2C5KT

N-terminal domain of tlg1 complexed with n-terminus of vps51
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
89
Chain Sequence
EDPFQQVVKDTKEQLNRINNYITRHNTADDQEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFDRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 51
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 89
sequence length 91
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5kT00
2KWHA 1IJ6A 2X9XA 3FXEB 3L3PA 2X9WA 4DNDA 1H7CA 2K48A 2XTLA 2C5IT 3QUJA 2C5JA 1LVFA 3S4UA 3FXDB 2CA5A 3CVRA 2MBGA 3MXZA 4J2CA 2KWIB 3P7IA 4B6XA 1IJ5A 3N5LA 2X9YA 1LRZA 2C5KT 1QSDA 4L0RA 3TKLB 3CKDA 2IC6A 4CQIA 1Z0PA 2IC9A 4EYYR 1ZKEA 3QK6A 4FI5A 2G0UA
chains in the Genus database with same CATH superfamily
3ZSTA 2V7JA 5H6QB 4JI0T 4YT0A 4TWDA 3LJCA 2CHNA 5C8YE 5KX5E 1J5ET 1XMOT 2J62A 4EOZB 2WZHA 3AA0B 4B3MT 2KINB 3O1JA 4ZZCA 4FI5A 3O4XE 5HEJA 5JREA 2VQFT 1LVKA 1BR2A 2GK9A 4EIWA 5JQGE 4KUMB 3SS1A 1HF8A 4U7IA 5AQSB 4KHPT 4U31A 2BG9E 2V6YB 2JQHA 3LFMA 2RA1A 4P0AA 3C4XA 3ONJA 2LSGA 4DR5T 4AKHA 1CUNA 2DHRA 3MXZA 4GYRA 4LF4T 1KK7A 2QVAA 2XQ5A 2WDRA 4ZS3A 2YINA 5L3BB 4OK0A 2G0UA 3CQCB 5DQVA 1G73A 1U5PA 5L3CB 4YTPA 2X67A 2YOEA 5LBMA 5FXVA 2LKGA 3RRCA 2XQ8A 3PUWF 3BQKA 4DV0T 4OYKA 3K3OA 4PK4A 5LXTE 3NRYA 2HPLA 3AEEA 4LFAT 2NP9A 4JLEA 3TLVA 3UU6A 5F3JA 3S4UA 4IHJE 2IHR1 4N78D 2BG9C 3RC8A 4QXBB 4IE4A 1WYCA 2OV9A 3ZYLA 3P4WA 4JYAT 3ONLC 4LFCT 2V6YA 3LK3B 4DUYT 3KFWX 3ZN1B 1HNZT 4YLHA 3CIRA 2WAUA 1D1BA 4AQYT 4CI3B 3ZMTB 4CQIA 5DQWA 1N32T 4HTEA 3ZT5A 5FXXA 3L3PA 3ETUA 5FP3A 5A1LA 4WBOA 1X9BA 3GA8A 3C4WA 4H9QC 3QC9A 1UUSA 2X9HA 1HCIA 3R6NA 1US7B 4DV4T 2V7IA 2XSBA 3IHRA 1Y64B 2D2SA 3N9PA 3FBLA 4MLKA 3AXJB 3OKQA 4EZ4A 5L2LA 2LSYA 2D9DA 2W4XA 1OEDE 2PG8A 1WYBA 4AQFC 5J0ZA 3Q9DA 2UUAT 4CXYA 3UU4A 5CGMA 5HXEA 4H9RC 4FJOA 5C2TA 4C91A 5LCYA 3RYCE 3HKCE 2YN6A 4IE0A 3VKHA 2HN2A 3PJAA 2E2AA 3RI5A 4AQGA 3UT5E 3FZHB 2IC6A 2Y6XA 3BK9A 5LHGB 3O9XA 2WY2A 5LYJE 5JDMA 4PK5A 2CEAA 1MMDA 2WMOA 3FZMB 3ZSSA 2XJ7A 2MBGA 4CI2B 2CM0A 2DNXA 3AE3A 2YU1A 2W63A 3GN5B 5F8PA 2V6XA 3OTOT 4IDZA 4ASKA 4MBQA 1YKHB 5FL1A 3LK2B 2QYWA 3UQ4A 4F8HA 3ZCJA 2CA5A 3AXJA 2KWIB 2X0HA 2EHOB 4CXXA 3JADA 3JC6D 4ZI7E 2LLYA 1KEYA 4NIQA 2X68A 3RIUA 2NW7A 2WQYA 4TN7B 1E1HB 2Z6EA 3TLWA 2X9WA 4ANJA 4HWFA 1N33T 3UQ7A 2YEVC 3IA3A 5L4EA 3C64A 4AXPA 3RKOA 2LE8A 3VU7H 1QLBA 4EB6E 1JNZA 4K0KT 2FJDA 3ANWA 2ZM6T 2UUBT 4A56A 3L39A 3SFDA 2J47A 4PAGA 5LGTB 4ZI3D 3KBTA 4LMJA 2DLRA 3MZKB 3DJBA 5FKYA 1E7PA 1YW0A 1I6ZA 3MACA 1XWMA 4QX7B 4BAYB 4L9IA 4KX6A 2EHOA 4ISSA 2BS4A 2E5LT 4EXTA 2XSAA 2YKSA 4G2AA 4AIUA 2IIUA 4GK0E 4YXDA 1IAPA 2WWVA 3UFEA 4DV6T 2XPKA 3RYFE 3AE7A 1E2AA 4CN4A 4EZHA 1M7KA 2CPTA 4KI0F 4EEBA 2BKPA 4OYJA 2H88A 1L0VA 5IWAT 4ADZA 3U78A 3VHLA 4B3TT 4IE7A 1J1JA 2K3WA 4IDOA 2N1GA 3KV9A 3ZPOA 2W2UA 4OX9T 1Z0PA 4YJ2E 4EYYR 4HWHA 1W9RA 3NBXX 3NZQA 2D0TA 3PUVF 4GOUA 5AQUB 4P0BA 1IBKT 5JDHA 3T1YT 2H7OA 4X1IE 4Z8XA 1MIVA 3Q5EA 2CXDA 4YY3T 2V7MA 2C0SA 3Q2MA 3CWZB 2KWHA 2XQ3A 5AQFB 4C90A 5EK3A 3CPZA 2CLYB 4DV7T 1XNRT 1W0BA 2XAHB 4CXWA 5JR9B 2RPAA 2SPCA 2AE9A 3FZLB 5EK2A 5AQHB 4L5GA 3TLSA 3HKBE 4AQFA 3K3QC 5JVDE 5LG3A 2V7LA 3LBXB 1MIYA 3HA4A 1HNXT 4EGWA 4CI1B 4WZXA 5H6RB 5HEUA 4X62T 5L3GB 5KMGP 1FJGT 2V7KA 3KBUA 4X66T 2WMNA 4AKIA 1UCUA 3EVYA 3N9LA 4JI5T 5AQKB 2WB5A 5LHIB 2JIWA 1ZKEA 2FJAA 4UV9B 2BS2A 1HTJF 3ZEFB 3PUYF 5HXSA 1D1AA 3B5MA 1J5WA 3FZFB 5FY1A 4AKLA 2K9AA 4A98A 3P4PA 4L0RA 5BMVE 2VB6A 4DVDA 2I0MA 4JI4T 1G8XA 4TNWA 2AXDS 3ZJ1A 4ISTA 3RIUC 4QKNA 2B76A 2A9UA 3AE4A 3SRZA 2LSIA 3MA9A 3AE2A 5IHYA 2M6IA 2IUBA 4IE5A 4B6XA 1I94T 2MAWA 2W61A 1Z8UA 4UF0B 3LBXA 2NWBA 4B3RT 3O1IA 2XTLA 1UK5A 3PUQA 2WWUA 3L09A 2MYSA 3FB2A 4EAHA 2VL0A 3AEBA 5HXRA 2LEHA 1FEWA 4E7SA 4YSZA 3VKGA 3LG7A 4Z90A 3VR9A 2L9QA 1YQ3A 2BVLA 2VQET 3SOLA 3AE9A 3K8PC 3TLUA 4P1NA 3ZYKA 2V1DB 4NPPA 5HWXA 2IDOB 3JC6C 5JDGA 2X0LB 4CN6A 5HEOA 2XAFB 2EHOC 5J1GA 5ADXL 4IE6A 2UXXB 3R84B 2HHHT 4JI2T 2OLTA 1MNDA 5TAOA 3IEEA 2HPJA 3CX6B 4H63H 2P9BA 2FJEA 3EI0A 3PUZF 3Q5WA 1HFAA 3I0OA 4DNDA 4UF0A 2J4GA 3NVOA 4TV8E 4J2CA 3AB3B 4BJMA 5ABFB 3L8RA 4NXNT 1B7TA 3K3NA 1ZP0A 4ZI2D 5F5WA 2ODUA 2DWKA 5JRCB 5LP6E 2JQ9A 5HCMA 3GWHA 1V9DA 3I0QA 4IL4A 4O4LE 5JDLA 2K24A 4ERRA 2LKHA 2XY8B 2FBWA 3ZJ2A 3RF1A 4PJMA 2HH7A 2VVNA 5AQLB 3UUXB 2BKNA 4PFPA 2XAQB 4ILAA 1EZ3A 