A;  1LVF A;  2BDE A;  1VRB A;  4TNV A;  4LFA T;  3EHZ A;  4ZI7 E;  3NWI A;  3GN5 B;  2A9U A;  1OED A;  1U5P A;  3OYZ A;  2P9B A;  3PU3 A;  3TLU A;  5JVD E;  2LRK A;  3I9Y A;  4TV9 E;  3F31 A;  1HG2 A;  1NEN A;  3OTO T;  5AQM B;  3E22 E;  2J1D G;  2YIN A;  4LML A;  4ZS2 A;  2Q9Q C;  1MIV A;  2VKH A;  2HPJ A;  3E08 A;  4NUU A;  4OFZ A;  4G2A A;  1IZN B;  2MAW A;  3I9W A;  3AXJ A;  3EDV A;  2CXF A;  2CWY A;  3BQI A;  1L0V A;  1IBK T;  1HNX T;  5CB4 E;  4GYS A;  4OX9 T;  3B5M A;  2WDQ A;  2XSA A;  3PU8 A;  2YDS A;  4IRE A;  2K9A A;  2NW7 A;  2BG9 B;  2V7K A;  3UQ4 A;  1KF6 A;  3CK6 A;  2XUE A;  4BAY B;  2KMF A;  3AEF A;  3FXD B;  4E7S A;  1E2A A;  2L9Q A;  5L3G B;  4IE7 A;  3PUV F;  4DV0 T;  3U78 A;  2N2N A;  2CBI A;  3JC6 C;  4NUV A;  2DNX A;  3KVB A;  2MYS A;  5LGN B;  3LK2 B;  2W62 A;  3UFE A;  5JDH A;  1Z0P A;  4G63 A;  2J62 A;  3AB3 B;  4ISS A;  5AFU L;  4DO0 A;  3AEC A;  4UVA B;  3CX8 B;  3EAB A;  1QUU A;  2LSK A;  1NAF A;  2E9X C;  2OV9 A;  4O2B E;  4ZS3 A;  1KK7 A;  4L9I A;  3AE7 A;  3UU8 A;  2UXC T;  1S94 A;  1N34 T;  4B3T T;  3PDY A;  2H3R A;  3ZMZ B;  4AQF C;  3HKB E;  1M7K A;  3SFD A;  1IBM T;  2LKH A;  1MNE A;  2HH7 A;  5C3J A;  5JRE A;  4ZI3 D;  1B7T A;  2UUB T;  3DJB A;  2V6Y B;  2FJA A;  2IIU A;  3FZF B;  4ZHQ E;  4CXY A;  3ZC0 A;  3VHL A;  3L09 A;  5LMN T;  3VRA A;  4X1K E;  3HA4 A;  3N9L A;  4PFO A;  3RX6 A;  5FVK A;  4JEH B;  1HF8 A;  2CBJ A;  5LYJ E;  2XJ7 A;  5JRC B;  2LHN A;  4KX6 A;  2QYW A;  2LM9 A;  4K0U A;  3C51 A;  1XZY A;  5LXT E;  4MBQ A;  3N9M A;  1E1H B;  2HN1 A;  2V5D A;  2CWO A;  3ZYK A;  2QA7 A;  2VQE T;  3RIA A;  4IE4 A;  4QX7 B;  4AKL A;  5JTG A;  3ZCJ A;  3O4X E;  3U3I A;  1V9D A;  2Q9Q A;  4LF9 T;  5KDM C;  1MMN A;  4IDZ A;  4UVB B;  4I0U A;  4H9P C;  4H9N C;  3P50 A;  3N2G E;  4DV2 T;  1D1B A;  4I43 B;  3MKD A;  3BK9 A;  3O1I A;  1WR0 A;  2X51 A;  2X68 A;  4ZZC A;  3FB2 A;  5J2U E;  2PJQ A;  3UU5 A;  3PV0 F;  3PJA J;  4UVC B;  3UTK A;  3QB5 K;  5JDL A;  4GYR A;  3PUG A;  4EV6 A;  1UK5 A;  3BQL A;  3AAI A;  1CHU A;  5ABF