4LF5T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf5T00
3T1HT 1IBKT 4DV0T 4DR6T 4LF9T 4GKJT 4B3TT 5IWAT 1HNZT 4JV5T 4B3RT 4DR5T 5LMUT 2F4VT 4LFAT 4LF5T 4X62T 4DV3T 4AQYT 4JI2T 4NXMT 1XMQT 1N36T 1HNXT 4LF7T 4DR4T 4YHHT 4DV1T 4OX9T 4LF8T 4GKKT 4B3MT 2HHHT 4JYAT 1IBLT 4JI3T 2UUAT 4DV4T 4B3ST 4LF4T 1N32T 4DR1T 4DUZT 4JI1T 1FJGT 4LFBT 2UUBT 5BR8T 2UXBT 4K0KT 1I94T 4LF6T 2VQET 4DV2T 4DV5T 1XNQT 4DV6T 2UXCT 4DR7T 4JI4T 4DUYT 2ZM6T 4JI7T 4JI8T 5LMNT 1HR0T 4DR3T 2UUCT 4LFCT 4YY3T 3T1YT 1IBMT 4JI0T 1XMOT 4X65T 2UU9T 1HNWT 2VQFT 4X64T 1XNRT 1N33T 4JI5T 3OTOT 4JI6T 4NXNT 4X66T 4DR2T 1N34T 2E5LT 4KHPT 2UXDT 4DV7T 1J5ET
chains in the Genus database with same CATH superfamily
3AEFA 3HKDE 2OLTA 4IDQA 1OEDA 3N9NA 3V5SA 4QXCB 5FXVA 3KV6A 4DV0T 5JR9A 4AISA 4DR6T 4ADZA 3RIAA 2L9QA 4I50E 5IWAT 4GOUA 4HGAA 2NTXA 2YU1A 1T98A 5HCMA 5KMGP 1XZYA 2V6YB 2ZM8A 5FY1A 2VVNA 4C90A 2ODUA 4AQFA 3QC9A 5KDMC 3NZQA 2CLYB 2WBLA 4I43B 1YD8G 5L47A 2NR4A 2F4VT 2DNXA 3N2GE 5FXXA 3Q5DA 2VKJA 4H9PC 2XAQB 1Z0PA 2WWUA 3EVYA 2BG9C 2XJ7A 2H3RA 1ZV4X 4LF5T 1WRDA 2E9XB 4FI5A 4QXHB 1KNZA 4O2BE 2LRKA 4PJNA 1VRBA 5FVKA 3VU7H 2ACXA 1XMQT 3P7IA 3LFMA 5AQRB 1AJ3A 2W67A 5FYMA 4IIJE 4TV9E 3ANWA 5EK3A 3AVRA 3RF1A 3P8CD 4YT0A 4PW8A 5LB7B 2M6IA 4EEDA 1MNDA 3KINB 4QWNB 4AQGA 4WNKA 5AQFB 1T8BA 5C8YE 2YK0A 2CBIA 2WCAA 3KBUA 1W0AA 2MPKA 2QVAA 3NRYA 4YTMA 4OX9T 1MNEA 3ZJ1A 4EEBA 4AKLA 3J9X1 3RIFA 2IW5B 4I0UA 4UV8B 2KZ7B 1R8IA 3P4PA 4GK0E 4NIQA 4YHJA 5HCJA 2MBGA 5LA6E 1HG2A 1UGOA 3GMIA 4EV6A 4B3MT 4AKHA 2W63A 5FL1A 5LGUB 3BK9A 2X9XA 4CN6A 1E1HB 1JNRA 5HXHA 2X0LB 4KP3C 4HWIB 3TLUA 2LSKA 2VWAA 3H3MA 4H63H 3ZN0B 4ZZCA 4JI3T 2DI4A 2NW7A 2EHOD 1HFAA 2C0SA 1UX4A 2VL8A 4DBRA 5LHIB 2ZM2A 2MOZA 2UUAT 2WS3A 1N32T 4UV9B 1W9RA 2YDSA 4DUZT 1FJGT 1T72A 3PUGA 2PBIA 4YSYA 1KFYA 2LJLA 4HFCA 4IE0A 4KI0F 1KNRA 1VCTA 5DQVA 3X1DA 5JDGA 2PJQA 1FIOA 4G63A 4U74A 2V7MA 5FL0A 1ZP0A 2IMLA 4HWCA 3N9QA 4COFA 2BKNA 4LF6T 2NP9A 1YKHB 5AQIB 2WDQA 1MMNA 4IDZA 3E08A 4X1IE 3ZJ2A 2V5CA 4UVAB 1ZEEA 4DV5T 1SUMB 2UXCT 2D0TA 3ONXA 4LMKA 3EAMA 4DIDB 4JBWF 4Q25A 2VKDA 2XQ8A 5EK2A 1IAPA 3UTKA 2D5UA 3PU8A 4TX5A 2CXLA 3UFEA 3ZCJA 4CXXA 2C5JA 4YTNA 2BDEA 4I4TE 1Z8UA 4QKNA 1EZ3A 2V8SV 4IE5A 5LP6E 4CXYA 2XAGB 3O1JA 4F8HA 2X68A 1HR0T 3HKEE 4Z90A 3M65A 1SE7A 3FBZA 3BQKA 4A98A 2E8IA 3C64A 3CQCB 3I0OA 4HN9A 4CQIA 3AEDA 1D1CA 4XZCA 3ZT7A 3PU3A 3VR9A 2AXDS 5CGMA 2UU9T 2EHOA 1OEDC 5HXSA 3CKDA 2W4XA 3MZKB 4JI5T 2RP4A 3RX6A 5HEOA 4EYUA 3ZMVB 3AE1A 5LBQB 5F5WA 1MIWA 2JQKA 3C98B 3ESLA 3LK3B 4X1YE 5AQKB 3I1AA 2E5LT 4P0AA 4DV7T 1WR6A 1E2AA 2X51A 1IJ6A 2BG9B 2LLYA 3T1HT 4QH4A 1D1AA 1YQ3A 2LSYA 2Q9QD 3AAAB 3C4XA 4CN4A 3CX7B 5ABGA 2WQYA 2JMKA 1IJ5A 1BR2A 1V9DA 2KLQA 3ANWB 3O4XE 3P50A 4ILUA 4U33A 2NTYA 4LF9T 1DU2A 2CLYC 4UELA 4U31A 2W00A 4V1Av 3RPUA 2M6BA 1HNZT 2X0HA 2CMRA 2NW8A 4X20E 4BA9A 2XY8B 3UU6A 4ZI7E 5LG3A 4PJLA 3PUVF 2XQAA 5AQTB 4IL4A 4CI1B 4KHZF 5JDLA 2W61A 1FMWA 2LEHA 2XAHB 2XQYA 4IE4A 5LMUT 3AAIA 4IDPA 3VKHA 