4LF5T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf5T00
4JI0T 5LMUT 4LFCT 4KHPT 4DR5T 4DR7T 4DV1T 4B3TT 5BR8T 4DV5T 1HNZT 4JI4T 4LF9T 1N32T 4DR2T 4YHHT 1IBKT 1N33T 4YY3T 4DV4T 1J5ET 4JI1T 4DR1T 4DR6T 4JV5T 4LFBT 4AQYT 4LF4T 4B3ST 2UU9T 1XNQT 2VQET 4JI6T 2UUCT 4DR3T 2UUBT 2F4VT 1I94T 4DV7T 2UXBT 2HHHT 4OX9T 4X64T 1IBMT 4DV6T 4B3RT 2UXDT 1HR0T 4JI5T 4JI3T 4LF7T 1XMQT 1N34T 4DV0T 4DV3T 4LF8T 2UXCT 1N36T 2UUAT 3T1HT 4GKKT 4DUYT 4JI8T 4JYAT 4DR4T 4NXNT 4B3MT 2ZM6T 4DV2T 3T1YT 1XMOT 4LF5T 2E5LT 4LFAT 5IWAT 4JI7T 1HNXT 4K0KT 1HNWT 1XNRT 4JI2T 4X65T 4LF6T 4X66T 3OTOT 1FJGT 1IBLT 5LMNT 4GKJT 4X62T 2VQFT 4NXMT 4DUZT
chains in the Genus database with same CATH superfamily
1E7PA 4ISTA 5AQSB 4GYRA 5LMUT 4TV8E 5JDNA 2DCFA 4U2YA 3RKOA 4JLEA 1IBMT 2RP4A 3JCFA 4KHPT 2W63A 4NUVA 4OFZA 2C0SA 5J0ZA 3H3MA 3PUSA 4P0AA 2M67A 4DV1T 4MBQA 4B3TT 3CKDA 1H7CA 1JNRA 1MMAA 2CM0A 3DP7A 4CI2B 4YHJA 5DJQC 3N9MA 2D0TA 4EEDA 1R8IA 3ZMZB 2XQ4A 3I0QA 2FJAA 4YTNA 5L3FB 1IBKT 1OEDE 1N33T 3RIAA 5C3JA 3RIUC 2JQKA 3ZEFB 3NZPA 3RPUA 4IE6A 3UTKA 2HH7A 2MOZA 5L4EA 2IDOB 2XY8B 3ESLA 3K3OA 4QWNB 5IHYA 3SOLA 4YT0A 5L3DB 1SUMB 3AEBA 5FVKA 5H6QB 2QGSA 3VRAA 3CX8B 3PV0F 3F2EA 5FMNA 3ZSTA 2H7OA 4HFHA 4AQYT 4CQIA 4C91A 3EHZA 5AQPB 4HFDA 5HEGA 5ETWA 5F5WA 3C4ZA 3RYCE 1ZP0A 4H9OC 5JDQA 2WWUA 4H9NC 2A3DA 1MNDA 4HFEA 1ZOYA 2IMLA 1XNQT 1M62A 2JPFA 3TLVA 5J2UE 3LBXB 1T8BA 5EK4A 1UX5A 3AEFA 2YDSA 2CXFA 2IC9A 3L8RA 3Q9DA 2X68A 5FKYA 3KBUA 2XHEB 3SS1A 2IC6A 4O4HE 3RYIE 1ZKEA 1VCTA 3AE1A 4IIJE 2YINA 4DMWA 2YDRA 3BQIA 3EDUA 4A97A 3TKLB 1HX8A 4OX9T 2KSRA 4PK6A 3QOFA 3QB5A 3N9OA 4TZ4C 1HR0T 3P8CD 3JC6C 3X1DA 5AQRB 2ZM8A 1XMQT 1WRDA 4X1KE 4IDOA 3S4UA 2LHRA 3A5XA 3G06A 3KDSE 4XBFB 2X0YA 5EK2A 4KI0F 3RC3A 2LHNA 5JR9C 5JR9A 2UXCT 4UR9A 2I59A 5KDMC 1UX4A 3IA3A 2LKHA 4H9PC 5AQIB 2XQ5A 2NR4A 4IE7A 4EB6E 3UU3A 1LVFA 3T1HT 2KWHA 3ABVA 4OYJA 2E8IA 4HEAA 4YFSA 2X9YA 3H37A 4DBQA 3B13A 4EYYR 3C50A 2B1EA 4YSXA 4TNWA 2IAKA 4DUYT 3UT5E 3PUXF 1CHUA 3WI3A 1MIYA 5TAOA 5JRCA 3KV9A 4ZOLE 1VCSA 4QXBB 3VU7H 1Z0PA 3K3QC 3AEAA 5HEUA 5LJNA 4L5GA 3TLSA 1U5PA 4EGWA 2LT3A 1U4QA 1G73A 1V9DA 3ANWB 2W67A 4H63H 2WQYA 5AQNB 3J9X1 5FY1A 5FXVA 5IUXA 1FIOA 3QC9A 4UF0A 2L8KA 3PURA 3ZCIA 2VURA 2BBHA 2HN1A 1WYBA 2KINB 4IGUA 4JI7T 2FUPA 3CX7B 2V7JA 1JNZA 3KVAA 5FP3A 3E0ZA 2Q9QC 5FXZA 3JC6D 1X79A 3AE8A 3Q5EA 5DQWA 2BS3A 3FBZA 3JADA 2CHOA 3PUVF 2LSJA 5HXHA 4X65T 2K9AA 4ZZCA 2KMFA 4IT4A 3ZPOA 2ACXA 2X9HA 4ZHQE 3NZQA 1VOMA 4U3CA 1IBLT 3AXJB 2C5IT 2H7VC 3L09A 4HFIA 4JUYA 4X1YE 5LMNT 4WYVA 2QYWA 3AEEA 3ZMSB 2L3LA 3AA1B 3RRCA 1LRZA 4ZI7E 5LNKA 1D0XA 3NKZA 2JJ9A 2X0LB 3U3IA 4KUMB 4CXXA 2NTXA 4EAHA 3HR0A 3U78A 5ADXL 5JQGE 4YSYA 3NVOA 1NENA 2BG9B 2VVSA 4DV0T 4ZEYA 5HEOA 3KV4A 4U33A 5CGMA 1OXZA 1VRBA 2Y8DA 4LFCT 2IW5B 2NP9A 3HA4A 4CXWA 2V7MA 4DR7T 1OEDA 1OEDC 5L3BB 4NIQA 5HCJA 3DTOA 2BVMA 3RQUA 3AE5A 3OJAA 2VL8A 2K5BB 2LJLA 3GN5B 1HNZT 2WP9A 2XAJB 4QXCB 4LF9T 4TUYE 3NWIA 4A98A 3WAJA 1MNEA 3PUZF 1US7B 2YU1A 