4LF5T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf5T00
4JI6T 4X65T 2UUAT 4K0KT 4DV5T 4JI4T 4JI1T 1XNRT 4B3TT 4NXNT 4YY3T 1I94T 4LF9T 4JYAT 4DV7T 4AQYT 1N34T 4JI5T 4JI0T 4DR4T 4LFBT 2UUCT 4NXMT 3T1HT 5BR8T 4OX9T 4JI2T 4KHPT 1IBKT 1N36T 4GKJT 4JI8T 5IWAT 4DR5T 1HNXT 4X66T 4DUYT 1J5ET 4LF5T 4DR1T 4DR7T 1N32T 2VQET 4DV6T 2UUBT 1HR0T 2UXDT 1FJGT 4JI3T 4B3RT 3T1YT 5LMNT 4YHHT 1XMOT 1IBMT 4LF6T 4JV5T 4GKKT 2F4VT 4LF7T 4X62T 2ZM6T 4DR2T 4LF8T 1XMQT 1N33T 5LMUT 2UXCT 4DV3T 2VQFT 4DV4T 4DR3T 4B3ST 4B3MT 2HHHT 4DV0T 2E5LT 4DV2T 3OTOT 4DV1T 2UXBT 1XNQT 4DR6T 1HNWT 1IBLT 4LFAT 4X64T 4LFCT 4LF4T 2UU9T 4DUZT 4JI7T 1HNZT
chains in the Genus database with same CATH superfamily
2BBHA 3CIRA 4TNWA 3P4WA 3PUAA 5LG4A 2UUAT 1HTJF 3C51A 2V6XA 3NKZA 2H88A 2M67A 3OBVE 3P7IA 5AQRB 2V7MA 3AE7A 1LRZA 3AEBA 4MALA 5L3FB 5JDNA 3J7Yq 3OYXA 4O4HE 4JI1T 1H7CA 4H9SE 3PUGA 1I94T 3G06A 3ZMZB 1AJ3A 2BS3A 1MMDA 2DLRA 5E0OA 1OEDB 2HPJA 2WQYA 4OFZA 1UK5A 1MMNA 5FP3A 4CI3B 3ZN1B 5LGNB 2W2UA 5HXCA 2ODUA 1JNRA 2L3LA 3F31A 3SFEA 3U78A 5HXHA 3SOLA 3VHLA 1ZP0A 3ABVA 1SUMB 5IYZE 2LJLA 4H63H 4MFRA 3SS1A 3QNUA 3RPUA 3UUMA 2VKHA 4EOZB 3TLVA 3ZCIA 4YSYA 2W00A 1GQEA 4CN1A 2WB5A 5ADXL 2C5IT 3FZHB 3HKDE 4DR4T 2UXNB 2UUCT 2JMHA 3AE3A 3UFEA 3K3QC 3K8PC 3T1HT 5CFBA 4IREA 3AAEB 3M65A 4HFVA 3TLUA 2NWBA 4JI2T 3UU3A 5BR8T 1D1BA 4BA9A 1KK7A 2IIUA 3CVRA 1T8BA 3LK3B 5FL0A 3UUXB 2L8KA 3V5SA 2V7LA 3HL6A 3Q5EA 3UU4A 1N36T 4JI8T 5LB7B 5IWAT 3V5UA 2XAQB 3QK6A 4KP3C 4QXHB 2W0GA 3RRCA 3HA4A 4OYJA 2WDVA 4ISTA 3AE2A 4UVAB 2XM2A 3QC9A 3UULA 2LSGA 1OEDA 5LHGB 3A8YC 3H3MA 1ZEEA 4IE7A 2XTLA 4QH4A 4AQFC 3AE4A 3VKGA 1J1JA 2W61A 2ZM0A 3IF8B 1E7PA 4HFEA 5LJMA 4AKGA 3KINB 2E2AA 2BZBA 4JI3T 1HS7A 4IDOA 3T1YT 2DNXA 3AEDA 3ONJA 1UCUA 5FY1A 2CHOA 2BG9C 3AE6A 3EAMA 3K3NA 3PV0F 2BG9E 4GK5E 5FXXA 3TLWA 2LE8A 5HXSA 3PUSA 5HCMA 4GKKT 3EABA 4UV8B 2RPAA 4EV6A 3ZJ1A 4GYSA 5KX5E 3PURA 2X9WA 1ZV4X 2V5DA 4X62T 3ZYLA 5LG3A 4H9NC 3TLTA 2VL8A 2V8SV 4TZ4C 1G8XA 3WI3A 4CXWA 1BR1A 2JQQA 2KT9A 3N9LA 1HX8A 3C64A 2NTXA 3L39A 3Q9DA 1CUNA 1S94A 3PJAA 4IDPA 4ZI2D 3AXJA 1T7SA 2NW9A 1D0YA 2J1DG 2WM9A 4HEAA 5FY7A 2BVMA 2JPFA 3B5MA 3H37A 3VU7H 4ANJA 2EHOB 4ZI7E 2FJEA 1LVKA 1BR2A 2DWKA 1YXRA 3RYFE 2I0MA 3CQXC 3Q5WA 3N5LA 2KMFA 4U2ZA 2WS3A 1UUSA 3JADA 5HAXA 4WBNE 2LM9A 3P4RA 2WZHA 5L3GB 4YXDA 4AKIA 2W63A 5L3BB 2E5LT 3FXEB 2AXDS 2V7JA 1MNEA 4AI6A 4DV2T 1HR0T 2IC6A 4HFDA 4YJ3E 4H9PC 4PAGA 2CWOA 3KVBA 4L0RA 4Z90A 3L09A 3RQWA 2YEVC 5IHYA 4LMJA 4E7SA 2YDRA 2CXLA 5JDMA 5ABGA 4DR6T 2C0SA 4HN9A 2CXDA 3AVSA 3NRYA 2N2NA 2WDRA 2E9XB 1KF6A 1Y01A 3GWHA 4IGUA 5LBMA 1ZOYA 2VKJA 2K48A 3R84B 2MTQA 4IDQA 2KWHA 1JNZA 1EZ3A 3L8RA 5LP6E 4HFBA 2V6YA 3SFDA 2J47A 1VCSA 2YKSA 2EHOA 3ZKRA 2KINB 4AKHA 2LKHA 5HXEA 1WR6A 5C8YE 2XAGB 5JDHA 5J1GA 2ACXA 4MLKA 4X5TA 5LJNA 3KDSE 1Z0PA 4PJNA 2QA7A 3FZMB 1W9RA 1HX1B 3LFMA 4ISSA 3ZT7A 2NR4A 5AQLB 2QVAA 2A72A 4JI4T 2XHEB 3C4XA 4AXPA 2FJAA 4M1PA 2IDOB 2D2SA 4FJOA 4UF0B 4EEDA 4EB6E 2LHRA 4XAXB 