2C5KT

N-terminal domain of tlg1 complexed with n-terminus of vps51
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
89
Chain Sequence
b'EDPFQQVVKDTKEQLNRINNYITRHNTADDQEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFDRRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 51
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 36
structure length 89
sequence length 91
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5kT00
1LRZA 3CVRA 1LVFA 2G0UA 3QK6A 4B6XA 2C5KT 2X9XA 3FXEB 4CQIA 3CKDA 3FXDB 1IJ6A 2CA5A 4J2CA 3TKLB 3L3PA 2MBGA 2X9YA 4DNDA 1Z0PA 3N5LA 4EYYR 4L0RA 2KWIB 2IC9A 3S4UA 4FI5A 1H7CA 2C5JA 2K48A 3QUJA 3P7IA 2X9WA 2XTLA 2C5IT 2IC6A 3MXZA 1IJ5A 1ZKEA 2KWHA 1QSDA
chains in the Genus database with same CATH superfamily
1GQEA 3LSVA 3VKGA 4X65T 5FL0A 4OFZA 2YOEA 2QYWA 2E5VA 2X0LB 3TLVA 3N9MA 3O9XA 5AQPB 1HF8A 2QGSA 2K9AA 5ABEA 4B6XA 3UULA 4GK5E 2ZMAA 4U7IA 4TV8E 3TLTA 2JQHA 3AXJB 1MNEA 2KINB 2PJQA 2C5JA 4HFEA 5L3EB 4G2AA 4CI3B 4KMCA 4JI6T 4JI3T 5KXJA 4JI1T 2EHOA 1WLXA 1US7B 3AE4A 5HEOA 2N9DA 2LSIA 1O3XA 1D0ZA 3VRAA 3B5MA 4HWDA 2IC6A 2FUPA 4HWHA 2BDEA 2WCAA 1HNXT 3ZYMA 3AAIA 3CK6A 1S94A 1XNRT 3PV0F 1NEKA 1MMGA 2MOZA 3RIUA 1HX1B 2BKPA 3EABA 4EEBA 2HPJA 4I55E 3K3QC 5ETWA 4QX8B 4TWHA 1QLBA 2J47A 4I50E 2CM0A 3V5SA 4HWFA 2W00A 2Q9QB 2E8IA 4HKAA 4UV8B 2NW9A 5FKYA 3UUNA 3I0QA 4AKGA 3K3OA 4UF0B 4HGAA 5LGNB 4UVAB 3QK6A 2C5KT 4GOUA 4B3TT 2LJLA 2XQ9A 3L3PA 2LHNA 3OJAA 2WMNA 4WZXA 2KXPB 1X9BA 2MPKA 1HR0T 3U78A 2HN2A 3T1YT 3PTRB 3ZSSA 4O2BE 4XBFB 5JREA 2YEVC 4AQYT 1UX4A 4ILBA 4CI2B 5HCMA 5EZYE 1Z0PA 3KBUA 4WNKA 1M7KA 3QB5K 4AQFA 4COFA 5J2TE 5BR8T 4B3ST 4AISA 4LMKA 4DV5T 2L3LA 2BG9B 5JDGA 2V6XA 3MJXA 5KDMC 4O4HE 3ZSTA 3PUQA 4ERRA 2YU2A 2M6BA 2HPLA 4X1YE 5JQGE 4X64T 4C91A 4ZI2C 3H37A 3D0TA 2AE9A 2YKSA 5LJMA 3Q5WA 2XPKA 4DUYT 2MYSA 2VKHA 4KP3C 4TV9E 4A98A 1HG2A 4EIWA 2W0GA 4HWIB 5L4EA 1QUUA 2C5IT 3Q5EA 5LHHB 2F4VT 3PE0A 1J1JA 2LRLA 2VL8A 2H88A 2RA1A 3C51A 4H9OC 4DNDA 4UXNB 5AQVB 5F5WA 5A1LA 2XAGB 1S35A 1HTJF 4EXTA 3MXZA 2XQ8A 4OX9T 5FYMA 2X9XA 3WAJA 4JUYA 2JJ9A 4L0RA 4DBRA 5JTGA 4HWCA 2XQ4A 1MMAA 3G06A 4EZ4A 4ZI3C 1LVFA 3VR8A 2XAHB 3PURA 3LJCA 3EDUA 2QRXA 3TLSA 4DV7T 3LDQB 4AKIA 2LOPA 2A72A 3PU8A 1VCSA 2BS2A 5ABFA 4O8SA 4K0UA 4QHOA 4QXHB 3PUSA 1IJ5A 3ZMZB 4MBQA 1KNZA 5JDFA 1YQ3A 2DWGA 5LP6E 2V5CA 4ZS3A 1VOMA 4OYJA 2IMLA 1FMWA 3AE9A 4IHJE 3UFGA 2LSYA 2E2AA 1KEYA 2XQAA 2VKJA 2WWVA 4CQIA 2UXXB 3DTOA 4YSZA 5LBMA 1T8BA 5ADXL 2R6GF 4DR1T 3NRXA 2Q9QC 4ZEYA 3RC3A 5LCYA 2FBWA 4DV3T 1NWMX 4Z91A 4PNIA 3ANWB 4H63H 5JR9A 1D0XA 4TWFA 2BS4A 4NUVA 1ZEEA 4U31A 4KX6A 3ONXA 2XAFB 2XM2A 4M1PA 2JQQA 3JAEA 3ETVA 5L3DB 5L47A 3CX6B 3GMIA 3OPCA 4DUZT 4PJNA 3VR9A 3HI2A 4LF6T 3RC8A 1ZV4X 3PJAJ 2EHOD 2JQKA 4OHFA 2JMHA 2D2SA 3TKLB 4J2CA 3I9WA 4WW0A 3O1IA 2MTQA 2D0UA 1JNZA 1HCIA 4YTPA 1H7CA 2BG9C 4LFAT 3RIFA 4V1Av 2P9BA 4QKNA 3AEFA 4YSYA 4IL9A 3P8CD 2HN1A 3ONJA 2VURA 4B3RT 1OEDA 2FJEA 2W67A 4AKRB 4JV5T 2CCQA 2VB6A 1XDPA 3RQUA 1YKHB 2WP9A 5JRCB 3HKCE 3KVAA 4G63A 1KK7A 2BVLA 3ZEFB 4AXPA 4FJOA 5HXCA 2XUEA 3AB3B 2ACZA 3RGLA 3O1JA 2ACXA 3LK2B 4JI7T 1I6ZA 2WM9A 4O4IE 4P0AA 1SHZC 2CMRA 2XQ6A 3RKOA 4YTMA 2CEAA 2YU1A 1LKXA 3PUZF 2KWHA 1G8XA 3UQ4A 5C3JA 3V5UA 4L9IA 2XJ7A 5C8YE 3DJBA 1N33T 5AQKB 4IE7A 2LE8A 4DR4T 2JIWA 1WYCA 4YHJA 3EDVA 3LK3B 4JLEA 2JPFA 3FXEB 2WDVA 3PUXF 4P09A 3ZT5A 2W4XA 4MLKA 1FEWA 5L3FB 4JI0T 2BBJA 2NW8A 2E9XA 1IZNB 3VHLA 1WR0A 2YINA 5HEHA 3WI3A 3I9YA 1JNRA 4H9RC 2XY8B 5BMVE 1HFAA 2B1EA 2DWKA 2ODUA 3O4XE 4EEDA 3AEAA 5L3GB 2VQFT 1J5ET 1D0YA 3AA7B 4ISSA 3RLFF 4IDZA 2IHR1 4Z8XA 5JH7E 1D1AA 3IF8B 5H6QB 5L4HA 2C0SA 3K1SA 4H9NC 4U2YA 4IE4A 2VVSA 4DV1T 2UXBT 5TAOA 2LM9A 4WYVA 3FB2A 3ZPOA 5GONE 4GKKT 2BKNA 2SPCA 2ZLYA 2WMOA 3ZYKA 1W0BA 2FJAA 2PTFA 5LMUT 3BQIA 4YT0A 3LBXA 2X0YA 1KNRA 1UCUA 1KF6A 5HXRA 3UU5A 2DL1A 4DBQA 2OV9A 4L5GA 2LEHA 3N2OA 3K3NA 3ESLA 2W2UA 3ZN0B 2WZIA 2KT9A 5FXVA 1IBLT 3RH3A 2KNDA 2V7JA 3RYIE 2GK9A 3E0ZA 4X62T 5ABHA 4TN7B 3F31A 4CXXA 3KDSE 2XQ5A 4GYSA 4YSXA 1X79A 4JI5T 4IDOA 4IDQA 2FJDA 4KI0F 3AECA 3GN5A 4OK0A 5AQJB 3FZFB 3CX8B 5AQOB 3C4ZA 3Q9DA 4I0UA 4TNVA 2DCFA 3ZYLA 3ZMSB 1WR6A 5CA0E 4UIGA 2UXCT 3HL6A 1WCRA 5FXWA 2LSKA 3N9LA 2FJBA 3OTOT 5HAXA 4U7YA 4WBOA 3RKGA 4BAYB 4QWNB 3RYHE 2IDOB 4CN6A 2UUAT 3JAFA 3P50A 3ZJ1A 2VQET 4GKJT 5JDQA 3NZPA 