2C5KT

N-terminal domain of tlg1 complexed with n-terminus of vps51
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
89
Chain Sequence
EDPFQQVVKDTKEQLNRINNYITRHNTADDQEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFDRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING PROTEIN 51
total genus 36
structure length 89
sequence length 91
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5kT00
2C5KT 2MBGA 1IJ6A 2C5IT 4EYYR 1ZKEA 2CA5A 3FXEB 3S4UA 3QK6A 1Z0PA 1QSDA 4L0RA 2KWIB 4FI5A 3TKLB 2X9YA 3N5LA 4DNDA 3QUJA 1LRZA 3MXZA 3FXDB 2KWHA 3CVRA 1H7CA 3CKDA 2IC9A 2G0UA 4J2CA 3P7IA 3L3PA 2XTLA 2C5JA 2K48A 1IJ5A 2X9WA 4CQIA 2X9XA 4B6XA 2IC6A 1LVFA
chains in the Genus database with same CATH superfamily
1Y64B 2N1GA 4DV5T 3JADA 5ABFA 5BR8T 3RGLA 4CI3B 4KHZF 4AQFA 3C4WA 4ZZBA 4DR4T 3VU7H 1HFAA 3KV6A 1MNDA 3L09A 4TX5A 2WDVA 4GK5E 5HXSA 1BR4A 2XQ9A 3A8YC 5JR9A 4ASKA 2X67A 2HH7A 3LG7A 2BDEA 3K8PC 5EK3A 5DJQC 4AKGA 3QUJA 4DMVA 2V7JA 4CXYA 1SE7A 3CVRA 3KFWX 3AE1A 4YSYA 2NR4A 4QX8B 5IWAT 2UXCT 2WU2A 4GYSA 5JRCB 5HCJA 4DUYT 3OBVE 3AA0B 2WWUA 4QX7B 1E7PA 3PUWF 2VB6A 3OKQA 5CB4E 5HEJA 4JBWF 2LJLA 2W63A 5FXVA 4YTMA 3TLSA 3OYZA 5FKYA 1KF6A 4UVAB 5LB7B 2LEHA 3C50A 2BVLA 2H3RA 2ZM2A 3HKDE 2UXNB 3CX6B 2CE7A 4QHOA 5L47A 4B3ST 4B3RT 4MFRA 2ACZA 2HN2A 4O4LE 4FI5A 2I0MA 3T8OA 3TKLB 3K3NA 2X9YA 1XDPA 3GWHA 2NW8A 1T72A 3AA7B 5HWYA 4A98A 2F4VT 4U72A 5ABEA 4GKJT 3ONJA 2OV9A 5AFUL 2V5DA 4DV4T 1UX4A 4OYJA 3RQUA 4CZZB 3PU3A 4F8HA 1IZNB 2BS4A 2E5LT 1D0YA 5AQMB 4JYAT 3EHZA 4YTNA 2FJBA 3AE6A 1J5WA 2Q9QA 5LOVE 3CK6A 2JQ9A 3PTRB 4IL4A 1FIOA 4IE0A 2V5CA 2Y6XA 5AQUB 3RC3A 4HWHA 4X5TA 2VWAA 3ETVA 2V1DB 2BG9A 2XQ8A 2W66A 4ZHQE 4LF7T 2ODUA 4HFIA 3PE0A 2CWYA 3CMLA 2PFVA 4PJLA 3UTKA 5L3DB 4XBFB 4EB6E 3RX6A 4H9RC 4ZXLA 3VRAA 2WDQA 3C4XA 4EEBA 1EZ3A 4WBOA 2EHOB 3ZCIA 1KEYA 2YDSA 4P1NA 4LMLA 5FMNA 3V5SA 1HX8A 3PURA 3SS1A 4G63A 5HEOA 4YTPA 2YEVC 1KNRA 4C91A 4AI6A 5ABGA 1KNZA 2FJDA 2KMFA 4DR7T 5J1GA 2XQAA 5FXZA 2DHRA 4LFCT 2JMKA 4YLHA 3AB3B 3N9NA 5HXRA 3I9YA 5DQVA 4AKHA 1UURA 2UUCT 3UUBA 4FJOA 3RIFA 3RPUA 2Y48B 1HG2A 1B7TA 3ZYKA 3AE9A 2MAWA 4HWFA 3CIRA 4I55E 1UK5A 1W09A 3ZN0B 3ZYLA 4UV9B 3N2KE 4IDZA 2MBGA 3RC8A 4UEMA 4CI1B 5LJNA 3RIUA 4WBNE 4ZI2C 2CEAA 3PUQA 4IREA 2AXDS 2YK0A 3L8RA 2WM9A 2JRKA 1UGOA 5CGMA 5LJMA 4U3CA 1CHUA 2JPFA 2P9BA 3AEDA 3F2EA 4H9QC 3PUGA 5HCMA 1T7SA 4G2AA 3AEAA 3TLVA 4AQGA 5DABA 5AQNB 5J2TE 3KINB 2UXDT 1NWMX 2V7LA 2M6BA 3VKGA 2HN1A 2CLYB 4PAGA 1WYBA 3I0OA 4HE8A 2IC9A 2M67A 3PUSA 3SRZA 2JQHA 2WY2A 1OEDE 2ZLYA 3EAMA 3UQ4A 2PJQA 2XAHB 2Y8DA 2LLYA 2MYSA 2X9WA 4IHJE 2GK9A 4GK0E 2LT3A 1I94T 4LF5T 2IDOB 3ONXA 3OJAA 4A56A 3P4SA 3AAEB 3AE3A 4H9NC 3OPCA 4TV8E 3H3AA 4ZS3A 3UUNA 2YOEA 4DBQA 4DBRA 4QXBB 1D0XA 3FHNA 3ZLIA 2YINA 5J2UE 2PBIA 1HR0T 3UQ7A 4LMKA 2LRKA 3B5MA 3P8CD 3RLFF 3Q5EA 1OXZA 2XQYA 4JEHB 4OYKA 2Q9QC 5LHIB 2V6YA 3UULA 2LKHA 2RP4A 4BA9A 2A2FX 3F31A 4PK5A 1YKHB 2DWGA 3SFDA 4JI0T 2IW5B 4AXPA 1ZP0A 4XAXB 3P4WA 2YDRA 3HKCE 2OLTA 3PJAA 4TNVA 1YQ4A 2W4XA 5HWXA 3R84B 3K3QC 1MIVA 4YJ3E 4DO0A 1ZOYA 2PG8A 4YJ2E 2C5JA 2VL8A 3RIAA 5LYJE 3RQWA 3LK42 3UU3A 4DR6T 4EEDA 5LBMA 5JH7E 2LSJA 4CQIA 4E7SA 2W2UA 4UF0A 4NUUA 1E2AA 3CX7B 3ZMVB 4CXWA 4B3MT 2Q9QD 4GKKT 4H9OC 5KDMC 1YKEB 4JI6T 2HHHT 2J62A 2RA1A 3MK7C 4QXHB 1NEKA 3KBUA 1HNXT 4L0RA 2KWIB 3QOFA 5C2TA 1UUSA 2N2NA 3PV0F 4ISSA 4PNIA 3C4ZA 4IL9A 4JI1T 1MIWA 2W0GA 4ZI3C 2E9XB 1OEDC 5C8YE 2RPAA 3JCFA 2WZIA 3AA1B 4UF0B 5LMUT 3IEEA 1CUNA 2IAKA 3RYHE 3KVAA 4AIUA 1ZEEA 3JAEA 5AQQB 5AQTB 5HAXA 4WYVA 3UT5E 1XNQT 2CXFA 5LXTE 3BQLA 3DP7A 5HXEA 2KZ7B 2BBHA 2MTQA 5JTGA 4DV3T 1HG5A 3NZPA 2XTLA 3Q5WA 2M6IA 3AAAB 3C98B 5LHGB 1IJ5A 2DWKA 2ZMAA 4CN1A 3EABA 5BMVE 5CA1E 3RKOA 4LF4T 3PUAA 3P4QA 5LGUB 2J47A 5HEGA 3MKDA 3NWIA 4JI8T 3B13A 4I50E 4MLKA 4OFZA 4ILBA 3LJCA 1XNRT 2V6YB 2WDRA 5JRCA 4TWFA 3RKGA 3KV9A 1SUMB 1VCSA 3RF1A 3P50A 4A97A 2FUPA 2E9XC 2DL1A 3HKBE 3PU8A 2CXLA 2V26A 5ETWA 3RYFE 4AKLA 5L3FB 2UXXB 3NKZA 3SOLA 3N5LA 4DV7T 1MIYA 5JDMA 3OTOT 2LE8A 1IBMT 3GA8A 2BG9E 4K0UA 4H63V 3RH3A 3ZSTA 1N33T 4U31A 3VR8A 2UXBT 1YXRA 4JUYA 2KSRA 2X0YA 5LMNT 4LF9T 4X66T 2K3WA 2JMHA 3ZYMA 5ABFB 2XSBA 2R6GF 3JC6D 2W00A 2NTXA 2LHNA 4UR9A 1U5PA 2H88A 3RRCA 2DLRA 3EDUA 4X62T 3PJAJ 1W0BA 4B6XA 5HXCA 4ZEYA 4I43B 5AQHB 3T1YT 5F8PA 3GMIA 4EZ4A 4M1PA 1IJ6A 