2AE9A 2OV9A 3H37A 1US7B 2K24A 4WZXA 2WWVA 4HTEA 2PTFA 2HH7A 5FY7A 1G73A 1Y64B 2J62A 5HEHA 3IEEA 4LFAT 1KK7A 2JJ9A 4L0RA 4X62T 2UXNB 4DV3T 4G2AA 1WCRA 3EABA 4IDOA 1X79A 4YSXA 3ABVA 3U78A 2LT3A 2XM2A 5JDQA 5LGNB 4NXMT 4MBQA 1N36T 2LE8A 3FHNA 1HNXT 3ONJA 2DWKA 4HFHA 2N2NA 5C3JA 2OA5A 3VKGA 5HEJA 3P4RA 3ZKRA 2WZIA 4DR4T 3RH3A 5FVLA 3UU4A 4ERRA 1J5WA 3HKCE 2LOPA 4A97A 1YW0A 2KNDA 3IBPA 4LMLA 3RYIE 3ZSSA 4ZZBA 4LF8T 4ZS2A 5J0ZA 5F3JA 4CI2B 4GKKT 3NBXX 5JDHA 2YKSA 3F31A 4UF0B 1N34T 1UX5A 5ABHA 2X67A 5AQSB 3FZLB 1VCSA 5KXJA 2J4GA 3AE3A 5JDNA 4IREA 2CWOA 4HEAA 2WMOA 4U7YA 5LOVE 1D1BA 5JH7E 1X9BA 2WMNA 2WY2A 3GA8A 3ZMUB 4E7SA 5L3EB 4FJOA 2HHHT 1BR4A 1HF8A 2HN2A 3AE7A 3ZYKA 4C91A 2XM1A 2JPFA 2X9YA 4U2YA 4ZI2D 2G0UA 2QA7A 1E7PA 5FXZA 3V5UA 3CX8B 2W2UA 2IAKA 2XPKA 4NXNT 4LF4T 1WR0A 2ZMAA 4HFVA 3ETUA 4OYJA 4DR1T 1M7KA 1H7CA 4OHFA 4EAHA 3UUXB 2WDRA 4ZI3C 3ZC1A 4LFBT 1JNZA 3MJXA 3LK42 2BG9A 5AQLB 5BR8T 3KVBA 2UXBT 2DWGA 2M67A 2MAWA 2YOEA 3MACA 4YJ2E 5TAOA 4UVBB 1SHZC 4A56A 2CHNA 2IHR1 4TNVA 3ZN1B 3JC6D 3VR8A 4ISTA 2VQET 3ETVA 3MXZA 4AXPA 2D0UA 4DO0A 2H89A 2E9XC 5FXWA 2VB6A 5JR9B 4BAYB 2LSGA 4NPPA 4DV6T 4IGUA 4YXDA 4ISSA 3K1SA 2KMFA 2LOSA 4HFDA 1MMAA 5AQGB 4ZXLA 2WU5A 3C4ZA 3T8OA 4JI4T 5L3FB 5L3DB 1LVFA 1W09A 2SPCA 2HPJA 2XSAA 2QGSA 3UFGA 4ZEYA 3F2EA 4JI7T 2V26A 5JR9C 1S94A 5KX5E 1KNPA 2DLRA 2PFVA 4IE6A 4TNWA 5AQVB 4L5GA 1FEWA 5LMNT 4PJJA 3ZCIA 3CPZA 5HXRA 1D0XA 4JEUB 5L4HA 5IUXA 5E0OA 3AA1B 3HR0A 2PG8A 4EYYR 3I9YA 5CFBA 2H7OA 1NAFA 4LFCT 3GN5B 4JLEA 4PJMA 1MIVA 3T1YT 3VHLA 4JI0T 2CBJA 4X65T 1XMOT 3KV9A 4WBNE 5ABFA 3AE6A 4EZ4A 4ASKA 1XNRT 1N33T 4KHPT 4NUUA 5JDFA 2MYSA 4JI6T 4QHOA 4AKRB 4EB6E 3K3NA 3Q2MA 2XQ4A 2BVLA 2X66A 3FXEB 4H63V 2BZBA 3MK7C 5JRCA 5HWXA 5A1LA 3FZFB 2UXDT 3NRXA 4PNIA 1J5ET 1IZNB 3N9OA 5JRCB 4GIWA 2CRBA 1Y01A 4GYSA 2LHRA 2I6HA 3PUWF 2V7JA 3PJAA 1IBKT 3RKOA 5H6QB 3JCFA 4UVCB 4BJMA 4J2CA 2WZHA 4O8SA 3PV0F 1UUSA 4UEMA 5HAXA 2CEAA 3N9MA 4KX6A 4KBMB 5DQWA 1YQ4A 2NW9A 3Q5EA 4EZHA 4KMCA 2VL0A 3RIUA 1HG5A 3O9XA 4JV5T 3NVOA 5LNKA 4K0UA 4B3RT 3D0TA 3GN5A 4H9NC 4H9RC 3TLWA 1OEDE 3K3OA 2V1DB 1WYBA 4MFRA 4QH1A 2K48A 5EK4A 3UUBA 5J2UE 3I9WA 3KFWX 1S35A 3RKGA 5J2TE 4DR5T 5FKYA 2BBHA 4GK5E 3MKDA 3FB2A 2JMHA 2XQ7A 2LSIA 4UF0A 3UQ7A 2ACZA 4LMJA 2ES0A 3ZYMA 2BG9E 4X5TA 5L3GB 1GQEA 1XDOA 1WFDA 2VASA 1O3XA 3P4WA 4HFIA 4P09A 4F6RC 5JREA 3OBVE 2V6YA 3RC3A 3UUNA 3VRBA 3LBXA 3RI5A 2FJBA 4HWDA 4YFSA 3W15B 5AQJB 3RRCA 1NEKA 4DMWA 5CA1E 2BKOA 2YU2A 4JUYA 3KBTA 3ZLIA 2IIUA 2LHNA 4TN7B 3B13A 2VURA 3N5LA 4YHHT 5AQQB 4GKJT 2E9XD 3SFEA 3U3IA 2VVSA 2HN1A 3CQXC 3OJAA 4DV1T 4JEHB 3SFDA 5DJQC 3MA9A 1YKEB 3L09A 3CIRA 4B3TT 2E2AA 3E22E 5AQUB 3RYCE 4I55E 5ADXL 3HA4A 3IF8B 1BR0A 2IUBA 2GK9A 2FUPA 2V7LA 2X9WA 2B1EA 4IDNA 1HCIA 4EGWA 3AE9A 3EUHA 4ZHQE 5HXEA 5LGTB 4TWHA 2XAJB 2CHOA 1IBMT 4Z91A 1UURA 2RPAA 3TLSA 1OXZA 2K3WA 3CMLA 3N9LA 3QUJA 3PUQA 2WSSV 2XZEA 4JI1T 4AKIA 2C5KT 5CB4E 2WM9A 5LBMA 1OEDB 4IHJE 4A5XA 2LKHA 3PUZF 3QB5A 4L9IA 4ILAA 