4CN1A 1AJ3A 1XDOA 5LYJE 5AQIB 3QNUA 3L8RA 4U3CA 3C50A 3CIRA 4I4TE 1IBMT 4JEHB 5AQFB 4U2ZA 1W0AA 5AQTB 1QSDA 3ZKRA 1FIOA 2CXFA 3MACA 3UQ7A 4AI6A 4AKHA 4X5TA 5HWXA 3JCFA 4HFHA 2L9QA 3EHZA 3P4QA 2E5LT 1UK5A 3RPUA 3C98B 3MKDA 4DV0T 3AE5A 2X0HA 2JRKA 3UT5E 2K48A 3U3IA 2WBLA 1U4QA 3KFWX 3N9OA 4IDPA 4LF7T 2DNXA 4DMWA 2BZBA 1NENA 3CMLA 1V9DA 5LJNA 3EI0A 1R8IA 4TWDA 4UF0A 5J2UE 3A8YC 3KBTA 3SWHA 4YJ2E 3VRBA 2VL0A 3JC6C 2I0MA 5JDNA 4PJMA 4DV4T 4HFDA 3CWZB 2H7OA 2M67A 3UUBA 5JDLA 2WU5A 2Z6EA 5LNKA 5H6RB 5HXHA 3Q5DA 1UURA 5KX5E 1MMDA 4X1IE 4LF8T 3P4PA 3N5LA 5CFBA 2XM1A 1I94T 3ETUA 5JR9B 3AEEA 1YD8G 4QH5A 1U5PA 1M62A 3PUVF 3QB5A 3RRCA 1IAPA 2AXDS 2NR4A 4TNWA 4YTNA 2BG9E 4QXBB 4QH4A 4ZXLA 4DR6T 1YKEB 5FNVE 2J1DG 2BG9A 2CLYB 1LVKA 1YQ4A 2WSSV 2UXDT 4DV2T 2X66A 2IW5B 3N2GE 1E7PA 2WDQA 4K0KT 3LFMA 4KBMB 3ZJ2A 5ABGA 1E2AA 4GIWA 3KV6A 2E9XD 3FXDB 4WBNE 4ZS2A 5FY7A 4KUMB 4O4LE 2V6YB 3TLWA 3T8OA 1D1BA 2X9WA 2KSRA 1CUNA 1OEDB 4EZHA 1XNQT 2LLYA 2JQ9A 4IE6A 1UX5A 4UEMA 3NWIA 3OVUA 3RYCE 5EK4A 4BJNA 2PBIA 3AEBA 4PK5A 4ASKA 4EYUA 1YXRA 2ZM6T 2WWUA 1ZOYA 2LRKA 4MALA 3IBPA 3EVYA 3L09A 3DP7A 5HXSA 1BR1A 1IBKT 3ZCJA 4MFRA 3Q2MA 2X9HA 4KHZF 4IGUA 4P1NA 2CWYA 3F2EA 2WDRA 3KV5A 1MMNA 2OLTA 5L3BB 4TUYE 3R6NA 2NTYA 3BK9A 1VCTA 3PUAA 2I59A 3TLUA 4ZI2D 5HEJA 1ZKEA 2WU2A 5M4YA 4HN9A 2WQYA 3HR0A 3FZHB 2CA5A 3FBLA 3B13A 3BQLA 2HH7A 2XSAA 3MA9A 4EV6A 3JADA 2K5BB 5FXXA 3ZC1A 4HFVA 3J7Yq 3SS1A 5FP3A 2Y6XA 1W9RA 3P4RA 2CHNA 5AQLB 4EOZB 3C64A 3KV9A 4F6RC 3OKQA 2VWAA 3ANWA 4IDNA 3UUMA 2BS3A 3OYZA 4LF5T 4NXMT 2YDSA 2H89A 2VK9A 4H9QC 2YDRA 4LMLA 2CPTA 1N32T 4IT4A 3N9NA 3ABVA 4PK6A 2IUBA 2EHOB 4ZI3D 5FY0A 3FHNA 4DO0A 4ILCA 2KZ7B 4CXWA 5JR9C 4HFBA 1N34T 3ZT6A 5KMGP 3FZKB 3AE6A 3SRZA 2PFVA 3HKEE 4X1KE 3H3MA 5E0OA 5J1GA 4ZHQE 1MIYA 2MAWA 3N9QA 4NPPA 2CXDA 1KFYA 2CLYC 2VKOA 1B7TA 4IL4A 4ILUA 2N2NA 3PDYA 2V7IA 5LG3A 5LGTB 3K8PC 3QUJA 2Y48B 3P7IA 4U33A 2BVMA 5AQRB 5AQMB 3E08A 5JRCA 4IE5A 4C90A 2CWOA 2ODVA 5CB4E 2ES0A 2Q9QD 3M3ZB 4TZ4C 2W61A 1ZP0A 3HKBE 4LF4T 5LHGB 1UUSA 3N2KE 3UTKA 5LBQB 2M6IA 1OEDC 2LSGA 1L0VA 5DQVA 5AQUB 1Y64B 1HS7A 4JBWF 2W63A 1BR4A 3RYFE 4I43B 2MBGA 5EK2A 5FL1A 4NUUA 5JVDE 4JI2T 3ZLIA 4ZZBA 4O4JE 3PUWF 5AFUL 3KV4A 5CGMA 3HA4A 3RIAA 4DIDB 4O2AE 2IAKA 2XHEB 3NVOA 2Y8DA 3I1AA 3ZN1B 1DU2A 5LG4A 4DR7T 3IHRA 4EYYR 3UU6A 5LB7B 5HEUA 3I0OA 4IREA 2IIUA 2CBIA 3RX6A 3CQXC 2V1DB 4BJMA 5LOVE 1SA0E 2K24A 2NW7A 3C4XA 3P4SA 3NZQA 4EAHA 4HEAA 2WAUA 5FVKA 3AE1A 1FJGT 3ZCIA 4BA9A 3AE8A 2A9UA 4PJLA 2LSJA 2NOXA 3RHWA 4GK0E 1CHUA 4DR3T 3UU8A 4ZI7E 5LHIB 4LFCT 3MK7C 3ZMUB 3Q5XA 4QXCB 2E9XC 3M65A 2V7MA 5JDHA 5J0ZA 3LK42 4QX7B 1E1HB 4ZZCA 4Z90A 1Y01A 3SOLA 3AXJA 4ZOLE 4CI1B 4U72A 1T7SA 5IWAT 4YXDA 2H7VC 4DR2T 4F8HA 2NWBA 1W09A 5HXEA 1SE7A 2A2FX 4DR5T 4A5XA 2LKGA 1MIWA 2XQ7A 2XAJB 3F57A 2DHRA 1HG5A 2DLRA 3NRYA 2XSBA 2EHOC 1G73A 5L3CB 2LHRA 5DQWA 1XWMA 2BBHA 3A7MA 1T98A 3EAMA 3P4WA 4LF9T 5ABFB 4CXYA 5LA6E 3QC9A 3NBXX 4FI5A 2QA7A 2OA5A 2YN6A 3RQWA 3AA6B 2YK0A 3PJAA 2V5DA 1T72A 4EGWA 2Q9QA 3AE2A 1WYBA 3X1DA 3LG7A 1HNZT 4YJ3E 5IHYA 5IYZE 4PK4A 3ZC0A 4E7ZA 3RIUC 2HHHT 2UXNB 3AE3A 4NIQA 4YLHA 1MIVA 3QOFA 3CVRA 3O1HA 2NTXA 4U74A 1IJ6A 1YW0A 3PUYF 2YDQA 2J4GA 4ADZA 5AQNB 4Q25A 3AEGA 5HCJA 5DABA 5HEGA 3ONLC 2J62A 5C2TA 3FZLB 2VKDA 3UU3A 3C4WA 5LXTE 3CQGB 1BR2A 2W62A 2CHOA 3VU7H 3CKDA 3CPZA 2XQYA 5HYAA 4JI4T 3RI5A 4CN4A 4YY3T 3T1HT 1FMVA 3KINB 4LMJA 3CQCB 3VKHA 1MNDA 2RP4A 2LKHA 4ISTA 4AKLA 3KVBA 4UR9A 2CE7A 5LMNT 1XZYA 4DMVA 4LFBT 4H9SE 1LRZA 4P0BA 5FXZA 2IC9A 4ANJA 2WB5A 2X67A 4AQFC 5CA1E 2JMKA 2XASB 4IE0A 3GWHA 4JYAT 4QH1A 4XZCA 4YHHT 2W66A 4A56A 2L8KA 3RRWA 3CX7B 3UFEA 3AVRA 4N78D 2D5UA 4PFOA 2CRBA 4B3MT 1XMOT 3H3AA 4H63V 3W15B 4ILAA 1N36T 5FVLA 3L39A 4NXNT 2X9YA 5CJ5A 5F3JA 2B76A 2VASA 1OWAA 2KWIB 3ZMTB 5AQQB 2D9DA 1NAFA 2V7KA 4HFCA 2CXLA 2D0TA 5AQHB 5FY1A 4TX5A 2X51A 3E22E 3AVSA 2UUBT 1KNPA 3FBZA 2WY2A 5L2LA 2PG8A 2ZM0A 3AA0B 2ZM8A 3ZMVB 3IEEA 4DV6T 3AAAB 2ZM2A 4UVCB 3RF1A 4UELA 1ZHCA 3OBVE 3PU3A 2A3DA 2WZHA 1J5WA 1VRBA 2XAQB 3BQKA 2XTLA 4OYKA 2V8SV 4DVDA 3NKZA 4PAGA 2G0UA 2WS3A 3UU4A 2DI4A 2BKOA 2E9XB 3A5XA 4E7SA 3OYXA 1OXZA 1WRDA 4CZZB 3UUXB 2CBJA 2V6YA 1HX8A 4A97A 4GYRA 2K3WA 4XAXB 1OEDE 4PW8A 3AEDA 4KHPT 3AAEB 3ZT7A 2V7LA 1SUMB 3JC6D 5AQGB 3S4UA 4JEUB 2LOSA 3SFEA 1HNWT 4HTEA 1UGOA 2RPAA 4AQGA 5LGUB 3N9PA 1D1CA 4X66T 3IA3A 2LM2A 2N1GA 2QVAA 4MHCA 5EK3A 3FZMB 4PJJA 4H9PC 2KLQA 3EUHA 2XQ3A 2X68A 3LBXB 2H3RA 4YFSA 4PFPA 3PUGA 3R84B 3MZKB 2LT3A 2KMFA 3J9X1 2UU9T 4JI8T 3GA8A 5FMNA 2VVNA 3HKDE 3AA1B 1WFDA 3AE7A 4HE8A 3WAKA 5JDMA 1Z8UA 4UVBB 3SFDA 4EB6E 2NP9A 4HFIA 5F8PA 5IUXA 4AIUA 5DJQC 1EZ3A 2XZEA 1XMQT 2V26A 3B57A 2UUCT 4IIJE 4UV9B 5AQSB 4X20E 3GN5B 2I6HA 1BR0A 5HWYA