5JDFA 2LRLA 3NRXA 4H9NC 2ODVA 3TKLB 5AQGB 1WCRA 2XAJB 2CMRA 2JPFA 3UU3A 5DABA 2D5UA 4TWHA 2K48A 1WR6A 3VR8A 2LRKA 5ETWA 3FXDB 3AEFA 5HEHA 2BDEA 4WBNE 4JI6T 3DTOA 4H9PC 2LOPA 1BR1A 3CQGB 5IYZE 4IDQA 5M4YA 5ABFA 3I9YA 1T8BA 3Q5DA 2Q9QB 4WNKA 1H7CA 2Y48B 4AI6A 2R6GF 4UVBB 2Q9QD 2W0GA 3AA1B 2FJBA 2LOSA 1XNQT 2PFVA 2MPKA 3ZKRA 2YDRA 2WS3A 2KSRA 3FHNA 2MTQA 2KMFA 3RYIE 5FY0A 1AJ3A 4U2YA 2KLQA 3IBPA 1U4QA 3N5LA 2W62A 5CA0E 4DV2T 4A5XA 2LT3A 2CWOA 4DUZT 5AQRB 3RYHE 5FMNA 2CLYC 4DBQA 4CN1A 1SE7A 2CBJA 3AEAA 1D1CA 1LVFA 3E22E 2CXLA 5FXZA 1W0AA 4U2ZA 4XZCA 4QHOA 4HKAA 1ZOYA 4DMWA 2Q9QA 2YDSA 3N9QA 3QUJA 1UX4A 5HAXA 3CVRA 1T98A 4IREA 5HYAA 3PUSA 1MIWA 4XAXB 3O1HA 3AE1A 4YHHT 2XQ9A 5LOVE 3ZC1A 2WDQA 4Z91A 1FMWA 4H63V 3ESLA 3PU8A 5C3JA 2ACXA 5HXCA 4LF9T 4HGAA 2KXPB 5LMNT 5AQQB 3ONXA 2CXFA 3N2OA 2XHEB 3UU8A 4COFA 5FY7A 2QGSA 3GN5A 1T7SA 5CJ5A 1KFYA 3UUBA 4PFOA 1SA0E 2JJ9A 4LMKA 2W67A 3AA7B 3T1HT 4H9OC 5LHHB 5AQJB 2CCQA 2X9YA 5L47A 2Y8DA 1HG2A 5L3EB 2L8KA 2WDVA 4HFBA 3QK6A 5CB4E 5AFUL 2NR4A 4JV5T 4B3ST 3UULA 5LA6E 3KV6A 2VKDA 3OYXA 4DV5T 3F31A 2X66A 3WI3A 4I55E 5DJQC 2XQYA 3CMLA 2BS3A 4DMVA 4O4IE 3RLFF 1YD8G 3AE8A 4G63A 2WU2A 3OBVE 4CZZB 4YSXA 4X20E 4O4HE 5GONE 3N2KE 3SWHA 3F57A 2FUPA 5LGUB 3P50A 4TWFA 3GMIA 2VK9A 5LMUT 4K0UA 5FL0A 4PNIA 3NKZA 5CFBA 5JTGA 2M67A 2PJQA 3JAEA 4DO0A 1XZYA 4LF8T 2CBIA 3CX7B 4GIWA 2PBIA 3N9MA 5AQTB 4BJNA 2HN1A 2LM2A 1ZV4X 4ZHQE 3UU5A 3C50A 4X65T 4JI7T 4O2AE 5AQMB 4YSYA 4NXMT 2V26A 2WBLA 5ABHA 3ZC0A 4ZI2C 4X1KE 1IJ6A 1YQ4A 4GKKT 4JI1T 4DR7T 5L4HA 3C98B 4HN9A 1OEDB 1VCTA 4IDNA 2XASB 1M62A 2I59A 2I6HA 3KV5A 3OVUA 4JI3T 3A5XA 4HFEA 3KV4A 3AECA 3UFGA 5J2TE 3N2GE 2JMHA 1S35A 4QX8B 3X1DA 2VL8A 4ZOLE 3RKGA 3A7MA 4M1PA 4H9SE 4YFSA 3EHZA 2UXDT 3LSVA 3RRWA 4WW0A 2XAGB 2XUEA 5HXHA 3PUXF 4LF7T 5AQNB 3H37A 1O3XA 4HWCA 3EABA 3G06A 2N2NA 2VURA 1QUUA 3P4SA 5JR9A 2A72A 3AEDA 2Q9QC 2BKOA 2J1DG 4WYVA 2WM9A 3RIFA 4KHZF 2ZM0A 3PURA 3LDQB 4DR6T 1MMAA 3RQUA 4PJJA 3T8OA 4MFRA 2BZBA 3AE6A 4HFVA 3ZT6A 3VRAA 1HR0T 1VCSA 2LSKA 5LJNA 4ILCA 3J7Yq 1N36T 4LF6T 3RX6A 4DV1T 3K1SA 4U72A 3ZMVB 4O2BE 5FXWA 1UX5A 1YKEB 4UVCB 4OFZA 1VOMA 1Y01A 4PJLA 5FVKA 2KNDA 1IBLT 3BQLA 2WCAA 1KNRA 3ZMSB 4IT4A 4JEUB 4BA9A 1UURA 2ES0A 3J9X1 2VKOA 3C4ZA 2VASA 5L3DB 2LHNA 4ZS2A 2N9DA 4EEDA 4EV6A 2H89A 5AQPB 3E0ZA 2MOZA 1NWMX 1YXRA 2ZM2A 2YK0A 1HS7A 1MMGA 3MJXA 3HI2A 2K5BB 4TV9E 3PUGA 3CX8B 3UTKA 2KZ7B 3FBZA 4HWDA 1HX8A 2IC9A 3M65A 3BQIA 3N9OA 3W15B 4HWIB 3U3IA 4ZI3C 2XQ7A 2LHRA 2X0YA 1WFDA 4I43B 5BR8T 4ZEYA 3MK7C 1KF6A 4TUYE 3AAAB 3ZLIA 1BR4A 4EYUA 4JUYA 2BBJA 2E9XB 3ZMZB 3RIAA 1SHZC 2UU9T 4AKRB 4HFHA 5KXJA 2XQAA 2E9XD 3UUMA 1XMQT 1LRZA 2C5KT 4KP3C 4DV3T 3H3MA 4ZXLA 3ZMUB 4UVAB 2YDQA 3ZYMA 2RP4A 3KVBA 2QA7A 3I9WA 5KDMC 4MHCA 3PV0F 3AEGA 3ETVA 5LGNB 4DIDB 1R8IA 2X51A 1VRBA 1GQEA 2NTXA 4V1Av 4QH1A 4JEHB 3H3AA 3CK6A 3FXEB 1OWAA 4KMCA 1S94A 3JCFA 3I1AA 2C5IT 4DR4T 4DBRA 2L3LA 5E0OA 3KINB 1QSDA 5JRCA 4DR3T 3CQXC 4PJNA 2XQ6A 5LBQB 3V5UA 4AISA 3NWIA 2XM2A 2X9XA 2A2FX 4IIJE 3IF8B 2E9XA 2W00A 3JAFA 2LSJA 3WAKA 4JI8T 1CHUA 5AQVB 3CKDA 3PUAA 3PU3A 2ZLYA 1XDPA 1HX1B 3RPUA 1N34T 1X79A 3ANWB 3ABVA 2D0UA 2XQ4A 5JR9C 4UEMA 4KBMB 4HEAA 4X5TA 2JQQA 2XM1A 3FZKB 1HNWT 4IGUA 1MNEA 5JH7E 5LB7B 1SUMB 1OEDC 3LK42 2VWAA 1IZNB 3QNUA 2A3DA 2ZMAA 3HL6A 2V5DA 4F6RC 4ZZBA 4X1YE 4DR2T 3WAJA 1IJ5A 3HKEE 2KT9A 3SFEA 3QOFA 4DR1T 1OXZA 4YTMA 1KNPA 2XZEA 2EHOD 4QH5A 5LJMA 5ABEA 5IUXA 2ZM8A 2NW9A 3B57A 1NAFA 3EDVA 2UUCT 1WR0A 1ZHCA 3MKDA 2M6BA 3E08A 2BG9B 2CRBA 3RHWA 2CWYA 3AA6B 2DI4A 1D0YA 3PTRB 4O8SA 1UGOA 2V5CA 5JDQA 3QB5K 3N9NA 4U33A 3AAEB 1D0XA 1XDOA 4IL9A 4UELA 5HWYA 4UR9A 4PW8A 1BR0A 2ACZA 3ZN0B 2W66A 2JQKA 2UXBT 4YHJA 4U7YA 1FIOA 4NUUA 1WLXA 2WU5A 2DWGA 3PDYA 2OA5A 2PTFA 3HKDE 5AQOB 2H7VC 5FNVE 1JNRA 3QB5A 3PE0A 2IW5B 3ZT7A 3DP7A 3B13A 4YTNA 4GK5E 5HEGA 1NEKA 4LMLA 3OYZA 4ILBA 1FMVA 2BBHA 2BG9A 5FVLA 1HG5A 5LNKA 2VKHA 2LJLA 3OPCA 2UXCT 1LKXA 2WP9A 4UXNB 1WRDA 4JBWF 1NENA 2VVSA 3OJAA 3RQWA 2H3RA 4XBFB 2BVMA 3UUNA 2WSSV 2V8SV 4QH4A 5AQIB 4NUVA 4LF5T 1W09A 2IAKA 3P4QA 3PJAJ 1KNZA 4TZ4C 4QXHB 4TX5A 5J2UE 5EK4A 5L3FB 3EAMA 4UIGA 2UXNB 2DL1A 4YJ3E 2IMLA 1ZEEA 4UV8B 3TLTA 1D0ZA 4HE8A 4IDPA 3NZPA 3AVRA 2VKJA 5LG4A 2WZIA 5CA1E 4P09A 3C51A 3AAIA 2E8IA 1DU2A 4ILUA 2C5JA 2JMKA 2E9XC 2F4VT 5HCJA 4O4JE 4X64T 2CE7A 2NOXA 2CHOA 5JDNA 4TNVA 2YU2A 1IBMT 3RGLA 4PK6A 4A97A 4I4TE 3Q5XA 3F2EA 3RH3A 4MALA 3EUHA 1T72A 3RC3A 4Q25A 4QWNB 4QXCB 3AVSA 5ABGA 4LFBT 3VRBA 3A8YC 3KDSE 4E7ZA 3HR0A 4AKGA 3P4RA 3P8CD 4HFIA 2LM9A 4I0UA 3KVAA 2E5VA 5FYMA 4OHFA 3ZCIA 4I50E 2NTYA 2B1EA 4GKJT 5EZYE 3AE5A 3M3ZB 3EDUA 4GYSA 4HFDA 3D0TA 3V5SA 1MMNA 2DCFA 4U74A 3P7IA 4HFCA 2JRKA 2QRXA 4U3CA 2NW8A 1OEDA
