3J9X1

A virus that infects a hyperthermophile encapsidates a-form dna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
128
structure length
128
Chain Sequence
b'SRSYSQRYAKWQAKFNAFSNPTVASTILSNVSPVAQQNFQTNVPKFTSVNENVSAVLTQYGITGPNRAIYQGFGLKVARALNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNIITGSPTGYVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein
publication title A virus that infects a hyperthermophile encapsidates A-form DNA.
pubmed doi rcsb
molecule tags Virus
total genus 50
structure length 128
sequence length 128
chains with identical sequence 2, 3, 4, 5, 6, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x, y, z
ec nomenclature
pdb deposition date 2015-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF12193 Sulf_coat_C Sulfolobus virus coat protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3j9x101
3F2EA 3J9X1 3FBLA 3FBZA
chains in the Genus database with same CATH superfamily
5L3CB 2KLQA 3GA8A 2WBLA 3PU8A 1SHZC 4KBMB 4O8SA 2W4XA 3ZSTA 4BJNA 1FMVA 1KEYA 5F8PA 3NBXX 2WMOA 2BG9A 3RH3A 4DMWA 2E5LT 4XZCA 3NKZA 4NXNT 3RPUA 2JMKA 3UU6A 3A7MA 5L4EA 1HG2A 2UU9T 3L09A 2BVMA 2I6HA 3ETVA 2KINB 3FHNA 3RKGA 4M1PA 5TAOA 4O4JE 4YTPA 4ZOLE 5JQGE 1DU2A 3ZMVB 3IEEA 2LSKA 1YQ4A 5EK2A 2CHNA 5EK4A 5FKYA 2K48A 2V8SV 3RHWA 5H6RB 3PUSA 1T7SA 2D5UA 2YINA 4HFEA 5JTGA 5LG3A 2BDEA 1N33T 3QB5K 2YU2A 1VCTA 2LM9A 2NW7A 1MIWA 4U31A 2K24A 3D0TA 2ZM2A 5HEOA 5FMNA 1SUMB 3L8RA 2R6GF 2LHRA 5HCJA 4KI0F 2V7KA 4ILBA 4U2ZA 5FL1A 2BKNA 4EIWA 4X1YE 3J7Yq 3LBXB 3ZYLA 2BKPA 4COFA 4A98A 5FXZA 4TN7B 1M62A 5C8YE 1XMOT 3PUYF 2BG9E 3F31A 3RC8A 3SWHA 2E9XC 5J2TE 4HFDA 2X0YA 2CEAA 2LSJA 1E7PA 3KV6A 4AQGA 4PNIA 5F3JA 2FUPA 5LJNA 2LKGA 4HFBA 2X66A 3AEAA 3JC6C 5FL0A 2WCAA 3P50A 3E08A 2XASB 3OPCA 4HEAA 4ISTA 4KX6A 3M65A 1I6ZA 4NXMT 3I9WA 3PURA 4JI3T 4GYRA 4FI5A 2ACZA 4LF8T 4A56A 3TLWA 2JQHA 3SFEA 4JEUB 4YTMA 2YOEA 3ZT7A 3CKDA 2AE9A 2YK0A 2ZM0A 2W00A 5HXEA 3NVOA 4OK0A 3RIFA 4CN6A 2XQYA 2UXCT 2VL0A 5LP6E 4NUVA 3FXDB 2IW5B 1U5PA 3AA0B 3JCFA 3KFWX 1D0YA 3RGLA 5FVKA 2XY8B 2W63A 1KK7A 1FEWA 3O1IA 4ZI3C 4DMVA 5LMUT 3RLFF 4WZXA 3KV9A 2XPKA 4AQYT 4PW8A 3Q2MA 1FJGT 2CCQA 2XM2A 5AQIB 3PDYA 3RI5A 4HFCA 4TWFA 3PUXF 4IE6A 2VKDA 2XAFB 2WDVA 3ONLC 5HXCA 4HFHA 5HYAA 4NPPA 2ODVA 2M6BA 1OEDB 3ZN0B 1YW0A 3Q5WA 4DIDB 3FBLA 2CA5A 4LMKA 2N1GA 3UTKA 1CUNA 3AE7A 2Y6XA 4H9PC 2WZHA 2ES0A 4QH4A 2CHOA 3VKHA 1Y64B 4DUZT 4CN1A 4EXTA 2X9HA 3AEGA 3FZLB 4WYVA 2X9XA 2DI4A 4NIQA 2X9YA 1OEDC 5HAXA 3FZFB 2WDRA 3MACA 2Y8DA 3P4PA 3VR8A 3N9OA 4X66T 2VQFT 1HX1B 2D9DA 2WP9A 3ANWB 2YDQA 2H7VC 5LGNB 3FZMB 2UXDT 2K3WA 4CQIA 3B13A 1EZ3A 4ZS3A 4ZS2A 5LNKA 3AA6B 2VK9A 3C4XA 4JI0T 2CWOA 3B5MA 1FIOA 3KINB 3U3IA 3M3ZB 2K9AA 2LJLA 4TNVA 1V9DA 4DR4T 3Q5DA 3NZPA 3VRBA 3DTOA 5ETWA 2NP9A 1L0VA 5FP3A 4ZZCA 2UXXB 3T8OA 3AXJA 1KNZA 2ACXA 4JI6T 3DP7A 3PU3A 2H89A 3KV4A 4YXDA 4IDQA 3LJCA 2X9WA 3UUBA 1NEKA 3W15B 4PK5A 4CXYA 4I50E 4UVCB 1HNZT 2LRKA 4IE4A 1UURA 4X5TA 3UFGA 4UVBB 4DV4T 3KBTA 1G73A 2P9BA 2FBWA 4PJJA 2YDSA 1KNRA 4L0RA 5FYMA 2JQQA 2FJBA 1B7TA 3UQ7A 3HKBE 4AQFC 1D0XA 4DR5T 2XQ4A 3HL6A 1CHUA 2UXBT 3LSVA 3ZKRA 3PJAJ 5LBMA 2LKHA 2YKSA 2IHR1 1ZV4X 1IBLT 4H63H 4JUYA 2PTFA 1BR4A 2CBJA 1XNRT 1SA0E 4GKKT 3UUNA 3SFDA 5L3GB 3OYZA 4E7SA 3VR9A 2XSBA 5ABEA 1BR2A 2WB5A 2CRBA 2NR4A 2ZM6T 2IDOB 4UR9A 1HFAA 5LGTB 1FMWA 2QRXA 3MXZA 5JR9C 3N9LA 1UX5A 4ZXLA 5AQHB 1YQ3A 1HR0T 4JI2T 2BZBA 2XAGB 1XZYA 4KHPT 4DV6T 4B3TT 4IDOA 2K5BB 2E9XA 2KNDA 4IE7A 1ZHCA 3BQIA 2Q9QD 3HA4A 5LJMA 5AQPB 4YSYA 1N34T 2LSYA 3LBXA 3KV5A 4UXNB 4UF0B 3OTOT 3I0QA 3IA3A 5AQSB 4P09A 4QKNA 1S94A 3WAJA 3GMIA 3U78A 2E8IA 4TZ4C 4QX7B 1IBKT 2RP4A 3PTRB 3KVBA 3ZC0A 3TLVA 3P4RA 3N9PA 4B3ST 3TLSA 4EV6A 2E9XD 3C50A 2ODUA 4YY3T 4CZZB 3Q5XA 2WAUA 1E2AA 3GN5A 2WDQA 1BR1A 4O2BE 2NTXA 5FVLA 2HPJA 2YU1A 3ZJ1A 3CX6B 4K0UA 2V6YB 4F6RC 2XJ7A 3ONJA 2LOSA 2VWAA 3LK2B 2LOPA 2LT3A 2WU2A 2EHOB 2JJ9A 2V5CA 4AKHA 4HWCA 4JI4T 4C91A 2VB6A 3N5LA 3EAMA 5LXTE 3K8PC 3RYFE 3AVRA 5JDGA 4X65T 2WY2A 3PUAA 3EI0A 3CIRA 4HE8A 3K3NA 1GQEA 4L9IA 5AFUL 3CK6A 4U7IA 4YSXA 2N2NA 2CLYB 5J0ZA 2D0TA 3LK3B 2KZ7B 2XQ7A 4UELA 3LK42 4HWHA 4QH5A 2BBJA 5E0OA 4DBRA 4ILCA 1W09A 3BQKA 2QA7A 2GK9A 4HN9A 2IIUA 2CPTA 4U2YA 4DV7T 2DL1A 5JVDE 2W2UA 3AE1A 2KWHA 5ABFA 3AAEB 5FXVA 4LFAT 4UEMA 