4LF5T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf5T00
4JI8T 4NXMT 4DR4T 1I94T 3T1HT 4YHHT 1HNXT 2UUAT 4X62T 4DR5T 4JI6T 1XNRT 2UUCT 4LF6T 4OX9T 2UXBT 4LFBT 1XNQT 4JI5T 3OTOT 4AQYT 1IBLT 1XMOT 4DV4T 2E5LT 4K0KT 2ZM6T 4LF5T 4DR7T 1XMQT 2UXDT 1IBMT 2UXCT 1HNZT 4DV3T 3T1YT 5LMNT 4JYAT 4DV6T 2UU9T 1HNWT 4JI2T 4LF7T 1J5ET 4B3RT 4JI0T 4GKJT 1N36T 2UUBT 4DR3T 4DR6T 1IBKT 4YY3T 4DV0T 4DV1T 2HHHT 2VQET 4JI1T 4DUZT 4LFAT 4LF4T 4KHPT 4JI4T 4GKKT 4DV7T 4B3MT 4DV5T 4NXNT 4LFCT 4B3TT 4B3ST 4LF9T 4DR1T 4X64T 4JV5T 1N33T 1N32T 4X65T 5BR8T 4JI3T 1N34T 4DUYT 4X66T 5IWAT 2F4VT 5LMUT 4LF8T 1HR0T 2VQFT 4DV2T 1FJGT 4DR2T 4JI7T
chains in the Genus database with same CATH superfamily
4ZI7E 3N5LA 2RP4A 3JAEA 3T1HT 4DR5T 1XNRT 4ZOLE 3CVRA 1X9BA 3CKDA 2XSAA 3VHLA 4OHFA 1FEWA 2ZLYA 2BG9B 1CHUA 3AEBA 3CQXC 4DVDA 4HWFA 2V5DA 2W62A 2N1GA 1Y64B 2JJ9A 1UCUA 2VK9A 4MBQA 1XMQT 3RIUA 3TKLB 3FZLB 3L39A 2PFVA 4O4LE 4UR9A 3KDSE 5LHGB 3NZQA 2V7IA 5F3JA 4YLHA 5CJ5A 2HHHT 2VQET 4HGAA 4XBFB 1MNEA 4PK5A 1L0VA 1YKEB 4OYJA 4GK5E 3KV6A 2H3RA 4I50E 3ZCIA 1SA0E 4CN4A 3LBXA 5EK2A 2CWOA 3F31A 2DNXA 3DTOA 3EDVA 3IA3A 2YDQA 5LJMA 3ZMUB 5EZYE 4X1YE 2IUBA 3ANWB 4AKRB 2E9XD 4AKGA 4JI8T 5LXTE 4U7YA 2UUCT 4HFCA 2CHNA 1JNZA 3AXJA 2CXFA 1HX1B 2OLTA 5DQVA 2MPKA 4H9SE 1ZP0A 5FXZA 1UX4A 3AE1A 3RC3A 4PAGA 3ZN0B 1NEKA 2K3WA 2UXCT 2Q9QB 1HNZT 2BG9A 4G63A 2CLYB 1KF6A 2DCFA 2N9DA 3RH3A 4IL9A 2J47A 2MBGA 1EZ3A 2WS3A 2PJQA 3PUVF 2Y8DA 4ZXLA 5AQHB 3UFGA 2HH7A 3JADA 3NRXA 4OFZA 3IHRA 4P1NA 4JLEA 5H6QB 5BMVE 2LRLA 4DUZT 4H9NC 3FZMB 2X9YA 2NOXA 1WR6A 4YT0A 1Z8UA 1M62A 4DO0A 3ZT5A 3G06A 4MHCA 4PK4A 4IL4A 1N33T 3P50A 2GK9A 2WAUA 1NAFA 2BG9C 4X66T 2F4VT 1HR0T 4PK6A 3RI5A 3KBTA 3QNUA 3QC9A 1FJGT 3C4WA 2W0GA 4CN6A 3TLVA 1BR1A 2V7KA 1E7PA 2LEHA 2NP9A 3PJAA 5L3DB 1WR0A 3RHWA 2D2SA 1XDPA 4LMKA 4U72A 2YEVC 4IDQA 3EABA 5AQPB 1XDOA 3AAEB 5AFUL 4WYVA 5KXJA 5L3FB 3PV0F 4DV6T 4ILUA 3N2GE 2ZM0A 3F2EA 4HE8A 5F5WA 4YSZA 3CIRA 3PE0A 4Q25A 3PJAJ 4XZCA 4HTEA 4N78D 4KHPT 3O1IA 3DP7A 3QOFA 4WW0A 4NXNT 4CI1B 1D1BA 3AAIA 4ZZBA 5LP6E 2QA7A 2LT3A 4O8SA 4AISA 5JRCA 2L8KA 1T98A 5BR8T 4I55E 1N34T 3OPCA 4UV9B 5C2TA 5FMNA 1WFDA 3C51A 3KFWX 3LDQB 3ZKRA 2DWKA 1WCRA 5CGMA 2NTYA 5HAXA 1O3XA 1E2AA 4DR4T 3VR9A 2CLYC 1OEDA 2DHRA 4J2CA 1NWMX 3BQLA 4JI6T 4ZI2D 4FJOA 4HN9A 4DMVA 2BVMA 3UQ4A 2B1EA 5HXSA 4AQYT 4F6RC 3A7MA 2UXNB 5LBMA 3X1DA 4F8HA 4ZS3A 3GN5B 2LKGA 2ZM8A 4HWDA 5ABFB 3PTRB 2UU9T 2FJAA 4JI2T 3UUMA 3AA6B 3IEEA 4AQFA 2J4GA 3FZKB 4BJNA 2D0TA 3C4ZA 3Q5XA 2ZMAA 1OEDC 2K5BB 2LJLA 2XQ5A 2XAQB 2FJEA 5AQTB 1SHZC 3ZPOA 4AKHA 3FBLA 3B57A 2KSRA 5AQKB 4KHZF 4PJNA 4X5TA 3SS1A 5EK4A 1SUMB 4UVBB 2LM9A 1MMAA 5EK3A 2QGSA 3UU5A 5CA0E 4YHHT 3NBXX 2NR4A 3NWIA 3PUAA 5HEUA 3VRBA 3NRYA 2W63A 5JVDE 3ZYMA 1JNRA 1XWMA 4TNWA 4A56A 5L2LA 1XNQT 4PJLA 4NUUA 5L3CB 5HXRA 4DMWA 2Q9QD 3HR0A 4U2YA 3VKGA 5JTGA 3UU3A 5L3EB 1OXZA 1GQEA 3C64A 2JRKA 1SE7A 2ACXA 2BS2A 5KMGP 4P0BA 5AQOB 1IBKT 5CFBA 3RF1A 3M65A 1UURA 2CEAA 3P4SA 5AQVB 