chains in the Genus database with same CATH topology
1SHZC 2V7JA 2D0TA 4AKRB 5H6QB 2Q9QA 4GOUA 3N9QA 3QUJA 4P0BA 1UX4A 5JDHA 5HAXA 2H7OA 4X1IE 2E9XD 3CVRA 3LJCA 1T98A 5HYAA 3UUMA 3PUSA 1MIWA 4XAXB 4Z8XA 3O1HA 1MIVA 5C8YE 1LRZA 5KX5E 5LOVE 3ZC1A 2C5KT 4KP3C 2CXDA 4EOZB 3AA0B 2KINB 2V7MA 3O1JA 3ZMUB 2C0SA 4UVAB 3Q2MA 4FI5A 1FMWA 3CWZB 2KWHA 4H63V 3O4XE 3ZYMA 2RP4A 3KVBA 3ESLA 2QA7A 3I9WA 3PU8A 5KDMC 5JREA 4MHCA 1LVKA 4C90A 5EK3A 1BR2A 2ACXA 5HXCA 3ETVA 2GK9A 3CPZA 4HGAA 4EIWA 5JQGE 5LGNB 2CLYB 2KXPB 4KUMB 2XAHB 3ONXA 4CXWA 2X51A 3SS1A 5JR9B 1HF8A 2CXFA 3N2OA 1VRBA 2XHEB 2NTXA 4V1Av 2SPCA 4JEHB 3H3AA 5FY7A 3FXEB 1OWAA 2QGSA 4KMCA 4L5GA 5EK2A 3HKBE 3GN5A 3LFMA 1S94A 3I1AA 2RA1A 4P0AA 2C5IT 4PFOA 1SA0E 3C4XA 2JJ9A 4AQFA 2LSGA 3K3QC 4DBRA 3AA7B 4AKHA 1CUNA 2DHRA 3MXZA 4H9OC 4GYRA 5JVDE 2L3LA 5LHHB 5E0OA 2CCQA 2V7LA 2X9YA 3KINB 3LBXB 1KK7A 1QSDA 1MIYA 2Y8DA 3HA4A 2YINA 4ZS3A 5JRCA 5L3BB 3CQXC 4PJNA 4OK0A 1HG2A 4CI1B 5L3EB 2L8KA 5LBQB 3QK6A 3V5UA 5CB4E 5AFUL 5H6RB 2G0UA 2X9XA 3CQCB 2A2FX 5DQVA 4IIJE 1G73A 3IF8B 5L3GB 3UULA 5LA6E 2E9XA 1U5PA 5KMGP 5L3CB 2X67A 3KV6A 2V7KA 2W00A 3KBUA 5LBMA 5FXVA 2LSJA 2VKDA 2WMNA 3WAKA 3RRCA 3OYXA 4AKIA 1UCUA 3BQKA 3EVYA 3F31A 2X66A 3N9LA 3WI3A 3CKDA 3PUAA 3PU3A 4OYKA 2ZLYA 3K3OA 4PK4A 5LHIB 4I55E 5LXTE 3NRYA 2HPLA 1ZKEA 5DJQC 4UV9B 2XQYA 1HTJF 2NP9A 3RPUA 1X79A 3ANWB 4JLEA 3ZEFB 3CMLA 2D0UA 5HXSA 4DMVA 5F3JA 5JR9C 4O4IE 4UEMA 4KBMB 1D1AA 4HEAA 3S4UA 1YD8G 4G63A 4IHJE 4N78D 3OBVE 4CZZB 2JQQA 5FY1A 4X20E 4AKLA 2K9AA 4O4HE 4IGUA 5GONE 3RC8A 5BMVE 4L0RA 4IE4A 3N2KE 4QXBB 1MNEA 5JH7E 1WYCA 2VB6A 4DVDA 3SWHA 3F57A 1G8XA 3ZYLA 5LGUB 3LK42 2VWAA 3ZJ1A 1IZNB 4ISTA 4QKNA 2A3DA 3GMIA 2VK9A 2ZMAA 3HL6A 4F6RC 4K0UA 3LK3B 3SRZA 2LSIA 3MA9A 4X1YE 3KFWX 3WAJA 3ZN1B 4PNIA 5IHYA 4IE5A 4YLHA 4B6XA 2WAUA 1IJ5A 1D1BA 3HKEE 2M67A 2PJQA 4CI3B 2KT9A 3ZMTB 4DO0A 2W61A 4CQIA 5DQWA 3CX7B 4GIWA 4UF0B 1OXZA 3LBXA 2PBIA 4HTEA 2EHOD 2NWBA 3N9MA 3O1IA 5FXXA 3L3PA 4BJNA 2XTLA 3ETUA 5FP3A 1ZV4X 3PUQA 5LJMA 2WWUA 4WBOA 5A1LA 3L09A 2MYSA 3FB2A 3GA8A 4ZHQE 3C4WA 3C50A 4H9QC 4EAHA 2ZM8A 3QC9A 5HXRA 2X9HA 2NW9A 4O2AE 3B57A 1HCIA 2LEHA 1NAFA 1FEWA 1US7B 3R6NA 3EDVA 4E7SA 3VKGA 2V7IA 2V26A 1ZHCA 2WBLA 3MKDA 3ZC0A 3LG7A 3IHRA 2L9QA 3E08A 1Y64B 4ZI2C 2D2SA 4X1KE 3N9PA 1IJ6A 3FBLA 3OKQA 4MLKA 2BVLA 4EZ4A 5L2LA 2LSYA 2CWYA 3SOLA 3AA6B 3K8PC 3C98B 4HN9A 2DI4A 2PG8A 3ZYKA 1D0YA 1WYBA 2V1DB 4AQFC 3PTRB 2XASB 4O8SA 2I59A 5HWXA 3Q9DA 3KV5A 5JDQA 4CXYA 3A5XA 3JC6C 5JDGA 2X0LB 3KV4A 3N9NA 5HXEA 4H9RC 5J2TE 3N2GE 4FJOA 2XAFB 2JMHA 2EHOC 1S35A 3AAEB 5J1GA 5LCYA 4C91A 4QX8B 5ADXL 3RYCE 1D0XA 3HKCE 4IE0A 2VL8A 3VKHA 4ZOLE 4IE6A 2UXXB 4UELA 3R84B 5HWYA 4M1PA 1MNDA 5TAOA 4PW8A 1BR0A 4AQGA 3ZN0B 4H9SE 3IEEA 4YHJA 2HPJA 4YFSA 3CX6B 4H63H 3UT5E 2P9BA 2IC6A 1FIOA 2Y6XA 3Q5WA 3BK9A 4NUUA 5LHGB 1HFAA 3O9XA 1WLXA 3RRWA 5LYJE 3I0OA 4WW0A 2DWGA 3PDYA 4UF0A 2XAGB 4DNDA 5JDMA 2XUEA 4PK5A 2CEAA 2OA5A 3HKDE 1MMDA 5HXHA 2WMOA 2H7VC 5FNVE 2MBGA 3PE0A 4TV8E 4J2CA 3AB3B 3H37A 4CI2B 4BJMA 1O3XA 2IW5B 2CM0A 3DP7A 1B7TA 2DNXA 3B13A 3K3NA 2YU1A 2W63A 3GN5B 4GK5E 5F8PA 2N2NA 1QUUA 4IDZA 4ASKA 4ZI2D 5JR9A 4MBQA 1YKHB 3OYZA 1FMVA 2A72A 3LK2B 2ODUA 3ZCJA 2CA5A 2DWKA 1HG5A 2Q9QC 2VKHA 5LNKA 5JRCB 2LJLA 2J1DG 5LP6E 2KWIB 1LKXA 2EHOB 3GWHA 2WM9A 4CXXA 4UXNB 1V9DA 1WRDA 2ZM0A 3I0QA 3PURA 3OJAA 3JC6D 4O4LE 4ZI7E 5JDLA 2K24A 1MMAA 4ERRA 2X68A 4PJJA 2NW7A 3T8OA 4TN7B 4MFRA 2BZBA 4HFVA 2H3RA 3ZJ2A 1E1HB 2Z6EA 4XBFB 2X9WA 2BVMA 4PJMA 3UUNA 4ANJA 2WSSV 2HH7A 2LSKA 5LJNA 3UUXB 2YEVC 3J7Yq 4PFPA 2XAQB 1EZ3A 5JDFA 3C64A 4AXPA 3NRXA 4H9NC 4NUVA 2IAKA 2ODVA 3RKOA 3RX6A 3TKLB 2LE8A 1KNZA 4TZ4C 2XAJB 2CMRA 4QXHB 4TX5A 2JPFA 5J2UE 4U72A 3VU7H 3ZMVB 5DABA 4O2BE 2D5UA 5EK4A 5L3FB 5FXWA 1UX5A 4UIGA 2K48A 2UXNB 1YKEB 4EB6E 1WR6A 4UVCB 5ETWA 4YJ3E 3FXDB 4OFZA 3ANWA 1ZEEA 2BDEA 4UV8B 4WBNE 3DTOA 4H9PC 1D0ZA 1VOMA 4A56A 2LOPA 4HE8A 4PJLA 1BR1A 3NZPA 3AVRA 