4DBRA 4OHFA 3PUWF 2WMOA 4KUMB 4IDNA 3EVYA 2K5BB 2BKPA 3NZQA 4QH1A 3TLSA 3WAKA 4BJMA 3UUNA 2V5CA 5JR9C 1OXZA 2XUEA 3S4UA 2CE7A 3AEGA 3MKDA 3RIAA 4OYKA 3MK7C 3UU8A 5LNKA 4DV7T 1IAPA 1G73A 2V6YB 2WSSV 3B57A 2E5VA 3RIUA 3TKLB 3ZMVB 3EHZA 4U7YA 1WYBA 2H89A 1UGOA 4AQFA 4DBQA 4LFBT 3QOFA 3P4PA 1KFYA 3AA7B 3KV5A 3PU3A 2WMNA 4O2BE 4WYVA 5AQIB 4L9IA 5F3JA 2I59A 1E2AA 5H6QB 2X9YA 1MIWA 2Y8DA 4PFOA 4IIJE 4L5GA 4ZXLA 2CLYC 4C90A 1UX5A 3KBTA 1IBKT 4KHPT 4GKJT 2Q9QC 1FMWA 1ZKEA 2CPTA 3MA9A 4A56A 4DR5T 1HNXT 3ZC1A 3MXZA 5HEHA 3ZMUB 3KV4A 4H9QC 3PDYA 5DJQC 3CWZB 2JQ9A 4JUYA 4HFHA 3AE5A 4YFSA 4ILCA 4LMLA 4P09A 1N32T 3B13A 5AQHB 2VQET 1HF8A 5ETWA 4YJ2E 4DV6T 2X68A 3LJCA 2D0UA 1UURA 2UUBT 1XDOA 3IEEA 4A98A 4ZHQE 5AQUB 5AQTB 5LHHB 4XZCA 2M6IA 3RGLA 3MJXA 1X9BA 3IHRA 4B3RT 1SHZC 1OWAA 2C5KT 3UU5A 3BQLA 2KXPB 1J5WA 5LA6E 2W62A 2SPCA 5LXTE 4YHHT 1WCRA 1IBMT 4LF6T 4UIGA 2CMRA 2JIWA 4PFPA 5FYMA 5FXZA 1X79A 3RYIE 5L3CB 4NUUA 3BQKA 3AB3B 4TV8E 4LF7T 3K1SA 4AQGA 4DMVA 5CA1E 5HWYA 2M6BA 2XSBA 2YU2A 3JAEA 2R6GF 3LBXA 1NAFA 4KBMB 5DQVA 4QHOA 4I0UA 2UXCT 5JRCB 4I55E 3ESLA 4YLHA 5FL1A 3PE0A 4HWFA 3NVOA 4LF8T 1XMQT 1N33T 2FUPA 5BMVE 5LMUT 2CA5A 2WDQA 3ZT5A 2JRKA 2XQ7A 3N9OA 4YSZA 5ABFA 3F2EA 3NBXX 2BS2A 5HEGA 4HWHA 4P0BA 2K24A 2CRBA 2NW7A 2LOPA 3FXDB 1YQ4A 1IJ5A 3BK9A 4X1YE 3ANWB 5AQPB 4PJLA 3ONXA 2QGSA 4B3ST 4X1KE 2CXFA 2MBGA 2ZM2A 1U4QA 3R6NA 4AKRB 2HHHT 1KNZA 3ETVA 4A5XA 4EYUA 4JEUB 3OTOT 3ZT6A 2CM0A 1ZHCA 4HWCA 2AE9A 2UXBT 3N9QA 4WNKA 2XY8B 5HXRA 3MZKB 1HFAA 1QUUA 3CX6B 2Q9QA 5EZYE 5L2LA 1XNQT 4TV9E 3FB2A 2IHR1 3QUJA 4MHCA 1HNWT 2XQYA 3IBPA 3GMIA 5C2TA 1QSDA 3EI0A 2FJDA 1E1HB 2VK9A 2XPKA 5EK2A 5JQGE 2XQ5A 4YTNA 5CGMA 2LM2A 4CQIA 4O4IE 4U33A 5JR9B 3Q5XA 3NZPA 3PUYF 4H9RC 5FXVA 3ZMTB 4F6RC 2UU9T 1XZYA 3A7MA 5H6RB 4JI7T 2PFVA 2X0YA 3CQGB 2JMKA 2Q9QD 4BAYB 5AQKB 4X65T 1Y64B 3MACA 4QXBB 4O2AE 2KSRA 4G2AA 4CXXA 3DP7A 2LEHA 5FMNA 4ILAA 2VASA 3ZSTA 4BJNA 3WAJA 4DV5T 4YSXA 1XNRT 2CBJA 4EIWA 2J62A 4B3TT 4NXNT 4YY3T 3RF1A 4LF9T 1NENA 2XQ4A 4ZI2C 2Q9QB 3QB5K 3PUQA 4CI1B 2HN1A 3EDUA 1M62A 3KV6A 2XSAA 2JJ9A 4X1IE 2PJQA 5FVLA 3JCFA 1YW0A 3PU8A 2HPLA 1YKHB 2DCFA 3C50A 3QB5A 3RLFF 4AISA 4IL4A 3I9YA 4GOUA 4O4LE 1LKXA 2D0TA 3N2KE 1N34T 2XZEA 2YDQA 3U3IA 4YT0A 4DNDA 4Z91A 4COFA 4DO0A 4NXMT 3OYZA 3PUXF 4I4TE 3I0QA 2XQ6A 3GN5A 4PK4A 4EAHA 3DTOA 4QKNA 2V26A 5JDGA 2JQHA 3E0ZA 3N2OA 5FXWA 3D0TA 1BR0A 3PTRB 3PJAJ 1OEDE 3HKBE 1D0XA 1OEDC 2ZMAA 2D9DA 1XWMA 4WBOA 5AQMB 1US7B 4IDZA 5L4HA 4HFCA 4ZS2A 2VVSA 4ASKA 4DUYT 1J5ET 2LSIA 4DR1T 3VKHA 4NPPA 1M7KA 2C5JA 2XASB 3AA0B 4DR7T 2HH7A 1HG2A 5J2UE 2ES0A 1KEYA 3L3PA 2YU1A 3I1AA 2IAKA 4TN7B 3RIUC 2LSJA 5F5WA 5JDLA 2UXDT 2B1EA 5ABHA 3VRAA 1HCIA 5JDQA 1FJGT 4KHZF 5FNVE 2WZIA 4ZI3C 1WYCA 4U3CA 4EGWA 3OPCA 3N9MA 2DWGA 2BG9A 3HKCE 3NWIA 2W66A 1W0AA 4AKLA 4ZS3A 3ZCJA 2WU5A 4AIUA 1XMOT 4IE0A 4JV5T 4J2CA 4PK5A 2IMLA 4ZZCA 4QX8B 4G63A 2V1DB 3I9WA 5JH7E 3P50A 2JQKA 3AAAB 2FBWA 4GIWA 3ZC0A 1S35A 4V1Av 2WY2A 4TNVA 4K0UA 2CBIA 