3J9X1

A virus that infects a hyperthermophile encapsidates a-form dna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
128
structure length
128
Chain Sequence
SRSYSQRYAKWQAKFNAFSNPTVASTILSNVSPVAQQNFQTNVPKFTSVNENVSAVLTQYGITGPNRAIYQGFGLKVARALNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNIITGSPTGYVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords coat protein
publication title A virus that infects a hyperthermophile encapsidates A-form DNA.
pubmed doi rcsb
total genus 50
structure length 128
sequence length 128
chains with identical sequence 2, 3, 4, 5, 6, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x, y, z
ec nomenclature
pdb deposition date 2015-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF12193 Sulf_coat_C Sulfolobus virus coat protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3j9x101
3F2EA 3J9X1 3FBZA 3FBLA
chains in the Genus database with same CATH superfamily
1S35A 4ZEYA 3ZT7A 2CCQA 4TWDA 1WR0A 1MIWA 4G63A 5AQTB 1XMOT 4C91A 4X20E 3Q2MA 2WDVA 3ZT6A 4DV6T 2UXXB 3HKDE 3I1AA 2LM9A 4DR1T 3AVSA 4A56A 1IBKT 4DMWA 3LFMA 2XQAA 4Z8XA 2BS3A 3V5UA 1L0VA 4ILBA 3AAIA 3RPUA 2NP9A 4CXYA 1T8BA 4E7ZA 2FJAA 2CRBA 3ZSSA 2OV9A 3LK42 4HWDA 2XSBA 2GK9A 2JQHA 4BJNA 3AAAB 2UUBT 3CKDA 3AXJA 2KT9A 2YDQA 5JDLA 5LYJE 3CX8B 3AE6A 3AE7A 3LJCA 2RP4A 3JADA 1S94A 3SOLA 2LM2A 1ZHCA 1ZKEA 2M6IA 4DO0A 1GQEA 2Y48B 4HWCA 1G8XA 4O2BE 2W0GA 5L3FB 3KBTA 3M3ZB 2LKGA 4AISA 3ZN0B 3PUAA 1U4QA 4XZCA 3IBPA 4F8HA 2NTYA 1OXZA 2W66A 4I43B 2UXDT 2X0YA 4U31A 2HPLA 4YHHT 5HCMA 3CMLA 4TUYE 5J2UE 2DNXA 1B7TA 3R6NA 3KFWX 1JNZA 5L4EA 2BDEA 3PUZF 3PUVF 4JI2T 2KWIB 2J4GA 4HFIA 3FXEB 2CHNA 1J5WA 4JI0T 1FIOA 2LRKA 5ABGA 2OA5A 5HEUA 2CMRA 5FVKA 4DMVA 3N9QA 2C5IT 5AQJB 4TV9E 2UXBT 2E2AA 5A1LA 2I59A 4CN6A 3O9XA 4KHPT 4H9OC 3UQ4A 3S4UA 3PUSA 1BR0A 4ISTA 3KVBA 5C3JA 3RHWA 1NAFA 4U7IA 4MBQA 4U72A 3SWHA 4I0UA 2X9HA 4ZS3A 3WAJA 4IE7A 3PJAJ 2WMNA 2QRXA 4JV5T 2BKNA 2HN1A 2Q9QA 4NXNT 2YKSA 4E7SA 4COFA 3KBUA 3RQWA 3P4PA 2N2NA 4IDPA 3PUQA 3JAFA 2I0MA 2X0LB 2WBLA 1T72A 3U78A 4WW0A 2PJQA 3TLSA 2IW5B 2XQ6A 3N9MA 3B13A 3VU7H 2YK0A 2X68A 2JPFA 3FBLA 2VB6A 2BS2A 2KLQA 4ZZCA 2QYWA 3AA6B 3RRCA 3VRBA 2BKOA 3ZC0A 5FL1A 2JJ9A 5LJNA 3H37A 2V5CA 4UELA 4M1PA 2IHR1 2ACXA 2A3DA 2PG8A 2YDRA 2V7KA 3ZSTA 3W15B 3GMIA 2DCFA 5HEJA 3QK6A 2D2SA 3OKQA 5JDHA 3CX6B 2VWAA 3ETUA 4CI1B 2MBGA 1XNRT 4HTEA 4YSYA 1XMQT 5LHGB 3RGLA 1LKXA 2VL8A 4EYYR 4GK0E 4YSZA 2I6HA 5LGNB 2CXFA 2WMOA 2WDRA 1V9DA 4ISSA 1H7CA 1IJ6A 4F6RC 4L9IA 4UF0B 2KNDA 4AXPA 3UTKA 3AEDA 5EK2A 4X64T 2JQ9A 5C8YE 3AXJB 3RYFE 3QOFA 1QSDA 1KNPA 3R84B 2XQ5A 4HWFA 4P09A 3NRXA 4H9NC 4OK0A 4JYAT 3P7IA 1UURA 1CHUA 4QH4A 3V5SA 2D0UA 3IA3A 5J2TE 1KNRA 3PURA 1N34T 2VQET 1MNEA 2CEAA 4ZOLE 1YQ3A 4GYRA 1OEDE 1E7PA 3LG7A 5CA1E 4OHFA 4CZZB 2YU1A 2W67A 2LHNA 1HFAA 4ZI2D 4WNKA 2LSGA 2NW9A 2VKJA 3C4XA 2EHOC 3ZMSB 4DVDA 4HFVA 3LBXA 5HEGA 4AIUA 2ODUA 2IDOB 4NXMT 2LE8A 3EUHA 4IE5A 4PJLA 2KWHA 5AQHB 2V7LA 4PK6A 3CQXC 3ZT5A 3Q9DA 1MMGA 2LSYA 5HCJA 4UR9A 3N2OA 1BR1A 4G2AA 5HXCA 2Y6XA 5H6QB 3ZCJA 3ESLA 2DWKA 2XASB 3RIAA 3OJAA 4X1YE 4ILAA 3ZKRA 3NVOA 5LBQB 1W9RA 3MZKB 1UK5A 3FB2A 3P8CD 3AE2A 3AE8A 4K0KT 3NZQA 3OTOT 2KINB 2YINA 5HXEA 4YJ2E 1D0YA 3RC8A 3FZHB 4LF4T 5ABFA 1X9BA 4BAYB 4EEBA 3O1JA 4TWHA 4BJMA 2Q9QB 4DR7T 2AE9A 3AECA 2B76A 4IREA 4TZ4C 3WI3A 3GN5A 2IAKA 1UX5A 3K3OA 3NZPA 4PAGA 5AQVB 4YHJA 4NPPA 3CPZA 5KXJA 2E9XB 2BVMA 4DR4T 4ZI2C 2J47A 4KUMB 2BG9C 3KV5A 3B57A 1LRZA 3ZMVB 2CHOA 1I6ZA 3HKEE 3M65A 2XQ4A 3RIFA 1KK7A 2XJ7A 4DR5T 4YTPA 1W0AA 4YTNA 2VKOA 3ZCIA 3Q5XA 4LF9T 2CBJA 2ACZA 4X5TA 3T1YT 3SFEA 5J1GA 2IIUA 1MMNA 2QGSA 4JI8T 1D1CA 2V1DB 3F2EA 2L9QA 3ZEFB 5JH7E 4GYSA 1I94T 2XTLA 2UUAT 1ZV4X 3KVAA 2FJBA 2V26A 2RA1A 3FXDB 4DV5T 2HH7A 2LHRA 2CA5A 1HG5A 2J1DG 3BQLA 3OYZA 4JI5T 2C5JA 2LRLA 5JRCB 2H7VC 4TV8E 3C4ZA 3SS1A 5ETWA 3LK2B 4QKNA 4AQYT 1DU2A 4DUZT 2QVAA 2VASA 2BVLA 2XQYA 5F3JA 3GWHA 4LMKA 3N9NA 2BZBA 3N2GE 2MYSA 4X1IE 3Q5WA 5AQIB 4OX9T 3FZFB 2CBIA 5L2LA 5FKYA 2EHOA 4PJJA 3E0ZA 3PU8A 4Z90A 5AQPB 4P0AA 3PV0F 3N9LA 3NWIA 4N78D 4ASKA 5HWXA 4GKKT 3PUGA 1XDPA 3AA0B 2UXNB 2BKPA 5FY0A 3JAEA 1M62A 2IC6A 3NKZA 3EVYA 1OEDB 1WYBA 5AQGB 4IL4A 2JIWA 3AEGA 3HI2A 2Y8DA 4LF6T 5JR9C 3L3PA 3QB5A 4ZXLA 4U2ZA 3KDSE 3UQ7A 4JI1T 3FZKB 3PE0A 4KBMB 