chains in the Genus database with same CATH topology
4U72A 1U5PA 3RRCA 3VKGA 2JMHA 1IAPA 2D2SA 3TKLB 4J2CA 3I9WA 4WW0A 3O1IA 2MTQA 2D0UA 4OFZA 4QXBB 1HCIA 2H7VC 2X0LB 1H7CA 3N9MA 3O9XA 1YKEB 1HF8A 2J1DG 5FNVE 2QGSA 2K9AA 4V1Av 2NWBA 2CLYB 2P9BA 4QKNA 5HXEA 1LVKA 2WSSV 2A2FX 4B6XA 2X66A 3P8CD 3UULA 4GK5E 2IW5B 2ZMAA 3N2GE 1MIWA 4TV8E 2XAJB 3F57A 3LFMA 2DHRA 4AKRB 1MNEA 2CCQA 2KINB 1HG5A 2VB6A 2PJQA 2C5JA 4KBMB 1YKHB 2DLRA 3NRYA 5L3EB 3ZJ2A 5JRCB 4G2AA 4CI3B 4KMCA 3HKCE 3KVAA 4G63A 2EHOC 1G73A 5L3CB 1KK7A 2LHRA 5DQWA 4GIWA 2EHOA 2BVLA 3ZEFB 1WLXA 4AXPA 3KV6A 4FJOA 1US7B 5HXCA 2E9XD 1T98A 2XUEA 3FXDB 3AB3B 4WBNE 4ZS2A 5FY7A 3O1JA 4KUMB 4O4LE 2N9DA 2ACXA 2LSIA 1O3XA 3LK2B 4CXYA 5LA6E 3QC9A 2WM9A 3NBXX 4FI5A 4O4IE 2QA7A 4P0AA 1D0ZA 1SHZC 2OA5A 2CMRA 3RKOA 3T8OA 1D1BA 3AA6B 2X9WA 2CEAA 2YU1A 2IC6A 1LKXA 2YK0A 1CUNA 2KWHA 4EZHA 1G8XA 2BDEA 2Q9QA 4IE6A 1WYBA 3LG7A 4YJ3E 5IHYA 1UX5A 4L9IA 3V5UA 3ZYMA 5C8YE 3AAIA 4UEMA 5IYZE 4PK4A 3ZC0A 3DJBA 3RYCE 5EK4A 4BJNA 4IE7A 4E7ZA 1S94A 2PBIA 2LE8A 4PK5A 4ASKA 1MMGA 2MOZA 2UXNB 4EYUA 4YLHA 1MIVA 1WYCA 2HPJA 4I55E 3CVRA 3O1HA 4YHJA 2WWUA 3EDVA 3K3QC 3LK3B 4JLEA 2JPFA 3FXEB 5ETWA 4P09A 2NTXA 4U74A 4QX8B 4MLKA 1IJ6A 1YW0A 4MALA 3IBPA 3EVYA 1FEWA 3L09A 5L3FB 4ADZA 3DP7A 5HXSA 4I50E 2CM0A 1BR1A 3V5SA 2W00A 2Q9QB 2E8IA 5DABA 2NW8A 4HKAA 4UV8B 2NW9A 2E9XA 1IZNB 3UUNA 3I0QA 3ZCJA 2VKDA 3VHLA 3C4WA 4MFRA 5LXTE 4AKGA 2YINA 3CQGB 3WI3A 3K3OA 1BR2A 3Q2MA 2X9HA 3I9YA 2W62A 4UF0B 4HGAA 5LGNB 4H9RC 4UVAB 3QK6A 4IGUA 2C5KT 5BMVE 4GOUA 3VU7H 2CWYA 2LJLA 3CKDA 1HFAA 3CPZA 2B1EA 2DWKA 2ODUA 2XQYA 3F2EA 3L3PA 3O4XE 5HYAA 5L3GB 2LHNA 3OJAA 1D0YA 2WMNA 3AA7B 2KXPB 3KV5A 1MMNA 4ISSA 1FMVA 5L3BB 3KINB 4IDZA 3CQCB 3VKHA 4TUYE 3R6NA 1MNDA 2RP4A 4Z8XA 2NTYA 4ISTA 4AKLA 3BK9A 3PUAA 3U78A 3KVBA 2I59A 4ZI2D 2CE7A 5JH7E 3PTRB 1D1AA 1ZKEA 4DMVA 4O2BE 4XBFB 3IF8B 1LRZA 4H9SE 5H6QB 5JREA 2C0SA 5M4YA 2YEVC 4HN9A 4H9NC 3HR0A 4P0BA 2CA5A 1UX4A 3FBLA 3B13A 3BQLA 4IE4A 5FXZA 4CI2B 5EZYE 1Z0PA 2HH7A 3MA9A 2IC9A 5TAOA 2LM9A 3KBUA 4WNKA 4ANJA 2K5BB 3FB2A 2X67A 4AQFC 3ZPOA 5GONE 5FXXA 5CA1E 3ZC1A 4HFVA 4AQFA 2JMKA 2XASB 3J7Yq 3SS1A 2SPCA 2ZLYA 5FP3A 5J2TE 2WMOA 4IE0A 3GWHA 3ZYKA 2Y6XA 4XZCA 3BQIA 4EOZB 4A56A 2L8KA 3C64A 3KV9A 3LBXA 3RRWA 3CX7B 4F6RC 3OKQA 3UFEA 2VWAA 2L3LA 3ANWA 3UUMA 5JDGA 1UCUA 5HXRA 3AVRA 3OYZA 3MJXA 4DBQA 4N78D 5KDMC 4L5GA 2LEHA 3N2OA 4O4HE 2D5UA 4PFOA 2VK9A 4H9QC 3K3NA 3H3AA 3PUQA 3ESLA 4H63V 3W15B 4ERRA 2YU2A 3ZN0B 2HPLA 4X1YE 5JQGE 4C91A 4ZI2C 2KT9A 3H37A 5FXVA 3D0TA 3RH3A 2KNDA 2V7JA 5LJMA 2X9YA 3RYIE 3N9NA 2GK9A 3E0ZA 3Q5WA 5F3JA 4TN7B 3F31A 2MYSA 4PK6A 2VKHA 4CXXA 3KDSE 4KP3C 2EHOB 4TV9E 4ZI3D 2VASA 3FHNA 5FY0A 1HG2A 4GYSA 4EIWA 4DO0A 2KZ7B 2W0GA 1X79A 1OWAA 1QUUA 2C5IT 4CXWA 5LHHB 5JR9C 2KWIB 3ZMTB 3PE0A 2VL8A 1NAFA 5KMGP 2V7KA 2CXLA 3GN5A 2RA1A 3C51A 3SRZA 2PFVA 4OK0A 2D0TA 4H9OC 5FY1A 4TX5A 2X51A 3E22E 4UXNB 4DNDA 3HKEE 3AVSA 4X1KE 5A1LA 3CX8B 3C4ZA 3Q9DA 3FBZA 2XAGB 5L2LA 5E0OA 5J1GA 2PG8A 1S35A 2DCFA 2ZM0A 3AA0B 3ZYLA 2ZM8A 1HTJF 3ZMSB 4ZHQE 3ZMVB 4EXTA 3IEEA 1MIYA 1WR6A 3MXZA 4UIGA 5CA0E 3HL6A 3N9QA 3AAAB 2CXDA 2CLYC 5FYMA 2ZM2A 2X9XA 4UVCB 5FXWA 2LSKA 3N9LA 4UELA 5HAXA 2VKOA 4WBOA 1B7TA 4BAYB 4QWNB 4JUYA 1ZHCA 4ILUA 3RYHE 2JJ9A 2N2NA 3WAJA 3PDYA 2V7IA 4L0RA 4DBRA 3OBVE 3PU3A 2A3DA 5LGTB 3K8PC 1VRBA 1MMAA 3QUJA 2Y48B 3P7IA 2XAQB 3ZJ1A 3BQKA 2XTLA 4OYKA 4DVDA 5JDQA 2BVMA 4PAGA 3NZPA 4EZ4A 4ZI3C 3E08A 1AJ3A 1LVFA 2G0UA 2DI4A 5JRCA 2XAHB 4IE5A 5LYJE 4C90A 2CWOA 2ODVA 3PURA 3LJCA 3EDUA 2E9XB 3A5XA 5CB4E 4E7SA 3OYXA 1OXZA 3C50A 2ES0A 4AKIA 2Q9QD 1WRDA 4TZ4C 4CZZB 2W61A 3UUXB 2LOPA 2A72A 4I4TE 4JEHB 3HKBE 3PU8A 5LHGB 1HX8A 4O8SA 4K0UA 4QHOA 4GYRA 3N2KE 1IJ5A 3PUSA 4QXHB 3ZMZB 4MBQA 1KNZA 1QSDA 4XAXB 5JDFA 3UTKA 5LBQB 4PW8A 2DWGA 5LP6E 3AAEB 1FIOA 2LSGA 5DQVA 1Y64B 2CXFA 1HS7A 2W63A 3MACA 1BR4A 1VOMA 4ZS3A 3RYFE 2V7LA 4I43B 2MBGA 5EK2A 4AI6A 3JC6D 