4LF6T 3N9OA 4O2BE 3FXEB 1N36T 2QGSA 4C90A 2OA5A 4ANJA 1HTJF 3IA3A 3AVSA 3KVBA 2AE9A 4V1Av 4H9SE 5EK2A 2XAFB 3WI3A 2BS3A 4X65T 3E08A 4U7IA 3SFEA 2UUBT 2HPLA 3O1IA 2YN6A 2NW7A 4JLEA 3TLTA 4AQFC 2WS3A 1H7CA 5KXJA 2VKDA 5L4HA 3J7Yq 4PJJA 1O3XA 1J5ET 2QA7A 5CFBA 2J1DG 4IDOA 3UUXB 4QXCB 1MMGA 3LFMA 2K5BB 5TAOA 2FBWA 3O1JA 2BKOA 4TWDA 5JDFA 3X1DA 2CCQA 4IGUA 4X1YE 5LA6E 5E0OA 1W9RA 2WU5A 3DTOA 1IAPA 3AE2A 1XZYA 1QSDA 2L8KA 3PUVF 4HFCA 4IDNA 3WAJA 4DR1T 4GOUA 4CXXA 2ZM8A 5IYZE 4ZI7E 2XAJB 3V5UA 2BG9B 4DVDA 4DIDB 5JDQA 2D0UA 2ZM0A 2K24A 4KMCA 4B3TT 3QC9A 4ZI3D 3UU6A 5JR9B 2KXPB 2VK9A 4ILUA 4UVCB 3MZKB 5FNVE 4CN4A 2MOZA 4P0BA 3O9XA 3TLUA 1WCRA 3D0TA 2LSGA 4X1IE 4ISTA 4CN6A 2B1EA 4EIWA 5ADXL 5JQGE 3HA4A 1IBKT 3AE8A 4ERRA 1D1CA 3ZEFB 2XQ3A 5JDHA 2V7MA 5JREA 2JQQA 2X9XA 4HEAA 4EYUA 1QLBA 3AE7A 3ZC1A 1D1AA 3MJXA 4LFAT 2XQ7A 3FBLA 4X20E 3ONLC 4YY3T 2E5VA 1ZKEA 3OVUA 5AQVB 2IMLA 4DMWA 1L0VA 1SA0E 3ZMUB 3PUZF 3QNUA 2A9UA 3EDVA 2KT9A 4PK4A 2D9DA 3ANWA 2WWVA 3ZT5A 2X9HA 4K0KT 2XPKA 4IE4A 2XM1A 4O2AE 4EGWA 4EXTA 5IUXA 4P0AA 4AKIA 3ZN1B 2WCAA 3A5XA 2DNXA 2XSAA 1UX5A 3FXDB 5FXXA 2BG9C 2LSKA 3AVRA 3I1AA 4KBMB 4ILAA 4PFPA 2VL0A 4YFSA 5HEUA 3I9WA 4X1KE 5LHHB 3CPZA 2UUAT 3ZMSB 1G8XA 3CQXC 2N9DA 1FMWA 2LM2A 5JDLA 3Q5XA 2J4GA 1QUUA 5FVKA 3BQIA 4IDQA 2CHOA 3IHRA 3RI5A 3FZLB 5AQFB 5F3JA 4N78D 1UCUA 3KV5A 2VASA 3MACA 4J2CA 3LK3B 2JQKA 4L5GA 4UVBB 4COFA 2SPCA 2W62A 5KMGP 1X79A 2YU1A 3H37A 1V9DA 5HEHA 4AQYT 1ZV4X 4U33A 4EYYR 1WR0A 4A5XA 1MMAA 1BR1A 5IHYA 3F57A 2V7IA 5L2LA 4DR5T 1FMVA 2CXDA 4HFHA 4P09A 4Z90A 2QRXA 4JI2T 4NPPA 3VKHA 2VVNA 2WBLA 4PFOA 2A3DA 2CLYC 3CX8B 2KINB 4HWDA 5J0ZA 4PJMA 1LVKA 3AA6B 3MXZA 4HKAA 2WMOA 4QH4A 3RIUC 3AECA 4EOZB 4DV2T 3BK9A 1OEDB 2NP9A 3ZCJA 1WLXA 3IF8B 3Q9DA 2LOSA 3CWZB 3G06A 3LSVA 5FY7A 5LGTB 4X64T 2BVMA 5AQOB 3VR9A 4TV9E 3H3MA 1WRDA 4XZCA 5ABHA 4LFBT 1NAFA 5GONE 2XAQB 4NXNT 4QH5A 4AKRB 5CA0E 1X9BA 3AXJB 1MMDA 2DI4A 5EZYE 2VVSA 5FL0A 4YHHT 3HR0A 4Z8XA 1M7KA 3UFGA 4L9IA 2YKSA 5LNKA 4EAHA 5L4EA 2C5IT 1M62A 3HL6A 3DJBA 3S4UA 2ES0A 2CM0A 2VQFT 3A7MA 1Z0PA 3QK6A 2DCFA 3LBXA 4ZOLE 3SWHA 4NXMT 2H7OA 5FL1A 5EK4A 1S94A 1NENA 5AQIB 2FJEA 5M4YA 3AE4A 1U4QA 3ABVA 2ACXA 2X66A 2E8IA 3C64A 4GIWA 5LP6E 1KNPA 5JR9C 5LG4A 2XQ6A 2Z6EA 2WB5A 2XHEB 3AXJA 2EHOC 2BKPA 3CKDA 2XAGB 4HFVA 4DR3T 4Q25A 4HWIB 5A1LA 1HNWT 3TLWA 5KX5E 2NTYA 2JIWA 2E9XD 2UU9T 3N2OA 4JV5T 3JAFA 5LG3A 4KI0F 1FEWA 1JNZA 4HFBA 4BJNA 2CBJA 3KV4A 5AQSB 3ZJ1A 4E7ZA 4JI5T 2XUEA 2V7KA 4WW0A 3J9X1 4O4HE 1Z8UA 3UU5A 4F6RC 3N9QA 4IT4A 2XM2A 4HN9A 4O4IE 4TNWA 1ZHCA 3N9MA 3K3OA 3KBTA 3P4PA 3WAKA 3FBZA 2WQYA 1VCTA 5L3EB 1HS7A 1YQ3A 2D2SA 1OEDA 4YSXA 1YW0A 3P4RA 2V8SV 4QKNA 1D0ZA 4U74A 5L3BB 2JJ9A 3OYXA 1BR2A 3NVOA 3NRYA 4CI2B 3W15B 2X0HA 2VKJA 4Z91A 4O4JE 2ZM6T 1I6ZA 2BZBA 1MNEA 4UV8B 3VRBA 3I0QA 3NBXX 3JC6C 5JDNA 2X68A 1KFYA 3HKEE 2NWBA 4H9PC 4PK6A 4TWHA 4WZXA 1WYCA 2LOPA 3NRXA 1OWAA 3PDYA 3UUMA 4KHPT 5AQGB 3LBXB 2IUBA 4JI3T 2BS2A 3N2GE 4HGAA 3Q5DA 1XWMA 4MALA 5FVLA 5JVDE 2LSIA 3LDQB 4QWNB 2FJAA 3RYCE 3IBPA 4BJMA 1BR0A 5HYAA 3GN5B 3LK2B 3ZPOA 2LHRA 3KDSE 4EV6A 1N34T 2CMRA 2D0TA 3CQCB 1VRBA 3FZKB 4DV6T 2BBJA 2YU2A 2LRLA 2WZHA 2MPKA 2H89A 2PTFA 3ESLA 3FZHB 5CJ5A 3ZMTB 4U2ZA 2XQ5A 3RRWA 1KK7A 1SHZC 4IE6A 4MBQA 1T8BA 1AJ3A 3ZMZB 4DNDA 4PW8A 5HXHA 3AEGA 4QH1A 2LSYA 3MA9A 4AISA 3Q2MA 4DV0T 4LMJA 1YD8G 2KWHA 4UELA 3N9PA 3ETUA 3FZFB 2XY8B 4I4TE 3UU8A 1IBLT 4JI7T 4HTEA 3P7IA 5H6QB 3EI0A 4NUVA 5DQWA 5H6RB 2QVAA 2BKNA 2V6XA 4KX6A 4ZS2A 3ZKRA 3GN5A 1G73A 3E22E 3HI2A 5FXWA 1R8IA 4KUMB 4IE7A 4ZZCA 1T98A 5FP3A 4IE5A 4TZ4C 3AEBA 3N9LA 3VHLA 1S35A 2B76A 5LCYA 2XJ7A 1E1HB 1HX1B 3PUXF 4OHFA 3U78A 4EZHA 5LGNB 2VQET 2CPTA 5C3JA 1XMQT 5LBQB 2WSSV 1WR6A 2HPJA 2ODVA 5AQJB 2NW9A 1US7B 2KNDA 3QB5A 4HWCA 1FJGT 4YXDA 5L3CB 5L3GB 2K9AA 2E2AA 2X0LB 4O8SA 2LKGA 2KLQA 1WFDA 5F5WA 1JNRA 1MMNA 5JDGA 4HFEA 1HNZT 2EHOA 4OX9T 3ANWB 3AAIA 2CWOA 3K1SA 2CRBA 4KP3C 5FY0A 4LF8T 2G0UA 2CHNA 4U2YA 4TUYE 2I59A 2C0SA 3RYIE 4HFDA 2K48A 3FB2A 4ADZA 2EHOD 4YT0A 4YSZA 1Y01A 1W0AA 2X51A 2VKOA 2WAUA 3CQGB 4DUZT 1XMOT 1N32T 2H7VC 2WMNA 2XASB 2E9XA 3FZMB 2IC6A 3PUYF 2VURA 2C5KT 4OK0A 4YHJA 3T1HT 3BQKA 2QYWA 2YDQA 3B57A 2W61A 1HF8A 2WP9A 2IIUA 4JEUB 2CA5A 2Q9QB 4PJNA 4MHCA 4TN7B 5FYMA 4DR2T 2IHR1 3AE5A 3C51A 3RHWA 4IIJE 3U3IA 3ZSSA 2NOXA 3EUHA 3ZT6A 4GYRA 2XQ4A 4ILCA 3UFEA 4UXNB 5AQRB 3O4XE 2LM9A 3E0ZA 2L9QA 2D5UA 1LKXA 5AQPB 1J1JA 2CBIA 3ZJ2A 4U7YA 5AQLB 1GQEA 1LRZA 4NIQA 3UU4A 3ZT7A 4BAYB 3EVYA 3AEEA 1DU2A 4UIGA 4JI4T 2XZEA 4H63H 3R6NA 4DV1T 3L3PA 3QB5K 2A72A 2W67A 4WNKA 1HCIA 2L3LA 2VKHA 3AEFA 2I6HA 1VOMA 5AQKB 3M3ZB 3NZQA 3M65A 4I0UA 3L39A 5FY1A 4ZI2D 3ZC0A 4IDPA 3O1HA 1XDOA 1D1BA 1LVFA
