1IBLT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1iblT00
4DR5T 5BR8T 4DV2T 4NXNT 4X62T 1I94T 4GKKT 1N32T 4JI5T 4LF9T 1HNWT 4DUYT 4YY3T 4LFCT 4LF5T 4LF4T 4X65T 4DR1T 2E5LT 1HR0T 4NXMT 1IBMT 4LF8T 4DR6T 1XNQT 4LF6T 1IBKT 4DV6T 2F4VT 4AQYT 4OX9T 4B3RT 4DV3T 2VQFT 4DV5T 4GKJT 5LMNT 4DR4T 2UXDT 4DR7T 1IBLT 2UUCT 4DUZT 4KHPT 4YHHT 1N33T 2ZM6T 4K0KT 2HHHT 4LFAT 4DV0T 4JI4T 1XNRT 2UUAT 4JI6T 4DV1T 2UXCT 4B3TT 4JYAT 1HNZT 4B3MT 5IWAT 4DV7T 4JI3T 4X66T 4JI8T 1HNXT 4JI1T 2VQET 4JI7T 4LFBT 4B3ST 4DR3T 1XMOT 2UUBT 5LMUT 4JI2T 4LF7T 1N36T 4X64T 1XMQT 2UU9T 1J5ET 3T1HT 4JI0T 4JV5T 3OTOT 3T1YT 4DV4T 2UXBT 1N34T 1FJGT 4DR2T
chains in the Genus database with same CATH superfamily
2LLYA 4IIJE 1FEWA 1R8IA 2NTXA 3H37A 3RYFE 3TLVA 4ZOLE 3ZPOA 1S35A 2D9DA 4HFHA 4EZHA 2W00A 4LFCT 4HWHA 4GYSA 1FMVA 3CK6A 3N5LA 5ETWA 2E2AA 2G0UA 4QWNB 3O1IA 2CBIA 3UT5E 5JDQA 4AQFC 2JIWA 4AI6A 3KV6A 4JEHB 3B5MA 2V7KA 1GQEA 2X0LB 4EZ4A 4ZS2A 2K48A 5JH7E 4NIQA 2E9XA 3N9PA 2WBLA 2H3RA 3W15B 2XSAA 2I59A 1BR4A 4JI4T 3PE0A 3PUAA 4ZHQE 3HKEE 3ZSSA 4AKLA 4ILUA 3AXJB 2V5CA 2AE9A 1WYBA 1W9RA 3LG7A 4U2ZA 3NZQA 2HN2A 5JQGE 4MLKA 4MHCA 2K24A 3EABA 3JC6C 4AXPA 4PK6A 4IE5A 2Q9QA 2ZM8A 3N9QA 3AEGA 5LNKA 5CGMA 5JRCB 1XZYA 4IE4A 1NEKA 1I94T 1VCTA 4UEMA 5KMGP 1QUUA 4GK5E 4CN1A 2ACZA 5LGUB 3QB5K 5AQRB 5JR9B 3ESLA 4YTMA 5DQVA 2ES0A 3AE3A 1LKXA 2DI4A 2LOSA 1HR0T 2BKNA 3RC3A 2NWBA 1O3XA 4XAXB 3AAEB 4YJ2E 1D0XA 5HEUA 2N9DA 3ETUA 3P4SA 4AQFA 4Z8XA 3HKDE 3N9LA 3ZCJA 2IAKA 4CXWA 2I6HA 4H63H 3VKHA 5LB7B 2MOZA 1SHZC 2WZIA 4C91A 2LRLA 4P0AA 5AQSB 2KSRA 4ZXLA 3DJBA 4JI3T 4HFEA 3IBPA 2PJQA 4IL9A 3P4RA 5JR9C 2QYWA 4X64T 5HXCA 2UU9T 3RLFF 2X51A 1D0YA 2RA1A 3VR9A 3R6NA 4DIDB 1Y01A 3G06A 2W66A 4JI5T 2FJBA 2BKOA 3WI3A 3UU4A 5A1LA 1Z0PA 5FVKA 2CMRA 4YXDA 3Q5EA 4CZZB 3PJAJ 2XQ9A 5ABGA 4YTNA 2XHEB 2WAUA 3ANWB 2KT9A 3CX7B 4KMCA 1HG2A 4O4LE 5LXTE 4UIGA 3K3QC 4IE0A 5HEJA 4ZI3D 5AQLB 3AE2A 3JAEA 5FYMA 4HFVA 4GKJT 2LKHA 2IUBA 3NZPA 3ZJ1A 3PJAA 5HEOA 1OEDC 4ZZBA 1N33T 4TWDA 4MALA 4DV1T 3P8CD 2UXCT 4G63A 4JI7T 5F5WA 3AVRA 2A2FX 4LF7T 4DBQA 1HF8A 4GOUA 4HGAA 2ACXA 3T1YT 3CQGB 4DO0A 4EGWA 