3AE7A 2OV9A 3PUXF 4JV5T 5ADXL 3LBXB 1MNDA 3HKBE 4C91A 4EGWA 3FXDB 2L9QA 2WMNA 2EHOD 1QLBA 4BAYB 2C5IT 3FZFB 3ZMVB 2XQ4A 3JC6C 3JCFA 4TV8E 2IMLA 2KT9A 3QK6A 4PJMA 2K24A 2E2AA 2V1DB 4EZ4A 4PNIA 2MYSA 5L3BB 5JDHA 1WRDA 2WBLA 4CI3B 2VKOA 2LSYA 2FJDA 3I0OA 2V8SV 1T7SA 3I9WA 1OEDE 2OA5A 3ONXA 4WNKA 4IE0A 2X0HA 3RLFF 1J1JA 4I0UA 5L47A 3AXJB 5FNVE 2LLYA 2BVLA 2CXLA 5FXVA 4DV4T 2VASA 2WDQA 3IF8B 3N2OA 3GA8A 4BJMA 2CM0A 3AEGA 3T1YT 4EYYR 4I43B 2A2FX 3Q9DA 3GMIA 4U2ZA 1WYBA 1XZYA 1FMWA 3ZT7A 2RA1A 2FBWA 3DJBA 2HPJA 4MFRA 4QHOA 1BR0A 1T8BA 5JDNA 2DI4A 3E22E 4EB6E 2X67A 1MIWA 2BS4A 2LOPA 2WM9A 3L8RA 4O2BE 4JBWF 2V26A 2XTLA 2LHRA 5LBQB 2D9DA 1VOMA 5HXEA 3JAFA 2E8IA 1N32T 4CI2B 1HCIA 5LB7B 3MACA 3ETUA 3HKDE 4QKNA 4EAHA 2XQ8A 2X9XA 1G8XA 4KBMB 4DR2T 2CBIA 4U7IA 3TLTA 4HKAA 2WB5A 4YSXA 4X62T 2MOZA 4AXPA 2KWIB 2WU5A 5HWYA 3QUJA 2WSSV 5AQJB 2IDOB 3AE8A 2V6YB 4L9IA 1VCSA 2BZBA 2YOEA 5KX5E 2YU1A 3ZYLA 2VKDA 4ZI3C 2X9WA 3I9YA 5JDLA 2D5UA 2QYWA 4JI0T 4ADZA 2VKHA 3CMLA 2UUBT 2KWHA 4QH1A 4DIDB 3VR8A 5ABEA 3ZT6A 4JI1T 1W0AA 2X51A 3ESLA 4I4TE 2KMFA 5HEOA 5GONE 4HFIA 4IE4A 4B6XA 3LSVA 3CQCB 4B3ST 4C90A 4X64T 5HEGA 1KEYA 5IUXA 5FYMA 2J1DG 5JRCB 3FHNA 5LJNA 2K48A 4A98A 4HFDA 2VQFT 3AA7B 3ZJ2A 4DV2T 1ZKEA 4BA9A 5LG4A 1D1CA 3HKCE 2JQQA 3WAKA 3AE2A 3NVOA 5AQUB 3C98B 2A3DA 2BKNA 3VKHA 1OEDB 4ILCA 2LSKA 2WWVA 2XM1A 4UIGA 5LGNB 1UK5A 4H63V 4HFVA 1QUUA 4CQIA 2LRKA 4ZS2A 3GWHA 2E5VA 3LFMA 5HCMA 3OVUA 4ZI2C 3N9PA 4KP3C 4UVCB 1OWAA 2PTFA 3RKGA 3M3ZB 1IAPA 4ZHQE 2V6YA 4CZZB 2JIWA 5JDMA 5AQRB 1N36T 2K9AA 4QXHB 3UQ7A 2W66A 3QB5A 3N2KE 2WZHA 4DNDA 3MA9A 3PURA 3MK7C 4B3MT 4O4JE 3EHZA 4HWIB 2JMHA 4WZXA 1LVFA 5HXCA 3EI0A 3SRZA 3BQKA 2XHEB 3L3PA 4EZHA 3ONLC 4QH5A 3UU8A 4ANJA 4ILBA 3OBVE 2FUPA 1I6ZA 2XQ9A 5LOVE 1FIOA 5CB4E 1WYCA 4G2AA 4UVAB 4ASKA 2Y48B 3H3AA 3RQUA 4LF6T 2LSJA 5AQNB 2UXBT 2CHOA 5C8YE 1HTJF 2WDRA 3E08A 3AEDA 1IBLT 1ZV4X 4IE5A 4YHJA 2CCQA 4H63H 4HFBA 4EV6A 1J5WA 5AQIB 3H37A 3MZKB 3N9QA 2LOSA 5LA6E 2LSIA 2CE7A 4KX6A 2VB6A 2DWGA 2NTXA 4GKJT 4EXTA 3FBZA 2G0UA 4YSYA 4DBQA 4DR3T 4YY3T 2DLRA 2EHOA 5HEJA 3LJCA 1D0YA 4LFAT 2MAWA 3V5SA 5F8PA 2HN2A 3PUWF 1IJ6A 4LFCT 2L3LA 2E9XB 2WY2A 2VL0A 2X0LB 5LNKA 2AXDS 4AKIA 5IWAT 2X66A 4MALA 3ONJA 2Z6EA 1ZHCA 2JPFA 2WQYA 3QB5K 2BBHA 2LM2A 3RYFE 1NENA 5C3JA 3BK9A 2WZIA 3AEFA 4NXMT 3W15B 1IJ5A 5HXHA 2CBJA 2XQ3A 2EHOC 4IE6A 3AECA 3R84B 1YQ4A 3FB2A 4UV8B 3I1AA 4V1Av 3AE6A 2XM2A 3P7IA 2MTQA 4IDNA 2CPTA 4TWHA 1ZEEA 4QX8B 2UXDT 3CK6A 2VURA 3RIFA 5FL1A 2QVAA 3ZCJA 5LHIB 2HPLA 4PW8A 3EDUA 5AQSB 4IDZA 2YKSA 1J5ET 2QRXA 1YW0A 4TUYE 2IAKA 3Q5EA 2ODUA 4EIWA 4E7ZA 3WI3A 3SFEA 2VWAA 2H88A 3UU6A 3O9XA 5CA1E 4GYSA 2VKJA 1W09A 3BQIA 4DV5T 2DL1A 3O1HA 1S94A 4B3TT 3UUNA 5FY1A 4Z8XA 3EVYA 3HL6A 4X65T 4O4HE 1AJ3A 3K3NA 3UU4A 3P4QA 4LF8T 4KUMB 2A72A 3AAAB 3KV4A 2E9XA 3FZHB 4CN1A 5JH7E 2YINA 4TZ4C 2V7JA 1I94T 2ZM2A 3HA4A 2X68A 3KVBA 3LG7A 2C0SA 2NW8A 3KV5A 2I0MA 3Q5WA 3TLWA 2IHR1 5DJQC 4JI5T 3K1SA 3B5MA 1XMOT 1HS7A 5LYJE 2XZEA 