4OYJA 4AKHA 5HWXA 4NUUA 3S4UA 4JEUB 5JVDE 2LOSA 3ZLIA 4HTEA 4O4JE 2L9QA 1FMWA 4IHJE 5AFUL 3KV4A 2LSYA 3HA4A 4AQGA 4O2AE 2IAKA 5LGUB 2XHEB 3N9PA 1D1CA 2VKJA 2Y8DA 3I1AA 4CQIA 3ZN1B 2UXXB 2N1GA 3DTOA 3RPUA 5LG4A 3C98B 4MHCA 3MKDA 3IHRA 4EYYR 5LBMA 5EK3A 2JRKA 3UT5E 5ADXL 3I0OA 4PJJA 4H9PC 2K48A 2KLQA 3NRXA 3U3IA 3EUHA 3RX6A 2WBLA 2Q9QC 3CQXC 2V1DB 2X68A 3RC3A 4BJMA 3LBXB 2H3RA 1SA0E 5LCYA 1NWMX 1U4QA 2K24A 3KFWX 3N9OA 5LOVE 2NW7A 4YFSA 4PNIA 4PFPA 3ANWB 3C4XA 4H63H 2DNXA 3NZQA 3PUGA 4DMWA 2BZBA 4HEAA 4EAHA 5JR9A 1D0XA 2WAUA 3R84B 3MZKB 3CMLA 3ZCIA 1V9DA 4BA9A 5LJNA 2LT3A 4NUVA 2KMFA 3J9X1 4UF0A 1ZEEA 5J2UE 4PJLA 3KBTA 2LSJA 3SWHA 3ONXA 2XAFB 4YJ2E 2NOXA 3GA8A 5FMNA 3HKDE 3AA1B 3JC6C 4GK0E 4M1PA 4HE8A 3WAKA 5JDNA 2JQQA 4PJMA 5JDMA 3ETVA 4UVBB 5L3DB 3CWZB 2H7OA 4EB6E 2M67A 2NP9A 4ZI7E 5F8PA 5JDLA 3CX6B 3GMIA 2Z6EA 5LHIB 5LNKA 5DJQC 5H6RB 5HXHA 1EZ3A 3MK7C 5KX5E 1MMDA 4X1IE 4PJNA 3HI2A 3ZMUB 3N5LA 3Q5XA 4QXCB 2E9XC 2V26A 3B57A 3M65A 2V7MA 4IIJE 3RC8A 1ZV4X 5JDHA 2EHOD 3LK42 4QX7B 4UV9B 1E1HB 3ETUA 5JR9B 1YD8G 4X20E 3GN5B 4OHFA 1BR0A 3SOLA 4ZOLE 4CI1B 5HWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRZ A;  3CVR A;  1LVF A;  2G0U A;  3QK6 A;  4B6X A;  2C5K T;  2X9X A;  3FXE B;  4CQI A;  3CKD A;  3FXD B;  1IJ6 A;  2CA5 A;  4J2C A;  3TKL B;  3L3P A;  2MBG A;  2X9Y A;  4DND A;  1Z0P A;  3N5L A;  4EYY R;  4L0R A;  2KWI B;  2IC9 A;  3S4U A;  4FI5 A;  1H7C A;  2C5J A;  2K48 A;  3QUJ A;  3P7I A;  2X9W A;  2XTL A;  2C5I T;  2IC6 A;  3MXZ A;  1IJ5 A;  1ZKE A;  2KWH A;  1QSD A; 
#chains in the Genus database with same CATH topology
 1GQE A;  3LSV A;  3VKG A;  4X65 T;  5FL0 A;  4OFZ A;  2YOE A;  2QYW A;  2E5V A;  2X0L B;  3TLV A;  3N9M A;  3O9X A;  5AQP B;  1HF8 A;  2QGS A;  2K9A A;  5ABE A;  4B6X A;  3UUL A;  4GK5 E;  2ZMA A;  4U7I A;  4TV8 E;  3TLT A;  2JQH A;  3AXJ B;  1MNE A;  2KIN B;  2PJQ A;  2C5J A;  4HFE A;  5L3E B;  4G2A A;  4CI3 B;  4KMC A;  4JI6 T;  4JI3 T;  5KXJ A;  4JI1 T;  2EHO A;  1WLX A;  1US7 B;  3AE4 A;  5HEO A;  2N9D A;  2LSI A;  1O3X A;  1D0Z A;  3VRA A;  3B5M A;  4HWD A;  2IC6 A;  2FUP A;  4HWH A;  2BDE A;  2WCA A;  1HNX T;  3ZYM A;  3AAI A;  3CK6 A;  1S94 A;  1XNR T;  3PV0 F;  1NEK A;  1MMG A;  2MOZ A;  3RIU A;  1HX1 B;  2BKP A;  3EAB A;  4EEB A;  2HPJ A;  4I55 E;  3K3Q C;  5ETW A;  4QX8 B;  4TWH A;  1QLB A;  2J47 A;  4I50 E;  2CM0 A;  3V5S A;  4HWF A;  2W00 A;  2Q9Q B;  2E8I A;  4HKA A;  4UV8 B;  2NW9 A;  5FKY A;  3UUN A;  3I0Q A;  4AKG A;  3K3O A;  4UF0 B;  4HGA A;  5LGN B;  4UVA B;  3QK6 A;  2C5K T;  4GOU A;  4B3T T;  2LJL A;  2XQ9 A;  3L3P A;  2LHN A;  3OJA A;  2WMN A;  4WZX A;  2KXP B;  1X9B A;  2MPK A;  1HR0 T;  3U78 A;  2HN2 A;  3T1Y T;  3PTR B;  3ZSS A;  4O2B E;  4XBF B;  5JRE A;  2YEV C;  4AQY T;  1UX4 A;  4ILB A;  4CI2 B;  5HCM A;  5EZY E;  1Z0P A;  3KBU A;  4WNK A;  1M7K A;  3QB5 K;  4AQF A;  4COF A;  5J2T E;  5BR8 T;  4B3S T;  4AIS A;  4LMK A;  4DV5 T;  2L3L A;  2BG9 B;  5JDG A;  2V6X A;  3MJX A;  5KDM C;  4O4H E;  3ZST A;  3PUQ A;  4ERR A;  2YU2 A;  2M6B A;  2HPL A;  4X1Y E;  5JQG E;  4X64 T;  4C91 A;  4ZI2 C;  3H37 A;  3D0T A;  2AE9 A;  2YKS A;  5LJM A;  3Q5W A;  2XPK A;  4DUY T;  2MYS A;  2VKH A;  4KP3 C;  4TV9 E;  4A98 A;  1HG2 A;  4EIW A;  2W0G A;  4HWI B;  5L4E A;  1QUU A;  2C5I T;  3Q5E A;  5LHH B;  2F4V T;  3PE0 A;  1J1J A;  2LRL A;  2VL8 A;  2H88 A;  2RA1 A;  3C51 A;  4H9O C;  4DND A;  4UXN B;  5AQV B;  5F5W A;  5A1L A;  2XAG B;  1S35 A;  1HTJ F;  4EXT A;  3MXZ A;  2XQ8 A;  4OX9 T;  5FYM A;  2X9X A;  3WAJ A;  4JUY A;  2JJ9 A;  4L0R A;  4DBR A;  5JTG A;  4HWC A;  2XQ4 A;  1MMA A;  3G06 A;  4EZ4 A;  4ZI3 C;  1LVF A;  3VR8 A;  2XAH B;  3PUR A;  3LJC A;  3EDU A;  2QRX A;  3TLS A;  4DV7 T;  3LDQ B;  4AKI A;  2LOP A;  2A72 A;  3PU8 A;  1VCS A;  2BS2 A;  5ABF A;  4O8S A;  4K0U A;  4QHO A;  4QXH B;  3PUS A;  1IJ5 A;  3ZMZ B;  4MBQ A;  1KNZ A;  5JDF A;  1YQ3 A;  2DWG A;  5LP6 E;  2V5C A;  4ZS3 A;  1VOM A;  4OYJ A;  2IML A;  1FMW A;  3AE9 A;  4IHJ E;  3UFG A;  2LSY A;  2E2A A;  1KEY A;  2XQA A;  2VKJ A;  2WWV A;  4CQI A;  2UXX B;  3DTO A;  4YSZ A;  5LBM A;  1T8B A;  5ADX L;  2R6G F;  4DR1 T;  3NRX A;  2Q9Q C;  4ZEY A;  3RC3 A;  5LCY A;  2FBW A;  4DV3 T;  1NWM X;  4Z91 A;  4PNI A;  3ANW B;  4H63 H;  5JR9 A;  