2C5KT

N-terminal domain of tlg1 complexed with n-terminus of vps51
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
89
Chain Sequence
EDPFQQVVKDTKEQLNRINNYITRHNTADDQEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFDRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 51
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 36
structure length 89
sequence length 91
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5kT00
2IC9A 2C5KT 2G0UA 4CQIA 4EYYR 1IJ5A 2K48A 2X9YA 2KWHA 4L0RA 3TKLB 1LRZA 2KWIB 3FXDB 4FI5A 1H7CA 1IJ6A 1QSDA 4DNDA 3CVRA 2MBGA 3QUJA 1LVFA 4J2CA 1Z0PA 3MXZA 2CA5A 2X9XA 3QK6A 3N5LA 4B6XA 2X9WA 2C5IT 3P7IA 3L3PA 3FXEB 2C5JA 3CKDA 2XTLA 2IC6A 3S4UA 1ZKEA
chains in the Genus database with same CATH superfamily
1R8IA 1WFDA 2BZBA 3EHZA 5ETWA 5LJMA 4ANJA 2CHOA 3AB3B 3FBZA 2D5UA 5JDGA 2D9DA 1M62A 5DJQC 4ZI2C 2UXNB 2CMRA 5CA1E 3NRYA 4HWCA 4XZCA 4WNKA 5L4EA 2DWKA 3P4QA 4O8SA 3JC6D 4ILCA 4DV7T 5L4HA 2BS4A 2IDOB 2GK9A 3HKDE 1MIVA 5FVLA 4AQFA 2B76A 4PK5A 4JEHB 2H88A 1W0BA 2A3DA 1N36T 5LG4A 4EOZB 2BS2A 2LSGA 4OX9T 4DR2T 4UEMA 2HHHT 3N2OA 3AEBA 5FMNA 2JQ9A 5CA0E 4ILUA 4HFHA 4LMKA 5FNVE 1D0XA 5FL1A 5H6RB 4KX6A 4FI5A 5LGTB 4TWDA 3J9X1 2M6BA 2YINA 2A9UA 4AXPA 3U3IA 4EB6E 4Z91A 2RP4A 3PE0A 2VKDA 4EXTA 3QB5K 3AA0B 4B3ST 5JQGE 1ZP0A 2X0LB 2BKNA 2E5LT 1QLBA 2WDQA 5LYJE 3ESLA 4CXXA 2FJBA 1KK7A 2XQ5A 5TAOA 2XHEB 2IW5B 2UXBT 3NZPA 2C5KT 3M65A 4U31A 1YQ3A 2D2SA 2UXDT 4PFOA 5HAXA 1VOMA 3RC3A 3BQLA 3UU3A 2CLYC 4TWFA 3AA7B 3AECA 4KUMB 4P09A 3RX6A 3FZMB 4X5TA 3KBTA 3EDUA 5LJNA 4H9OC 3PU3A 4Q25A 3QOFA 1ZOYA 2WY2A 1CHUA 3EUHA 4YTPA 2CWYA 3QB5A 4AI6A 1WYCA 1XNRT 5HXHA 3AEEA 2BG9A 3UUNA 3CK6A 1IZNB 3EI0A 5L3EB 4AQGA 4PK4A 4ZI2D 5GONE 5L2LA 4L9IA 4YY3T 3I9YA 4OK0A 2ODVA 2D0UA 3AE4A 2XAJB 3AVRA 3SS1A 5IUXA 4ZI3C 5LP6E 1QSDA 3EAMA 3RLFF 4PJLA 2W00A 4J2CA 2OV9A 4DIDB 5JREA 3VRAA 1ZKEA 4UF0B 2UXCT 3K3QC 3AE7A 4U7IA 4PJJA 3RKOA 2AXDS 4HFBA 1L0VA 2Y48B 4I43B 2J47A 4CN4A 1E2AA 3IA3A 2ZMAA 3MJXA 3W15B 3NVOA 4DMVA 1J5WA 4ZS3A 2WZHA 3NBXX 2L8KA 5LMUT 4TV9E 2YN6A 3AXJA 1HNXT 4CXWA 4X66T 2XUEA 4UR9A 3N5LA 2EHOC 2CBJA 4ERRA 3J7Yq 3QC9A 3CX8B 1NEKA 1FMVA 4DVDA 5KXJA 4CN1A 4IL4A 3VR9A 1HNWT 4MLKA 4AQYT 5JDLA 5JRCA 2B1EA 3AAEB 1UCUA 4A98A 2FJAA 5FXWA 3LFMA 5J0ZA 3OJAA 2E9XC 2V5CA 3E22E 3QK6A 5JR9B 2XM2A 1MMGA 4IIJE 3UU6A 4UVBB 4A97A 1FIOA 3NKZA 3ZN1B 4TV8E 2A72A 2XQ9A 4JI6T 4WW0A 2L3LA 5FY7A 1YXRA 3MKDA 2LRKA 4LMJA 4PJMA 1QUUA 3MXZA 5FY0A 1S94A 2LKGA 3O4XE 5F3JA 1VCSA 5H6QB 2CWOA 2I6HA 3A5XA 5LHGB 5JTGA 3FZLB 4MHCA 2KZ7B 2W66A 4TN7B 3LBXA 2V7LA 3AA1B 4JI3T 3MACA 4YHHT 3VKHA 1KFYA 3OKQA 4A5XA 3Q9DA 3CPZA 5FYMA 2X68A 2Q9QA 2RA1A 2SPCA 5ADXL 3P4WA 5CB4E 3P4PA 4ILAA 4HTEA 2H7OA 3FZHB 4UXNB 2QRXA 4IDNA 4NPPA 2AE9A 5HEOA 2V7MA 3MK7C 3CQXC 3KV9A 4LFBT 5JDMA 5FY1A 2VURA 4WBOA 2LSKA 5AQOB 2YDSA 4EYYR 3TLSA 3ANWA 3CIRA 4PAGA 2VL0A 2I0MA 5JDQA 3UFGA 5HWYA 4HWDA 5L3FB 4AKHA 4DV5T 2ZM2A 3K1SA 1OEDB 1ZV4X 5LNKA 2VL8A 2JJ9A 2JMKA 5EK3A 4LF6T 2NTYA 3ZMUB 2G0UA 2K9AA 4KBMB 5HEJA 3L09A 4CXYA 3AE3A 4H9SE 3I0OA 5JDHA 2PBIA 2N2NA 5JVDE 3RPUA 2VK9A 2NW7A 5J2TE 4MFRA 4AQFC 4PW8A 1I6ZA 2V26A 1D0ZA 5L3CB 3RRCA 2KXPB 2WCAA 3QNUA 1UURA 2DHRA 2K3WA 3HA4A 1LVKA 2XQ6A 3HKEE 2LOPA 2HN2A 3LSVA 3P50A 5LG3A 3FXDB 4PK6A 4P1NA 5DQVA 5HXCA 3OYXA 4ZS2A 4NXNT 3L8RA 2BS3A 3RIUA 3B13A 2IAKA 5JH7E 3Q2MA 2NWBA 4YTNA 3SFDA 4FJOA 2NOXA 5AQRB 4KMCA 3C98B 3ZJ2A 1IBLT 2V8SV 2X9WA 2X66A 4DUYT 3KV5A 3JADA 4HFIA 4JUYA 2ZM6T 3MZKB 3D0TA 3LK2B 2NP9A 1IBMT 4QX8B 4UELA 3CX6B 2ZM0A 5BR8T 4TWHA 5FL0A 2YDRA 2DL1A 1US7B 2HN1A 4IGUA 1JNZA 1XNQT 4QH1A 2UU9T 1W09A 4GYRA 4X1YE 2YK0A 1E7PA 2WWVA 2VKHA 2QYWA 4K0UA 1WR6A 4M1PA 4EV6A 2CXLA 3H37A 3TLVA 2LE8A 4U2ZA 2WAUA 3ZMTB 4TZ4C 2BG9C 5HXRA 1SE7A 2IHR1 3AEDA 3O1JA 4UIGA 4V1Av 3VKGA 3Q5DA 3JAFA 4JV5T 5LGUB 1U5PA 3P4SA 1XWMA 3TLTA 3TLUA 5HCMA 4X1IE 4OYKA 4LFAT 1HTJF 1CUNA 3ETVA 3ZKRA 4DV3T 1Z8UA 3UU4A 3AE8A 1XDPA 5C3JA 3Q5WA 4H9PC 2E8IA 5AQPB 2OA5A 3UULA 4F8HA 4ADZA 3N9OA 4DR5T 4CN6A 4ISSA 4TNWA 3K3OA 1UX5A 1ZHCA 3TKLB 2W67A 3Q5EA 2CPTA 3ZMSB 5FKYA 2X0YA 4E7SA 5FVKA 2XQ8A 3F57A 1WR0A 2VQFT 4ZXLA 2C5IT 2K24A 3IBPA 4GK5E 2QA7A 2V7IA 2KLQA 4JBWF 4QXBB 5HCJA 5LHIB 1WRDA 2Z6EA 5KMGP 3O1HA 2V7KA 3C51A 2PJQA 3Q5XA 3QUJA 3GWHA 4YJ3E 1KNPA 1ZEEA 2BBJA 2LHRA 2VQET 2JRKA 1JNRA 