5AQMB 3O1IA 2ZM0A 1ZOYA 2LKGA 2BVMA 2LM2A 4K0KT 5HWYA 3RHWA 1I94T 4PK5A 2CA5A 3A5XA 1MMGA 3EI0A 2BS4A 4OYKA 2K9AA 4ANJA 2L3LA 4DV2T 3VRAA 3L3PA 5H6RB 1HX1B 3NZPA 2W0GA 3KV4A 3FZKB 4GYRA 2A3DA 1QLBA 1HX8A 4ILCA 3RLFF 2C5IT 2XSBA 2CCQA 1M62A 3G06A 3RC8A 3ZEFB 5LG4A 3A8YC 2E9XA 3HKBE 4DUYT 4PK4A 2KWIB 5GONE 3QK6A 1QUUA 2ZM6T 4JI8T 3AA0B 4MALA 4AI6A 2FJAA 4HWHA 2K5BB 2V5DA 3LSVA 5IHYA 3J7Yq 5FY0A 4NUVA 5AQNB 4TWFA 2WB5A 5AFUL 3PUAA 2KINB 3SOLA 3Q5WA 4KUMB 3UU5A 4ZI2C 3I0QA 3OVUA 4HWFA 2UXXB 3L8RA 4EIWA 4QXBB 3SRZA 5L4EA 4YTPA 1U5PA 2NWBA 2V7IA 4DNDA 4EXTA 4X64T 3K8PC 4PFPA 3AA6B 1MMDA 2XHEB 1OWAA 2D9DA 2LM9A 3AVSA 4TZ4C 5JVDE 1L0VA 3RYHE 2CM0A 1XWMA 2XQ9A 2N9DA 4UIGA 1D0YA 3EHZA 3PJAJ 4YJ3E 2QYWA 3TLTA 2V6XA 3P4QA 2XQ6A 3UQ4A 1B7TA 2DCFA 3AB3B 3N2KE 2XASB 4Z8XA 4MLKA 3UU8A 2RA1A 2R6GF 3R84B 5HYAA 3UT5E 3LK2B 4H9QC 4WBOA 4ZOLE 3CWZB 3JC6C 5LCYA 3CVRA 2KT9A 4QH5A 1WLXA 1D0ZA 1J1JA 2DHRA 3OPCA 4HFEA 5EZYE 5LJNA 3AE2A 2JRKA 2Y8DA 3UUMA 2VKHA 1BR1A 4ZS3A 1HS7A 4DMVA 5FP3A 2EHOB 3CX6B 3FXDB 2YEVC 3IA3A 3N9PA 3NWIA 3QOFA 3FZMB 3EDUA 4EOZB 2JIWA 2HPLA 4ZI3D 1LKXA 2WAUA 1UCUA 5F8PA 5FMNA 5J1GA 2N1GA 4QX8B 3DP7A 3GWHA 2A2FX 3AA7B 4P0BA 2NOXA 3AECA 4PAGA 3RQWA 4HKAA 1XDPA 3S4UA 2Y48B 5HEUA 5ETWA 3B57A 3DTOA 3F57A 2WU2A 4BJNA 3JADA 1I6ZA 4TV8E 3JAEA 2LRLA 4U3CA 5AQOB 1MIYA 2I0MA 2L8KA 4H9OC 4JI2T 2WDVA 4B6XA 5HXCA 4DBQA 3O1HA 4XBFB 5HEGA 5ABEA 3WAKA 2Z6EA 2FJDA 3AXJB 3AXJA 4ILBA 3AEGA 1SA0E 4P1NA 5CA0E 5LJMA 4LF7T 2CXFA 2W66A 3PUSA 4WW0A 3PE0A 2YN6A 3LDQB 2BS2A 3WAJA 5IYZE 3UULA 5CJ5A 4QX7B 1QSDA 2XUEA 4H9SE 4U2ZA 3KDSE 1HTJF 2CE7A 3C4WA 2XQ5A 1CHUA 4O4JE 3ZSTA 3AEBA 3LG7A 2MTQA 2J1DG 2KSRA 4IE7A 4O4HE 4TWDA 3IHRA 4E7ZA 2XTLA 2CXDA 3BQLA 4OFZA 1NENA 1KF6A 5FNVE 2XQ3A 2X0YA 2Y6XA 1NWMX 3LBXB 4JYAT 1IBLT 5ABFB 2QRXA 4O2AE 3ZT6A 5AQPB 1CUNA 4YLHA 2D2SA 1UK5A 3NKZA 1T7SA 3M3ZB 3OYZA 5L3BB 3C50A 3ONLC 4DV4T 4B3ST 2EHOC 4XAXB 3ZMZB 4IT4A 2P9BA 2YDQA 3AE5A 3PURA 4CXWA 4CN1A 2JQHA 4OK0A 3EDVA 3AEEA 2IC6A 3HI2A 3N2OA 4O4LE 2LSJA 3ZPOA 2BS3A 2UUBT 2VKOA 2X9HA 3FBLA 2YDRA 2WP9A 3RGLA 1W0BA 3K3QC 3ZMTB 4YSZA 5JTGA 5DABA 2J47A 3QB5K 3PUXF 1FMVA 2FJEA 4O4IE 3WI3A 2FBWA 4UR9A 3OYXA 1U4QA 5LXTE 3ZT5A 2Q9QC 5LHHB 4DVDA 3RRWA 3LJCA 4AQFC 3QNUA 3C51A 4UXNB 3ZYLA 1XNQT 2H7VC 3AEAA 3R6NA 3SS1A 3PUYF 1KEYA 3HL6A 2IC9A 5AQHB 2A72A 3P4SA 3RIUC 4CZZB 5BMVE 4DR7T 2YINA 3KV5A 2Q9QB 4IL9A 3PTRB 3SWHA 5JQGE 3OKQA 2E5VA 1G8XA 1VOMA 4HFBA 3DJBA 1ZHCA 2KXPB 4U7IA 1ZKEA 2ODVA 5L2LA 2BBJA 3ZC0A 2H88A 2I59A 3TLVA 3UU3A 2JQQA 4MHCA 5JDMA 4DR3T 2UUCT 4X1KE 4HE8A 4WYVA 3H3AA 3AE4A 4YY3T 2DL1A 2Q9QA 2CWYA 3L39A 3Q5XA 5LHGB 2W62A 4TUYE 2XAFB 5L3CB 2VK9A 3Q9DA 3TKLB 5LYJE 4AQYT 3B5MA 3CK6A 1HNWT 2VQFT 1LVKA 4N78D 4PK6A 4PFOA 5C2TA 1WYCA 2KWHA 3OTOT 2A9UA 2BKPA 3A7MA 3AAEB 4AKGA 3BQIA 4U72A 1YXRA 4AIUA 2CPTA 1LRZA 2B76A 4M1PA 3CQGB 2ZLYA 3RYFE 3AE8A 3PDYA 5M4YA 4X66T 3FZHB 3JAFA 3KVAA 2V7KA 4DR2T 4CI3B 2JQ9A 3E0ZA 3ZMSB 2IDOB 3RQUA