2X0LB 3RKOA 3RX6A 4ZZBA 5LGUB 2OV9A 2ZM6T 2J4GA 2X67A 3OJAA 3P8CD 1VCTA 5AQNB 2OLTA 2XAJB 5AQVB 5TAOA 3CK6A 3VRBA 3ZPOA 2BBJA 3SRZA 3ZEFB 4H9OC 5LGTB 4JLEA 2EHOD 2WBLA 4HFIA 5JDFA 4DR2T 1XDPA 4I43B 2E9XC 1FEWA 5L4EA 1FIOA 2LKGA 1KNRA 3E22E 3AVRA 4HWIB 5LHIB 2VQFT 1MMAA 4UELA 3T8OA 3CPZA 2KZ7B 4EYYR 3UUBA 2NTYA 2X0HA 4U2YA 2BG9B 2VL0A 2X66A 5IUXA 4DR3T 3ANWA 4DV0T 1I6ZA 5HEOA 1VRBA 2DHRA 1SA0E 5L3DB 3CX8B 3CMLA 4DIDB 4UXNB 4UR9A 3ZYMA 3Q2MA 2DL1A 2NW8A 5AQFB 4NUVA 1SE7A 3PUZF 4QX7B 5L47A 3FBLA 3LK2B 5AQGB 3C98B 4JYAT 4UF0A 4B6XA 4HTEA 2NP9A 2X51A 3OVUA 2HN2A 3AEFA 4N78D 2XAFB 3KBUA 2N1GA 4HWDA 3FZLB 5AQQB 2VWAA 1T98A 4CN4A 4LFAT 2I6HA 2LHNA 2CCQA 3AE1A 4QWNB 1WRDA 3FBZA 5JVDE 3RYHE 4EEBA 1D0ZA 3LK42 4OK0A 5C3JA 4TX5A 4Z8XA 5J2TE 3RI5A 2X9HA 3JC6C 4P1NA 4H63V 5LBQB 3AA6B 5F8PA 5JR9A 2LSYA 4KX6A 2V7KA 4DUZT 4UVBB 1HG5A 4YTPA 3I0OA 3HI2A 2MAWA 3DJBA 3FZKB 3GA8A 3LDQB 4JBWF 1IJ6A 2WWVA 4ILUA 4U72A 1HNZT 4JI6T 2GK9A 3ETUA 5A1LA 1WLXA 3UU6A 1MIYA 3C4WA 3KVAA 4YTMA 5AQSB 4KMCA 1U5PA 3ONLC 4C91A 4HKAA 4PW8A 4ZI3D 3VR9A 4P0AA 2NOXA 5FVKA 4CN6A 4ZEYA 2IC9A 4K0KT 5HYAA 3O1IA 3AAIA 2XAHB 2BVLA 2LT3A 4EZ4A 3ZJ2A 2A3DA 5GONE 3RKGA 2XQAA 3LBXB 3O1JA 1B7TA 4CI2B 1DU2A 2UXXB 4U74A 2VB6A 3ZLIA 2N9DA 5L3EB 1LVFA 2A2FX 3PUVF 4PJMA 5ABFB 2RP4A 2IW5B 4AQYT 3RC3A 5AQOB 3RHWA 4DVDA 4JI5T 4IE4A 1BR4A 4MBQA 3VR8A 3O1HA 3ZMSB 4GYRA 4DMWA 5HEUA 4JI0T 2W4XA 2YDSA 3CX7B 4CXYA 2ODVA 3JC6D 5HCJA 4B3MT 4OX9T 1W09A 3UFGA 3W15B 3KFWX 2EHOC 2P9BA 3NRXA 1L0VA 1WR0A 4ERRA 5CJ5A 5HWXA 2E9XD 3K3OA 1NEKA 3P4SA 2V7IA 2CEAA 5AFUL 4X66T 4LF5T 2WCAA 4Q25A 4UEMA 2CWYA 2FJBA 3FHNA 2PTFA 1KNPA 5KDMC 2X9XA 4A97A 2MPKA 5JRCA 3M3ZB 3UTKA 2G0UA 2XQ8A 2L9QA 5DQWA 1MMGA 4FI5A 1R8IA 4TWDA 3N9PA 3AE8A 3X1DA 2PBIA 2Y6XA 3A5XA 2ACZA 4TWHA 2LOSA 1IZNB 4X20E 2MYSA 3UQ4A 2E8IA 5LMNT 4IL9A 3N9NA 2WP9A 3RYCE 4EXTA 2ZLYA 2CLYB 2A9UA 2H7OA 4NIQA 2YN6A 4PJJA 5KXJA 5JREA 4TWFA 4UVCB 4IE5A 3AECA 3FZFB 4LMKA 1YD8G 2D5UA 4UV9B 5CB4E 3UQ7A 2F4VT 1D1CA 2DI4A 3ZN0B 2PG8A 1V9DA 2YINA 3C4ZA 3N2GE 3LG7A 5DABA 4EZHA 5CA0E 1YQ3A 2VKOA 4ILBA 1O3XA 2ZM8A 2LSKA 2K9AA 3Q5DA 5LYJE 2XQ3A 3EUHA 5HEJA 3ZSSA 1FMVA 2KLQA 4IHJE 2YK0A 5EK3A 2IUBA 2BKNA 4IE6A 2KNDA 3KV9A 4GK0E 2WWUA 4U31A 5M4YA 3JAFA 2XJ7A 3AXJB 4F8HA 3O9XA 3E08A 2B76A 2BS4A 2WU2A 1W0BA 5FY0A 3RH3A 3EDVA 3H3AA 2VVNA 2MOZA 2Z6EA 4DV3T 1CHUA 3AA1B 2K3WA 3AE9A 4WW0A 4ZOLE 3F57A 2QYWA 4KI0F 4O4JE 4IT4A 4PNIA 5FKYA 3LSVA 1NWMX 4I50E 5EK4A 3RIFA 4DV4T 3AEAA 2XQ9A 1MNDA 3GN5B 2LLYA 2W67A 2OA5A 3P4QA 1QLBA 3HR0A 2BDEA 4PK6A 5LCYA 3RRWA 5J0ZA 3AEEA 4JEHB 3CKDA 4CZZB 2YOEA 4U7IA 1T72A 1WFDA 5LOVE 3OKQA 1MIVA 2QRXA 1D1AA 2WAUA 4YHJA 4DV1T 3RQUA 4E7ZA 4TUYE 2Y48B 2VURA 3BQIA 3ZYKA 3IA3A 1IBLT 4QXCB 5KMGP 2H7VC 2E9XA 2XM1A 4X64T 4LFCT 1VOMA 3SWHA 2CHNA 4ADZA 5ABEA 5JTGA 3O4XE 4HE8A 3CQCB 2LRKA 1YKEB 2KWIB 5AQJB 3HKEE 4O8SA 4HGAA 1UX4A 2RA1A 4QH5A 4LF4T 3RC8A 4XBFB 2H3RA 2LRLA 4WZXA 3UT5E 3J9X1 1Z8UA 2BKOA 2VKDA