1D0X A;  4TWF A;  2BS4 A;  4NUV A;  1ZEE A;  4U31 A;  4KX6 A;  3ONX A;  2XAF B;  2XM2 A;  4M1P A;  2JQQ A;  3JAE A;  3ETV A;  5L3D B;  5L47 A;  3CX6 B;  3GMI A;  3OPC A;  4DUZ T;  4PJN A;  3VR9 A;  3HI2 A;  4LF6 T;  3RC8 A;  1ZV4 X;  3PJA J;  2EHO D;  2JQK A;  4OHF A;  2JMH A;  2D2S A;  3TKL B;  4J2C A;  3I9W A;  4WW0 A;  3O1I A;  2MTQ A;  2D0U A;  1JNZ A;  1HCI A;  4YTP A;  1H7C A;  2BG9 C;  4LFA T;  3RIF A;  4V1A v;  2P9B A;  4QKN A;  3AEF A;  4YSY A;  4IL9 A;  3P8C D;  2HN1 A;  3ONJ A;  2VUR A;  4B3R T;  1OED A;  2FJE A;  2W67 A;  4AKR B;  4JV5 T;  2CCQ A;  2VB6 A;  1XDP A;  3RQU A;  1YKH B;  2WP9 A;  5JRC B;  3HKC E;  3KVA A;  4G63 A;  1KK7 A;  2BVL A;  3ZEF B;  4AXP A;  4FJO A;  5HXC A;  2XUE A;  3AB3 B;  2ACZ A;  3RGL A;  3O1J A;  2ACX A;  3LK2 B;  4JI7 T;  1I6Z A;  2WM9 A;  4O4I E;  4P0A A;  1SHZ C;  2CMR A;  2XQ6 A;  3RKO A;  4YTM A;  2CEA A;  2YU1 A;  1LKX A;  3PUZ F;  2KWH A;  1G8X A;  3UQ4 A;  5C3J A;  3V5U A;  4L9I A;  2XJ7 A;  5C8Y E;  3DJB A;  1N33 T;  5AQK B;  4IE7 A;  2LE8 A;  4DR4 T;  2JIW A;  1WYC A;  4YHJ A;  3EDV A;  3LK3 B;  4JLE A;  2JPF A;  3FXE B;  2WDV A;  3PUX F;  4P09 A;  3ZT5 A;  2W4X A;  4MLK A;  1FEW A;  5L3F B;  4JI0 T;  2BBJ A;  2NW8 A;  2E9X A;  1IZN B;  3VHL A;  1WR0 A;  2YIN A;  5HEH A;  3WI3 A;  3I9Y A;  1JNR A;  4H9R C;  2XY8 B;  5BMV E;  1HFA A;  2B1E A;  2DWK A;  2ODU A;  3O4X E;  4EED A;  3AEA A;  5L3G B;  2VQF T;  1J5E T;  1D0Y A;  3AA7 B;  4ISS A;  3RLF F;  4IDZ A;  2IHR 1;  4Z8X A;  5JH7 E;  1D1A A;  3IF8 B;  5H6Q B;  5L4H A;  2C0S A;  3K1S A;  4H9N C;  4U2Y A;  4IE4 A;  2VVS A;  4DV1 T;  2UXB T;  5TAO A;  2LM9 A;  4WYV A;  3FB2 A;  3ZPO A;  5GON E;  4GKK T;  2BKN A;  2SPC A;  2ZLY A;  2WMO A;  3ZYK A;  1W0B A;  2FJA A;  2PTF A;  5LMU T;  3BQI A;  4YT0 A;  3LBX A;  2X0Y A;  1KNR A;  1UCU A;  1KF6 A;  5HXR A;  3UU5 A;  2DL1 A;  4DBQ A;  2OV9 A;  4L5G A;  2LEH A;  3N2O A;  3K3N A;  3ESL A;  2W2U A;  3ZN0 B;  2WZI A;  2KT9 A;  5FXV A;  1IBL T;  3RH3 A;  2KND A;  2V7J A;  3RYI E;  2GK9 A;  3E0Z A;  4X62 T;  5ABH A;  4TN7 B;  3F31 A;  4CXX A;  3KDS E;  2XQ5 A;  4GYS A;  4YSX A;  1X79 A;  4JI5 T;  4IDO A;  4IDQ A;  2FJD A;  4KI0 F;  3AEC A;  3GN5 A;  4OK0 A;  5AQJ B;  3FZF B;  3CX8 B;  5AQO B;  3C4Z A;  3Q9D A;  4I0U A;  4TNV A;  2DCF A;  3ZYL A;  3ZMS B;  1WR6 A;  5CA0 E;  4UIG A;  2UXC T;  3HL6 A;  1WCR A;  5FXW A;  2LSK A;  3N9L A;  2FJB A;  3OTO T;  5HAX A;  4U7Y A;  4WBO A;  3RKG A;  4BAY B;  4QWN B;  3RYH E;  2IDO B;  4CN6 A;  2UUA T;  3JAF A;  3P50 A;  3ZJ1 A;  2VQE T;  4GKJ T;  5JDQ A;  3NZP A;  4CN1 A;  1AJ3 A;  1XDO A;  5LYJ E;  5AQI B;  3QNU A;  3L8R A;  4U3C A;  3C50 A;  3CIR A;  4I4T E;  1IBM T;  4JEH B;  5AQF B;  4U2Z A;  1W0A A;  5AQT B;  1QSD A;  3ZKR A;  1FIO A;  2CXF A;  3MAC A;  3UQ7 A;  4AI6 A;  4AKH A;  4X5T A;  5HWX A;  3JCF A;  4HFH A;  2L9Q A;  3EHZ A;  3P4Q A;  2E5L T;  1UK5 A;  3RPU A;  3C98 B;  3MKD A;  4DV0 T;  3AE5 A;  2X0H A;  2JRK A;  3UT5 E;  2K48 A;  3U3I A;  2WBL A;  1U4Q A;  3KFW X;  3N9O A;  4IDP A;  4LF7 T;  2DNX A;  4DMW A;  2BZB A;  1NEN A;  3CML A;  1V9D A;  5LJN A;  3EI0 A;  1R8I A;  4TWD A;  4UF0 A;  5J2U E;  3A8Y C;  3KBT A;  3SWH A;  4YJ2 E;  3VRB A;  2VL0 A;  3JC6 C;  2I0M A;  5JDN A;  4PJM A;  4DV4 T;  4HFD A;  3CWZ B;  2H7O A;  2M67 A;  3UUB A;  5JDL A;  2WU5 A;  2Z6E A;  5LNK A;  5H6R B;  5HXH A;  3Q5D A;  1UUR A;  5KX5 E;  1MMD A;  4X1I E;  4LF8 T;  3P4P A;  3N5L A;  5CFB A;  2XM1 A;  1I94 T;  3ETU A;  5JR9 B;  3AEE A;  1YD8 G;  4QH5 A;  1U5P A;  1M62 A;  3PUV F;  3QB5 A;  3RRC A;  1IAP A;  2AXD S;  2NR4 A;  4TNW A;  4YTN A;  2BG9 E;  4QXB B;  4QH4 A;  4ZXL A;  4DR6 T;  1YKE B;  5FNV E;  2J1D G;  2BG9 A;  2CLY B;  1LVK A;  1YQ4 A;  2WSS V;  2UXD T;  4DV2 T;  2X66 A;  2IW5 B;  3N2G E;  1E7P A;  2WDQ A;  4K0K T;  3LFM A;  4KBM B;  3ZJ2 A;  5ABG A;  1E2A A;  4GIW A;  3KV6 A;  2E9X D;  3FXD B;  4WBN E;  4ZS2 A;  5FY7 A;  4KUM B;  4O4L E;  2V6Y B;  3TLW A;  3T8O A;  1D1B A;  2X9W A;  2KSR A;  1CUN A;  1OED B;  4EZH A;  1XNQ T;  2LLY A;  2JQ9 A;  4IE6 A;  1UX5 A;  4UEM A;  3NWI A;  3OVU A;  3RYC E;  5EK4 A;  4BJN A;  2PBI A;  3AEB A;  4PK5 A;  4ASK A;  4EYU A;  1YXR A;  2ZM6 T;  2WWU A;  1ZOY A;  2LRK A;  4MAL A;  3IBP A;  3EVY A;  3L09 A;  3DP7 A;  5HXS A;  