2WY2A 4FJOA 4LF7T 3AA1B 1IBLT 3OBVE 1HTJF 1MNDA 2NR4A 3C4WA 3F57A 4A5XA 3NBXX 2J62A 4UV8B 4LF5T 4Q25A 2YN6A 2V8SV 4K0UA 4YY3T 3VRAA 5FNVE 1R8IA 1IBMT 5JREA 5FVLA 3GN5B 4EYUA 2BG9A 4C90A 4EB6E 4P0BA 1HF8A 4CN4A 3RYIE 4TNVA 4I55E 4JI6T 1OWAA 2FUPA 5LG4A 3MKDA 4QX8B 2HPJA 2LLYA 5IUXA 5AQUB 2ZM0A 1YXRA 3CX7B 3ZYKA 2H89A 4LFAT 3UUMA 1FEWA 2WZIA 3X1DA 4ILCA 3J7Yq 4EIWA 3MXZA 3UUBA 5LHIB 3LK3B 5GONE 3UFEA 5AQQB 3KV9A 4UV9B 1IZNB 4UXNB 2FBWA 5LG3A 2E5LT 1E2AA 3K1SA 3FZMB 3ZYMA 3AE4A 4IT4A 2KZ7B 4QXHB 4AKGA 3AEBA 2UUCT 1KNZA 1SA0E 5FXWA 1JNRA 3L8RA 3IHRA 3LSVA 3AB3B 3ZPOA 2ZMAA 3MK7C 5LBMA 2X66A 1KFYA 3PUXF 5HWYA 2SPCA 4QX7B 2UXCT 4V1Av 3CQGB 4DBRA 1Y64B 2W2UA 5AQMB 4H9RC 2CM0A 4TX5A 5L3CB 5LCYA 2L3LA 5LGUB 3SFDA 3RRWA 1D0ZA 5FY1A 2EHOD 5HYAA 2LKHA 4ANJA 5JDGA 4AQGA 4KMCA 5AQRB 2YU2A 2Z6EA 1NWMX 5KX5E 4HFDA 1IAPA 5CB4E 2JMKA 3A5XA 4YJ3E 2UU9T 4QHOA 3TLTA 1LVFA 3RLFF 2NW7A 2V5DA 3EABA 3T8OA 4TN7B 2DLRA 5CJ5A 2CWYA 4X1KE 5AQLB 3ABVA 4AKHA 3UU6A 5C2TA 1QUUA 4IL9A 2X51A 1UUSA 2MTQA 2XQ3A 5JR9A 4YSXA 2BBHA 2PTFA 5LJMA 1N33T 4ADZA 5FXXA 5DQWA 5ADXL 2ZM6T 3DJBA 3Q5DA 4IDNA 1WRDA 2KMFA 3HL6A 4EV6A 2XM2A 2YEVC 4ZZBA 3AE1A 4U7YA 4IGUA 5F5WA 4JUYA 2VL0A 2L8KA 5CA0E 3PDYA 3AEAA 1N32T 1VCTA 5M4YA 4B3MT 2CLYC 3RYHE 3K3QC 5FP3A 4YFSA 4ERRA 1WCRA 1M7KA 4KX6A 2K5BB 2JMHA 2X0HA 1NENA 5JDMA 1IJ5A 3TLUA 1X79A 4JI3T 5DABA 4DUYT 3CVRA 1US7B 2RPAA 3VR9A 1WYCA 4B6XA 2LSKA 3HKCE 1G73A 4IDZA 4GIWA 3KINB 3RC3A 2K9AA 3WAKA 3VKGA 4DV4T 3A8YC 2VKDA 2XQ8A 3E22E 2VVSA 3UUNA 3MJXA 4B3RT 1J1JA 5LNKA 3GA8A 4A97A 5FL0A 1Y01A 1ZP0A 4JLEA 4XBFB 4QXBB 1D1BA 3AEFA 2VKHA 3UU5A 4DV3T 4JEHB 1HX8A 5JQGE 3O1HA 2VURA 4AKLA 3JCFA 2VK9A 4IDOA 1WFDA 4GKJT 2WDQA 2N9DA 4EGWA 1NEKA 1XNQT 5LA6E 5LGTB 5L3DB 3ZC1A 2A72A 2WP9A 2HHHT 2W4XA 1HR0T 4PJNA 3J9X1 5JDFA 5FYMA 1BR2A 2MOZA 2K48A 4H63H 3VKHA 2N1GA 4IE6A 3ZJ1A 3ONJA 4WYVA 3UUXB 5IYZE 1SHZC 3N2KE 2NW8A 1HNXT 2W63A 1MIVA 3AVRA 4B3ST 3E08A 3FHNA 1UX4A 1MMAA 2CPTA 3ANWA 3ZYLA 2WZHA 4EXTA 4A98A 3Q5EA 2LEHA 2LJLA 2VVNA 1SE7A 3UT5E 3DP7A 2M67A 4EZHA 2CWOA 1XWMA 3EDVA 3QB5K 1SUMB 3CQCB 2FJDA 4DNDA 5HEHA 2IC9A 3QNUA 2WCAA 3BK9A 1W0BA 4MHCA 2BBJA 2C0SA 2CXDA 3AAEB 3D0TA 2CE7A 2DI4A 2KSRA 3ZJ2A 1KEYA 4DV7T 2LT3A 3PUYF 4GK5E 2ODVA 3U3IA 3UU8A 4CI3B 3K8PC 4I4TE 5DJQC 3L39A 4DR2T 3AEEA 1UCUA 4AQFC 5HXHA 3N9OA 3ZN1B 4NIQA 4HFHA 4OYKA 5JDQA 4QXCB 4ZS2A 2A9UA 3LBXB 2PFVA 4AKIA 4HFBA 5ABEA 3C64A 2VQFT 4L5GA 3TKLB 4AKRB 3G06A 4HN9A 1HNWT 2WS3A 2D5UA 3IEEA 4UF0A 4YXDA 2XZEA 1Z0PA 2H3RA 3AE5A 4PJMA 3P4SA 2X67A 2BG9E 1YKHB 5L3EB 1VCSA 4MLKA 5AQOB 4P1NA 5L3GB 4H9SE 4ZI7E 2V6YA 3B5MA 5IHYA 2XQ7A 3CK6A 3RF1A 4FI5A 4LF8T 5ABFB 2XAGB 4PNIA 3SRZA 5KMGP 2MAWA 3ETVA 4X66T 1VRBA 4NUUA 4JI4T 1N36T 2LOSA 3HA4A 4OFZA 2W61A 5IWAT 3DTOA 3F31A 1EZ3A 3AE3A 4KP3C 4CXWA 1FMWA 2LSIA 1YQ4A 2F4VT 3QC9A 4UVBB 1Z8UA 1FMVA 1W09A 4DV2T 2JQKA 3RH3A 4QWNB 4J2CA 3H3MA 4GOUA 3UFGA 5BMVE 2X9YA 2LSJA 4Z91A 1OEDC 3HR0A 4KHZF 2DWGA 2XPKA 3EI0A 3P4QA 3I0OA 4UIGA 4H9PC 2H88A 3RQUA 3PJAA 4PFPA 5H6RB 4HKAA 5AFUL 4IE4A 2W00A 4WBOA 3A7MA 2ZM8A 3RYCE 1T7SA 3RIUA 3ANWB 4B3TT 1QLBA 3FZLB 2IUBA 5LMNT 4L0RA 4HE8A 3N5LA 5FXVA 4DR6T 1AJ3A 1HG2A 2X9WA 4O4HE 4QH5A 4U2YA 4X62T 2WSSV 2CXLA 5JDNA 5L47A 2X9XA 2FJEA 1XZYA 2XHEB 4TWFA 2E9XA 4MALA 3CIRA 4HFEA 3RKOA 5LP6E 5HXRA 2AXDS 4H63V 4PK4A 1E1HB 4UEMA 1VOMA 5CGMA 4AQFA 2P9BA 4WBNE 4LFBT 1HS7A 4DV1T 2XQ9A 1WR6A 3JC6D 4MFRA 3T1HT 2EHOB 5AQKB 4IIJE 4QH1A 4NUVA 2C5KT 2CLYB 3CWZB 2NWBA 3MACA 2ZLYA 2M6BA 4EEDA 3IF8B 2DHRA 4AI6A 3I0QA 2YDSA 4HWHA 4DV0T 4HGAA 4PK5A 3LDQB 3ZMUB 2WWUA 4XAXB 3EDUA 3ZMTB 3MA9A 4LMJA 5HXSA 5FXZA 3ZLIA 4YTMA 4LFCT 5JRCA 3BQIA 2K24A 3PTRB 4EZ4A 2XAQB 3P4RA 5FY7A 4O4JE 3KV4A 2YOEA 1HNZT 3UU4A 4HWIB 4IDQA 5FMNA 4EAHA 2V6YB 2WU2A 3N9PA 5F8PA 5AQFB 4DR3T 2V7JA 1KF6A 2XAHB 5CFBA 2ES0A 4CI2B 5LHHB 4KI0F 4I50E 3P50A 2R6GF 2HN2A 1J5ET 3PU3A 3ONXA 2JRKA 1XDOA 3KV6A 4TNWA 5BR8T 4ZHQE 3HKBE 3BQKA 3RKGA 2XM1A 3K3NA 2JQQA 5JVDE 5HEOA 2DL1A 2BG9B 2V7MA 3JC6C 5E0OA 3EHZA 3VR8A 4BA9A 2E5VA 3ONLC 4ZI3D 5LXTE 3EAMA 5DQVA 4OYJA 4YT0A 4HEAA 3OVUA 2K3WA 3OYXA 1HX1B 1OEDA 4X65T 5L4HA 3C98B 1O3XA 3O1IA 5LOVE 4CXXA 3ZMZB 2XUEA 2E8IA 3C51A 4PW8A 5LB7B 2LOPA 3AA7B 4LMLA 2Q9QD 4IE0A 3FBZA 2WB5A 1ZEEA 4JEUB 4O8SA 1FJGT 2WM9A 1MIYA 2KXPB 2WU5A 3RI5A 3NRYA 2PBIA 3O4XE 5EZYE 4H9QC 3RX6A 2XAFB 2E9XD 5L3BB 2W62A 2NOXA 3TLWA 5EK3A 2ZM2A 4O4LE 2H7OA 4CQIA 4JI7T 1CUNA 2WWVA 5EK4A 2XAJB 3AE9A 3VHLA 2QA7A 2V7IA 2MPKA 4ILUA 3QUJA 2BS4A 4U3CA 5AQSB 2A2FX 4WZXA 1MMDA 1ZOYA 3OPCA 1YW0A 2V6XA 4U33A 1D1AA 3I9YA 3C50A 1BR4A 1T98A 2XY8B 4HFCA 4ZI3C 3UULA 4JBWF 4DIDB 5TAOA 2IMLA 3P4WA 4O4IE 2B1EA 2NTXA 5JTGA 2D0TA 1U5PA 4UVCB 1D0XA 2XSAA 2WQYA 4EOZB 1HCIA 1LVKA 4DBQA 3UU3A 3I9WA 2WAUA 4O2AE 4PFOA 2OLTA 2G0UA 5ABHA 4YLHA 3RIUC 1YD8G 1UGOA 4U74A 1WLXA 1YKEB 3PUWF 5AQNB 5HAXA 5J0ZA 2D9DA 2Q9QC 3TLVA 4IHJE 3L09A 5JR9B 5LMUT 5KDMC 4CN1A 4UVAB 3H3AA 2E9XC