2KNDA 2VKJA 3CQGB 5IYZE 5M4YA 3I9YA 5LG4A 4PAGA 5LGTB 2Q9QB 3BQLA 5CA1E 4P09A 3C51A 4ZI3D 3ZMSB 4JEUB 3KBTA 4BA9A 3AAIA 4WNKA 2E8IA 2Y48B 1H7CA 2DLRA 2ES0A 3J9X1 4AI6A 4UVBB 4ILUA 2C5JA 3MZKB 3DJBA 2Q9QD 2VKOA 2JMKA 2E9XC 3C4ZA 2VASA 2W0GA 1YW0A 4O4JE 5L3DB 2LHNA 3MACA 2CE7A 2N9DA 3AA1B 4QX7B 4ZS2A 4BAYB 2NOXA 4L9IA 2LOSA 3E0ZA 2PFVA 5JDNA 2YU2A 2MOZA 1NWMX 2ZM2A 2EHOA 4PK6A 4ISSA 4I4TE 3Q5XA 4EXTA 3FHNA 2MTQA 2YK0A 3F2EA 4G2AA 4GK0E 2KMFA 3RYIE 5FY0A 3RH3A 1IAPA 1HS7A 4MALA 3UFEA 1AJ3A 3EUHA 1MMGA 3RC3A 4QWNB 3MJXA 4QXCB 3HI2A 2K5BB 3AVSA 3RYFE 4TV9E 2KLQA 3IBPA 3PUGA 3CX8B 1U4QA 3N5LA 4EZHA 2W62A 3UTKA 2KZ7B 5CA0E 3KDSE 3FBZA 4E7ZA 3HR0A 4AKGA 2LT3A 3P8CD 1HX8A 2IC9A 2LM9A 3M65A 4OYJA 2CWOA 3BQIA 3KVAA 3N9OA 3RYHE 3W15B 5FMNA 2CLYC 5FYMA 4OHFA 3ZCIA 3U3IA 4ZI3C 4DBQA 2LHRA 4I50E 4ADZA 2NTYA 3U78A 3VHLA 2B1EA 4I43B 4IE7A 5EZYE 1D1CA 1LVFA 3EDUA 4GYSA 3V5SA 3D0TA 1MMNA 3E22E 2DCFA 4U74A 2N1GA 3MK7C 3P7IA 2CXLA 5FXZA 4TUYE 2JRKA 4XZCA 3KV9A 3AAAB 4QHOA 3ZPOA 3ZLIA 1BR4A 4HKAA 4EYUA 2NW8A 4JUYA 1Z0PA 4YJ2E 4EYYR 4DMWA 2E9XB 3ZMZB 3NBXX 3NZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWH A;  1IJ6 A;  2X9X A;  3FXE B;  3L3P A;  2X9W A;  4DND A;  1H7C A;  2K48 A;  2XTL A;  2C5I T;  3QUJ A;  2C5J A;  1LVF A;  3S4U A;  3FXD B;  2CA5 A;  3CVR A;  2MBG A;  3MXZ A;  4J2C A;  2KWI B;  3P7I A;  4B6X A;  1IJ5 A;  3N5L A;  2X9Y A;  1LRZ A;  2C5K T;  1QSD A;  4L0R A;  3TKL B;  3CKD A;  2IC6 A;  4CQI A;  1Z0P A;  2IC9 A;  4EYY R;  1ZKE A;  3QK6 A;  4FI5 A;  2G0U A; 
#chains in the Genus database with same CATH topology
 3ZST A;  2V7J A;  5H6Q B;  4JI0 T;  4YT0 A;  4TWD A;  3LJC A;  2CHN A;  5C8Y E;  5KX5 E;  1J5E T;  1XMO T;  2J62 A;  4EOZ B;  2WZH A;  3AA0 B;  4B3M T;  2KIN B;  3O1J A;  4ZZC A;  4FI5 A;  3O4X E;  5HEJ A;  5JRE A;  2VQF T;  1LVK A;  1BR2 A;  2GK9 A;  4EIW A;  5JQG E;  4KUM B;  3SS1 A;  1HF8 A;  4U7I A;  5AQS B;  4KHP T;  4U31 A;  2BG9 E;  2V6Y B;  2JQH A;  3LFM A;  2RA1 A;  4P0A A;  3C4X A;  3ONJ A;  2LSG A;  4DR5 T;  4AKH A;  1CUN A;  2DHR A;  3MXZ A;  4GYR A;  4LF4 T;  1KK7 A;  2QVA A;  2XQ5 A;  2WDR A;  4ZS3 A;  2YIN A;  5L3B B;  4OK0 A;  2G0U A;  3CQC B;  5DQV A;  1G73 A;  1U5P A;  5L3C B;  4YTP A;  2X67 A;  2YOE A;  5LBM A;  5FXV A;  2LKG A;  3RRC A;  2XQ8 A;  3PUW F;  3BQK A;  4DV0 T;  4OYK A;  3K3O A;  4PK4 A;  5LXT E;  3NRY A;  2HPL A;  3AEE A;  4LFA T;  2NP9 A;  4JLE A;  3TLV A;  3UU6 A;  5F3J A;  3S4U A;  4IHJ E;  2IHR 1;  4N78 D;  2BG9 C;  3RC8 A;  4QXB B;  4IE4 A;  1WYC A;  2OV9 A;  3ZYL A;  3P4W A;  4JYA T;  3ONL C;  4LFC T;  2V6Y A;  3LK3 B;  4DUY T;  3KFW X;  3ZN1 B;  1HNZ T;  4YLH A;  3CIR A;  2WAU A;  1D1B A;  4AQY T;  4CI3 B;  3ZMT B;  4CQI A;  5DQW A;  1N32 T;  4HTE A;  3ZT5 A;  5FXX A;  3L3P A;  3ETU A;  5FP3 A;  5A1L A;  4WBO A;  1X9B A;  3GA8 A;  3C4W A;  4H9Q C;  3QC9 A;  1UUS A;  2X9H A;  1HCI A;  3R6N A;  1US7 B;  4DV4 T;  2V7I A;  2XSB A;  3IHR A;  1Y64 B;  2D2S A;  3N9P A;  3FBL A;  4MLK A;  3AXJ B;  3OKQ A;  4EZ4 A;  5L2L A;  2LSY A;  2D9D A;  2W4X A;  1OED E;  2PG8 A;  1WYB A;  4AQF C;  5J0Z A;  3Q9D A;  2UUA T;  4CXY A;  3UU4 A;  5CGM A;  5HXE A;  4H9R C;  4FJO A;  5C2T A;  4C91 A;  5LCY A;  3RYC E;  3HKC E;  2YN6 A;  4IE0 A;  3VKH A;  2HN2 A;  3PJA A;  2E2A A;  3RI5 A;  4AQG A;  3UT5 E;  3FZH B;  2IC6 A;  2Y6X A;  3BK9 A;  5LHG B;  3O9X A;  2WY2 A;  5LYJ E;  5JDM A;  4PK5 A;  2CEA A;  1MMD A;  2WMO A;  3FZM B;  3ZSS A;  2XJ7 A;  2MBG A;  4CI2 B;  2CM0 A;  2DNX A;  3AE3 A;  2YU1 A;  2W63 A;  3GN5 B;  5F8P A;  2V6X A;  3OTO T;  4IDZ A;  4ASK A;  4MBQ A;  1YKH B;  5FL1 A;  3LK2 B;  2QYW A;  3UQ4 A;  4F8H A;  3ZCJ A;  2CA5 A;  3AXJ A;  2KWI B;  2X0H A;  2EHO B;  4CXX A;  3JAD A;  3JC6 D;  4ZI7 E;  2LLY A;  1KEY A;  4NIQ A;  2X68 A;  3RIU A;  2NW7 A;  2WQY A;  4TN7 B;  1E1H B;  2Z6E A;  3TLW A;  2X9W A;  4ANJ A;  4HWF A;  1N33 T;  3UQ7 A;  2YEV C;  3IA3 A;  5L4E A;  3C64 A;  4AXP A;  3RKO A;  2LE8 A;  3VU7 H;  1QLB A;  4EB6 E;  1JNZ A;  4K0K T;  2FJD A;  3ANW A;  2ZM6 T;  2UUB T;  4A56 A;  3L39 A;  3SFD A;  2J47 A;  4PAG A;  5LGT B;  4ZI3 D;  3KBT A;  4LMJ A;  2DLR A;  3MZK B;  3DJB A;  5FKY A;  1E7P A;  1YW0 A;  1I6Z A;  3MAC A;  1XWM A;  4QX7 B;  4BAY B;  4L9I A;  4KX6 A;  2EHO A;  4ISS A;  2BS4 