2J62A 4LMJA 4AQFC 3MXZA 4PFPA 5LXTE 3TLTA 5HWYA 5L4HA 4DV4T 2Q9QD 4KBMB 2D9DA 3HKBE 3PU8A 4HKAA 2NWBA 2CA5A 2V5CA 4V1Av 2BKOA 3ZMVB 4DMVA 4UVCB 5LJMA 3ZMUB 4DR1T 1LKXA 2E9XA 2DL1A 5LGUB 4JV5T 5C2TA 4AXPA 1GQEA 2XAGB 3P4PA 2AXDS 5JDHA 1WFDA 2UXXB 5AQOB 4CZZB 4O2AE 3C4WA 3UUBA 2UU9T 2RPAA 5AQTB 3RGLA 5ABGA 4DVDA 4CI3B 4B3ST 1BR0A 1XDPA 4H9QC 2C5JA 3VR8A 4HE8A 4Q25A 2EHOB 5CA1E 2VWAA 3P4RA 4JEHB 4B6XA 3K8PC 4TV9E 3OYZA 2UUCT 4JI6T 2V6YB 4DR3T 2UUBT 3HL6A 3MJXA 3LBXA 3PJAA 2AE9A 4I4TE 3RH3A 1DU2A 3VHLA 5DQVA 4OHFA 1ZHCA 3LJCA 2YK0A 3ZC1A 3ANWA 2F4VT 1E1HB 3GWHA 4UXNB 2XSBA 2WSSV 4AQGA 4DV7T 3ZN0B 2UXBT 1MMDA 2E9XD 2J4GA 3Q5WA 4ASKA 4PK5A 4X64T 4AIUA 4IDPA 2IHR1 2ZM2A 2DWKA 1Z8UA 2W2UA 3LK42 4KMCA 4OK0A 4HWDA 1WLXA 2KNDA 4UVBB 4X20E 4JI5T 2Z6EA 2XQ9A 3RKGA 3ZJ2A 4IE0A 1N34T 4DV3T 2QRXA 1S94A 2N2NA 3AEDA 3IBPA 4LF8T 3R6NA 4EOZB 4AKHA 5CB4E 2WU5A 2IUBA 2G0UA 2ZLYA 3ZKRA 5ABEA 5L2LA 4X62T 1N36T 1W09A 4HFBA 4WZXA 4QH4A 1YKEB 3AE6A 3IEEA 2BKNA 3CMLA 2XM1A 3RQWA 1HG5A 2VKDA 4AKGA 2RA1A 2MPKA 2YEVC 4O4JE 4TX5A 4GKKT 1NEKA 3N9QA 3PUQA 2DNXA 4MHCA 1BR2A 2WMNA 4N78D 3FZLB 3RF1A 5L47A 4JYAT 2V5DA 2XASB 2XUEA 4ERRA 4ILAA 3AEGA 3CIRA 1BR1A 1CUNA 3MZKB 2PFVA 5LG3A 1E2AA 2SPCA 4A56A 3RC8A 5L3GB 2ZM6T 4L0RA 2PBIA 5JDGA 3P50A 2XPKA 4PK4A 1HNWT 1J5WA 1MMGA 2E9XC 3B57A 3PJAJ 4JEUB 1D0ZA 1UURA 3AE2A 2XQ7A 3HI2A 1YD8G 2Q9QB 2CLYB 3AA0B 3BK9A 4YSZA 4BAYB 4LF4T 3RI5A 1O3XA 4K0KT 2CCQA 1FMWA 2BDEA 3K1SA 4O2BE 4Z91A 4AI6A 3RIUA 5JDFA 4JBWF 3AAEB 4HFVA 2D2SA 4EXTA 1FMVA 4UV8B 2KZ7B 4X66T 2E9XB 3OTOT 2V7LA 5LA6E 3R84B 3A8YC 3AE4A 4YJ3E 2HPLA 1XDOA 2W0GA 5HXRA 5C8YE 5JTGA 5LP6E 3FXDB 2XTLA 4GKJT 5LBMA 4HTEA 5LGNB 3KFWX 3AA6B 3KVBA 4MFRA 3V5SA 2VQFT 3AE3A 5KX5E 3O4XE 4H9RC 2DLRA 1ZEEA 5J1GA 4DUZT 3P7IA 4MLKA 4I43B 4JI0T 2WDQA 3ONJA 2N9DA 2WBLA 4U7YA 3LK3B 5AQMB 1J1JA 2X9WA 2CXDA 1QSDA 1SA0E 2W61A 2VK9A 3BQKA 2XM2A 2WS3A 3O1JA 4COFA 2CHNA 5HXEA 2A2FX 2NW7A 3SRZA 3C4XA 3F31A 2E5VA 2LM2A 4TWDA 4TWFA 3FB2A 2I0MA 3RHWA 3SWHA 4AQFA 4YJ2E 4NUUA 4YLHA 2KLQA 3Q2MA 5EZYE 1Y64B 4DBRA 4FI5A 5EK3A 3UU8A 2BS4A 1HCIA 1N32T 2VKHA 1L0VA 4PJMA 2H88A 4IL9A 2JMKA 2LM9A 1WR6A 5AQUB 1D0YA 3OVUA 4K0UA 4YY3T 2V7IA 4KP3C 5LGTB 1BR4A 4I50E 2K48A 2OLTA 2A72A 2V7KA 1Y01A 2WAUA 2W66A 3I9YA 4IDZA 2V1DB 5HEHA 2A9UA 4HWFA 4JI1T 2NOXA 2CWYA 4IL4A 2ZMAA 2EHOD 2LEHA 2YN6A 4QHOA 1HS7A 3VR9A 4TN7B 2LSKA 5JRCB 2JIWA 5J2TE 3JAFA 3UFGA 5FL0A 2PG8A 3C98B 1HTJF 3MACA 2BG9E 3I1AA 3PDYA 2WWVA 5CA0E 3LDQB 3PTRB 5LHIB 3VRBA 3LSVA 3HKCE 5AQLB 3VKHA 3W15B 4HN9A 3Q5XA 5HWXA 3PU3A 5FYMA 4L9IA 2LRLA 2W4XA 5LBQB 3UQ4A 5ABHA 2DHRA 2BBJA 1YKHB 4X1IE 1KFYA 3UFEA 1KNZA 4I55E 1WYCA 4BA9A 3DJBA 1HG2A 4ZI3D 2CEAA 2LSYA 3JAEA 1I94T 2HHHT 5HEJA 2XZEA 4PW8A 4G2AA 1UK5A 3QK6A 1T7SA 2LOSA 3RIFA 3ZCJA 4CI1B 2D5UA 2I6HA 2KXPB 2XAQB 2BZBA 4IDNA 4U74A 2P9BA 2B76A 2KWIB 4WNKA 4ZS2A 4PAGA 5BMVE 5AQKB 5LHGB 3I0OA 3AE9A 4HWHA 2X0HA 4P1NA 4UV9B 3ZYKA 4DNDA 2CWOA 3GN5A 4AKRB 1ZV4X 2MBGA 3UULA 4BJMA 5CFBA 