chains in the Genus database with same CATH topology
1S35A 3DTOA 3F31A 3MZKB 1EZ3A 2CCQA 4KP3C 3FB2A 3P8CD 3T8OA 4CXWA 3NZQA 1MIWA 1FMWA 2KINB 2YINA 2LSIA 4G63A 5HXEA 4YJ2E 1D0YA 3QC9A 4TN7B 4UVBB 4C91A 4X20E 3Q2MA 2DLRA 3RC8A 2CWYA 1FMVA 4X1KE 2UXXB 3HKDE 4AKHA 3I1AA 2LM9A 3RH3A 4QWNB 4BAYB 1QUUA 3AVSA 4J2CA 4GOUA 4A56A 3O1JA 4DMWA 4BJMA 2X51A 2Q9QB 5BMVE 3LFMA 2X9YA 2MTQA 2LSJA 4Z8XA 4TZ4C 5JR9A 3WI3A 3GN5A 3V5UA 2IAKA 1UX5A 3K3OA 3NZPA 4PAGA 4YHJA 3HR0A 5LJMA 2DWGA 3AAIA 3RPUA 3CPZA 2E9XB 3I0OA 4UIGA 4H9PC 2NP9A 2BVMA 4ADZA 4CXYA 5FXXA 5DQWA 5ADXL 4PFPA 5H6RB 4ZI2C 4HKAA 4KUMB 5AFUL 3DJBA 4E7ZA 3KV5A 3B57A 4IE4A 1LRZA 2W00A 4WBOA 3ZMVB 3HKEE 1WRDA 3RYCE 2ZM8A 3M65A 2KMFA 3HL6A 3LK42 3ANWB 1KK7A 2GK9A 4BJNA 2YEVC 3AAAB 4L0RA 3CKDA 4HE8A 3N5LA 2VKOA 3ZCIA 5FXVA 2KT9A 5JDLA 3Q5XA 4IGUA 1AJ3A 5LYJE 1HG2A 2X9WA 4O4HE 3CX8B 4JUYA 2L8KA 2WSSV 2CXLA 5JDNA 3LJCA 5J1GA 2RP4A 2X9XA 1MMNA 5CA0E 3PDYA 2QGSA 2XHEB 5M4YA 2E9XA 4MALA 2CLYC 1S94A 1D1CA 3RYHE 3SOLA 2V1DB 3F2EA 3K3QC 1ZHCA 2L9QA 5FP3A 3RKOA 1ZKEA 4YFSA 4DO0A 3ZEFB 5JH7E 4GYSA 4ERRA 2Y48B 5LP6E 5HXRA 1G8XA 2XTLA 4O2BE 2W0GA 4H63V 4PK4A 1E1HB 2K5BB 1ZV4X 2JMHA 5L3FB 3KVAA 3KBTA 2V26A 1VOMA 4UEMA 5JDMA 2RA1A 3ZN0B 1IJ5A 3FXDB 3PUAA 1X79A 1U4QA 4AQFA 5DABA 4XZCA 2HH7A 2LHRA 3IBPA 2P9BA 4WBNE 1HS7A 2CA5A 2NTYA 1OXZA 3CVRA 4I43B 1US7B 2HPLA 1HG5A 2J1DG 3BQLA 1WYCA 1WR6A 4B6XA 2LSKA 3JC6D 3OYZA 3HKCE 2C5JA 4MFRA 3CMLA 1G73A 4IDZA 4TUYE 5JRCB 5J2UE 2DNXA 2H7VC 1B7TA 4GIWA 4TV8E 3KINB 3C4ZA 3SS1A 2EHOB 3RC3A 3R6NA 5ETWA 2K9AA 3KFWX 4IIJE 3WAKA 2BDEA 4NUVA 3LK2B 3VKGA 2C5KT 4QKNA 2CLYB 3CWZB 2NWBA 2KWIB 3MACA 2ZLYA 2VKDA 3E22E 3IF8B 3FXEB 2VASA 2DHRA 4AI6A 2BVLA 2XQYA 1FIOA 3I0QA 3MJXA 3UUNA 5F3JA 5LNKA 3GA8A 2OA5A 3GWHA 2CMRA 3N9NA 4DMVA 3N9QA 4HGAA 2C5IT 2BZBA 4TV9E 3N2GE 4PK5A 3ZMUB 5A1LA 2WWUA 4JLEA 2I59A 4XAXB 3EDUA 3ZMTB 2MYSA 4X1IE 4XBFB 3Q5WA 4QXBB 3O9XA 3MA9A 5HXSA 5FXZA 1D1BA 4H9OC 3ZLIA 3S4UA 5L2LA 3PUSA 5JRCA 2VKHA 3BQIA 2K24A 1BR0A 2EHOA 4PJJA 3PTRB 4EZ4A 2XAQB 4ISTA 4JEHB 1HX8A 3E0ZA 3PU8A 3KVBA 5FY7A 5JQGE 3O1HA 4O4JE 4AKLA 1NAFA 3KV4A 2VK9A 4MBQA 4U72A 2N9DA 3SWHA 4P0AA 3N9LA 4ZS3A 2X9HA 4N78D 4ASKA 3WAJA 5LA6E 5LGTB 4IE7A 5L3DB 3ZC1A 5HWXA 2A72A 5FMNA 2WMNA 4EAHA 3PUGA 3N9PA 5F8PA 3AA0B 2UXNB 4PJNA 3J9X1 5JDFA 5FY0A 2Q9QA 2V7JA 5FYMA 2XAHB 2ES0A 2IC6A 1BR2A 3EVYA 4CI2B 4E7SA 5LHHB 4I50E 2MOZA 1WYBA 2K48A 3KBUA 4H63H 3PU3A 3ONXA 2JRKA 3KV6A 3VKHA 2N1GA 2N2NA 4IE6A 3PUQA 3ZJ1A 4ZHQE 3HI2A 2X0LB 3HKBE 3BQKA 2WBLA 2Y8DA 3UUXB 5IYZE 3U78A 3K3NA 2PJQA 4WW0A 2JQQA 5JVDE 2IW5B 5JR9C 1SHZC 3L3PA 3N9MA 3B13A 3N2KE 2NW8A 3VU7H 2YK0A 3KDSE 2V7MA 2X68A 3PE0A 4KBMB 2JPFA 3JC6C 2W63A 1MIVA 4FJOA 5E0OA 3AVRA 3FBLA 3AA1B 3E08A 3FHNA 1HTJF 1UX4A 1MNDA 1MMAA 3OBVE 4BA9A 3C4WA 3ANWA 3ZYLA 2VB6A 4ZI3D 2KLQA 5LXTE 3F57A 3AA6B 3RRCA 4EXTA 3ZC0A 5DQVA 2JJ9A 5LJNA 3H37A 2LEHA 4OYJA 4UELA 4M1PA 2LJLA 4HEAA 3NBXX 2ACXA 3DP7A 4UV8B 3UT5E 2M67A 2A3DA 2PG8A 2V7KA 4EZHA 2CWOA 4K0UA 3OYXA 3W15B 3EDVA 3CQCB 4DNDA 3GMIA 2DCFA 3QK6A 2D2SA 2IC9A 3OKQA 5FNVE 5JDHA 3C98B 3CX6B 2VWAA 3ETUA 5JREA 4CI1B 2MBGA 1O3XA 3O1IA 4HTEA 5LOVE 3BK9A 3GN5B 5LHGB 4EYUA 4MHCA 1LKXA 2C0SA 2VL8A 4C90A 2CXDA 4EB6E 3AAEB 3D0TA 4CXXA 3ZMZB 4P0BA 1HF8A 2XUEA 2E8IA 4EYYR 2CE7A 2DI4A 3C51A 4PW8A 3RYIE 4I55E 2LOPA 3AA7B 4GK0E 3ZJ2A 2Q9QD 1OWAA 4IE0A 5LG4A 3FBZA 3MKDA 5LGNB 1ZEEA 2CXFA 2LT3A 4GK5E 4JEUB 4O8SA 2HPJA 2ODVA 2WMOA 4QX8B 3U3IA 4CI3B 2WM9A 3K8PC 1MIYA 2KXPB 4I4TE 1V9DA 3NRYA 4ISSA 5DJQC 1H7CA 1IJ6A 2ZM0A 2PBIA 3O4XE 5EZYE 4F6RC 4L9IA 3CX7B 4UF0B 3ZYKA 1UCUA 2KNDA 4H9QC 3RX6A 4AXPA 2XAFB 2E9XD 4AQFC 5L3BB 3UTKA 5HXHA 2W62A 3N9OA 