chains in the Genus database with same CATH topology
3T1HT 1IBKT 4DV0T 4DR6T 4LF9T 4GKJT 4B3TT 5IWAT 1HNZT 4JV5T 4B3RT 4DR5T 5LMUT 2F4VT 4LFAT 4LF5T 4X62T 4DV3T 4AQYT 4JI2T 4NXMT 1XMQT 1N36T 1HNXT 4LF7T 4DR4T 4YHHT 4DV1T 4OX9T 4LF8T 4GKKT 4B3MT 2HHHT 4JYAT 1IBLT 4JI3T 2UUAT 4DV4T 4B3ST 4LF4T 1N32T 4DR1T 4DUZT 4JI1T 1FJGT 4LFBT 2UUBT 5BR8T 2UXBT 4K0KT 1I94T 4LF6T 2VQET 4DV2T 4DV5T 1XNQT 4DV6T 2UXCT 4DR7T 4JI4T 4DUYT 2ZM6T 4JI7T 4JI8T 5LMNT 1HR0T 4DR3T 2UUCT 4LFCT 4YY3T 3T1YT 1IBMT 4JI0T 1XMOT 4X65T 2UU9T 1HNWT 2VQFT 4X64T 1XNRT 1N33T 4JI5T 3OTOT 4JI6T 4NXNT 4X66T 4DR2T 1N34T 2E5LT 4KHPT 2UXDT 4DV7T 1J5ET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H T;  1IBK T;  4DV0 T;  4DR6 T;  4LF9 T;  4GKJ T;  4B3T T;  5IWA T;  1HNZ T;  4JV5 T;  4B3R T;  4DR5 T;  5LMU T;  2F4V T;  4LFA T;  4LF5 T;  4X62 T;  4DV3 T;  4AQY T;  4JI2 T;  4NXM T;  1XMQ T;  1N36 T;  1HNX T;  4LF7 T;  4DR4 T;  4YHH T;  4DV1 T;  4OX9 T;  4LF8 T;  4GKK T;  4B3M T;  2HHH T;  4JYA T;  1IBL T;  4JI3 T;  2UUA T;  4DV4 T;  4B3S T;  4LF4 T;  1N32 T;  4DR1 T;  4DUZ T;  4JI1 T;  1FJG T;  4LFB T;  2UUB T;  5BR8 T;  2UXB T;  4K0K T;  1I94 T;  4LF6 T;  2VQE T;  4DV2 T;  4DV5 T;  1XNQ T;  4DV6 T;  2UXC T;  4DR7 T;  4JI4 T;  4DUY T;  2ZM6 T;  4JI7 T;  4JI8 T;  5LMN T;  1HR0 T;  4DR3 T;  2UUC T;  4LFC T;  4YY3 T;  3T1Y T;  1IBM T;  4JI0 T;  1XMO T;  4X65 T;  2UU9 T;  1HNW T;  2VQF T;  4X64 T;  1XNR T;  1N33 T;  4JI5 T;  3OTO T;  4JI6 T;  4NXN T;  4X66 T;  4DR2 T;  1N34 T;  2E5L T;  4KHP T;  2UXD T;  4DV7 T;  1J5E T; 
#chains in the Genus database with same CATH topology
 3AEF A;  3HKD E;  2OLT A;  4IDQ A;  1OED A;  3N9N A;  3V5S A;  4QXC B;  5FXV A;  3KV6 A;  4DV0 T;  5JR9 A;  4AIS A;  4DR6 T;  4ADZ A;  3RIA A;  2L9Q A;  4I50 E;  5IWA T;  4GOU A;  4HGA A;  2NTX A;  2YU1 A;  1T98 A;  5HCM A;  5KMG P;  1XZY A;  2V6Y B;  2ZM8 A;  5FY1 A;  2VVN A;  4C90 A;  2ODU A;  4AQF A;  3QC9 A;  5KDM C;  3NZQ A;  2CLY B;  2WBL A;  4I43 B;  1YD8 G;  5L47 A;  2NR4 A;  2F4V T;  2DNX A;  3N2G E;  5FXX A;  3Q5D A;  2VKJ A;  4H9P C;  2XAQ B;  1Z0P A;  2WWU A;  3EVY A;  2BG9 C;  2XJ7 A;  2H3R A;  1ZV4 X;  4LF5 T;  1WRD A;  2E9X B;  4FI5 A;  4QXH B;  1KNZ A;  4O2B E;  2LRK A;  4PJN A;  1VRB A;  5FVK A;  3VU7 H;  2ACX A;  1XMQ T;  3P7I A;  3LFM A;  5AQR B;  1AJ3 A;  2W67 A;  5FYM A;  4IIJ E;  4TV9 E;  3ANW A;  5EK3 A;  3AVR A;  3RF1 A;  3P8C D;  4YT0 A;  4PW8 A;  5LB7 B;  2M6I A;  4EED A;  1MND A;  3KIN B;  4QWN B;  4AQG A;  4WNK A;  5AQF B;  1T8B A;  5C8Y E;  2YK0 A;  2CBI A;  2WCA A;  3KBU A;  1W0A A;  2MPK A;  2QVA A;  3NRY A;  4YTM A;  4OX9 T;  1MNE A;  3ZJ1 A;  4EEB A;  4AKL A;  3J9X 1;  3RIF A;  2IW5 B;  4I0U A;  4UV8 B;  2KZ7 B;  1R8I A;  3P4P A;  4GK0 E;  4NIQ A;  4YHJ A;  5HCJ A;  2MBG A;  5LA6 E;  1HG2 A;  1UGO A;  3GMI A;  4EV6 A;  4B3M T;  4AKH A;  2W63 A;  5FL1 A;  5LGU B;  3BK9 A;  2X9X A;  4CN6 A;  1E1H B;  1JNR A;  5HXH A;  2X0L B;  4KP3 C;  4HWI B;  3TLU A;  2LSK A;  2VWA