3NKZA 1KNRA 1Z0PA 5FVKA 5FY0A 3OJAA 2VVNA 2CRBA 2E9XC 4LF7T 3UTKA 3ZC0A 2X9HA 3N9MA 4WBOA 4YJ3E 5A1LA 4A97A 2I59A 5L4HA 3CQGB 2LE8A 2BKPA 5AQQB 3CX7B 5IHYA 1LVKA 4GKKT 3O1JA 5ABGA 2BKOA 5LGUB 2V7MA 3RKOA 4DR1T 1D1AA 3J9X1 2J62A 5HYAA 2IW5B 4TX5A 2CA5A 4YTNA 4NPPA 2XJ7A 3U78A 3AB3B 4IHJE 4QXBB 3RC8A 2XAGB 3ZJ1A 2W61A 3SWHA 4IREA 2M67A 4U31A 5JREA 4P0AA 1S35A 4EEDA 3LK3B 3Q2MA 3HKEE 3PUZF 4OX9T 4CXWA 4ZEYA 5J2UE 2LSGA 3ZSTA 3S4UA 4AQGA 1R8IA 2LHNA 4UF0B 4U3CA 2FJBA 4H9OC 4DR7T 4EEBA 1IBMT 4L0RA 3OYZA 4OK0A 3PUYF 4LMLA 3VRAA 4DV3T 5JDQA 5LMNT 1HNWT 2KZ7B 4YFSA 5J2TE 5FVLA 2WWUA 2YDSA 5ETWA 3JC6D 2JQKA 4Z91A 4YTMA 4QX7B 3RIUC 4H9PC 3ABVA 4L5GA 3RYIE 3P4WA 3KBUA 2RPAA 3ZMZB 4GIWA 4QH4A 2KNDA 3AE4A 4TV9E 4EOZB 2V5CA 3P4PA 3AVRA 4JEHB 1YQ3A 3RYCE 4YTPA 3N9NA 3IBPA 2H7VC 2V6XA 4DUYT 3OYXA 4JEUB 4U74A 1MIYA 2Y6XA 5AQMB 1MMGA 2XASB 5JDFA 3AEEA 4M1PA 2BS3A 3KV9A 3K3OA 4PFOA 1MMNA 4IDPA 2H89A 3C4XA 3A8YC 2A9UA 2CMRA 3KVAA 2ES0A 5AQGB 4E7SA 3ZSSA 5JR9B 4IE7A 2CXDA 5HWXA 3CX8B 3ZMTB 2WDVA 4IIJE 5FKYA 1VCTA 1U5PA 4XAXB 4JYAT 2WCAA 5L4EA 2C5JA 3RX6A 4HFHA 4UF0A 1HF8A 2XQAA 3D0TA 1KK7A 3U3IA 4DR6T 4ISSA 4QXCB 2JMKA 1FMVA 2NWBA 3P8CD 4LMJA 1D0ZA 2P9BA 4PFPA 5L3GB 4ERRA 3RRWA 2EHOB 3P4RA 2XQ7A 3B13A 5AQFB 3ANWA 1ZOYA 3ZEFB 5HCJA 1BR4A 4KMCA 4UXNB 1UUSA 4YJ2E 3NZPA 2I6HA 4ZI3D 4EYUA 2PG8A 3AE3A 2M6BA 4COFA 2H7OA 4ZZCA 1HNXT 3H3MA 3PU8A 4O4IE 1B7TA 1WLXA 3ETVA 1T72A 3E0ZA 3UUBA 4LFBT 2JQHA 3EAMA 1YXRA 3OTOT 3WAJA 2Q9QA 5LG3A 2UXXB 5JR9A 3EUHA 4LF5T 5J1GA 1UGOA 4U33A 2VVSA 2HN1A 3C50A 1Y01A 4HEAA 5IYZE 4DV1T 2NW9A 5AQLB 4KI0F 5LCYA 2YK0A 4PJJA 4FI5A 4DV7T 2XUEA 3TLSA 1US7B 2Q9QC 4LF9T 2WU2A 5JDGA 5JR9C 1U4QA 2B76A 2XAJB 3ZYKA 3CWZB 3K8PC 1X79A 1MIVA 5LMUT 4QWNB 2W67A 4ILAA 2XAHB 3PDYA 4AI6A 1HG5A 2WP9A 4A5XA 4K0UA 3AVSA 3RIAA 2IC9A 2C5KT 4JI7T 4MLKA 3VU7H 4P09A 4X20E 3HI2A 3AA0B 3T8OA 2KXPB 2ACZA 3AE5A 4YXDA 3RQWA 4IDOA 4GYRA 5HEHA 4X1IE 3K3QC 1QSDA 4WBNE 1M7KA 2R6GF 2BG9E 3SOLA 4TWFA 4TN7B 2E5LT 2ZM6T 3CX6B 4GOUA 5DABA 4H9QC 3RGLA 4JUYA 3PUSA 4B3RT 3MXZA 5ABHA 2V7LA 4Z90A 3SFDA 5M4YA 3N9OA 1KFYA 2JQ9A 1DU2A 1YD8G 3ZN1B 1VRBA 3ZC1A 2X0YA 5LHHB 3R6NA 4X1KE 4H9RC 4DBRA 3MJXA 1LKXA 2IIUA 4CXXA 2VL8A 4JI4T 4AQFC 1D0XA 4UEMA 5J0ZA 2M6IA 1BR2A 3AA1B 2W4XA 1KNZA 1MMDA 2XQYA 4NIQA 2CWYA 2XSBA 5DQWA 4JI3T 5E0OA 3AEAA 2SPCA 5KDMC 3ZLIA 5FL0A 4OYKA 3PUGA 1KNPA 4HWCA 4TNVA 4GK0E 2XAFB 2UUAT 5JQGE 2PBIA 3AE9A 3KINB 2W2UA 2YDRA 5FP3A 4UELA 5H6RB 2NW7A 1W9RA 2LKHA 1UX5A 3GN5A 3OKQA 3Q5DA 2W00A 2IC6A 5ABFA 1HFAA 3MKDA 4K0KT 1CUNA 3RPUA 2N2NA 4ISTA 3TLUA 3N9LA 2YU2A 1E1HB 5FXWA 3RRCA 1V9DA 3PU3A 5FXXA 2BDEA 4HWHA 3I0QA 5TAOA 2KINB 3FXEB 4TWDA 2D0UA 1HG2A 2KLQA 4DV0T 3UFEA 2XY8B 2WMOA 1H7CA 2XQ6A 2YN6A 3O4XE 3LK42 4LF4T 4AIUA 3UULA 3RYHE 1LRZA 3ZMSB 2AE9A 1W0BA 4HFEA 3V5UA 3F57A 2BBJA 4AKLA 4NUVA 4CXYA 3CPZA 2ODVA 4O2AE 3LK2B 3J7Yq 1YKHB 1HX8A 3L09A 5FY7A 1IZNB 5LGTB 3UUXB 3PUQA 3A5XA 4IGUA 3UT5E 2XPKA 1G73A 4IT4A