5EK2A 2NOXA 5EK3A 3UUMA 5C8YE 2ZM2A 3RYFE 4O4LE 2H7OA 4CQIA 1CUNA 1FEWA 1QSDA 3ZN1B 5EK4A 3J7Yq 2XAJB 4EIWA 3MXZA 3VHLA 2QA7A 5LHIB 3R84B 3LK3B 2V7IA 4P09A 3NRXA 4H9NC 4OYKA 4OK0A 5GONE 3UFEA 5JDQA 4QXCB 4ZS2A 4ILUA 3KV9A 3P7IA 3LBXB 3QUJA 2PFVA 4AKIA 2A2FX 3V5SA 2D0UA 3C64A 1MMDA 4UV9B 5J2TE 3PURA 1IZNB 4L5GA 4UXNB 3TKLB 1MNEA 3ZYMA 2CEAA 4ZOLE 1YW0A 4AKRB 2KZ7B 4GYRA 4HN9A 4QXHB 1D1AA 3I9YA 3C50A 4AKGA 1BR4A 2D5UA 1T98A 3LG7A 5CA1E 3IEEA 4UF0A 4OHFA 1SA0E 5FXWA 1KNZA 4ZI3C 3UULA 4CZZB 3IHRA 5TAOA 1Z0PA 3AB3B 2YU1A 2H3RA 4O4IE 2B1EA 3ZPOA 2ZMAA 2LHNA 3MK7C 5LBMA 4PJMA 2NTXA 1HFAA 4ZI2D 2X66A 2X67A 4WNKA 2D0TA 1YKHB 1U5PA 2LSGA 4UVCB 5HWYA 5L3EB 1D0XA 2SPCA 2NW9A 2VKJA 4QX7B 4V1Av 3CQGB 3C4XA 4DBRA 2EHOC 1Y64B 3ZMSB 4EOZB 1HCIA 4H9RC 4MLKA 4DVDA 4HFVA 1LVKA 5L3GB 4H9SE 4ZI7E 3LBXA 2CM0A 4TX5A 4DBQA 5L3CB 5LCYA 2L3LA 2ODUA 5LGUB 3I9WA 2LE8A 2WAUA 3RRWA 3EUHA 4IE5A 4PJLA 2KWHA 1D0ZA 4O2AE 4PFOA 5IHYA 2V7LA 2G0UA 4PK6A 4YLHA 3CQXC 5FY1A 1YD8G 4FI5A 4U74A 3Q9DA 1MMGA 1WLXA 2EHOD 5HYAA 2XAGB 4ANJA 1YKEB 4PNIA 5JDGA 5HAXA 2LSYA 4AQGA 3N2OA 1BR1A 4G2AA 2Q9QC 4KMCA 2Y6XA 5HXCA 5H6QB 3SRZA 4IHJE 3ZCJA 5KMGP 2YU2A 2Z6EA 3ESLA 1NWMX 3L09A 3ETVA 5KX5E 1VRBA 4NUUA 5JR9B 2DWKA 1IAPA 2XASB 5CB4E 3OJAA 2JMKA 4X1YE 5KDMC 2LOSA 3HA4A 3A5XA 4YJ3E 4OFZA 4QHOA 4UVAB 2W61A 1LVFA 5LBQB 3H3AA 2NW7A 2E9XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2E A;  3J9X 1;  3FBZ A;  3FBL A; 
#chains in the Genus database with same CATH topology
 1S35 A;  4ZEY A;  3ZT7 A;  2CCQ A;  4TWD A;  1WR0 A;  1MIW A;  4G63 A;  5AQT B;  1XMO T;  4C91 A;  4X20 E;  3Q2M A;  2WDV A;  3ZT6 A;  4DV6 T;  2UXX B;  3HKD E;  3I1A A;  2LM9 A;  4DR1 T;  3AVS A;  4A56 A;  1IBK T;  4DMW A;  3LFM A;  2XQA A;  4Z8X A;  2BS3 A;  3V5U A;  1L0V A;  4ILB A;  3AAI A;  3RPU A;  2NP9 A;  4CXY A;  1T8B A;  4E7Z A;  2FJA A;  2CRB A;  3ZSS A;  2OV9 A;  3LK4 2;  4HWD A;  2XSB A;  2GK9 A;  2JQH A;  4BJN A;  3AAA B;  2UUB T;  3CKD A;  3AXJ A;  2KT9 A;  2YDQ A;  5JDL A;  5LYJ E;  3CX8 B;  3AE6 A;  3AE7 A;  3LJC A;  2RP4 A;  3JAD A;  1S94 A;  3SOL A;  2LM2 A;  1ZHC A;  1ZKE A;  2M6I A;  4DO0 A;  1GQE A;  2Y48 B;  4HWC A;  1G8X A;  4O2B E;  2W0G A;  5L3F B;  3KBT A;  3M3Z B;  2LKG A;  4AIS A;  3ZN0 B;  3PUA A;  1U4Q A;  4XZC A;  3IBP A;  4F8H A;  2NTY A;  1OXZ A;  2W66 A;  4I43 B;  2UXD T;  2X0Y A;  4U31 A;  2HPL A;  4YHH T;  5HCM A;  3CML A;  4TUY E;  5J2U E;  2DNX A;  1B7T A;  3R6N A;  3KFW X;  1JNZ A;  5L4E A;  2BDE A;  3PUZ F;  3PUV F;  4JI2 T;  2KWI B;  2J4G A;  4HFI A;  3FXE B;  2CHN A;  1J5W A;  4JI0 T;  1FIO A;  2LRK A;  5ABG A;  2OA5 A;  5HEU A;  2CMR A;  5FVK A;  4DMV A;  3N9Q A;  2C5I T;  5AQJ B;  4TV9 E;  2UXB T;  2E2A A;  5A1L A;  2I59 A;  4CN6 A;  3O9X A;  4KHP T;  4H9O C;  3UQ4 A;  3S4U A;  3PUS A;  1BR0 A;  4IST A;  3KVB A;  5C3J A;  3RHW A;  1NAF A;  4U7I A;  4MBQ A;  4U72 A;  3SWH A;  4I0U A;  2X9H A;  4ZS3 A;  3WAJ A;  4IE7 A;  3PJA J;  2WMN A;  2QRX A;  4JV5 T;  2BKN A;  2HN1 A;  2Q9Q A;  4NXN T;  2YKS A;  4E7S A;  4COF A;  3KBU A;  3RQW A;  3P4P A;  2N2N A;  4IDP A;  3PUQ A;  3JAF A;  2I0M A;  2X0L B;  2WBL A;  1T72 A;  3U78 A;  4WW0 A;  2PJQ A;  3TLS A;  2IW5 B;  2XQ6 A;  3N9M A;  3B13 A;  3VU7 H;  2YK0 A;  2X68 A;  2JPF A;  3FBL A;  2VB6 A;  2BS2 A;  2KLQ A;  4ZZC A;  2QYW A;  3AA6 B;  3RRC A;  3VRB A;  2BKO A;  3ZC0 A;  5FL1 A;  2JJ9 A;  5LJN A;  3H37 A;  2V5C A;  4UEL A;  4M1P A;  2IHR 1;  2ACX A;  2A3D A;  2PG8 A;  2YDR A;  2V7K A;  3ZST A;  3W15 B;  3GMI A;  2DCF A;  5HEJ A;  3QK6 A;  2D2S A;  3OKQ A;  5JDH A;  3CX6 B;  2VWA A;  3ETU A;  4CI1 B;  2MBG A;  1XNR T;  4HTE A;  4YSY A;  1XMQ T;  5LHG B;  3RGL A;  1LKX A;  2VL8 A;  4EYY R;  4GK0 E;  4YSZ A;  2I6H A;  5LGN B;  2CXF A;  2WMO A;  2WDR A;  1V9D A;  4ISS A;  1H7C A;  1IJ6 A;  4F6R C;  4L9I A;  4UF0 B;  2KND A;  4AXP A;  3UTK A;  3AED A;  5EK2 A;  4X64 T;  2JQ9 A;  5C8Y E;  3AXJ B;  3RYF E;  3QOF A;  1QSD A;  1KNP A;  3R84 B;  2XQ5 A;  4HWF A;  4P09 A;  3NRX A;  4H9N C;  4OK0 A;  4JYA T;  3P7I A;  1UUR A;  1CHU A;  4QH4 A;  3V5S A;  2D0U A;  3IA3 A;  5J2T E;  1KNR A;  3PUR A;  1N34 T;  2VQE T;  1MNE A;  2CEA A;  4ZOL E;  1YQ3 A;  4GYR A;  1OED E;  1E7P A;  3LG7 A;  5CA1 E;  4OHF A;  4CZZ B;  2YU1 