3ZLIA 3AVRA 2YOEA 3P4WA 3AECA 2UUAT 1XWMA 2H89A 1KK7A 1WCRA 2WB5A 3KINB 4GIWA 4QH5A 4EIWA 3Q5DA 3BQLA 4U72A 2XJ7A 4PJNA 1D1AA 2KT9A 2LLYA 4EZHA 2JQ9A 2V26A 3C51A 3QB5K 4O4IE 4JI8T 2X9XA 4DR4T 5L3EB 2VASA 2DWGA 2V6XA 2YU2A 3M65A 3A7MA 2YKSA 4ZS3A 4ZZBA 2NW8A 1FEWA 4GYSA 5HYAA 4NXNT 1HX1B 1M7KA 3LG7A 5FXXA 3J7Yq 4B3MT 4A5XA 4DV2T 4PNIA 5FVLA 3ZMTB 4E7ZA 1YW0A 1WR0A 4UVAB 3LFMA 4QX7B 2V6YA 4XZCA 4LF5T 5DABA 3AVSA 1IJ5A 3PE0A 3UU5A 5FY7A 3RLFF 3TLUA 3NRYA 2Y6XA 5H6RB 4CN6A 2PJQA 2JQQA 2JQHA 1LVKA 1W0AA 4QX8B 5HAXA 3UQ7A 2HPJA 3AAAB 1QUUA 2CLYC 2CBJA 5IYZE 1NAFA 5LG4A 4JI2T 5F3JA 1XNRT 5HXSA 2V8SV 2WZIA 2C5KT 5AQHB 4LF6T 3H3AA 5JR9B 1B7TA 2NW9A 1T98A 2WY2A 4FJOA 1FJGT 4UELA 4LFBT 1I6ZA 2VL0A 4TNVA 4PFOA 2BG9C 5JDMA 3GA8A 1W0BA 5FNVE 2BVLA 3CQXC 3FHNA 4QH1A 3AXJA 4NPPA 5ABFA 2XAFB 1YXRA 2XQYA 3FZKB 5AQGB 5AQQB 2L9QA 5F8PA 4ADZA 3TLWA 1QLBA 4OYKA 4YTPA 4GOUA 3NRXA 4NXMT 1HF8A 3CX6B 3ONLC 4H9SE 2WU2A 4O8SA 2K24A 4PJLA 2XQ8A 2CXLA 4YXDA 3EUHA 4EYUA 5M4YA 2ZM0A 2R6GF 4HWCA 4CN1A 4DR5T 4IDQA 4MALA 2ES0A 2X67A 3GMIA 3SFEA 2LSIA 4F8HA 2J47A 3ZSSA 1YQ3A 3CPZA 2WDVA 3N2GE 3N2OA 4I0UA 4U31A 1NWMX 2Y48B 4ISSA 5FY0A 4PJJA 4ZI2D 5BR8T 4DV5T 5LYJE 3ETUA 2M6IA 4JI4T 4ZI3C 3AE7A 5LHHB 3RYFE 3KBTA 4IREA 3RX6A 3T8OA 3ZYLA 4YHHT 4EZ4A 4DR2T 3E22E 4HWIB 5AQVB 2WZHA 4J2CA 4ILBA 3N2KE 4WBNE 2XQAA 2QVAA 3ZJ1A 5L3CB 3O1IA 4HFCA 4UF0B 1KNPA 2K3WA 1IJ6A 1X9BA 1S35A 4WBOA 5FXWA 3UU4A 4ILCA 4EV6A 4U2ZA 4QKNA 5AFUL 4UEMA 3P4SA 1W9RA 3OYXA 3HKDE 2GK9A 4CN4A 1D1BA 1YQ4A 2DI4A 2N1GA 3IF8B 4QXHB 2JRKA 4HGAA 4U7IA 4WW0A 5AQJB 5HXCA 3FZMB 2VQET 5HCMA 4UIGA 3ZT7A 2VKJA 3ZN1B 5LB7B 4E7SA 2XSAA 1XZYA 2WMOA 4IHJE 4Z90A 4C90A 3AAIA 2UXDT 2ODUA 3ONXA 4AKLA 3L3PA 3CQGB 5ABFB 5KXJA 4XAXB 5FL1A 3O9XA 2Q9QA 3UUNA 2BG9A 2WCAA 2ACZA 2LRKA 4GK0E 3MA9A 3HKEE 3K3NA 4EEBA 4ZI2C 1MIWA 2XAHB 3CQCB 3FBLA 2QA7A 2CE7A 3P4QA 5JREA 1SHZC 4X5TA 2FJEA 2IIUA 4B3RT 1KNRA 3ETVA 3WAKA 4JI3T 3EI0A 3VKGA 5E0OA 4LF7T 4G63A 3RYHE 2YDQA 3UU6A 1MMNA 1MIVA 1SE7A 2EHOA 2LE8A 3ZYMA 2BS2A 3N9LA 4O4LE 4GK5E 2H3RA 3B5MA 5AQFB 3EABA 2LSGA 3IHRA 3KV6A 3PUAA 2CBIA 3OKQA 2HN2A 2LOPA 3SFDA 3QNUA 3C64A 3OBVE 1OWAA 1J5ET 1KEYA 2CRBA 3KV5A 3PUGA 2E2AA 5JVDE 3N9PA 2CPTA 1OEDB 3L39A 3UUMA 3N9NA 5JH7E 3FXEB 1IZNB 1UUSA 2WM9A 3O1HA 3M3ZB 2MYSA 4ZXLA 2MTQA 3I9WA 2CMRA 2UXNB 4ANJA 5KMGP 3OPCA 5GONE 3UUXB 4KHZF 5A1LA 4DV6T 2XQ6A 3CVRA 3EAMA 2XQ3A 3FZFB 1G8XA 4P09A 3CK6A 2EHOC 3D0TA 3ZC0A 4DO0A 3PUYF 1HFAA 2BKPA 4ILUA 4IE4A 3LK2B 2MAWA 3V5UA 3T1YT 2NTYA 1XMOT 1HNXT 5CJ5A 2FJDA 4CXYA 4DR6T 3CWZB 2LKGA 3PUWF 4Z8XA 2E5LT 2X66A 3EVYA 2VKOA 2WDRA 3ZT6A 5IWAT 4LFAT 3N5LA 3E08A 1UGOA 3AA7B 4YTMA 3ZT5A 4LMKA 3AB3B 4KX6A 4LMLA 1AJ3A 2JMHA 4AKIA 5LOVE 1EZ3A 2J1DG 2OA5A 3MK7C 3QUJA 3FZHB 3MKDA 3RRWA 4AISA 2OV9A 3F57A 3NBXX 5LCYA 4TWHA 2VVNA 2FBWA 4H63V 1T72A 2PTFA 4BJNA 4M1PA 4F6RC 4IE5A 4DIDB 2D0UA 2ODVA 2M6BA 2VB6A 2W62A 2FJBA 1IAPA 2W00A 4P0BA 1D1CA 2X51A 5JDLA 1UCUA 1KF6A 3EDVA