3GN5B 2YN6A 2H88A 4NXNT 1MIYA 2CLYB 3RIAA 2KLQA 2V5DA 2A3DA 4GKKT 2OA5A 4ZI2D 1N32T 5HAXA 2XQYA 3KFWX 3UUBA 2FJAA 5JREA 2KXPB 3FZKB 2L9QA 3ZMZB 5AQVB 2FUPA 4JLEA 4KX6A 4DVDA 1WR6A 2LOPA 3RHWA 3VRBA 2V7IA 3LBXB 4H63V 3FZHB 4YHJA 3TLUA 5LBMA 2DNXA 3IA3A 4JUYA 1U4QA 3AE8A 2DCFA 1SA0E 2D5UA 2Z6EA 3P50A 3I9WA 4P0BA 2CLYC 2M6BA 3AE6A 5ABHA 2CHOA 3LJCA 1OEDA 4QHOA 1MMDA 1ZP0A 4HE8A 5LBQB 5FY1A 5J2TE 2W61A 2LSJA 1E1HB 4O4JE 3JCFA 1IJ6A 2JMKA 3CQCB 1G73A 3B57A 1J5ET 2XJ7A 4JV5T 3JAFA 3C4ZA 2IW5B 4J2CA 3CIRA 2IC6A 1YXRA 3PUYF 2X0YA 4ISSA 2R6GF 2V7LA 4QXCB 2QGSA 5LGNB 3PUXF 5EK3A 2BS4A 1MMGA 2BS2A 4H9QC 3NVOA 2WM9A 4OFZA 4I50E 5IUXA 1VOMA 4L9IA 3N9MA 1HTJF 1IJ5A 1LVFA 5HEHA 4ASKA 3RGLA 2BBJA 4CI2B 3AE1A 3ZMUB 5LOVE 1ZOYA 2W67A 2LJLA 2DL1A 2V6YA 4PAGA 4K0UA 3R84B 4LFAT 4QKNA 4ANJA 2WY2A 2UUAT 2DWKA 2LEHA 3HA4A 1SE7A 2EHOA 3EVYA 2BG9B 2JRKA 5FXVA 3ONJA 1KFYA 4I0UA 2JQQA 2XAFB 3Q5XA 5FKYA 1WCRA 1WLXA 1WRDA 2LE8A 4HEAA 5LHGB 1AJ3A 3NKZA 2CEAA 5FL1A 4CI3B 4COFA 4DMVA 4B6XA 4DR2T 3AE9A 5ABEA 2I0MA 2NR4A 3RH3A 5AFUL 2YOEA 2L8KA 2NP9A 4KP3C 4PJNA 4UF0A 5HYAA 5EK2A 3ZN1B 2VKJA 2MYSA 4EYYR 2CWOA 4EYUA 2BG9C 4DR6T 3L3PA 5JDGA 2NW7A 4L5GA 3D0TA 2IIUA 2LM2A 1UK5A 3QB5A 1CUNA 4AQYT 2XAJB 4AQGA 4HFDA 4B3RT 2HPLA 2LRKA 5L3EB 2V1DB 2CXFA 4H9OC 3A5XA 3U3IA 3PUSA 5AQOB 3ZYLA 4AIUA 2X9WA 2UUCT 2E9XD 4ERRA 2HHHT 3AEDA 3CX6B 5CJ5A 5LYJE 2VWAA 4JYAT 4ZEYA 3EDUA 4U31A 2XAQB 5CA1E 4AISA 4N78D 2ODVA 2SPCA 1MNEA 3E0ZA 2AXDS 2WDQA 3A8YC 4JI0T 2XAHB 1US7B 1LRZA 2Q9QD 2K3WA 3DP7A 2XPKA 2CRBA 2N1GA 4V1Av 3UU3A 2W62A 2N2NA 1XDOA 2C0SA 3BQKA 4X1YE 3J7Yq 1J5WA 4A97A 1EZ3A 2IHR1 1UGOA 3K1SA 2MPKA 4G2AA 1WFDA 2J4GA 2V7MA 1YKEB 5JDHA 1IBKT 2WS3A 2PTFA 2VL8A 2VVNA 5AQPB 3RIUC 3E08A 3ZMSB 2F4VT 5HXEA 5HWXA 3O1HA 4DV3T 3I0QA 3WAJA 2DLRA 5LHIB 3ETVA 4UVCB 1YQ4A 3RQWA 3PU8A 1KNRA 3TLWA 1XNRT 3AVSA 5HCJA 3A7MA 4M1PA 3RIFA 1HNXT 3NWIA 5LA6E 4AKHA 2LSYA 2WP9A 2CWYA 3X1DA 1OXZA 5HCMA 3BQIA 1OEDE 3T1HT 2UXNB 3PURA 2XQ4A 5IYZE 3JC6D 4ILAA 4ZI3C 3ABVA 2RPAA 3AA0B 1BR1A 2X66A 2V7JA 4O4IE 5KXJA 1T72A 5HWYA 1BR2A 3VKGA 2YU1A 4NUVA 2YDSA 3I1AA 5AQKB 3PUZF 1W0BA 1I6ZA 