4LF5T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf5T00
4DV3T 1N36T 4JI5T 4DR6T 4JV5T 1N33T 2UU9T 4DV5T 1FJGT 4DR5T 4DV7T 4B3RT 2VQET 4JI8T 4LF7T 3T1YT 4DUYT 4GKJT 4DR2T 4DV2T 4DR1T 3OTOT 1HR0T 4DR4T 4DR3T 4LF4T 1IBMT 1HNWT 4LFCT 4DV6T 1J5ET 1N34T 4DUZT 4LF8T 4LFAT 4B3TT 4JI4T 5BR8T 4JI7T 4X66T 1HNZT 4LF5T 2UXCT 2UXBT 1IBKT 4DV1T 4B3MT 5LMNT 2HHHT 4X65T 1HNXT 5LMUT 5IWAT 4DV4T 2F4VT 4JYAT 4X64T 2VQFT 4JI2T 4JI0T 2ZM6T 4B3ST 4LFBT 2E5LT 4K0KT 4NXMT 4YY3T 4KHPT 1XNRT 4GKKT 4DR7T 2UUAT 4YHHT 4NXNT 4X62T 1XMQT 4OX9T 1XMOT 4DV0T 2UUBT 1N32T 4JI6T 3T1HT 4LF9T 1XNQT 4JI3T 2UXDT 4JI1T 4AQYT 1IBLT 4LF6T 2UUCT 1I94T
chains in the Genus database with same CATH superfamily
3CKDA 2W66A 2FUPA 3BQLA 2VWAA 2UU9T 5LA6E 2VQET 3O1HA 1E7PA 4DR2T 3LK3B 2LSJA 2Q9QD 2LOPA 4ZZCA 3I1AA 5LG3A 3A7MA 4YTPA 5IUXA 4A56A 5AQUB 4UF0A 5CJ5A 5AQKB 2W2UA 1LVFA 3T8OA 2MOZA 3AE6A 3ZN1B 4PJNA 3M65A 2ACZA 1W0BA 4MFRA 4AIUA 2LM9A 2H88A 4NPPA 2E9XD 2LKGA 4QH1A 3AE3A 3P50A 4HN9A 3PE0A 4PJMA 2OV9A 3KDSE 4IE0A 2VKHA 2VL0A 2E9XA 2KT9A 3GWHA 2AE9A 5ADXL 3BQKA 5HEJA 1OEDC 4ISTA 4IDQA 4WBOA 1CHUA 2HPJA 1KNRA 3JC6D 5FP3A 2LOSA 3Q5EA 3CX6B 3J9X1 3JADA 1HTJF 5ETWA 2W62A 3RYHE 5L4HA 2D0UA 1XWMA 1G73A 3FBLA 4HFDA 4QH5A 3TLSA 2XZEA 3VRAA 4OYKA 1WLXA 2CPTA 2A72A 2PBIA 5AQPB 3WI3A 4KBMB 4ZHQE 2NTXA 3AAAB 3WAKA 3PUXF 2OA5A 2IC9A 3TLWA 3RC8A 2LJLA 1LVKA 1YKEB 3PJAJ 5FXWA 3UQ4A 1HG5A 5FXVA 2EHOB 4TWHA 3ZT5A 2M6BA 2W67A 1ZEEA 2LM2A 3EHZA 3L39A 5ABFA 4ERRA 4QXBB 3ABVA 3CWZB 2UXCT 1IBKT 2WDRA 3GN5A 3FBZA 5AQOB 3H3MA 4XZCA 4AKGA 2CLYB 5LOVE 4AXPA 1L0VA 3N9QA 1MMGA 3AE9A 4AKRB 3R6NA 1Z0PA 2QRXA 5CB4E 4PK5A 2YN6A 2P9BA 3AXJB 1KNZA 5LHGB 4KHPT 2PFVA 3TLVA 3BQIA 2LEHA 2C0SA 3E22E 3UU8A 1IAPA 4O2BE 2D5UA 3H3AA 3KBTA 1JNRA 2ZM2A 5IHYA 1KK7A 2KWIB 2VKDA 5HWYA 1OEDB 3RRCA 3T1YT 2Y48B 3PU8A 3ZMSB 2B76A 2XQ6A 3AE1A 4WNKA 5JDGA 4ASKA 3HL6A 4Z8XA 5L3DB 1HNWT 1MNDA 5FXZA 3F2EA 3PUYF 4HEAA 3RYIE 4JEHB 4O4LE 2UXXB 4HWDA 3OPCA 4HFCA 4I0UA 4MHCA 3LBXB 3ZC1A 3SOLA 1UUSA 2XM1A 4QXHB 5F8PA 2WWUA 1J1JA 3C50A 4Z91A 5FVKA 3EUHA 2BKPA 2K24A 3S4UA 3PUWF 3AEDA 4ZOLE 3NRYA 2KINB 1OXZA 5F3JA 4E7ZA 2N1GA 4YJ3E 4CN1A 2BBJA 3PU3A 2YDSA 4O4IE 2YKSA 4LMKA 3IF8B 2KSRA 3CQCB 3NVOA 5JTGA 3ZJ2A 5FKYA 3ONXA 3HR0A 2XJ7A 3MZKB 3ANWA 2XQYA 1HX1B 3OKQA 5LNKA 2E5VA 4J2CA 3ZKRA 2X0YA 5LGTB 2N2NA 2IAKA 5JDFA 2D9DA 5L3EB 3U78A 4HE8A 5JDMA 3AVRA 3SWHA 1BR0A 2VK9A 3EABA 2HPLA 3AE5A 3N2OA 1HX8A 1HFAA 2CA5A 2N9DA 2VKJA 1WYBA 5H6QB 2G0UA 1IBMT 2CXLA 4LFCT 2I6HA 2J1DG 3P4QA 2AXDS 1UX4A 1Z8UA 2WZIA 5HCJA 2L9QA 3PUVF 3ZCIA 3ETVA 2IC6A 4X1YE 3RPUA 4IGUA 4H9PC 4YJ2E 5HXEA 4F6RC 1U5PA 4G63A 3CK6A 4O4JE 5FYMA 2LRKA 5JR9A 1ZOYA 3PUSA 3DTOA 4ZI2C 2KLQA 2PJQA 4K0UA 4WW0A 5LGNB 3UUXB 4ILAA 2V1DB 3AEFA 1I6ZA 2DL1A 2GK9A 4DR7T 2X0HA 3N9OA 2HN1A 2XQ3A 1YKHB 4KHZF 3G06A 3RQUA 1Y01A 1FEWA 4CI3B 1J5WA 2ACXA 1N32T 4JI3T 4JBWF 3VR9A 2LSIA 1I94T 2W4XA 4H9RC 4IIJE 3RF1A 4AQGA 3ZYMA 4DV3T 3P4SA 3LFMA 2IUBA 1KF6A 2DLRA 2DWKA 