2BBHA 2YKSA 4YT0A 1NENA 4U72A 5LB7B 3RQUA 2KMFA 5C2TA 2XQ4A 4JLEA 4PJNA 4Z8XA 2W2UA 3HKBE 3RH3A 5EZYE 2W0GA 3BQKA 4EYUA 5AQNB 4ZI7E 3PUXF 1LKXA 3UT5E 5JR9A 2XZEA 4IDZA 3TLWA 5CFBA 2WB5A 3ZYKA 2V7JA 2LEHA 3OVUA 2J1DG 4B6XA 2JMHA 2H89A 5M4YA 4IREA 4IL9A 4QWNB 3IF8B 1J5ET 2KSRA 3ZSTA 2WZIA 2HH7A 2RPAA 4YSYA 2H7VC 2NW9A 4TX5A 3K8PC 4CI2B 5AQJB 3KVBA 3GN5A 1MNEA 4IE5A 1IBKT 2IC9A 3N9PA 2XASB 2Q9QC 3RF1A 2KWIB 4LMLA 2E5VA 3ONJA 4CI1B 2MBGA 3ZN0B 4DUZT 3HL6A 3MA9A 3ZYLA 2JPFA 3AAAB 2WS3A 3FXEB 5F8PA 3RYHE 3UQ7A 5HEUA 2JQQA 3B57A 4IE4A 1HFAA 3LK3B 2D0TA 3ZJ1A 2Y8DA 4OHFA 5KDMC 2XAGB 4NXMT 5AQIB 4B3MT 5FXVA 2CBIA 5LBQB 1W9RA 1U4QA 4DV0T 5AQGB 3ZT7A 1IAPA 2FUPA 5F5WA 4DV6T 1KNZA 5DABA 4ILBA 3O9XA 3UFEA 4COFA 2H3RA 1WCRA 1IJ6A 4ZOLE 4O4HE 4DR1T 4XBFB 3FBLA 4EIWA 2W4XA 3WI3A 4KI0F 1HX1B 1WYBA 2CM0A 3CQGB 1OEDA 2LSYA 5ABEA 3UTKA 1NWMX 3PUAA 4KHPT 3C50A 2BKPA 3VR8A 2DLRA 2E2AA 2CLYB 2XSBA 1VRBA 4DV1T 3KFWX 4L5GA 2VB6A 2W62A 3HKCE 2BG9E 3UUBA 4CQIA 4ZI3D 4NUUA 3CQCB 3AE9A 3AE1A 4KHZF 3KINB 2A2FX 2XQ3A 3PUVF 2XTLA 2XAQB 1YD8G 2BVLA 3RRWA 2PG8A 4GOUA 1IJ5A 2X67A 4MBQA 2ACZA 4O4LE 4LF7T 1M7KA 1BR2A 3JC6C 3RIUC 4CI3B 4EEBA 2HPJA 3PJAA 4BJMA 4H9QC 2K48A 1O3XA 3NWIA 5AQLB 5IWAT 1T8BA 1FMWA 5AQTB 1H7CA 1HX8A 3PV0F 3CMLA 4O2AE 1N34T 2X0HA 2WU5A 3WAKA 3H3AA 2EHOD 2N1GA 5FP3A 3PUYF 3V5SA 1T98A 4ASKA 3ABVA 3SFEA 3BQIA 2LJLA 2KNDA 4ZHQE 2K5BB 5BMVE 4UVCB 3UQ4A 2XQAA 3GMIA 4H63H 2LM2A 3UU5A 2C5JA 4IE7A 1D1BA 2WMNA 3PJAJ 2V6YB 3K3NA 5L3DB 2CXDA 2LKHA 2VVNA 1X79A 4LF8T 2E9XD 2UUCT 3LBXB 5A1LA 1G73A 3EVYA 4HFEA 4X62T 1KEYA 4I0UA 2EHOB 5CGMA 4GKKT 2IC6A 4HGAA 3RYFE 2Q9QB 3ZT6A 2CEAA 5HYAA 3X1DA 3KBUA 3U78A 3IHRA 3VRBA 3DJBA 4QX7B 4HEAA 3B5MA 4WYVA 5LMNT 2ES0A 4JEUB 3ZPOA 4DV4T 1FEWA 4EZHA 3I1AA 3AAIA 4G63A 2E9XB 3I9WA 1HR0T 5ABGA 4DR4T 4IT4A 3OPCA 2IMLA 1T7SA 3EABA 1MMNA 2XQ7A 2DNXA 1HNZT 5ABFB 2LM9A 2WDVA 4BA9A 4HWIB 1KNRA 2XAFB 1Z0PA 4WBNE 2MYSA 3L3PA 4Z90A 1N33T 4QXCB 5JDNA 4HWFA 5AQQB 4YSXA 1YW0A 3KVAA 3N2KE 1KF6A 5LXTE 3PUGA 2IUBA 1Y64B 4QKNA 2CCQA 2F4VT 3A7MA 4KP3C 2X9XA 1D1AA 1N32T 4AKRB 5HXEA 3EDVA 4YJ2E 4JI1T 2UUAT 3RIFA 2WBLA 4C91A 2LRLA 4C90A 2W61A 4IDOA 3ZMVB 5J2UE 2X51A 1EZ3A 4JI5T 4TUYE 2XAHB 4P0BA 5HEGA 3ZYMA 2CA5A 5J1GA 4QXHB 3FZFB 4OYJA 3CKDA 5AQMB 5AQHB 2ODUA 1B7TA 3PTRB 4DR3T 4NUVA 1XMOT 4JI7T 2J4GA 3JCFA 4O4JE 4GK0E 3UUXB 2DCFA 4DR6T 1MIWA 5FXZA 3UU8A 3V5UA 5JR9C 3N2GE 2ACXA 3RKGA 3C4WA 4UF0A 1S35A 2VASA 2YEVC 4HWHA 4OFZA 3NRXA 4QHOA 1VCTA 3RI5A 2X9HA 1SA0E 1BR4A 5CJ5A 1YKEB 3PDYA 2DWGA 4PFPA 2VKJA 3PUSA 4AISA 3T8OA 4K0KT 2V5DA 4YXDA 4HFDA 4LFCT 3ZC0A 2LLYA 3DP7A 1D1CA 2XJ7A 4ZZBA 3FZKB 4JI8T 4B3TT 2PTFA 3RC8A 4MALA 3PURA 3ZCJA 3UUMA 5EK2A 3M3ZB 4DNDA 3DTOA 5AQUB 4JI2T 2FJEA 3E0ZA 3HI2A 2WWUA 1E1HB 3T1YT 4QH5A 1FJGT 1HG2A 5AQVB 5FXXA 2I59A 4ZZCA 2R6GF 3CVRA 3RIAA 4GKJT 3C4ZA 1W0AA 5LGNB 2YOEA 3S4UA 3F31A 3ONXA 1HF8A 2XY8B 1XMQT 1BR0A 4IE0A 1WLXA 2L9QA 5DQWA 2BVMA 3N9NA 3LK42 3P4RA 4LF5T 4ISTA 1XDOA 1OEDC 3CX7B 3AEFA 4N78D 3RGLA 4HFCA 4TNVA 2KT9A 2KWHA 4G2AA 1LRZA 1OWAA 2N9DA 4U7YA 3AVSA 2WMOA 4HKAA 3LG7A 4H63V 3RQWA 3N9QA 5AQKB 3IEEA 4X1KE 2XQYA 3L39A 4H9RC 2M67A 2MOZA 4L0RA 3ZC1A 4DBQA 3PUQA 2WM9A 5L3GB 1XZYA 4X20E 2VKOA 3ONLC 4U74A 3T1HT 2FJDA 3JAEA 2FBWA 4YFSA 4JI4T 2JQKA 4EAHA 1GQEA 2YU2A 2J62A 1Y01A 2BG9B 1D0YA 4O4IE 5C8YE 3I0QA 1UGOA 2WU2A 5JDFA 2CE7A 4LF4T 4AKLA 4UV8B 5AQSB 5IHYA 2LHNA 2JQHA 5ABHA 4DMWA 2BDEA 2YU1A 2C0SA 3N9LA 3P7IA 3AE6A 4AKGA 3AEGA 4QH4A 5LA6E 1YQ4A 4X64T 2LT3A 2W63A 3KV4A 3LDQB 1HCIA 3C64A 2V6XA 3P8CD 4I55E 5LBMA 4DBRA 3ZMZB 3O1IA 1I94T 3OYZA 5AFUL 1HS7A 1SUMB 4YTMA 2UUBT 2ZLYA 3ZLIA 4U2YA 3SWHA 3OBVE 5LCYA 2VWAA 2ZM8A 4DV2T 3VU7H 5HXSA 3SOLA 4GYSA 3AXJB 4U3CA 2NR4A 1UK5A 1MIYA 4YSZA 3PUZF 5KX5E 3C4XA 2V6YA 3FHNA 1X9BA 3GN5B 3ZEFB 1MMAA 3VHLA 1DU2A 4U33A 1OXZA 4YLHA 4EZ4A 5EK4A 3KDSE 4ZEYA 1G8XA 5IYZE 3AE2A 2WDRA 2BKOA 3HR0A 2EHOA 2CRBA 2X9YA 2QVAA 4P0AA 1YKHB 3ZCIA 2LSIA 4H9NC 2CHNA 3NZQA 5JRCB 1J1JA 1AJ3A 4HE8A 4BJNA 2NW8A 2VVSA 3AE5A 2WQYA 3WAJA 4X65T 2WP9A 5AQFB 3PUWF 1V9DA 3CWZB 3N9MA 2E9XA 3R84B 3ZSSA 1BR1A 1SHZC 3RYIE 3E08A 4I4TE 5HWXA 2P9BA 2Q9QD 3LJCA 4I50E 4BAYB 4HFVA 2XM1A 4IE6A 1HG5A 3PU8A 3FB2A 4HN9A 5ABFA 4DR7T 3R6NA 1UUSA 4A56A 5LHHB 4UV9B 3A8YC 4IDPA 2UXXB 1MMDA 2NTXA 2OLTA 1UX4A 4PNIA 1MNDA 2V1DB 2QGSA 4O2BE 4XAXB 2MPKA 4E7ZA 3OTOT 4EEDA 4F6RC 2IIUA 4AKIA 3RYCE 2LOSA 2DI4A 5E0OA 3RHWA 4UVAB 2MAWA 3KV6A 2KINB 3AA6B 2MTQA 4LF9T 2CXFA 1T72A 2WSSV 5HEHA 2LSJA 3F2EA 1LVFA 4IHJE 4AIUA 2HPLA 4NIQA 4YHJA 3ETUA 4IDQA 4DO0A 4CZZB 2PFVA 3AEAA 2YDQA 4B3RT 4JYAT 5L3BB 4WZXA 2Y6XA 2JIWA 3H3MA 4EGWA 3G06A 3BK9A 5LOVE 4JI0T 1NAFA 2XSAA 2XPKA 1OEDE 5L47A 2M6IA 3ANWB 3GA8A 4GIWA 3ZT5A 3SRZA