chains in the Genus database with same CATH topology
4JI8T 4NXMT 4DR4T 1I94T 3T1HT 4YHHT 1HNXT 2UUAT 4X62T 4DR5T 4JI6T 1XNRT 2UUCT 4LF6T 4OX9T 2UXBT 4LFBT 1XNQT 4JI5T 3OTOT 4AQYT 1IBLT 1XMOT 4DV4T 2E5LT 4K0KT 2ZM6T 4LF5T 4DR7T 1XMQT 2UXDT 1IBMT 2UXCT 1HNZT 4DV3T 3T1YT 5LMNT 4JYAT 4DV6T 2UU9T 1HNWT 4JI2T 4LF7T 1J5ET 4B3RT 4JI0T 4GKJT 1N36T 2UUBT 4DR3T 4DR6T 1IBKT 4YY3T 4DV0T 4DV1T 2HHHT 2VQET 4JI1T 4DUZT 4LFAT 4LF4T 4KHPT 4JI4T 4GKKT 4DV7T 4B3MT 4DV5T 4NXNT 4LFCT 4B3TT 4B3ST 4LF9T 4DR1T 4X64T 4JV5T 1N33T 1N32T 4X65T 5BR8T 4JI3T 1N34T 4DUYT 4X66T 5IWAT 2F4VT 5LMUT 4LF8T 1HR0T 2VQFT 4DV2T 1FJGT 4DR2T 4JI7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 T;  4NXM T;  4DR4 T;  1I94 T;  3T1H T;  4YHH T;  1HNX T;  2UUA T;  4X62 T;  4DR5 T;  4JI6 T;  1XNR T;  2UUC T;  4LF6 T;  4OX9 T;  2UXB T;  4LFB T;  1XNQ T;  4JI5 T;  3OTO T;  4AQY T;  1IBL T;  1XMO T;  4DV4 T;  2E5L T;  4K0K T;  2ZM6 T;  4LF5 T;  4DR7 T;  1XMQ T;  2UXD T;  1IBM T;  2UXC T;  1HNZ T;  4DV3 T;  3T1Y T;  5LMN T;  4JYA T;  4DV6 T;  2UU9 T;  1HNW T;  4JI2 T;  4LF7 T;  1J5E T;  4B3R T;  4JI0 T;  4GKJ T;  1N36 T;  2UUB T;  4DR3 T;  4DR6 T;  1IBK T;  4YY3 T;  4DV0 T;  4DV1 T;  2HHH T;  2VQE T;  4JI1 T;  4DUZ T;  4LFA T;  4LF4 T;  4KHP T;  4JI4 T;  4GKK T;  4DV7 T;  4B3M T;  4DV5 T;  4NXN T;  4LFC T;  4B3T T;  4B3S T;  4LF9 T;  4DR1 T;  4X64 T;  4JV5 T;  1N33 T;  1N32 T;  4X65 T;  5BR8 T;  4JI3 T;  1N34 T;  4DUY T;  4X66 T;  5IWA T;  2F4V T;  5LMU T;  4LF8 T;  1HR0 T;  2VQF T;  4DV2 T;  1FJG T;  4DR2 T;  4JI7 T; 
#chains in the Genus database with same CATH topology
 4ZI7 E;  3N5L A;  2RP4 A;  3JAE A;  3T1H T;  4DR5 T;  1XNR T;  4ZOL E;  3CVR A;  1X9B A;  3CKD A;  2XSA A;  3VHL A;  4OHF A;  1FEW A;  2ZLY A;  2BG9 B;  1CHU A;  3AEB A;  3CQX C;  4DVD A;  4HWF A;  2V5D A;  2W62 A;  2N1G A;  1Y64 B;  2JJ9 A;  1UCU A;  2VK9 A;  4MBQ A;  1XMQ T;  3RIU A;  3TKL B;  3FZL B;  3L39 A;  2PFV A;  4O4L E;  4UR9 A;  3KDS E;  5LHG B;  3NZQ A;  2V7I A;  5F3J A;  4YLH A;  5CJ5 A;  2HHH T;  2VQE T;  4HGA A;  4XBF B;  1MNE A;  4PK5 A;  1L0V A;  1YKE B;  4OYJ A;  4GK5 E;  3KV6 A;  2H3R A;  4I50 E;  3ZCI A;  1SA0 E;  4CN4 A;  3LBX A;  5EK2 A;  2CWO A;  3F31 A;  2DNX A;  3DTO A;  3EDV A;  3IA3 A;  2YDQ A;  5LJM A;  3ZMU B;  5EZY E;  4X1Y E;  2IUB A;  3ANW B;  4AKR B;  2E9X D;  4AKG A;  4JI8 T;  5LXT E;  4U7Y A;  2UUC T;  4HFC A;  2CHN A;  1JNZ A;  3AXJ A;  2CXF A;  1HX1 B;  2OLT A;  5DQV A;  2MPK A;  4H9S E;  1ZP0 A;  5FXZ A;  1UX4 A;  3AE1 A;  3RC3 A;  4PAG A;  3ZN0 B;  1NEK A;  2K3W A;  2UXC T;  2Q9Q B;  1HNZ T;  2BG9 A;  4G63 A;  2CLY B;  1KF6 A;  2DCF A;  2N9D A;  3RH3 A;  4IL9 A;  2J47 A;  2MBG A;  1EZ3 A;  2WS3 A;  2PJQ A;  3PUV F;  2Y8D A;  4ZXL A;  5AQH B;  3UFG A;  2HH7 A;  3JAD A;  3NRX A;  4OFZ A;  3IHR A;  4P1N A;  4JLE A;  5H6Q B;  5BMV E;  2LRL A;  4DUZ T;  4H9N C;  3FZM B;  2X9Y A;  2NOX A;  1WR6 A;  4YT0 A;  1Z8U A;  1M62 A;  4DO0 A;  3ZT5 A;  3G06 A;  4MHC A;  4PK4 