A;  2W67 A;  2LHN A;  1HFA A;  4ZI2 D;  4WNK A;  2LSG A;  2NW9 A;  2VKJ A;  3C4X A;  2EHO C;  3ZMS B;  4DVD A;  4HFV A;  3LBX A;  5HEG A;  4AIU A;  2ODU A;  2IDO B;  4NXM T;  2LE8 A;  3EUH A;  4IE5 A;  4PJL A;  2KWH A;  5AQH B;  2V7L A;  4PK6 A;  3CQX C;  3ZT5 A;  3Q9D A;  1MMG A;  2LSY A;  5HCJ A;  4UR9 A;  3N2O A;  1BR1 A;  4G2A A;  5HXC A;  2Y6X A;  5H6Q B;  3ZCJ A;  3ESL A;  2DWK A;  2XAS B;  3RIA A;  3OJA A;  4X1Y E;  4ILA A;  3ZKR A;  3NVO A;  5LBQ B;  1W9R A;  3MZK B;  1UK5 A;  3FB2 A;  3P8C D;  3AE2 A;  3AE8 A;  4K0K T;  3NZQ A;  3OTO T;  2KIN B;  2YIN A;  5HXE A;  4YJ2 E;  1D0Y A;  3RC8 A;  3FZH B;  4LF4 T;  5ABF A;  1X9B A;  4BAY B;  4EEB A;  3O1J A;  4TWH A;  4BJM A;  2Q9Q B;  4DR7 T;  2AE9 A;  3AEC A;  2B76 A;  4IRE A;  4TZ4 C;  3WI3 A;  3GN5 A;  2IAK A;  1UX5 A;  3K3O A;  3NZP A;  4PAG A;  5AQV B;  4YHJ A;  4NPP A;  3CPZ A;  5KXJ A;  2E9X B;  2BVM A;  4DR4 T;  4ZI2 C;  2J47 A;  4KUM B;  2BG9 C;  3KV5 A;  3B57 A;  1LRZ A;  3ZMV B;  2CHO A;  1I6Z A;  3HKE E;  3M65 A;  2XQ4 A;  3RIF A;  1KK7 A;  2XJ7 A;  4DR5 T;  4YTP A;  1W0A A;  4YTN A;  2VKO A;  3ZCI A;  3Q5X A;  4LF9 T;  2CBJ A;  2ACZ A;  4X5T A;  3T1Y T;  3SFE A;  5J1G A;  2IIU A;  1MMN A;  2QGS A;  4JI8 T;  1D1C A;  2V1D B;  3F2E A;  2L9Q A;  3ZEF B;  5JH7 E;  4GYS A;  1I94 T;  2XTL A;  2UUA T;  1ZV4 X;  3KVA A;  2FJB A;  2V26 A;  2RA1 A;  3FXD B;  4DV5 T;  2HH7 A;  2LHR A;  2CA5 A;  1HG5 A;  2J1D G;  3BQL A;  3OYZ A;  4JI5 T;  2C5J A;  2LRL A;  5JRC B;  2H7V C;  4TV8 E;  3C4Z A;  3SS1 A;  5ETW A;  3LK2 B;  4QKN A;  4AQY T;  1DU2 A;  4DUZ T;  2QVA A;  2VAS A;  2BVL A;  2XQY A;  5F3J A;  3GWH A;  4LMK A;  3N9N A;  2BZB A;  3N2G E;  2MYS A;  4X1I E;  3Q5W A;  5AQI B;  4OX9 T;  3FZF B;  2CBI A;  5L2L A;  5FKY A;  2EHO A;  4PJJ A;  3E0Z A;  3PU8 A;  4Z90 A;  5AQP B;  4P0A A;  3PV0 F;  3N9L A;  3NWI A;  4N78 D;  4ASK A;  5HWX A;  4GKK T;  3PUG A;  1XDP A;  3AA0 B;  2UXN B;  2BKP A;  5FY0 A;  3JAE A;  1M62 A;  2IC6 A;  3NKZ A;  3EVY A;  1OED B;  1WYB A;  5AQG B;  4IL4 A;  2JIW A;  3AEG A;  3HI2 A;  2Y8D A;  4LF6 T;  5JR9 C;  3L3P A;  3QB5 A;  4ZXL A;  4U2Z A;  3KDS E;  3UQ7 A;  4JI1 T;  3FZK B;  3PE0 A;  4KBM B;  2WY2 A;  4FJO A;  4LF7 T;  3AA1 B;  1IBL T;  3OBV E;  1HTJ F;  1MND A;  2NR4 A;  3C4W A;  3F57 A;  4A5X A;  3NBX X;  2J62 A;  4UV8 B;  4LF5 T;  4Q25 A;  2YN6 A;  2V8S V;  4K0U A;  4YY3 T;  3VRA A;  5FNV E;  1R8I A;  1IBM T;  5JRE A;  5FVL A;  3GN5 B;  4EYU A;  2BG9 A;  4C90 A;  4EB6 E;  4P0B A;  1HF8 A;  4CN4 A;  3RYI E;  4TNV A;  4I55 E;  4JI6 T;  1OWA A;  2FUP A;  5LG4 A;  3MKD A;  4QX8 B;  2HPJ A;  2LLY A;  5IUX A;  5AQU B;  2ZM0 A;  1YXR A;  3CX7 B;  3ZYK A;  2H89 A;  4LFA T;  3UUM A;  1FEW A;  2WZI A;  3X1D A;  4ILC A;  3J7Y q;  4EIW A;  3MXZ A;  3UUB A;  5LHI B;  3LK3 B;  5GON E;  3UFE A;  5AQQ B;  3KV9 A;  4UV9 B;  1IZN B;  4UXN B;  2FBW A;  5LG3 A;  2E5L T;  1E2A A;  3K1S A;  3FZM B;  3ZYM A;  3AE4 A;  4IT4 A;  2KZ7 B;  4QXH B;  4AKG A;  3AEB A;  2UUC T;  1KNZ A;  1SA0 E;  5FXW A;  1JNR A;  3L8R A;  3IHR A;  3LSV A;  3AB3 B;  3ZPO A;  2ZMA A;  3MK7 C;  5LBM A;  2X66 A;  1KFY A;  3PUX F;  5HWY A;  2SPC A;  4QX7 B;  2UXC T;  4V1A v;  3CQG B;  4DBR A;  1Y64 B;  2W2U A;  5AQM B;  4H9R C;  2CM0 A;  4TX5 A;  5L3C B;  5LCY A;  2L3L A;  5LGU B;  3SFD A;  3RRW A;  1D0Z A;  5FY1 A;  2EHO D;  5HYA A;  2LKH A;  4ANJ A;  5JDG A;  4AQG A;  4KMC A;  5AQR B;  2YU2 A;  2Z6E A;  1NWM X;  5KX5 E;  4HFD A;  1IAP A;  5CB4 E;  2JMK A;  3A5X A;  4YJ3 E;  2UU9 T;  4QHO A;  3TLT A;  1LVF A;  3RLF F;  2NW7 A;  2V5D A;  3EAB A;  3T8O A;  4TN7 B;  2DLR A;  5CJ5 A;  2CWY A;  4X1K E;  5AQL B;  3ABV A;  4AKH A;  3UU6 A;  5C2T A;  1QUU A;  4IL9 A;  2X51 A;  1UUS A;  2MTQ A;  2XQ3 A;  5JR9 A;  4YSX A;  2BBH A;  2PTF A;  5LJM A;  1N33 T;  4ADZ A;  5FXX A;  5DQW A;  5ADX L;  2ZM6 T;  3DJB A;  3Q5D A;  4IDN A;  1WRD A;  2KMF A;  3HL6 A;  4EV6 A;  2XM2 A;  2YEV C;  4ZZB A;  3AE1 A;  4U7Y A;  4IGU A;  5F5W A;  4JUY A;  2VL0 A;  2L8K A;  5CA0 E;  3PDY A;  3AEA A;  1N32 T;  1VCT A;  5M4Y A;  4B3M T;  2CLY C;  3RYH E;  3K3Q C;  5FP3 A;  4YFS A;  4ERR A;  1WCR A;  1M7K A;  4KX6 A;  2K5B B;  2JMH A;  2X0H A;  1NEN A;  5JDM A;  1IJ5 A;  3TLU A;  1X79 A;  4JI3 T;  5DAB A;  4DUY T;  