chains in the Genus database with same CATH topology
2IC9A 2VKJA 3PUSA 2BZBA 5ETWA 3N9PA 4UXNB 5LJMA 2XASB 2Q9QC 3T8OA 4ANJA 2KWIB 2V7MA 3ZC0A 3MK7C 3AB3B 4CI1B 3CQXC 3KV9A 3DP7A 1D1CA 2MBGA 3ZN0B 3HL6A 3MA9A 3ZYLA 3FBZA 2JPFA 2D5UA 5JDMA 3AAAB 5JDGA 3FXEB 5FY1A 5F8PA 3RC8A 4WBOA 4MALA 3RYHE 5DJQC 2LSKA 4ZI2C 2UXNB 2JQQA 3B57A 3PURA 2CMRA 3ZCJA 5CA1E 3NRYA 4IE4A 1HFAA 4EYYR 4XZCA 3ANWA 3LK3B 2D0TA 3ZJ1A 2Y8DA 4WNKA 3UUMA 2DWKA 5EK2A 4PAGA 4OHFA 4O8SA 5KDMC 3JC6D 2XAGB 4DNDA 5FXVA 3DTOA 5JDQA 2GK9A 5HWYA 5L3FB 4AKHA 3HKDE 1MIVA 2ZM2A 5LBQB 1ZV4X 1U4QA 5LNKA 2VL8A 1IAPA 3E0ZA 2JJ9A 2JMKA 5EK3A 2NTYA 3ZMUB 2G0UA 2K9AA 3HI2A 2WWUA 4KBMB 1E1HB 4AQFA 1KNZA 5DABA 4PK5A 1HG2A 3O9XA 4JEHB 3L09A 3UFEA 4CXYA 5FXXA 2H3RA 2A3DA 2I59A 4H9SE 3I0OA 1IJ6A 5LG4A 4ZOLE 4EOZB 4O4HE 5JDHA 3CVRA 2PBIA 4XBFB 2N2NA 2LSGA 3FBLA 4EIWA 5JVDE 3RPUA 3WI3A 2VK9A 2NW7A 5J2TE 3C4ZA 4UEMA 1WYBA 5LGNB 4MFRA 3S4UA 3F31A 3N2OA 5FMNA 4AQFC 2CM0A 3CQGB 3ONXA 5CA0E 1HF8A 2LSYA 4PW8A 2V26A 4ILUA 1BR0A 5FNVE 3UTKA 1NWMX 3PUAA 1D0XA 1D0ZA 5L3CB 3RRCA 2KXPB 3C50A 1WLXA 4IE0A 5H6RB 2L9QA 4FI5A 5LGTB 5DQWA 2DHRA 2DLRA 3HA4A 1LVKA 3J9X1 2BVMA 2CLYB 2YINA 3N9NA 4AXPA 3LK42 3U3IA 1VRBA 4ISTA 4EB6E 3HKEE 3KFWX 4L5GA 2VB6A 2RP4A 2W62A 3HKCE 3CX7B 2LOPA 3PE0A 4N78D 2VKDA 4EXTA 4CQIA 4ZI3D 2KT9A 2KWHA 3AA0B 4G2AA 1LRZA 4NUUA 1OWAA 5JQGE 2X0LB 2N9DA 3FXDB 3CQCB 4PK6A 5LYJE 3ESLA 5DQVA 5HXCA 4CXXA 3OYXA 4ZS2A 3AVSA 1KK7A 2WMOA 3KINB 4HKAA 5TAOA 2A2FX 2XHEB 2IW5B 3LG7A 4H63V 3B13A 2XTLA 2XAQB 3N9QA 1YD8G 3IEEA 2BVLA 3NZPA 4X1KE 2C5KT 2IAKA 2XQYA 3RRWA 4H9RC 2PG8A 4GOUA 2M67A 3M65A 2MOZA 1IJ5A 5JH7E 2X67A 3Q2MA 4L0RA 2NWBA 4MBQA 3ZC1A 2D2SA 4FJOA 4DBQA 3PUQA 2NOXA 4PFOA 2WM9A 5HAXA 1VOMA 3RC3A 4O4LE 5L3GB 3BQLA 4KMCA 2VKOA 4X20E 1BR2A 3C98B 3ZJ2A 3JC6C 4U74A 4CI3B 2X9WA 2CLYC 2X66A 2HPJA 3AA7B 4YFSA 3KV5A 4EAHA 4JUYA 4BJMA 4H9QC 2YU2A 3MZKB 3D0TA 3LK2B 2K48A 2NP9A 4KUMB 4P09A 1O3XA 1D0YA 3RX6A 4O4IE 5C8YE 3I0QA 4QX8B 4UELA 5JDFA 3CX6B 2ZM0A 1FMWA 3KBTA 2CE7A 1H7CA 1HX8A 4AKLA 3CMLA 3EDUA 4O2AE 4UV8B 5LJNA 1US7B 4H9OC 5IHYA 3PU3A 2LHNA 3WAKA 4DMWA 3H3AA 2EHOD 4IGUA 2BDEA 2YU1A 2C0SA 2N1GA 3N9LA 3P7IA 4AKGA 3EUHA 5FP3A 5LA6E 3V5SA 1T98A 2CWYA 4GYRA 4X1YE 4ASKA 4AI6A 2YK0A 2LT3A 2W63A 1WYCA 2VKHA 5HXHA 3BQIA 1WR6A 3KV4A 4K0UA 3UUNA 2LJLA 1IZNB 2KNDA 4M1PA 2K5BB 4ZHQE 5BMVE 4UVCB 2CXLA 1HCIA 3C64A 5L3EB 3H37A 4AQGA 4PK4A 4ZI2D 3GMIA 5GONE 4H63H 5L2LA 3P8CD 2LE8A 2C5JA 4L9IA 4I55E 5LBMA 4IE7A 2WAUA 3I9YA 4OK0A 4DBRA 1D1BA 2WMNA 2ODVA 3ZMZB 2D0UA 3O1IA 3ZMTB 3K3NA 2XAJB 5L3DB 3AVRA 3OYZA 5AFUL 2CXDA 3SS1A 1HS7A 4TZ4C 1X79A 4ZI3C 5HXRA 2E9XD 3LBXB 3O1JA 2ZLYA 1QSDA 3ZLIA 5LP6E 4UIGA 4V1Av 1G73A 5A1LA 4PJLA 3SWHA 3EVYA 3VKGA 2W00A 4J2CA 3OBVE 5LCYA 5JREA 2VWAA 2EHOB 2ZM8A 3VU7H 2IC6A 3SOLA 5HXSA 1ZKEA 4GYSA 4HGAA 4UF0B 3RYFE 2Q9QB 2CEAA 3K3QC 5HYAA 4PJJA 5LGUB 3RKOA 1U5PA 1MIYA 5KX5E 3C4XA 2Y48B 3FHNA 3KBUA 3U78A 3IHRA 4I43B 4X1IE 3DJBA 4QX7B 4OYKA 4HEAA 3GN5B 3ZEFB 2ES0A 1MMAA 3VHLA 1OXZA 4YLHA 4EZ4A 2ZMAA 3MJXA 4JEUB 5EK4A 3W15B 1HTJF 1CUNA 3KDSE 3ZPOA 1G8XA 5IYZE 3ETVA 4DMVA 3HR0A 2EHOA 4ZS3A 1FEWA 3NBXX 2L8KA 3Q5WA 2X9YA 2E8IA 4H9PC 4TV9E 2OA5A 4EZHA 3UULA 3I1AA 3AAIA 4G63A 2E9XB 4P0AA 4ADZA 4CXWA 1YKHB 3I9WA 3ZCIA 2LSIA 4H9NC 2XUEA 3N9OA 3NZQA 5JRCB 3N5LA 2EHOC 1AJ3A 4HE8A 4ISSA 1MMNA 2DNXA 3K3OA 4BJNA 1UX5A 1ZHCA 2NW8A 2LM9A 4ERRA 4BA9A 3J7Yq 3TKLB 3QC9A 3CX8B 3ZMSB 1FMVA 3WAJA 4DVDA 4E7SA 1V9DA 3CWZB 3F57A 3N9MA 2E9XA 2XAFB 1Z0PA 3R84B 4WBNE 4MLKA 1BR1A 5JDLA 2C5IT 2MYSA 3L3PA 1SHZC 2K24A 3IBPA 3RYIE 4GK5E 2QA7A 2V7IA 3E08A 5JRCA 2B1EA 2KLQA 4QXCB 4I4TE 5JDNA 4QXBB 5HWXA 5LHIB 2P9BA 3AAEB 2Q9QD 1YW0A 3LJCA 4I50E 1WRDA 2Z6EA 1UCUA 3KVAA 4HFVA 4BAYB 5FXWA 5KMGP 3O1HA 3N2KE 4IE6A 3LFMA 1HG5A 3PU8A 2V7KA 3FB2A 5LXTE 4HN9A 3C51A 3PUGA 3OJAA 3R6NA 2E9XC 4A56A 2PJQA 3Q5XA 3QUJA 1Y64B 3GWHA 4QKNA 2CCQA 3E22E 4YJ3E 1ZEEA 5LHHB 