A;  2E5L T;  4EXT A;  2XSA A;  2YKS A;  4G2A A;  4AIU A;  2IIU A;  4GK0 E;  4YXD A;  1IAP A;  2WWV A;  3UFE A;  4DV6 T;  2XPK A;  3RYF E;  3AE7 A;  1E2A A;  4CN4 A;  4EZH A;  1M7K A;  2CPT A;  4KI0 F;  4EEB A;  2BKP A;  4OYJ A;  2H88 A;  1L0V A;  5IWA T;  4ADZ A;  3U78 A;  3VHL A;  4B3T T;  4IE7 A;  1J1J A;  2K3W A;  4IDO A;  2N1G A;  3KV9 A;  3ZPO A;  2W2U A;  4OX9 T;  1Z0P A;  4YJ2 E;  4EYY R;  4HWH A;  1W9R A;  3NBX X;  3NZQ A;  2D0T A;  3PUV F;  4GOU A;  5AQU B;  4P0B A;  1IBK T;  5JDH A;  3T1Y T;  2H7O A;  4X1I E;  4Z8X A;  1MIV A;  3Q5E A;  2CXD A;  4YY3 T;  2V7M A;  2C0S A;  3Q2M A;  3CWZ B;  2KWH A;  2XQ3 A;  5AQF B;  4C90 A;  5EK3 A;  3CPZ A;  2CLY B;  4DV7 T;  1XNR T;  1W0B A;  2XAH B;  4CXW A;  5JR9 B;  2RPA A;  2SPC A;  2AE9 A;  3FZL B;  5EK2 A;  5AQH B;  4L5G A;  3TLS A;  3HKB E;  4AQF A;  3K3Q C;  5JVD E;  5LG3 A;  2V7L A;  3LBX B;  1MIY A;  3HA4 A;  1HNX T;  4EGW A;  4CI1 B;  4WZX A;  5H6R B;  5HEU A;  4X62 T;  5L3G B;  5KMG P;  1FJG T;  2V7K A;  3KBU A;  4X66 T;  2WMN A;  4AKI A;  1UCU A;  3EVY A;  3N9L A;  4JI5 T;  5AQK B;  2WB5 A;  5LHI B;  2JIW A;  1ZKE A;  2FJA A;  4UV9 B;  2BS2 A;  1HTJ F;  3ZEF B;  3PUY F;  5HXS A;  1D1A A;  3B5M A;  1J5W A;  3FZF B;  5FY1 A;  4AKL A;  2K9A A;  4A98 A;  3P4P A;  4L0R A;  5BMV E;  2VB6 A;  4DVD A;  2I0M A;  4JI4 T;  1G8X A;  4TNW A;  2AXD S;  3ZJ1 A;  4IST A;  3RIU C;  4QKN A;  2B76 A;  2A9U A;  3AE4 A;  3SRZ A;  2LSI A;  3MA9 A;  3AE2 A;  5IHY A;  2M6I A;  2IUB A;  4IE5 A;  4B6X A;  1I94 T;  2MAW A;  2W61 A;  1Z8U A;  4UF0 B;  3LBX A;  2NWB A;  4B3R T;  3O1I A;  2XTL A;  1UK5 A;  3PUQ A;  2WWU A;  3L09 A;  2MYS A;  3FB2 A;  4EAH A;  2VL0 A;  3AEB A;  5HXR A;  2LEH A;  1FEW A;  4E7S A;  4YSZ A;  3VKG A;  3LG7 A;  4Z90 A;  3VR9 A;  2L9Q A;  1YQ3 A;  2BVL A;  2VQE T;  3SOL A;  3AE9 A;  3K8P C;  3TLU A;  4P1N A;  3ZYK A;  2V1D B;  4NPP A;  5HWX A;  2IDO B;  3JC6 C;  5JDG A;  2X0L B;  4CN6 A;  5HEO A;  2XAF B;  2EHO C;  5J1G A;  5ADX L;  4IE6 A;  2UXX B;  3R84 B;  2HHH T;  4JI2 T;  2OLT A;  1MND A;  5TAO A;  3IEE A;  2HPJ A;  3CX6 B;  4H63 H;  2P9B A;  2FJE A;  3EI0 A;  3PUZ F;  3Q5W A;  1HFA A;  3I0O A;  4DND A;  4UF0 A;  2J4G A;  3NVO A;  4TV8 E;  4J2C A;  3AB3 B;  4BJM A;  5ABF B;  3L8R A;  4NXN T;  1B7T A;  3K3N A;  1ZP0 A;  4ZI2 D;  5F5W A;  2ODU A;  2DWK A;  5JRC B;  5LP6 E;  2JQ9 A;  5HCM A;  3GWH A;  1V9D A;  3I0Q A;  4IL4 A;  4O4L E;  5JDL A;  2K24 A;  4ERR A;  2LKH A;  2XY8 B;  2FBW A;  3ZJ2 A;  3RF1 A;  4PJM A;  2HH7 A;  2VVN A;  5AQL B;  3UUX B;  2BKN A;  4PFP A;  2XAQ B;  4ILA A;  1EZ3 A;  5JDF A;  2LRL A;  3NRX A;  4H9N C;  2ODV A;  3TKL B;  5AQG B;  1WCR A;  2XAJ B;  2CMR A;  2JPF A;  3UU3 A;  5DAB A;  2D5U A;  4TWH A;  2K48 A;  1WR6 A;  3VR8 A;  2LRK A;  5ETW A;  3FXD B;  3AEF A;  5HEH A;  2BDE A;  4WBN E;  4JI6 T;  3DTO A;  4H9P C;  2LOP A;  1BR1 A;  3CQG B;  5IYZ E;  4IDQ A;  5M4Y A;  5ABF A;  3I9Y A;  1T8B A;  3Q5D A;  2Q9Q B;  4WNK A;  1H7C A;  2Y48 B;  4AI6 A;  2R6G F;  4UVB B;  2Q9Q D;  2W0G A;  3AA1 B;  2FJB A;  2LOS A;  1XNQ T;  2PFV A;  2MPK A;  3ZKR A;  2YDR A;  2WS3 A;  2KSR A;  3FHN A;  2MTQ A;  2KMF A;  3RYI E;  5FY0 A;  1AJ3 A;  4U2Y A;  2KLQ A;  3IBP A;  1U4Q A;  3N5L A;  2W62 A;  5CA0 E;  4DV2 T;  4A5X A;  2LT3 A;  2CWO A;  4DUZ T;  5AQR B;  3RYH E;  5FMN A;  2CLY C;  4DBQ A;  4CN1 A;  1SE7 A;  2CBJ A;  3AEA A;  1D1C A;  1LVF A;  3E22 E;  2CXL A;  5FXZ A;  1W0A A;  4U2Z A;  4XZC A;  4QHO A;  4HKA A;  1ZOY A;  4DMW A;  2Q9Q A;  2YDS A;  3N9Q A;  3QUJ A;  1UX4 A;  5HAX A;  3CVR A;  1T98 A;  4IRE A;  5HYA A;  3PUS A;  1MIW A;  4XAX B;  3O1H A;  3AE1 A;  4YHH T;  2XQ9 A;  5LOV E;  3ZC1 A;  2WDQ A;  4Z91 A;  1FMW A;  4H63 V;  3ESL A;  3PU8 A;  5C3J A;  2ACX A;  5HXC A;  4LF9 T;  4HGA A;  2KXP B;  5LMN T;  5AQQ B;  3ONX A;  2CXF A;  3N2O A;  2XHE B;  3UU8 A;  4COF A;  5FY7 A;  2QGS A;  3GN5 A;  1T7S A;  5CJ5 A;  1KFY A;  3UUB A;  4PFO A;  1SA0 E;  2JJ9 A;  4LMK A;  2W67 A;  3AA7 B;  3T1H T;  4H9O C;  5LHH B;  5AQJ B;  2CCQ A;  2X9Y A;  5L47 A;  2Y8D A;  1HG2 A;  5L3E B;  2L8K A;  2WDV A;  4HFB A;  3QK6 A;  5CB4 E;  5AFU L;  2NR4 A;  4JV5 T;  4B3S T;  3UUL A;  5LA6 E;  3KV6 A;  2VKD A;  3OYX A;  4DV5 T;  3F31 A;  2X66 A;  3WI3 A;  4I55 E;  5DJQ C;  2XQY A;  