1X9BA 3B57A 3UT5E 2KT9A 2I59A 2MAWA 3VKGA 5L47A 4XBFB 2MYSA 4KP3C 5JDHA 4TX5A 3K1SA 3PUGA 1OEDA 4DR3T 1MIYA 5J1GA 4TV9E 4B3MT 2VKHA 1KF6A 4OYJA 1UGOA 1XDOA 2UUAT 4AKGA 4O4IE 4O4HE 4EEBA 2I0MA 2LE8A 4IREA 3UULA 3PUZF 2CWYA 4EZ4A 3E0ZA 2W66A 4AXPA 2HN2A 5F5WA 3OVUA 1YD8G 2WWUA 2BG9B 3VU7H 1W0AA 2JQ9A 5L3EB 2Y48B 3AE6A 3ANWA 5JDFA 2QYWA 2LEHA 5HXHA 1IJ5A 2M67A 5L3BB 3NRYA 3PUVF 4JBWF 1IBMT 3AEDA 2L8KA 3NZQA 4JYAT 5JH7E 5IYZE 2BS2A 4U74A 4IDZA 3PV0F 4B6XA 4PFPA 3TLUA 4Z91A 1MNDA 2IC6A 3HKCE 4HFVA 5CFBA 4CI1B 5LBQB 5AQTB 2KSRA 3K3OA 3OBVE 3N2GE 1D1CA 3SS1A 4IL4A 4CI2B 4WBNE 4ZEYA 1N36T 4I0UA 4OFZA 1QSDA 2XHEB 2LLYA 4H9SE 2X67A 2XQ6A 2D0UA 4AQFA 5LHGB 3UQ4A 2NW8A 3RRWA 5IWAT 4GK0E 5FY7A 2DLRA 3RYIE 4PJNA 3PUWF 3RC3A 5JDMA 2OA5A 5HEHA 2FJAA 5L4HA 3V5SA 5FY1A 3L3PA 4P0BA 5ADXL 3RQUA 2OV9A 1JNZA 1IZNB 3RIUC 3P4SA 4ZZBA 4YFSA 3C64A 4EYYR 3AE9A 5JR9A 2C5IT 3FZHB 2WQYA 5HEUA 1WFDA 1OWAA 5JRCB 5LGUB 4O2AE 4KUMB 3AEEA 2W0GA 5AQUB 4GYSA 2IUBA 2CM0A 3EUHA 5HXSA 2XAJB 5LHHB 4CXXA 4U72A 3P4WA 3CX7B 2V7LA 3CWZB 2PBIA 3SRZA 5L2LA 4X62T 5AQQB 4HTEA 5DJQC 5BMVE 3O1JA 3L39A 3JAFA 1O3XA 4OHFA 4OX9T 2XAQB 2VKOA 5LA6E 4MHCA 4LFBT 3ZPOA 2V26A 5DQWA 4U3CA 1I94T 1Z0PA 4DR1T 3UU5A 5AQFB 2L3LA 4IDPA 4CI3B 2VL8A 2DCFA 1MMGA 2Z6EA 4HFIA 5LCYA 4ZI2D 3ZMTB 3ABVA 5L3DB 2C5KT 4PJLA 1H7CA 2HN1A 4Q25A 2J47A 2A3DA 2WZIA 2BS4A 1YKHB 3UUMA 3UU8A 1D0ZA 1QUUA 3OYXA 4PAGA 2AXDS 3T1HT 3ZMUB 4DR2T 2J4GA 2XQ3A 3FB2A 3EDVA 3ZC1A 2VURA 3RYCE 3E22E 4XAXB 4MLKA 3N9MA 5HCMA 4TWDA 2RA1A 4ZHQE 2CE7A 5ABHA 4UV8B 1G8XA 4BAYB 2VVNA 3O1HA 1UX4A 2A9UA 3RRCA 4DR6T 2M6IA 4GOUA 4ILUA 5AQOB 2XUEA 1T8BA 3ZYKA 1HNWT 1R8IA 5HWYA 5JREA 4JI7T 5ABGA 2V7IA 4IHJE 2NTYA 3LG7A 2UXNB 3ETUA 4YLHA 4PK6A 1HF8A 4X1KE 2MTQA 3QUJA 2CXFA 4YT0A 4I55E 2W62A 4LF5T 2WU5A 3P7IA 2OLTA 2IAKA 1D1AA 1LRZA 4H9NC 1UCUA 3OJAA 1LKXA 4JLEA 5HXRA 3ZJ2A 4HWIB 3HI2A 3UFEA 5IHYA 4QXCB 2X68A 3BQLA 3AE5A 4DNDA 5AQKB 4AKIA 2CXDA 1LVFA 3ONXA 2DHRA 3AE2A 2LRLA 4MFRA 4MBQA 5FNVE 3IHRA 3NRXA 4OYKA 4EOZB 2J62A 5JDNA 4TUYE 5DQVA 4YHJA 3JC6D 5A1LA 2BBHA 3SOLA 2BKOA 2HH7A 3UUXB 2ZMAA 1VOMA 4LF9T 2XAHB 4LMLA 3C98B 1HCIA 2UUCT 2X51A 5BR8T 4EEDA 5KXJA 3HKEE 5CB4E 3VRAA 5CA0E 3VHLA 5CGMA 4Z8XA 4EGWA 2RPAA 4BA9A 3CQXC 5AQJB 4H9RC 1AJ3A 3A5XA 4X1IE 3AEBA 2EHOC 1JNRA 1WR0A 3HKDE 4YJ2E 1SE7A 5FY0A 2D2SA 2VVSA 3ZCJA 3ZT6A 1IJ6A 3MKDA 2KWIB 2PG8A 4LFCT 2Q9QB 1W0BA 4DO0A 4ZI3D 3EDUA 4DBQA 4A5XA 1N32T 2DNXA 4YSZA 2JQKA 2V5DA 4AIUA 5CA1E 2DWKA 2CLYC 1J5ET 1E1HB 3ZCIA 2V6XA 2E5VA 4AISA 2Q9QC 3EVYA 4Z90A 1ZP0A 2E9XB 3RIUA 4F8HA 4IE0A 4ADZA 1T72A 4N78D 2H3RA 3NWIA 3AAIA 3N2OA 3AAAB 5KMGP 4H9QC 3QK6A 2LM2A 3S4UA 2NW9A 4V1Av 2W67A 3H3AA 3IBPA 3V5UA 4JV5T 1MNEA 4DV5T 2YEVC 4IE5A 5AQVB 1WCRA 1J1JA 4PFOA 2HPLA 5LG4A 4LF4T 3GN5B 1NENA 2BS3A 2LHNA 5AQGB 2MOZA 2SPCA 5JRCA 3I1AA 3RX6A 4WW0A 4TWHA 2A2FX 4O4LE 2XTLA 2KXPB 3J9X1 1W9RA 4IGUA 5GONE 4CXWA 2F4VT 4IL9A 4YJ3E 3ZYMA 4DV1T 3BK9A 4GKJT 1WR6A 4ASKA 2N9DA 5KX5E 3JADA 1YXRA 3DJBA 3I0OA 3RQWA 4B3RT 5L3FB 1M7KA 1Z8UA 2BG9C 4H9OC 3F2EA 5AQLB 1HS7A 2YN6A 3X1DA 4HWFA 2C0SA 3UU4A 4AKRB 5C2TA 3TKLB 3FZKB 5JDQA 5C3JA 2X0LB 5JDLA 3AA1B 1X79A 2V7JA 1OEDE 4X64T 4WNKA 3AVSA 2IC9A 5EK3A 5AQMB 4EB6E 2E2AA 4QXBB 1ZKEA 3JAEA 4JEHB 3PE0A 2V1DB 2YDRA 4J2CA 2BVLA 3KVAA 1J5WA 3AA7B 3P8CD 2VQET 2ZM8A 2XQ5A 4DR7T 4IT4A 3AE4A 2PJQA 5ABFB 4U7YA 2B76A 4WBOA 1NAFA 2CMRA 2HHHT 3KDSE 4JI8T 3ZSSA 3CQGB 2L9QA 5DABA 5CJ5A 3N9QA 3AB3B 3PUQA 3RKOA 2G0UA 5HWXA 2NWBA 4LF7T 1MIVA 4KMCA 4I43B 3ZMZB 1WRDA 3MK7C 4KHZF 3AECA 5KDMC 2LSIA 4C90A 5AQRB 1US7B 2B1EA 4QH1A 2QVAA 4EYUA 2WS3A 3FBZA 1WYCA 3IF8B 4QXHB 4DUYT 4EAHA 1U4QA 4AI6A 3MZKB 4DV3T 4QWNB 5LB7B 3MJXA 4HWDA 3QNUA 4GK5E 5FXXA 2QGSA 2WM9A 2WWVA 2JPFA 5H6QB 1HG5A 3O4XE 5LHIB 4HGAA 4TV8E 3AEFA 1YKEB 3TLTA 1NWMX 3AE8A 4P1NA 4EZHA 3QOFA 3R6NA 2C5JA 4UF0A 1XWMA 3N2KE 3FXEB 5HEGA 3P4QA 4L5GA 3Q9DA 2A72A 3CMLA 2WSSV 3QC9A 4U33A 1ZOYA 1OXZA 2KMFA 4QHOA 2XQ8A 4MALA 3ZT5A 5J2UE 3CVRA 1HNXT 4UV9B 1KFYA 2MPKA 1VRBA 3C4WA 3EHZA 1S35A 4ISSA 3RIAA 1MMDA 3RF1A 5LOVE 3N9NA 3G06A 2VKJA 3HR0A 2V6YA 1T98A 1UK5A 3O9XA 1HTJF 4HKAA 4H63V 4DVDA 1UUSA 4PK4A 3MA9A 2MBGA 3CQCB 3GWHA 4K0KT 3WAKA 3ESLA 2EHOA 3OKQA 4JI5T 4IDNA 1XMQT 2X0HA 3CPZA 4G63A 3Q5EA 2XSAA 3LFMA 4AKLA 5EZYE 3H3MA 1D1BA 3H37A 4I4TE 3I9YA 3KBUA 3PJAA 4A97A 4DV2T 3K3QC 4G2AA 5JR9B 4P0AA 2XQ9A 1Y01A 4PJMA 2WMNA 3ZLIA 2UUBT 4TNWA 5AQNB 2EHOD 2JIWA 3T1YT 3C51A 2FJDA 4FJOA 1KNPA 1XNQT 5M4YA 4NUUA 4CN4A 1WYBA 2VASA 5IUXA 1XDPA 2Q9QA 2H88A 2XZEA 3ZMSB 4BJMA 4UVAB 3LDQB 3UU3A 4ANJA 1BR0A 2FJEA 2V7MA 1MMAA 3RYHE 4YHHT 1LVKA 1ZEEA 3AE3A 2IMLA 2W61A 3A8YC 5HEJA 3ZN1B 1HX8A 1IAPA 2DWGA 2JRKA 2XQAA 3CX8B 2H7OA 3WI3A 4DV0T 4YTNA 4LF6T 2CXLA 2XM1A 5FXWA 3ZEFB 3QB5A 3R84B 3AXJB 5LYJE 2CBIA 4ZI7E 2NOXA 2J1DG 4ERRA 4E7ZA 4ZI2C 4X20E 4ILAA 4JI1T 2ZLYA 3EABA 1QLBA 2PFVA 4IIJE 4GIWA 2JMHA 2LSGA 4UIGA 3C4ZA 5LMNT 1VCSA 1MMNA 4LMJA 1WLXA 3F57A 4QX8B