1YD8G 2KWHA 1JNRA 4HN9A 2VKOA 3O4XE 5L3GB 2BKPA 3L8RA 2IC9A 3LK3B 3B13A 5LJNA 1M62A 3TKLB 4WYVA 1E7PA 2HPJA 1D1AA 2LSGA 2J62A 3UQ4A 3RIUA 4ILCA 4DR4T 4HWCA 1NAFA 2XAGB 3CX8B 4DUZT 4KHPT 4ZZCA 2LT3A 3UU5A 3UUMA 3HKBE 5M4YA 2NW8A 3AXJA 5AQIB 3FHNA 3CMLA 4I4TE 4A98A 4TNVA 2FBWA 3PUVF 4CI1B 1MIVA 4GYRA 2YEVC 5C8YE 1W0AA 5JDNA 4DR3T 1KF6A 2OLTA 1XMOT 3C50A 5L3CB 2CM0A 4ADZA 2WU5A 5JRCA 5HXRA 2C5IT 5JVDE 4Q25A 3J9X1 5FY7A 1FJGT 2XM1A 1HG5A 3ZEFB 4OK0A 4KBMB 3WAKA 2ZLYA 4L0RA 4IREA 4OYKA 2VKDA 4YT0A 5C3JA 3GWHA 2KZ7B 3FZLB 3UU8A 3MK7C 3RKGA 2P9BA 1YW0A 2LHNA 4LF5T 3OVUA 5JR9A 3C64A 5JTGA 4PFPA 2H89A 4H9NC 5J1GA 1J1JA 2E5VA 3Q9DA 1IBMT 4LF8T 3RKOA 4EAHA 3PUWF 3UU6A 4NPPA 4CQIA 3MA9A 5L4EA 1V9DA 3RI5A 5ABFB 3O9XA 3PU3A 5AQGB 4CN4A 2BVLA 3SWHA 2WZHA 1UX5A 2XQ5A 3CWZB 2WQYA 2OV9A 3ZSTA 4C90A 1KK7A 4HTEA 1HS7A 4TX5A 3P4PA 2BS3A 4TNWA 1OWAA 4EEBA 2YU2A 1HNZT 4B3MT 2JQHA 2VQET 4F6RC 5KDMC 3FXDB 4HFBA 4IDZA 3AB3B 4BJNA 5EK4A 4O2BE 2Y6XA 3AECA 1BR0A 3TLTA 3PUQA 5AQHB 4YTPA 4JEUB 4F8HA 1M7KA 3EUHA 5AQQB 1S94A 2FJEA 2IDOB 1ZEEA 2WSSV 4HFCA 4WBOA 2XQ6A 5AQTB 2BBHA 3FBLA 3I0OA 2VASA 4LF4T 3RYCE 2Y8DA 2V6XA 1JNZA 3ANWA 1T98A 3ZYMA 1NENA 4YSYA 1L0VA 3L09A 1DU2A 4U7YA 4DV6T 1UURA 5F3JA 4YSXA 4HFIA 5LCYA 3JADA 4OX9T 3MKDA 2RP4A 5J2UE 2Y48B 3EI0A 3PTRB 3ZLIA 3F2EA 4TZ4C 1IBLT 1MMAA 4O2AE 4XZCA 1KNZA 2D0UA 2E9XB 3ZC1A 2LM9A 2QVAA 5BMVE 4HWDA 5AQUB 2EHOD 2JJ9A 4TN7B 4JI8T 4FJOA 3RRWA 2VK9A 4WW0A 3OPCA 2CCQA 5FVLA 1IAPA 4JI2T 5DQWA 3ZYKA 2BZBA 1Y64B 3HI2A 5KX5E 5C2TA 3IEEA 3GN5A 4HWIB 4DV4T 2JPFA 2UXBT 3LK42 1N34T 5LGTB 4KHZF 2WDRA 3VHLA 4FI5A 2LHRA 3QC9A 2X9YA 3V5SA 4IDNA 2XASB 3SFDA 1XDPA 4AKIA 3RRCA 4AKGA 3QOFA 3LBXA 2M6IA 4EB6E 3AA7B 4HKAA 4TV8E 4LMJA 3N2KE 3CKDA 3KVBA 5L3BB 4WNKA 3UULA 4LMLA 3N2OA 3Q5WA 1CHUA 4MFRA 2W4XA 3BK9A 5HXHA 4CXYA 3EHZA 4OYJA 4DV0T 4IDOA 3ZT6A 3HR0A 3ONXA 1LVKA 3K3OA 1MNDA 2JQ9A 2XUEA 3RQUA 2CE7A 3LSVA 4WBNE 4PFOA 3F57A 1FIOA 4U3CA 3HKCE 5L3FB 4DNDA 1UX4A 4IDQA 1KEYA 5J0ZA 4YFSA 2WU2A 4U2YA 4IDPA 4DR5T 3S4UA 3MXZA 2KMFA 3AAAB 3AEAA 2YDQA 2B1EA 4BA9A 1YQ3A 4P1NA 4DUYT 3RYIE 4KI0F 4ZI7E 3PUGA 4CXXA 5ADXL 2WMOA 