3CML A;  2BS3 A;  4DMV A;  4O4I E;  3RLF F;  1YD8 G;  3AE8 A;  4G63 A;  2WU2 A;  3OBV E;  4CZZ B;  4YSX A;  4X20 E;  4O4H E;  5GON E;  3N2K E;  3SWH A;  3F57 A;  2FUP A;  5LGU B;  3P50 A;  4TWF A;  3GMI A;  2VK9 A;  5LMU T;  4K0U A;  5FL0 A;  4PNI A;  3NKZ A;  5CFB A;  5JTG A;  2M67 A;  2PJQ A;  3JAE A;  4DO0 A;  1XZY A;  4LF8 T;  2CBI A;  3CX7 B;  4GIW A;  2PBI A;  3N9M A;  5AQT B;  4BJN A;  2HN1 A;  2LM2 A;  1ZV4 X;  4ZHQ E;  3UU5 A;  3C50 A;  4X65 T;  4JI7 T;  4O2A E;  5AQM B;  4YSY A;  4NXM T;  2V26 A;  2WBL A;  5ABH A;  3ZC0 A;  4ZI2 C;  4X1K E;  1IJ6 A;  1YQ4 A;  4GKK T;  4JI1 T;  4DR7 T;  5L4H A;  3C98 B;  4HN9 A;  1OED B;  1VCT A;  4IDN A;  2XAS B;  1M62 A;  2I59 A;  2I6H A;  3KV5 A;  3OVU A;  4JI3 T;  3A5X A;  4HFE A;  3KV4 A;  3AEC A;  3UFG A;  5J2T E;  3N2G E;  2JMH A;  1S35 A;  4QX8 B;  3X1D A;  2VL8 A;  4ZOL E;  3RKG A;  3A7M A;  4M1P A;  4H9S E;  4YFS A;  3EHZ A;  2UXD T;  3LSV A;  3RRW A;  4WW0 A;  2XAG B;  2XUE A;  5HXH A;  3PUX F;  4LF7 T;  5AQN B;  3H37 A;  1O3X A;  4HWC A;  3EAB A;  3G06 A;  2N2N A;  2VUR A;  1QUU A;  3P4S A;  5JR9 A;  2A72 A;  3AED A;  2Q9Q C;  2BKO A;  2J1D G;  4WYV A;  2WM9 A;  3RIF A;  4KHZ F;  2ZM0 A;  3PUR A;  3LDQ B;  4DR6 T;  1MMA A;  3RQU A;  4PJJ A;  3T8O A;  4MFR A;  2BZB A;  3AE6 A;  4HFV A;  3ZT6 A;  3VRA A;  1HR0 T;  1VCS A;  2LSK A;  5LJN A;  4ILC A;  3J7Y q;  1N36 T;  4LF6 T;  3RX6 A;  4DV1 T;  3K1S A;  4U72 A;  3ZMV B;  4O2B E;  5FXW A;  1UX5 A;  1YKE B;  4UVC B;  4OFZ A;  1VOM A;  1Y01 A;  4PJL A;  5FVK A;  2KND A;  1IBL T;  3BQL A;  2WCA A;  1KNR A;  3ZMS B;  4IT4 A;  4JEU B;  4BA9 A;  1UUR A;  2ES0 A;  3J9X 1;  2VKO A;  3C4Z A;  2VAS A;  5L3D B;  2LHN A;  4ZS2 A;  2N9D A;  4EED A;  4EV6 A;  2H89 A;  5AQP B;  3E0Z A;  2MOZ A;  1NWM X;  1YXR A;  2ZM2 A;  2YK0 A;  1HS7 A;  1MMG A;  3MJX A;  3HI2 A;  2K5B B;  4TV9 E;  3PUG A;  3CX8 B;  3UTK A;  2KZ7 B;  3FBZ A;  4HWD A;  1HX8 A;  2IC9 A;  3M65 A;  3BQI A;  3N9O A;  3W15 B;  4HWI B;  3U3I A;  4ZI3 C;  2XQ7 A;  2LHR A;  2X0Y A;  1WFD A;  4I43 B;  5BR8 T;  4ZEY A;  3MK7 C;  1KF6 A;  4TUY E;  3AAA B;  3ZLI A;  1BR4 A;  4EYU A;  4JUY A;  2BBJ A;  2E9X B;  3ZMZ B;  3RIA A;  1SHZ C;  2UU9 T;  4AKR B;  4HFH A;  5KXJ A;  2XQA A;  2E9X D;  3UUM A;  1XMQ T;  1LRZ A;  2C5K T;  4KP3 C;  4DV3 T;  3H3M A;  4ZXL A;  3ZMU B;  4UVA B;  2YDQ A;  3ZYM A;  2RP4 A;  3KVB A;  2QA7 A;  3I9W A;  5KDM C;  4MHC A;  3PV0 F;  3AEG A;  3ETV A;  5LGN B;  4DID B;  1R8I A;  2X51 A;  1VRB A;  1GQE A;  2NTX A;  4V1A v;  4QH1 A;  4JEH B;  3H3A A;  3CK6 A;  3FXE B;  1OWA A;  4KMC A;  1S94 A;  3JCF A;  3I1A A;  2C5I T;  4DR4 T;  4DBR A;  2L3L A;  5E0O A;  3KIN B;  1QSD A;  5JRC A;  4DR3 T;  3CQX C;  4PJN A;  2XQ6 A;  5LBQ B;  3V5U A;  4AIS A;  3NWI A;  2XM2 A;  2X9X A;  2A2F X;  4IIJ E;  3IF8 B;  2E9X A;  2W00 A;  3JAF A;  2LSJ A;  3WAK A;  4JI8 T;  1CHU A;  5AQV B;  3CKD A;  3PUA A;  3PU3 A;  2ZLY A;  1XDP A;  1HX1 B;  3RPU A;  1N34 T;  1X79 A;  3ANW B;  3ABV A;  2D0U A;  2XQ4 A;  5JR9 C;  4UEM A;  4KBM B;  4HEA A;  4X5T A;  2JQQ A;  2XM1 A;  3FZK B;  1HNW T;  4IGU A;  1MNE A;  5JH7 E;  5LB7 B;  1SUM B;  1OED C;  3LK4 2;  2VWA A;  1IZN B;  3QNU A;  2A3D A;  2ZMA A;  3HL6 A;  2V5D A;  4F6R C;  4ZZB A;  4X1Y E;  4DR2 T;  3WAJ A;  1IJ5 A;  3HKE E;  2KT9 A;  3SFE A;  3QOF A;  4DR1 T;  1OXZ A;  4YTM A;  1KNP A;  2XZE A;  2EHO D;  4QH5 A;  5LJM A;  5ABE A;  5IUX A;  2ZM8 A;  2NW9 A;  3B57 A;  1NAF A;  3EDV A;  2UUC T;  1WR0 A;  1ZHC A;  3MKD A;  2M6B A;  3E08 A;  2BG9 B;  2CRB A;  3RHW A;  2CWY A;  3AA6 B;  2DI4 A;  1D0Y A;  3PTR B;  4O8S A;  1UGO A;  2V5C A;  5JDQ A;  3QB5 K;  3N9N A;  4U33 A;  3AAE B;  1D0X A;  1XDO A;  4IL9 A;  4UEL A;  5HWY A;  4UR9 A;  4PW8 A;  1BR0 A;  2ACZ A;  3ZN0 B;  2W66 A;  2JQK A;  2UXB T;  4YHJ A;  4U7Y A;  1FIO A;  4NUU A;  1WLX A;  2WU5 A;  2DWG A;  3PDY A;  2OA5 A;  2PTF A;  3HKD E;  5AQO B;  2H7V C;  5FNV E;  1JNR A;  3QB5 A;  3PE0 A;  2IW5 B;  3ZT7 A;  3DP7 A;  3B13 A;  4YTN A;  4GK5 E;  5HEG A;  1NEK A;  4LML A;  3OYZ A;  4ILB A;  1FMV A;  2BBH A;  2BG9 A;  5FVL A;  1HG5 A;  5LNK A;  2VKH A;  2LJL A;  3OPC A;  2UXC T;  1LKX A;  2WP9 A;  4UXN B;  1WRD A;  4JBW F;  1NEN A;  2VVS A;  3OJA A;  3RQW A;  2H3R A;  4XBF B;  2BVM A;  3UUN A;  