chains in the Genus database with same CATH topology
1Y64B 2N1GA 4CI3B 4AQFA 3C4WA 3VU7H 1HFAA 3KV6A 1MNDA 3L09A 4TX5A 4GK5E 5HXSA 1BR4A 5JR9A 4ASKA 2X67A 2HH7A 3LG7A 2BDEA 3K8PC 5EK3A 5DJQC 4AKGA 3QUJA 4DMVA 2V7JA 4CXYA 3CVRA 3KFWX 4QX8B 4GYSA 5JRCB 3OBVE 3AA0B 2WWUA 4QX7B 2VB6A 3OKQA 5CB4E 2LJLA 2W63A 5FXVA 3OYZA 4UVAB 2LEHA 3C50A 2BVLA 2H3RA 2ZM2A 3HKDE 2UXNB 3CX6B 2CE7A 4QHOA 4MFRA 3T8OA 4O4LE 4FI5A 3TKLB 3K3NA 2X9YA 3GWHA 2NW8A 3AA7B 5HWYA 4U72A 5AFUL 1UX4A 4OYJA 4CZZB 3PU3A 1IZNB 1D0YA 2Q9QA 5LOVE 3PTRB 1FIOA 4IE0A 3RC3A 2Y6XA 4ZHQE 2VWAA 3ETVA 2V1DB 2ODUA 3PE0A 2CWYA 3CMLA 2PFVA 4PJLA 3UTKA 5L3DB 4XBFB 4EB6E 3RX6A 4H9RC 3C4XA 1EZ3A 4WBOA 2EHOB 3ZCIA 3V5SA 5FMNA 1HX8A 3PURA 3SS1A 4G63A 4AI6A 2YEVC 4C91A 1KNZA 2KMFA 5J1GA 5FXZA 2DHRA 2JMKA 4YLHA 3AB3B 3N9NA 5HXRA 3I9YA 5DQVA 4AKHA 4FJOA 3RPUA 2Y48B 1HG2A 1B7TA 3ZYKA 4I55E 3ZN0B 3ZYLA 4UV9B 3N2KE 4IDZA 2MBGA 3RC8A 4UEMA 4CI1B 5LJNA 4WBNE 4ZI2C 2CEAA 3PUQA 2YK0A 2WM9A 2JRKA 5LJMA 2JPFA 3F2EA 2P9BA 4H9QC 3PUGA 4AQGA 4G2AA 5DABA 5J2TE 3KINB 1NWMX 2V7LA 3VKGA 2CLYB 4PAGA 1WYBA 3I0OA 4HE8A 2IC9A 2M67A 3PUSA 3SRZA 2ZLYA 2PJQA 2XAHB 2Y8DA 2MYSA 2X9WA 4IHJE 2GK9A 4GK0E 2LT3A 3ONXA 3OJAA 4A56A 3AAEB 4ZS3A 4H9NC 3UUNA 4TV8E 3H3AA 4DBQA 4DBRA 4QXBB 1D0XA 3FHNA 3ZLIA 2YINA 5J2UE 2PBIA 5LHIB 3P8CD 1OXZA 2XQYA 4JEHB 4OYKA 2Q9QC 3UULA 4BA9A 2RP4A 2A2FX 3F31A 4PK5A 1YKHB 2DWGA 2IW5B 4AXPA 4XAXB 3HKCE 5HWXA 3R84B 3K3QC 1MIVA 4YJ3E 4DO0A 2PG8A 4YJ2E 2C5JA 2VL8A 5LYJE 3LK42 5LBMA 5JH7E 2LSJA 4CQIA 4E7SA 4UF0A 4NUUA 3ZMVB 3CX7B 4CXWA 2Q9QD 4H9OC 1YKEB 3MK7C 2RA1A 4QXHB 3KBUA 4L0RA 2KWIB 2N2NA 4ISSA 4PNIA 3C4ZA 1MIWA 2W0GA 4ZI3C 2E9XB 5C8YE 3AA1B 4UF0B 3IEEA 1CUNA 2IAKA 3RYHE 3KVAA 1ZEEA 5HAXA 3UT5E 2CXFA 5LXTE 3BQLA 3DP7A 5HXEA 2KZ7B 2MTQA 3ZC0A 1HG5A 3NZPA 2XTLA 3Q5WA 5LHGB 3AAAB 3C98B 1IJ5A 2DWKA 2ZMAA 5BMVE 5CA1E 3RKOA 3PUAA 5LGUB 3MKDA 3B13A 4I50E 4MLKA 4OFZA 3LJCA 5JRCA 3KV9A 2E9XC 3HKBE 5L3FB 3PU8A 2CXLA 2V26A 5ETWA 3RYFE 4AKLA 2UXXB 3SOLA 3N5LA 1MIYA 5JDMA 2LE8A 3GA8A 4K0UA 4H63V 3RH3A 4JUYA 2JMHA 3ZYMA 3JC6D 2W00A 2NTXA 2LHNA 3RRCA 1U5PA 3EDUA 2DLRA 4B6XA 5HXCA 4I43B 5F8PA 3GMIA 4EZ4A 4M1PA 1IJ6A 3N9OA 4O2BE 3FXEB 2QGSA 4C90A 2OA5A 4ANJA 1HTJF 3AVSA 3KVBA 4V1Av 4H9SE 5EK2A 2XAFB 3WI3A 3E08A 2HPLA 3O1IA 4AQFC 2NW7A 4JLEA 1H7CA 2VKDA 3J7Yq 4PJJA 1O3XA 2QA7A 2J1DG 3UUXB 4QXCB 1MMGA 3LFMA 2K5BB 5TAOA 3O1JA 5JDFA 2CCQA 4IGUA 4X1YE 5LA6E 5E0OA 3DTOA 1IAPA 3WAJA 2L8KA 1QSDA 4GOUA 4CXXA 2ZM8A 5IYZE 4ZI7E 2XAJB 3V5UA 4DVDA 5JDQA 2D0UA 2ZM0A 2K24A 4KMCA 3QC9A 4ZI3D 5JR9B 2KXPB 2VK9A 4ILUA 4UVCB 3MZKB 5FNVE 3O9XA 2MOZA 4P0BA 4EIWA 3D0TA 5JQGE 2LSGA 4X1IE 4ISTA 5ADXL 2B1EA 3HA4A 4ERRA 1D1CA 3ZEFB 5JDHA 5JREA 2V7MA 2JQQA 2X9XA 4HEAA 4EYUA 3ZC1A 1D1AA 3MJXA 3FBLA 4X20E 1ZKEA 4DMWA 1SA0E 3ZMUB 3EDVA 2KT9A 4PK4A 3ANWA 2X9HA 4IE4A 4O2AE 4P0AA 4EXTA 4AKIA 3ZN1B 3A5XA 2DNXA 5FXXA 1UX5A 3FXDB 2LSKA 3AVRA 3I1AA 4KBMB 4PFPA 4YFSA 5LHHB 3I9WA 4X1KE 3CPZA 3ZMSB 1G8XA 3CQXC 2N9DA 1FMWA 5JDLA 3Q5XA 1QUUA 3BQIA 3IHRA 5F3JA 4N78D 1UCUA 3KV5A 2VASA 3MACA 4J2CA 3LK3B 4L5GA 4UVBB 5KMGP 2SPCA 2W62A 1X79A 2YU1A 3H37A 1V9DA 1ZV4X 4EYYR 1MMAA 1BR1A 5IHYA 3F57A 2V7IA 5L2LA 1FMVA 2CXDA 4P09A 3VKHA 2WBLA 4PFOA 2A3DA 2CLYC 3CX8B 2KINB 4PJMA 1LVKA 3AA6B 3MXZA 4HKAA 2WMOA 4EOZB 3BK9A 2NP9A 3ZCJA 1WLXA 3IF8B 3Q9DA 2LOSA 3CWZB 5FY7A 5LGTB 2BVMA 4TV9E 1WRDA 4XZCA 1NAFA 5GONE 2XAQB 4AKRB 5CA0E 5EZYE 1MMDA 2DI4A 3HR0A 4Z8XA 4L9IA 5LNKA 4EAHA 2C5IT 3HL6A 3DJBA 3S4UA 2ES0A 2CM0A 3QK6A 1Z0PA 4ZOLE 2DCFA 3LBXA 3SWHA 2H7OA 5EK4A 1S94A 5M4YA 1U4QA 2ACXA 2X66A 2E8IA 3C64A 4GIWA 5LP6E 5LG4A 2Z6EA 2XHEB 2EHOC 3CKDA 2XAGB 4HFVA 5A1LA 5KX5E 2NTYA 2E9XD 3N2OA 1FEWA 4E7ZA 4BJNA 3KV4A 3ZJ1A 2XUEA 2V7KA 4WW0A 3J9X1 4O4HE 4F6RC 3N9QA 5KDMC 4HN9A 4O4IE 3WAKA 1ZHCA 3N9MA 3K3OA 3KBTA 3FBZA 5L3EB 1HS7A 2D2SA 1YW0A 4QKNA 1D0ZA 4U74A 5L3BB 2JJ9A 3OYXA 1BR2A 3NRYA 4CI2B 3W15B 2VKJA 4O4JE 2BZBA 1MNEA 4UV8B 