chains in the Genus database with same CATH topology
4JI0T 5LMUT 4LFCT 4KHPT 4DR5T 4DR7T 4DV1T 4B3TT 5BR8T 4DV5T 1HNZT 4JI4T 4LF9T 1N32T 4DR2T 4YHHT 1IBKT 1N33T 4YY3T 4DV4T 1J5ET 4JI1T 4DR1T 4DR6T 4JV5T 4LFBT 4AQYT 4LF4T 4B3ST 2UU9T 1XNQT 2VQET 4JI6T 2UUCT 4DR3T 2UUBT 2F4VT 1I94T 4DV7T 2UXBT 2HHHT 4OX9T 4X64T 1IBMT 4DV6T 4B3RT 2UXDT 1HR0T 4JI5T 4JI3T 4LF7T 1XMQT 1N34T 4DV0T 4DV3T 4LF8T 2UXCT 1N36T 2UUAT 3T1HT 4GKKT 4DUYT 4JI8T 4JYAT 4DR4T 4NXNT 4B3MT 2ZM6T 4DV2T 3T1YT 1XMOT 4LF5T 2E5LT 4LFAT 5IWAT 4JI7T 1HNXT 4K0KT 1HNWT 1XNRT 4JI2T 4X65T 4LF6T 4X66T 3OTOT 1FJGT 1IBLT 5LMNT 4GKJT 4X62T 2VQFT 4NXMT 4DUZT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 T;  5LMU T;  4LFC T;  4KHP T;  4DR5 T;  4DR7 T;  4DV1 T;  4B3T T;  5BR8 T;  4DV5 T;  1HNZ T;  4JI4 T;  4LF9 T;  1N32 T;  4DR2 T;  4YHH T;  1IBK T;  1N33 T;  4YY3 T;  4DV4 T;  1J5E T;  4JI1 T;  4DR1 T;  4DR6 T;  4JV5 T;  4LFB T;  4AQY T;  4LF4 T;  4B3S T;  2UU9 T;  1XNQ T;  2VQE T;  4JI6 T;  2UUC T;  4DR3 T;  2UUB T;  2F4V T;  1I94 T;  4DV7 T;  2UXB T;  2HHH T;  4OX9 T;  4X64 T;  1IBM T;  4DV6 T;  4B3R T;  2UXD T;  1HR0 T;  4JI5 T;  4JI3 T;  4LF7 T;  1XMQ T;  1N34 T;  4DV0 T;  4DV3 T;  4LF8 T;  2UXC T;  1N36 T;  2UUA T;  3T1H T;  4GKK T;  4DUY T;  4JI8 T;  4JYA T;  4DR4 T;  4NXN T;  4B3M T;  2ZM6 T;  4DV2 T;  3T1Y T;  1XMO T;  4LF5 T;  2E5L T;  4LFA T;  5IWA T;  4JI7 T;  1HNX T;  4K0K T;  1HNW T;  1XNR T;  4JI2 T;  4X65 T;  4LF6 T;  4X66 T;  3OTO T;  1FJG T;  1IBL T;  5LMN T;  4GKJ T;  4X62 T;  2VQF T;  4NXM T;  4DUZ T; 
#chains in the Genus database with same CATH topology
 1E7P A;  4IST A;  5AQS B;  4GYR A;  5LMU T;  4TV8 E;  5JDN A;  2DCF A;  4U2Y A;  3RKO A;  4JLE A;  1IBM T;  2RP4 A;  3JCF A;  4KHP T;  2W63 A;  4NUV A;  4OFZ A;  2C0S A;  5J0Z A;  3H3M A;  3PUS A;  4P0A A;  2M67 A;  4DV1 T;  4MBQ A;  4B3T T;  3CKD A;  1H7C A;  1JNR A;  1MMA A;  2CM0 A;  3DP7 A;  4CI2 B;  4YHJ A;  5DJQ C;  3N9M A;  2D0T A;  4EED A;  1R8I A;  3ZMZ B;  2XQ4 A;  3I0Q A;  2FJA A;  4YTN A;  5L3F B;  1IBK T;  1OED E;  1N33 T;  3RIA A;  5C3J A;  3RIU C;  2JQK A;  3ZEF B;  3NZP A;  3RPU A;  4IE6 A;  3UTK A;  2HH7 A;  2MOZ A;  5L4E A;  2IDO B;  2XY8 B;  3ESL A;  3K3O A;  4QWN B;  5IHY A;  3SOL A;  4YT0 A;  5L3D B;  1SUM B;  3AEB A;  5FVK A;  5H6Q B;  2QGS A;  3VRA A;  3CX8 B;  3PV0 F;  3F2E A;  5FMN A;  3ZST A;  2H7O A;  4HFH A;  4AQY T;  4CQI A;  4C91 A;  3EHZ A;  5AQP B;  4HFD A;  5HEG A;  5ETW A;  5F5W A;  3C4Z A;  3RYC E;  1ZP0 A;  4H9O C;  5JDQ A;  2WWU A;  4H9N C;  2A3D A;  1MND A;  4HFE A;  1ZOY A;  2IML A;  1XNQ T;  1M62 A;  2JPF A;  3TLV A;  5J2U E;  3LBX B;  1T8B A;  5EK4 A;  1UX5 A;  3AEF A;  2YDS A;  2CXF A;  2IC9 A;  3L8R A;  3Q9D A;  2X68 A;  5FKY A;  3KBU A;  2XHE B;  3SS1 A;  2IC6 A;  4O4H E;  3RYI E;  1ZKE A;  1VCT A;  3AE1 A;  4IIJ E;  2YIN A;  4DMW A;  2YDR A;  3BQI A;  3EDU A;  4A97 A;  3TKL B;  1HX8 A;  4OX9 T;  2KSR A;  4PK6 A;  3QOF A;  3QB5 A;  3N9O A;  4TZ4 C;  1HR0 