2XQ7A 3AAIA 4TV9E 4Z90A 1VRBA 5JDFA 4GIWA 3MACA 3AEEA 3PV0F 1D0ZA 5LMNT 3Q5DA 5DABA 1UCUA 5FY0A 3MZKB 2UXDT 4DR7T 5L47A 3CPZA 4PK4A 3N9NA 2W2UA 3KDSE 3UFEA 2BG9A 4E7ZA 2XQAA 5CB4E 1T7SA 3T8OA 1X9BA 3PDYA 3SS1A 2ZM0A 4O4HE 4DMWA 5CFBA 2QA7A 4IE7A 2VB6A 3DTOA 4H9SE 2XSBA 2JQKA 4QX8B 2MBGA 3OTOT 1E2AA 2KINB 3NRXA 1H7CA 5BR8T 2XQ8A 2L3LA 4X62T 1MIWA 2V8SV 1HFAA 4TWHA 3EAMA 3E22E 4UVAB 3NRYA 4H9PC 5L2LA 3ZC0A 2B76A 4PW8A 3C98B 4Z91A 2X0HA 3KBTA 2GK9A 3C4XA 5FXXA 4H9RC 3KV5A 2WMNA 1QLBA 3ZT7A 2NTYA 4UXNB 1WR0A 3KVAA 4NUUA 1ZHCA 3ZJ2A 5FXWA 4TUYE 1MMNA 4U72A 5L3DB 4ILBA 3ZMVB 5IHYA 4YSZA 2CBJA 5LG4A 5AQJB 3LDQB 1VCSA 2ZM6T 4K0KT 1X79A 4I43B 4JI6T 5E0OA 2CA5A 3P4WA 3AA6B 3H3MA 5TAOA 3M65A 4DV7T 4I55E 1OEDB 3KINB 1W09A 4JBWF 1HCIA 2UUBT 3UTKA 3OBVE 3RX6A 2IMLA 3QUJA 4IL4A 3ZCIA 4ZI2C 4EOZB 5GONE 1FMWA 1SUMB 3MJXA 3ZMTB 2V26A 4P09A 3FXEB 3LFMA 4U7IA 2A9UA 2E8IA 3KV9A 4PJLA 1IZNB 3F31A 5AQNB 5LJMA 1T8BA 2A72A 4X65T 4QH5A 5FNVE 2E5LT 3K8PC 4EEDA 3ZN0B 3RF1A 3H3AA 2X9HA 1XNQT 3AE7A 3FB2A 4YJ3E 1ZV4X 2VL0A 2XTLA 3IF8B 4QH1A 3P7IA 2BVMA 3UQ7A 5L4HA 3RC8A 4IT4A 4CN6A 3RPUA 2WCAA 3N9OA 3TLSA 1HX8A 3AA1B 5FL0A 4ZS3A 5H6QB 2V6YB 2H7VC 4U33A 1D1CA 2JMHA 3IHRA 4UELA 2XM2A 2MAWA 3U78A 2X68A 2J47A 2EHOB 3QNUA 3HL6A 4B3ST 3NBXX 2D0TA 2XZEA 1YKHB 3OJAA 2XY8B 2YKSA 3CVRA 3V5UA 4QH4A 2YK0A 2X9XA 2ZM2A 4EXTA 4PJJA 3P4QA 2PBIA 4QXBB 1U5PA 4PK5A 1KNPA 4EV6A 3CQXC 5H6RB 4LF9T 4YY3T 4DBRA 2DWGA 4X1KE 2WWUA 3C4WA 3GA8A 1WYCA 4UF0B 5FP3A 4X5TA 4BJMA 5FXZA 3UUXB 3O1JA 4DR1T 3OKQA 3N2GE 2K9AA 2LKGA 5DJQC 4IE6A 3SOLA 4ISTA 2ODUA 5AQFB 4NXMT 2K5BB 3UUNA 3OYZA 3KBUA 2EHOC 2D2SA 2C5KT 2LSKA 5HEGA 5FMNA 4UV8B 4MBQA 2X67A 3ZKRA 2BDEA 4WZXA 2W0GA 1UUSA 3LK2B 4DV5T 4A5XA 5LG3A 3AEFA 2UXXB 2ZMAA 4QX7B 2CXLA 2XQ3A 4O8SA 4X1IE 5LHHB 4OHFA 1NWMX 5IWAT 4X66T 1D1BA 2NW9A 3L39A 5AQMB 4JI1T 1HX1B 3EDVA 3GMIA 1Z8UA 4IGUA 3VRAA 2M67A 3AE4A 4UR9A 3RYHE 5LMUT 2MTQA 2VURA 2BG9E 4A56A 5EZYE 3QK6A 1N36T 1XMQT 1B7TA 5CA0E 2PG8A 3VU7H 4IHJE 4DV2T 4YLHA 2FJDA 2CHNA 3ONLC 1HNWT 4LMKA 2CPTA 3SRZA 2YDRA 4PNIA 2HH7A 3K3NA 5LP6E 2YINA 3C51A 2DHRA 2CXDA 2Q9QB 2W63A 3M3ZB 