3I0QA 3NBXX 3JC6C 5JDNA 2X68A 3HKEE 2NWBA 4H9PC 4PK6A 1WYCA 2LOPA 3NRXA 1OWAA 3PDYA 3UUMA 3LBXB 3N2GE 4HGAA 4MALA 5JVDE 4BJMA 2LSIA 4QWNB 3RYCE 1BR0A 3IBPA 5HYAA 3GN5B 3LK2B 3ZPOA 2LHRA 3KDSE 2CMRA 2D0TA 3CQCB 1VRBA 2YU2A 3ESLA 3ZMTB 1AJ3A 3RRWA 1KK7A 1SHZC 4IE6A 4MBQA 3ZMZB 4DNDA 4PW8A 5HXHA 2LSYA 3MA9A 3Q2MA 1YD8G 2KWHA 4UELA 3N9PA 3ETUA 4I4TE 4HTEA 3P7IA 5H6QB 4NUVA 5DQWA 5H6RB 4ZS2A 3GN5A 1G73A 3E22E 3HI2A 5FXWA 4KUMB 4IE7A 1T98A 5FP3A 4IE5A 4TZ4C 3N9LA 3VHLA 1S35A 5LCYA 1E1HB 4OHFA 4EZHA 5LGNB 3U78A 5LBQB 2WSSV 1WR6A 2HPJA 2ODVA 2NW9A 1US7B 2KNDA 5L3CB 5L3GB 2K9AA 2X0LB 4O8SA 2KLQA 5JDGA 1MMNA 2EHOA 3ANWB 3AAIA 2CWOA 5FY0A 4KP3C 2G0UA 4TUYE 2I59A 2C0SA 3RYIE 2K48A 3FB2A 4ADZA 2EHOD 3CQGB 2X51A 2VKOA 2WAUA 2H7VC 2WMNA 2XASB 2E9XA 2IC6A 2C5KT 4OK0A 4YHJA 3BQKA 3B57A 2W61A 1HF8A 4JEUB 4PJNA 2CA5A 2Q9QB 4TN7B 4MHCA 5FYMA 3C51A 3U3IA 4IIJE 2NOXA 3EUHA 4GYRA 3UFEA 4UXNB 3O4XE 2LM9A 3E0ZA 2L9QA 2D5UA 1LKXA 3ZJ2A 1LRZA 4BAYB 3EVYA 4UIGA 4H63H 3R6NA 3L3PA 2A72A 4WNKA 1HCIA 2L3LA 2VKHA 5JR9C 1VOMA 3NZQA 3M65A 5FY1A 4ZI2D 3O1HA 1D1BA 1LVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5K T;  2MBG A;  1IJ6 A;  2C5I T;  4EYY R;  1ZKE A;  2CA5 A;  3FXE B;  3S4U A;  3QK6 A;  1Z0P A;  1QSD A;  4L0R A;  2KWI B;  4FI5 A;  3TKL B;  2X9Y A;  3N5L A;  4DND A;  3QUJ A;  1LRZ A;  3MXZ A;  3FXD B;  2KWH A;  3CVR A;  1H7C A;  3CKD A;  2IC9 A;  2G0U A;  4J2C A;  3P7I A;  3L3P A;  2XTL A;  2C5J A;  2K48 A;  1IJ5 A;  2X9W A;  4CQI A;  2X9X A;  4B6X A;  2IC6 A;  1LVF A; 
#chains in the Genus database with same CATH topology
 1Y64 B;  2N1G A;  4DV5 T;  3JAD A;  5ABF A;  5BR8 T;  3RGL A;  4CI3 B;  4KHZ F;  4AQF A;  3C4W A;  4ZZB A;  4DR4 T;  3VU7 H;  1HFA A;  3KV6 A;  1MND A;  3L09 A;  4TX5 A;  2WDV A;  4GK5 E;  5HXS A;  1BR4 A;  2XQ9 A;  3A8Y C;  5JR9 A;  4ASK A;  2X67 A;  2HH7 A;  3LG7 A;  2BDE A;  3K8P C;  5EK3 A;  5DJQ C;  4AKG A;  3QUJ A;  4DMV A;  2V7J A;  4CXY A;  1SE7 A;  3CVR A;  3KFW X;  3AE1 A;  4YSY A;  2NR4 A;  4QX8 B;  5IWA T;  2UXC T;  2WU2 A;  4GYS A;  5JRC B;  5HCJ A;  4DUY T;  3OBV E;  3AA0 B;  2WWU A;  4QX7 B;  1E7P A;  3PUW F;  2VB6 A;  3OKQ A;  5CB4 E;  5HEJ A;  4JBW F;  2LJL A;  2W63 A;  5FXV A;  4YTM A;  3TLS A;  3OYZ A;  5FKY A;  1KF6 A;  4UVA B;  5LB7 B;  2LEH A;  3C50 A;  2BVL A;  2H3R A;  2ZM2 A;  3HKD E;  2UXN B;  3CX6 B;  2CE7 A;  4QHO A;  5L47 A;  4B3S T;  4B3R T;  4MFR A;  2ACZ A;  2HN2 A;  4O4L E;  4FI5 A;  2I0M A;  3T8O A;  3TKL B;  3K3N A;  2X9Y A;  1XDP A;  3GWH A;  2NW8 A;  1T72 A;  3AA7 B;  5HWY A;  4A98 A;  2F4V T;  4U72 A;  5ABE A;  4GKJ T;  3ONJ A;  2OV9 A;  5AFU L;  2V5D A;  4DV4 T;  1UX4 A;  4OYJ A;  3RQU A;  4CZZ B;  3PU3 A;  4F8H A;  1IZN B;  2BS4 A;  2E5L T;  1D0Y A;  5AQM B;  4JYA T;  3EHZ A;  4YTN A;  2FJB A;  3AE6 A;  1J5W A;  2Q9Q A;  5LOV E;  3CK6 A;  2JQ9 A;  3PTR B;  4IL4 A;  1FIO A;  4IE0 A;  2V5C A;  2Y6X A;  5AQU B;  3RC3 A;  4HWH A;  4X5T A;  2VWA A;  3ETV A;  2V1D B;  2BG9 A;  2XQ8 A;  2W66 A;  4ZHQ E;  4LF7 T;  2ODU A;  4HFI A;  3PE0 A;  2CWY A;  3CML A;  2PFV A;  4PJL A;  3UTK A;  5L3D B;  4XBF B;  4EB6 E;  3RX6 A;  4H9R C;  4ZXL A;  3VRA A;  2WDQ A;  3C4X A;  4EEB A;  1EZ3 A;  4WBO A;  2EHO B;  3ZCI A;  1KEY A;  2YDS A;  4P1N A;  4LML A;  5FMN A;  3V5S A;  1HX8 A;  3PUR A;  3SS1 A;  4G63 A;  5HEO A;  4YTP A;  2YEV C;  1KNR A;  4C91 A;  4AI6 A;  5ABG A;  1KNZ A;  2FJD A;  2KMF A;  4DR7 T;  5J1G A;  2XQA A;  5FXZ A;  2DHR A;  4LFC T;  2JMK A;  4YLH A;  3AB3 B;  3N9N A;  5HXR A;  3I9Y A;  5DQV A;  4AKH A;  1UUR A;  2UUC T;  3UUB A;  4FJO A;  3RIF A;  3RPU A;  2Y48 B;  1HG2 A;  1B7T A;  3ZYK A;  3AE9 A;  2MAW A;  4HWF A;  3CIR A;  4I55 E;  1UK5 A;  1W09 A;  3ZN0 B;  3ZYL A;  4UV9 B;  3N2K E;  4IDZ A;  2MBG A;  3RC8 A;  4UEM A;  4CI1 B;  5LJN A;  3RIU A;  4WBN E;  4ZI2 C;  2CEA A;  3PUQ A;  4IRE A;  2AXD S;  2YK0 A;  3L8R A;  2WM9 A;  2JRK A;  1UGO A;  5CGM A;  5LJM A;  4U3C A;  1CHU A;  2JPF A;  2P9B A;  3AED A;  3F2E A;  4H9Q C;  3PUG A;  5HCM A;  1T7S A;  4G2A A;  3AEA A;  3TLV A;  4AQG A;  5DAB A;  5AQN B;  5J2T E;  3KIN B;  2UXD T;  1NWM X;  2V7L A;  2M6B A;  3VKG A;  2HN1 A;  2CLY B;  4PAG A;  1WYB A;  3I0O A;  4HE8 A;  2IC9 A;  2M67 A;  3PUS A;  3SRZ A;  2JQH A;  2WY2 A;  1OED E;  2ZLY A;  