4ZZBA 4B3RT 3PUQA 2MAWA 4QX8B 4DV2T 2CWOA 3CVRA 4ZXLA 4IHJE 4ZS3A 5L47A 4CXWA 1MNEA 1T7SA 1ZHCA 2JPFA 4UV9B 2JQHA 3KVAA 2C5JA 4UVAB 5LG4A 4I4TE 4X65T 1HCIA 4AISA 4JYAT 4IL4A 4CXXA 1VRBA 4U74A 4L0RA 3KV5A 3RX6A 4M1PA 3OYZA 2LE8A 2NTYA 1HF8A 4AKLA 3ZYLA 2XQ4A 3ZN0B 3FZLB 3QOFA 4NXMT 2W00A 2XAJB 1SHZC 2V6XA 3D0TA 3IEEA 1X79A 2CMRA 3VHLA 5IYZE 1XDPA 4IDZA 4QXCB 2XM2A 4CQIA 1LKXA 4A97A 1MMDA 1BR4A 2UXNB 5H6RB 2XTLA 2CE7A 4DBQA 5FL0A 3VKGA 1LRZA 3RQWA 4FI5A 2NW7A 3ZMZB 2BVLA 3NZPA 3AE7A 4BAYB 3CX7B 1XZYA 5EK4A 4DR4T 4UVBB 3AAEB 4DV6T 2M67A 2BKNA 4JI7T 1HNZT 4ZI3C 5JVDE 2CLYC 3LK42 1SUMB 2XSBA 5C2TA 4U31A 1KNPA 2KMFA 5LYJE 4X5TA 4HWHA 3PDYA 3JC6C 5F5WA 1XDOA 4PFPA 3ZMTB 1W0AA 4IE5A 3P4RA 1W9RA 1D1AA 3K8PC 4AQFC 2E5LT 3OJAA 3PJAA 4L9IA 5FY1A 3NKZA 4QHOA 5ABGA 4OX9T 4A98A 5JH7E 3PUAA 2XASB 1XNQT 2UXDT 2CXFA 5C8YE 4EEDA 3C4XA 5LGUB 4TWFA 4OYJA 5JDNA 2EHOD 2V26A 3AEBA 3DP7A 2YK0A 2X0LB 5AQIB 4IDPA 4EZHA 3V5UA 3ZMUB 1N36T 4JI5T 2LHNA 1UGOA 4O4HE 2EHOA 3ONLC 4YSYA 1WCRA 4HFHA 3N2GE 5JDLA 2VL8A 5L2LA 5AQNB 3Q5WA 4DR1T 5KMGP 4NUVA 3UFEA 1BR1A 5FNVE 5HWXA 1S35A 1J5ET 1HS7A 2BDEA 2ZM0A 3QK6A 2Q9QB 4LFAT 4HWCA 4ILUA 2XAGB 3NZQA 3AXJA 3ZSTA 3CX8B 3MXZA 4KI0F 1WFDA 4HFIA 4X64T 4AQFA 3AE4A 3B13A 4O8SA 1Y64B 3I0OA 3N9PA 2FJEA 2WU5A 4P09A 1M62A 3HI2A 2YOEA 2W63A 5FL1A 1D1BA 3OVUA 2XUEA 4ZS2A 3FZKB 1WYCA 2VURA 1OEDA 4GYSA 1FMWA 3V5SA 3UU4A 4UIGA 2WP9A 4GK5E 4ADZA 2IMLA 4TWDA 5KDMC 4JV5T 5HEUA 4Q25A 4GK0E 3O1IA 3NWIA 2CBJA 2J47A 4I43B 3LK2B 4ISSA 2IHR1 3MJXA 2ES0A 5FY0A 3UU5A 3LBXA 1R8IA 2LLYA 3MKDA 2WDQA 2Y8DA 3IHRA 3VU7H 2A9UA 4X66T 3FHNA 1ZKEA 5J2UE 2X9YA 5HXCA 2M6IA 4YXDA 5LMNT 4DNDA 5DJQC 4DO0A 5LMUT 2BG9B 4U3CA 5DQWA 1T98A 2XQ8A 3RKOA 1NAFA 1NEKA 3ZEFB 2ZLYA 4B6XA 5CA1E 4TUYE 2WMOA 4X20E 3ZSSA 3I9WA 2WQYA 1NENA 2BG9E 1XMQT 1NWMX 3L09A 4ILBA 4XBFB 2X66A 1KEYA 4JEUB 3AA6B 3ONJA 3CQGB 1IBLT 3FZMB 5L3FB 1MMAA 3N9NA 4ZI7E 1US7B 2XQ9A 3ZLIA 4DR6T 5LB7B 1BR2A 3EVYA 3RIUC 5JQGE 2YDQA 2JRKA 3ZJ1A 5HCMA 4Z90A 1QUUA 3R84B 1HR0T 3RYFE 4H63H 1YXRA 2QVAA 3N2KE 4LMJA 4HFEA 2H7VC 4LF5T 4HWIB 2VVSA 4DMWA 4B3MT 2WZHA 2KWHA 2KXPB 1HNXT 5HXRA 3O4XE 3LSVA 4EYYR 3LDQB 3L8RA 4HWFA 3UT5E 4IL9A 4HFBA 3ZT7A 5KXJA 5BMVE 1FMVA 3UUMA 2ZM6T 2ZM8A 4K0KT 5JDHA 3P4PA 3QNUA 5FVLA 3F57A 5HAXA 5CGMA 1D0XA 1E2AA 3UFGA 2V7MA 3J7Yq 4EGWA 3A8YC 5AQTB 1OWAA 5AQRB 2JMKA 2J4GA 3RH3A 4JI8T 4LF7T 2BS3A 2NW9A 1CUNA 3FXEB 3SS1A 3OTOT 1QLBA 4FJOA 1H7CA 2XAQB 2D0TA 4PJLA 4ANJA 3W15B 5LBMA 1D0ZA 2ODUA 3AAIA 5FXXA 4TV8E 3CPZA 5AQLB 4P0AA 4YT0A 2X67A 4IT4A 2XHEB 3UTKA 2QGSA 4KUMB 5L4EA 2VQFT 5TAOA 4ZI2D 4IE4A 1G8XA 4U2YA 2W0GA 2BBHA 3DJBA 4LFBT 4I55E 5ABEA 4YHHT 1MIYA 2BZBA 3HKEE 2XY8B 1VOMA 4L5GA 1T8BA 4CI2B 2LKHA 3FZHB 2UUCT 5AQHB 3E0ZA 5E0OA 3C64A 1EZ3A 3JAEA 2X9XA 3KV6A 4HTEA 3AEGA 1FJGT 2I0MA 4DIDB 4DUYT 5AQSB 3SFDA 3KBUA 4CN6A 1QSDA 5EK2A 2LT3A 2Q9QC 4WBNE 4LF4T 3K3NA 4LMLA 4UEMA 2V6YB 2CRBA 2I59A 4TV9E 2E8IA 4KP3C 5HEHA 3TLUA 4YSZA 3O1JA 2FBWA 4WYVA 2QYWA 5IWAT 