A;  4IL4 A;  1N33 T;  3P50 A;  2GK9 A;  2WAU A;  1NAF A;  2BG9 C;  4X66 T;  2F4V T;  1HR0 T;  4PK6 A;  3RI5 A;  3KBT A;  3QNU A;  3QC9 A;  1FJG T;  3C4W A;  2W0G A;  4CN6 A;  3TLV A;  1BR1 A;  2V7K A;  1E7P A;  2LEH A;  2NP9 A;  3PJA A;  5L3D B;  1WR0 A;  3RHW A;  2D2S A;  1XDP A;  4LMK A;  4U72 A;  2YEV C;  4IDQ A;  3EAB A;  5AQP B;  1XDO A;  3AAE B;  5AFU L;  4WYV A;  5KXJ A;  5L3F B;  3PV0 F;  4DV6 T;  4ILU A;  3N2G E;  2ZM0 A;  3F2E A;  4HE8 A;  5F5W A;  4YSZ A;  3CIR A;  3PE0 A;  4Q25 A;  3PJA J;  4XZC A;  4HTE A;  4N78 D;  4KHP T;  3O1I A;  3DP7 A;  3QOF A;  4WW0 A;  4NXN T;  4CI1 B;  1D1B A;  3AAI A;  4ZZB A;  5LP6 E;  2QA7 A;  2LT3 A;  4O8S A;  4AIS A;  5JRC A;  2L8K A;  1T98 A;  5BR8 T;  4I55 E;  1N34 T;  3OPC A;  4UV9 B;  5C2T A;  5FMN A;  1WFD A;  3C51 A;  3KFW X;  3LDQ B;  3ZKR A;  2DWK A;  1WCR A;  5CGM A;  2NTY A;  5HAX A;  1O3X A;  1E2A A;  4DR4 T;  3VR9 A;  2CLY C;  1OED A;  2DHR A;  4J2C A;  1NWM X;  3BQL A;  4JI6 T;  4ZI2 D;  4FJO A;  4HN9 A;  4DMV A;  2BVM A;  3UQ4 A;  2B1E A;  5HXS A;  4AQY T;  4F6R C;  3A7M A;  2UXN B;  5LBM A;  3X1D A;  4F8H A;  4ZS3 A;  3GN5 B;  2LKG A;  2ZM8 A;  4HWD A;  5ABF B;  3PTR B;  2UU9 T;  2FJA A;  4JI2 T;  3UUM A;  3AA6 B;  3IEE A;  4AQF A;  2J4G A;  3FZK B;  4BJN A;  2D0T A;  3C4Z A;  3Q5X A;  2ZMA A;  1OED C;  2K5B B;  2LJL A;  2XQ5 A;  2XAQ B;  2FJE A;  5AQT B;  1SHZ C;  3ZPO A;  4AKH A;  3FBL A;  3B57 A;  2KSR A;  5AQK B;  4KHZ F;  4PJN A;  4X5T A;  3SS1 A;  5EK4 A;  1SUM B;  4UVB B;  2LM9 A;  1MMA A;  5EK3 A;  2QGS A;  3UU5 A;  5CA0 E;  4YHH T;  3NBX X;  2NR4 A;  3NWI A;  3PUA A;  5HEU A;  3VRB A;  3NRY A;  2W63 A;  5JVD E;  3ZYM A;  1JNR A;  1XWM A;  4TNW A;  4A56 A;  5L2L A;  1XNQ T;  4PJL A;  4NUU A;  5L3C B;  5HXR A;  4DMW A;  2Q9Q D;  3HR0 A;  4U2Y A;  3VKG A;  5JTG A;  3UU3 A;  5L3E B;  1OXZ A;  1GQE A;  3C64 A;  2JRK A;  1SE7 A;  2ACX A;  2BS2 A;  5KMG P;  4P0B A;  5AQO B;  1IBK T;  5CFB A;  3RF1 A;  3M65 A;  1UUR A;  2CEA A;  3P4S A;  5AQV B;  3AE7 A;  2OV9 A;  3PUX F;  4JV5 T;  5ADX L;  3LBX B;  1MND A;  3HKB E;  4C91 A;  4EGW A;  3FXD B;  2L9Q A;  2WMN A;  2EHO D;  1QLB A;  4BAY B;  2C5I T;  3FZF B;  3ZMV B;  2XQ4 A;  3JC6 C;  3JCF A;  4TV8 E;  2IML A;  2KT9 A;  3QK6 A;  4PJM A;  2K24 A;  2E2A A;  2V1D B;  4EZ4 A;  4PNI A;  2MYS A;  5L3B B;  5JDH A;  1WRD A;  2WBL A;  4CI3 B;  2VKO A;  2LSY A;  2FJD A;  3I0O A;  2V8S V;  1T7S A;  3I9W A;  1OED E;  2OA5 A;  3ONX A;  4WNK A;  4IE0 A;  2X0H A;  3RLF F;  1J1J A;  4I0U A;  5L47 A;  3AXJ B;  5FNV E;  2LLY A;  2BVL A;  2CXL A;  5FXV A;  4DV4 T;  2VAS A;  2WDQ A;  3IF8 B;  3N2O A;  3GA8 A;  4BJM A;  2CM0 A;  3AEG A;  3T1Y T;  4EYY R;  4I43 B;  2A2F X;  3Q9D A;  3GMI A;  4U2Z A;  1WYB A;  1XZY A;  1FMW A;  3ZT7 A;  2RA1 A;  2FBW A;  3DJB A;  2HPJ A;  4MFR A;  4QHO A;  1BR0 A;  1T8B A;  5JDN A;  2DI4 A;  3E22 E;  4EB6 E;  2X67 A;  1MIW A;  2BS4 A;  2LOP A;  2WM9 A;  3L8R A;  4O2B E;  4JBW F;  