2WSS V;  2V8S V;  4QH4 A;  5AQI B;  4NUV A;  4LF5 T;  1W09 A;  2IAK A;  3P4Q A;  3PJA J;  1KNZ A;  4TZ4 C;  4QXH B;  4TX5 A;  5J2U E;  5EK4 A;  5L3F B;  3EAM A;  4UIG A;  2UXN B;  2DL1 A;  4YJ3 E;  2IML A;  1ZEE A;  4UV8 B;  3TLT A;  1D0Z A;  4HE8 A;  4IDP A;  3NZP A;  3AVR A;  2VKJ A;  5LG4 A;  2WZI A;  5CA1 E;  4P09 A;  3C51 A;  3AAI A;  2E8I A;  1DU2 A;  4ILU A;  2C5J A;  2JMK A;  2E9X C;  2F4V T;  5HCJ A;  4O4J E;  4X64 T;  2CE7 A;  2NOX A;  2CHO A;  5JDN A;  4TNV A;  2YU2 A;  1IBM T;  3RGL A;  4PK6 A;  4A97 A;  4I4T E;  3Q5X A;  3F2E A;  3RH3 A;  4MAL A;  3EUH A;  1T72 A;  3RC3 A;  4Q25 A;  4QWN B;  4QXC B;  3AVS A;  5ABG A;  4LFB T;  3VRB A;  3A8Y C;  3KDS E;  4E7Z A;  3HR0 A;  4AKG A;  3P4R A;  3P8C D;  4HFI A;  2LM9 A;  4I0U A;  3KVA A;  2E5V A;  5FYM A;  4OHF A;  3ZCI A;  4I50 E;  2NTY A;  2B1E A;  4GKJ T;  5EZY E;  3AE5 A;  3M3Z B;  3EDU A;  4GYS A;  4HFD A;  3D0T A;  3V5S A;  1MMN A;  2DCF A;  4U74 A;  3P7I A;  4HFC A;  2JRK A;  2QRX A;  4U3C A;  2NW8 A;  1OED A; 
#chains in the Genus database with same CATH homology
 1SHZ C;  2V7J A;  2D0T A;  4AKR B;  5H6Q B;  2Q9Q A;  4GOU A;  3N9Q A;  3QUJ A;  4P0B A;  1UX4 A;  5JDH A;  5HAX A;  2H7O A;  4X1I E;  2E9X D;  3CVR A;  3LJC A;  1T98 A;  5HYA A;  3UUM A;  3PUS A;  1MIW A;  4XAX B;  4Z8X A;  3O1H A;  1MIV A;  5C8Y E;  1LRZ A;  5KX5 E;  5LOV E;  3ZC1 A;  2C5K T;  4KP3 C;  2CXD A;  4EOZ B;  3AA0 B;  2KIN B;  2V7M A;  3O1J A;  3ZMU B;  2C0S A;  4UVA B;  3Q2M A;  4FI5 A;  1FMW A;  3CWZ B;  2KWH A;  4H63 V;  3O4X E;  3ZYM A;  2RP4 A;  3KVB A;  3ESL A;  2QA7 A;  3I9W A;  3PU8 A;  5KDM C;  5JRE A;  4MHC A;  1LVK A;  4C90 A;  5EK3 A;  1BR2 A;  2ACX A;  5HXC A;  3ETV A;  2GK9 A;  3CPZ A;  4HGA A;  4EIW A;  5JQG E;  5LGN B;  2CLY B;  2KXP B;  4KUM B;  2XAH B;  3ONX A;  4CXW A;  2X51 A;  3SS1 A;  5JR9 B;  1HF8 A;  2CXF A;  3N2O A;  1VRB A;  2XHE B;  2NTX A;  4V1A v;  2SPC A;  4JEH B;  3H3A A;  5FY7 A;  3FXE B;  1OWA A;  2QGS A;  4KMC A;  4L5G A;  5EK2 A;  3HKB E;  3GN5 A;  3LFM A;  1S94 A;  3I1A A;  2RA1 A;  4P0A A;  2C5I T;  4PFO A;  1SA0 E;  3C4X A;  2JJ9 A;  4AQF A;  2LSG A;  3K3Q C;  4DBR A;  3AA7 B;  4AKH A;  1CUN A;  2DHR A;  3MXZ A;  4H9O C;  4GYR A;  5JVD E;  2L3L A;  5LHH B;  5E0O A;  2CCQ A;  2V7L A;  2X9Y A;  3KIN B;  3LBX B;  1KK7 A;  1QSD A;  1MIY A;  2Y8D A;  3HA4 A;  2YIN A;  4ZS3 A;  5JRC A;  5L3B B;  3CQX C;  4PJN A;  4OK0 A;  1HG2 A;  4CI1 B;  5L3E B;  2L8K A;  5LBQ B;  3QK6 A;  3V5U A;  5CB4 E;  5AFU L;  5H6R B;  2G0U A;  2X9X A;  3CQC B;  2A2F X;  5DQV A;  4IIJ E;  1G73 A;  3IF8 B;  5L3G B;  3UUL A;  5LA6 E;  2E9X A;  1U5P A;  5KMG P;  5L3C B;  2X67 A;  3KV6 A;  2V7K A;  2W00 A;  3KBU A;  5LBM A;  5FXV A;  2LSJ A;  2VKD A;  2WMN A;  3WAK A;  3RRC A;  3OYX A;  4AKI A;  1UCU A;  3BQK A;  3EVY A;  3F31 A;  2X66 A;  3N9L A;  3WI3 A;  3CKD A;  3PUA A;  3PU3 A;  4OYK A;  2ZLY A;  3K3O A;  4PK4 A;  5LHI B;  4I55 E;  5LXT E;  3NRY A;  2HPL A;  1ZKE A;  5DJQ C;  4UV9 B;  2XQY A;  1HTJ F;  2NP9 A;  3RPU A;  1X79 A;  3ANW B;  4JLE A;  3ZEF B;  3CML A;  2D0U A;  5HXS A;  4DMV A;  5F3J A;  5JR9 C;  4O4I E;  4UEM A;  4KBM B;  1D1A A;  4HEA A;  3S4U A;  1YD8 G;  4G63 A;  4IHJ E;  4N78 D;  3OBV E;  4CZZ B;  2JQQ A;  5FY1 A;  4X20 E;  4AKL A;  2K9A A;  4O4H E;  4IGU A;  5GON E;  3RC8 A;  5BMV E;  4L0R A;  4IE4 A;  3N2K E;  4QXB B;  1MNE A;  5JH7 E;  1WYC A;  2VB6 A;  4DVD A;  3SWH A;  3F57 A;  1G8X A;  3ZYL A;  5LGU B;  3LK4 2;  2VWA A;  3ZJ1 A;  1IZN B;  4IST A;  4QKN A;  2A3D A;  3GMI A;  2VK9 A;  2ZMA A;  3HL6 A;  4F6R C;  4K0U A;  3LK3 B;  3SRZ A;  2LSI A;  3MA9 A;  4X1Y E;  3KFW X;  3WAJ A;  3ZN1 B;  4PNI A;  5IHY A;  4IE5 A;  4YLH A;  4B6X A;  2WAU A;  1IJ5 A;  1D1B A;  3HKE E;  2M67 A;  2PJQ A;  4CI3 B;  2KT9 A;  3ZMT B;  4DO0 A;  2W61 A;  4CQI A;  5DQW A;  3CX7 B;  4GIW A;  4UF0 B;  1OXZ A;  3LBX A;  2PBI A;  4HTE A;  2EHO D;  2NWB A;  3N9M A;  3O1I A;  5FXX A;  3L3P A;  4BJN A;  2XTL A;  3ETU A;  5FP3 A;  1ZV4 X;  3PUQ A;  5LJM A;  2WWU A;  4WBO A;  5A1L A;  3L09 A;  2MYS A;  3FB2 A;  3GA8 A;  4ZHQ E;  3C4W A;  3C50 A;  4H9Q C;  4EAH A;  2ZM8 A;  3QC9 A;  5HXR A;  2X9H A;  2NW9 A;  4O2A E;  3B57 A;  1HCI A;  2LEH A;  1NAF A;  1FEW A;  1US7 B;  3R6N A;  3EDV A;  4E7S A;  