T;  3P8C D;  3JC6 C;  3X1D A;  5AQR B;  2ZM8 A;  1XMQ T;  1WRD A;  4X1K E;  4IDO A;  3S4U A;  2LHR A;  3A5X A;  3G06 A;  3KDS E;  4XBF B;  2X0Y A;  5EK2 A;  4KI0 F;  3RC3 A;  2LHN A;  5JR9 C;  5JR9 A;  2UXC T;  4UR9 A;  2I59 A;  5KDM C;  1UX4 A;  3IA3 A;  2LKH A;  4H9P C;  5AQI B;  2XQ5 A;  2NR4 A;  4IE7 A;  4EB6 E;  3UU3 A;  1LVF A;  3T1H T;  2KWH A;  3ABV A;  4OYJ A;  2E8I A;  4HEA A;  4YFS A;  2X9Y A;  3H37 A;  4DBQ A;  3B13 A;  4EYY R;  3C50 A;  2B1E A;  4YSX A;  4TNW A;  2IAK A;  4DUY T;  3UT5 E;  3PUX F;  1CHU A;  3WI3 A;  1MIY A;  5TAO A;  5JRC A;  3KV9 A;  4ZOL E;  1VCS A;  4QXB B;  3VU7 H;  1Z0P A;  3K3Q C;  3AEA A;  5HEU A;  5LJN A;  4L5G A;  3TLS A;  1U5P A;  4EGW A;  2LT3 A;  1U4Q A;  1G73 A;  1V9D A;  3ANW B;  2W67 A;  4H63 H;  2WQY A;  5AQN B;  3J9X 1;  5FY1 A;  5FXV A;  5IUX A;  1FIO A;  3QC9 A;  4UF0 A;  2L8K A;  3PUR A;  3ZCI A;  2VUR A;  2BBH A;  2HN1 A;  1WYB A;  2KIN B;  4IGU A;  4JI7 T;  2FUP A;  3CX7 B;  2V7J A;  1JNZ A;  3KVA A;  5FP3 A;  3E0Z A;  2Q9Q C;  5FXZ A;  3JC6 D;  1X79 A;  3AE8 A;  3Q5E A;  5DQW A;  2BS3 A;  3FBZ A;  3JAD A;  2CHO A;  3PUV F;  2LSJ A;  5HXH A;  4X65 T;  2K9A A;  4ZZC A;  2KMF A;  4IT4 A;  3ZPO A;  2ACX A;  2X9H A;  4ZHQ E;  3NZQ A;  1VOM A;  4U3C A;  1IBL T;  3AXJ B;  2C5I T;  2H7V C;  3L09 A;  4HFI A;  4JUY A;  4X1Y E;  5LMN T;  4WYV A;  2QYW A;  3AEE A;  3ZMS B;  2L3L A;  3AA1 B;  3RRC A;  1LRZ A;  4ZI7 E;  5LNK A;  1D0X A;  3NKZ A;  2JJ9 A;  2X0L B;  3U3I A;  4KUM B;  4CXX A;  2NTX A;  4EAH A;  3HR0 A;  3U78 A;  5ADX L;  5JQG E;  4YSY A;  3NVO A;  1NEN A;  2BG9 B;  2VVS A;  4DV0 T;  4ZEY A;  5HEO A;  3KV4 A;  4U33 A;  5CGM A;  1OXZ A;  1VRB A;  2Y8D A;  4LFC T;  2IW5 B;  2NP9 A;  3HA4 A;  4CXW A;  2V7M A;  4DR7 T;  1OED A;  1OED C;  5L3B B;  4NIQ A;  5HCJ A;  3DTO A;  2BVM A;  3RQU A;  3AE5 A;  3OJA A;  2VL8 A;  2K5B B;  2LJL A;  3GN5 B;  1HNZ T;  2WP9 A;  2XAJ B;  4QXC B;  4LF9 T;  4TUY E;  3NWI A;  4A98 A;  3WAJ A;  1MNE A;  3PUZ F;  1US7 B;  2YU1 A;  2J62 A;  4LMJ A;  4AQF C;  3MXZ A;  4PFP A;  5LXT E;  3TLT A;  5HWY A;  5L4H A;  4DV4 T;  2Q9Q D;  4KBM B;  2D9D A;  3HKB E;  3PU8 A;  4HKA A;  2NWB A;  2CA5 A;  2V5C A;  4V1A v;  2BKO A;  3ZMV B;  4DMV A;  4UVC B;  5LJM A;  3ZMU B;  4DR1 T;  1LKX A;  2E9X A;  2DL1 A;  5LGU B;  4JV5 T;  5C2T A;  4AXP A;  1GQE A;  2XAG B;  3P4P A;  2AXD S;  5JDH A;  1WFD A;  2UXX B;  5AQO B;  4CZZ B;  4O2A E;  3C4W A;  3UUB A;  2UU9 T;  2RPA A;  5AQT B;  3RGL A;  5ABG A;  4DVD A;  4CI3 B;  4B3S T;  1BR0 A;  1XDP A;  4H9Q C;  2C5J A;  3VR8 A;  4HE8 A;  4Q25 A;  2EHO B;  5CA1 E;  2VWA A;  3P4R A;  4JEH B;  4B6X A;  3K8P C;  4TV9 E;  3OYZ A;  2UUC T;  4JI6 T;  2V6Y B;  4DR3 T;  2UUB T;  3HL6 A;  3MJX A;  3LBX A;  3PJA A;  2AE9 A;  4I4T E;  3RH3 A;  1DU2 A;  3VHL A;  5DQV A;  4OHF A;  1ZHC A;  3LJC A;  2YK0 A;  3ZC1 A;  3ANW A;  2F4V T;  1E1H B;  3GWH A;  4UXN B;  2XSB A;  2WSS V;  4AQG A;  4DV7 T;  3ZN0 B;  2UXB T;  