chains in the Genus database with same CATH topology
4JI6T 4X65T 2UUAT 4K0KT 4DV5T 4JI4T 4JI1T 1XNRT 4B3TT 4NXNT 4YY3T 1I94T 4LF9T 4JYAT 4DV7T 4AQYT 1N34T 4JI5T 4JI0T 4DR4T 4LFBT 2UUCT 4NXMT 3T1HT 5BR8T 4OX9T 4JI2T 4KHPT 1IBKT 1N36T 4GKJT 4JI8T 5IWAT 4DR5T 1HNXT 4X66T 4DUYT 1J5ET 4LF5T 4DR1T 4DR7T 1N32T 2VQET 4DV6T 2UUBT 1HR0T 2UXDT 1FJGT 4JI3T 4B3RT 3T1YT 5LMNT 4YHHT 1XMOT 1IBMT 4LF6T 4JV5T 4GKKT 2F4VT 4LF7T 4X62T 2ZM6T 4DR2T 4LF8T 1XMQT 1N33T 5LMUT 2UXCT 4DV3T 2VQFT 4DV4T 4DR3T 4B3ST 4B3MT 2HHHT 4DV0T 2E5LT 4DV2T 3OTOT 4DV1T 2UXBT 1XNQT 4DR6T 1HNWT 1IBLT 4LFAT 4X64T 4LFCT 4LF4T 2UU9T 4DUZT 4JI7T 1HNZT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 T;  4X65 T;  2UUA T;  4K0K T;  4DV5 T;  4JI4 T;  4JI1 T;  1XNR T;  4B3T T;  4NXN T;  4YY3 T;  1I94 T;  4LF9 T;  4JYA T;  4DV7 T;  4AQY T;  1N34 T;  4JI5 T;  4JI0 T;  4DR4 T;  4LFB T;  2UUC T;  4NXM T;  3T1H T;  5BR8 T;  4OX9 T;  4JI2 T;  4KHP T;  1IBK T;  1N36 T;  4GKJ T;  4JI8 T;  5IWA T;  4DR5 T;  1HNX T;  4X66 T;  4DUY T;  1J5E T;  4LF5 T;  4DR1 T;  4DR7 T;  1N32 T;  2VQE T;  4DV6 T;  2UUB T;  1HR0 T;  2UXD T;  1FJG T;  4JI3 T;  4B3R T;  3T1Y T;  5LMN T;  4YHH T;  1XMO T;  1IBM T;  4LF6 T;  4JV5 T;  4GKK T;  2F4V T;  4LF7 T;  4X62 T;  2ZM6 T;  4DR2 T;  4LF8 T;  1XMQ T;  1N33 T;  5LMU T;  2UXC T;  4DV3 T;  2VQF T;  4DV4 T;  4DR3 T;  4B3S T;  4B3M T;  2HHH T;  4DV0 T;  2E5L T;  4DV2 T;  3OTO T;  4DV1 T;  2UXB T;  1XNQ T;  4DR6 T;  1HNW T;  1IBL T;  4LFA T;  4X64 T;  4LFC T;  4LF4 T;  2UU9 T;  4DUZ T;  4JI7 T;  1HNZ T; 
#chains in the Genus database with same CATH topology
 2BBH A;  3CIR A;  4TNW A;  3P4W A;  3PUA A;  5LG4 A;  2UUA T;  1HTJ F;  3C51 A;  2V6X A;  3NKZ A;  2H88 A;  2M67 A;  3OBV E;  3P7I A;  5AQR B;  2V7M A;  3AE7 A;  1LRZ A;  3AEB A;  4MAL A;  5L3F B;  5JDN A;  3J7Y q;  3OYX A;  4O4H E;  4JI1 T;  1H7C A;  4H9S E;  3PUG A;  1I94 T;  3G06 A;  3ZMZ B;  1AJ3 A;  2BS3 A;  1MMD A;  2DLR A;  5E0O A;  1OED B;  2HPJ A;  2WQY A;  4OFZ A;  1UK5 A;  1MMN A;  5FP3 A;  4CI3 B;  3ZN1 B;  5LGN B;  2W2U A;  5HXC A;  2ODU A;  1JNR A;  2L3L A;  3F31 A;  3SFE A;  3U78 A;  5HXH A;  3SOL A;  3VHL A;  1ZP0 A;  3ABV A;  1SUM B;  5IYZ E;  2LJL A;  4H63 H;  4MFR A;  3SS1 A;  3QNU A;  3RPU A;  3UUM A;  2VKH A;  4EOZ B;  3TLV A;  3ZCI A;  4YSY A;  2W00 A;  1GQE A;  4CN1 A;  2WB5 A;  5ADX L;  2C5I T;  3FZH B;  3HKD E;  4DR4 T;  2UXN B;  2UUC T;  2JMH A;  3AE3 A;  3UFE A;  3K3Q C;  3K8P C;  3T1H T;  5CFB A;  4IRE A;  3AAE B;  3M65 A;  4HFV A;  3TLU A;  2NWB A;  4JI2 T;  3UU3 A;  5BR8 T;  1D1B A;  4BA9 A;  1KK7 A;  2IIU A;  3CVR A;  1T8B A;  3LK3 B;  5FL0 A;  3UUX B;  2L8K A;  3V5S A;  2V7L A;  3HL6 A;  3Q5E A;  3UU4 A;  1N36 T;  4JI8 T;  5LB7 B;  5IWA T;  3V5U A;  2XAQ B;  3QK6 A;  4KP3 C;  4QXH B;  2W0G A;  3RRC A;  3HA4 A;  4OYJ A;  2WDV A;  4IST A;  3AE2 A;  4UVA B;  2XM2 A;  3QC9 A;  3UUL A;  2LSG A;  1OED A;  5LHG B;  3A8Y C;  3H3M A;  1ZEE A;  4IE7 A;  2XTL A;  4QH4 A;  4AQF