A;  3H3M A;  4H63 H;  3ZN0 B;  4ZZC A;  4JI3 T;  2DI4 A;  2NW7 A;  2EHO D;  1HFA A;  2C0S A;  1UX4 A;  2VL8 A;  4DBR A;  5LHI B;  2ZM2 A;  2MOZ A;  2UUA T;  2WS3 A;  1N32 T;  4UV9 B;  1W9R A;  2YDS A;  4DUZ T;  1FJG T;  1T72 A;  3PUG A;  2PBI A;  4YSY A;  1KFY A;  2LJL A;  4HFC A;  4IE0 A;  4KI0 F;  1KNR A;  1VCT A;  5DQV A;  3X1D A;  5JDG A;  2PJQ A;  1FIO A;  4G63 A;  4U74 A;  2V7M A;  5FL0 A;  1ZP0 A;  2IML A;  4HWC A;  3N9Q A;  4COF A;  2BKN A;  4LF6 T;  2NP9 A;  1YKH B;  5AQI B;  2WDQ A;  1MMN A;  4IDZ A;  3E08 A;  4X1I E;  3ZJ2 A;  2V5C A;  4UVA B;  1ZEE A;  4DV5 T;  1SUM B;  2UXC T;  2D0T A;  3ONX A;  4LMK A;  3EAM A;  4DID B;  4JBW F;  4Q25 A;  2VKD A;  2XQ8 A;  5EK2 A;  1IAP A;  3UTK A;  2D5U A;  3PU8 A;  4TX5 A;  2CXL A;  3UFE A;  3ZCJ A;  4CXX A;  2C5J A;  4YTN A;  2BDE A;  4I4T E;  1Z8U A;  4QKN A;  1EZ3 A;  2V8S V;  4IE5 A;  5LP6 E;  4CXY A;  2XAG B;  3O1J A;  4F8H A;  2X68 A;  1HR0 T;  3HKE E;  4Z90 A;  3M65 A;  1SE7 A;  3FBZ A;  3BQK A;  4A98 A;  2E8I A;  3C64 A;  3CQC B;  3I0O A;  4HN9 A;  4CQI A;  3AED A;  1D1C A;  4XZC A;  3ZT7 A;  3PU3 A;  3VR9 A;  2AXD S;  5CGM A;  2UU9 T;  2EHO A;  1OED C;  5HXS A;  3CKD A;  2W4X A;  3MZK B;  4JI5 T;  2RP4 A;  3RX6 A;  5HEO A;  4EYU A;  3ZMV B;  3AE1 A;  5LBQ B;  5F5W A;  1MIW A;  2JQK A;  3C98 B;  3ESL A;  3LK3 B;  4X1Y E;  5AQK B;  3I1A A;  2E5L T;  4P0A A;  4DV7 T;  1WR6 A;  1E2A A;  2X51 A;  1IJ6 A;  2BG9 B;  2LLY A;  3T1H T;  4QH4 A;  1D1A A;  1YQ3 A;  2LSY A;  2Q9Q D;  3AAA B;  3C4X A;  4CN4 A;  3CX7 B;  5ABG A;  2WQY A;  2JMK A;  1IJ5 A;  1BR2 A;  1V9D A;  2KLQ A;  3ANW B;  3O4X E;  3P50 A;  4ILU A;  4U33 A;  2NTY A;  4LF9 T;  1DU2 A;  2CLY C;  4UEL A;  4U31 A;  2W00 A;  4V1A v;  3RPU A;  2M6B A;  1HNZ T;  2X0H A;  2CMR A;  2NW8 A;  4X20 E;  4BA9 A;  2XY8 B;  3UU6 A;  4ZI7 E;  5LG3 A;  4PJL A;  3PUV F;  2XQA A;  5AQT B;  4IL4 A;  4CI1 B;  4KHZ F;  5JDL A;  2W61 A;  1FMW A;  2LEH A;  2XAH B;  2XQY A;  4IE4 A;  5LMU T;  3AAI A;  4IDP A;  3VKH A;  2AE9 A;  2OV9 A;  3H37 A;  1US7 B;  2K24 A;  4WZX A;  2WWV A;  4HTE A;  2PTF A;  2HH7 A;  5FY7 A;  1G73 A;  1Y64 B;  2J62 A;  5HEH A;  3IEE A;  4LFA T;  1KK7 A;  2JJ9 A;  4L0R A;  4X62 T;  2UXN B;  4DV3 T;  4G2A A;  1WCR A;  3EAB A;  4IDO A;  1X79 A;  4YSX A;  3ABV A;  3U78 A;  2LT3 A;  2XM2 A;  5JDQ A;  5LGN B;  4NXM T;  4MBQ A;  1N36 T;  2LE8 A;  3FHN A;  1HNX T;  3ONJ A;  2DWK A;  4HFH A;  2N2N A;  5C3J A;  2OA5 A;  3VKG A;  5HEJ A;  3P4R A;  3ZKR A;  2WZI A;  4DR4 T;  3RH3 A;  5FVL A;  3UU4 A;  4ERR A;  1J5W A;  3HKC E;  2LOP A;  4A97 A;  1YW0 A;  2KND A;  3IBP A;  4LML A;  3RYI E;  3ZSS A;  4ZZB A;  4LF8 T;  4ZS2 A;  5J0Z A;  5F3J A;  4CI2 B;  4GKK T;  3NBX X;  5JDH A;  2YKS A;  3F31 A;  4UF0 B;  1N34 T;  1UX5 A;  5ABH A;  2X67 A;  5AQS B;  3FZL B;  1VCS A;  5KXJ A;  2J4G A;  3AE3 A;  5JDN A;  4IRE A;  2CWO A;  4HEA A;  2WMO A;  4U7Y A;  5LOV E;  1D1B A;  5JH7 E;  1X9B A;  2WMN A;  2WY2 A;  