chains in the Genus database with same CATH topology
3L3PA 1MNEA 2P9BA 4P0BA 5L3CB 5ADXL 2YEVC 4IE5A 2KLQA 4PJJA 3GA8A 2WBLA 3PU8A 1IZNB 4L0RA 5FYMA 2JQQA 4PFOA 1SHZC 2HPLA 5LG4A 4KBMB 4O8SA 4YFSA 1B7TA 3C64A 3HKBE 4BJNA 1FMVA 3GN5B 4EYYR 2LHNA 5F8PA 5JR9A 2C5IT 2MOZA 2SPCA 3NBXX 2WMOA 1D0XA 3I1AA 3RH3A 4AQFC 4DMWA 4XZCA 3RX6A 4WW0A 2A2FX 4O4LE 3HL6A 2XTLA 5LBMA 2KXPB 1OWAA 3J9X1 3RPUA 5JRCB 2JMKA 5LGUB 4IGUA 5GONE 4CXWA 1ZV4X 4H63H 4JUYA 4YJ3E 1HG2A 3ZYMA 4O2AE 3L09A 3BK9A 1BR4A 1WR6A 4KUMB 2BVMA 1SA0E 3ETVA 3FHNA 2KINB 3UUNA 2W0GA 5L3GB 4ASKA 3OYZA 4GYSA 4E7SA 4M1PA 2N9DA 1BR2A 5TAOA 5KX5E 4O4JE 2CM0A 3EUHA 3DJBA 5HXSA 2XAJB 3I0OA 4ZOLE 5LHHB 4CXXA 5JQGE 1HFAA 4U72A 5LGTB 1FMWA 3CX7B 3MXZA 5JR9C 5L3FB 2V7LA 3CWZB 3N9LA 3ZMVB 1UX5A 2LSKA 2PBIA 3IEEA 4H9OC 3SRZA 5EK2A 5EK4A 5L2LA 2K48A 3F2EA 4HTEA 5DJQC 5H6RB 3PUSA 2BZBA 5BMVE 3O1JA 1HS7A 2XAGB 1O3XA 2D5UA 4OHFA 2XAQB 2VKOA 2YINA 5LA6E 4MHCA 2BDEA 2C0SA 3ZPOA 4AKRB 3TKLB 2YU2A 5JDQA 2K5BB 2V26A 2X0LB 5DQWA 2LM9A 2NW7A 1MIWA 2E9XA 2KNDA 2K24A 1ZHCA 3BQIA 1X79A 2V7JA 3AA1B 2Q9QD 3D0TA 1Z0PA 3HA4A 2ZM2A 4WNKA 5LJMA 3AVSA 2IC9A 5EK3A 4EB6E 4QXBB 2L3LA 1ZKEA 4JEHB 4CI3B 5FMNA 2VL8A 3PE0A 2DCFA 2V1DB 1MMGA 2LHRA 2Z6EA 2LSYA 4J2CA 2BVLA 3LBXA 2V7KA 3KVAA 3KV5A 4UXNB 5LCYA 4ZI2D 4UF0B 3AA7B 3P8CD 3ZMTB 3I0QA 5L3DB 4P09A 2ZM8A 4QKNA 1S94A 4EIWA 3WAJA 2C5KT 3GMIA 4X1YE 4PJLA 1H7CA 3U78A 2E8IA 3J7Yq 3LBXB 3ZYLA 2PJQA 4TZ4C 4QX7B 2RP4A 3PTRB 3KVBA 3ZC0A 5FXZA 2A3DA 3N9PA 4TN7B 4WBOA 1NAFA 5C8YE 2CMRA 1YKHB 3KDSE 3UUMA 2E9XD 1D0ZA 1QUUA 3C50A 3OYXA 4PAGA 3V5SA 3CQGB 3F31A 3RC8A 2ODUA 3SWHA 2E9XC 4CZZB 5J2TE 3Q5XA 3ZMUB 2WAUA 2L9QA 5DABA 2CEAA 2LSJA 3GN5A 3N9QA 3KV6A 4AQGA 1BR1A 4PNIA 3AB3B 5F3JA 3PUQA 5LJNA 3RKOA 4O2BE 2NTXA 2G0UA 5HWXA 2X66A 2HPJA 2NWBA 3JC6C 2YU1A 3E08A 3ZJ1A 2XASB 3CX6B 3FB2A 3EDVA 4K0UA 3ZC1A 1MIVA 4HEAA 3RYCE 4F6RC 3E22E 4XAXB 4KMCA 4I43B 4MLKA 3N9MA 3ZMZB 4ISTA 1WRDA 3M65A 3MK7C 3I9WA 2LOSA 3PURA 2RA1A 2VWAA 4ZHQE 3LK2B 2CE7A 4UV8B 4GYRA 1G8XA 4BAYB 5KDMC 2LSIA 2LOPA 2LT3A 2EHOB 4FI5A 4C90A 2JJ9A 4A56A 4AKHA 3O1HA 1UX4A 4C91A 2VB6A 1US7B 2B1EA 3N5LA 4JEUB 4EYUA 5LXTE 3FBZA 1WYCA 3RRCA 3CKDA 3IF8B 3K8PC 2YK0A 4QXHB 2ZM0A 4GOUA 2W00A 4ILUA 3RYFE 5HXEA 3AVRA 4EAHA 2XUEA 5JDGA 4OK0A 3ZYKA 1U4QA 3PUAA 3V5UA 2XQYA 3MZKB 5HWYA 5JREA 5JRCA 4AI6A 5LP6E 4QWNB 3MJXA 4NUVA 4GK5E 2V7IA 5FXXA 4IHJE 2NTYA 4HE8A 3K3NA 5AFUL 2QGSA 3FXDB 4L9IA 2IW5B 1U5PA 3AA0B 3LG7A 2N2NA 2UXNB 2WM9A 3ETUA 4YLHA 4PK6A 1HF8A 2CLYB 4X1KE 2MTQA 2JPFA 5H6QB 2D0TA 3LK3B 3KFWX 1HG5A 2KZ7B 2CXFA 3QUJA 1D0YA 3O4XE 4UELA 4I55E 5LHIB 4HGAA 3LK42 4TV8E 2W62A 1YKEB 2W63A 1NWMX 5E0OA 3P7IA 4DBRA 2IAKA 4EZHA 1KK7A 3R6NA 1FEWA 3O1IA 3BQKA 1D1AA 2QA7A 1LRZA 2C5JA 4H9NC 3N2KE 1UCUA 4UF0A 2GK9A 3FXEB 4HN9A 4ZI3C 4DMVA 3OJAA 1LKXA 4JLEA 3KV9A 4L5GA 5JVDE 3Q9DA 2A72A 5HXRA 3ZJ2A 2KWHA 3CMLA 2WSSV 3HI2A 3UFEA 5IHYA 4PW8A 3QC9A 3AAEB 3Q2MA 4QXCB 2X68A 3BQLA 5FXVA 1OXZA 2KMFA 4QHOA 4DNDA 2CCQA 4UEMA 4MALA 5J2UE 3CVRA 3PDYA 3B57A 4AKIA 3UT5E 2CXDA 1LVFA 2KT9A 2I59A 3ONXA 4IE6A 4UV9B 1VRBA 2DHRA 2VKDA 3C4WA 4IE7A 1S35A 4MFRA 4MBQA 3VKGA 4XBFB 5FNVE 2MYSA 3IHRA 2XAFB 4ISSA 3NRXA 1MMDA 4OYKA 4KP3C 4EOZB 5LOVE 5JDHA 3N9NA 4TX5A 5JDNA 4TUYE 5DQVA 3PUGA 5HXCA 5HYAA 4YHJA 3JC6D 1MIYA 2ODVA 2VKJA 3HR0A 5J1GA 5A1LA 4TV9E 3SOLA 1T98A 2HH7A 3UUXB 2ZMAA 3O9XA 1HTJF 4HKAA 2VKHA 3ZN0B 4H63V 4DVDA 4PK4A 1VOMA 1YW0A 3MA9A 3Q5WA 4OYJA 3FBLA 2CA5A 2XAHB 2MBGA 3CQCB 3C98B 3GWHA 1HCIA 4AKGA 2N1GA 3WAKA 3UTKA 1CUNA 3ESLA 2EHOA 2X51A 3OKQA 4O4IE 4O4HE 3HKEE 2Y6XA 2LE8A 4H9PC 2ES0A 5CB4E 3VKHA 1Y64B 5CA0E 3CPZA 3UULA 4G63A 4EXTA 2X9HA 3LFMA 2CWYA 