3OBVE 4QWNB 3IBPA 2E9XC 4EZ4A 3NRXA 3Q9DA 3N9MA 2X68A 3B57A 4H9NC 3EAMA 5A1LA 5HEOA 3AE8A 3B5MA 1VCSA 2WY2A 4YFSA 4AI6A 1XNRT 1MMNA 2X9HA 3MA9A 3JCFA 3AE2A 4PNIA 2K5BB 4U72A 2WSSV 3ZPOA 1XMOT 3I0QA 4AKIA 3HA4A 4U7YA 2MBGA 4P0BA 3AVSA 4JUYA 3RGLA 3H37A 4UELA 2Q9QA 3PUZF 2LHRA 2A2FX 3SRZA 4O2AE 3K3OA 4DR5T 4IREA 4DV7T 3FXDB 3N9LA 4TZ4C 2WCAA 5LP6E 2VVNA 2NR4A 2L3LA 2YEVC 4YSXA 3KV9A 4EYUA 4YLHA 2YU2A 3EDVA 4X1IE 3VR8A 2JMHA 3AEEA 5AQFB 1UCUA 2PTFA 3PV0F 4B3TT 1U4QA 2VKOA 5BR8T 4ZI3D 2CWYA 3HKBE 5J1GA 2Y6XA 4EEBA 2UXBT 2BG9C 2XAFB 5EZYE 3TKLB 3BK9A 4H9OC 3AEAA 2F4VT 2MYSA 2H7OA 4UF0B 2R6GF 4CN4A 2C5IT 1GQEA 2JIWA 4YTMA 5LHIB 2Z6EA 3U3IA 1YW0A 3PTRB 4HGAA 4EXTA 4NIQA 5JRCA 3UU3A 4B3ST 2H89A 3K1SA 1WRDA 4GYRA 4UV8B 2UUAT 4NXNT 4X62T 5AQVB 2JQQA 4DV0T 4LF9T 5HYAA 4QKNA 3ZCJA 4AQYT 4LF6T 2E9XB 4X1KE 3IA3A 2YDRA 2YINA 3GA8A 2QA7A 4PAGA 4EOZB 4F8HA 5JREA 4CZZB 4XAXB 2A3DA 1N33T 4IDOA 2RP4A 2V8SV 2ODVA 1HG2A 2H3RA 1D1CA 5LBQB 2YU1A 2CEAA 2FJBA 5ABHA 1V9DA 3E08A 2XSAA 5JRCB 2BS4A 5AQJB 4I50E 4IE6A 1UK5A 2BG9A 4GIWA 1YD8G 2WDVA 2NWBA 2C5KT 4LF8T 2NP9A 2IIUA 3AA1B 4CXYA 1KFYA 2HN2A 2DWGA 3K3QC 2XPKA 3ESLA 4DV1T 4EIWA 3UUBA 2K48A 4BJNA 4AKHA 5GONE 5DABA 3EI0A 4MLKA 5ABFB 1SE7A 2XQAA 5CFBA 1E1HB 3GN5B 3Q5XA 3TLTA 4DMVA 4IE7A 3C98B 3ZC0A 4N78D 2MTQA 4U2ZA 2RA1A 2KZ7B 4PK4A 5HEGA 3RIFA 3O9XA 1WR6A 2D2SA 2V5CA 1OEDE 4WZXA 3ZYKA 3RYCE 3AB3B 5LHHB 3EDUA 1DU2A 3QUJA 2VB6A 4EAHA 4DR3T 4EB6E 3P4WA 3NBXX 4JI4T 2K9AA 4YHJA 2WBLA 5AFUL 4DBRA 4H63V 4E7SA 3C4ZA 2FJDA 3UULA 5JR9C 5M4YA 2BS2A 1D0YA 4G2AA 3ZT6A 3HKCE 5J0ZA 2HHHT 3RIAA 3QB5K 4BA9A 3RKGA 2CCQA 3C51A 5AQQB 4KMCA 3SFEA 5L3BB 2V7LA 3PUGA 3KINB 3CMLA 5AQGB 3RC3A 3PURA 1SA0E 2NOXA 5DQVA 1VCTA 4YY3T 5CA0E 2CXDA 3FZFB 4GKKT 2VASA 2X9WA 2MPKA 3ZMVB 5EK3A 2V7IA 4H9SE 3ETUA 2DHRA 4TN7B 5HXHA 4JI1T 1MIVA 3UUNA 1B7TA 2JQKA 3HKDE 3Q2MA 2XQ7A 1AJ3A 4UXNB 2LSGA 2SPCA 2WAUA 4KX6A 2LSYA 4JLEA 2CHOA 4DV5T 4TX5A 3X1DA 3WAJA 3QB5A 1IZNB 2IDOB 3ANWB 5FMNA 1O3XA 1YQ4A 4H9QC 1T72A 3RIUA 2OLTA 4EV6A 2XQ5A 3N5LA 2BKOA 1JNZA 5L3CB 4ILCA 4IDNA 4OK0A 4DUZT 3AA0B 3LG7A 2DI4A 2JQ9A 1FIOA 2CBIA 4U33A 4QH4A 1WR0A 2XAHB 3RLFF 5LCYA 4V1Av 3M3ZB 2WMNA 1IJ6A 2DCFA 3Q5DA 1W09A 3I9YA 2IW5B 2J62A 2BVMA 5L3GB 2V5DA 2WWVA 4MBQA 3L3PA 4U7IA 3KVBA 3F31A 2NW8A 4NUUA 2WB5A 4ZEYA 4JI0T 4PK6A 2PG8A 4TNVA 1UX5A 4PJJA 2DNXA 3GMIA 4DVDA 3LJCA 5LJNA 4P1NA 5HXSA 1IJ5A 4UR9A 3MACA 5J2TE 4C90A 2LSKA 2KNDA 5JR9B 1X9BA 2UUBT 4JI6T 3CIRA 3C4WA 2WM9A 2L8KA 2CHNA 1ZV4X 2WS3A 3P7IA 3VKHA 3AA7B 2V6YA 4A5XA 4MALA 1YQ3A 2W61A 4GKJT 3UQ7A 2X51A 3A5XA 3KFWX 1ZP0A 5FY7A 4TNWA 4C91A 3VRBA 3FB2A 4HKAA 4QX7B 1N34T 3RRWA 2K3WA 3MK7C 2E2AA 5JDQA 2FJAA 5AQMB 5LJMA 4GOUA 2V7JA 1UURA 3RI5A 4CI1B 5KX5E 3UU6A 4UVCB 4HFVA 2B1EA 4BJMA 4DV4T 2WU2A 3KV4A 3OYXA 3QC9A 4OHFA 2LRLA 1M7KA 4PW8A 2RPAA 4JI2T 3AECA 1MIWA 5LXTE 4OFZA 4PFOA 3CQXC 2CM0A 5C3JA 2JJ9A 4YTNA 3T1HT 2ZMAA 3RHWA 1S94A 2HH7A 4COFA 2EHOC 2V7KA 3P8CD 3JAFA