2V26 A;  2XTL A;  2LHR A;  5LBQ B;  2D9D A;  1VOM A;  5HXE A;  3JAF A;  2E8I A;  1N32 T;  4CI2 B;  1HCI A;  5LB7 B;  3MAC A;  3ETU A;  3HKD E;  4QKN A;  4EAH A;  2XQ8 A;  2X9X A;  1G8X A;  4KBM B;  4DR2 T;  2CBI A;  4U7I A;  3TLT A;  4HKA A;  2WB5 A;  4YSX A;  4X62 T;  2MOZ A;  4AXP A;  2KWI B;  2WU5 A;  5HWY A;  3QUJ A;  2WSS V;  5AQJ B;  2IDO B;  3AE8 A;  2V6Y B;  4L9I A;  1VCS A;  2BZB A;  2YOE A;  5KX5 E;  2YU1 A;  3ZYL A;  2VKD A;  4ZI3 C;  2X9W A;  3I9Y A;  5JDL A;  2D5U A;  2QYW A;  4JI0 T;  4ADZ A;  2VKH A;  3CML A;  2UUB T;  2KWH A;  4QH1 A;  4DID B;  3VR8 A;  5ABE A;  3ZT6 A;  4JI1 T;  1W0A A;  2X51 A;  3ESL A;  4I4T E;  2KMF A;  5HEO A;  5GON E;  4HFI A;  4IE4 A;  4B6X A;  3LSV A;  3CQC B;  4B3S T;  4C90 A;  4X64 T;  5HEG A;  1KEY A;  5IUX A;  5FYM A;  2J1D G;  5JRC B;  3FHN A;  5LJN A;  2K48 A;  4A98 A;  4HFD A;  2VQF T;  3AA7 B;  3ZJ2 A;  4DV2 T;  1ZKE A;  4BA9 A;  5LG4 A;  1D1C A;  3HKC E;  2JQQ A;  3WAK A;  3AE2 A;  3NVO A;  5AQU B;  3C98 B;  2A3D A;  2BKN A;  3VKH A;  1OED B;  4ILC A;  2LSK A;  2WWV A;  2XM1 A;  4UIG A;  5LGN B;  1UK5 A;  4H63 V;  4HFV A;  1QUU A;  4CQI A;  2LRK A;  4ZS2 A;  3GWH A;  2E5V A;  3LFM A;  5HCM A;  3OVU A;  4ZI2 C;  3N9P A;  4KP3 C;  4UVC B;  1OWA A;  2PTF A;  3RKG A;  3M3Z B;  1IAP A;  4ZHQ E;  2V6Y A;  4CZZ B;  2JIW A;  5JDM A;  5AQR B;  1N36 T;  2K9A A;  4QXH B;  3UQ7 A;  2W66 A;  3QB5 A;  3N2K E;  2WZH A;  4DND A;  3MA9 A;  3PUR A;  3MK7 C;  4B3M T;  4O4J E;  3EHZ A;  4HWI B;  2JMH A;  4WZX A;  1LVF A;  5HXC A;  3EI0 A;  3SRZ A;  3BQK A;  2XHE B;  3L3P A;  4EZH A;  3ONL C;  4QH5 A;  3UU8 A;  4ANJ A;  4ILB A;  3OBV E;  2FUP A;  1I6Z A;  2XQ9 A;  5LOV E;  1FIO A;  5CB4 E;  1WYC A;  4G2A A;  4UVA B;  4ASK A;  2Y48 B;  3H3A A;  3RQU A;  4LF6 T;  2LSJ A;  5AQN B;  2UXB T;  2CHO A;  5C8Y E;  1HTJ F;  2WDR A;  3E08 A;  3AED A;  1IBL T;  1ZV4 X;  4IE5 A;  4YHJ A;  2CCQ A;  4H63 H;  4HFB A;  4EV6 A;  1J5W A;  5AQI B;  3H37 A;  3MZK B;  3N9Q A;  2LOS A;  5LA6 E;  2LSI A;  2CE7 A;  4KX6 A;  2VB6 A;  2DWG A;  2NTX A;  4GKJ T;  4EXT A;  3FBZ A;  2G0U A;  4YSY A;  4DBQ A;  4DR3 T;  4YY3 T;  2DLR A;  2EHO A;  5HEJ A;  3LJC A;  1D0Y A;  4LFA T;  2MAW A;  3V5S A;  5F8P A;  2HN2 A;  3PUW F;  1IJ6 A;  4LFC T;  2L3L A;  2E9X B;  2WY2 A;  2VL0 A;  2X0L B;  5LNK A;  2AXD S;  4AKI A;  5IWA T;  2X66 A;  4MAL A;  3ONJ A;  2Z6E A;  1ZHC A;  2JPF A;  2WQY A;  3QB5 K;  2BBH A;  2LM2 A;  3RYF E;  1NEN A;  5C3J A;  3BK9 A;  2WZI A;  3AEF A;  4NXM T;  3W15 B;  1IJ5 A;  5HXH A;  2CBJ A;  2XQ3 A;  2EHO C;  4IE6 A;  3AEC A;  3R84 B;  1YQ4 A;  3FB2 A;  4UV8 B;  3I1A A;  4V1A v;  3AE6 A;  2XM2 A;  3P7I A;  2MTQ A;  4IDN A;  2CPT A;  4TWH A;  1ZEE A;  4QX8 B;  2UXD T;  3CK6 A;  2VUR A;  3RIF A;  5FL1 A;  2QVA A;  3ZCJ A;  5LHI B;  2HPL A;  4PW8 A;  3EDU A;  5AQS B;  4IDZ A;  2YKS A;  1J5E T;  2QRX A;  1YW0 A;  4TUY E;  2IAK A;  3Q5E A;  2ODU A;  4EIW A;  4E7Z A;  3WI3 A;  3SFE A;  2VWA