4AKLA 4EZ4A 3E0ZA 5EZYE 3VHLA 2X9XA 4AXPA 2DI4A 1D1BA 4Z8XA 2X9YA 4BA9A 3H37A 4I4TE 3CQXC 3I9YA 3KBUA 1YD8G 3K3QC 4G2AA 2WWUA 5JR9B 4P0AA 4H9RC 5HAXA 1AJ3A 4PJMA 2WMNA 3ZLIA 3VU7H 3MACA 2Y8DA 3A5XA 5L3EB 4X1IE 2Y48B 3ANWA 3N9OA 5JDFA 2LEHA 2EHOD 5HXHA 1IJ5A 3C51A 2M67A 5L3BB 3NRYA 4FJOA 2EHOC 3ANWB 5M4YA 3HKDE 4NUUA 2L8KA 4YJ2E 5FY0A 2H7VC 2D2SA 3NZQA 5LGNB 1WYBA 2VASA 3ZCJA 1IJ6A 2Q9QA 3MKDA 4CQIA 5JH7E 3B13A 5IYZE 2KWIB 1EZ3A 2PG8A 4ZS3A 4U74A 4ZS2A 3ZMSB 4BJMA 5LNKA 3AA6B 4IDZA 2Q9QB 4B6XA 2VK9A 4PFPA 3C4XA 4UVAB 2CWOA 4ANJA 1MNDA 2IC6A 1BR0A 4DO0A 1FIOA 4ZI3D 3EDUA 2V7MA 3HKCE 1MMAA 3KINB 4DBQA 3U3IA 3RYHE 4HFVA 4CI1B 2K9AA 1LVKA 1ZEEA 2DNXA 2LJLA 1V9DA 2W61A 5LBQB 3K3OA 3OBVE 3ZN1B 3N2GE 3NZPA 1D1CA 3DTOA 5CA1E 2DWKA 5ETWA 2CLYC 2NP9A 3SS1A 1HX8A 5FP3A 1E1HB 1IAPA 3ZCIA 2DWGA 2UXXB 3T8OA 2JRKA 4CI2B 3CX8B 2H7OA 4WBNE 3WI3A 1KNZA 2ACXA 2Q9QC 5JDLA 3DP7A 2CXLA 3EVYA 3PU3A 4OFZA 1QSDA 2XHEB 5FXWA 3ZEFB 2E9XB 3KV4A 3LJCA 3R84B 2X9WA 4H9SE 5LYJE 2X67A 4ZI7E 4IE0A 4ADZA 2NOXA 2J1DG 2D0UA 4N78D 4AQFA 4ERRA 3W15B 4E7ZA 4PK5A 4X20E 4ZI2C 5LHGB 4CXYA 4I50E 2ZLYA 2NW8A 2H3RA 4UVCB 3RRWA 3AAIA 3N2OA 2PFVA 4IIJE 4GK0E 3AAAB 5FY7A 4GIWA 2DLRA 4IE4A 5KMGP 2JMHA 3RYIE 4H9QC 2LSGA 3QK6A 4PJNA 4UIGA 3C4ZA 3S4UA 2NW9A 4UVBB 4V1Av 3RC3A 1MMNA 1WLXA 3F57A 3KBTA 5JDMA 2OA5A 4QX8B 3H3AA 1G73A 3IBPA 5FY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2E A;  3J9X 1;  3FBL A;  3FBZ A; 
#chains in the Genus database with same CATH topology
 5L3C B;  2KLQ A;  3GA8 A;  2WBL A;  3PU8 A;  1SHZ C;  4KBM B;  4O8S A;  2W4X A;  3ZST A;  4BJN A;  1FMV A;  1KEY A;  5F8P A;  3NBX X;  2WMO A;  2BG9 A;  3RH3 A;  4DMW A;  2E5L T;  4XZC A;  3NKZ A;  4NXN T;  3RPU A;  2JMK A;  3UU6 A;  3A7M A;  5L4E A;  1HG2 A;  2UU9 T;  3L09 A;  2BVM A;  2I6H A;  3ETV A;  2KIN B;  3FHN A;  3RKG A;  4M1P A;  5TAO A;  4O4J E;  4YTP A;  4ZOL E;  5JQG E;  1DU2 A;  3ZMV B;  3IEE A;  2LSK A;  1YQ4 A;  5EK2 A;  2CHN A;  5EK4 A;  5FKY A;  2K48 A;  2V8S V;  3RHW A;  5H6R B;  3PUS A;  1T7S A;  2D5U A;  2YIN A;  4HFE A;  5JTG A;  5LG3 A;  2BDE A;  1N33 T;  3QB5 K;  2YU2 A;  1VCT A;  2LM9 A;  2NW7 A;  1MIW A;  4U31 A;  2K24 A;  3D0T A;  2ZM2 A;  5HEO A;  5FMN A;  1SUM B;  3L8R A;  2R6G F;  2LHR A;  5HCJ A;  4KI0 F;  2V7K A;  4ILB A;  4U2Z A;  5FL1 A;  2BKN A;  4EIW A;  4X1Y E;  3J7Y q;  3LBX B;  3ZYL A;  2BKP A;  4COF A;  4A98 A;  5FXZ A;  4TN7 B;  1M62 A;  5C8Y E;  1XMO T;  3PUY F;  2BG9 E;  3F31 A;  3RC8 A;  3SWH A;  2E9X C;  5J2T E;  4HFD A;  2X0Y A;  2CEA A;  2LSJ A;  1E7P A;  3KV6 A;  4AQG A;  4PNI A;  5F3J A;  2FUP A;  5LJN A;  2LKG A;  4HFB A;  2X66 A;  3AEA A;  3JC6 C;  5FL0 A;  2WCA A;  3P50 A;  3E08 A;  2XAS B;  3OPC A;  4HEA A;  4IST A;  4KX6 A;  3M65 A;  1I6Z A;  4NXM T;  3I9W A;  3PUR A;  4JI3 T;  4GYR A;  4FI5 A;  2ACZ A;  4LF8 T;  4A56 A;  3TLW A;  2JQH A;  3SFE A;  4JEU B;  4YTM A;  2YOE A;  3ZT7 A;  3CKD A;  2AE9 A;  2YK0 A;  2ZM0 A;  2W00 A;  5HXE A;  3NVO A;  4OK0 A;  3RIF A;  4CN6 A;  2XQY A;  2UXC T;  2VL0 A;  5LP6 E;  4NUV A;  3FXD B;  2IW5 B;  1U5P A;  3AA0 B;  3JCF A;  3KFW X;  1D0Y A;  3RGL A;  5FVK A;  2XY8 B;  2W63 A;  1KK7 A;  1FEW A;  3O1I A;  4ZI3 C;  4DMV A;  5LMU T;  3RLF F;  4WZX A;  3KV9 A;  2XPK A;  4AQY T;  4PW8 A;  3Q2M A;  1FJG T;  2CCQ A;  2XM2 A;  5AQI B;  3PDY A;  3RI5 A;  4HFC A;  4TWF A;  3PUX F;  4IE6 A;  2VKD A;  2XAF B;  2WDV A;  3ONL C;  5HXC A;  4HFH A;  5HYA A;  4NPP A;  2ODV A;  2M6B A;  1OED B;  3ZN0 B;  1YW0 A;  3Q5W A;  4DID B;  3FBL A;  2CA5 A;  4LMK A;  2N1G A;  3UTK A;  1CUN A;  3AE7 A;  2Y6X A;  4H9P C;  2WZH A;  2ES0 A;  4QH4 A;  2CHO A;  3VKH A;  1Y64 B;  4DUZ T;  4CN1 A;  4EXT A;  2X9H A;  3AEG A;  3FZL B;  4WYV A;  2X9X A;  2DI4 A;  4NIQ A;  2X9Y A;  1OED C;  5HAX A;  3FZF B;  2WDR A;  3MAC A;  2Y8D A;  3P4P A;  3VR8 A;  3N9O A;  4X66 T;  2VQF T;  1HX1 B;  2D9D A;  2WP9 A;  3ANW B;  2YDQ A;  2H7V C;  5LGN B;  3FZM B;  2UXD T;  2K3W A;  4CQI A;  3B13 A;  1EZ3 A;  4ZS3 A;  4ZS2 A;  5LNK A;  3AA6 B;  2VK9 A;  3C4X A;  4JI0 T;  2CWO A;  3B5M A;  1FIO A;  3KIN B;  3U3I A;  3M3Z B;  2K9A A;  2LJL A;  4TNV A;  1V9D A;  4DR4 T;  3Q5D A;  3NZP A;  3VRB A;  3DTO A;  5ETW A;  2NP9 A;  1L0V A;  5FP3 A;  4ZZC A;  2UXX B;  3T8O