4KP3C 2X9XA 1D1AA 3QK6A 2LHRA 5JR9B 1MMGA 2JRKA 4UV9B 4IIJE 4AKRB 5HXEA 4UVBB 3EDVA 4YJ2E 1FIOA 2UXXB 1MMDA 2NTXA 3ZN1B 4TV8E 2A72A 2WBLA 4U72A 4C91A 4C90A 2W61A 2KMFA 4WW0A 1UX4A 4PNIA 3ZMVB 5J2UE 2L3LA 1MNDA 4JLEA 4PJNA 2X51A 5FY7A 1EZ3A 2V1DB 2QGSA 4O2BE 4TUYE 4Z8XA 4XAXB 3MKDA 2XAHB 3HKBE 4E7ZA 4PJMA 4P0BA 3RH3A 1QUUA 5EZYE 2W0GA 2CA5A 3MXZA 5J1GA 3BQKA 3ZYMA 4F6RC 4QXHB 1S94A 3O4XE 5FY0A 4EYUA 5F3JA 4OYJA 4ZI7E 3CKDA 5H6QB 4AKIA 3RYCE 1LKXA 2LOSA 3UT5E 5JR9A 2CWOA 2ODUA 1B7TA 3PTRB 4NUVA 3A5XA 5LHGB 2DI4A 5E0OA 4MHCA 4IDZA 4UVAB 3KV6A 2KINB 3AA6B 2KZ7B 2MTQA 2CXFA 3ZYKA 4O4JE 2WSSV 2V7JA 2LEHA 2LSJA 3F2EA 4GK0E 3UUXB 1LVFA 2DCFA 4IHJE 4TN7B 2HPLA 3LBXA 2J1DG 4B6XA 4YHJA 1MIWA 5FXZA 2V7LA 3ETUA 3V5UA 3AA1B 2JMHA 4DO0A 5JR9C 4CZZB 2PFVA 3N2GE 3MACA 3VKHA 5M4YA 3OKQA 2ACXA 5L3BB 4QWNB 2Y6XA 3IF8B 3Q9DA 3C4WA 3CPZA 5FYMA 2X68A 4UF0A 2Q9QA 2HH7A 1S35A 2RA1A 2VASA 3BK9A 2YEVC 2SPCA 5ADXL 5LOVE 5CB4E 4OFZA 2H7VC 2NW9A 4TX5A 3K8PC 1NAFA 3NRXA 4CI2B 4QHOA 3KVBA 2X9HA 1SA0E 1BR4A 3GN5A 1MNEA 4HTEA 3ANWB 3GA8A 2H7OA 1YKEB 4IE5A 4GIWA 3PDYA 2DWGA 3SRZA 4PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IC9 A;  2C5K T;  2G0U A;  4CQI A;  4EYY R;  1IJ5 A;  2K48 A;  2X9Y A;  2KWH A;  4L0R A;  3TKL B;  1LRZ A;  2KWI B;  3FXD B;  4FI5 A;  1H7C A;  1IJ6 A;  1QSD A;  4DND A;  3CVR A;  2MBG A;  3QUJ A;  1LVF A;  4J2C A;  1Z0P A;  3MXZ A;  2CA5 A;  2X9X A;  3QK6 A;  3N5L A;  4B6X A;  2X9W A;  2C5I T;  3P7I A;  3L3P A;  3FXE B;  2C5J A;  3CKD A;  2XTL A;  2IC6 A;  3S4U A;  1ZKE A; 
#chains in the Genus database with same CATH topology
 1R8I A;  1WFD A;  2BZB A;  3EHZ A;  5ETW A;  5LJM A;  4ANJ A;  2CHO A;  3AB3 B;  3FBZ A;  2D5U A;  5JDG A;  2D9D A;  1M62 A;  5DJQ C;  4ZI2 C;  2UXN B;  2CMR A;  5CA1 E;  3NRY A;  4HWC A;  4XZC A;  4WNK A;  5L4E A;  2DWK A;  3P4Q A;  4O8S A;  3JC6 D;  4ILC A;  4DV7 T;  5L4H A;  2BS4 A;  2IDO B;  2GK9 A;  3HKD E;  1MIV A;  5FVL A;  4AQF A;  2B76 A;  4PK5 A;  4JEH B;  2H88 A;  1W0B A;  2A3D A;  1N36 T;  5LG4 A;  4EOZ B;  2BS2 A;  2LSG A;  4OX9 T;  4DR2 T;  4UEM A;  2HHH T;  3N2O A;  3AEB A;  5FMN A;  2JQ9 A;  5CA0 E;  4ILU A;  4HFH A;  4LMK A;  5FNV E;  1D0X A;  5FL1 A;  5H6R B;  4KX6 A;  4FI5 A;  5LGT B;  4TWD A;  3J9X 1;  2M6B A;  2YIN A;  2A9U A;  4AXP A;  3U3I A;  4EB6 E;  4Z91 A;  2RP4 A;  3PE0 A;  2VKD A;  4EXT A;  3QB5 K;  3AA0 B;  4B3S T;  5JQG E;  1ZP0 A;  2X0L B;  2BKN A;  2E5L T;  1QLB A;  2WDQ A;  5LYJ E;  3ESL A;  4CXX A;  2FJB A;  1KK7 A;  2XQ5 A;  5TAO A;  2XHE B;  2IW5 B;  2UXB T;  3NZP A;  2C5K T;  3M65 A;  4U31 A;  1YQ3 A;  2D2S A;  2UXD T;  4PFO A;  5HAX A;  1VOM A;  3RC3 A;  3BQL A;  3UU3 A;  2CLY C;  4TWF A;  3AA7 B;  3AEC A;  4KUM B;  4P09 A;  3RX6 A;  3FZM B;  4X5T A;  3KBT A;  3EDU A;  5LJN A;  4H9O C;  3PU3 A;  4Q25 A;  3QOF A;  1ZOY A;  2WY2 A;  1CHU A;  3EUH A;  4YTP A;  2CWY A;  3QB5 A;  4AI6 A;  1WYC A;  1XNR T;  5HXH A;  3AEE A;  2BG9 A;  3UUN A;  3CK6 A;  1IZN B;  3EI0 A;  5L3E B;  4AQG A;  4PK4 A;  4ZI2 D;  5GON E;  5L2L A;  4L9I A;  4YY3 T;  3I9Y A;  4OK0 A;  2ODV A;  2D0U A;  3AE4 A;  2XAJ B;  3AVR A;  3SS1 A;  5IUX A;  4ZI3 C;  5LP6 E;  1QSD A;  3EAM A;  3RLF F;  4PJL A;  2W00 A;  4J2C A;  2OV9 A;  4DID B;  5JRE A;  3VRA A;  1ZKE A;  4UF0 B;  2UXC T;  3K3Q C;  3AE7 A;  4U7I A;  4PJJ A;  3RKO A;  2AXD S;  4HFB A;  1L0V A;  2Y48 B;  4I43 B;  2J47 A;  4CN4 A;  1E2A A;  3IA3 A;  2ZMA A;  3MJX A;  3W15 B;  3NVO A;  4DMV A;  1J5W A;  4ZS3 A;  2WZH A;  3NBX X;  2L8K A;  5LMU T;  4TV9 E;  2YN6 A;  3AXJ A;  1HNX T;  4CXW A;  4X66 T;  2XUE A;  4UR9 A;  3N5L A;  2EHO C;  2CBJ A;  4ERR A;  3J7Y q;  3QC9 A;  3CX8 B;  1NEK A;  1FMV A;  4DVD A;  5KXJ A;  4CN1 A;  4IL4 A;  3VR9 A;  1HNW T;  4MLK A;  4AQY T;  5JDL A;  5JRC A;  2B1E A;  3AAE B;  1UCU A;  4A98 A;  2FJA A;  5FXW A;  3LFM A;  5J0Z A;  3OJA A;  2E9X C;  2V5C A;  3E22 E;  3QK6 A;  5JR9 B;  2XM2 A;  1MMG A;  4IIJ E;  3UU6 A;  4UVB B;  4A97 A;  1FIO A;  3NKZ A;  3ZN1 B;  4TV8 E;  2A72 A;  2XQ9 A;  4JI6 T;  4WW0 A;  2L3L A;  5FY7 A;  1YXR A;  3MKD A;  2LRK A;  4LMJ A;  4PJM A;  1QUU A;  3MXZ A;  5FY0 A;  1S94 A;  2LKG A;  3O4X E;  5F3J A;  1VCS A;  5H6Q B;  2CWO A;  2I6H A;  3A5X A;  5LHG B;  5JTG A;  3FZL B;  4MHC A;  2KZ7 B;  2W66 A;  4TN7 