3CVR A;  1US7 B;  2RPA A;  3VR9 A;  1WYC A;  4B6X A;  2LSK A;  3HKC E;  1G73 A;  4IDZ A;  4GIW A;  3KIN B;  3RC3 A;  2K9A A;  3WAK A;  3VKG A;  4DV4 T;  3A8Y C;  2VKD A;  2XQ8 A;  3E22 E;  2VVS A;  3UUN A;  3MJX A;  4B3R T;  1J1J A;  5LNK A;  3GA8 A;  4A97 A;  5FL0 A;  1Y01 A;  1ZP0 A;  4JLE A;  4XBF B;  4QXB B;  1D1B A;  3AEF A;  2VKH A;  3UU5 A;  4DV3 T;  4JEH B;  1HX8 A;  5JQG E;  3O1H A;  2VUR A;  4AKL A;  3JCF A;  2VK9 A;  4IDO A;  1WFD A;  4GKJ T;  2WDQ A;  2N9D A;  4EGW A;  1NEK A;  1XNQ T;  5LA6 E;  5LGT B;  5L3D B;  3ZC1 A;  2A72 A;  2WP9 A;  2HHH T;  2W4X A;  1HR0 T;  4PJN A;  3J9X 1;  5JDF A;  5FYM A;  1BR2 A;  2MOZ A;  2K48 A;  4H63 H;  3VKH A;  2N1G A;  4IE6 A;  3ZJ1 A;  3ONJ A;  4WYV A;  3UUX B;  5IYZ E;  1SHZ C;  3N2K E;  2NW8 A;  1HNX T;  2W63 A;  1MIV A;  3AVR A;  4B3S T;  3E08 A;  3FHN A;  1UX4 A;  1MMA A;  2CPT A;  3ANW A;  3ZYL A;  2WZH A;  4EXT A;  4A98 A;  3Q5E A;  2LEH A;  2LJL A;  2VVN A;  1SE7 A;  3UT5 E;  3DP7 A;  2M67 A;  4EZH A;  2CWO A;  1XWM A;  3EDV A;  3QB5 K;  1SUM B;  3CQC B;  2FJD A;  4DND A;  5HEH A;  2IC9 A;  3QNU A;  2WCA A;  3BK9 A;  1W0B A;  4MHC A;  2BBJ A;  2C0S A;  2CXD A;  3AAE B;  3D0T A;  2CE7 A;  2DI4 A;  2KSR A;  3ZJ2 A;  1KEY A;  4DV7 T;  2LT3 A;  3PUY F;  4GK5 E;  2ODV A;  3U3I A;  3UU8 A;  4CI3 B;  3K8P C;  4I4T E;  5DJQ C;  3L39 A;  4DR2 T;  3AEE A;  1UCU A;  4AQF C;  5HXH A;  3N9O A;  3ZN1 B;  4NIQ A;  4HFH A;  4OYK A;  5JDQ A;  4QXC B;  4ZS2 A;  2A9U A;  3LBX B;  2PFV A;  4AKI A;  4HFB A;  5ABE A;  3C64 A;  2VQF T;  4L5G A;  3TKL B;  4AKR B;  3G06 A;  4HN9 A;  1HNW T;  2WS3 A;  2D5U A;  3IEE A;  4UF0 A;  4YXD A;  2XZE A;  1Z0P A;  2H3R A;  3AE5 A;  4PJM A;  3P4S A;  2X67 A;  2BG9 E;  1YKH B;  5L3E B;  1VCS A;  4MLK A;  5AQO B;  4P1N A;  5L3G B;  4H9S E;  4ZI7 E;  2V6Y A;  3B5M A;  5IHY A;  2XQ7 A;  3CK6 A;  3RF1 A;  4FI5 A;  4LF8 T;  5ABF B;  2XAG B;  4PNI A;  3SRZ A;  5KMG P;  2MAW A;  3ETV A;  4X66 T;  1VRB A;  4NUU A;  4JI4 T;  1N36 T;  2LOS A;  3HA4 A;  4OFZ A;  2W61 A;  5IWA T;  3DTO A;  3F31 A;  1EZ3 A;  3AE3 A;  4KP3 C;  4CXW A;  1FMW A;  2LSI A;  1YQ4 A;  2F4V T;  3QC9 A;  4UVB B;  1Z8U A;  1FMV A;  1W09 A;  4DV2 T;  2JQK A;  3RH3 A;  4QWN B;  4J2C A;  3H3M A;  4GOU A;  3UFG A;  5BMV E;  2X9Y A;  2LSJ A;  4Z91 A;  1OED C;  3HR0 A;  4KHZ F;  2DWG A;  2XPK A;  3EI0 A;  3P4Q A;  3I0O A;  4UIG A;  4H9P C;  2H88 A;  3RQU A;  3PJA A;  4PFP A;  5H6R B;  4HKA A;  5AFU L;  4IE4 A;  2W00 A;  4WBO A;  3A7M A;  2ZM8 A;  3RYC E;  1T7S A;  3RIU A;  3ANW B;  4B3T T;  1QLB A;  3FZL B;  2IUB A;  5LMN T;  4L0R A;  4HE8 A;  3N5L A;  5FXV A;  4DR6 T;  1AJ3 A;  1HG2 A;  2X9W A;  4O4H E;  4QH5 A;  4U2Y A;  4X62 T;  2WSS V;  2CXL A;  5JDN A;  5L47 A;  2X9X A;  2FJE A;  1XZY A;  2XHE B;  4TWF A;  2E9X A;  4MAL A;  3CIR A;  4HFE A;  3RKO A;  5LP6 E;  5HXR A;  2AXD S;  4H63 V;  4PK4 A;  1E1H B;  4UEM A;  1VOM A;  5CGM A;  4AQF A;  2P9B A;  4WBN E;  4LFB T;  1HS7 A;  4DV1 T;  2XQ9 A;  1WR6 A;  3JC6 D;  4MFR A;  3T1H T;  2EHO B;  5AQK B;  4IIJ E;  4QH1 A;  4NUV A;  2C5K T;  2CLY B;  3CWZ B;  2NWB A;  3MAC A;  2ZLY A;  2M6B A;  4EED A;  3IF8 B;  2DHR A;  4AI6 A;  3I0Q A;  2YDS A;  4HWH A;  4DV0 T;  4HGA A;  4PK5 A;  3LDQ B;  3ZMU B;  2WWU A;  4XAX B;  3EDU A;  3ZMT B;  3MA9 A;  4LMJ A;  5HXS A;  5FXZ A;  3ZLI A;  4YTM A;  4LFC T;  5JRC A;  3BQI A;  2K24 A;  3PTR B;  4EZ4 A;  2XAQ B;  3P4R A;  5FY7 A;  4O4J E;  3KV4 A;  2YOE A;  1HNZ T;  3UU4 A;  4HWI B;  4IDQ A;  5FMN A;  4EAH A;  2V6Y B;  2WU2 A;  3N9P A;  5F8P A;  5AQF B;  4DR3 T;  2V7J A;  1KF6 A;  2XAH B;  5CFB A;  2ES0 A;  4CI2 B;  5LHH B;  4KI0 F;  4I50 E;  3P50 A;  2R6G F;  2HN2 A;  1J5E T;  3PU3 A;  3ONX A;  2JRK A;  1XDO A;  3KV6 A;  4TNW A;  5BR8 T;  4ZHQ E;  3HKB E;  3BQK A;  3RKG A;  2XM1 A;  3K3N A;  2JQQ A;  5JVD E;  5HEO A;  2DL1 A;  2BG9 B;  2V7M A;  3JC6 C;  5E0O A;  3EHZ A;  3VR8 A;  4BA9 A;  2E5V A;  3ONL C;  4ZI3 D;  5LXT E;  3EAM A;  5DQV A;  4OYJ A;  4YT0 A;  4HEA A;  3OVU A;  2K3W A;  3OYX A;  1HX1 B;  1OED A;  4X65 T;  5L4H A;  3C98 B;  1O3X A;  3O1I A;  5LOV E;  4CXX A;  3ZMZ B;  2XUE A;  2E8I A;  3C51 A;  4PW8 A;  5LB7 B;  2LOP A;  3AA7 B;  4LML A;  2Q9Q D;  4IE0 A;  3FBZ A;  2WB5 A;  1ZEE A;  4JEU B;  