A;  1Y64 B;  2MTQ A;  2YK0 A;  5HWY A;  3LG7 A;  4PJM A;  4HTE A;  2SPC A;  2XQY A;  3UU3 A;  4MLK A;  2DWG A;  5LCY A;  2E9X A;  3PUS A;  5FY7 A;  1QLB A;  2K3W A;  3NBX X;  5JQG E;  2KSR A;  3AE1 A;  3CX7 B;  4CXX A;  5L4E A;  5C8Y E;  4AQF A;  2KLQ A;  3KV5 A;  2EHO C;  2VKD A;  3CQX C;  1J1J A;  2CLY B;  5KMG P;  2J47 A;  5LHG B;  3P7I A;  2VK9 A;  4LMJ A;  2FJB A;  2Y48 B;  4WBN E;  1OXZ A;  4CI1 B;  3PUY F;  4PK6 A;  2AE9 A;  4HE8 A;  4DND A;  2WS3 A;  2LRL A;  5F3J A;  2Q9Q D;  4YSY A;  1H7C A;  2AXD S;  3H37 A;  3EDU A;  2JMK A;  1KNZ A;  2IHR 1;  2JJ9 A;  1MND A;  3K3N A;  3LSV A;  4O4L E;  3AED A;  2ZM0 A;  4L0R A;  4DBQ A;  2KXP B;  2XAH B;  4KI0 F;  4BJM A;  3D0T A;  4Q25 A;  5AQQ B;  2BS2 A;  5LHI B; 
#chains in the Genus database with same CATH homology
 4ADZ A;  2DCF A;  2DWK A;  3AAA B;  4JUY A;  4DBR A;  3KVA A;  2VKJ A;  3SRZ A;  4ANJ A;  2CXL A;  2A3D A;  2W61 A;  3ZC1 A;  4EIW A;  4KP3 C;  5L3B B;  1YW0 A;  1ZKE A;  2H7O A;  4WNK A;  5HXS A;  1YKE B;  1WYB A;  3N9P A;  1HS7 A;  5HXE A;  2KZ7 B;  2XTL A;  2DI4 A;  2N1G A;  1FMV A;  1SHZ C;  1MMA A;  2E9X B;  1HX8 A;  3O1H A;  2RA1 A;  2LSG A;  4H9R C;  5JDG A;  2MOZ A;  3N5L A;  4H9Q C;  5LBQ B;  4YLH A;  2VKO A;  2K5B B;  2M67 A;  3ONX A;  3RRC A;  2BVL A;  4UEL A;  2LSI A;  3RYH E;  2LSJ A;  3ZPO A;  1D0Y A;  3GWH A;  3CML A;  2IW5 B;  4J2C A;  2C5J A;  4UV9 B;  2NTX A;  1VOM A;  5ADX L;  4X1I E;  3HKC E;  4EYY R;  3ZN1 B;  2VAS A;  2LJL A;  2WMN A;  4PJN A;  2NW9 A;  2LEH A;  2LT3 A;  1SA0 E;  5FY0 A;  4FI5 A;  2C5K T;  4KBM B;  4EB6 E;  2VL8 A;  1LVK A;  1WLX A;  2V7J A;  3LBX A;  4IE0 A;  4QHO A;  3RRW A;  4YHJ A;  2LOP A;  4A56 A;  3PTR B;  3V5S A;  4UXN B;  4UF0 A;  2K24 A;  3KV6 A;  4MHC A;  4HFV A;  3RYC E;  4X1Y E;  4TZ4 C;  5HAX A;  4QXH B;  3FBL A;  3UT5 E;  3VU7 H;  5LP6 E;  5FXW A;  4JLE A;  3NZP A;  3LK3 B;  2UXN B;  3Q2M A;  1LVF A;  4H63 V;  2E8I A;  4TUY E;  5FYM A;  2EHO B;  2BDE A;  3O1J A;  2V7I A;  1VRB A;  3QUJ A;  4AI6 A;  3F2E A;  4AQG A;  4X20 E;  4MFR A;  