4AKRB 3KV4A 4LF6T 5ABFA 2WWVA 3AE5A 2KWIB 2PFVA 2E9XC 3FZFB 2VVSA 2VQFT 2H7OA 5F8PA 2WB5A 2LSIA 3BQLA 4TWFA 4X20E 4EIWA 4PJMA 4YHHT 4U74A 4UV9B 5HXSA 4E7SA 1G8XA 1QSDA 4XBFB 4HWFA 3UFGA 4B3TT 2KNDA 1ZKEA 4QXHB 1XWMA 4KUMB 4LFBT 2VKHA 4GK0E 3Q2MA 4UVBB 5JDLA 4BAYB 3SFEA 2Q9QC 2QRXA 2WDVA 3FBZA 3FZMB 2J1DG 2C5JA 5JDMA 3AEBA 3ZT5A 2HN1A 2NOXA 3OYXA 3I9YA 3VR8A
chains in the Genus database with same CATH topology
4DR5T 5BR8T 4DV2T 4NXNT 4X62T 1I94T 4GKKT 1N32T 4JI5T 4LF9T 1HNWT 4DUYT 4YY3T 4LFCT 4LF5T 4LF4T 4X65T 4DR1T 2E5LT 1HR0T 4NXMT 1IBMT 4LF8T 4DR6T 1XNQT 4LF6T 1IBKT 4DV6T 2F4VT 4AQYT 4OX9T 4B3RT 4DV3T 2VQFT 4DV5T 4GKJT 5LMNT 4DR4T 2UXDT 4DR7T 1IBLT 2UUCT 4DUZT 4KHPT 4YHHT 1N33T 2ZM6T 4K0KT 2HHHT 4LFAT 4DV0T 4JI4T 1XNRT 2UUAT 4JI6T 4DV1T 2UXCT 4B3TT 4JYAT 1HNZT 4B3MT 5IWAT 4DV7T 4JI3T 4X66T 4JI8T 1HNXT 4JI1T 2VQET 4JI7T 4LFBT 4B3ST 4DR3T 1XMOT 2UUBT 5LMUT 4JI2T 4LF7T 1N36T 4X64T 1XMQT 2UU9T 1J5ET 3T1HT 4JI0T 4JV5T 3OTOT 3T1YT 4DV4T 2UXBT 1N34T 1FJGT 4DR2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 T;  5BR8 T;  4DV2 T;  4NXN T;  4X62 T;  1I94 T;  4GKK T;  1N32 T;  4JI5 T;  4LF9 T;  1HNW T;  4DUY T;  4YY3 T;  4LFC T;  4LF5 T;  4LF4 T;  4X65 T;  4DR1 T;  2E5L T;  1HR0 T;  4NXM T;  1IBM T;  4LF8 T;  4DR6 T;  1XNQ T;  4LF6 T;  1IBK T;  4DV6 T;  2F4V T;  4AQY T;  4OX9 T;  4B3R T;  4DV3 T;  2VQF T;  4DV5 T;  4GKJ T;  5LMN T;  4DR4 T;  2UXD T;  4DR7 T;  1IBL T;  2UUC T;  4DUZ T;  4KHP T;  4YHH T;  1N33 T;  2ZM6 T;  4K0K T;  2HHH T;  4LFA T;  4DV0 T;  4JI4 T;  1XNR T;  2UUA T;  4JI6 T;  4DV1 T;  2UXC T;  4B3T T;  4JYA T;  1HNZ T;  4B3M T;  5IWA T;  4DV7 T;  4JI3 T;  4X66 T;  4JI8 T;  1HNX T;  4JI1 T;  2VQE T;  4JI7 T;  4LFB T;  4B3S T;  4DR3 T;  1XMO T;  2UUB T;  5LMU T;  4JI2 T;  4LF7 T;  1N36 T;  4X64 T;  1XMQ T;  2UU9 T;  1J5E T;  3T1H T;  4JI0 T;  4JV5 T;  3OTO T;  3T1Y T;  4DV4 T;  2UXB T;  1N34 T;  1FJG T;  4DR2 T; 
#chains in the Genus database with same CATH topology