C;  3AE4 A;  3VKG A;  1J1J A;  2W61 A;  2ZM0 A;  3IF8 B;  1E7P A;  4HFE A;  5LJM A;  4AKG A;  3KIN B;  2E2A A;  2BZB A;  4JI3 T;  1HS7 A;  4IDO A;  3T1Y T;  2DNX A;  3AED A;  3ONJ A;  1UCU A;  5FY1 A;  2CHO A;  2BG9 C;  3AE6 A;  3EAM A;  3K3N A;  3PV0 F;  2BG9 E;  4GK5 E;  5FXX A;  3TLW A;  2LE8 A;  5HXS A;  3PUS A;  5HCM A;  4GKK T;  3EAB A;  4UV8 B;  2RPA A;  4EV6 A;  3ZJ1 A;  4GYS A;  5KX5 E;  3PUR A;  2X9W A;  1ZV4 X;  2V5D A;  4X62 T;  3ZYL A;  5LG3 A;  4H9N C;  3TLT A;  2VL8 A;  2V8S V;  4TZ4 C;  1G8X A;  3WI3 A;  4CXW A;  1BR1 A;  2JQQ A;  2KT9 A;  3N9L A;  1HX8 A;  3C64 A;  2NTX A;  3L39 A;  3Q9D A;  1CUN A;  1S94 A;  3PJA A;  4IDP A;  4ZI2 D;  3AXJ A;  1T7S A;  2NW9 A;  1D0Y A;  2J1D G;  2WM9 A;  4HEA A;  5FY7 A;  2BVM A;  2JPF A;  3B5M A;  3H37 A;  3VU7 H;  4ANJ A;  2EHO B;  4ZI7 E;  2FJE A;  1LVK A;  1BR2 A;  2DWK A;  1YXR A;  3RYF E;  2I0M A;  3CQX C;  3Q5W A;  3N5L A;  2KMF A;  4U2Z A;  2WS3 A;  1UUS A;  3JAD A;  5HAX A;  4WBN E;  2LM9 A;  3P4R A;  2WZH A;  5L3G B;  4YXD A;  4AKI A;  2W63 A;  5L3B B;  2E5L T;  3FXE B;  2AXD S;  2V7J A;  1MNE A;  4AI6 A;  4DV2 T;  1HR0 T;  2IC6 A;  4HFD A;  4YJ3 E;  4H9P C;  4PAG A;  2CWO A;  3KVB A;  4L0R A;  4Z90 A;  3L09 A;  3RQW A;  2YEV C;  5IHY A;  4LMJ A;  4E7S A;  2YDR A;  2CXL A;  5JDM A;  5ABG A;  4DR6 T;  2C0S A;  4HN9 A;  2CXD A;  3AVS A;  3NRY A;  2N2N A;  2WDR A;  2E9X B;  1KF6 A;  1Y01 A;  3GWH A;  4IGU A;  5LBM A;  1ZOY A;  2VKJ A;  2K48 A;  3R84 B;  2MTQ A;  4IDQ A;  2KWH A;  1JNZ A;  1EZ3 A;  3L8R A;  5LP6 E;  4HFB A;  2V6Y A;  3SFD A;  2J47 A;  1VCS A;  2YKS A;  2EHO A;  3ZKR A;  2KIN B;  4AKH A;  2LKH A;  5HXE A;  1WR6 A;  5C8Y E;  2XAG B;  5JDH A;  5J1G A;  2ACX A;  4MLK A;  4X5T A;  5LJN A;  3KDS E;  1Z0P A;  4PJN A;  2QA7 A;  3FZM B;  1W9R A;  1HX1 B;  3LFM A;  4ISS A;  3ZT7 A;  2NR4 A;  5AQL B;  2QVA A;  2A72 A;  4JI4 T;  2XHE B;  3C4X A;  4AXP A;  2FJA A;  4M1P A;  2IDO B;  2D2S A;  4FJO A;  4UF0 B;  4EED A;  4EB6 E;  2LHR A;  4XAX B;  4DBR A;  4OHF A;  3PUW F;  2WMO A;  4KUM B;  4IDN A;  3EVY A;  2K5B B;  2BKP A;  3NZQ A;  4QH1 A;  3TLS A;  3WAK A;  4BJM A;  3UUN A;  2V5C A;  5JR9 C;  1OXZ A;  2XUE A;  3S4U A;  2CE7 A;  3AEG A;  3MKD A;  3RIA A;  4OYK A;  3MK7 C;  3UU8 A;  5LNK A;  4DV7 T;  1IAP A;  1G73 A;  2V6Y B;  2WSS V;  3B57 A;  2E5V A;  3RIU A;  3TKL B;  3ZMV B;  3EHZ A;  4U7Y A;  1WYB A;  2H89 A;  1UGO A;  4AQF A;  4DBQ A;  4LFB T;  3QOF A;  3P4P A;  1KFY A;  3AA7 B;  3KV5 A;  3PU3 A;  2WMN A;  4O2B E;  4WYV A;  5AQI B;  4L9I A;  5F3J A;  2I59 A;  1E2A A;  5H6Q B;  2X9Y A;  1MIW A;  2Y8D A;  4PFO A;  4IIJ E;  4L5G A;  4ZXL A;  2CLY C;  4C90 A;  1UX5 A;  3KBT A;  1IBK T;  4KHP T;  4GKJ T;  2Q9Q C;  1FMW A;  1ZKE A;  2CPT A;  3MA9 A;  4A56 A;  4DR5 T;  1HNX T;  3ZC1 A;  3MXZ A;  5HEH A;  3ZMU B;  3KV4 A;  4H9Q C;  3PDY A;  5DJQ C;  3CWZ B;  2JQ9 A;  4JUY A;  4HFH A;  3AE5 A;  4YFS A;  4ILC A;  4LML A;  4P09 A;  1N32 T;  