3EAM A;  3UQ4 A;  2PJQ A;  2XAH B;  2Y8D A;  2LLY A;  2MYS A;  2X9W A;  4IHJ E;  2GK9 A;  4GK0 E;  2LT3 A;  1I94 T;  4LF5 T;  2IDO B;  3ONX A;  3OJA A;  4A56 A;  3P4S A;  3AAE B;  3AE3 A;  4H9N C;  3OPC A;  4TV8 E;  3H3A A;  4ZS3 A;  3UUN A;  2YOE A;  4DBQ A;  4DBR A;  4QXB B;  1D0X A;  3FHN A;  3ZLI A;  2YIN A;  5J2U E;  2PBI A;  1HR0 T;  3UQ7 A;  4LMK A;  2LRK A;  3B5M A;  3P8C D;  3RLF F;  3Q5E A;  1OXZ A;  2XQY A;  4JEH B;  4OYK A;  2Q9Q C;  5LHI B;  2V6Y A;  3UUL A;  2LKH A;  2RP4 A;  4BA9 A;  2A2F X;  3F31 A;  4PK5 A;  1YKH B;  2DWG A;  3SFD A;  4JI0 T;  2IW5 B;  4AXP A;  1ZP0 A;  4XAX B;  3P4W A;  2YDR A;  3HKC E;  2OLT A;  3PJA A;  4TNV A;  1YQ4 A;  2W4X A;  5HWX A;  3R84 B;  3K3Q C;  1MIV A;  4YJ3 E;  4DO0 A;  1ZOY A;  2PG8 A;  4YJ2 E;  2C5J A;  2VL8 A;  3RIA A;  5LYJ E;  3RQW A;  3LK4 2;  3UU3 A;  4DR6 T;  4EED A;  5LBM A;  5JH7 E;  2LSJ A;  4CQI A;  4E7S A;  2W2U A;  4UF0 A;  4NUU A;  1E2A A;  3CX7 B;  3ZMV B;  4CXW A;  4B3M T;  2Q9Q D;  4GKK T;  4H9O C;  5KDM C;  1YKE B;  4JI6 T;  2HHH T;  2J62 A;  2RA1 A;  3MK7 C;  4QXH B;  1NEK A;  3KBU A;  1HNX T;  4L0R A;  2KWI B;  3QOF A;  5C2T A;  1UUS A;  2N2N A;  3PV0 F;  4ISS A;  4PNI A;  3C4Z A;  4IL9 A;  4JI1 T;  1MIW A;  2W0G A;  4ZI3 C;  2E9X B;  1OED C;  5C8Y E;  2RPA A;  3JCF A;  2WZI A;  3AA1 B;  4UF0 B;  5LMU T;  3IEE A;  1CUN A;  2IAK A;  3RYH E;  3KVA A;  4AIU A;  1ZEE A;  3JAE A;  5AQQ B;  5AQT B;  5HAX A;  4WYV A;  3UT5 E;  1XNQ T;  2CXF A;  5LXT E;  3BQL A;  3DP7 A;  5HXE A;  2KZ7 B;  2BBH A;  2MTQ A;  5JTG A;  4DV3 T;  1HG5 A;  3NZP A;  2XTL A;  3Q5W A;  2M6I A;  3AAA B;  3C98 B;  5LHG B;  1IJ5 A;  2DWK A;  2ZMA A;  4CN1 A;  3EAB A;  5BMV E;  5CA1 E;  3RKO A;  4LF4 T;  3PUA A;  3P4Q A;  5LGU B;  2J47 A;  5HEG A;  3MKD A;  3NWI A;  4JI8 T;  3B13 A;  4I50 E;  4MLK A;  4OFZ A;  4ILB A;  3LJC A;  1XNR T;  2V6Y B;  2WDR A;  5JRC A;  4TWF A;  3RKG A;  3KV9 A;  1SUM B;  1VCS A;  3RF1 A;  3P50 A;  4A97 A;  2FUP A;  2E9X C;  2DL1 A;  3HKB E;  3PU8 A;  2CXL A;  2V26 A;  5ETW A;  3RYF E;  4AKL A;  5L3F B;  2UXX B;  3NKZ A;  3SOL A;  3N5L A;  4DV7 T;  1MIY A;  5JDM A;  3OTO T;  2LE8 A;  1IBM T;  3GA8 A;  2BG9 E;  4K0U A;  4H63 V;  3RH3 A;  3ZST A;  1N33 T;  4U31 A;  3VR8 A;  2UXB T;  1YXR A;  4JUY A;  2KSR A;  2X0Y A;  5LMN T;  4LF9 T;  4X66 T;  2K3W A;  2JMH A;  3ZYM A;  5ABF B;  2XSB A;  2R6G F;  3JC6 D;  2W00 A;  2NTX A;  2LHN A;  4UR9 A;  1U5P A;  2H88 A;  3RRC A;  2DLR A;  3EDU A;  4X62 T;  3PJA J;  1W0B A;  4B6X A;  5HXC A;  4ZEY A;  4I43 B;  5AQH B;  3T1Y T;  5F8P A;  3GMI A;  4EZ4 A;  4M1P A;  1IJ6 A;  4LF6 T;  3N9O A;  4O2B E;  3FXE B;  1N36 T;  2QGS A;  4C90 A;  2OA5 A;  4ANJ A;  1HTJ F;  3IA3 A;  3AVS A;  3KVB A;  2AE9 A;  4V1A v;  4H9S E;  5EK2 A;  2XAF B;  3WI3 A;  2BS3 A;  4X65 T;  3E08 A;  4U7I A;  3SFE A;  2UUB T;  2HPL A;  3O1I A;  2YN6 A;  2NW7 A;  4JLE A;  3TLT A;  4AQF C;  2WS3 A;  1H7C A;  5KXJ A;  2VKD A;  5L4H A;  3J7Y q;  4PJJ A;  1O3X A;  1J5E T;  2QA7 A;  5CFB A;  2J1D G;  4IDO A;  3UUX B;  4QXC B;  1MMG A;  3LFM A;  2K5B B;  5TAO A;  2FBW A;  3O1J A;  2BKO A;  4TWD A;  5JDF A;  3X1D A;  2CCQ A;  4IGU A;  4X1Y E;  5LA6 E;  5E0O A;  1W9R A;  2WU5 A;  3DTO A;  1IAP A;  3AE2 A;  1XZY A;  1QSD A;  2L8K A;  3PUV F;  4HFC A;  4IDN A;  3WAJ A;  4DR1 T;  4GOU A;  4CXX A;  2ZM8 A;  5IYZ E;  4ZI7 E;  2XAJ B;  3V5U A;  2BG9 B;  4DVD A;  4DID B;  5JDQ A;  2D0U A;  2ZM0 A;  2K24 A;  4KMC A;  4B3T T;  3QC9 A;  4ZI3 D;  3UU6 A;  5JR9 B;  2KXP B;  2VK9 A;  4ILU A;  4UVC B;  3MZK B;  5FNV E;  4CN4 A;  2MOZ A;  4P0B A;  3O9X A;  3TLU A;  1WCR A;  3D0T A;  2LSG A;  4X1I E;  4IST A;  4CN6 A;  2B1E A;  4EIW A;  5ADX L;  5JQG E;  3HA4 A;  1IBK T;  3AE8 A;  4ERR A;  1D1C A;  3ZEF B;  2XQ3 A;  5JDH A;  2V7M A;  5JRE A;  2JQQ A;  2X9X A;  4HEA A;  4EYU A;  1QLB A;  3AE7 A;  3ZC1 A;  1D1A A;  3MJX A;  4LFA T;  2XQ7 A;  3FBL A;  4X20 E;  3ONL C;  4YY3 T;  2E5V A;  1ZKE A;  3OVU A;  5AQV B;  2IML A;  4DMW A;  1L0V A;  1SA0 E;  3ZMU B;  3PUZ F;  3QNU A;  2A9U A;  3EDV A;  2KT9 A;  4PK4 A;  2D9D A;  3ANW A;  2WWV A;  3ZT5 A;  2X9H A;  4K0K T;  2XPK A;  4IE4 A;  2XM1 A;  4O2A E;  4EGW A;  4EXT A;  5IUX A;  4P0A A;  4AKI A;  3ZN1 B;  2WCA A;  3A5X A;  2DNX A;  2XSA A;  1UX5 A;  3FXD