3GA8 A;  3ZMU B;  4E7S A;  5L3E B;  4FJO A;  2HHH T;  1BR4 A;  1HF8 A;  2HN2 A;  3AE7 A;  3ZYK A;  4C91 A;  2XM1 A;  2JPF A;  2X9Y A;  4U2Y A;  4ZI2 D;  2G0U A;  2QA7 A;  1E7P A;  5FXZ A;  3V5U A;  3CX8 B;  2W2U A;  2IAK A;  2XPK A;  4NXN T;  4LF4 T;  1WR0 A;  2ZMA A;  4HFV A;  3ETU A;  4OYJ A;  4DR1 T;  1M7K A;  1H7C A;  4OHF A;  4EAH A;  3UUX B;  2WDR A;  4ZI3 C;  3ZC1 A;  4LFB T;  1JNZ A;  3MJX A;  3LK4 2;  2BG9 A;  5AQL B;  5BR8 T;  3KVB A;  2UXB T;  2DWG A;  2M67 A;  2MAW A;  2YOE A;  3MAC A;  4YJ2 E;  5TAO A;  4UVB B;  1SHZ C;  4A56 A;  2CHN A;  2IHR 1;  4TNV A;  3ZN1 B;  3JC6 D;  3VR8 A;  4IST A;  2VQE T;  3ETV A;  3MXZ A;  4AXP A;  2D0U A;  4DO0 A;  2H89 A;  2E9X C;  5FXW A;  2VB6 A;  5JR9 B;  4BAY B;  2LSG A;  4NPP A;  4DV6 T;  4IGU A;  4YXD A;  4ISS A;  3K1S A;  2KMF A;  2LOS A;  4HFD A;  1MMA A;  5AQG B;  4ZXL A;  2WU5 A;  3C4Z A;  3T8O A;  4JI4 T;  5L3F B;  5L3D B;  1LVF A;  1W09 A;  2SPC A;  2HPJ A;  2XSA A;  2QGS A;  3UFG A;  4ZEY A;  3F2E A;  4JI7 T;  2V26 A;  5JR9 C;  1S94 A;  5KX5 E;  1KNP A;  2DLR A;  2PFV A;  4IE6 A;  4TNW A;  5AQV B;  4L5G A;  1FEW A;  5LMN T;  4PJJ A;  3ZCI A;  3CPZ A;  5HXR A;  1D0X A;  4JEU B;  5L4H A;  5IUX A;  5E0O A;  3AA1 B;  3HR0 A;  2PG8 A;  4EYY R;  3I9Y A;  5CFB A;  2H7O A;  1NAF A;  4LFC T;  3GN5 B;  4JLE A;  4PJM A;  1MIV A;  3T1Y T;  3VHL A;  4JI0 T;  2CBJ A;  4X65 T;  1XMO T;  3KV9 A;  4WBN E;  5ABF A;  3AE6 A;  4EZ4 A;  4ASK A;  1XNR T;  1N33 T;  4KHP T;  4NUU A;  5JDF A;  2MYS A;  4JI6 T;  4QHO A;  4AKR B;  4EB6 E;  3K3N A;  3Q2M A;  2XQ4 A;  2BVL A;  2X66 A;  3FXE B;  4H63 V;  2BZB A;  3MK7 C;  5JRC A;  5HWX A;  5A1L A;  3FZF B;  2UXD T;  3NRX A;  4PNI A;  1J5E T;  1IZN B;  3N9O A;  5JRC B;  4GIW A;  2CRB A;  1Y01 A;  4GYS A;  2LHR A;  2I6H A;  3PUW F;  2V7J A;  3PJA A;  1IBK T;  3RKO A;  5H6Q B;  3JCF A;  4UVC B;  4BJM A;  4J2C A;  2WZH A;  4O8S A;  3PV0 F;  1UUS A;  4UEM A;  5HAX A;  2CEA A;  3N9M A;  4KX6 A;  4KBM B;  5DQW A;  1YQ4 A;  2NW9 A;  3Q5E A;  4EZH A;  4KMC A;  2VL0 A;  3RIU A;  1HG5 A;  3O9X A;  4JV5 T;  3NVO A;  5LNK A;  4K0U A;  4B3R T;  3D0T A;  3GN5 A;  4H9N C;  4H9R C;  3TLW A;  1OED E;  3K3O A;  2V1D B;  1WYB A;  4MFR A;  4QH1 A;  2K48 A;  5EK4 A;  3UUB A;  5J2U E;  3I9W A;  3KFW X;  1S35 A;  3RKG A;  5J2T E;  4DR5 T;  5FKY A;  2BBH A;  4GK5 E;  3MKD A;  3FB2 A;  2JMH A;  2XQ7 A;  2LSI A;  4UF0 A;  3UQ7 A;  2ACZ A;  4LMJ A;  2ES0 A;  3ZYM A;  2BG9 E;  4X5T A;  5L3G B;  1GQE A;  1XDO A;  1WFD A;  2VAS A;  1O3X A;  3P4W A;  4HFI A;  4P09 A;  4F6R C;  5JRE A;  3OBV E;  2V6Y A;  3RC3 A;  3UUN A;  3VRB A;  3LBX A;  3RI5 A;  2FJB A;  4HWD A;  4YFS A;  3W15 B;  5AQJ B;  3RRC A;  1NEK A;  4DMW A;  5CA1 E;  2BKO A;  2YU2 A;  4JUY A;  3KBT A;  3ZLI A;  2IIU A;  2LHN A;  4TN7 B;  3B13 A;  2VUR A;  3N5L A;  4YHH T;  5AQQ B;  4GKJ T;  2E9X D;  3SFE A;  3U3I A;  2VVS A;  2HN1 A;  3CQX C;  3OJA A;  4DV1 T;  4JEH B;  3SFD A;  5DJQ C;  3MA9 A;  