B;  3LBX A;  2V7L A;  3AA1 B;  4JI3 T;  3MAC A;  4YHH T;  3VKH A;  1KFY A;  3OKQ A;  4A5X A;  3Q9D A;  3CPZ A;  5FYM A;  2X68 A;  2Q9Q A;  2RA1 A;  2SPC A;  5ADX L;  3P4W A;  5CB4 E;  3P4P A;  4ILA A;  4HTE A;  2H7O A;  3FZH B;  4UXN B;  2QRX A;  4IDN A;  4NPP A;  2AE9 A;  5HEO A;  2V7M A;  3MK7 C;  3CQX C;  3KV9 A;  4LFB T;  5JDM A;  5FY1 A;  2VUR A;  4WBO A;  2LSK A;  5AQO B;  2YDS A;  4EYY R;  3TLS A;  3ANW A;  3CIR A;  4PAG A;  2VL0 A;  2I0M A;  5JDQ A;  3UFG A;  5HWY A;  4HWD A;  5L3F B;  4AKH A;  4DV5 T;  2ZM2 A;  3K1S A;  1OED B;  1ZV4 X;  5LNK A;  2VL8 A;  2JJ9 A;  2JMK A;  5EK3 A;  4LF6 T;  2NTY A;  3ZMU B;  2G0U A;  2K9A A;  4KBM B;  5HEJ A;  3L09 A;  4CXY A;  3AE3 A;  4H9S E;  3I0O A;  5JDH A;  2PBI A;  2N2N A;  5JVD E;  3RPU A;  2VK9 A;  2NW7 A;  5J2T E;  4MFR A;  4AQF C;  4PW8 A;  1I6Z A;  2V26 A;  1D0Z A;  5L3C B;  3RRC A;  2KXP B;  2WCA A;  3QNU A;  1UUR A;  2DHR A;  2K3W A;  3HA4 A;  1LVK A;  2XQ6 A;  3HKE E;  2LOP A;  2HN2 A;  3LSV A;  3P50 A;  5LG3 A;  3FXD B;  4PK6 A;  4P1N A;  5DQV A;  5HXC A;  3OYX A;  4ZS2 A;  4NXN T;  3L8R A;  2BS3 A;  3RIU A;  3B13 A;  2IAK A;  5JH7 E;  3Q2M A;  2NWB A;  4YTN A;  3SFD A;  4FJO A;  2NOX A;  5AQR B;  4KMC A;  3C98 B;  3ZJ2 A;  1IBL T;  2V8S V;  2X9W A;  2X66 A;  4DUY T;  3KV5 A;  3JAD A;  4HFI A;  4JUY A;  2ZM6 T;  3MZK B;  3D0T A;  3LK2 B;  2NP9 A;  1IBM T;  4QX8 B;  4UEL A;  3CX6 B;  2ZM0 A;  5BR8 T;  4TWH A;  5FL0 A;  2YDR A;  2DL1 A;  1US7 B;  2HN1 A;  4IGU A;  1JNZ A;  1XNQ T;  4QH1 A;  2UU9 T;  1W09 A;  4GYR A;  4X1Y E;  2YK0 A;  1E7P A;  2WWV A;  2VKH A;  2QYW A;  4K0U A;  1WR6 A;  4M1P A;  4EV6 A;  2CXL A;  3H37 A;  3TLV A;  2LE8 A;  4U2Z A;  2WAU A;  3ZMT B;  4TZ4 C;  2BG9 C;  5HXR A;  1SE7 A;  2IHR 1;  3AED A;  3O1J A;  4UIG A;  4V1A v;  3VKG A;  3Q5D A;  3JAF A;  4JV5 T;  5LGU B;  1U5P A;  3P4S A;  1XWM A;  3TLT A;  3TLU A;  5HCM A;  4X1I E;  4OYK A;  4LFA T;  1HTJ F;  1CUN A;  3ETV A;  3ZKR A;  4DV3 T;  1Z8U A;  3UU4 A;  3AE8 A;  1XDP A;  5C3J A;  3Q5W A;  4H9P C;  2E8I A;  5AQP B;  2OA5 A;  3UUL A;  4F8H A;  4ADZ A;  3N9O A;  4DR5 T;  4CN6 A;  4ISS A;  4TNW A;  3K3O A;  1UX5 A;  1ZHC A;  3TKL B;  2W67 A;  3Q5E A;  2CPT A;  3ZMS B;  5FKY A;  2X0Y A;  4E7S A;  5FVK A;  2XQ8 A;  3F57 A;  1WR0 A;  2VQF T;  4ZXL A;  2C5I T;  2K24 A;  3IBP A;  4GK5 E;  2QA7 A;  2V7I A;  2KLQ A;  4JBW F;  4QXB B;  5HCJ A;  5LHI B;  1WRD A;  2Z6E A;  5KMG P;  3O1H A;  2V7K A;  3C51 A;  2PJQ A;  3Q5X A;  3QUJ A;  3GWH A;  4YJ3 E;  1KNP A;  1ZEE A;  2BBJ A;  2LHR A;  2VQE T;  2JRK A;  1JNR A;  2BBH A;  2YKS A;  4YT0 A;  1NEN A;  4U72 A;  5LB7 B;  3RQU A;  2KMF A;  5C2T A;  2XQ4 A;  4JLE A;  4PJN A;  4Z8X A;  2W2U A;  3HKB E;  3RH3 A;  5EZY E;  2W0G A;  3BQK A;  4EYU A;  5AQN B;  4ZI7 E;  3PUX F;  1LKX A;  3UT5 E;  5JR9 A;  2XZE A;  4IDZ A;  3TLW A;  5CFB A;  2WB5 A;  3ZYK A;  2V7J A;  2LEH A;  3OVU A;  2J1D G;  4B6X A;  2JMH A;  2H89 A;  5M4Y A;  4IRE A;  4IL9 A;  4QWN B;  3IF8 B;  1J5E T;  2KSR A;  3ZST A;  2WZI A;  2HH7 A;  2RPA A;  4YSY A;  2H7V C;  2NW9 A;  4TX5 A;  3K8P C;  4CI2 B;  5AQJ B;  3KVB A;  3GN5 A;  1MNE A;  4IE5 A;  1IBK T;  2IC9 A;  3N9P A;  2XAS B;  2Q9Q C;  3RF1 A;  2KWI B;  4LML A;  2E5V A;  3ONJ A;  4CI1 B;  2MBG A;  3ZN0 B;  4DUZ T;  3HL6 A;  3MA9 A;  3ZYL A;  2JPF A;  3AAA B;  2WS3 A;  3FXE B;  5F8P A;  3RYH E;  3UQ7 A;  5HEU A;  2JQQ A;  3B57 A;  4IE4 A;  1HFA A;  3LK3 B;  2D0T A;  3ZJ1 A;  2Y8D A;  4OHF A;  5KDM C;  2XAG B;  4NXM T;  5AQI B;  4B3M T;  5FXV A;  2CBI A;  5LBQ B;  1W9R A;  1U4Q A;  4DV0 T;  5AQG B;  3ZT7 A;  1IAP A;  2FUP A;  5F5W A;  4DV6 T;  1KNZ A;  5DAB A;  4ILB A;  3O9X A;  3UFE A;  4COF A;  2H3R A;  1WCR A;  1IJ6 A;  4ZOL E;  4O4H E;  4DR1 T;  4XBF B;  3FBL A;  4EIW A;  2W4X A;  3WI3 A;  4KI0 F;  1HX1 B;  1WYB A;  2CM0 A;  3CQG B;  1OED A;  2LSY A;  5ABE A;  3UTK A;  1NWM X;  3PUA A;  4KHP T;  3C50 A;  2BKP A;  3VR8 A;  2DLR A;  2E2A A;  2CLY B;  2XSB A;  1VRB A;  4DV1 T;  3KFW X;  4L5G A;  2VB6 A;  2W62 A;  3HKC E;  2BG9 E;  3UUB A;  4CQI A;  4ZI3 D;  4NUU A;  3CQC B;  3AE9 A;  3AE1 A;  4KHZ F;  3KIN B;  2A2F X;  2XQ3 A;  3PUV F;  2XTL A;  2XAQ B;  1YD8 G;  2BVL A;  3RRW A;  2PG8 A;  4GOU A;  1IJ5 A;  2X67 A;  4MBQ A;  2ACZ A;  4O4L E;  4LF7 T;  