B;  5FXX A;  2BG9 C;  2LSK A;  3AVR A;  3I1A A;  4KBM B;  4ILA A;  4PFP A;  2VL0 A;  4YFS A;  5HEU A;  3I9W A;  4X1K E;  5LHH B;  3CPZ A;  2UUA T;  3ZMS B;  1G8X A;  3CQX C;  2N9D A;  1FMW A;  2LM2 A;  5JDL A;  3Q5X A;  2J4G A;  1QUU A;  5FVK A;  3BQI A;  4IDQ A;  2CHO A;  3IHR A;  3RI5 A;  3FZL B;  5AQF B;  5F3J A;  4N78 D;  1UCU A;  3KV5 A;  2VAS A;  3MAC A;  4J2C A;  3LK3 B;  2JQK A;  4L5G A;  4UVB B;  4COF A;  2SPC A;  2W62 A;  5KMG P;  1X79 A;  2YU1 A;  3H37 A;  1V9D A;  5HEH A;  4AQY T;  1ZV4 X;  4U33 A;  4EYY R;  1WR0 A;  4A5X A;  1MMA A;  1BR1 A;  5IHY A;  3F57 A;  2V7I A;  5L2L A;  4DR5 T;  1FMV A;  2CXD A;  4HFH A;  4P09 A;  4Z90 A;  2QRX A;  4JI2 T;  4NPP A;  3VKH A;  2VVN A;  2WBL A;  4PFO A;  2A3D A;  2CLY C;  3CX8 B;  2KIN B;  4HWD A;  5J0Z A;  4PJM A;  1LVK A;  3AA6 B;  3MXZ A;  4HKA A;  2WMO A;  4QH4 A;  3RIU C;  3AEC A;  4EOZ B;  4DV2 T;  3BK9 A;  1OED B;  2NP9 A;  3ZCJ A;  1WLX A;  3IF8 B;  3Q9D A;  2LOS A;  3CWZ B;  3G06 A;  3LSV A;  5FY7 A;  5LGT B;  4X64 T;  2BVM A;  5AQO B;  3VR9 A;  4TV9 E;  3H3M A;  1WRD A;  4XZC A;  5ABH A;  4LFB T;  1NAF A;  5GON E;  2XAQ B;  4NXN T;  4QH5 A;  4AKR B;  5CA0 E;  1X9B A;  3AXJ B;  1MMD A;  2DI4 A;  5EZY E;  2VVS A;  5FL0 A;  4YHH T;  3HR0 A;  4Z8X A;  1M7K A;  3UFG A;  4L9I A;  2YKS A;  5LNK A;  4EAH A;  5L4E A;  2C5I T;  1M62 A;  3HL6 A;  3DJB A;  3S4U A;  2ES0 A;  2CM0 A;  2VQF T;  3A7M A;  1Z0P A;  3QK6 A;  2DCF A;  3LBX A;  4ZOL E;  3SWH A;  4NXM T;  2H7O A;  5FL1 A;  5EK4 A;  1S94 A;  1NEN A;  5AQI B;  2FJE A;  5M4Y A;  3AE4 A;  1U4Q A;  3ABV A;  2ACX A;  2X66 A;  2E8I A;  3C64 A;  4GIW A;  5LP6 E;  1KNP A;  5JR9 C;  5LG4 A;  2XQ6 A;  2Z6E A;  2WB5 A;  2XHE B;  3AXJ A;  2EHO C;  2BKP A;  3CKD A;  2XAG B;  4HFV A;  4DR3 T;  4Q25 A;  4HWI B;  5A1L A;  1HNW T;  3TLW A;  5KX5 E;  2NTY A;  2JIW A;  2E9X D;  2UU9 T;  3N2O A;  4JV5 T;  3JAF A;  5LG3 A;  4KI0 F;  1FEW A;  1JNZ A;  4HFB A;  4BJN A;  2CBJ A;  3KV4 A;  5AQS B;  3ZJ1 A;  4E7Z A;  4JI5 T;  2XUE A;  2V7K A;  4WW0 A;  3J9X 1;  4O4H E;  1Z8U A;  3UU5 A;  4F6R C;  3N9Q A;  4IT4 A;  2XM2 A;  4HN9 A;  4O4I E;  4TNW A;  1ZHC A;  3N9M A;  3K3O A;  3KBT A;  3P4P A;  3WAK A;  3FBZ A;  2WQY A;  1VCT A;  5L3E B;  1HS7 A;  1YQ3 A;  2D2S A;  1OED A;  4YSX A;  1YW0 A;  3P4R A;  2V8S V;  4QKN A;  1D0Z A;  4U74 A;  5L3B B;  2JJ9 A;  3OYX A;  1BR2 A;  3NVO A;  3NRY A;  4CI2 B;  3W15 B;  2X0H A;  2VKJ A;  4Z91 A;  4O4J E;  2ZM6 T;  1I6Z A;  2BZB A;  1MNE A;  4UV8 B;  3VRB A;  3I0Q A;  3NBX X;  3JC6 C;  5JDN A;  2X68 A;  1KFY A;  3HKE E;  2NWB A;  4H9P C;  4PK6 A;  4TWH A;  4WZX A;  1WYC A;  2LOP A;  3NRX A;  1OWA A;  3PDY A;  3UUM A;  4KHP T;  5AQG B;  3LBX B;  2IUB A;  4JI3 T;  2BS2 A;  3N2G E;  4HGA A;  3Q5D A;  1XWM A;  4MAL A;  5FVL A;  5JVD E;  2LSI A;  3LDQ B;  4QWN B;  2FJA A;  3RYC E;  3IBP A;  4BJM A;  1BR0 A;  5HYA A;  3GN5 B;  3LK2 B;  3ZPO A;  2LHR A;  3KDS E;  4EV6 A;  1N34 T;  2CMR A;  2D0T A;  3CQC B;  1VRB A;  3FZK B;  4DV6 T;  2BBJ A;  2YU2 A;  2LRL A;  2WZH A;  2MPK A;  2H89 A;  2PTF A;  3ESL A;  3FZH B;  5CJ5 A;  3ZMT B;  4U2Z A;  2XQ5 A;  3RRW A;  1KK7 A;  1SHZ C;  4IE6 A;  4MBQ A;  1T8B A;  1AJ3 A;  3ZMZ B;  4DND A;  4PW8 A;  5HXH A;  3AEG A;  4QH1 A;  2LSY A;  3MA9 A;  4AIS A;  3Q2M A;  4DV0 T;  4LMJ A;  1YD8 G;  2KWH A;  4UEL A;  3N9P A;  3ETU A;  3FZF B;  2XY8 B;  4I4T E;  3UU8 A;  1IBL T;  4JI7 T;  4HTE A;  3P7I A;  5H6Q B;  3EI0 A;  4NUV A;  5DQW A;  5H6R B;  2QVA A;  2BKN A;  2V6X A;  4KX6 A;  4ZS2 A;  3ZKR A;  3GN5 A;  1G73 A;  3E22 E;  3HI2 A;  5FXW A;  1R8I A;  4KUM B;  4IE7 A;  4ZZC A;  1T98 A;  5FP3 A;  4IE5 A;  4TZ4 C;  3AEB A;  3N9L A;  3VHL A;  1S35 A;  2B76 A;  5LCY A;  2XJ7 A;  1E1H B;  1HX1 B;  3PUX F;  4OHF A;  3U78 A;  4EZH A;  5LGN B;  2VQE T;  2CPT A;  5C3J A;  1XMQ T;  5LBQ B;  2WSS V;  1WR6 A;  2HPJ A;  2ODV A;  5AQJ B;  2NW9 A;  1US7 B;  2KND A;  3QB5 A;  4HWC A;  1FJG T;  4YXD A;  5L3C B;  5L3G B;  2K9A A;  2E2A A;  2X0L B;  4O8S A;  2LKG A;  2KLQ A;  1WFD A;  5F5W A;  1JNR A;  1MMN A;  5JDG A;  4HFE A;  1HNZ T;  2EHO A;  4OX9 T;  3ANW B;  3AAI A;  2CWO A;  3K1S A;  2CRB A;  4KP3 C;  5FY0 A;  4LF8 T;  2G0U A;  2CHN A;  4U2Y A;  4TUY E;  2I59 A;  2C0S A;  3RYI E;  4HFD A;  2K48 A;  3FB2 