A;  3AXJ A;  1KNZ A;  2ACX A;  4JI6 T;  3DP7 A;  3PU3 A;  2H89 A;  3KV4 A;  4YXD A;  4IDQ A;  3LJC A;  2X9W A;  3UUB A;  1NEK A;  3W15 B;  4PK5 A;  4CXY A;  4I50 E;  4UVC B;  1HNZ T;  2LRK A;  4IE4 A;  1UUR A;  4X5T A;  3UFG A;  4UVB B;  4DV4 T;  3KBT A;  1G73 A;  2P9B A;  2FBW A;  4PJJ A;  2YDS A;  1KNR A;  4L0R A;  5FYM A;  2JQQ A;  2FJB A;  1B7T A;  3UQ7 A;  3HKB E;  4AQF C;  1D0X A;  4DR5 T;  2XQ4 A;  3HL6 A;  1CHU A;  2UXB T;  3LSV A;  3ZKR A;  3PJA J;  5LBM A;  2LKH A;  2YKS A;  2IHR 1;  1ZV4 X;  1IBL T;  4H63 H;  4JUY A;  2PTF A;  1BR4 A;  2CBJ A;  1XNR T;  1SA0 E;  4GKK T;  3UUN A;  3SFD A;  5L3G B;  3OYZ A;  4E7S A;  3VR9 A;  2XSB A;  5ABE A;  1BR2 A;  2WB5 A;  2CRB A;  2NR4 A;  2ZM6 T;  2IDO B;  4UR9 A;  1HFA A;  5LGT B;  1FMW A;  2QRX A;  3MXZ A;  5JR9 C;  3N9L A;  1UX5 A;  4ZXL A;  5AQH B;  1YQ3 A;  1HR0 T;  4JI2 T;  2BZB A;  2XAG B;  1XZY A;  4KHP T;  4DV6 T;  4B3T T;  4IDO A;  2K5B B;  2E9X A;  2KND A;  4IE7 A;  1ZHC A;  3BQI A;  2Q9Q D;  3HA4 A;  5LJM A;  5AQP B;  4YSY A;  1N34 T;  2LSY A;  3LBX A;  3KV5 A;  4UXN B;  4UF0 B;  3OTO T;  3I0Q A;  3IA3 A;  5AQS B;  4P09 A;  4QKN A;  1S94 A;  3WAJ A;  3GMI A;  3U78 A;  2E8I A;  4TZ4 C;  4QX7 B;  1IBK T;  2RP4 A;  3PTR B;  3KVB A;  3ZC0 A;  3TLV A;  3P4R A;  3N9P A;  4B3S T;  3TLS A;  4EV6 A;  2E9X D;  3C50 A;  2ODU A;  4YY3 T;  4CZZ B;  3Q5X A;  2WAU A;  1E2A A;  3GN5 A;  2WDQ A;  1BR1 A;  4O2B E;  2NTX A;  5FVL A;  2HPJ A;  2YU1 A;  3ZJ1 A;  3CX6 B;  4K0U A;  2V6Y B;  4F6R C;  2XJ7 A;  3ONJ A;  2LOS A;  2VWA A;  3LK2 B;  2LOP A;  2LT3 A;  2WU2 A;  2EHO B;  2JJ9 A;  2V5C A;  4AKH A;  4HWC A;  4JI4 T;  4C91 A;  2VB6 A;  3N5L A;  3EAM A;  5LXT E;  3K8P C;  3RYF E;  3AVR A;  5JDG A;  4X65 T;  2WY2 A;  3PUA A;  3EI0 A;  3CIR A;  4HE8 A;  3K3N A;  1GQE A;  4L9I A;  5AFU L;  3CK6 A;  4U7I A;  4YSX A;  2N2N A;  2CLY B;  5J0Z A;  2D0T A;  3LK3 B;  2KZ7 B;  2XQ7 A;  4UEL A;  3LK4 2;  4HWH A;  4QH5 A;  2BBJ A;  5E0O A;  4DBR A;  4ILC A;  1W09 A;  3BQK A;  2QA7 A;  2GK9 A;  4HN9 A;  2IIU A;  2CPT A;  4U2Y A;  4DV7 T;  2DL1 A;  5JVD E;  2W2U A;  3AE1 A;  2KWH A;  5ABF A;  3AAE B;  5FXV A;  4LFA T;  4UEM A;  1X9B A;  3B57 A;  3UT5 E;  2KT9 A;  2I59 A;  2MAW A;  3VKG A;  5L47 A;  4XBF B;  2MYS A;  4KP3 C;  5JDH A;  4TX5 A;  3K1S A;  3PUG A;  1OED A;  4DR3 T;  1MIY A;  5J1G A;  4TV9 E;  4B3M T;  2VKH A;  1KF6 A;  4OYJ A;  1UGO A;  1XDO A;  2UUA T;  4AKG A;  4O4I E;  4O4H E;  4EEB A;  2I0M A;  2LE8 A;  4IRE A;  3UUL A;  3PUZ F;  2CWY A;  4EZ4 A;  3E0Z A;  2W66 A;  4AXP A;  2HN2 A;  5F5W A;  3OVU A;  1YD8 G;  2WWU A;  2BG9 B;  3VU7 H;  1W0A A;  2JQ9 A;  5L3E B;  2Y48 B;  3AE6 A;  3ANW A;  5JDF A;  2QYW A;  2LEH A;  5HXH A;  1IJ5 A;  2M67 A;  5L3B B;  3NRY A;  3PUV F;  4JBW F;  1IBM T;  3AED A;  2L8K A;  3NZQ A;  4JYA T;  5JH7 E;  5IYZ E;  2BS2 A;  4U74 A;  4IDZ A;  3PV0 F;  4B6X A;  4PFP A;  3TLU A;  4Z91 A;  1MND A;  2IC6 A;  3HKC E;  4HFV A;  5CFB A;  4CI1 B;  5LBQ B;  5AQT B;  2KSR A;  3K3O A;  3OBV E;  3N2G E;  1D1C A;  3SS1 A;  4IL4 A;  4CI2 B;  4WBN E;  4ZEY A;  1N36 T;  4I0U A;  4OFZ A;  1QSD A;  2XHE B;  2LLY A;  4H9S E;  2X67 A;  2XQ6 A;  2D0U A;  4AQF A;  5LHG B;  3UQ4 A;  2NW8 A;  3RRW A;  5IWA T;  4GK0 E;  5FY7 A;  2DLR A;  3RYI E;  4PJN A;  3PUW F;  3RC3 A;  5JDM A;  2OA5 A;  5HEH A;  2FJA A;  5L4H A;  3V5S A;  5FY1 A;  3L3P A;  4P0B A;  5ADX L;  3RQU A;  2OV9 A;  1JNZ A;  1IZN B;  3RIU C;  3P4S A;  4ZZB A;  4YFS A;  3C64 A;  4EYY R;  3AE9 A;  5JR9 A;  2C5I T;  3FZH B;  2WQY A;  5HEU A;  1WFD A;  1OWA A;  5JRC B;  5LGU B;  4O2A E;  4KUM B;  3AEE A;  2W0G A;  5AQU B;  4GYS A;  2IUB A;  2CM0 A;  3EUH A;  5HXS A;  2XAJ B;  5LHH B;  4CXX A;  4U72 A;  3P4W A;  3CX7 B;  2V7L A;  3CWZ B;  2PBI A;  3SRZ A;  5L2L A;  4X62 T;  5AQQ B;  4HTE A;  5DJQ C;  5BMV E;  3O1J A;  3L39 A;  3JAF A;  1O3X A;  4OHF A;  4OX9 T;  2XAQ B;  2VKO A;  5LA6 E;  4MHC A;  4LFB T;  3ZPO A;  2V26 A;  5DQW A;  4U3C A;  1I94 T;  1Z0P A;  4DR1 T;  3UU5 A;  5AQF B;  2L3L A;  4IDP A;  4CI3 B;  2VL8 A;  2DCF A;  1MMG A;  2Z6E A;  4HFI A;  5LCY A;  4ZI2 D;  3ZMT B;  3ABV A;  5L3D B;  2C5K T;  4PJL A;  1H7C A;  2HN1 A;  4Q25 A;  2J47 A;  2A3D A;  2WZI A;  2BS4 A;  1YKH B;  3UUM A;  3UU8 A;  1D0Z