4O8S A;  1FJG T;  2WM9 A;  1MIY A;  2KXP B;  2WU5 A;  3RI5 A;  3NRY A;  2PBI A;  3O4X E;  5EZY E;  4H9Q C;  3RX6 A;  2XAF B;  2E9X D;  5L3B B;  2W62 A;  2NOX A;  3TLW A;  5EK3 A;  2ZM2 A;  4O4L E;  2H7O A;  4CQI A;  4JI7 T;  1CUN A;  2WWV A;  5EK4 A;  2XAJ B;  3AE9 A;  3VHL A;  2QA7 A;  2V7I A;  2MPK A;  4ILU A;  3QUJ A;  2BS4 A;  4U3C A;  5AQS B;  2A2F X;  4WZX A;  1MMD A;  1ZOY A;  3OPC A;  1YW0 A;  2V6X A;  4U33 A;  1D1A A;  3I9Y A;  3C50 A;  1BR4 A;  1T98 A;  2XY8 B;  4HFC A;  4ZI3 C;  3UUL A;  4JBW F;  4DID B;  5TAO A;  2IML A;  3P4W A;  4O4I E;  2B1E A;  2NTX A;  5JTG A;  2D0T A;  1U5P A;  4UVC B;  1D0X A;  2XSA A;  2WQY A;  4EOZ B;  1HCI A;  1LVK A;  4DBQ A;  3UU3 A;  3I9W A;  2WAU A;  4O2A E;  4PFO A;  2OLT A;  2G0U A;  5ABH A;  4YLH A;  3RIU C;  1YD8 G;  1UGO A;  4U74 A;  1WLX A;  1YKE B;  3PUW F;  5AQN B;  5HAX A;  5J0Z A;  2D9D A;  2Q9Q C;  3TLV A;  4IHJ E;  3L09 A;  5JR9 B;  5LMU T;  5KDM C;  4CN1 A;  4UVA B;  3H3A A;  2E9X C; 
#chains in the Genus database with same CATH homology
 1S35 A;  3DTO A;  3F31 A;  3MZK B;  1EZ3 A;  2CCQ A;  4KP3 C;  3FB2 A;  3P8C D;  3T8O A;  4CXW A;  3NZQ A;  1MIW A;  1FMW A;  2KIN B;  2YIN A;  2LSI A;  4G63 A;  5HXE A;  4YJ2 E;  1D0Y A;  3QC9 A;  4TN7 B;  4UVB B;  4C91 A;  4X20 E;  3Q2M A;  2DLR A;  3RC8 A;  2CWY A;  1FMV A;  4X1K E;  2UXX B;  3HKD E;  4AKH A;  3I1A A;  2LM9 A;  3RH3 A;  4QWN B;  4BAY B;  1QUU A;  3AVS A;  4J2C A;  4GOU A;  4A56 A;  3O1J A;  4DMW A;  4BJM A;  2X51 A;  2Q9Q B;  5BMV E;  3LFM A;  2X9Y A;  2MTQ A;  2LSJ A;  4Z8X A;  4TZ4 C;  5JR9 A;  3WI3 A;  3GN5 A;  3V5U A;  2IAK A;  1UX5 A;  3K3O A;  3NZP A;  4PAG A;  4YHJ A;  3HR0 A;  5LJM A;  2DWG A;  3AAI A;  3RPU A;  3CPZ A;  2E9X B;  3I0O A;  4UIG A;  4H9P C;  2NP9 A;  2BVM A;  4ADZ A;  4CXY A;  5FXX A;  5DQW A;  5ADX L;  4PFP A;  5H6R B;  4ZI2 C;  4HKA A;  4KUM B;  5AFU L;  3DJB A;  4E7Z A;  3KV5 A;  3B57 A;  4IE4 A;  1LRZ A;  2W00 A;  4WBO A;  3ZMV B;  3HKE E;  1WRD A;  3RYC E;  2ZM8 A;  3M65 A;  2KMF A;  3HL6 A;  3LK4 2;  3ANW B;  1KK7 A;  2GK9 A;  4BJN A;  2YEV C;  3AAA B;  4L0R A;  3CKD A;  4HE8 A;  3N5L A;  2VKO A;  3ZCI A;  5FXV A;  2KT9 A;  5JDL A;  3Q5X A;  4IGU A;  1AJ3 A;  5LYJ E;  1HG2 A;  2X9W A;  4O4H E;  3CX8 B;  4JUY A;  2L8K A;  2WSS V;  2CXL A;  5JDN A;  3LJC A;  5J1G A;  2RP4 A;  2X9X A;  1MMN A;  5CA0 E;  3PDY A;  2QGS A;  2XHE B;  5M4Y A;  2E9X A;  4MAL A;  2CLY C;  1S94 A;  1D1C A;  3RYH E;  3SOL A;  2V1D B;  3F2E A;  3K3Q C;  1ZHC A;  2L9Q A;  5FP3 A;  3RKO A;  1ZKE A;  4YFS A;  4DO0 A;  3ZEF B;  5JH7 E;  4GYS A;  4ERR A;  2Y48 B;  5LP6 E;  5HXR A;  1G8X A;  2XTL A;  4O2B E;  2W0G A;  4H63 V;  4PK4 A;  1E1H B;  2K5B B;  1ZV4 X;  2JMH A;  5L3F B;  3KVA A;  3KBT A;  2V26 A;  1VOM A;  4UEM A;  5JDM A;  2RA1 A;  3ZN0 B;  1IJ5 A;  3FXD B;  3PUA A;  1X79 A;  1U4Q A;  4AQF A;  5DAB A;  4XZC A;  2HH7 A;  2LHR A;  3IBP A;  2P9B A;  4WBN E;  1HS7 A;  2CA5 A;  2NTY A;  1OXZ A;  3CVR A;  4I43 B;  1US7 B;  2HPL A;  1HG5 A;  2J1D G;  3BQL A;  1WYC A;  1WR6 A;  4B6X A;  2LSK A;  3JC6 D;  3OYZ A;  3HKC E;  2C5J A;  4MFR A;  3CML A;  1G73 A;  4IDZ A;  4TUY E;  5JRC B;  5J2U E;  2DNX A;  2H7V C;  1B7T A;  4GIW A;  4TV8 E;  3KIN B;  3C4Z A;  3SS1 A;  2EHO B;  3RC3 A;  3R6N A;  5ETW A;  2K9A A;  3KFW X;  4IIJ E;  3WAK A;  2BDE A;  4NUV A;  3LK2 B;  3VKG A;  2C5K T;  4QKN A;  2CLY B;  3CWZ B;  2NWB A;  2KWI B;  3MAC A;  2ZLY A;  2VKD A;  3E22 E;  3IF8 B;  3FXE B;  2VAS A;  2DHR A;  4AI6 A;  2BVL A;  2XQY A;  1FIO A;  3I0Q A;  3MJX A;  3UUN A;  5F3J A;  5LNK A;  3GA8 A;  2OA5 A;  3GWH A;  2CMR A;  3N9N A;  4DMV A;  3N9Q A;  4HGA A;  2C5I T;  2BZB A;  4TV9 E;  3N2G E;  4PK5 A;  3ZMU B;  5A1L A;  2WWU A;  4JLE A;  2I59 A;  4XAX B;  3EDU A;  3ZMT B;  2MYS A;  4X1I E;  4XBF B;  3Q5W A;  4QXB B;  3O9X A;  3MA9 A;  5HXS A;  5FXZ A;  1D1B A;  4H9O C;  3ZLI A;  3S4U A;  5L2L A;  3PUS A;  5JRC A;  2VKH A;  3BQI A;  2K24 A;  1BR0 A;  2EHO A;  4PJJ A;  3PTR B;  4EZ4 A;  2XAQ B;  4IST A;  4JEH B;  1HX8 A;  3E0Z A;  3PU8 A;  3KVB A;  5FY7 A;  5JQG E;  3O1H A;  4O4J E;  4AKL A;  1NAF A;  3KV4 A;  2VK9 A;  4MBQ A;  4U72 A;  2N9D A;  3SWH A;  4P0A A;  3N9L A;  4ZS3 A;  2X9H A;  4N78 D;  4ASK A;  3WAJ A;  5LA6 E;  5LGT