3B13 A;  5AQH B;  2VQE T;  1HF8 A;  5ETW A;  4YJ2 E;  4DV6 T;  2X68 A;  3LJC A;  2D0U A;  1UUR A;  2UUB T;  1XDO A;  3IEE A;  4A98 A;  4ZHQ E;  5AQU B;  5AQT B;  5LHH B;  4XZC A;  2M6I A;  3RGL A;  3MJX A;  1X9B A;  3IHR A;  4B3R T;  1SHZ C;  1OWA A;  2C5K T;  3UU5 A;  3BQL A;  2KXP B;  1J5W A;  5LA6 E;  2W62 A;  2SPC A;  5LXT E;  4YHH T;  1WCR A;  1IBM T;  4LF6 T;  4UIG A;  2CMR A;  2JIW A;  4PFP A;  5FYM A;  5FXZ A;  1X79 A;  3RYI E;  5L3C B;  4NUU A;  3BQK A;  3AB3 B;  4TV8 E;  4LF7 T;  3K1S A;  4AQG A;  4DMV A;  5CA1 E;  5HWY A;  2M6B A;  2XSB A;  2YU2 A;  3JAE A;  2R6G F;  3LBX A;  1NAF A;  4KBM B;  5DQV A;  4QHO A;  4I0U A;  2UXC T;  5JRC B;  4I55 E;  3ESL A;  4YLH A;  5FL1 A;  3PE0 A;  4HWF A;  3NVO A;  4LF8 T;  1XMQ T;  1N33 T;  2FUP A;  5BMV E;  5LMU T;  2CA5 A;  2WDQ A;  3ZT5 A;  2JRK A;  2XQ7 A;  3N9O A;  4YSZ A;  5ABF A;  3F2E A;  3NBX X;  2BS2 A;  5HEG A;  4HWH A;  4P0B A;  2K24 A;  2CRB A;  2NW7 A;  2LOP A;  3FXD B;  1YQ4 A;  1IJ5 A;  3BK9 A;  4X1Y E;  3ANW B;  5AQP B;  4PJL A;  3ONX A;  2QGS A;  4B3S T;  4X1K E;  2CXF A;  2MBG A;  2ZM2 A;  1U4Q A;  3R6N A;  4AKR B;  2HHH T;  1KNZ A;  3ETV A;  4A5X A;  4EYU A;  4JEU B;  3OTO T;  3ZT6 A;  2CM0 A;  1ZHC A;  4HWC A;  2AE9 A;  2UXB T;  3N9Q A;  4WNK A;  2XY8 B;  5HXR A;  3MZK B;  1HFA A;  1QUU A;  3CX6 B;  2Q9Q A;  5EZY E;  5L2L A;  1XNQ T;  4TV9 E;  3FB2 A;  2IHR 1;  3QUJ A;  4MHC A;  1HNW T;  2XQY A;  3IBP A;  3GMI A;  5C2T A;  1QSD A;  3EI0 A;  2FJD A;  1E1H B;  2VK9 A;  2XPK A;  5EK2 A;  5JQG E;  2XQ5 A;  4YTN A;  5CGM A;  2LM2 A;  4CQI A;  4O4I E;  4U33 A;  5JR9 B;  3Q5X A;  3NZP A;  3PUY F;  4H9R C;  5FXV A;  3ZMT B;  4F6R C;  2UU9 T;  1XZY A;  3A7M A;  5H6R B;  4JI7 T;  2PFV A;  2X0Y A;  3CQG B;  2JMK A;  2Q9Q D;  4BAY B;  5AQK B;  4X65 T;  1Y64 B;  3MAC A;  4QXB B;  4O2A E;  2KSR A;  4G2A A;  4CXX A;  3DP7 A;  2LEH A;  5FMN A;  4ILA A;  2VAS A;  3ZST A;  4BJN A;  3WAJ A;  4DV5 T;  4YSX A;  1XNR T;  2CBJ A;  4EIW A;  2J62 A;  4B3T T;  4NXN T;  4YY3 T;  3RF1 A;  4LF9 T;  1NEN A;  2XQ4 A;  4ZI2 C;  2Q9Q B;  3QB5 K;  3PUQ A;  4CI1 B;  2HN1 A;  3EDU A;  1M62 A;  3KV6 A;  2XSA A;  2JJ9 A;  4X1I E;  2PJQ A;  5FVL A;  3JCF A;  1YW0 A;  3PU8 A;  2HPL A;  1YKH B;  2DCF A;  3C50 A;  3QB5 A;  3RLF F;  4AIS A;  4IL4 A;  3I9Y A;  4GOU A;  4O4L E;  1LKX A;  2D0T A;  3N2K E;  1N34 T;  2XZE A;  2YDQ A;  3U3I A;  4YT0 A;  4DND A;  4Z91 A;  4COF A;  4DO0 A;  4NXM T;  3OYZ A;  3PUX F;  4I4T E;  3I0Q A;  2XQ6 A;  3GN5 A;  4PK4 A;  4EAH A;  3DTO A;  4QKN A;  2V26 A;  5JDG A;  2JQH A;  3E0Z A;  3N2O A;  5FXW A;  3D0T A;  1BR0 A;  3PTR B;  3PJA J;  1OED E;  3HKB E;  1D0X A;  1OED C;  2ZMA A;  2D9D A;  1XWM A;  4WBO A;  5AQM B;  1US7 B;  4IDZ A;  5L4H A;  4HFC A;  4ZS2 A;  2VVS A;  4ASK A;  4DUY T;  1J5E T;  2LSI A;  4DR1 T;  3VKH A;  4NPP A;  1M7K A;  2C5J A;  2XAS B;  3AA0 B;  4DR7 T;  2HH7 A;  1HG2 A;  5J2U E;  2ES0 A;  1KEY A;  3L3P A;  2YU1 A;  3I1A