1YKE B;  3L09 A;  3CIR A;  4B3T T;  2E2A A;  3E22 E;  5AQU B;  3RYC E;  4I55 E;  5ADX L;  3HA4 A;  3IF8 B;  1BR0 A;  2IUB A;  2GK9 A;  2FUP A;  2V7L A;  2X9W A;  2B1E A;  4IDN A;  1HCI A;  4EGW A;  3AE9 A;  3EUH A;  4ZHQ E;  5HXE A;  5LGT B;  4TWH A;  2XAJ B;  2CHO A;  1IBM T;  4Z91 A;  1UUR A;  2RPA A;  3TLS A;  1OXZ A;  2K3W A;  3CML A;  3N9L A;  3QUJ A;  3PUQ A;  2WSS V;  2XZE A;  4JI1 T;  4AKI A;  2C5K T;  5CB4 E;  2WM9 A;  5LBM A;  1OED B;  4IHJ E;  4A5X A;  2LKH A;  3PUZ F;  3QB5 A;  4L9I A;  4ILA A;  5AQM B;  3O1I A;  2ZM0 A;  1ZOY A;  2LKG A;  2BVM A;  2LM2 A;  4K0K T;  5HWY A;  3RHW A;  1I94 T;  4PK5 A;  2CA5 A;  3A5X A;  1MMG A;  3EI0 A;  2BS4 A;  4OYK A;  2K9A A;  4ANJ A;  2L3L A;  4DV2 T;  3VRA A;  3L3P A;  5H6R B;  1HX1 B;  3NZP A;  2W0G A;  3KV4 A;  3FZK B;  4GYR A;  2A3D A;  1QLB A;  1HX8 A;  4ILC A;  3RLF F;  2C5I T;  2XSB A;  2CCQ A;  1M62 A;  3G06 A;  3RC8 A;  3ZEF B;  5LG4 A;  3A8Y C;  2E9X A;  3HKB E;  4DUY T;  4PK4 A;  2KWI B;  5GON E;  3QK6 A;  1QUU A;  2ZM6 T;  4JI8 T;  3AA0 B;  4MAL A;  4AI6 A;  2FJA A;  4HWH A;  2K5B B;  2V5D A;  3LSV A;  5IHY A;  3J7Y q;  5FY0 A;  4NUV A;  5AQN B;  4TWF A;  2WB5 A;  5AFU L;  3PUA A;  2KIN B;  3SOL A;  3Q5W A;  4KUM B;  3UU5 A;  4ZI2 C;  3I0Q A;  3OVU A;  4HWF A;  2UXX B;  3L8R A;  4EIW A;  4QXB B;  3SRZ A;  5L4E A;  4YTP A;  1U5P A;  2NWB A;  2V7I A;  4DND A;  4EXT A;  4X64 T;  3K8P C;  4PFP A;  3AA6 B;  1MMD A;  2XHE B;  1OWA A;  2D9D A;  2LM9 A;  3AVS A;  4TZ4 C;  5JVD E;  1L0V A;  3RYH E;  2CM0 A;  1XWM A;  2XQ9 A;  2N9D A;  4UIG A;  1D0Y A;  3EHZ A;  3PJA J;  4YJ3 E;  2QYW A;  3TLT A;  2V6X A;  3P4Q A;  2XQ6 A;  3UQ4 A;  1B7T A;  2DCF A;  3AB3 B;  3N2K E;  2XAS B;  4Z8X A;  4MLK A;  3UU8 A;  2RA1 A;  2R6G F;  3R84 B;  5HYA A;  3UT5 E;  3LK2 B;  4H9Q C;  4WBO A;  4ZOL E;  3CWZ B;  3JC6 C;  5LCY A;  3CVR A;  2KT9 A;  4QH5 A;  1WLX A;  1D0Z A;  1J1J A;  2DHR A;  3OPC A;  4HFE A;  5EZY E;  5LJN A;  3AE2 A;  2JRK A;  2Y8D A;  3UUM A;  2VKH A;  1BR1 A;  4ZS3 A;  1HS7 A;  4DMV A;  5FP3 A;  2EHO B;  3CX6 B;  3FXD B;  2YEV C;  3IA3 A;  3N9P A;  3NWI A;  3QOF A;  3FZM B;  3EDU A;  4EOZ B;  2JIW A;  2HPL A;  4ZI3 D;  1LKX A;  2WAU A;  1UCU A;  5F8P A;  5FMN A;  5J1G A;  2N1G A;  4QX8 B;  3DP7 A;  3GWH A;  2A2F X;  3AA7 B;  4P0B A;  2NOX A;  3AEC A;  4PAG A;  3RQW A;  4HKA A;  1XDP A;  3S4U A;  2Y48 B;  5HEU A;  5ETW A;  3B57 A;  3DTO A;  3F57 A;  2WU2 A;  4BJN A;  3JAD A;  1I6Z A;  4TV8 E;  3JAE A;  2LRL A;  4U3C A;  5AQO B;  1MIY A;  2I0M A;  2L8K A;  4H9O C;  4JI2 T;  2WDV A;  4B6X A;  5HXC A;  4DBQ A;  3O1H A;  4XBF B;  5HEG A;  5ABE A;  3WAK A;  2Z6E A;  2FJD A;  3AXJ B;  3AXJ A;  4ILB A;  3AEG A;  1SA0 E;  4P1N A;  5CA0 E;  5LJM A;  4LF7 T;  2CXF A;  2W66 A;  3PUS A;  4WW0 A;  3PE0 A;  2YN6 A;  3LDQ B;  2BS2 A;  3WAJ A;  5IYZ E;  3UUL A;  5CJ5 A;  4QX7 B;  1QSD A;  2XUE A;  4H9S E;  4U2Z A;  3KDS E;  1HTJ F;  2CE7 A;  3C4W A;  2XQ5 A;  1CHU