1M7K A;  1BR2 A;  3JC6 C;  3RIU C;  4CI3 B;  4EEB A;  2HPJ A;  3PJA A;  4BJM A;  4H9Q C;  2K48 A;  1O3X A;  3NWI A;  5AQL B;  5IWA T;  1T8B A;  1FMW A;  5AQT B;  1H7C A;  1HX8 A;  3PV0 F;  3CML A;  4O2A E;  1N34 T;  2X0H A;  2WU5 A;  3WAK A;  3H3A A;  2EHO D;  2N1G A;  5FP3 A;  3PUY F;  3V5S A;  1T98 A;  4ASK A;  3ABV A;  3SFE A;  3BQI A;  2LJL A;  2KND A;  4ZHQ E;  2K5B B;  5BMV E;  4UVC B;  3UQ4 A;  2XQA A;  3GMI A;  4H63 H;  2LM2 A;  3UU5 A;  2C5J A;  4IE7 A;  1D1B A;  2WMN A;  3PJA J;  2V6Y B;  3K3N A;  5L3D B;  2CXD A;  2LKH A;  2VVN A;  1X79 A;  4LF8 T;  2E9X D;  2UUC T;  3LBX B;  5A1L A;  1G73 A;  3EVY A;  4HFE A;  4X62 T;  1KEY A;  4I0U A;  2EHO B;  5CGM A;  4GKK T;  2IC6 A;  4HGA A;  3RYF E;  2Q9Q B;  3ZT6 A;  2CEA A;  5HYA A;  3X1D A;  3KBU A;  3U78 A;  3IHR A;  3VRB A;  3DJB A;  4QX7 B;  4HEA A;  3B5M A;  4WYV A;  5LMN T;  2ES0 A;  4JEU B;  3ZPO A;  4DV4 T;  1FEW A;  4EZH A;  3I1A A;  3AAI A;  4G63 A;  2E9X B;  3I9W A;  1HR0 T;  5ABG A;  4DR4 T;  4IT4 A;  3OPC A;  2IML A;  1T7S A;  3EAB A;  1MMN A;  2XQ7 A;  2DNX A;  1HNZ T;  5ABF B;  2LM9 A;  2WDV A;  4BA9 A;  4HWI B;  1KNR A;  2XAF B;  1Z0P A;  4WBN E;  2MYS A;  3L3P A;  4Z90 A;  1N33 T;  4QXC B;  5JDN A;  4HWF A;  5AQQ B;  4YSX A;  1YW0 A;  3KVA A;  3N2K E;  1KF6 A;  5LXT E;  3PUG A;  2IUB A;  1Y64 B;  4QKN A;  2CCQ A;  2F4V T;  3A7M A;  4KP3 C;  2X9X A;  1D1A A;  1N32 T;  4AKR B;  5HXE A;  3EDV A;  4YJ2 E;  4JI1 T;  2UUA T;  3RIF A;  2WBL A;  4C91 A;  2LRL A;  4C90 A;  2W61 A;  4IDO A;  3ZMV B;  5J2U E;  2X51 A;  1EZ3 A;  4JI5 T;  4TUY E;  2XAH B;  4P0B A;  5HEG A;  3ZYM A;  2CA5 A;  5J1G A;  4QXH B;  3FZF B;  4OYJ A;  3CKD A;  5AQM B;  5AQH B;  2ODU A;  1B7T A;  3PTR B;  4DR3 T;  4NUV A;  1XMO T;  4JI7 T;  2J4G A;  3JCF A;  4O4J E;  4GK0 E;  3UUX B;  2DCF A;  4DR6 T;  1MIW A;  5FXZ A;  3UU8 A;  3V5U A;  5JR9 C;  3N2G E;  2ACX A;  3RKG A;  3C4W A;  4UF0 A;  1S35 A;  2VAS A;  2YEV C;  4HWH A;  4OFZ A;  3NRX A;  4QHO A;  1VCT A;  3RI5 A;  2X9H A;  1SA0 E;  1BR4 A;  5CJ5 A;  1YKE B;  3PDY A;  2DWG A;  4PFP A;  2VKJ A;  3PUS A;  4AIS A;  3T8O A;  4K0K T;  2V5D A;  4YXD A;  4HFD A;  4LFC T;  3ZC0 A;  2LLY A;  3DP7 A;  1D1C A;  2XJ7 A;  4ZZB A;  3FZK B;  4JI8 T;  4B3T T;  2PTF A;  3RC8 A;  4MAL A;  3PUR A;  3ZCJ A;  3UUM A;  5EK2 A;  3M3Z B;  4DND A;  3DTO A;  5AQU B;  4JI2 T;  2FJE A;  3E0Z A;  3HI2 A;  2WWU A;  1E1H B;  3T1Y T;  4QH5 A;  1FJG T;  1HG2 A;  5AQV B;  5FXX A;  2I59 A;  4ZZC A;  2R6G F;  3CVR A;  3RIA A;  4GKJ T;  3C4Z A;  1W0A A;  5LGN B;  2YOE A;  3S4U A;  3F31 A;  3ONX A;  1HF8 A;  2XY8 B;  1XMQ T;  1BR0 A;  4IE0 A;  1WLX A;  2L9Q A;  5DQW A;  2BVM A;  3N9N A;  3LK4 2;  3P4R A;  4LF5 T;  4IST A;  1XDO A;  1OED C;  3CX7 B;  3AEF A;  4N78 D;  3RGL A;  4HFC A;  4TNV A;  2KT9 A;  2KWH A;  4G2A A;  1LRZ A;  1OWA A;  2N9D A;  4U7Y A;  3AVS A;  2WMO A;  4HKA A;  3LG7 A;  4H63 V;  3RQW A;  3N9Q A;  5AQK B;  3IEE A;  4X1K E;  2XQY A;  3L39 A;  4H9R C;  2M67 A;  2MOZ A;  4L0R A;  3ZC1 A;  4DBQ A;  3PUQ A;  2WM9 A;  5L3G B;  1XZY A;  4X20 E;  2VKO A;  3ONL C;  4U74 A;  3T1H T;  2FJD A;  3JAE A;  2FBW A;  4YFS A;  4JI4 T;  2JQK A;  4EAH A;  1GQE A;  2YU2 A;  2J62 A;  1Y01 A;  2BG9 B;  1D0Y A;  4O4I E;  5C8Y E;  3I0Q A;  1UGO A;  2WU2 A;  5JDF A;  2CE7 A;  4LF4 T;  4AKL A;  4UV8 B;  5AQS B;  5IHY A;  2LHN A;  2JQH A;  5ABH A;  4DMW A;  2BDE A;  2YU1 A;  2C0S A;  3N9L A;  3P7I A;  3AE6 A;  4AKG A;  3AEG A;  4QH4 A;  5LA6 E;  1YQ4 A;  4X64 T;  2LT3 A;  2W63 A;  3KV4 A;  3LDQ B;  1HCI A;  3C64 A;  2V6X A;  3P8C D;  4I55 E;  5LBM A;  4DBR A;  3ZMZ B;  3O1I A;  1I94 T;  3OYZ A;  5AFU L;  1HS7 A;  1SUM B;  4YTM A;  2UUB T;  2ZLY A;  3ZLI A;  4U2Y A;  3SWH A;  3OBV E;  5LCY A;  2VWA A;  2ZM8 A;  4DV2 T;  3VU7 H;  5HXS A;  3SOL A;  4GYS A;  3AXJ B;  4U3C A;  2NR4 A;  1UK5 A;  1MIY A;  4YSZ A;  3PUZ F;  5KX5 E;  3C4X A;  2V6Y A;  3FHN A;  1X9B A;  3GN5 B;  3ZEF B;  1MMA A;  3VHL A;  1DU2 A;  4U33 A;  1OXZ A;  4YLH A;  4EZ4 A;  5EK4 A;  3KDS E;  4ZEY A;  1G8X A;  5IYZ E;  3AE2 A;  2WDR A;  2BKO A;  3HR0 A;  2EHO A;  2CRB A;  2X9Y A;  2QVA A;  4P0A A;  1YKH B;  3ZCI A;  2LSI A;  4H9N C;  2CHN A;  3NZQ A;  5JRC B;  1J1J A;  1AJ3 A;  4HE8 A;  4BJN A;  2NW8 A;  2VVS A;  3AE5 A;  2WQY