chains in the Genus database with same CATH topology
4DV3T 1N36T 4JI5T 4DR6T 4JV5T 1N33T 2UU9T 4DV5T 1FJGT 4DR5T 4DV7T 4B3RT 2VQET 4JI8T 4LF7T 3T1YT 4DUYT 4GKJT 4DR2T 4DV2T 4DR1T 3OTOT 1HR0T 4DR4T 4DR3T 4LF4T 1IBMT 1HNWT 4LFCT 4DV6T 1J5ET 1N34T 4DUZT 4LF8T 4LFAT 4B3TT 4JI4T 5BR8T 4JI7T 4X66T 1HNZT 4LF5T 2UXCT 2UXBT 1IBKT 4DV1T 4B3MT 5LMNT 2HHHT 4X65T 1HNXT 5LMUT 5IWAT 4DV4T 2F4VT 4JYAT 4X64T 2VQFT 4JI2T 4JI0T 2ZM6T 4B3ST 4LFBT 2E5LT 4K0KT 4NXMT 4YY3T 4KHPT 1XNRT 4GKKT 4DR7T 2UUAT 4YHHT 4NXNT 4X62T 1XMQT 4OX9T 1XMOT 4DV0T 2UUBT 1N32T 4JI6T 3T1HT 4LF9T 1XNQT 4JI3T 2UXDT 4JI1T 4AQYT 1IBLT 4LF6T 2UUCT 1I94T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 T;  1N36 T;  4JI5 T;  4DR6 T;  4JV5 T;  1N33 T;  2UU9 T;  4DV5 T;  1FJG T;  4DR5 T;  4DV7 T;  4B3R T;  2VQE T;  4JI8 T;  4LF7 T;  3T1Y T;  4DUY T;  4GKJ T;  4DR2 T;  4DV2 T;  4DR1 T;  3OTO T;  1HR0 T;  4DR4 T;  4DR3 T;  4LF4 T;  1IBM T;  1HNW T;  4LFC T;  4DV6 T;  1J5E T;  1N34 T;  4DUZ T;  4LF8 T;  4LFA T;  4B3T T;  4JI4 T;  5BR8 T;  4JI7 T;  4X66 T;  1HNZ T;  4LF5 T;  2UXC T;  2UXB T;  1IBK T;  4DV1 T;  4B3M T;  5LMN T;  2HHH T;  4X65 T;  1HNX T;  5LMU T;  5IWA T;  4DV4 T;  2F4V T;  4JYA T;  4X64 T;  2VQF T;  4JI2 T;  4JI0 T;  2ZM6 T;  4B3S T;  4LFB T;  2E5L T;  4K0K T;  4NXM T;  4YY3 T;  4KHP T;  1XNR T;  4GKK T;  4DR7 T;  2UUA T;  4YHH T;  4NXN T;  4X62 T;  1XMQ T;  4OX9 T;  1XMO T;  4DV0 T;  2UUB T;  1N32 T;  4JI6 T;  3T1H T;  4LF9 T;  1XNQ T;  4JI3 T;  2UXD T;  4JI1 T;  4AQY T;  1IBL T;  4LF6 T;  2UUC T;  1I94 T; 
#chains in the Genus database with same CATH topology
 3CKD A;  2W66 A;  2FUP A;  3BQL A;  2VWA A;  2UU9 T;  5LA6 E;  2VQE T;  3O1H A;  1E7P A;  4DR2 T;  3LK3 B;  2LSJ A;  2Q9Q D;  2LOP A;  4ZZC A;  3I1A A;  5LG3 A;  3A7M A;  4YTP A;  5IUX A;  4A56 A;  5AQU B;  4UF0 A;  5CJ5 A;  5AQK B;  2W2U A;  1LVF A;  3T8O A;  2MOZ A;  3AE6 A;  3ZN1 B;  4PJN A;  3M65 A;  2ACZ A;  1W0B A;  4MFR A;  4AIU A;  2LM9 A;  2H88 A;  4NPP A;  2E9X D;  2LKG A;  4QH1 A;  3AE3 A;  3P50 A;  4HN9 A;  3PE0 A;  4PJM A;  2OV9 A;  3KDS E;  4IE0 A;  2VKH A;  2VL0 A;  2E9X A;  2KT9 A;  3GWH A;  2AE9 A;  5ADX L;  3BQK A;  5HEJ A;  1OED C;  4IST A;  4IDQ A;  4WBO A;  1CHU A;  2HPJ A;  1KNR A;  3JC6 D;  5FP3 A;  2LOS A;  3Q5E A;  3CX6 B;  3J9X 1;  3JAD A;  1HTJ F;  5ETW A;  2W62 A;  3RYH E;  5L4H A;  2D0U A;  1XWM A;  1G73 A;  3FBL A;  4HFD A;  4QH5 A;  3TLS A;  2XZE A;  3VRA A;  4OYK A;  1WLX A;  2CPT A;  2A72 A;  2PBI A;  5AQP B;  3WI3 A;  4KBM B;  4ZHQ E;  2NTX A;  3AAA B;  3WAK A;  3PUX F;  2OA5 A;  2IC9 A;  3TLW A;  3RC8 A;  2LJL A;  1LVK A;  1YKE B;  3PJA J;  5FXW A;  3UQ4 A;  1HG5 A;  5FXV A;  2EHO B;  4TWH A;  3ZT5 A;  2M6B A;  2W67 A;  1ZEE A;  2LM2 A;  3EHZ A;  3L39 A;  5ABF A;  4ERR A;  4QXB B;  3ABV A;  3CWZ B;  2UXC T;  1IBK T;  2WDR A;  3GN5 A;  3FBZ A;  5AQO B;  3H3M A;  4XZC A;  4AKG A;  2CLY B;  5LOV E;  4AXP A;  1L0V A;  3N9Q A;  1MMG A;  3AE9 A;  4AKR B;  3R6N A;  1Z0P