A;  4O4J E;  3ZST A;  3AEB A;  3LG7 A;  2MTQ A;  2J1D G;  2KSR A;  4IE7 A;  4O4H E;  4TWD A;  3IHR A;  4E7Z A;  2XTL A;  2CXD A;  3BQL A;  4OFZ A;  1NEN A;  1KF6 A;  5FNV E;  2XQ3 A;  2X0Y A;  2Y6X A;  1NWM X;  3LBX B;  4JYA T;  1IBL T;  5ABF B;  2QRX A;  4O2A E;  3ZT6 A;  5AQP B;  1CUN A;  4YLH A;  2D2S A;  1UK5 A;  3NKZ A;  1T7S A;  3M3Z B;  3OYZ A;  5L3B B;  3C50 A;  3ONL C;  4DV4 T;  4B3S T;  2EHO C;  4XAX B;  3ZMZ B;  4IT4 A;  2P9B A;  2YDQ A;  3AE5 A;  3PUR A;  4CXW A;  4CN1 A;  2JQH A;  4OK0 A;  3EDV A;  3AEE A;  2IC6 A;  3HI2 A;  3N2O A;  4O4L E;  2LSJ A;  3ZPO A;  2BS3 A;  2UUB T;  2VKO A;  2X9H A;  3FBL A;  2YDR A;  2WP9 A;  3RGL A;  1W0B A;  3K3Q C;  3ZMT B;  4YSZ A;  5JTG A;  5DAB A;  2J47 A;  3QB5 K;  3PUX F;  1FMV A;  2FJE A;  4O4I E;  3WI3 A;  2FBW A;  4UR9 A;  3OYX A;  1U4Q A;  5LXT E;  3ZT5 A;  2Q9Q C;  5LHH B;  4DVD A;  3RRW A;  3LJC A;  4AQF C;  3QNU A;  3C51 A;  4UXN B;  3ZYL A;  1XNQ T;  2H7V C;  3AEA A;  3R6N A;  3SS1 A;  3PUY F;  1KEY A;  3HL6 A;  2IC9 A;  5AQH B;  2A72 A;  3P4S A;  3RIU C;  4CZZ B;  5BMV E;  4DR7 T;  2YIN A;  3KV5 A;  2Q9Q B;  4IL9 A;  3PTR B;  3SWH A;  5JQG E;  3OKQ A;  2E5V A;  1G8X A;  1VOM A;  4HFB A;  3DJB A;  1ZHC A;  2KXP B;  4U7I A;  1ZKE A;  2ODV A;  5L2L A;  2BBJ A;  3ZC0 A;  2H88 A;  2I59 A;  3TLV A;  3UU3 A;  2JQQ A;  4MHC A;  5JDM A;  4DR3 T;  2UUC T;  4X1K E;  4HE8 A;  4WYV A;  3H3A A;  3AE4 A;  4YY3 T;  2DL1 A;  2Q9Q A;  2CWY A;  3L39 A;  3Q5X A;  5LHG B;  2W62 A;  4TUY E;  2XAF B;  5L3C B;  2VK9 A;  3Q9D A;  3TKL B;  5LYJ E;  4AQY T;  3B5M A;  3CK6 A;  1HNW T;  2VQF T;  1LVK A;  4N78 D;  4PK6 A;  4PFO A;  5C2T A;  1WYC A;  2KWH A;  3OTO T;  2A9U A;  2BKP A;  3A7M A;  3AAE B;  4AKG A;  3BQI A;  4U72 A;  1YXR A;  4AIU A;  2CPT A;  1LRZ A;  2B76 A;  4M1P A;  3CQG B;  2ZLY A;  3RYF E;  3AE8 A;  3PDY A;  5M4Y A;  4X66 T;  3FZH B;  3JAF A;  3KVA A;  2V7K A;  4DR2 T;  4CI3 B;  2JQ9 A;  3E0Z A;  3ZMS B;  2IDO B;  3RQU A; 
#chains in the Genus database with same CATH homology
 3T1H T;  1IBK T;  4DV0 T;  4DR6 T;  4LF9 T;  4GKJ T;  4B3T T;  5IWA T;  1HNZ T;  4JV5 T;  4B3R T;  4DR5 T;  5LMU T;  2F4V T;  4LFA T;  4LF5 T;  4X62 T;  4DV3 T;  4AQY T;  4JI2 T;  4NXM T;  1XMQ T;  1N36 T;  1HNX T;  4LF7 T;  4DR4 T;  4YHH T;  4DV1 T;  4OX9 T;  4LF8 T;  4GKK T;  4B3M T;  2HHH T;  4JYA T;  1IBL T;  4JI3 T;  2UUA T;  4DV4 T;  4B3S T;  4LF4 T;  1N32 T;  4DR1 T;  4DUZ T;  4JI1 T;  1FJG T;  4LFB T;  2UUB T;  5BR8 T;  2UXB T;  4K0K T;  1I94 T;  4LF6 T;  2VQE T;  4DV2 T;  4DV5 T;  1XNQ T;  4DV6 T;  2UXC T;  4DR7 T;  4JI4 T;  4DUY T;  2ZM6 T;  4JI7 T;  4JI8 T;  5LMN T;  1HR0 T;  4DR3 T;  2UUC T;  4LFC T;  4YY3 T;  3T1Y T;  1IBM T;  4JI0 T;  1XMO T;  4X65 T;  2UU9 T;  1HNW T;  2VQF T;  4X64 T;  1XNR T;  1N33 T;  4JI5 T;  3OTO T;  4JI6 T;  4NXN T;  4X66 T;  4DR2 T;  1N34 T;  2E5L T;  4KHP T;  2UXD T;  4DV7 T;  1J5E T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...