3VKG A;  2V7I A;  2V26 A;  1ZHC A;  2WBL A;  3MKD A;  3ZC0 A;  3LG7 A;  3IHR A;  2L9Q A;  3E08 A;  1Y64 B;  4ZI2 C;  2D2S A;  4X1K E;  3N9P A;  1IJ6 A;  3FBL A;  3OKQ A;  4MLK A;  2BVL A;  4EZ4 A;  5L2L A;  2LSY A;  2CWY A;  3SOL A;  3AA6 B;  3K8P C;  3C98 B;  4HN9 A;  2DI4 A;  2PG8 A;  3ZYK A;  1D0Y A;  1WYB A;  2V1D B;  4AQF C;  3PTR B;  2XAS B;  4O8S A;  2I59 A;  5HWX A;  3Q9D A;  3KV5 A;  5JDQ A;  4CXY A;  3A5X A;  3JC6 C;  5JDG A;  2X0L B;  3KV4 A;  3N9N A;  5HXE A;  4H9R C;  5J2T E;  3N2G E;  4FJO A;  2XAF B;  2JMH A;  2EHO C;  1S35 A;  3AAE B;  5J1G A;  5LCY A;  4C91 A;  4QX8 B;  5ADX L;  3RYC E;  1D0X A;  3HKC E;  4IE0 A;  2VL8 A;  3VKH A;  4ZOL E;  4IE6 A;  2UXX B;  4UEL A;  3R84 B;  5HWY A;  4M1P A;  1MND A;  5TAO A;  4PW8 A;  1BR0 A;  4AQG A;  3ZN0 B;  4H9S E;  3IEE A;  4YHJ A;  2HPJ A;  4YFS A;  3CX6 B;  4H63 H;  3UT5 E;  2P9B A;  2IC6 A;  1FIO A;  2Y6X A;  3Q5W A;  3BK9 A;  4NUU A;  5LHG B;  1HFA A;  3O9X A;  1WLX A;  3RRW A;  5LYJ E;  3I0O A;  4WW0 A;  2DWG A;  3PDY A;  4UF0 A;  2XAG B;  4DND A;  5JDM A;  2XUE A;  4PK5 A;  2CEA A;  2OA5 A;  3HKD E;  1MMD A;  5HXH A;  2WMO A;  2H7V C;  5FNV E;  2MBG A;  3PE0 A;  4TV8 E;  4J2C A;  3AB3 B;  3H37 A;  4CI2 B;  4BJM A;  1O3X A;  2IW5 B;  2CM0 A;  3DP7 A;  1B7T A;  2DNX A;  3B13 A;  3K3N A;  2YU1 A;  2W63 A;  3GN5 B;  4GK5 E;  5F8P A;  2N2N A;  1QUU A;  4IDZ A;  4ASK A;  4ZI2 D;  5JR9 A;  4MBQ A;  1YKH B;  3OYZ A;  1FMV A;  2A72 A;  3LK2 B;  2ODU A;  3ZCJ A;  2CA5 A;  2DWK A;  1HG5 A;  2Q9Q C;  2VKH A;  5LNK A;  5JRC B;  2LJL A;  2J1D G;  5LP6 E;  2KWI B;  1LKX A;  2EHO B;  3GWH A;  2WM9 A;  4CXX A;  4UXN B;  1V9D A;  1WRD A;  2ZM0 A;  3I0Q A;  3PUR A;  3OJA A;  3JC6 D;  4O4L E;  4ZI7 E;  5JDL A;  2K24 A;  1MMA A;  4ERR A;  2X68 A;  4PJJ A;  2NW7 A;  3T8O A;  4TN7 B;  4MFR A;  2BZB A;  4HFV A;  2H3R A;  3ZJ2 A;  1E1H B;  2Z6E A;  4XBF B;  2X9W A;  2BVM A;  4PJM A;  3UUN A;  4ANJ A;  2WSS V;  2HH7 A;  2LSK A;  5LJN A;  3UUX B;  2YEV C;  3J7Y q;  4PFP A;  2XAQ B;  1EZ3 A;  5JDF A;  3C64 A;  4AXP A;  3NRX A;  4H9N C;  4NUV A;  2IAK A;  2ODV A;  3RKO A;  3RX6 A;  3TKL B;  2LE8 A;  1KNZ A;  4TZ4 C;  2XAJ B;  2CMR A;  4QXH B;  4TX5 A;  2JPF A;  5J2U E;  4U72 A;  3VU7 H;  3ZMV B;  5DAB A;  4O2B E;  2D5U A;  5EK4 A;  5L3F B;  5FXW A;  1UX5 A;  4UIG A;  2K48 A;  2UXN B;  1YKE B;  4EB6 E;  1WR6 A;  4UVC B;  5ETW A;  4YJ3 E;  3FXD B;  4OFZ A;  3ANW A;  1ZEE A;  2BDE A;  4UV8 B;  4WBN E;  3DTO A;  4H9P C;  1D0Z A;  1VOM A;  4A56 A;  2LOP A;  4HE8 A;  4PJL A;  1BR1 A;  3NZP A;  3AVR A;  2KND A;  2VKJ A;  3CQG B;  5IYZ E;  5M4Y A;  3I9Y A;  5LG4 A;  4PAG A;  5LGT B;  2Q9Q B;  3BQL A;  5CA1 E;  4P09 A;  3C51 A;  4ZI3 D;  3ZMS B;  4JEU B;  3KBT A;  4BA9 A;  3AAI A;  4WNK A;  2E8I A;  2Y48 B;  1H7C A;  2DLR A;  2ES0 A;  3J9X 1;  4AI6 A;  4UVB B;  4ILU A;  2C5J A;  3MZK B;  3DJB A;  2Q9Q D;  2VKO A;  2JMK A;  2E9X C;  3C4Z A;  2VAS A;  2W0G A;  1YW0 A;  4O4J E;  5L3D B;  2LHN A;  3MAC A;  2CE7 A;  2N9D A;  3AA1 B;  4QX7 B;  4ZS2 A;  4BAY B;  2NOX A;  4L9I A;  2LOS A;  3E0Z A;  2PFV A;  5JDN A;  2YU2 A;  2MOZ A;  1NWM X;  2ZM2 A;  2EHO A;  4PK6 A;  4ISS A;  4I4T E;  3Q5X A;  4EXT A;  3FHN A;  2MTQ A;  2YK0 A;  3F2E A;  4G2A A;  4GK0 E;  2KMF A;  3RYI E;  5FY0 A;  3RH3 A;  1IAP A;  1HS7 A;  4MAL A;  3UFE A;  1AJ3 A;  3EUH A;  1MMG A;  3RC3 A;  4QWN B;  3MJX A;  4QXC B;  3HI2 A;  2K5B B;  3AVS A;  3RYF E;  4TV9 E;  2KLQ A;  3IBP A;  3PUG A;  3CX8 B;  1U4Q A;  3N5L A;  4EZH A;  2W62 A;  3UTK A;  2KZ7 B;  5CA0 E;  3KDS E;  3FBZ A;  4E7Z A;  3HR0 A;  4AKG A;  2LT3 A;  3P8C D;  1HX8 A;  2IC9 A;  2LM9 A;  3M65 A;  4OYJ A;  2CWO A;  3BQI A;  3KVA A;  3N9O A;  3RYH E;  3W15 B;  5FMN A;  2CLY C;  5FYM A;  4OHF A;  3ZCI A;  3U3I A;  4ZI3 C;  4DBQ A;  2LHR A;  4I50 E;  4ADZ A;  2NTY A;  3U78 A;  3VHL A;  2B1E A;  4I43 B;  4IE7 A;  5EZY E;  1D1C A;  1LVF A;  3EDU A;  4GYS A;  3V5S A;  3D0T A;  1MMN A;  3E22 E;  2DCF A;  4U74 A;  2N1G A;  3MK7 C;  3P7I A;  2CXL A;  5FXZ A;  4TUY E;  2JRK A;  4XZC A;  3KV9 A;  3AAA B;  4QHO A;  3ZPO A;  3ZLI A;  1BR4 A;  4HKA A;  4EYU A;  2NW8 A;  4JUY A;  1Z0P A;  4YJ2 E;  4EYY R;  4DMW A;  2E9X B;  3ZMZ B;  3NBX X;  3NZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...