1BR1 A;  1IBK T;  3ZCJ A;  4MFR A;  3Q2M A;  2X9H A;  4KHZ F;  4IGU A;  4P1N A;  2CWY A;  3F2E A;  2WDR A;  3KV5 A;  1MMN A;  2OLT A;  5L3B B;  4TUY E;  3R6N A;  2NTY A;  3BK9 A;  1VCT A;  3PUA A;  2I59 A;  3TLU A;  4ZI2 D;  5HEJ A;  1ZKE A;  2WU2 A;  5M4Y A;  4HN9 A;  2WQY A;  3HR0 A;  3FZH B;  2CA5 A;  3FBL A;  3B13 A;  3BQL A;  2HH7 A;  2XSA A;  3MA9 A;  4EV6 A;  3JAD A;  2K5B B;  5FXX A;  3ZC1 A;  4HFV A;  3J7Y q;  3SS1 A;  5FP3 A;  2Y6X A;  1W9R A;  3P4R A;  2CHN A;  5AQL B;  4EOZ B;  3C64 A;  3KV9 A;  4F6R C;  3OKQ A;  2VWA A;  3ANW A;  4IDN A;  3UUM A;  2BS3 A;  3OYZ A;  4LF5 T;  4NXM T;  2YDS A;  2H89 A;  2VK9 A;  4H9Q C;  2YDR A;  4LML A;  2CPT A;  1N32 T;  4IT4 A;  3N9N A;  3ABV A;  4PK6 A;  2IUB A;  2EHO B;  4ZI3 D;  5FY0 A;  3FHN A;  4DO0 A;  4ILC A;  2KZ7 B;  4CXW A;  5JR9 C;  4HFB A;  1N34 T;  3ZT6 A;  5KMG P;  3FZK B;  3AE6 A;  3SRZ A;  2PFV A;  3HKE E;  4X1K E;  3H3M A;  5E0O A;  5J1G A;  4ZHQ E;  1MIY A;  2MAW A;  3N9Q A;  4NPP A;  2CXD A;  1KFY A;  2CLY C;  2VKO A;  1B7T A;  4IL4 A;  4ILU A;  2N2N A;  3PDY A;  2V7I A;  5LG3 A;  5LGT B;  3K8P C;  3QUJ A;  2Y48 B;  3P7I A;  4U33 A;  2BVM A;  5AQR B;  5AQM B;  3E08 A;  5JRC A;  4IE5 A;  4C90 A;  2CWO A;  2ODV A;  5CB4 E;  2ES0 A;  2Q9Q D;  3M3Z B;  4TZ4 C;  2W61 A;  1ZP0 A;  3HKB E;  4LF4 T;  5LHG B;  1UUS A;  3N2K E;  3UTK A;  5LBQ B;  2M6I A;  1OED C;  2LSG A;  1L0V A;  5DQV A;  5AQU B;  1Y64 B;  1HS7 A;  4JBW F;  2W63 A;  1BR4 A;  3RYF E;  4I43 B;  2MBG A;  5EK2 A;  5FL1 A;  4NUU A;  5JVD E;  4JI2 T;  3ZLI A;  4ZZB A;  4O4J E;  3PUW F;  5AFU L;  3KV4 A;  5CGM A;  3HA4 A;  3RIA A;  4DID B;  4O2A E;  2IAK A;  2XHE B;  3NVO A;  2Y8D A;  3I1A A;  3ZN1 B;  1DU2 A;  5LG4 A;  4DR7 T;  3IHR A;  4EYY R;  3UU6 A;  5LB7 B;  5HEU A;  3I0O A;  4IRE A;  2IIU A;  2CBI A;  3RX6 A;  3CQX C;  2V1D B;  4BJM A;  5LOV E;  1SA0 E;  2K24 A;  2NW7 A;  3C4X A;  3P4S A;  3NZQ A;  4EAH A;  4HEA A;  2WAU A;  5FVK A;  3AE1 A;  1FJG T;  3ZCI A;  4BA9 A;  3AE8 A;  2A9U A;  4PJL A;  2LSJ A;  2NOX A;  3RHW A;  4GK0 E;  1CHU A;  4DR3 T;  3UU8 A;  4ZI7 E;  5LHI B;  4LFC T;  3MK7 C;  3ZMU B;  3Q5X A;  4QXC B;  2E9X C;  3M65 A;  2V7M A;  5JDH A;  5J0Z A;  3LK4 2;  4QX7 B;  1E1H B;  4ZZC A;  4Z90 A;  1Y01 A;  3SOL A;  3AXJ A;  4ZOL E;  4CI1 B;  4U72 A;  1T7S A;  5IWA T;  4YXD A;  2H7V C;  4DR2 T;  4F8H A;  2NWB A;  1W09 A;  5HXE A;  1SE7 A;  2A2F X;  4DR5 T;  4A5X A;  2LKG A;  1MIW A;  2XQ7 A;  2XAJ B;  3F57 A;  2DHR A;  1HG5 A;  2DLR A;  3NRY A;  2XSB A;  2EHO C;  1G73 A;  5L3C B;  2LHR A;  5DQW A;  1XWM A;  2BBH A;  3A7M A;  1T98 A;  3EAM A;  3P4W A;  4LF9 T;  5ABF B;  4CXY A;  5LA6 E;  3QC9 A;  3NBX X;  4FI5 A;  2QA7 A;  2OA5 A;  2YN6 A;  3RQW A;  3AA6 B;  2YK0 A;  3PJA A;  2V5D A;  1T72 A;  4EGW A;  2Q9Q A;  3AE2 A;  1WYB A;  3X1D A;  3LG7 A;  1HNZ T;  4YJ3 E;  5IHY A;  5IYZ E;  4PK4 A;  3ZC0 A;  4E7Z A;  3RIU C;  2HHH T;  2UXN B;  3AE3 A;  4NIQ A;  4YLH A;  1MIV A;  3QOF A;  3CVR A;  3O1H A;  2NTX A;  4U74 A;  1IJ6 A;  1YW0 A;  3PUY F;  2YDQ A;  2J4G A;  4ADZ A;  5AQN B;  4Q25 A;  3AEG A;  5HCJ A;  5DAB A;  5HEG A;  3ONL C;  2J62 A;  5C2T A;  3FZL B;  2VKD A;  3UU3 A;  3C4W A;  5LXT E;  3CQG B;  1BR2 A;  2W62 A;  2CHO A;  3VU7 H;  3CKD A;  3CPZ A;  2XQY A;  5HYA A;  4JI4 T;  3RI5 A;  4CN4 A;  4YY3 T;  3T1H T;  1FMV A;  3KIN B;  4LMJ A;  3CQC B;  3VKH A;  1MND A;  2RP4 A;  2LKH A;  4IST A;  4AKL A;  3KVB A;  4UR9 A;  2CE7 A;  5LMN T;  1XZY A;  4DMV A;  4LFB T;  4H9S E;  1LRZ A;  4P0B A;  5FXZ A;  2IC9 A;  4ANJ A;  2WB5 A;  2X67 A;  4AQF C;  5CA1 E;  2JMK A;  2XAS B;  4IE0 A;  3GWH A;  4JYA T;  4QH1 A;  4XZC A;  4YHH T;  2W66 A;  4A56 A;  2L8K A;  3RRW A;  3CX7 B;  3UFE A;  3AVR A;  4N78 D;  2D5U A;  4PFO A;  2CRB A;  4B3M T;  1XMO T;  3H3A A;  4H63 V;  3W15 B;  4ILA A;  1N36 T;  5FVL A;  3L39 A;  4NXN T;  2X9Y A;  5CJ5 A;  5F3J A;  2B76 A;  2VAS A;  1OWA A;  2KWI B;  3ZMT B;  5AQQ B;  2D9D A;  1NAF A;  2V7K A;  4HFC A;  2CXL A;  2D0T A;  5AQH B;  5FY1 A;  4TX5 A;  2X51 A;  3E22 E;  3AVS A;  2UUB T;  1KNP A;  3FBZ A;  2WY2 A;  5L2L A;  2PG8 A;  2ZM0 A;  3AA0 B;  2ZM8 A;  3ZMV B;  3IEE A;  4DV6 T;  3AAA B;  2ZM2 A;  4UVC B;  3RF1 A;  4UEL A;  1ZHC A;  3OBV E;  3PU3 A;  2A3D A;  2WZH A;  1J5W A;  1VRB