A;  2H88 A;  3UU6 A;  3O9X A;  5CA1 E;  4GYS A;  2VKJ A;  1W09 A;  3BQI A;  4DV5 T;  2DL1 A;  3O1H A;  1S94 A;  4B3T T;  3UUN A;  5FY1 A;  4Z8X A;  3EVY A;  3HL6 A;  4X65 T;  4O4H E;  1AJ3 A;  3K3N A;  3UU4 A;  3P4Q A;  4LF8 T;  4KUM B;  2A72 A;  3AAA B;  3KV4 A;  2E9X A;  3FZH B;  4CN1 A;  5JH7 E;  2YIN A;  4TZ4 C;  2V7J A;  1I94 T;  2ZM2 A;  3HA4 A;  2X68 A;  3KVB A;  3LG7 A;  2C0S A;  2NW8 A;  3KV5 A;  2I0M A;  3Q5W A;  3TLW A;  2IHR 1;  5DJQ C;  4JI5 T;  3K1S A;  3B5M A;  1XMO T;  1HS7 A;  5LYJ E;  2XZE A;  3NKZ A;  1KNR A;  1Z0P A;  5FVK A;  5FY0 A;  3OJA A;  2VVN A;  2CRB A;  2E9X C;  4LF7 T;  3UTK A;  3ZC0 A;  2X9H A;  3N9M A;  4WBO A;  4YJ3 E;  5A1L A;  4A97 A;  2I59 A;  5L4H A;  3CQG B;  2LE8 A;  2BKP A;  5AQQ B;  3CX7 B;  5IHY A;  1LVK A;  4GKK T;  3O1J A;  5ABG A;  2BKO A;  5LGU B;  2V7M A;  3RKO A;  4DR1 T;  1D1A A;  3J9X 1;  2J62 A;  5HYA A;  2IW5 B;  4TX5 A;  2CA5 A;  4YTN A;  4NPP A;  2XJ7 A;  3U78 A;  3AB3 B;  4IHJ E;  4QXB B;  3RC8 A;  2XAG B;  3ZJ1 A;  2W61 A;  3SWH A;  4IRE A;  2M67 A;  4U31 A;  5JRE A;  4P0A A;  1S35 A;  4EED A;  3LK3 B;  3Q2M A;  3HKE E;  3PUZ F;  4OX9 T;  4CXW A;  4ZEY A;  5J2U E;  2LSG A;  3ZST A;  3S4U A;  4AQG A;  1R8I A;  2LHN A;  4UF0 B;  4U3C A;  2FJB A;  4H9O C;  4DR7 T;  4EEB A;  1IBM T;  4L0R A;  3OYZ A;  4OK0 A;  3PUY F;  4LML A;  3VRA A;  4DV3 T;  5JDQ A;  5LMN T;  1HNW T;  2KZ7 B;  4YFS A;  5J2T E;  5FVL A;  2WWU A;  2YDS A;  5ETW A;  3JC6 D;  2JQK A;  4Z91 A;  4YTM A;  4QX7 B;  3RIU C;  4H9P C;  3ABV A;  4L5G A;  3RYI E;  3P4W A;  3KBU A;  2RPA A;  3ZMZ B;  4GIW A;  4QH4 A;  2KND A;  3AE4 A;  4TV9 E;  4EOZ B;  2V5C A;  3P4P A;  3AVR A;  4JEH B;  1YQ3 A;  3RYC E;  4YTP A;  3N9N A;  3IBP A;  2H7V C;  2V6X A;  4DUY T;  3OYX A;  4JEU B;  4U74 A;  1MIY A;  2Y6X A;  5AQM B;  1MMG A;  2XAS B;  5JDF A;  3AEE A;  4M1P A;  2BS3 A;  3KV9 A;  3K3O A;  4PFO A;  1MMN A;  4IDP A;  2H89 A;  3C4X A;  3A8Y C;  2A9U A;  2CMR A;  3KVA A;  2ES0 A;  5AQG B;  4E7S A;  3ZSS A;  5JR9 B;  4IE7 A;  2CXD A;  5HWX A;  3CX8 B;  3ZMT B;  2WDV A;  4IIJ E;  5FKY A;  1VCT A;  1U5P A;  4XAX B;  4JYA T;  2WCA A;  5L4E A;  2C5J A;  3RX6 A;  4HFH A;  4UF0 A;  1HF8 A;  2XQA A;  3D0T A;  1KK7 A;  3U3I A;  4DR6 T;  4ISS A;  4QXC B;  2JMK A;  1FMV A;  2NWB A;  3P8C D;  4LMJ A;  1D0Z A;  2P9B A;  4PFP A;  5L3G B;  4ERR A;  3RRW A;  2EHO B;  3P4R A;  2XQ7 A;  3B13 A;  5AQF B;  3ANW A;  1ZOY A;  3ZEF B;  5HCJ A;  1BR4 A;  4KMC A;  4UXN B;  1UUS A;  4YJ2 E;  3NZP A;  2I6H A;  4ZI3 D;  4EYU A;  2PG8 A;  3AE3 A;  2M6B A;  4COF A;  2H7O A;  4ZZC A;  1HNX T;  3H3M A;  3PU8 A;  4O4I E;  1B7T A;  1WLX A;  3ETV A;  1T72 A;  3E0Z A;  3UUB A;  4LFB T;  2JQH A;  3EAM A;  1YXR A;  3OTO T;  3WAJ A;  2Q9Q A;  5LG3 A;  2UXX B;  5JR9 A;  3EUH A;  4LF5 T;  5J1G A;  1UGO A;  4U33 A;  2VVS A;  2HN1 A;  3C50 A;  1Y01 A;  4HEA A;  5IYZ E;  4DV1 T;  2NW9 A;  5AQL B;  4KI0 F;  5LCY A;  2YK0 A;  4PJJ A;  4FI5 A;  