A;  4ADZ A;  2EHO D;  4YT0 A;  4YSZ A;  1Y01 A;  1W0A A;  2X51 A;  2VKO A;  2WAU A;  3CQG B;  4DUZ T;  1XMO T;  1N32 T;  2H7V C;  2WMN A;  2XAS B;  2E9X A;  3FZM B;  2IC6 A;  3PUY F;  2VUR A;  2C5K T;  4OK0 A;  4YHJ A;  3T1H T;  3BQK A;  2QYW A;  2YDQ A;  3B57 A;  2W61 A;  1HF8 A;  2WP9 A;  2IIU A;  4JEU B;  2CA5 A;  2Q9Q B;  4PJN A;  4MHC A;  4TN7 B;  5FYM A;  4DR2 T;  2IHR 1;  3AE5 A;  3C51 A;  3RHW A;  4IIJ E;  3U3I A;  3ZSS A;  2NOX A;  3EUH A;  3ZT6 A;  4GYR A;  2XQ4 A;  4ILC A;  3UFE A;  4UXN B;  5AQR B;  3O4X E;  2LM9 A;  3E0Z A;  2L9Q A;  2D5U A;  1LKX A;  5AQP B;  1J1J A;  2CBI A;  3ZJ2 A;  4U7Y A;  5AQL B;  1GQE A;  1LRZ A;  4NIQ A;  3UU4 A;  3ZT7 A;  4BAY B;  3EVY A;  3AEE A;  1DU2 A;  4UIG A;  4JI4 T;  2XZE A;  4H63 H;  3R6N A;  4DV1 T;  3L3P A;  3QB5 K;  2A72 A;  2W67 A;  4WNK A;  1HCI A;  2L3L A;  2VKH A;  3AEF A;  2I6H A;  1VOM A;  5AQK B;  3M3Z B;  3NZQ A;  3M65 A;  4I0U A;  3L39 A;  5FY1 A;  4ZI2 D;  3ZC0 A;  4IDP A;  3O1H A;  1XDO A;  1D1B A;  1LVF A; 
#chains in the Genus database with same CATH homology
 1Y64 B;  2N1G A;  4CI3 B;  4AQF A;  3C4W A;  3VU7 H;  1HFA A;  3KV6 A;  1MND A;  3L09 A;  4TX5 A;  4GK5 E;  5HXS A;  1BR4 A;  5JR9 A;  4ASK A;  2X67 A;  2HH7 A;  3LG7 A;  2BDE A;  3K8P C;  5EK3 A;  5DJQ C;  4AKG A;  3QUJ A;  4DMV A;  2V7J A;  4CXY A;  3CVR A;  3KFW X;  4QX8 B;  4GYS A;  5JRC B;  3OBV E;  3AA0 B;  2WWU A;  4QX7 B;  2VB6 A;  3OKQ A;  5CB4 E;  2LJL A;  2W63 A;  5FXV A;  3OYZ A;  4UVA B;  2LEH A;  3C50 A;  2BVL A;  2H3R A;  2ZM2 A;  3HKD E;  2UXN B;  3CX6 B;  2CE7 A;  4QHO A;  4MFR A;  3T8O A;  4O4L E;  4FI5 A;  3TKL B;  3K3N A;  2X9Y A;  3GWH A;  2NW8 A;  3AA7 B;  5HWY A;  4U72 A;  5AFU L;  1UX4 A;  4OYJ A;  4CZZ B;  3PU3 A;  1IZN B;  1D0Y A;  2Q9Q A;  5LOV E;  3PTR B;  1FIO A;  4IE0 A;  3RC3 A;  2Y6X A;  4ZHQ E;  2VWA A;  3ETV A;  2V1D B;  2ODU A;  3PE0 A;  2CWY A;  3CML A;  2PFV A;  4PJL A;  3UTK A;  5L3D B;  4XBF B;  4EB6 E;  3RX6 A;  4H9R C;  3C4X A;  1EZ3 A;  4WBO A;  2EHO B;  3ZCI A;  3V5S A;  5FMN A;  1HX8 A;  3PUR A;  3SS1 A;  4G63 A;  4AI6 A;  2YEV C;  4C91 A;  1KNZ A;  2KMF A;  5J1G A;  5FXZ A;  2DHR A;  2JMK A;  4YLH A;  3AB3 B;  3N9N A;  5HXR A;  3I9Y A;  5DQV A;  4AKH A;  4FJO A;  3RPU A;  2Y48 B;  1HG2 A;  1B7T A;  3ZYK A;  4I55 E;  3ZN0 B;  3ZYL A;  4UV9 B;  3N2K E;  4IDZ A;  2MBG A;  3RC8 A;  4UEM A;  4CI1 B;  5LJN A;  4WBN E;  4ZI2 C;  2CEA A;  3PUQ A;  2YK0 A;  2WM9 A;  2JRK A;  5LJM A;  2JPF A;  3F2E A;  2P9B A;  4H9Q C;  3PUG A;  4AQG A;  4G2A A;  5DAB A;  5J2T E;  3KIN B;  1NWM X;  2V7L A;  3VKG A;  2CLY B;  4PAG A;  1WYB A;  3I0O A;  4HE8 A;  2IC9 A;  2M67 A;  3PUS A;  3SRZ A;  2ZLY A;  2PJQ A;  2XAH B;  2Y8D A;  2MYS A;  2X9W A;  4IHJ E;  2GK9 A;  4GK0 E;  2LT3 A;  3ONX A;  3OJA A;  4A56 A;  3AAE B;  4ZS3 A;  4H9N C;  3UUN A;  4TV8 E;  3H3A A;  4DBQ A;  4DBR A;  4QXB B;  1D0X A;  3FHN A;  3ZLI A;  2YIN A;  5J2U E;  2PBI A;  5LHI B;  3P8C D;  1OXZ A;  2XQY A;  4JEH B;  4OYK A;  2Q9Q C;  3UUL A;  4BA9 A;  2RP4 A;  2A2F X;  3F31 A;  4PK5 A;  1YKH B;  2DWG A;  2IW5 B;  4AXP A;  4XAX B;  3HKC E;  5HWX A;  3R84 B;  3K3Q C;  1MIV A;  4YJ3 E;  4DO0 A;  2PG8 A;  4YJ2 E;  2C5J A;  2VL8 A;  5LYJ E;  3LK4 2;  5LBM A;  5JH7 E;  2LSJ A;  4CQI A;  4E7S A;  4UF0 A;  4NUU A;  3ZMV B;  3CX7 B;  4CXW A;  2Q9Q D;  4H9O C;  1YKE B;  3MK7 C;  2RA1 A;  4QXH B;  3KBU A;  4L0R A;  2KWI B;  2N2N A;  4ISS A;  4PNI A;  3C4Z A;  1MIW A;  2W0G A;  4ZI3 C;  2E9X B;  5C8Y E;  3AA1 B;  4UF0 B;  3IEE A;  1CUN A;  2IAK A;  3RYH E;  3KVA A;  1ZEE A;  5HAX A;  3UT5 E;  2CXF A;  5LXT E;  3BQL A;  3DP7 A;  5HXE A;  2KZ7 B;  2MTQ A;  3ZC0 A;  1HG5 A;  3NZP A;  2XTL A;  3Q5W A;  5LHG B;  3AAA B;  3C98 B;  1IJ5 A;  2DWK A;  2ZMA A;  5BMV E;  5CA1 E;  3RKO A;  3PUA A;  5LGU B;  3MKD A;  3B13 A;  4I50 E;  4MLK A;  4OFZ A;  3LJC A;  5JRC A;  3KV9 A;  2E9X C;  3HKB E;  5L3F B;  3PU8 A;  2CXL A;  2V26 A;  5ETW A;  3RYF E;  4AKL A;  2UXX B;  3SOL A;  3N5L A;  1MIY A;  5JDM A;  2LE8 A;  3GA8 A;  4K0U A;  4H63 V;  3RH3 A;  4JUY A;  2JMH A;  3ZYM A;  3JC6 D;  2W00 A;  2NTX A;  2LHN A;  3RRC A;  1U5P A;  3EDU A;  2DLR A;  4B6X A;  5HXC A;  4I43 B;  5F8P A;  3GMI A;  4EZ4 A;  4M1P A;  1IJ6 A;  3N9O A;  4O2B E;  3FXE B;  2QGS