A;  2XAQ B;  3BQK A;  2XTL A;  4OYK A;  2V8S V;  4DVD A;  3NKZ A;  4PAG A;  2G0U A;  2WS3 A;  3UU4 A;  2DI4 A;  2BKO A;  2E9X B;  3A5X A;  4E7S A;  3OYX A;  1OXZ A;  1WRD A;  4CZZ B;  3UUX B;  2CBJ A;  2V6Y A;  1HX8 A;  4A97 A;  4GYR A;  2K3W A;  4XAX B;  1OED E;  4PW8 A;  3AED A;  4KHP T;  3AAE B;  3ZT7 A;  2V7L A;  1SUM B;  3JC6 D;  5AQG B;  3S4U A;  4JEU B;  2LOS A;  3SFE A;  1HNW T;  4HTE A;  1UGO A;  2RPA A;  4AQG A;  5LGU B;  3N9P A;  1D1C A;  4X66 T;  3IA3 A;  2LM2 A;  2N1G A;  2QVA A;  4MHC A;  5EK3 A;  3FZM B;  4PJJ A;  4H9P C;  2KLQ A;  3EUH A;  2XQ3 A;  2X68 A;  3LBX B;  2H3R A;  4YFS A;  4PFP A;  3PUG A;  3R84 B;  3MZK B;  2LT3 A;  2KMF A;  3J9X 1;  2UU9 T;  4JI8 T;  3GA8 A;  5FMN A;  2VVN A;  3HKD E;  3AA1 B;  1WFD A;  3AE7 A;  4HE8 A;  3WAK A;  5JDM A;  1Z8U A;  4UVB B;  3SFD A;  4EB6 E;  2NP9 A;  4HFI A;  5F8P A;  5IUX A;  4AIU A;  5DJQ C;  1EZ3 A;  2XZE A;  1XMQ T;  2V26 A;  3B57 A;  2UUC T;  4IIJ E;  4UV9 B;  5AQS B;  4X20 E;  3GN5 B;  2I6H A;  1BR0 A;  5HWY A; 
#chains in the Genus database with same CATH homology
 4U72 A;  1U5P A;  3RRC A;  3VKG A;  2JMH A;  1IAP A;  2D2S A;  3TKL B;  4J2C A;  3I9W A;  4WW0 A;  3O1I A;  2MTQ A;  2D0U A;  4OFZ A;  4QXB B;  1HCI A;  2H7V C;  2X0L B;  1H7C A;  3N9M A;  3O9X A;  1YKE B;  1HF8 A;  2J1D G;  5FNV E;  2QGS A;  2K9A A;  4V1A v;  2NWB A;  2CLY B;  2P9B A;  4QKN A;  5HXE A;  1LVK A;  2WSS V;  2A2F X;  4B6X A;  2X66 A;  3P8C D;  3UUL A;  4GK5 E;  2IW5 B;  2ZMA A;  3N2G E;  1MIW A;  4TV8 E;  2XAJ B;  3F57 A;  3LFM A;  2DHR A;  4AKR B;  1MNE A;  2CCQ A;  2KIN B;  1HG5 A;  2VB6 A;  2PJQ A;  2C5J A;  4KBM B;  1YKH B;  2DLR A;  3NRY A;  5L3E B;  3ZJ2 A;  5JRC B;  4G2A A;  4CI3 B;  4KMC A;  3HKC E;  3KVA A;  4G63 A;  2EHO C;  1G73 A;  5L3C B;  1KK7 A;  2LHR A;  5DQW A;  4GIW A;  2EHO A;  2BVL A;  3ZEF B;  1WLX A;  4AXP A;  3KV6 A;  4FJO A;  1US7 B;  5HXC A;  2E9X D;  1T98 A;  2XUE A;  3FXD B;  3AB3 B;  4WBN E;  4ZS2 A;  5FY7 A;  3O1J A;  4KUM B;  4O4L E;  2N9D A;  2ACX A;  2LSI A;  1O3X A;  3LK2 B;  4CXY A;  5LA6 E;  3QC9 A;  2WM9 A;  3NBX X;  4FI5 A;  4O4I E;  2QA7 A;  4P0A A;  1D0Z A;  1SHZ C;  2OA5 A;  2CMR A;  3RKO A;  3T8O A;  1D1B A;  3AA6 B;  2X9W A;  2CEA A;  2YU1 A;  2IC6 A;  1LKX A;  2YK0 A;  1CUN A;  2KWH A;  4EZH A;  1G8X A;  2BDE A;  2Q9Q A;  4IE6 A;  1WYB A;  3LG7 A;  4YJ3 E;  5IHY A;  1UX5 A;  4L9I A;  3V5U A;  3ZYM A;  5C8Y E;  3AAI A;  4UEM A;  5IYZ E;  4PK4 A;  3ZC0 A;  3DJB A;  3RYC E;  5EK4 A;  4BJN A;  4IE7 A;  4E7Z A;  1S94 A;  2PBI A;  2LE8 A;  4PK5 A;  4ASK A;  1MMG A;  2MOZ A;  2UXN B;  4EYU A;  4YLH A;  1MIV A;  1WYC A;  2HPJ A;  4I55 E;  3CVR A;  3O1H A;  4YHJ A;  2WWU A;  3EDV A;  3K3Q C;  3LK3 B;  4JLE A;  2JPF A;  3FXE B;  5ETW A;  4P09 A;  2NTX A;  4U74 A;  4QX8 B;  4MLK A;  1IJ6 A;  1YW0 A;  4MAL A;  3IBP A;  3EVY A;  1FEW A;  3L09 A;  5L3F B;  4ADZ A;  3DP7 A;  5HXS A;  4I50 E;  2CM0 A;  1BR1 A;  3V5S A;  2W00 A;  2Q9Q B;  2E8I A;  5DAB A;  2NW8 A;  4HKA A;  4UV8 B;  2NW9 A;  2E9X A;  1IZN B;  3UUN A;  3I0Q A;  3ZCJ A;  2VKD A;  3VHL A;  3C4W A;  4MFR A;  5LXT E;  4AKG A;  2YIN A;  3CQG B;  3WI3 A;  3K3O A;  1BR2 A;  3Q2M A;  2X9H A;  3I9Y A;  2W62 A;  4UF0 B;  4HGA A;  5LGN B;  4H9R C;  4UVA B;  3QK6 A;  4IGU A;  2C5K T;  5BMV E;  4GOU A;  3VU7 H;  2CWY A;  2LJL A;  3CKD A;  1HFA A;  3CPZ A;  2B1E A;  2DWK A;  2ODU A;  2XQY A;  3F2E A;  3L3P A;  3O4X E;  5HYA A;  5L3G B;  2LHN A;  3OJA A;  1D0Y A;  2WMN A;  3AA7 B;  2KXP B;  3KV5 A;  1MMN A;  4ISS A;  1FMV A;  5L3B B;  3KIN B;  4IDZ A;  3CQC B;  3VKH A;  4TUY E;  3R6N A;  1MND A;  2RP4 A;  4Z8X A;  2NTY A;  4IST A;  4AKL A;  3BK9 A;  3PUA A;  3U78 A;  3KVB A;  2I59 A;  4ZI2 D;  2CE7 A;  5JH7 E;  3PTR B;  1D1A A;  1ZKE A;  4DMV A;  4O2B E;  4XBF B;  3IF8 B;  1LRZ A;  4H9S E;  5H6Q B;  5JRE A;  2C0S A;  5M4Y A;  2YEV C;  4HN9 A;  4H9N C;  3HR0 A;  4P0B A;  2CA5 A;  1UX4 A;  3FBL A;  3B13 A;  3BQL A;  4IE4 A;  5FXZ A;  4CI2 B;  5EZY E;  1Z0P A;  2HH7 A;  3MA9 A;  2IC9 A;  5TAO A;  2LM9 A;  3KBU A;  4WNK A;  4ANJ A;  2K5B B;  3FB2 A;  2X67 A;  4AQF C;  3ZPO A;  5GON E;  5FXX A;  5CA1 E;  3ZC1 A;  4HFV A;  4AQF A;  2JMK A;  2XAS B;  3J7Y q;  3SS1 A;  2SPC A;  2ZLY A;  5FP3 A;  5J2T E;  2WMO A;  4IE0 A;  