A;  2QRX A;  5CB4 E;  4PK5 A;  2YN6 A;  2P9B A;  3AXJ B;  1KNZ A;  5LHG B;  4KHP T;  2PFV A;  3TLV A;  3BQI A;  2LEH A;  2C0S A;  3E22 E;  3UU8 A;  1IAP A;  4O2B E;  2D5U A;  3H3A A;  3KBT A;  1JNR A;  2ZM2 A;  5IHY A;  1KK7 A;  2KWI B;  2VKD A;  5HWY A;  1OED B;  3RRC A;  3T1Y T;  2Y48 B;  3PU8 A;  3ZMS B;  2B76 A;  2XQ6 A;  3AE1 A;  4WNK A;  5JDG A;  4ASK A;  3HL6 A;  4Z8X A;  5L3D B;  1HNW T;  1MND A;  5FXZ A;  3F2E A;  3PUY F;  4HEA A;  3RYI E;  4JEH B;  4O4L E;  2UXX B;  4HWD A;  3OPC A;  4HFC A;  4I0U A;  4MHC A;  3LBX B;  3ZC1 A;  3SOL A;  1UUS A;  2XM1 A;  4QXH B;  5F8P A;  2WWU A;  1J1J A;  3C50 A;  4Z91 A;  5FVK A;  3EUH A;  2BKP A;  2K24 A;  3S4U A;  3PUW F;  3AED A;  4ZOL E;  3NRY A;  2KIN B;  1OXZ A;  5F3J A;  4E7Z A;  2N1G A;  4YJ3 E;  4CN1 A;  2BBJ A;  3PU3 A;  2YDS A;  4O4I E;  2YKS A;  4LMK A;  3IF8 B;  2KSR A;  3CQC B;  3NVO A;  5JTG A;  3ZJ2 A;  5FKY A;  3ONX A;  3HR0 A;  2XJ7 A;  3MZK B;  3ANW A;  2XQY A;  1HX1 B;  3OKQ A;  5LNK A;  2E5V A;  4J2C A;  3ZKR A;  2X0Y A;  5LGT B;  2N2N A;  2IAK A;  5JDF A;  2D9D A;  5L3E B;  3U78 A;  4HE8 A;  5JDM A;  3AVR A;  3SWH A;  1BR0 A;  2VK9 A;  3EAB A;  2HPL A;  3AE5 A;  3N2O A;  1HX8 A;  1HFA A;  2CA5 A;  2N9D A;  2VKJ A;  1WYB A;  5H6Q B;  2G0U A;  1IBM T;  2CXL A;  4LFC T;  2I6H A;  2J1D G;  3P4Q A;  2AXD S;  1UX4 A;  1Z8U A;  2WZI A;  5HCJ A;  2L9Q A;  3PUV F;  3ZCI A;  3ETV A;  2IC6 A;  4X1Y E;  3RPU A;  4IGU A;  4H9P C;  4YJ2 E;  5HXE A;  4F6R C;  1U5P A;  4G63 A;  3CK6 A;  4O4J E;  5FYM A;  2LRK A;  5JR9 A;  1ZOY A;  3PUS A;  3DTO A;  4ZI2 C;  2KLQ A;  2PJQ A;  4K0U A;  4WW0 A;  5LGN B;  3UUX B;  4ILA A;  2V1D B;  3AEF A;  1I6Z A;  2DL1 A;  2GK9 A;  4DR7 T;  2X0H A;  3N9O A;  2HN1 A;  2XQ3 A;  1YKH B;  4KHZ F;  3G06 A;  3RQU A;  1Y01 A;  1FEW A;  4CI3 B;  1J5W A;  2ACX A;  1N32 T;  4JI3 T;  4JBW F;  3VR9 A;  2LSI A;  1I94 T;  2W4X A;  4H9R C;  4IIJ E;  3RF1 A;  4AQG A;  3ZYM A;  4DV3 T;  3P4S A;  3LFM A;  2IUB A;  1KF6 A;  2DLR A;  2DWK A;  4ZZB A;  4B3R T;  3PUQ A;  2MAW A;  4QX8 B;  4DV2 T;  2CWO A;  3CVR A;  4ZXL A;  4IHJ E;  4ZS3 A;  5L47 A;  4CXW A;  1MNE A;  1T7S A;  1ZHC A;  2JPF A;  4UV9 B;  2JQH A;  3KVA A;  2C5J A;  4UVA B;  5LG4 A;  4I4T E;  4X65 T;  1HCI A;  4AIS A;  4JYA T;  4IL4 A;  4CXX A;  1VRB A;  4U74 A;  4L0R A;  3KV5 A;  3RX6 A;  4M1P A;  3OYZ A;  2LE8 A;  2NTY A;  1HF8 A;  4AKL A;  3ZYL A;  2XQ4 A;  3ZN0 B;  3FZL B;  3QOF A;  4NXM T;  2W00 A;  2XAJ B;  1SHZ C;  2V6X A;  3D0T A;  3IEE A;  1X79 A;  2CMR A;  3VHL A;  5IYZ E;  1XDP A;  4IDZ A;  4QXC B;  2XM2 A;  4CQI A;  1LKX A;  4A97 A;  1MMD A;  1BR4 A;  2UXN B;  5H6R B;  2XTL A;  2CE7 A;  4DBQ A;  5FL0 A;  3VKG A;  1LRZ A;  3RQW A;  4FI5 A;  2NW7 A;  3ZMZ B;  2BVL A;  3NZP A;  3AE7 A;  4BAY B;  3CX7 B;  1XZY A;  5EK4 A;  4DR4 T;  4UVB B;  3AAE B;  4DV6 T;  2M67 A;  2BKN A;  4JI7 T;  1HNZ T;  4ZI3 C;  5JVD E;  2CLY C;  3LK4 2;  1SUM B;  2XSB A;  5C2T A;  4U31 A;  