3HI2 A;  4ZI7 E;  5BMV E;  3CWZ B;  1HG5 A;  5EK3 A;  2NWB A;  2X9Y A;  1UX4 A;  2B1E A;  3GN5 B;  5HXH A;  4DMW A;  1U5P A;  3N9N A;  2W63 A;  1UX5 A;  5FMN A;  4O4H E;  3OYZ A;  3PE0 A;  4WW0 A;  2P9B A;  2X9X A;  3PU3 A;  2WWU A;  5DQW A;  4O2A E;  1IAP A;  5JVD E;  4HGA A;  4GIW A;  2LE8 A;  2RP4 A;  3ZJ2 A;  4PAG A;  4C91 A;  3I9Y A;  4TV9 E;  3F31 A;  1HG2 A;  5J1G A;  2A2F X;  3AA1 B;  1ZHC A;  4QXC B;  4AKG A;  3DTO A;  2YU2 A;  1IJ6 A;  3E22 E;  3N2K E;  2J1D G;  4GK0 E;  2YIN A;  2EHO A;  1WRD A;  5L2L A;  4ZS2 A;  2Q9Q C;  4I55 E;  1MIV A;  3RYI E;  2W0G A;  2LHR A;  2HPJ A;  2K48 A;  2VKH A;  3E08 A;  4NUU A;  4HKA A;  4OFZ A;  4G2A A;  3LFM A;  4JEU B;  1D0X A;  1IZN B;  2L8K A;  3I9W A;  3C98 B;  3EDV A;  3KBU A;  2CXF A;  5JR9 A;  3VKH A;  2CWY A;  3BQI A;  5LOV E;  4YJ3 E;  2CLY C;  2JMH A;  3MA9 A;  5CB4 E;  3KFW X;  4GYS A;  1S35 A;  3W15 B;  3L3P A;  3PU8 A;  5A1L A;  3KV9 A;  3KV4 A;  2WSS V;  3RPU A;  2K9A A;  3IF8 B;  2NW7 A;  2V7K A;  3OYX A;  2JQQ A;  3UUX B;  4N78 D;  2ODU A;  2PG8 A;  4IST A;  5LGU B;  2XUE A;  4AKI A;  4I50 E;  3C64 A;  4BAY B;  3CQG B;  5EK2 A;  2KMF A;  3FXD B;  4E7S A;  2IAK A;  2L9Q A;  5L3G B;  3LBX B;  4IE7 A;  4UEM A;  5FP3 A;  3HR0 A;  2ZM8 A;  1ZV4 X;  2ZMA A;  3MJX A;  2XAF B;  3FXE B;  3IEE A;  2OA5 A;  3U78 A;  2DHR A;  3JC6 D;  2NW8 A;  3EVY A;  3ZYL A;  2N2N A;  4UF0 B;  1X79 A;  2LSY A;  3JC6 C;  4NUV A;  4OHF A;  2V26 A;  2DNX A;  2C5I T;  3KVB A;  2MYS A;  3R6N A;  5LGN B;  3LK2 B;  2WM9 A;  3SWH A;  4BJN A;  3OKQ A;  3ESL A;  3WAJ A;  2W62 A;  3UFE A;  4PFP A;  3ZEF B;  4TN7 B;  5E0O A;  5JDH A;  1Z0P A;  4G63 A;  3GMI A;  3AB3 B;  4ISS A;  3ZLI A;  5AFU L;  2JRK A;  4DO0 A;  2I59 A;  4UVA B;  3CX8 B;  3GA8 A;  2LOS A;  2E9X D;  1QUU A;  2LSK A;  3C4X A;  1NAF A;  4M1P A;  2E9X C;  5M4Y A;  4O2B E;  3ZMS B;  1BR2 A;  4ZS3 A;  1KK7 A;  4L9I A;  2BVM A;  3EUH A;  4H9O C;  2UXX B;  4P0A A;  2NTY A;  3UUN A;  2ODV A;  5L3F B;  1S94 A;  5J2T E;  2X0L B;  4PNI A;  5ETW A;  3N2O A;  3PDY A;  2KND A;  