A;  1QUU A;  3OYX A;  4PAG A;  2AXD S;  3T1H T;  3ZMU B;  4DR2 T;  2J4G A;  2XQ3 A;  3FB2 A;  3EDV A;  3ZC1 A;  2VUR A;  3RYC E;  3E22 E;  4XAX B;  4MLK A;  3N9M A;  5HCM A;  4TWD A;  2RA1 A;  4ZHQ E;  2CE7 A;  5ABH A;  4UV8 B;  1G8X A;  4BAY B;  2VVN A;  3O1H A;  1UX4 A;  2A9U A;  3RRC A;  4DR6 T;  2M6I A;  4GOU A;  4ILU A;  5AQO B;  2XUE A;  1T8B A;  3ZYK A;  1HNW T;  1R8I A;  5HWY A;  5JRE A;  4JI7 T;  5ABG A;  2V7I A;  4IHJ E;  2NTY A;  3LG7 A;  2UXN B;  3ETU A;  4YLH A;  4PK6 A;  1HF8 A;  4X1K E;  2MTQ A;  3QUJ A;  2CXF A;  4YT0 A;  4I55 E;  2W62 A;  4LF5 T;  2WU5 A;  3P7I A;  2OLT A;  2IAK A;  1D1A A;  1LRZ A;  4H9N C;  1UCU A;  3OJA A;  1LKX A;  4JLE A;  5HXR A;  3ZJ2 A;  4HWI B;  3HI2 A;  3UFE A;  5IHY A;  4QXC B;  2X68 A;  3BQL A;  3AE5 A;  4DND A;  5AQK B;  4AKI A;  2CXD A;  1LVF A;  3ONX A;  2DHR A;  3AE2 A;  2LRL A;  4MFR A;  4MBQ A;  5FNV E;  3IHR A;  3NRX A;  4OYK A;  4EOZ B;  2J62 A;  5JDN A;  4TUY E;  5DQV A;  4YHJ A;  3JC6 D;  5A1L A;  2BBH A;  3SOL A;  2BKO A;  2HH7 A;  3UUX B;  2ZMA A;  1VOM A;  4LF9 T;  2XAH B;  4LML A;  3C98 B;  1HCI A;  2UUC T;  2X51 A;  5BR8 T;  4EED A;  5KXJ A;  3HKE E;  5CB4 E;  3VRA A;  5CA0 E;  3VHL A;  5CGM A;  4Z8X A;  4EGW A;  2RPA A;  4BA9 A;  3CQX C;  5AQJ B;  4H9R C;  1AJ3 A;  3A5X A;  4X1I E;  3AEB A;  2EHO C;  1JNR A;  1WR0 A;  3HKD E;  4YJ2 E;  1SE7 A;  5FY0 A;  2D2S A;  2VVS A;  3ZCJ A;  3ZT6 A;  1IJ6 A;  3MKD A;  2KWI B;  2PG8 A;  4LFC T;  2Q9Q B;  1W0B A;  4DO0 A;  4ZI3 D;  3EDU A;  4DBQ A;  4A5X A;  1N32 T;  2DNX A;  4YSZ A;  2JQK A;  2V5D A;  4AIU A;  5CA1 E;  2DWK A;  2CLY C;  1J5E T;  1E1H B;  3ZCI A;  2V6X A;  2E5V A;  4AIS A;  2Q9Q C;  3EVY A;  4Z90 A;  1ZP0 A;  2E9X B;  3RIU A;  4F8H A;  4IE0 A;  4ADZ A;  1T72 A;  4N78 D;  2H3R A;  3NWI A;  3AAI A;  3N2O A;  3AAA B;  5KMG P;  4H9Q C;  3QK6 A;  2LM2 A;  3S4U A;  2NW9 A;  4V1A v;  2W67 A;  3H3A A;  3IBP A;  3V5U A;  4JV5 T;  1MNE A;  4DV5 T;  2YEV C;  4IE5 A;  5AQV B;  1WCR A;  1J1J A;  4PFO A;  2HPL A;  5LG4 A;  4LF4 T;  3GN5 B;  1NEN A;  2BS3 A;  2LHN A;  5AQG B;  2MOZ A;  2SPC A;  5JRC A;  3I1A A;  3RX6 A;  4WW0 A;  4TWH A;  2A2F X;  4O4L E;  2XTL A;  2KXP B;  3J9X 1;  1W9R A;  4IGU A;  5GON E;  4CXW A;  2F4V T;  4IL9 A;  4YJ3 E;  3ZYM A;  4DV1 T;  3BK9 A;  4GKJ T;  1WR6 A;  4ASK A;  2N9D A;  5KX5 E;  3JAD A;  1YXR A;  3DJB A;  3I0O A;  3RQW A;  4B3R T;  5L3F B;  1M7K A;  1Z8U A;  2BG9 C;  4H9O C;  3F2E A;  5AQL B;  1HS7 A;  2YN6 A;  3X1D A;  4HWF A;  2C0S A;  3UU4 A;  4AKR B;  5C2T A;  3TKL B;  3FZK B;  5JDQ A;  5C3J A;  2X0L B;  5JDL A;  3AA1 B;  1X79 A;  2V7J A;  1OED E;  4X64 T;  4WNK A;  3AVS A;  2IC9 A;  5EK3 A;  5AQM B;  4EB6 E;  2E2A A;  4QXB B;  1ZKE A;  3JAE A;  4JEH B;  3PE0 A;  2V1D B;  2YDR A;  4J2C A;  2BVL A;  3KVA A;  1J5W A;  3AA7 B;  3P8C D;  2VQE T;  2ZM8 A;  2XQ5 A;  4DR7 T;  4IT4 A;  3AE4 A;  2PJQ A;  5ABF B;  4U7Y A;  2B76 A;  4WBO A;  1NAF A;  2CMR A;  2HHH T;  3KDS E;  4JI8 T;  3ZSS A;  3CQG B;  2L9Q A;  5DAB A;  5CJ5 A;  3N9Q A;  3AB3 B;  3PUQ A;  3RKO A;  2G0U A;  5HWX A;  2NWB A;  4LF7 T;  1MIV A;  4KMC A;  4I43 B;  3ZMZ B;  1WRD A;  3MK7 C;  4KHZ F;  3AEC A;  5KDM C;  2LSI A;  4C90 A;  5AQR B;  1US7 B;  2B1E A;  4QH1 A;  2QVA A;  4EYU A;  2WS3 A;  3FBZ A;  1WYC A;  3IF8 B;  4QXH B;  4DUY T;  4EAH A;  1U4Q A;  4AI6 A;  3MZK B;  4DV3 T;  4QWN B;  5LB7 B;  3MJX A;  4HWD A;  3QNU A;  4GK5 E;  5FXX A;  2QGS A;  2WM9 A;  2WWV A;  2JPF A;  5H6Q B;  1HG5 A;  3O4X E;  5LHI B;  4HGA A;  4TV8 E;  3AEF A;  1YKE B;  3TLT A;  1NWM X;  3AE8 A;  4P1N A;  4EZH A;  3QOF A;  3R6N A;  2C5J A;  4UF0 A;  1XWM A;  3N2K E;  3FXE B;  5HEG A;  3P4Q A;  4L5G A;  3Q9D A;  2A72 A;  3CML A;  2WSS V;  3QC9 A;  4U33 A;  1ZOY A;  1OXZ A;  2KMF A;  4QHO A;  2XQ8 A;  4MAL A;  3ZT5 A;  5J2U E;  3CVR A;  1HNX T;  4UV9 B;  1KFY A;  2MPK A;  1VRB A;  3C4W A;  3EHZ A;  1S35 A;  4ISS A;  3RIA A;  1MMD A;  3RF1 A;  5LOV E;  3N9N A;  3G06 A;  2VKJ A;  3HR0 A;  2V6Y A;  1T98 A;  1UK5 A;  3O9X A;  1HTJ F;  4HKA A;  4H63 V;  4DVD A;  1UUS A;  4PK4 A;  3MA9 A;  2MBG A;  3CQC B;  3GWH A;  4K0K T;  3WAK A;  3ESL A;  2EHO A;  3OKQ A;  4JI5 T;  4IDN A;  1XMQ T;  2X0H A;  3CPZ A;  4G63 A;  3Q5E A;  2XSA A;  3LFM A;  4AKL A;  