1KNP A;  2KMF A;  5LYJ E;  4X5T A;  4HWH A;  3PDY A;  3JC6 C;  5F5W A;  1XDO A;  4PFP A;  3ZMT B;  1W0A A;  4IE5 A;  3P4R A;  1W9R A;  1D1A A;  3K8P C;  4AQF C;  2E5L T;  3OJA A;  3PJA A;  4L9I A;  5FY1 A;  3NKZ A;  4QHO A;  5ABG A;  4OX9 T;  4A98 A;  5JH7 E;  3PUA A;  2XAS B;  1XNQ T;  2UXD T;  2CXF A;  5C8Y E;  4EED A;  3C4X A;  5LGU B;  4TWF A;  4OYJ A;  5JDN A;  2EHO D;  2V26 A;  3AEB A;  3DP7 A;  2YK0 A;  2X0L B;  5AQI B;  4IDP A;  4EZH A;  3V5U A;  3ZMU B;  1N36 T;  4JI5 T;  2LHN A;  1UGO A;  4O4H E;  2EHO A;  3ONL C;  4YSY A;  1WCR A;  4HFH A;  3N2G E;  5JDL A;  2VL8 A;  5L2L A;  5AQN B;  3Q5W A;  4DR1 T;  5KMG P;  4NUV A;  3UFE A;  1BR1 A;  5FNV E;  5HWX A;  1S35 A;  1J5E T;  1HS7 A;  2BDE A;  2ZM0 A;  3QK6 A;  2Q9Q B;  4LFA T;  4HWC A;  4ILU A;  2XAG B;  3NZQ A;  3AXJ A;  3ZST A;  3CX8 B;  3MXZ A;  4KI0 F;  1WFD A;  4HFI A;  4X64 T;  4AQF A;  3AE4 A;  3B13 A;  4O8S A;  1Y64 B;  3I0O A;  3N9P A;  2FJE A;  2WU5 A;  4P09 A;  1M62 A;  3HI2 A;  2YOE A;  2W63 A;  5FL1 A;  1D1B A;  3OVU A;  2XUE A;  4ZS2 A;  3FZK B;  1WYC A;  2VUR A;  1OED A;  4GYS A;  1FMW A;  3V5S A;  3UU4 A;  4UIG A;  2WP9 A;  4GK5 E;  4ADZ A;  2IML A;  4TWD A;  5KDM C;  4JV5 T;  5HEU A;  4Q25 A;  4GK0 E;  3O1I A;  3NWI A;  2CBJ A;  2J47 A;  4I43 B;  3LK2 B;  4ISS A;  2IHR 1;  3MJX A;  2ES0 A;  5FY0 A;  3UU5 A;  3LBX A;  1R8I A;  2LLY A;  3MKD A;  2WDQ A;  2Y8D A;  3IHR A;  3VU7 H;  2A9U A;  4X66 T;  3FHN A;  1ZKE A;  5J2U E;  2X9Y A;  5HXC A;  2M6I A;  4YXD A;  5LMN T;  4DND A;  5DJQ C;  4DO0 A;  5LMU T;  2BG9 B;  4U3C A;  5DQW A;  1T98 A;  2XQ8 A;  3RKO A;  1NAF A;  1NEK A;  3ZEF B;  2ZLY A;  4B6X A;  5CA1 E;  4TUY E;  2WMO A;  4X20 E;  3ZSS A;  3I9W A;  2WQY A;  1NEN A;  2BG9 E;  1XMQ T;  1NWM X;  3L09 A;  4ILB A;  4XBF B;  2X66 A;  1KEY A;  4JEU B;  3AA6 B;  3ONJ A;  3CQG B;  1IBL T;  3FZM B;  5L3F B;  1MMA A;  3N9N A;  4ZI7 E;  1US7 B;  2XQ9 A;  3ZLI A;  4DR6 T;  5LB7 B;  1BR2 A;  3EVY A;  3RIU C;  5JQG E;  2YDQ A;  2JRK A;  3ZJ1 A;  5HCM A;  4Z90 A;  1QUU A;  3R84 B;  1HR0 T;  3RYF E;  4H63 H;  1YXR A;  2QVA A;  3N2K E;  4LMJ A;  4HFE A;  2H7V C;  4LF5 T;  4HWI B;  2VVS A;  4DMW A;  4B3M T;  2WZH A;  2KWH A;  2KXP B;  1HNX T;  5HXR A;  3O4X E;  3LSV A;  4EYY R;  3LDQ B;  3L8R A;  4HWF A;  3UT5 E;  4IL9 A;  4HFB A;  3ZT7 A;  5KXJ A;  5BMV E;  1FMV A;  3UUM A;  2ZM6 T;  2ZM8 A;  4K0K T;  5JDH A;  3P4P A;  3QNU A;  5FVL A;  3F57 A;  5HAX A;  5CGM A;  1D0X A;  1E2A A;  3UFG A;  2V7M A;  3J7Y q;  4EGW A;  3A8Y C;  5AQT B;  1OWA A;  5AQR B;  2JMK A;  2J4G A;  3RH3 A;  4JI8 T;  4LF7 T;  2BS3 A;  2NW9 A;  1CUN A;  3FXE B;  3SS1 A;  3OTO T;  1QLB A;  4FJO A;  1H7C A;  2XAQ B;  2D0T A;  4PJL A;  4ANJ A;  3W15 B;  5LBM A;  1D0Z A;  2ODU A;  3AAI A;  5FXX A;  4TV8 E;  3CPZ A;  5AQL B;  4P0A A;  4YT0 A;  2X67 A;  4IT4 A;  2XHE B;  3UTK A;  2QGS A;  4KUM B;  5L4E A;  2VQF T;  5TAO A;  4ZI2 D;  4IE4 A;  1G8X A;  4U2Y A;  2W0G A;  2BBH