4DV7 T;  2XUE A;  3TLS A;  1US7 B;  2Q9Q C;  4LF9 T;  2WU2 A;  5JDG A;  5JR9 C;  1U4Q A;  2B76 A;  2XAJ B;  3ZYK A;  3CWZ B;  3K8P C;  1X79 A;  1MIV A;  5LMU T;  4QWN B;  2W67 A;  4ILA A;  2XAH B;  3PDY A;  4AI6 A;  1HG5 A;  2WP9 A;  4A5X A;  4K0U A;  3AVS A;  3RIA A;  2IC9 A;  2C5K T;  4JI7 T;  4MLK A;  3VU7 H;  4P09 A;  4X20 E;  3HI2 A;  3AA0 B;  3T8O A;  2KXP B;  2ACZ A;  3AE5 A;  4YXD A;  3RQW A;  4IDO A;  4GYR A;  5HEH A;  4X1I E;  3K3Q C;  1QSD A;  4WBN E;  1M7K A;  2R6G F;  2BG9 E;  3SOL A;  4TWF A;  4TN7 B;  2E5L T;  2ZM6 T;  3CX6 B;  4GOU A;  5DAB A;  4H9Q C;  3RGL A;  4JUY A;  3PUS A;  4B3R T;  3MXZ A;  5ABH A;  2V7L A;  4Z90 A;  3SFD A;  5M4Y A;  3N9O A;  1KFY A;  2JQ9 A;  1DU2 A;  1YD8 G;  3ZN1 B;  1VRB A;  3ZC1 A;  2X0Y A;  5LHH B;  3R6N A;  4X1K E;  4H9R C;  4DBR A;  3MJX A;  1LKX A;  2IIU A;  4CXX A;  2VL8 A;  4JI4 T;  4AQF C;  1D0X A;  4UEM A;  5J0Z A;  2M6I A;  1BR2 A;  3AA1 B;  2W4X A;  1KNZ A;  1MMD A;  2XQY A;  4NIQ A;  2CWY A;  2XSB A;  5DQW A;  4JI3 T;  5E0O A;  3AEA A;  2SPC A;  5KDM C;  3ZLI A;  5FL0 A;  4OYK A;  3PUG A;  1KNP A;  4HWC A;  4TNV A;  4GK0 E;  2XAF B;  2UUA T;  5JQG E;  2PBI A;  3AE9 A;  3KIN B;  2W2U A;  2YDR A;  5FP3 A;  4UEL A;  5H6R B;  2NW7 A;  1W9R A;  2LKH A;  1UX5 A;  3GN5 A;  3OKQ A;  3Q5D A;  2W00 A;  2IC6 A;  5ABF A;  1HFA A;  3MKD A;  4K0K T;  1CUN A;  3RPU A;  2N2N A;  4IST A;  3TLU A;  3N9L A;  2YU2 A;  1E1H B;  5FXW A;  3RRC A;  1V9D A;  3PU3 A;  5FXX A;  2BDE A;  4HWH A;  3I0Q A;  5TAO A;  2KIN B;  3FXE B;  4TWD A;  2D0U A;  1HG2 A;  2KLQ A;  4DV0 T;  3UFE A;  2XY8 B;  2WMO A;  1H7C A;  2XQ6 A;  2YN6 A;  3O4X E;  3LK4 2;  4LF4 T;  4AIU A;  3UUL A;  3RYH E;  1LRZ A;  3ZMS B;  2AE9 A;  1W0B A;  4HFE A;  3V5U A;  3F57 A;  2BBJ A;  4AKL A;  4NUV A;  4CXY A;  3CPZ A;  2ODV A;  4O2A E;  3LK2 B;  3J7Y q;  1YKH B;  1HX8 A;  3L09 A;  5FY7 A;  1IZN B;  5LGT B;  3UUX B;  3PUQ A;  3A5X A;  4IGU A;  3UT5 E;  2XPK A;  1G73 A;  4IT4 A; 
#chains in the Genus database with same CATH homology
 4JI8 T;  4NXM T;  4DR4 T;  1I94 T;  3T1H T;  4YHH T;  1HNX T;  2UUA T;  4X62 T;  4DR5 T;  4JI6 T;  1XNR T;  2UUC T;  4LF6 T;  4OX9 T;  2UXB T;  4LFB T;  1XNQ T;  4JI5 T;  3OTO T;  4AQY T;  1IBL T;  1XMO T;  4DV4 T;  2E5L T;  4K0K T;  2ZM6 T;  4LF5 T;  4DR7 T;  1XMQ T;  2UXD T;  1IBM T;  2UXC T;  1HNZ T;  4DV3 T;  3T1Y T;  5LMN T;  4JYA T;  4DV6 T;  2UU9 T;  1HNW T;  4JI2 T;  4LF7 T;  1J5E T;  4B3R T;  4JI0 T;  4GKJ T;  1N36 T;  2UUB T;  4DR3 T;  4DR6 T;  1IBK T;  4YY3 T;  4DV0 T;  4DV1 T;  2HHH T;  2VQE T;  4JI1 T;  4DUZ T;  4LFA T;  4LF4 T;  4KHP T;  4JI4 T;  4GKK T;  4DV7 T;  4B3M T;  4DV5 T;  4NXN T;  4LFC T;  4B3T T;  4B3S T;  4LF9 T;  4DR1 T;  4X64 T;  4JV5 T;  1N33 T;  1N32 T;  4X65 T;  5BR8 T;  4JI3 T;  1N34 T;  4DUY T;  4X66 T;  5IWA T;  2F4V T;  5LMU T;  4LF8 T;  1HR0 T;  2VQF T;  4DV2 T;  1FJG T;  4DR2 T;  4JI7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...