3GWH A;  3ZYK A;  2Y6X A;  4XZC A;  3BQI A;  4EOZ B;  4A56 A;  2L8K A;  3C64 A;  3KV9 A;  3LBX A;  3RRW A;  3CX7 B;  4F6R C;  3OKQ A;  3UFE A;  2VWA A;  2L3L A;  3ANW A;  3UUM A;  5JDG A;  1UCU A;  5HXR A;  3AVR A;  3OYZ A;  3MJX A;  4DBQ A;  4N78 D;  5KDM C;  4L5G A;  2LEH A;  3N2O A;  4O4H E;  2D5U A;  4PFO A;  2VK9 A;  4H9Q C;  3K3N A;  3H3A A;  3PUQ A;  3ESL A;  4H63 V;  3W15 B;  4ERR A;  2YU2 A;  3ZN0 B;  2HPL A;  4X1Y E;  5JQG E;  4C91 A;  4ZI2 C;  2KT9 A;  3H37 A;  5FXV A;  3D0T A;  3RH3 A;  2KND A;  2V7J A;  5LJM A;  2X9Y A;  3RYI E;  3N9N A;  2GK9 A;  3E0Z A;  3Q5W A;  5F3J A;  4TN7 B;  3F31 A;  2MYS A;  4PK6 A;  2VKH A;  4CXX A;  3KDS E;  4KP3 C;  2EHO B;  4TV9 E;  4ZI3 D;  2VAS A;  3FHN A;  5FY0 A;  1HG2 A;  4GYS A;  4EIW A;  4DO0 A;  2KZ7 B;  2W0G A;  1X79 A;  1OWA A;  1QUU A;  2C5I T;  4CXW A;  5LHH B;  5JR9 C;  2KWI B;  3ZMT B;  3PE0 A;  2VL8 A;  1NAF A;  5KMG P;  2V7K A;  2CXL A;  3GN5 A;  2RA1 A;  3C51 A;  3SRZ A;  2PFV A;  4OK0 A;  2D0T A;  4H9O C;  5FY1 A;  4TX5 A;  2X51 A;  3E22 E;  4UXN B;  4DND A;  3HKE E;  3AVS A;  4X1K E;  5A1L A;  3CX8 B;  3C4Z A;  3Q9D A;  3FBZ A;  2XAG B;  5L2L A;  5E0O A;  5J1G A;  2PG8 A;  1S35 A;  2DCF A;  2ZM0 A;  3AA0 B;  3ZYL A;  2ZM8 A;  1HTJ F;  3ZMS B;  4ZHQ E;  3ZMV B;  4EXT A;  3IEE A;  1MIY A;  1WR6 A;  3MXZ A;  4UIG A;  5CA0 E;  3HL6 A;  3N9Q A;  3AAA B;  2CXD A;  2CLY C;  5FYM A;  2ZM2 A;  2X9X A;  4UVC B;  5FXW A;  2LSK A;  3N9L A;  4UEL A;  5HAX A;  2VKO A;  4WBO A;  1B7T A;  4BAY B;  4QWN B;  4JUY A;  1ZHC A;  4ILU A;  3RYH E;  2JJ9 A;  2N2N A;  3WAJ A;  3PDY A;  2V7I A;  4L0R A;  4DBR A;  3OBV E;  3PU3 A;  2A3D A;  5LGT B;  3K8P C;  1VRB A;  1MMA A;  3QUJ A;  2Y48 B;  3P7I A;  2XAQ B;  3ZJ1 A;  3BQK A;  2XTL A;  4OYK A;  4DVD A;  5JDQ A;  2BVM A;  4PAG A;  3NZP A;  4EZ4 A;  4ZI3 C;  3E08 A;  1AJ3 A;  1LVF A;  2G0U A;  2DI4 A;  5JRC A;  2XAH B;  4IE5 A;  5LYJ E;  4C90 A;  2CWO A;  2ODV A;  3PUR A;  3LJC A;  3EDU A;  2E9X B;  3A5X A;  5CB4 E;  4E7S A;  3OYX A;  1OXZ A;  3C50 A;  2ES0 A;  4AKI A;  2Q9Q D;  1WRD A;  4TZ4 C;  4CZZ B;  2W61 A;  3UUX B;  2LOP A;  2A72 A;  4I4T E;  4JEH B;  3HKB E;  3PU8 A;  5LHG B;  1HX8 A;  4O8S A;  4K0U A;  4QHO A;  4GYR A;  3N2K E;  1IJ5 A;  3PUS A;  4QXH B;  3ZMZ B;  4MBQ A;  1KNZ A;  1QSD A;  4XAX B;  5JDF A;  3UTK A;  5LBQ B;  4PW8 A;  2DWG A;  5LP6 E;  3AAE B;  1FIO A;  2LSG A;  5DQV A;  1Y64 B;  2CXF A;  1HS7 A;  2W63 A;  3MAC A;  1BR4 A;  1VOM A;  4ZS3 A;  3RYF E;  2V7L A;  4I43 B;  2MBG A;  5EK2 A;  4AI6 A;  3JC6 D;  4OYJ A;  4AKH A;  5HWX A;  4NUU A;  3S4U A;  4JEU B;  5JVD E;  2LOS A;  3ZLI A;  4HTE A;  4O4J E;  2L9Q A;  1FMW A;  4IHJ E;  5AFU L;  3KV4 A;  2LSY A;  3HA4 A;  4AQG A;  4O2A E;  2IAK A;  5LGU B;  2XHE B;  3N9P A;  1D1C A;  2VKJ A;  2Y8D A;  3I1A A;  4CQI A;  3ZN1 B;  2UXX B;  2N1G A;  3DTO A;  3RPU A;  5LG4 A;  3C98 B;  4MHC A;  3MKD A;  3IHR A;  4EYY R;  5LBM A;  5EK3 A;  2JRK A;  3UT5 E;  5ADX L;  3I0O A;  4PJJ A;  4H9P C;  2K48 A;  2KLQ A;  3NRX A;  3U3I A;  3EUH A;  3RX6 A;  2WBL A;  2Q9Q C;  3CQX C;  2V1D B;  2X68 A;  3RC3 A;  4BJM A;  3LBX B;  2H3R A;  1SA0 E;  5LCY A;  1NWM X;  1U4Q A;  2K24 A;  3KFW X;  3N9O A;  5LOV E;  2NW7 A;  4YFS A;  4PNI A;  4PFP A;  3ANW B;  3C4X A;  4H63 H;  2DNX A;  3NZQ A;  3PUG A;  4DMW A;  2BZB A;  4HEA A;  4EAH A;  5JR9 A;  1D0X A;  2WAU A;  3R84 B;  3MZK B;  3CML A;  3ZCI A;  1V9D A;  4BA9 A;  5LJN A;  2LT3 A;  4NUV A;  2KMF A;  3J9X 1;  4UF0 A;  1ZEE A;  5J2U E;  4PJL A;  3KBT A;  2LSJ A;  3SWH A;  3ONX A;  2XAF B;  4YJ2 E;  2NOX A;  3GA8 A;  5FMN A;  3HKD E;  3AA1 B;  3JC6 C;  4GK0 E;  4M1P A;  4HE8 A;  3WAK A;  5JDN A;  2JQQ A;  4PJM A;  5JDM A;  3ETV A;  4UVB B;  5L3D B;  3CWZ B;  2H7O A;  4EB6 E;  2M67 A;  2NP9 A;  4ZI7 E;  5F8P A;  5JDL A;  3CX6 B;  3GMI A;  2Z6E A;  5LHI B;  5LNK A;  5DJQ C;  5H6R B;  5HXH A;  1EZ3 A;  3MK7 C;  5KX5 E;  1MMD A;  4X1I E;  4PJN A;  3HI2 A;  3ZMU B;  3N5L A;  3Q5X A;  4QXC B;  2E9X C;  2V26 A;  3B57 A;  3M65 A;  2V7M A;  4IIJ E;  3RC8 A;  1ZV4 X;  5JDH A;  2EHO D;  3LK4 2;  4QX7 B;  4UV9 B;  1E1H B;  3ETU A;  5JR9 B;  1YD8 G;  4X20 E;  3GN5 B;  4OHF A;  1BR0 A;  3SOL A;  4ZOL E;  4CI1 B;  5HWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...