5JDM A;  3WI3 A;  2H3R A;  3RKO A;  2JPF A;  3FHN A;  2D0T A;  1CUN A;  3ZMZ B;  4AQF C;  5JH7 E;  4QKN A;  3HKB E;  4O4J E;  5DQV A;  1LKX A;  3NRX A;  3PUR A;  2C0S A;  2G0U A;  3MZK B;  4PK5 A;  1MNE A;  2HH7 A;  3KBT A;  5JR9 B;  5LGT B;  3H3A A;  4O4I E;  2X9H A;  5CA0 E;  5JRE A;  1MIW A;  2XAQ B;  4ZI3 D;  1B7T A;  2ZM2 A;  1WR6 A;  3DJB A;  3V5U A;  4TV8 E;  4HEA A;  3RC3 A;  5GON E;  3S4U A;  2XAJ B;  4EAH A;  4ZHQ E;  4CXY A;  3AA6 B;  3VHL A;  3ZC0 A;  2WBL A;  3E0Z A;  2D0U A;  3L09 A;  5HWX A;  1BR1 A;  2CM0 A;  3B57 A;  2NOX A;  5LJM A;  2EHO D;  4QXB B;  3IHR A;  4ILU A;  5H6R B;  3ANW B;  2XAG B;  3K3Q C;  2N9D A;  4X1K E;  3HA4 A;  5FXZ A;  3N9L A;  4PFO A;  3RX6 A;  2Y6X A;  1FMW A;  4QX8 B;  3KDS E;  1HF8 A;  3PUA A;  4JEH B;  4U72 A;  5TAO A;  3O9X A;  5LYJ E;  5JRC B;  2LHN A;  3C4Z A;  3RYF E;  4AKR B;  2LM9 A;  3BQK A;  4K0U A;  4WBO A;  3CX6 B;  4EYU A;  4ERR A;  3C51 A;  1MMD A;  3QC9 A;  5LXT E;  4CZZ B;  4MBQ A;  2IC9 A;  1HFA A;  4UV8 B;  3N9M A;  3Q5X A;  1E1H B;  5LA6 E;  1US7 B;  2CWO A;  3ZYM A;  2CMR A;  2PBI A;  3RH3 A;  3M65 A;  3ZYK A;  3AAE B;  2CA5 A;  2QA7 A;  4YFS A;  2XAS B;  2ZLY A;  4IE4 A;  4QX7 B;  1D0Z A;  3FBZ A;  4AKL A;  4OYJ A;  5EK4 A;  4CXW A;  4UIG A;  5L3E B;  5CA1 E;  5DAB A;  3ZCJ A;  1YKH B;  3AVR A;  3ANW A;  3ETU A;  3O4X E;  3QK6 A;  4P09 A;  3I0O A;  5HXC A;  2VWA A;  3U3I A;  3K3O A;  1V9D A;  2Q9Q A;  4P0B A;  3AA0 B;  3WAK A;  5KDM C;  3CVR A;  1MMN A;  1WYC A;  4IDZ A;  4QWN B;  4UVB B;  4EOZ B;  4H9P C;  4H9N C;  3C50 A;  1YD8 G;  1O3X A;  3N2G E;  4ASK A;  5JDQ A;  5FXV A;  4DMV A;  2ES0 A;  5FY1 A;  5JRC A;  5IHY A;  2CCQ A;  5H6Q B;  1D1B A;  4GOU A;  4MAL A;  4I43 B;  5F8P A;  5LHH B;  3VKG A;  2V7L A;  3LJC A;  4PK4 A;  4B6X A;  1LRZ A;  2KWH A;  3MKD A;  3BK9 A;  2CEA A;  3O1I A;  1T98 A;  3J9X 1;  3ZMU B;  4EXT A;  2X51 A;  3AVS A;  2XHE B;  3IBP A;  3AA7 B;  2X68 A;  3FB2 A;  3OJA A;  4ZI2 D;  5J2U E;  5JDN A;  5EZY E;  2PJQ A;  2A72 A;  4CI2 B;  5HXR A;  2CE7 A;  3MAC A;  4ZI2 C;  