A;  3DJB A;  4LFB T;  4I55 E;  5ABE A;  4YHH T;  1MIY A;  2BZB A;  3HKE E;  2XY8 B;  1VOM A;  4L5G A;  1T8B A;  4CI2 B;  2LKH A;  3FZH B;  2UUC T;  5AQH B;  3E0Z A;  5E0O A;  3C64 A;  1EZ3 A;  3JAE A;  2X9X A;  3KV6 A;  4HTE A;  3AEG A;  1FJG T;  2I0M A;  4DID B;  4DUY T;  5AQS B;  3SFD A;  3KBU A;  4CN6 A;  1QSD A;  5EK2 A;  2LT3 A;  2Q9Q C;  4WBN E;  4LF4 T;  3K3N A;  4LML A;  4UEM A;  2V6Y B;  2CRB A;  2I59 A;  4TV9 E;  2E8I A;  4KP3 C;  5HEH A;  3TLU A;  4YSZ A;  3O1J A;  2FBW A;  4WYV A;  2QYW A;  5IWA T;  3OBV E;  4QWN B;  3IBP A;  2E9X C;  4EZ4 A;  3NRX A;  3Q9D A;  3N9M A;  2X68 A;  3B57 A;  4H9N C;  3EAM A;  5A1L A;  5HEO A;  3AE8 A;  3B5M A;  1VCS A;  2WY2 A;  4YFS A;  4AI6 A;  1XNR T;  1MMN A;  2X9H A;  3MA9 A;  3JCF A;  3AE2 A;  4PNI A;  2K5B B;  4U72 A;  2WSS V;  3ZPO A;  1XMO T;  3I0Q A;  4AKI A;  3HA4 A;  4U7Y A;  2MBG A;  4P0B A;  3AVS A;  4JUY A;  3RGL A;  3H37 A;  4UEL A;  2Q9Q A;  3PUZ F;  2LHR A;  2A2F X;  3SRZ A;  4O2A E;  3K3O A;  4DR5 T;  4IRE A;  4DV7 T;  3FXD B;  3N9L A;  4TZ4 C;  2WCA A;  5LP6 E;  2VVN A;  2NR4 A;  2L3L A;  2YEV C;  4YSX A;  3KV9 A;  4EYU A;  4YLH A;  2YU2 A;  3EDV A;  4X1I E;  3VR8 A;  2JMH A;  3AEE A;  5AQF B;  1UCU A;  2PTF A;  3PV0 F;  4B3T T;  1U4Q A;  2VKO A;  5BR8 T;  4ZI3 D;  2CWY A;  3HKB E;  5J1G A;  2Y6X A;  4EEB A;  2UXB T;  2BG9 C;  2XAF B;  5EZY E;  3TKL B;  3BK9 A;  4H9O C;  3AEA A;  2F4V T;  2MYS A;  2H7O A;  4UF0 B;  2R6G F;  4CN4 A;  2C5I T;  1GQE A;  2JIW A;  4YTM A;  5LHI B;  2Z6E A;  3U3I A;  1YW0 A;  3PTR B;  4HGA A;  4EXT A;  4NIQ A;  5JRC A;  3UU3 A;  4B3S T;  2H89 A;  3K1S A;  1WRD A;  4GYR A;  4UV8 B;  2UUA T;  4NXN T;  4X62 T;  5AQV B;  2JQQ A;  4DV0 T;  4LF9 T;  5HYA A;  4QKN A;  3ZCJ A;  4AQY T;  4LF6 T;  2E9X B;  4X1K E;  3IA3 A;  2YDR A;  2YIN A;  3GA8 A;  2QA7 A;  4PAG A;  4EOZ B;  4F8H A;  5JRE A;  4CZZ B;  4XAX B;  2A3D A;  1N33 T;  4IDO A;  2RP4 A;  2V8S V;  2ODV A;  1HG2 A;  2H3R A;  1D1C A;  5LBQ B;  2YU1 A;  2CEA A;  2FJB A;  5ABH A;  1V9D A;  3E08 A;  2XSA A;  5JRC B;  2BS4 A;  5AQJ B;  4I50 E;  4IE6 A;  1UK5 A;  2BG9 A;  4GIW A;  1YD8 G;  2WDV A;  2NWB A;  2C5K T;  4LF8 T;  2NP9 A;  2IIU A;  3AA1 B;  4CXY A;  1KFY A;  2HN2 A;  2DWG A;  3K3Q C;  2XPK A;  3ESL A;  4DV1 T;  4EIW A;  3UUB A;  2K48 A;  4BJN A;  4AKH A;  5GON E;  5DAB A;  3EI0 A;  4MLK A;  5ABF B;  1SE7 A;  2XQA A;  5CFB A;  1E1H B;  3GN5 B;  3Q5X A;  3TLT A;  4DMV A;  4IE7 A;  3C98 B;  3ZC0 A;  4N78 D;  2MTQ A;  4U2Z A;  2RA1 A;  2KZ7 B;  4PK4 A;  5HEG A;  3RIF A;  3O9X A;  1WR6 A;  2D2S A;  2V5C A;  1OED E;  4WZX A;  3ZYK A;  3RYC E;  3AB3 B;  5LHH B;  3EDU A;  1DU2 A;  3QUJ A;  2VB6 A;  4EAH A;  4DR3 T;  4EB6 E;  3P4W A;  3NBX X;  4JI4 T;  2K9A A;  4YHJ A;  2WBL A;  5AFU L;  4DBR A;  4H63 V;  4E7S A;  3C4Z A;  2FJD A;  3UUL A;  5JR9 C;  5M4Y A;  2BS2 A;  1D0Y A;  4G2A A;  3ZT6 A;  3HKC E;  5J0Z A;  2HHH T;  3RIA A;  3QB5 K;  4BA9 A;  3RKG A;  2CCQ A;  3C51 