A;  4C90 A;  2OA5 A;  4ANJ A;  1HTJ F;  3AVS A;  3KVB A;  4V1A v;  4H9S E;  5EK2 A;  2XAF B;  3WI3 A;  3E08 A;  2HPL A;  3O1I A;  4AQF C;  2NW7 A;  4JLE A;  1H7C A;  2VKD A;  3J7Y q;  4PJJ A;  1O3X A;  2QA7 A;  2J1D G;  3UUX B;  4QXC B;  1MMG A;  3LFM A;  2K5B B;  5TAO A;  3O1J A;  5JDF A;  2CCQ A;  4IGU A;  4X1Y E;  5LA6 E;  5E0O A;  3DTO A;  1IAP A;  3WAJ A;  2L8K A;  1QSD A;  4GOU A;  4CXX A;  2ZM8 A;  5IYZ E;  4ZI7 E;  2XAJ B;  3V5U A;  4DVD A;  5JDQ A;  2D0U A;  2ZM0 A;  2K24 A;  4KMC A;  3QC9 A;  4ZI3 D;  5JR9 B;  2KXP B;  2VK9 A;  4ILU A;  4UVC B;  3MZK B;  5FNV E;  3O9X A;  2MOZ A;  4P0B A;  4EIW A;  3D0T A;  5JQG E;  2LSG A;  4X1I E;  4IST A;  5ADX L;  2B1E A;  3HA4 A;  4ERR A;  1D1C A;  3ZEF B;  5JDH A;  5JRE A;  2V7M A;  2JQQ A;  2X9X A;  4HEA A;  4EYU A;  3ZC1 A;  1D1A A;  3MJX A;  3FBL A;  4X20 E;  1ZKE A;  4DMW A;  1SA0 E;  3ZMU B;  3EDV A;  2KT9 A;  4PK4 A;  3ANW A;  2X9H A;  4IE4 A;  4O2A E;  4P0A A;  4EXT A;  4AKI A;  3ZN1 B;  3A5X A;  2DNX A;  5FXX A;  1UX5 A;  3FXD B;  2LSK A;  3AVR A;  3I1A A;  4KBM B;  4PFP A;  4YFS A;  5LHH B;  3I9W A;  4X1K E;  3CPZ A;  3ZMS B;  1G8X A;  3CQX C;  2N9D A;  1FMW A;  5JDL A;  3Q5X A;  1QUU A;  3BQI A;  3IHR A;  5F3J A;  4N78 D;  1UCU A;  3KV5 A;  2VAS A;  3MAC A;  4J2C A;  3LK3 B;  4L5G A;  4UVB B;  5KMG P;  2SPC A;  2W62 A;  1X79 A;  2YU1 A;  3H37 A;  1V9D A;  1ZV4 X;  4EYY R;  1MMA A;  1BR1 A;  5IHY A;  3F57 A;  2V7I A;  5L2L A;  1FMV A;  2CXD A;  4P09 A;  3VKH A;  2WBL A;  4PFO A;  2A3D A;  2CLY C;  3CX8 B;  2KIN B;  4PJM A;  1LVK A;  3AA6 B;  3MXZ A;  4HKA A;  2WMO A;  4EOZ B;  3BK9 A;  2NP9 A;  3ZCJ A;  1WLX A;  3IF8 B;  3Q9D A;  2LOS A;  3CWZ B;  5FY7 A;  5LGT B;  2BVM A;  4TV9 E;  1WRD A;  4XZC A;  1NAF A;  5GON E;  2XAQ B;  4AKR B;  5CA0 E;  5EZY E;  1MMD A;  2DI4 A;  3HR0 A;  4Z8X A;  4L9I A;  5LNK A;  4EAH A;  2C5I T;  3HL6 A;  3DJB A;  3S4U A;  2ES0 A;  2CM0 A;  3QK6 A;  1Z0P A;  4ZOL E;  2DCF A;  3LBX A;  3SWH A;  2H7O A;  5EK4 A;  1S94 A;  5M4Y A;  1U4Q A;  2ACX A;  2X66 A;  2E8I A;  3C64 A;  4GIW A;  5LP6 E;  5LG4 A;  2Z6E A;  2XHE B;  2EHO C;  3CKD A;  2XAG B;  4HFV A;  5A1L A;  5KX5 E;  2NTY A;  2E9X D;  3N2O A;  1FEW A;  4E7Z A;  4BJN A;  3KV4 A;  3ZJ1 A;  2XUE A;  2V7K A;  4WW0 A;  3J9X 1;  4O4H E;  4F6R C;  3N9Q A;  5KDM C;  4HN9 A;  4O4I E;  3WAK A;  1ZHC A;  3N9M A;  3K3O A;  3KBT A;  3FBZ A;  5L3E B;  1HS7 A;  2D2S A;  1YW0 A;  4QKN A;  1D0Z A;  4U74 A;  5L3B B;  2JJ9 A;  3OYX A;  1BR2 A;  3NRY A;  4CI2 B;  3W15 B;  2VKJ A;  4O4J E;  2BZB A;  1MNE A;  4UV8 B;  3I0Q A;  3NBX X;  3JC6 C;  5JDN A;  2X68 A;  3HKE E;  2NWB A;  4H9P C;  4PK6 A;  1WYC A;  2LOP A;  3NRX A;  1OWA A;  3PDY A;  3UUM A;  3LBX B;  3N2G E;  4HGA A;  4MAL A;  5JVD E;  4BJM A;  2LSI A;  4QWN B;  3RYC E;  1BR0 A;  3IBP A;  5HYA A;  3GN5 B;  3LK2 B;  3ZPO A;  2LHR A;  3KDS E;  2CMR A;  2D0T A;  3CQC B;  1VRB A;  2YU2 A;  3ESL A;  3ZMT B;  1AJ3 A;  3RRW A;  1KK7 A;  1SHZ C;  4IE6 A;  4MBQ A;  3ZMZ B;  4DND A;  4PW8 A;  5HXH A;  2LSY A;  3MA9 A;  3Q2M A;  1YD8 G;  2KWH A;  4UEL A;  3N9P A;  3ETU A;  4I4T E;  4HTE A;  3P7I A;  5H6Q B;  4NUV A;  5DQW A;  5H6R B;  4ZS2 A;  3GN5 A;  1G73 A;  3E22 E;  3HI2 A;  5FXW A;  4KUM B;  4IE7 A;  1T98 A;  5FP3 A;  4IE5 A;  4TZ4 C;  3N9L A;  3VHL A;  1S35 A;  5LCY A;  1E1H B;  4OHF A;  4EZH A;  5LGN B;  3U78 A;  5LBQ B;  2WSS V;  1WR6 A;  2HPJ A;  2ODV A;  2NW9 A;  1US7 B;  2KND A;  5L3C B;  5L3G B;  2K9A A;  2X0L B;  4O8S A;  2KLQ A;  5JDG A;  1MMN A;  2EHO A;  3ANW B;  3AAI A;  2CWO A;  5FY0 A;  4KP3 C;  2G0U A;  4TUY E;  2I59 A;  2C0S A;  3RYI E;  2K48 A;  3FB2 A;  4ADZ A;  2EHO D;  3CQG B;  2X51 A;  2VKO A;  2WAU A;  2H7V C;  2WMN A;  2XAS B;  2E9X A;  2IC6 A;  2C5K T;  4OK0 A;  4YHJ A;  3BQK A;  3B57 A;  2W61 A;  1HF8 A;  4JEU B;  4PJN A;  2CA5 A;  2Q9Q B;  4TN7 B;  4MHC A;  5FYM A;  3C51 A;  3U3I A;  4IIJ E;  2NOX A;  3EUH A;  4GYR A;  3UFE A;  4UXN B;  3O4X E;  2LM9 A;  3E0Z A;  2L9Q A;  2D5U A;  1LKX A;  3ZJ2 A;  1LRZ A;  4BAY B;  3EVY A;  4UIG A;  4H63 H;  3R6N A;  3L3P A;  2A72 A;  4WNK A;  1HCI A;  2L3L A;  2VKH A;  5JR9 C;  1VOM A;  3NZQ A;  3M65 A;  5FY1 A;  4ZI2 D;  3O1H A;  1D1B A;  1LVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...