1MMD A;  2E9X D;  2J4G A;  3Q5W A;  4ASK A;  4PK5 A;  4X64 T;  4AIU A;  4IDP A;  2IHR 1;  2ZM2 A;  2DWK A;  1Z8U A;  2W2U A;  3LK4 2;  4KMC A;  4OK0 A;  4HWD A;  1WLX A;  2KND A;  4UVB B;  4X20 E;  4JI5 T;  2Z6E A;  2XQ9 A;  3RKG A;  3ZJ2 A;  4IE0 A;  1N34 T;  4DV3 T;  2QRX A;  1S94 A;  2N2N A;  3AED A;  3IBP A;  4LF8 T;  3R6N A;  4EOZ B;  4AKH A;  5CB4 E;  2WU5 A;  2IUB A;  2G0U A;  2ZLY A;  3ZKR A;  5ABE A;  5L2L A;  4X62 T;  1N36 T;  1W09 A;  4HFB A;  4WZX A;  4QH4 A;  1YKE B;  3AE6 A;  3IEE A;  2BKN A;  3CML A;  2XM1 A;  3RQW A;  1HG5 A;  2VKD A;  4AKG A;  2RA1 A;  2MPK A;  2YEV C;  4O4J E;  4TX5 A;  4GKK T;  1NEK A;  3N9Q A;  3PUQ A;  2DNX A;  4MHC A;  1BR2 A;  2WMN A;  4N78 D;  3FZL B;  3RF1 A;  5L47 A;  4JYA T;  2V5D A;  2XAS B;  2XUE A;  4ERR A;  4ILA A;  3AEG A;  3CIR A;  1BR1 A;  1CUN A;  3MZK B;  2PFV A;  5LG3 A;  1E2A A;  2SPC A;  4A56 A;  3RC8 A;  5L3G B;  2ZM6 T;  4L0R A;  2PBI A;  5JDG A;  3P50 A;  2XPK A;  4PK4 A;  1HNW T;  1J5W A;  1MMG A;  2E9X C;  3B57 A;  3PJA J;  4JEU B;  1D0Z A;  1UUR A;  3AE2 A;  2XQ7 A;  3HI2 A;  1YD8 G;  2Q9Q B;  2CLY B;  3AA0 B;  3BK9 A;  4YSZ A;  4BAY B;  4LF4 T;  3RI5 A;  1O3X A;  4K0K T;  2CCQ A;  1FMW A;  2BDE A;  3K1S A;  4O2B E;  4Z91 A;  4AI6 A;  3RIU A;  5JDF A;  4JBW F;  3AAE B;  4HFV A;  2D2S A;  4EXT A;  1FMV A;  4UV8 B;  2KZ7 B;  4X66 T;  2E9X B;  3OTO T;  2V7L A;  5LA6 E;  3R84 B;  3A8Y C;  3AE4 A;  4YJ3 E;  2HPL A;  1XDO A;  2W0G A;  5HXR A;  5C8Y E;  5JTG A;  5LP6 E;  3FXD B;  2XTL A;  4GKJ T;  5LBM A;  4HTE A;  5LGN B;  3KFW X;  3AA6 B;  3KVB A;  4MFR A;  3V5S A;  2VQF T;  3AE3 A;  5KX5 E;  3O4X E;  4H9R C;  2DLR A;  1ZEE A;  5J1G A;  4DUZ T;  3P7I A;  4MLK A;  4I43 B;  4JI0 T;  2WDQ A;  3ONJ A;  2N9D A;  2WBL A;  4U7Y A;  3LK3 B;  5AQM B;  1J1J A;  2X9W A;  2CXD A;  1QSD A;  1SA0 E;  2W61 A;  2VK9 A;  3BQK A;  2XM2 A;  2WS3 A;  3O1J A;  4COF A;  2CHN A;  5HXE A;  2A2F X;  2NW7 A;  3SRZ A;  3C4X A;  3F31 A;  2E5V A;  2LM2 A;  4TWD A;  4TWF A;  3FB2 A;  2I0M A;  3RHW A;  3SWH A;  4AQF A;  4YJ2 E;  4NUU A;  4YLH A;  2KLQ A;  3Q2M A;  5EZY E;  1Y64 B;  4DBR A;  4FI5 A;  5EK3 A;  3UU8 A;  2BS4 A;  1HCI A;  1N32 T;  2VKH A;  1L0V A;  4PJM A;  2H88 A;  4IL9 A;  2JMK A;  2LM9 A;  1WR6 A;  5AQU B;  1D0Y A;  3OVU A;  4K0U A;  4YY3 T;  2V7I A;  4KP3 C;  5LGT B;  1BR4 A;  4I50 E;  2K48 A;  2OLT A;  2A72 A;  2V7K A;  1Y01 A;  2WAU A;  2W66 A;  3I9Y A;  4IDZ A;  2V1D B;  5HEH A;  2A9U A;  4HWF A;  4JI1 T;  2NOX A;  2CWY A;  4IL4 A;  2ZMA A;  2EHO D;  2LEH A;  2YN6 A;  4QHO A;  1HS7 A;  3VR9 A;  4TN7 B;  2LSK A;  5JRC B;  2JIW A;  5J2T E;  3JAF A;  3UFG A;  5FL0 A;  2PG8 A;  3C98 B;  1HTJ F;  3MAC A;  2BG9 E;  3I1A A;  3PDY A;  2WWV A;  5CA0 E;  3LDQ B;  3PTR B;  5LHI B;  3VRB A;  3LSV A;  3HKC E;  5AQL B;  3VKH A;  3W15 B;  4HN9 A;  3Q5X A;  5HWX A;  3PU3 A;  5FYM A;  4L9I A;  2LRL A;  2W4X A;  5LBQ B;  3UQ4 A;  5ABH A;  2DHR A;  2BBJ A;  1YKH B;  4X1I