 2LLY A;  4IIJ E;  1FEW A;  1R8I A;  2NTX A;  3H37 A;  3RYF E;  3TLV A;  4ZOL E;  3ZPO A;  1S35 A;  2D9D A;  4HFH A;  4EZH A;  2W00 A;  4LFC T;  4HWH A;  4GYS A;  1FMV A;  3CK6 A;  3N5L A;  5ETW A;  2E2A A;  2G0U A;  4QWN B;  3O1I A;  2CBI A;  3UT5 E;  5JDQ A;  4AQF C;  2JIW A;  4AI6 A;  3KV6 A;  4JEH B;  3B5M A;  2V7K A;  1GQE A;  2X0L B;  4EZ4 A;  4ZS2 A;  2K48 A;  5JH7 E;  4NIQ A;  2E9X A;  3N9P A;  2WBL A;  2H3R A;  3W15 B;  2XSA A;  2I59 A;  1BR4 A;  4JI4 T;  3PE0 A;  3PUA A;  4ZHQ E;  3HKE E;  3ZSS A;  4AKL A;  4ILU A;  3AXJ B;  2V5C A;  2AE9 A;  1WYB A;  1W9R A;  3LG7 A;  4U2Z A;  3NZQ A;  2HN2 A;  5JQG E;  4MLK A;  4MHC A;  2K24 A;  3EAB A;  3JC6 C;  4AXP A;  4PK6 A;  4IE5 A;  2Q9Q A;  2ZM8 A;  3N9Q A;  3AEG A;  5LNK A;  5CGM A;  5JRC B;  1XZY A;  4IE4 A;  1NEK A;  1I94 T;  1VCT A;  4UEM A;  5KMG P;  1QUU A;  4GK5 E;  4CN1 A;  2ACZ A;  5LGU B;  3QB5 K;  5AQR B;  5JR9 B;  3ESL A;  4YTM A;  5DQV A;  2ES0 A;  3AE3 A;  1LKX A;  2DI4 A;  2LOS A;  1HR0 T;  2BKN A;  3RC3 A;  2NWB A;  1O3X A;  4XAX B;  3AAE B;  4YJ2 E;  1D0X A;  5HEU A;  2N9D A;  3ETU A;  3P4S A;  4AQF A;  4Z8X A;  3HKD E;  3N9L A;  3ZCJ A;  2IAK A;  4CXW A;  2I6H A;  4H63 H;  3VKH A;  5LB7 B;  2MOZ A;  1SHZ C;  2WZI A;  4C91 A;  2LRL A;  4P0A A;  5AQS B;  2KSR A;  4ZXL A;  3DJB A;  4JI3 T;  4HFE A;  3IBP A;  2PJQ A;  4IL9 A;  3P4R A;  5JR9 C;  2QYW A;  4X64 T;  5HXC A;  2UU9 T;  3RLF F;  2X51 A;  1D0Y A;  2RA1 A;  3VR9 A;  3R6N A;  4DID B;  1Y01 A;  3G06 A;  2W66 A;  4JI5 T;  2FJB A;  2BKO A;  3WI3 A;  3UU4 A;  5A1L A;  1Z0P A;  5FVK A;  2CMR A;  4YXD A;  3Q5E A;  4CZZ B;  3PJA J;  2XQ9 A;  5ABG A;  4YTN A;  2XHE B;  2WAU A;  3ANW B;  2KT9 A;  3CX7 B;  4KMC A;  1HG2 A;  4O4L E;  5LXT E;  4UIG A;  3K3Q C;  4IE0 A;  5HEJ A;  4ZI3 D;  5AQL B;  3AE2 A;  3JAE A;  5FYM A;  4HFV A;  4GKJ T;  2LKH A;  2IUB A;  3NZP A;  3ZJ1 A;  3PJA A;  5HEO A;  1OED C;  4ZZB A;  1N33 T;  4TWD A;  4MAL A;  4DV1 T;  3P8C D;  2UXC T;  4G63 A;  4JI7 T;  5F5W A;  3AVR A;  2A2F X;  4LF7 T;  4DBQ A;  1HF8 A;  4GOU A;  4HGA A;  2ACX A;  3T1Y T;  3CQG B;  4DO0 A;  4EGW A;  3GN5 B;  2YN6 A;  2H88 A;  4NXN T;  1MIY A;  2CLY B;  3RIA A;  2KLQ A;  2V5D A;  2A3D A;  4GKK T;  2OA5 A;  4ZI2 D;  1N32 T;  5HAX