A;  2IAK A;  4TN7 B;  3RIU C;  2LSJ A;  5F5W A;  5JDL A;  2UXD T;  2B1E A;  5ABH A;  3VRA A;  1HCI A;  5JDQ A;  1FJG T;  4KHZ F;  5FNV E;  2WZI A;  4ZI3 C;  1WYC A;  4U3C A;  4EGW A;  3OPC A;  3N9M A;  2DWG A;  2BG9 A;  3HKC E;  3NWI A;  2W66 A;  1W0A A;  4AKL A;  4ZS3 A;  3ZCJ A;  2WU5 A;  4AIU A;  1XMO T;  4IE0 A;  4JV5 T;  4J2C A;  4PK5 A;  2IML A;  4ZZC A;  4QX8 B;  4G63 A;  2V1D B;  3I9W A;  5JH7 E;  3P50 A;  2JQK A;  3AAA B;  2FBW A;  4GIW A;  3ZC0 A;  1S35 A;  4V1A v;  2WY2 A;  4TNV A;  4K0U A;  2CBI A;  2X0L B;  3RKO A;  3RX6 A;  4ZZB A;  5LGU B;  2OV9 A;  2ZM6 T;  2J4G A;  2X67 A;  3OJA A;  3P8C D;  1VCT A;  5AQN B;  2OLT A;  2XAJ B;  5AQV B;  5TAO A;  3CK6 A;  3VRB A;  3ZPO A;  2BBJ A;  3SRZ A;  3ZEF B;  4H9O C;  5LGT B;  4JLE A;  2EHO D;  2WBL A;  4HFI A;  5JDF A;  4DR2 T;  1XDP A;  4I43 B;  2E9X C;  1FEW A;  5L4E A;  1FIO A;  2LKG A;  1KNR A;  3E22 E;  3AVR A;  4HWI B;  5LHI B;  2VQF T;  1MMA A;  4UEL A;  3T8O A;  3CPZ A;  2KZ7 B;  4EYY R;  3UUB A;  2NTY A;  2X0H A;  4U2Y A;  2BG9 B;  2VL0 A;  2X66 A;  5IUX A;  4DR3 T;  3ANW A;  4DV0 T;  1I6Z A;  5HEO A;  1VRB A;  2DHR A;  1SA0 E;  5L3D B;  3CX8 B;  3CML A;  4DID B;  4UXN B;  4UR9 A;  3ZYM A;  3Q2M A;  2DL1 A;  2NW8 A;  5AQF B;  4NUV A;  1SE7 A;  3PUZ F;  4QX7 B;  5L47 A;  3FBL A;  3LK2 B;  5AQG B;  3C98 B;  4JYA T;  4UF0 A;  4B6X A;  4HTE A;  2NP9 A;  2X51 A;  3OVU A;  2HN2 A;  3AEF A;  4N78 D;  2XAF B;  3KBU A;  2N1G A;  4HWD A;  3FZL B;  5AQQ B;  2VWA A;  1T98 A;  4CN4 A;  4LFA T;  2I6H A;  2LHN A;  2CCQ A;  3AE1 A;  4QWN B;  1WRD A;  3FBZ A;  5JVD E;  3RYH E;  4EEB A;  1D0Z A;  3LK4 2;  4OK0 A;  5C3J A;  4TX5 A;  4Z8X A;  5J2T E;  3RI5 A;  2X9H A;  3JC6 C;  4P1N A;  4H63 V;  5LBQ B;  3AA6 B;  5F8P A;  5JR9 A;  2LSY A;  4KX6 A;  2V7K A;  4DUZ T;  4UVB B;  1HG5 A;  4YTP A;  3I0O A;  3HI2 A;  2MAW A;  3DJB A;  3FZK B;  3GA8 A;  3LDQ B;  4JBW F;  1IJ6 A;  2WWV A;  4ILU A;  4U72 A;  1HNZ T;  4JI6 T;  2GK9 A;  3ETU A;  5A1L A;  1WLX A;  3UU6 A;  1MIY A;  3C4W A;  3KVA A;  4YTM A;  5AQS B;  4KMC A;  1U5P A;  3ONL C;  4C91 A;  4HKA A;  4PW8 A;  4ZI3 D;  3VR9 A;  4P0A A;  2NOX A;  5FVK A;  4CN6 A;  4ZEY A;  2IC9 A;  4K0K T;  5HYA A;  3O1I A;  3AAI A;  2XAH B;  2BVL A;  2LT3 A;  4EZ4 A;  3ZJ2 A;  2A3D A;  5GON E;  3RKG A;  2XQA A;  3LBX B;  3O1J A;  1B7T A;  4CI2 B;  1DU2 A;  2UXX B;  4U74 A;  2VB6 A;  3ZLI A;  2N9D A;  5L3E B;  1LVF A;  2A2F X;  3PUV F;  4PJM A;  5ABF B;  2RP4 A;  2IW5 B;  4AQY T;  3RC3 A;  5AQO B;  3RHW A;  4DVD A;  4JI5 T;  4IE4 A;  1BR4 A;  4MBQ A;  3VR8 A;  3O1H A;  3ZMS B;  4GYR A;  4DMW A;  5HEU A;  4JI0 T;  2W4X A;  2YDS A;  3CX7 B;  4CXY A;  2ODV A;  3JC6 D;  5HCJ A;  4B3M T;  4OX9 T;  1W09 A;  3UFG A;  3W15 B;  3KFW X;  2EHO C;  2P9B A;  3NRX A;  1L0V A;  1WR0 A;  4ERR A;  5CJ5 A;  5HWX A;  2E9X D;  3K3O A;  1NEK A;  3P4S A;  2V7I A;  2CEA A;  5AFU L;  4X66 T;  4LF5 T;  2WCA A;  4Q25 A;  4UEM A;  2CWY A;  2FJB A;  