E;  1KFY A;  3UFE A;  1KNZ A;  4I55 E;  1WYC A;  4BA9 A;  3DJB A;  1HG2 A;  4ZI3 D;  2CEA A;  2LSY A;  3JAE A;  1I94 T;  2HHH T;  5HEJ A;  2XZE A;  4PW8 A;  4G2A A;  1UK5 A;  3QK6 A;  1T7S A;  2LOS A;  3RIF A;  3ZCJ A;  4CI1 B;  2D5U A;  2I6H A;  2KXP B;  2XAQ B;  2BZB A;  4IDN A;  4U74 A;  2P9B A;  2B76 A;  2KWI B;  4WNK A;  4ZS2 A;  4PAG A;  5BMV E;  5AQK B;  5LHG B;  3I0O A;  3AE9 A;  4HWH A;  2X0H A;  4P1N A;  4UV9 B;  3ZYK A;  4DND A;  2CWO A;  3GN5 A;  4AKR B;  1ZV4 X;  2MBG A;  3UUL A;  4BJM A;  5CFB A;  3ZLI A;  3AVR A;  2YOE A;  3P4W A;  3AEC A;  2UUA T;  1XWM A;  2H89 A;  1KK7 A;  1WCR A;  2WB5 A;  3KIN B;  4GIW A;  4QH5 A;  4EIW A;  3Q5D A;  3BQL A;  4U72 A;  2XJ7 A;  4PJN A;  1D1A A;  2KT9 A;  2LLY A;  4EZH A;  2JQ9 A;  2V26 A;  3C51 A;  3QB5 K;  4O4I E;  4JI8 T;  2X9X A;  4DR4 T;  5L3E B;  2VAS A;  2DWG A;  2V6X A;  2YU2 A;  3M65 A;  3A7M A;  2YKS A;  4ZS3 A;  4ZZB A;  2NW8 A;  1FEW A;  4GYS A;  5HYA A;  4NXN T;  1HX1 B;  1M7K A;  3LG7 A;  5FXX A;  3J7Y q;  4B3M T;  4A5X A;  4DV2 T;  4PNI A;  5FVL A;  3ZMT B;  4E7Z A;  1YW0 A;  1WR0 A;  4UVA B;  3LFM A;  4QX7 B;  2V6Y A;  4XZC A;  4LF5 T;  5DAB A;  3AVS A;  1IJ5 A;  3PE0 A;  3UU5 A;  5FY7 A;  3RLF F;  3TLU A;  3NRY A;  2Y6X A;  5H6R B;  4CN6 A;  2PJQ A;  2JQQ A;  2JQH A;  1LVK A;  1W0A A;  4QX8 B;  5HAX A;  3UQ7 A;  2HPJ A;  3AAA B;  1QUU A;  2CLY C;  2CBJ A;  5IYZ E;  1NAF A;  5LG4 A;  4JI2 T;  5F3J A;  1XNR T;  5HXS A;  2V8S V;  2WZI A;  2C5K T;  5AQH B;  4LF6 T;  3H3A A;  5JR9 B;  1B7T A;  2NW9 A;  1T98 A;  2WY2 A;  4FJO A;  1FJG T;  4UEL A;  4LFB T;  1I6Z A;  2VL0 A;  4TNV A;  4PFO A;  2BG9 C;  5JDM A;  3GA8 A;  1W0B A;  5FNV E;  2BVL A;  3CQX C;  3FHN A;  4QH1 A;  3AXJ A;  4NPP A;  5ABF A;  2XAF B;  1YXR A;  2XQY A;  3FZK B;  5AQG B;  5AQQ B;  2L9Q A;  5F8P A;  4ADZ A;  3TLW A;  1QLB A;  4OYK A;  4YTP A;  4GOU A;  3NRX A;  4NXM T;  1HF8 A;  3CX6 B;  3ONL C;  4H9S E;  2WU2 A;  4O8S A;  2K24 A;  4PJL A;  2XQ8 A;  2CXL A;  4YXD A;  3EUH A;  4EYU A;  5M4Y A;  2ZM0 A;  2R6G F;  4HWC A;  4CN1 A;  4DR5 T;  4IDQ A;  4MAL A;  2ES0 A;  2X67 A;  3GMI A;  3SFE A;  2LSI A;  4F8H A;  2J47 A;  3ZSS A;  1YQ3 A;  3CPZ A;  2WDV A;  3N2G E;  3N2O A;  4I0U A;  4U31 A;  1NWM X;  2Y48 B;  4ISS A;  5FY0 A;  4PJJ A;  4ZI2 D;  5BR8 T;  4DV5 T;  5LYJ E;  3ETU A;  2M6I A;  4JI4 T;  4ZI3 C;  3AE7 A;  5LHH B;  3RYF E;  3KBT A;  4IRE A;  3RX6 A;  3T8O A;  3ZYL A;  4YHH T;  4EZ4 A;  4DR2 T;  3E22 E;  4HWI B;  5AQV B;  2WZH A;  4J2C A;  4ILB A;  3N2K E;  4WBN E;  2XQA A;  2QVA A;  3ZJ1 A;  5L3C B;  3O1I A;  4HFC A;  4UF0 B;  1KNP A;  2K3W A;  1IJ6 A;  1X9B A;  1S35 A;  4WBO A;  5FXW A;  3UU4 A;  4ILC A;  4EV6 A;  4U2Z A;  4QKN A;  5AFU L;  4UEM A;  3P4S A;  1W9R A;  3OYX A;  3HKD E;  2GK9 A;  4CN4 A;  1D1B A;  1YQ4 A;  2DI4 A;  2N1G A;  3IF8 B;  4QXH B;  2JRK A;  4HGA A;  4U7I A;  4WW0 A;  5AQJ B;  5HXC A;  3FZM B;  2VQE T;  5HCM A;  4UIG A;  3ZT7 A;  2VKJ A;  