A;  3WAJ A;  4X65 T;  2WP9 A;  5AQF B;  3PUW F;  1V9D A;  3CWZ B;  3N9M A;  2E9X A;  3R84 B;  3ZSS A;  1BR1 A;  1SHZ C;  3RYI E;  3E08 A;  4I4T E;  5HWX A;  2P9B A;  2Q9Q D;  3LJC A;  4I50 E;  4BAY B;  4HFV A;  2XM1 A;  4IE6 A;  1HG5 A;  3PU8 A;  3FB2 A;  4HN9 A;  5ABF A;  4DR7 T;  3R6N A;  1UUS A;  4A56 A;  5LHH B;  4UV9 B;  3A8Y C;  4IDP A;  2UXX B;  1MMD A;  2NTX A;  2OLT A;  1UX4 A;  4PNI A;  1MND A;  2V1D B;  2QGS A;  4O2B E;  4XAX B;  2MPK A;  4E7Z A;  3OTO T;  4EED A;  4F6R C;  2IIU A;  4AKI A;  3RYC E;  2LOS A;  2DI4 A;  5E0O A;  3RHW A;  4UVA B;  2MAW A;  3KV6 A;  2KIN B;  3AA6 B;  2MTQ A;  4LF9 T;  2CXF A;  1T72 A;  2WSS V;  5HEH A;  2LSJ A;  3F2E A;  1LVF A;  4IHJ E;  4AIU A;  2HPL A;  4NIQ A;  4YHJ A;  3ETU A;  4IDQ A;  4DO0 A;  4CZZ B;  2PFV A;  3AEA A;  2YDQ A;  4B3R T;  4JYA T;  5L3B B;  4WZX A;  2Y6X A;  2JIW A;  3H3M A;  4EGW A;  3G06 A;  3BK9 A;  5LOV E;  4JI0 T;  1NAF A;  2XSA A;  2XPK A;  1OED E;  5L47 A;  2M6I A;  3ANW B;  3GA8 A;  4GIW A;  3ZT5 A;  3SRZ A; 
#chains in the Genus database with same CATH homology
 2IC9 A;  2VKJ A;  3PUS A;  2BZB A;  5ETW A;  3N9P A;  4UXN B;  5LJM A;  2XAS B;  2Q9Q C;  3T8O A;  4ANJ A;  2KWI B;  2V7M A;  3ZC0 A;  3MK7 C;  3AB3 B;  4CI1 B;  3CQX C;  3KV9 A;  3DP7 A;  1D1C A;  2MBG A;  3ZN0 B;  3HL6 A;  3MA9 A;  3ZYL A;  3FBZ A;  2JPF A;  2D5U A;  5JDM A;  3AAA B;  5JDG A;  3FXE B;  5FY1 A;  5F8P A;  3RC8 A;  4WBO A;  4MAL A;  3RYH E;  5DJQ C;  2LSK A;  4ZI2 C;  2UXN B;  2JQQ A;  3B57 A;  3PUR A;  2CMR A;  3ZCJ A;  5CA1 E;  3NRY A;  4IE4 A;  1HFA A;  4EYY R;  4XZC A;  3ANW A;  3LK3 B;  2D0T A;  3ZJ1 A;  2Y8D A;  4WNK A;  3UUM A;  2DWK A;  5EK2 A;  4PAG A;  4OHF A;  4O8S A;  5KDM C;  3JC6 D;  2XAG B;  4DND A;  5FXV A;  3DTO A;  5JDQ A;  2GK9 A;  5HWY A;  5L3F B;  4AKH A;  3HKD E;  1MIV A;  2ZM2 A;  5LBQ B;  1ZV4 X;  1U4Q A;  5LNK A;  2VL8 A;  1IAP A;  3E0Z A;  2JJ9 A;  2JMK A;  5EK3 A;  2NTY A;  3ZMU B;  2G0U A;  2K9A A;  3HI2 A;  2WWU A;  4KBM B;  1E1H B;  4AQF A;  1KNZ A;  5DAB A;  4PK5 A;  1HG2 A;  3O9X A;  4JEH B;  3L09 A;  3UFE A;  4CXY A;  5FXX A;  2H3R A;  2A3D A;  2I59 A;  4H9S E;  3I0O A;  1IJ6 A;  5LG4 A;  4ZOL E;  4EOZ B;  4O4H E;  5JDH A;  3CVR A;  2PBI A;  4XBF B;  2N2N A;  2LSG A;  3FBL A;  4EIW A;  5JVD E;  3RPU A;  3WI3 A;  2VK9 A;  2NW7 A;  5J2T E;  3C4Z A;  4UEM A;  1WYB A;  5LGN B;  4MFR A;  3S4U A;  3F31 A;  3N2O A;  5FMN A;  4AQF C;  2CM0 A;  3CQG B;  3ONX A;  5CA0 E;  1HF8 A;  2LSY A;  4PW8 A;  2V26 A;  4ILU A;  1BR0 A;  5FNV E;  3UTK A;  1NWM X;  3PUA A;  1D0X A;  1D0Z A;  5L3C B;  3RRC A;  2KXP B;  3C50 A;  1WLX A;  4IE0 A;  5H6R B;  2L9Q A;  4FI5 A;  5LGT B;  5DQW A;  2DHR A;  2DLR A;  3HA4 A;  1LVK A;  3J9X 1;  2BVM A;  2CLY B;  2YIN A;  3N9N A;  4AXP A;  3LK4 2;  3U3I A;  1VRB A;  4IST A;  4EB6 E;  3HKE E;  3KFW X;  4L5G A;  2VB6 A;  2RP4 A;  2W62 A;  3HKC E;  3CX7 B;  2LOP A;  3PE0 A;  4N78 D;  2VKD A;  4EXT A;  4CQI A;  4ZI3 D;  2KT9 A;  2KWH A;  3AA0 B;  4G2A A;  1LRZ A;  4NUU A;  1OWA A;  5JQG E;  2X0L B;  2N9D A;  3FXD B;  3CQC B;  4PK6 A;  5LYJ E;  3ESL A;  5DQV A;  5HXC A;  4CXX A;  3OYX A;  4ZS2 A;  3AVS A;  1KK7 A;  2WMO A;  3KIN B;  4HKA A;  5TAO A;  2A2F X;  2XHE B;  2IW5 B;  3LG7 A;  4H63 V;  3B13 A;  2XTL A;  2XAQ B;  3N9Q A;  1YD8 G;  3IEE A;  2BVL A;  3NZP A;  4X1K E;  2C5K T;  2IAK A;  2XQY A;  3RRW A;  4H9R C;  2PG8 A;  4GOU A;  2M67 A;  3M65 A;  2MOZ A;  1IJ5 A;  5JH7 E;  2X67 A;  3Q2M A;  4L0R A;  2NWB A;  4MBQ A;  3ZC1 A;  2D2S A;  4FJO A;  4DBQ A;  3PUQ A;  2NOX A;  4PFO A;  2WM9 A;  5HAX A;  1VOM A;  3RC3 A;  4O4L E;  5L3G B;  3BQL A;  4KMC A;  2VKO A;  4X20 E;  1BR2 A;  3C98 B;  3ZJ2 A;  3JC6 C;  4U74 A;  4CI3 B;  2X9W A;  2CLY C;  2X66 A;  2HPJ A;  3AA7 B;  4YFS A;  3KV5 A;  4EAH A;  4JUY A;  4BJM A;  4H9Q C;  2YU2 A;  3MZK B;  3D0T A;  3LK2 B;  2K48 A;  2NP9 A;  4KUM B;  4P09 A;  1O3X A;  1D0Y A;  3RX6 A;  4O4I E;  5C8Y E;  3I0Q A;  4QX8 B;  4UEL A;  5JDF A;  3CX6 B;  2ZM0 A;  1FMW A;  3KBT A;  2CE7 A;  1H7C A;  1HX8 A;  4AKL A;  3CML A;  3EDU A;  4O2A E;  4UV8 B;  5LJN A;  1US7 B;  4H9O C;  5IHY A;  3PU3 A;  2LHN A;  3WAK A;  4DMW A;  3H3A A;  2EHO D;  4IGU A;  2BDE A;  2YU1 A;  2C0S A;  2N1G A;  3N9L A;  3P7I A;  4AKG A;  3EUH A;  