5EZY E;  3H3M A;  1D1B A;  3H37 A;  4I4T E;  3I9Y A;  3KBU A;  3PJA A;  4A97 A;  4DV2 T;  3K3Q C;  4G2A A;  5JR9 B;  4P0A A;  2XQ9 A;  1Y01 A;  4PJM A;  2WMN A;  3ZLI A;  2UUB T;  4TNW A;  5AQN B;  2EHO D;  2JIW A;  3T1Y T;  3C51 A;  2FJD A;  4FJO A;  1KNP A;  1XNQ T;  5M4Y A;  4NUU A;  4CN4 A;  1WYB A;  2VAS A;  5IUX A;  1XDP A;  2Q9Q A;  2H88 A;  2XZE A;  3ZMS B;  4BJM A;  4UVA B;  3LDQ B;  3UU3 A;  4ANJ A;  1BR0 A;  2FJE A;  2V7M A;  1MMA A;  3RYH E;  4YHH T;  1LVK A;  1ZEE A;  3AE3 A;  2IML A;  2W61 A;  3A8Y C;  5HEJ A;  3ZN1 B;  1HX8 A;  1IAP A;  2DWG A;  2JRK A;  2XQA A;  3CX8 B;  2H7O A;  3WI3 A;  4DV0 T;  4YTN A;  4LF6 T;  2CXL A;  2XM1 A;  5FXW A;  3ZEF B;  3QB5 A;  3R84 B;  3AXJ B;  5LYJ E;  2CBI A;  4ZI7 E;  2NOX A;  2J1D G;  4ERR A;  4E7Z A;  4ZI2 C;  4X20 E;  4ILA A;  4JI1 T;  2ZLY A;  3EAB A;  1QLB A;  2PFV A;  4IIJ E;  4GIW A;  2JMH A;  2LSG A;  4UIG A;  3C4Z A;  5LMN T;  1VCS A;  1MMN A;  4LMJ A;  1WLX A;  3F57 A;  4QX8 B; 
#chains in the Genus database with same CATH homology
 3L3P A;  1MNE A;  2P9B A;  4P0B A;  5L3C B;  5ADX L;  2YEV C;  4IE5 A;  2KLQ A;  4PJJ A;  3GA8 A;  2WBL A;  3PU8 A;  1IZN B;  4L0R A;  5FYM A;  2JQQ A;  4PFO A;  1SHZ C;  2HPL A;  5LG4 A;  4KBM B;  4O8S A;  4YFS A;  1B7T A;  3C64 A;  3HKB E;  4BJN A;  1FMV A;  3GN5 B;  4EYY R;  2LHN A;  5F8P A;  5JR9 A;  2C5I T;  2MOZ A;  2SPC A;  3NBX X;  2WMO A;  1D0X A;  3I1A A;  3RH3 A;  4AQF C;  4DMW A;  4XZC A;  3RX6 A;  4WW0 A;  2A2F X;  4O4L E;  3HL6 A;  2XTL A;  5LBM A;  2KXP B;  1OWA A;  3J9X 1;  3RPU A;  5JRC B;  2JMK A;  5LGU B;  4IGU A;  5GON E;  4CXW A;  1ZV4 X;  4H63 H;  4JUY A;  4YJ3 E;  1HG2 A;  3ZYM A;  4O2A E;  3L09 A;  3BK9 A;  1BR4 A;  1WR6 A;  4KUM B;  2BVM A;  1SA0 E;  3ETV A;  3FHN A;  2KIN B;  3UUN A;  2W0G A;  5L3G B;  4ASK A;  3OYZ A;  4GYS A;  4E7S A;  4M1P A;  2N9D A;  1BR2 A;  5TAO A;  5KX5 E;  4O4J E;  2CM0 A;  3EUH A;  3DJB A;  5HXS A;  2XAJ B;  3I0O A;  4ZOL E;  5LHH B;  4CXX A;  5JQG E;  1HFA A;  4U72 A;  5LGT B;  1FMW A;  3CX7 B;  3MXZ A;  5JR9 C;  5L3F B;  2V7L A;  3CWZ B;  3N9L A;  3ZMV B;  1UX5 A;  2LSK A;  2PBI A;  3IEE A;  4H9O C;  3SRZ A;  5EK2 A;  5EK4 A;  5L2L A;  2K48 A;  3F2E A;  4HTE A;  5DJQ C;  5H6R B;  3PUS A;  2BZB A;  5BMV E;  3O1J A;  1HS7 A;  2XAG B;  1O3X A;  2D5U A;  4OHF A;  2XAQ B;  2VKO A;  2YIN A;  5LA6 E;  4MHC A;  2BDE A;  2C0S A;  3ZPO A;  4AKR B;  3TKL B;  2YU2 A;  5JDQ A;  2K5B B;  2V26 A;  2X0L B;  5DQW A;  2LM9 A;  2NW7 A;  1MIW A;  2E9X A;  2KND A;  2K24 A;  1ZHC A;  3BQI A;  1X79 A;  2V7J A;  3AA1 B;  2Q9Q D;  3D0T A;  1Z0P A;  3HA4 A;  2ZM2 A;  4WNK A;  5LJM A;  3AVS A;  2IC9 A;  5EK3 A;  4EB6 E;  4QXB B;  2L3L A;  1ZKE A;  4JEH B;  4CI3 B;  5FMN A;  2VL8 A;  3PE0 A;  2DCF A;  2V1D B;  1MMG A;  2LHR A;  2Z6E A;  2LSY A;  4J2C A;  2BVL A;  3LBX A;  2V7K A;  3KVA A;  3KV5 A;  4UXN B;  5LCY A;  4ZI2 D;  4UF0 B;  3AA7 B;  3P8C D;  3ZMT B;  3I0Q A;  5L3D B;  4P09 A;  2ZM8 A;  4QKN A;  1S94 A;  4EIW A;  3WAJ A;  2C5K T;  3GMI A;  4X1Y E;  4PJL A;  1H7C A;  3U78 A;  2E8I A;  3J7Y q;  3LBX B;  3ZYL A;  2PJQ A;  4TZ4 C;  4QX7 B;  2RP4 A;  3PTR B;  3KVB A;  3ZC0 A;  5FXZ A;  2A3D A;  3N9P A;  4TN7 B;  4WBO A;  1NAF A;  5C8Y E;  2CMR A;  1YKH B;  3KDS E;  3UUM A;  2E9X D;  1D0Z A;  1QUU A;  3C50 A;  3OYX A;  4PAG A;  3V5S A;  3CQG B;  3F31 A;  3RC8 A;  2ODU A;  3SWH A;  2E9X C;  4CZZ B;  5J2T E;  3Q5X A;  3ZMU B;  2WAU A;  2L9Q A;  5DAB A;  2CEA A;  2LSJ A;  3GN5 A;  3N9Q A;  3KV6 A;  4AQG A;  1BR1 A;  4PNI A;  3AB3 B;  5F3J A;  3PUQ A;  5LJN A;  3RKO A;  4O2B E;  2NTX A;  2G0U A;  5HWX A;  2X66 A;  2HPJ A;  2NWB A;  3JC6 C;  2YU1 A;  3E08 A;  3ZJ1 A;  2XAS B;  3CX6 B;  3FB2 A;  3EDV A;  4K0U A;  3ZC1 A;  1MIV A;  4HEA A;  3RYC E;  4F6R C;  3E22 E;  4XAX B;  4KMC A;  4I43 B;  4MLK A;  3N9M A;  3ZMZ B;  4IST A;  1WRD A;  3M65 A;  3MK7 C;  3I9W A;  2LOS A;  3PUR A;  2RA1 A;  2VWA A;  4ZHQ E;  3LK2 B;  2CE7 A;  4UV8 B;  4GYR A;  1G8X A;  4BAY B;  5KDM C;  2LSI A;  2LOP A;  2LT3 A;  2EHO B;  4FI5 A;  4C90 A;  2JJ9 A;  4A56 A;  4AKH A;  3O1H A;  1UX4 A;  4C91 A;  2VB6 A;  1US7 B;  2B1E A;  3N5L A;  4JEU B;  4EYU A;  5LXT E;  3FBZ A;  1WYC A;  3RRC A;  3CKD A;  3IF8 B;  3K8P C;  2YK0 A;  