A;  2XQY A;  3KFW X;  3UUB A;  2FJA A;  5JRE A;  2KXP B;  3FZK B;  2L9Q A;  3ZMZ B;  5AQV B;  2FUP A;  4JLE A;  4KX6 A;  4DVD A;  1WR6 A;  2LOP A;  3RHW A;  3VRB A;  2V7I A;  3LBX B;  4H63 V;  3FZH B;  4YHJ A;  3TLU A;  5LBM A;  2DNX A;  3IA3 A;  4JUY A;  1U4Q A;  3AE8 A;  2DCF A;  1SA0 E;  2D5U A;  2Z6E A;  3P50 A;  3I9W A;  4P0B A;  2CLY C;  2M6B A;  3AE6 A;  5ABH A;  2CHO A;  3LJC A;  1OED A;  4QHO A;  1MMD A;  1ZP0 A;  4HE8 A;  5LBQ B;  5FY1 A;  5J2T E;  2W61 A;  2LSJ A;  1E1H B;  4O4J E;  3JCF A;  1IJ6 A;  2JMK A;  3CQC B;  1G73 A;  3B57 A;  1J5E T;  2XJ7 A;  4JV5 T;  3JAF A;  3C4Z A;  2IW5 B;  4J2C A;  3CIR A;  2IC6 A;  1YXR A;  3PUY F;  2X0Y A;  4ISS A;  2R6G F;  2V7L A;  4QXC B;  2QGS A;  5LGN B;  3PUX F;  5EK3 A;  2BS4 A;  1MMG A;  2BS2 A;  4H9Q C;  3NVO A;  2WM9 A;  4OFZ A;  4I50 E;  5IUX A;  1VOM A;  4L9I A;  3N9M A;  1HTJ F;  1IJ5 A;  1LVF A;  5HEH A;  4ASK A;  3RGL A;  2BBJ A;  4CI2 B;  3AE1 A;  3ZMU B;  5LOV E;  1ZOY A;  2W67 A;  2LJL A;  2DL1 A;  2V6Y A;  4PAG A;  4K0U A;  3R84 B;  4LFA T;  4QKN A;  4ANJ A;  2WY2 A;  2UUA T;  2DWK A;  2LEH A;  3HA4 A;  1SE7 A;  2EHO A;  3EVY A;  2BG9 B;  2JRK A;  5FXV A;  3ONJ A;  1KFY A;  4I0U A;  2JQQ A;  2XAF B;  3Q5X A;  5FKY A;  1WCR A;  1WLX A;  1WRD A;  2LE8 A;  4HEA A;  5LHG B;  1AJ3 A;  3NKZ A;  2CEA A;  5FL1 A;  4CI3 B;  4COF A;  4DMV A;  4B6X A;  4DR2 T;  3AE9 A;  5ABE A;  2I0M A;  2NR4 A;  3RH3 A;  5AFU L;  2YOE A;  2L8K A;  2NP9 A;  4KP3 C;  4PJN A;  4UF0 A;  5HYA A;  5EK2 A;  3ZN1 B;  2VKJ A;  2MYS A;  4EYY R;  2CWO A;  4EYU A;  2BG9 C;  4DR6 T;  3L3P A;  5JDG A;  2NW7 A;  4L5G A;  3D0T A;  2IIU A;  2LM2 A;  1UK5 A;  3QB5 A;  1CUN A;  4AQY T;  2XAJ B;  4AQG A;  4HFD A;  4B3R T;  2HPL A;  2LRK A;  5L3E B;  2V1D B;  2CXF A;  4H9O C;  3A5X A;  3U3I A;  3PUS A;  5AQO B;  3ZYL A;  4AIU A;  2X9W A;  2UUC T;  2E9X D;  4ERR A;  2HHH T;  3AED A;  3CX6 B;  5CJ5 A;  5LYJ E;  2VWA A;  4JYA T;  4ZEY A;  3EDU A;  4U31 A;  2XAQ B;  5CA1 E;  4AIS A;  4N78 D;  2ODV A;  2SPC A;  1MNE A;  3E0Z A;  2AXD S;  2WDQ A;  3A8Y C;  4JI0 T;  2XAH B;  1US7 B;  1LRZ A;  