3ZN1 B;  5LB7 B;  4E7S A;  2XSA A;  1XZY A;  2WMO A;  4IHJ E;  4Z90 A;  4C90 A;  3AAI A;  2UXD T;  2ODU A;  3ONX A;  4AKL A;  3L3P A;  3CQG B;  5ABF B;  5KXJ A;  4XAX B;  5FL1 A;  3O9X A;  2Q9Q A;  3UUN A;  2BG9 A;  2WCA A;  2ACZ A;  2LRK A;  4GK0 E;  3MA9 A;  3HKE E;  3K3N A;  4EEB A;  4ZI2 C;  1MIW A;  2XAH B;  3CQC B;  3FBL A;  2QA7 A;  2CE7 A;  3P4Q A;  5JRE A;  1SHZ C;  4X5T A;  2FJE A;  2IIU A;  4B3R T;  1KNR A;  3ETV A;  3WAK A;  4JI3 T;  3EI0 A;  3VKG A;  5E0O A;  4LF7 T;  4G63 A;  3RYH E;  2YDQ A;  3UU6 A;  1MMN A;  1MIV A;  1SE7 A;  2EHO A;  2LE8 A;  3ZYM A;  2BS2 A;  3N9L A;  4O4L E;  4GK5 E;  2H3R A;  3B5M A;  5AQF B;  3EAB A;  2LSG A;  3IHR A;  3KV6 A;  3PUA A;  2CBI A;  3OKQ A;  2HN2 A;  2LOP A;  3SFD A;  3QNU A;  3C64 A;  3OBV E;  1OWA A;  1J5E T;  1KEY A;  2CRB A;  3KV5 A;  3PUG A;  2E2A A;  5JVD E;  3N9P A;  2CPT A;  1OED B;  3L39 A;  3UUM A;  3N9N A;  5JH7 E;  3FXE B;  1IZN B;  1UUS A;  2WM9 A;  3O1H A;  3M3Z B;  2MYS A;  4ZXL A;  2MTQ A;  3I9W A;  2CMR A;  2UXN B;  4ANJ A;  5KMG P;  3OPC A;  5GON E;  3UUX B;  4KHZ F;  5A1L A;  4DV6 T;  2XQ6 A;  3CVR A;  3EAM A;  2XQ3 A;  3FZF B;  1G8X A;  4P09 A;  3CK6 A;  2EHO C;  3D0T A;  3ZC0 A;  4DO0 A;  3PUY F;  1HFA A;  2BKP A;  4ILU A;  4IE4 A;  3LK2 B;  2MAW A;  3V5U A;  3T1Y T;  2NTY A;  1XMO T;  1HNX T;  5CJ5 A;  2FJD A;  4CXY A;  4DR6 T;  3CWZ B;  2LKG A;  3PUW F;  4Z8X A;  2E5L T;  2X66 A;  3EVY A;  2VKO A;  2WDR A;  3ZT6 A;  5IWA T;  4LFA T;  3N5L A;  3E08 A;  1UGO A;  3AA7 B;  4YTM A;  3ZT5 A;  4LMK A;  3AB3 B;  4KX6 A;  4LML A;  1AJ3 A;  2JMH A;  4AKI A;  5LOV E;  1EZ3 A;  2J1D G;  2OA5 A;  3MK7 C;  3QUJ A;  3FZH B;  3MKD A;  3RRW A;  4AIS A;  2OV9 A;  3F57 A;  3NBX X;  5LCY A;  4TWH A;  2VVN A;  2FBW A;  4H63 V;  1T72 A;  2PTF A;  4BJN A;  4M1P A;  4F6R C;  4IE5 A;  4DID B;  2D0U A;  2ODV A;  2M6B A;  2VB6 A;  2W62 A;  2FJB A;  1IAP A;  2W00 A;  4P0B A;  1D1C A;  2X51 A;  5JDL A;  1UCU A;  1KF6 A;  3EDV A; 
#chains in the Genus database with same CATH homology
 4JI0 T;  5LMU T;  4LFC T;  4KHP T;  4DR5 T;  4DR7 T;  4DV1 T;  4B3T T;  5BR8 T;  4DV5 T;  1HNZ T;  4JI4 T;  4LF9 T;  1N32 T;  4DR2 T;  4YHH T;  1IBK T;  1N33 T;  4YY3 T;  4DV4 T;  1J5E T;  4JI1 T;  4DR1 T;  4DR6 T;  4JV5 T;  4LFB T;  4AQY T;  4LF4 T;  4B3S T;  2UU9 T;  1XNQ T;  2VQE T;  4JI6 T;  2UUC T;  4DR3 T;  2UUB T;  2F4V T;  1I94 T;  4DV7 T;  2UXB T;  2HHH T;  4OX9 T;  4X64 T;  1IBM T;  4DV6 T;  4B3R T;  2UXD T;  1HR0 T;  4JI5 T;  4JI3 T;  4LF7 T;  1XMQ T;  1N34 T;  4DV0 T;  4DV3 T;  4LF8 T;  2UXC T;  1N36 T;  2UUA T;  3T1H T;  4GKK T;  4DUY T;  4JI8 T;  4JYA T;  4DR4 T;  4NXN T;  4B3M T;  2ZM6 T;  4DV2 T;  3T1Y T;  1XMO T;  4LF5 T;  2E5L T;  4LFA T;  5IWA T;  4JI7 T;  1HNX T;  4K0K T;  1HNW T;  1XNR T;  4JI2 T;  4X65 T;  4LF6 T;  4X66 T;  3OTO T;  1FJG T;  1IBL T;  5LMN T;  4GKJ T;  4X62 T;  2VQF T;  4NXM T;  4DUZ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...