4QXH B;  2ZM0 A;  4GOU A;  2W00 A;  4ILU A;  3RYF E;  5HXE A;  3AVR A;  4EAH A;  2XUE A;  5JDG A;  4OK0 A;  3ZYK A;  1U4Q A;  3PUA A;  3V5U A;  2XQY A;  3MZK B;  5HWY A;  5JRE A;  5JRC A;  4AI6 A;  5LP6 E;  4QWN B;  3MJX A;  4NUV A;  4GK5 E;  2V7I A;  5FXX A;  4IHJ E;  2NTY A;  4HE8 A;  3K3N A;  5AFU L;  2QGS A;  3FXD B;  4L9I A;  2IW5 B;  1U5P A;  3AA0 B;  3LG7 A;  2N2N A;  2UXN B;  2WM9 A;  3ETU A;  4YLH A;  4PK6 A;  1HF8 A;  2CLY B;  4X1K E;  2MTQ A;  2JPF A;  5H6Q B;  2D0T A;  3LK3 B;  3KFW X;  1HG5 A;  2KZ7 B;  2CXF A;  3QUJ A;  1D0Y A;  3O4X E;  4UEL A;  4I55 E;  5LHI B;  4HGA A;  3LK4 2;  4TV8 E;  2W62 A;  1YKE B;  2W63 A;  1NWM X;  5E0O A;  3P7I A;  4DBR A;  2IAK A;  4EZH A;  1KK7 A;  3R6N A;  1FEW A;  3O1I A;  3BQK A;  1D1A A;  2QA7 A;  1LRZ A;  2C5J A;  4H9N C;  3N2K E;  1UCU A;  4UF0 A;  2GK9 A;  3FXE B;  4HN9 A;  4ZI3 C;  4DMV A;  3OJA A;  1LKX A;  4JLE A;  3KV9 A;  4L5G A;  5JVD E;  3Q9D A;  2A72 A;  5HXR A;  3ZJ2 A;  2KWH A;  3CML A;  2WSS V;  3HI2 A;  3UFE A;  5IHY A;  4PW8 A;  3QC9 A;  3AAE B;  3Q2M A;  4QXC B;  2X68 A;  3BQL A;  5FXV A;  1OXZ A;  2KMF A;  4QHO A;  4DND A;  2CCQ A;  4UEM A;  4MAL A;  5J2U E;  3CVR A;  3PDY A;  3B57 A;  4AKI A;  3UT5 E;  2CXD A;  1LVF A;  2KT9 A;  2I59 A;  3ONX A;  4IE6 A;  4UV9 B;  1VRB A;  2DHR A;  2VKD A;  3C4W A;  4IE7 A;  1S35 A;  4MFR A;  4MBQ A;  3VKG A;  4XBF B;  5FNV E;  2MYS A;  3IHR A;  2XAF B;  4ISS A;  3NRX A;  1MMD A;  4OYK A;  4KP3 C;  4EOZ B;  5LOV E;  5JDH A;  3N9N A;  4TX5 A;  5JDN A;  4TUY E;  5DQV A;  3PUG A;  5HXC A;  5HYA A;  4YHJ A;  3JC6 D;  1MIY A;  2ODV A;  2VKJ A;  3HR0 A;  5J1G A;  5A1L A;  4TV9 E;  3SOL A;  1T98 A;  2HH7 A;  3UUX B;  2ZMA A;  3O9X A;  1HTJ F;  4HKA A;  2VKH A;  3ZN0 B;  4H63 V;  4DVD A;  4PK4 A;  1VOM A;  1YW0 A;  3MA9 A;  3Q5W A;  4OYJ A;  3FBL A;  2CA5 A;  2XAH B;  2MBG A;  3CQC B;  3C98 B;  3GWH A;  1HCI A;  4AKG A;  2N1G A;  3WAK A;  3UTK A;  1CUN A;  3ESL A;  2EHO A;  2X51 A;  3OKQ A;  4O4I E;  4O4H E;  3HKE E;  2Y6X A;  2LE8 A;  4H9P C;  2ES0 A;  5CB4 E;  3VKH A;  1Y64 B;  5CA0 E;  3CPZ A;  3UUL A;  4G63 A;  4EXT A;  2X9H A;  3LFM A;  2CWY A;  4AKL A;  4EZ4 A;  3E0Z A;  5EZY E;  3VHL A;  2X9X A;  4AXP A;  2DI4 A;  1D1B A;  4Z8X A;  2X9Y A;  4BA9 A;  3H37 A;  4I4T E;  3CQX C;  3I9Y A;  3KBU A;  1YD8 G;  3K3Q C;  4G2A A;  2WWU A;  5JR9 B;  4P0A A;  4H9R C;  5HAX A;  1AJ3 A;  4PJM A;  2WMN A;  3ZLI A;  3VU7 H;  3MAC A;  2Y8D A;  3A5X A;  5L3E B;  4X1I E;  2Y48 B;  3ANW A;  3N9O A;  5JDF A;  2LEH A;  2EHO D;  5HXH A;  1IJ5 A;  3C51 A;  2M67 A;  5L3B B;  3NRY A;  4FJO A;  2EHO C;  3ANW B;  5M4Y A;  3HKD E;  4NUU A;  2L8K A;  4YJ2 E;  5FY0 A;  2H7V C;  2D2S A;  3NZQ A;  5LGN B;  1WYB A;  2VAS A;  3ZCJ A;  1IJ6 A;  2Q9Q A;  3MKD A;  4CQI A;  5JH7 E;  3B13 A;  5IYZ E;  2KWI B;  1EZ3 A;  2PG8 A;  4ZS3 A;  4U74 A;  4ZS2 A;  3ZMS B;  4BJM A;  5LNK A;  3AA6 B;  4IDZ A;  2Q9Q B;  4B6X A;  2VK9 A;  4PFP A;  3C4X A;  4UVA B;  2CWO A;  4ANJ A;  1MND A;  2IC6 A;  1BR0 A;  4DO0 A;  1FIO A;  4ZI3 D;  3EDU A;  2V7M A;  3HKC E;  1MMA A;  3KIN B;  4DBQ A;  3U3I A;  3RYH E;  4HFV A;  4CI1 B;  2K9A A;  1LVK A;  1ZEE A;  2DNX A;  2LJL A;  1V9D A;  2W61 A;  5LBQ B;  3K3O A;  3OBV E;  3ZN1 B;  3N2G E;  3NZP A;  1D1C A;  3DTO A;  5CA1 E;  2DWK A;  5ETW A;  2CLY C;  2NP9 A;  3SS1 A;  1HX8 A;  5FP3 A;  1E1H B;  1IAP A;  3ZCI A;  2DWG A;  2UXX B;  3T8O A;  2JRK A;  4CI2 B;  3CX8 B;  2H7O A;  4WBN E;  3WI3 A;  1KNZ A;  2ACX A;  2Q9Q C;  5JDL A;  3DP7 A;  2CXL A;  3EVY A;  3PU3 A;  4OFZ A;  1QSD A;  2XHE B;  5FXW A;  3ZEF B;  2E9X B;  3KV4 A;  3LJC A;  3R84 B;  2X9W A;  4H9S E;  5LYJ E;  2X67 A;  4ZI7 E;  4IE0 A;  4ADZ A;  2NOX A;  2J1D G;  2D0U A;  4N78 D;  4AQF A;  4ERR A;  3W15 B;  4E7Z A;  4PK5 A;  4X20 E;  4ZI2 C;  5LHG B;  4CXY A;  4I50 E;  2ZLY A;  2NW8 A;  2H3R A;  4UVC B;  3RRW A;  3AAI A;  3N2O A;  2PFV A;  4IIJ E;  4GK0 E;  3AAA B;  5FY7 A;  4GIW A;  2DLR A;  4IE4 A;  5KMG P;  2JMH A;  3RYI E;  4H9Q C;  2LSG A;  3QK6 A;  4PJN A;  4UIG A;  3C4Z A;  3S4U A;  2NW9 A;  4UVB B;  4V1A v;  3RC3 A;  1MMN A;  1WLX A;  3F57 A;  3KBT A;  5JDM A;  2OA5 A;  4QX8 B;  3H3A A;  1G73 A;  3IBP A;  5FY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...