5FP3 A;  5LA6 E;  3V5S A;  1T98 A;  2CWY A;  4GYR A;  4X1Y E;  4ASK A;  4AI6 A;  2YK0 A;  2LT3 A;  2W63 A;  1WYC A;  2VKH A;  5HXH A;  3BQI A;  1WR6 A;  3KV4 A;  4K0U A;  3UUN A;  2LJL A;  1IZN B;  2KND A;  4M1P A;  2K5B B;  4ZHQ E;  5BMV E;  4UVC B;  2CXL A;  1HCI A;  3C64 A;  5L3E B;  3H37 A;  4AQG A;  4PK4 A;  4ZI2 D;  3GMI A;  5GON E;  4H63 H;  5L2L A;  3P8C D;  2LE8 A;  2C5J A;  4L9I A;  4I55 E;  5LBM A;  4IE7 A;  2WAU A;  3I9Y A;  4OK0 A;  4DBR A;  1D1B A;  2WMN A;  2ODV A;  3ZMZ B;  2D0U A;  3O1I A;  3ZMT B;  3K3N A;  2XAJ B;  5L3D B;  3AVR A;  3OYZ A;  5AFU L;  2CXD A;  3SS1 A;  1HS7 A;  4TZ4 C;  1X79 A;  4ZI3 C;  5HXR A;  2E9X D;  3LBX B;  3O1J A;  2ZLY A;  1QSD A;  3ZLI A;  5LP6 E;  4UIG A;  4V1A v;  1G73 A;  5A1L A;  4PJL A;  3SWH A;  3EVY A;  3VKG A;  2W00 A;  4J2C A;  3OBV E;  5LCY A;  5JRE A;  2VWA A;  2EHO B;  2ZM8 A;  3VU7 H;  2IC6 A;  3SOL A;  5HXS A;  1ZKE A;  4GYS A;  4HGA A;  4UF0 B;  3RYF E;  2Q9Q B;  2CEA A;  3K3Q C;  5HYA A;  4PJJ A;  5LGU B;  3RKO A;  1U5P A;  1MIY A;  5KX5 E;  3C4X A;  2Y48 B;  3FHN A;  3KBU A;  3U78 A;  3IHR A;  4I43 B;  4X1I E;  3DJB A;  4QX7 B;  4OYK A;  4HEA A;  3GN5 B;  3ZEF B;  2ES0 A;  1MMA A;  3VHL A;  1OXZ A;  4YLH A;  4EZ4 A;  2ZMA A;  3MJX A;  4JEU B;  5EK4 A;  3W15 B;  1HTJ F;  1CUN A;  3KDS E;  3ZPO A;  1G8X A;  5IYZ E;  3ETV A;  4DMV A;  3HR0 A;  2EHO A;  4ZS3 A;  1FEW A;  3NBX X;  2L8K A;  3Q5W A;  2X9Y A;  2E8I A;  4H9P C;  4TV9 E;  2OA5 A;  4EZH A;  3UUL A;  3I1A A;  3AAI A;  4G63 A;  2E9X B;  4P0A A;  4ADZ A;  4CXW A;  1YKH B;  3I9W A;  3ZCI A;  2LSI A;  4H9N C;  2XUE A;  3N9O A;  3NZQ A;  5JRC B;  3N5L A;  2EHO C;  1AJ3 A;  4HE8 A;  4ISS A;  1MMN A;  2DNX A;  3K3O A;  4BJN A;  1UX5 A;  1ZHC A;  2NW8 A;  2LM9 A;  4ERR A;  4BA9 A;  3J7Y q;  3TKL B;  3QC9 A;  3CX8 B;  3ZMS B;  1FMV A;  3WAJ A;  4DVD A;  4E7S A;  1V9D A;  3CWZ B;  3F57 A;  3N9M A;  2E9X A;  2XAF B;  1Z0P A;  3R84 B;  4WBN E;  4MLK A;  1BR1 A;  5JDL A;  2C5I T;  2MYS A;  3L3P A;  1SHZ C;  2K24 A;  3IBP A;  3RYI E;  4GK5 E;  2QA7 A;  2V7I A;  3E08 A;  5JRC A;  2B1E A;  2KLQ A;  4QXC B;  4I4T E;  5JDN A;  4QXB B;  5HWX A;  5LHI B;  2P9B A;  3AAE B;  2Q9Q D;  1YW0 A;  3LJC A;  4I50 E;  1WRD A;  2Z6E A;  1UCU A;  3KVA A;  4HFV A;  4BAY B;  5FXW A;  5KMG P;  3O1H A;  3N2K E;  4IE6 A;  3LFM A;  1HG5 A;  3PU8 A;  2V7K A;  3FB2 A;  5LXT E;  4HN9 A;  3C51 A;  3PUG A;  3OJA A;  3R6N A;  2E9X C;  4A56 A;  2PJQ A;  3Q5X A;  3QUJ A;  1Y64 B;  3GWH A;  4QKN A;  2CCQ A;  3E22 E;  4YJ3 E;  1ZEE A;  5LHH B;  4KP3 C;  2X9X A;  1D1A A;  3QK6 A;  2LHR A;  5JR9 B;  1MMG A;  2JRK A;  4UV9 B;  4IIJ E;  4AKR B;  5HXE A;  4UVB B;  3EDV A;  4YJ2 E;  1FIO A;  2UXX B;  1MMD A;  2NTX A;  3ZN1 B;  4TV8 E;  2A72 A;  2WBL A;  4U72 A;  4C91 A;  4C90 A;  2W61 A;  2KMF A;  4WW0 A;  1UX4 A;  4PNI A;  3ZMV B;  5J2U E;  2L3L A;  1MND A;  4JLE A;  4PJN A;  2X51 A;  5FY7 A;  1EZ3 A;  2V1D B;  2QGS A;  4O2B E;  4TUY E;  4Z8X A;  4XAX B;  3MKD A;  2XAH B;  3HKB E;  4E7Z A;  4PJM A;  4P0B A;  3RH3 A;  1QUU A;  5EZY E;  2W0G A;  2CA5 A;  3MXZ A;  5J1G A;  3BQK A;  3ZYM A;  4F6R C;  4QXH B;  1S94 A;  3O4X E;  5FY0 A;  4EYU A;  5F3J A;  4OYJ A;  4ZI7 E;  3CKD A;  5H6Q B;  4AKI A;  3RYC E;  1LKX A;  2LOS A;  3UT5 E;  5JR9 A;  2CWO A;  2ODU A;  1B7T A;  3PTR B;  4NUV A;  3A5X A;  5LHG B;  2DI4 A;  5E0O A;  4MHC A;  4IDZ A;  4UVA B;  3KV6 A;  2KIN B;  3AA6 B;  2KZ7 B;  2MTQ A;  2CXF A;  3ZYK A;  4O4J E;  2WSS V;  2V7J A;  2LEH A;  2LSJ A;  3F2E A;  4GK0 E;  3UUX B;  1LVF A;  2DCF A;  4IHJ E;  4TN7 B;  2HPL A;  3LBX A;  2J1D G;  4B6X A;  4YHJ A;  1MIW A;  5FXZ A;  2V7L A;  3ETU A;  3V5U A;  3AA1 B;  2JMH A;  4DO0 A;  5JR9 C;  4CZZ B;  2PFV A;  3N2G E;  3MAC A;  3VKH A;  5M4Y A;  3OKQ A;  2ACX A;  5L3B B;  4QWN B;  2Y6X A;  3IF8 B;  3Q9D A;  3C4W A;  3CPZ A;  5FYM A;  2X68 A;  4UF0 A;  2Q9Q A;  2HH7 A;  1S35 A;  2RA1 A;  2VAS A;  3BK9 A;  2YEV C;  2SPC A;  5ADX L;  5LOV E;  5CB4 E;  4OFZ A;  2H7V C;  2NW9 A;  4TX5 A;  3K8P C;  1NAF A;  3NRX A;  4CI2 B;  4QHO A;  3KVB A;  2X9H A;  1SA0 E;  1BR4 A;  3GN5 A;  1MNE A;  4HTE A;  3ANW B;  3GA8 A;  2H7O A;  1YKE B;  4IE5 A;  4GIW A;  3PDY A;  2DWG A;  3SRZ A;  4PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...