3FHN A;  2PTF A;  1KNP A;  5KDM C;  2X9X A;  4A97 A;  2MPK A;  5JRC A;  3M3Z B;  3UTK A;  2G0U A;  2XQ8 A;  2L9Q A;  5DQW A;  1MMG A;  4FI5 A;  1R8I A;  4TWD A;  3N9P A;  3AE8 A;  3X1D A;  2PBI A;  2Y6X A;  3A5X A;  2ACZ A;  4TWH A;  2LOS A;  1IZN B;  4X20 E;  2MYS A;  3UQ4 A;  2E8I A;  5LMN T;  4IL9 A;  3N9N A;  2WP9 A;  3RYC E;  4EXT A;  2ZLY A;  2CLY B;  2A9U A;  2H7O A;  4NIQ A;  2YN6 A;  4PJJ A;  5KXJ A;  5JRE A;  4TWF A;  4UVC B;  4IE5 A;  3AEC A;  3FZF B;  4LMK A;  1YD8 G;  2D5U A;  4UV9 B;  5CB4 E;  3UQ7 A;  2F4V T;  1D1C A;  2DI4 A;  3ZN0 B;  2PG8 A;  1V9D A;  2YIN A;  3C4Z A;  3N2G E;  3LG7 A;  5DAB A;  4EZH A;  5CA0 E;  1YQ3 A;  2VKO A;  4ILB A;  1O3X A;  2ZM8 A;  2LSK A;  2K9A A;  3Q5D A;  5LYJ E;  2XQ3 A;  3EUH A;  5HEJ A;  3ZSS A;  1FMV A;  2KLQ A;  4IHJ E;  2YK0 A;  5EK3 A;  2IUB A;  2BKN A;  4IE6 A;  2KND A;  3KV9 A;  4GK0 E;  2WWU A;  4U31 A;  5M4Y A;  3JAF A;  2XJ7 A;  3AXJ B;  4F8H A;  3O9X A;  3E08 A;  2B76 A;  2BS4 A;  2WU2 A;  1W0B A;  5FY0 A;  3RH3 A;  3EDV A;  3H3A A;  2VVN A;  2MOZ A;  2Z6E A;  4DV3 T;  1CHU A;  3AA1 B;  2K3W A;  3AE9 A;  4WW0 A;  4ZOL E;  3F57 A;  2QYW A;  4KI0 F;  4O4J E;  4IT4 A;  4PNI A;  5FKY A;  3LSV A;  1NWM X;  4I50 E;  5EK4 A;  3RIF A;  4DV4 T;  3AEA A;  2XQ9 A;  1MND A;  3GN5 B;  2LLY A;  2W67 A;  2OA5 A;  3P4Q A;  1QLB A;  3HR0 A;  2BDE A;  4PK6 A;  5LCY A;  3RRW A;  5J0Z A;  3AEE A;  4JEH B;  3CKD A;  4CZZ B;  2YOE A;  4U7I A;  1T72 A;  1WFD A;  5LOV E;  3OKQ A;  1MIV A;  2QRX A;  1D1A A;  2WAU A;  4YHJ A;  4DV1 T;  3RQU A;  4E7Z A;  4TUY E;  2Y48 B;  2VUR A;  3BQI A;  3ZYK A;  3IA3 A;  1IBL T;  4QXC B;  5KMG P;  2H7V C;  2E9X A;  2XM1 A;  4X64 T;  4LFC T;  1VOM A;  3SWH A;  2CHN A;  4ADZ A;  5ABE A;  5JTG A;  3O4X E;  4HE8 A;  3CQC B;  2LRK A;  1YKE B;  2KWI B;  5AQJ B;  3HKE E;  4O8S A;  4HGA A;  1UX4 A;  2RA1 A;  4QH5 A;  4LF4 T;  3RC8 A;  4XBF B;  2H3R A;  2LRL A;  4WZX A;  3UT5 E;  3J9X 1;  1Z8U A;  2BKO A;  2VKD A; 
#chains in the Genus database with same CATH homology
 4JI6 T;  4X65 T;  2UUA T;  4K0K T;  4DV5 T;  4JI4 T;  4JI1 T;  1XNR T;  4B3T T;  4NXN T;  4YY3 T;  1I94 T;  4LF9 T;  4JYA T;  4DV7 T;  4AQY T;  1N34 T;  4JI5 T;  4JI0 T;  4DR4 T;  4LFB T;  2UUC T;  4NXM T;  3T1H T;  5BR8 T;  4OX9 T;  4JI2 T;  4KHP T;  1IBK T;  1N36 T;  4GKJ T;  4JI8 T;  5IWA T;  4DR5 T;  1HNX T;  4X66 T;  4DUY T;  1J5E T;  4LF5 T;  4DR1 T;  4DR7 T;  1N32 T;  2VQE T;  4DV6 T;  2UUB T;  1HR0 T;  2UXD T;  1FJG T;  4JI3 T;  4B3R T;  3T1Y T;  5LMN T;  4YHH T;  1XMO T;  1IBM T;  4LF6 T;  4JV5 T;  4GKK T;  2F4V T;  4LF7 T;  4X62 T;  2ZM6 T;  4DR2 T;  4LF8 T;  1XMQ T;  1N33 T;  5LMU T;  2UXC T;  4DV3 T;  2VQF T;  4DV4 T;  4DR3 T;  4B3S T;  4B3M T;  2HHH T;  4DV0 T;  2E5L T;  4DV2 T;  3OTO T;  4DV1 T;  2UXB T;  1XNQ T;  4DR6 T;  1HNW T;  1IBL T;  4LFA T;  4X64 T;  4LFC T;  4LF4 T;  2UU9 T;  4DUZ T;  4JI7 T;  1HNZ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...