A;  5AQQ B;  4KMC A;  3SFE A;  5L3B B;  2V7L A;  3PUG A;  3KIN B;  3CML A;  5AQG B;  3RC3 A;  3PUR A;  1SA0 E;  2NOX A;  5DQV A;  1VCT A;  4YY3 T;  5CA0 E;  2CXD A;  3FZF B;  4GKK T;  2VAS A;  2X9W A;  2MPK A;  3ZMV B;  5EK3 A;  2V7I A;  4H9S E;  3ETU A;  2DHR A;  4TN7 B;  5HXH A;  4JI1 T;  1MIV A;  3UUN A;  1B7T A;  2JQK A;  3HKD E;  3Q2M A;  2XQ7 A;  1AJ3 A;  4UXN B;  2LSG A;  2SPC A;  2WAU A;  4KX6 A;  2LSY A;  4JLE A;  2CHO A;  4DV5 T;  4TX5 A;  3X1D A;  3WAJ A;  3QB5 A;  1IZN B;  2IDO B;  3ANW B;  5FMN A;  1O3X A;  1YQ4 A;  4H9Q C;  1T72 A;  3RIU A;  2OLT A;  4EV6 A;  2XQ5 A;  3N5L A;  2BKO A;  1JNZ A;  5L3C B;  4ILC A;  4IDN A;  4OK0 A;  4DUZ T;  3AA0 B;  3LG7 A;  2DI4 A;  2JQ9 A;  1FIO A;  2CBI A;  4U33 A;  4QH4 A;  1WR0 A;  2XAH B;  3RLF F;  5LCY A;  4V1A v;  3M3Z B;  2WMN A;  1IJ6 A;  2DCF A;  3Q5D A;  1W09 A;  3I9Y A;  2IW5 B;  2J62 A;  2BVM A;  5L3G B;  2V5D A;  2WWV A;  4MBQ A;  3L3P A;  4U7I A;  3KVB A;  3F31 A;  2NW8 A;  4NUU A;  2WB5 A;  4ZEY A;  4JI0 T;  4PK6 A;  2PG8 A;  4TNV A;  1UX5 A;  4PJJ A;  2DNX A;  3GMI A;  4DVD A;  3LJC A;  5LJN A;  4P1N A;  5HXS A;  1IJ5 A;  4UR9 A;  3MAC A;  5J2T E;  4C90 A;  2LSK A;  2KND A;  5JR9 B;  1X9B A;  2UUB T;  4JI6 T;  3CIR A;  3C4W A;  2WM9 A;  2L8K A;  2CHN A;  1ZV4 X;  2WS3 A;  3P7I A;  3VKH A;  3AA7 B;  2V6Y A;  4A5X A;  4MAL A;  1YQ3 A;  2W61 A;  4GKJ T;  3UQ7 A;  2X51 A;  3A5X A;  3KFW X;  1ZP0 A;  5FY7 A;  4TNW A;  4C91 A;  3VRB A;  3FB2 A;  4HKA A;  4QX7 B;  1N34 T;  3RRW A;  2K3W A;  3MK7 C;  2E2A A;  5JDQ A;  2FJA A;  5AQM B;  5LJM A;  4GOU A;  2V7J A;  1UUR A;  3RI5 A;  4CI1 B;  5KX5 E;  3UU6 A;  4UVC B;  4HFV A;  2B1E A;  4BJM A;  4DV4 T;  2WU2 A;  3KV4 A;  3OYX A;  3QC9 A;  4OHF A;  2LRL A;  1M7K A;  4PW8 A;  2RPA A;  4JI2 T;  3AEC A;  1MIW A;  5LXT E;  4OFZ A;  4PFO A;  3CQX C;  2CM0 A;  5C3J A;  2JJ9 A;  4YTN A;  3T1H T;  2ZMA A;  3RHW A;  1S94 A;  2HH7 A;  4COF A;  2EHO C;  2V7K A;  3P8C D;  3JAF A; 
#chains in the Genus database with same CATH homology
 4DV3 T;  1N36 T;  4JI5 T;  4DR6 T;  4JV5 T;  1N33 T;  2UU9 T;  4DV5 T;  1FJG T;  4DR5 T;  4DV7 T;  4B3R T;  2VQE T;  4JI8 T;  4LF7 T;  3T1Y T;  4DUY T;  4GKJ T;  4DR2 T;  4DV2 T;  4DR1 T;  3OTO T;  1HR0 T;  4DR4 T;  4DR3 T;  4LF4 T;  1IBM T;  1HNW T;  4LFC T;  4DV6 T;  1J5E T;  1N34 T;  4DUZ T;  4LF8 T;  4LFA T;  4B3T T;  4JI4 T;  5BR8 T;  4JI7 T;  4X66 T;  1HNZ T;  4LF5 T;  2UXC T;  2UXB T;  1IBK T;  4DV1 T;  4B3M T;  5LMN T;  2HHH T;  4X65 T;  1HNX T;  5LMU T;  5IWA T;  4DV4 T;  2F4V T;  4JYA T;  4X64 T;  2VQF T;  4JI2 T;  4JI0 T;  2ZM6 T;  4B3S T;  4LFB T;  2E5L T;  4K0K T;  4NXM T;  4YY3 T;  4KHP T;  1XNR T;  4GKK T;  4DR7 T;  2UUA T;  4YHH T;  4NXN T;  4X62 T;  1XMQ T;  4OX9 T;  1XMO T;  4DV0 T;  2UUB T;  1N32 T;  4JI6 T;  3T1H T;  4LF9 T;  1XNQ T;  4JI3 T;  2UXD T;  4JI1 T;  4AQY T;  1IBL T;  4LF6 T;  2UUC T;  1I94 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...