4IHJ E;  4I4T E;  2X66 A;  3Q9D A;  4UVC B;  4H9S E;  3T8O A;  3UTK A;  4IE5 A;  3J7Y q;  4V1A v;  1BR0 A;  4XAX B;  1D1A A;  2PFV A;  4H63 H;  5DJQ C;  5JDL A;  4GYR A;  5JDF A;  4IE6 A;  2D5U A;  3PUQ A;  5LNK A;  3PUG A;  3OBV E;  2W00 A;  3BQL A;  4YJ2 E;  3ZN0 B;  1HTJ F;  4TX5 A;  3AAI A;  3CKD A;  2HPL A;  3R84 B;  1Y64 B;  2MTQ A;  2YEV C;  1IJ5 A;  2YK0 A;  4GK5 E;  4Z8X A;  5HWY A;  3K8P C;  3LG7 A;  4PJM A;  4HTE A;  2SPC A;  2XQY A;  1QSD A;  5HYA A;  1ZEE A;  4MLK A;  4F6R C;  1EZ3 A;  2DWG A;  1OWA A;  3N9Q A;  3CPZ A;  3HKE E;  4HN9 A;  4U74 A;  2CXD A;  5LCY A;  2IC6 A;  3MXZ A;  2E9X A;  2GK9 A;  3PUS A;  3Q5W A;  5FY7 A;  2MBG A;  3TKL B;  4DVD A;  1AJ3 A;  4IGU A;  4ZI3 C;  3NBX X;  4AXP A;  4PJJ A;  5JQG E;  3CQC B;  2X9W A;  2NP9 A;  4CQI A;  1FEW A;  3CX7 B;  3A5X A;  2DLR A;  4CXX A;  4EZH A;  3KIN B;  2Z6E A;  5C8Y E;  4AQF A;  2KLQ A;  3KV5 A;  2EHO C;  2VKD A;  3ZMV B;  1MMG A;  2YU1 A;  4AKH A;  3CQX C;  2Q9Q B;  2BZB A;  4O8S A;  4C90 A;  3MK7 C;  1MIY A;  5L3D B;  5JR9 C;  4L5G A;  2CLY B;  4FJO A;  5KMG P;  4OYK A;  2KT9 A;  1BR4 A;  5LHG B;  3P7I A;  3N9O A;  2VK9 A;  3NRY A;  2V7M A;  4KUM B;  5FXX A;  2ACX A;  1HCI A;  2KIN B;  2Y48 B;  1OXZ A;  4WBN E;  2KWI B;  4CI1 B;  5LJN A;  4BA9 A;  4PK6 A;  4EZ4 A;  4HE8 A;  4DND A;  3HL6 A;  3RC8 A;  5F3J A;  3ETV A;  4PW8 A;  3SOL A;  5IYZ E;  1G8X A;  3ZJ1 A;  2Q9Q D;  2V1D B;  3C4W A;  4XBF B;  3ZCI A;  1H7C A;  2WMO A;  4OK0 A;  5KX5 E;  3NZQ A;  3P8C D;  3H37 A;  2Y8D A;  3LK4 2;  3EDU A;  2JMK A;  1KNZ A;  2X67 A;  1UCU A;  2WAU A;  2QGS A;  4CI3 B;  4XZC A;  1FIO A;  3F57 A;  3DP7 A;  2D2S A;  3UUL A;  2JJ9 A;  5LG4 A;  1D1C A;  1MND A;  2L3L A;  3K3N A;  4KMC A;  5LBM A;  3HKD E;  3GN5 A;  4O4L E;  2VB6 A;  4PJL A;  5FNV E;  3B13 A;  2ZM0 A;  3I1A A;  2H7V C;  1NWM X;  1U4Q A;  4ZOL E;  1G73 A;  4L0R A;  4DBQ A;  3SS1 A;  4IIJ E;  2KXP B;  2XAH B;  5L3C B;  3I0Q A;  4E7Z A;  3ZMT B;  4BJM A;  3D0T A;  3UUM A;  5LHI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...