B;  4IE7 A;  5L3D B;  3ZC1 A;  5HWX A;  2A72 A;  5FMN A;  2WMN A;  4EAH A;  3PUG A;  3N9P A;  5F8P A;  3AA0 B;  2UXN B;  4PJN A;  3J9X 1;  5JDF A;  5FY0 A;  2Q9Q A;  2V7J A;  5FYM A;  2XAH B;  2ES0 A;  2IC6 A;  1BR2 A;  3EVY A;  4CI2 B;  4E7S A;  5LHH B;  4I50 E;  2MOZ A;  1WYB A;  2K48 A;  3KBU A;  4H63 H;  3PU3 A;  3ONX A;  2JRK A;  3KV6 A;  3VKH A;  2N1G A;  2N2N A;  4IE6 A;  3PUQ A;  3ZJ1 A;  4ZHQ E;  3HI2 A;  2X0L B;  3HKB E;  3BQK A;  2WBL A;  2Y8D A;  3UUX B;  5IYZ E;  3U78 A;  3K3N A;  2PJQ A;  4WW0 A;  2JQQ A;  5JVD E;  2IW5 B;  5JR9 C;  1SHZ C;  3L3P A;  3N9M A;  3B13 A;  3N2K E;  2NW8 A;  3VU7 H;  2YK0 A;  3KDS E;  2V7M A;  2X68 A;  3PE0 A;  4KBM B;  2JPF A;  3JC6 C;  2W63 A;  1MIV A;  4FJO A;  5E0O A;  3AVR A;  3FBL A;  3AA1 B;  3E08 A;  3FHN A;  1HTJ F;  1UX4 A;  1MND A;  1MMA A;  3OBV E;  4BA9 A;  3C4W A;  3ANW A;  3ZYL A;  2VB6 A;  4ZI3 D;  2KLQ A;  5LXT E;  3F57 A;  3AA6 B;  3RRC A;  4EXT A;  3ZC0 A;  5DQV A;  2JJ9 A;  5LJN A;  3H37 A;  2LEH A;  4OYJ A;  4UEL A;  4M1P A;  2LJL A;  4HEA A;  3NBX X;  2ACX A;  3DP7 A;  4UV8 B;  3UT5 E;  2M67 A;  2A3D A;  2PG8 A;  2V7K A;  4EZH A;  2CWO A;  4K0U A;  3OYX A;  3W15 B;  3EDV A;  3CQC B;  4DND A;  3GMI A;  2DCF A;  3QK6 A;  2D2S A;  2IC9 A;  3OKQ A;  5FNV E;  5JDH A;  3C98 B;  3CX6 B;  2VWA A;  3ETU A;  5JRE A;  4CI1 B;  2MBG A;  1O3X A;  3O1I A;  4HTE A;  5LOV E;  3BK9 A;  3GN5 B;  5LHG B;  4EYU A;  4MHC A;  1LKX A;  2C0S A;  2VL8 A;  4C90 A;  2CXD A;  4EB6 E;  3AAE B;  3D0T A;  4CXX A;  3ZMZ B;  4P0B A;  1HF8 A;  2XUE A;  2E8I A;  4EYY R;  2CE7 A;  2DI4 A;  3C51 A;  4PW8 A;  3RYI E;  4I55 E;  2LOP A;  3AA7 B;  4GK0 E;  3ZJ2 A;  2Q9Q D;  1OWA A;  4IE0 A;  5LG4 A;  3FBZ A;  3MKD A;  5LGN B;  1ZEE A;  2CXF A;  2LT3 A;  4GK5 E;  4JEU B;  4O8S A;  2HPJ A;  2ODV A;  2WMO A;  4QX8 B;  3U3I A;  4CI3 B;  2WM9 A;  3K8P C;  1MIY A;  2KXP B;  4I4T E;  1V9D A;  3NRY A;  4ISS A;  5DJQ C;  1H7C A;  1IJ6 A;  2ZM0 A;  2PBI A;  3O4X E;  5EZY E;  4F6R C;  4L9I A;  3CX7 B;  4UF0 B;  3ZYK A;  1UCU A;  2KND A;  4H9Q C;  3RX6 A;  4AXP A;  2XAF B;  2E9X D;  4AQF C;  5L3B B;  3UTK A;  5HXH A;  2W62 A;  3N9O A;  5EK2 A;  2NOX A;  5EK3 A;  3UUM A;  5C8Y E;  2ZM2 A;  3RYF E;  4O4L E;  2H7O A;  4CQI A;  1CUN A;  1FEW A;  1QSD A;  3ZN1 B;  5EK4 A;  3J7Y q;  2XAJ B;  4EIW A;  3MXZ A;  3VHL A;  2QA7 A;  5LHI B;  3R84 B;  3LK3 B;  2V7I A;  4P09 A;  3NRX A;  4H9N C;  4OYK A;  4OK0 A;  5GON E;  3UFE A;  5JDQ A;  4QXC B;  4ZS2 A;  4ILU A;  3KV9 A;  3P7I A;  3LBX B;  3QUJ A;  2PFV A;  4AKI A;  2A2F X;  3V5S A;  2D0U A;  3C64 A;  1MMD A;  4UV9 B;  5J2T E;  3PUR A;  1IZN B;  4L5G A;  4UXN B;  3TKL B;  1MNE A;  3ZYM A;  2CEA A;  4ZOL E;  1YW0 A;  4AKR B;  2KZ7 B;  4GYR A;  4HN9 A;  4QXH B;  1D1A A;  3I9Y A;  3C50 A;  4AKG A;  1BR4 A;  2D5U A;  1T98 A;  3LG7 A;  5CA1 E;  3IEE A;  4UF0 A;  4OHF A;  1SA0 E;  5FXW A;  1KNZ A;  4ZI3 C;  3UUL A;  4CZZ B;  3IHR A;  5TAO A;  1Z0P A;  3AB3 B;  2YU1 A;  2H3R A;  4O4I E;  2B1E A;  3ZPO A;  2ZMA A;  2LHN A;  3MK7 C;  5LBM A;  4PJM A;  2NTX A;  1HFA A;  4ZI2 D;  2X66 A;  2X67 A;  4WNK A;  2D0T A;  1YKH B;  1U5P A;  2LSG A;  4UVC B;  5HWY A;  5L3E B;  1D0X A;  2SPC A;  2NW9 A;  2VKJ A;  4QX7 B;  4V1A v;  3CQG B;  3C4X A;  4DBR A;  2EHO C;  1Y64 B;  3ZMS B;  4EOZ B;  1HCI A;  4H9R C;  4MLK A;  4DVD A;  4HFV A;  1LVK A;  5L3G B;  4H9S E;  4ZI7 E;  3LBX A;  2CM0 A;  4TX5 A;  4DBQ A;  5L3C B;  5LCY A;  2L3L A;  2ODU A;  5LGU B;  3I9W A;  2LE8 A;  2WAU A;  3RRW A;  3EUH A;  4IE5 A;  4PJL A;  2KWH A;  1D0Z A;  4O2A E;  4PFO A;  5IHY A;  2V7L A;  2G0U A;  4PK6 A;  4YLH A;  3CQX C;  5FY1 A;  1YD8 G;  4FI5 A;  4U74 A;  3Q9D A;  1MMG A;  1WLX A;  2EHO D;  5HYA A;  2XAG B;  4ANJ A;  1YKE B;  4PNI A;  5JDG A;  5HAX A;  2LSY A;  4AQG A;  3N2O A;  1BR1 A;  4G2A A;  2Q9Q C;  4KMC A;  2Y6X A;  5HXC A;  5H6Q B;  3SRZ A;  4IHJ E;  3ZCJ A;  5KMG P;  2YU2 A;  2Z6E A;  3ESL A;  1NWM X;  3L09 A;  3ETV A;  5KX5 E;  1VRB A;  4NUU A;  5JR9 B;  2DWK A;  1IAP A;  2XAS B;  5CB4 E;  3OJA A;  2JMK A;  4X1Y E;  5KDM C;  2LOS A;  3HA4 A;  3A5X A;  4YJ3 E;  4OFZ A;  4QHO A;  4UVA B;  2W61 A;  1LVF A;  5LBQ B;  3H3A A;  2NW7 A;  2E9X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...