2Q9Q D;  2K3W A;  3DP7 A;  2XPK A;  2CRB A;  2N1G A;  4V1A v;  3UU3 A;  2W62 A;  2N2N A;  1XDO A;  2C0S A;  3BQK A;  4X1Y E;  3J7Y q;  1J5W A;  4A97 A;  1EZ3 A;  2IHR 1;  1UGO A;  3K1S A;  2MPK A;  4G2A A;  1WFD A;  2J4G A;  2V7M A;  1YKE B;  5JDH A;  1IBK T;  2WS3 A;  2PTF A;  2VL8 A;  2VVN A;  5AQP B;  3RIU C;  3E08 A;  3ZMS B;  2F4V T;  5HXE A;  5HWX A;  3O1H A;  4DV3 T;  3I0Q A;  3WAJ A;  2DLR A;  5LHI B;  3ETV A;  4UVC B;  1YQ4 A;  3RQW A;  3PU8 A;  1KNR A;  3TLW A;  1XNR T;  3AVS A;  5HCJ A;  3A7M A;  4M1P A;  3RIF A;  1HNX T;  3NWI A;  5LA6 E;  4AKH A;  2LSY A;  2WP9 A;  2CWY A;  3X1D A;  1OXZ A;  5HCM A;  3BQI A;  1OED E;  3T1H T;  2UXN B;  3PUR A;  2XQ4 A;  5IYZ E;  3JC6 D;  4ILA A;  4ZI3 C;  3ABV A;  2RPA A;  3AA0 B;  1BR1 A;  2X66 A;  2V7J A;  4O4I E;  5KXJ A;  1T72 A;  5HWY A;  1BR2 A;  3VKG A;  2YU1 A;  4NUV A;  2YDS A;  3I1A A;  5AQK B;  3PUZ F;  1W0B A;  1I6Z A;  1YD8 G;  2KWH A;  1JNR A;  4HN9 A;  2VKO A;  3O4X E;  5L3G B;  2BKP A;  3L8R A;  2IC9 A;  3LK3 B;  3B13 A;  5LJN A;  1M62 A;  3TKL B;  4WYV A;  1E7P A;  2HPJ A;  1D1A A;  2LSG A;  2J62 A;  3UQ4 A;  3RIU A;  4ILC A;  4DR4 T;  4HWC A;  1NAF A;  2XAG B;  3CX8 B;  4DUZ T;  4KHP T;  4ZZC A;  2LT3 A;  3UU5 A;  3UUM A;  3HKB E;  5M4Y A;  2NW8 A;  3AXJ A;  5AQI B;  3FHN A;  3CML A;  4I4T E;  4A98 A;  4TNV A;  2FBW A;  3PUV F;  4CI1 B;  1MIV A;  4GYR A;  2YEV C;  5C8Y E;  1W0A A;  5JDN A;  4DR3 T;  1KF6 A;  2OLT A;  1XMO T;  3C50 A;  5L3C B;  2CM0 A;  4ADZ A;  2WU5 A;  5JRC A;  5HXR A;  2C5I T;  5JVD E;  4Q25 A;  3J9X 1;  5FY7 A;  1FJG T;  2XM1 A;  1HG5 A;  3ZEF B;  4OK0 A;  4KBM B;  3WAK A;  2ZLY A;  4L0R A;  4IRE A;  4OYK A;  2VKD A;  4YT0 A;  5C3J A;  3GWH A;  2KZ7 B;  3FZL B;  3UU8 A;  3MK7 C;  3RKG A;  2P9B A;  1YW0 A;  2LHN A;  4LF5 T;  3OVU A;  5JR9 A;  3C64 A;  5JTG A;  4PFP A;  2H89 A;  4H9N C;  5J1G A;  1J1J A;  2E5V A;  3Q9D A;  1IBM T;  4LF8 T;  3RKO A;  4EAH A;  3PUW F;  3UU6 A;  4NPP A;  4CQI A;  3MA9 A;  5L4E A;  1V9D A;  3RI5 A;  5ABF B;  3O9X A;  3PU3 A;  5AQG B;  4CN4 A;  2BVL A;  3SWH A;  2WZH A;  1UX5 A;  2XQ5 A;  3CWZ B;  2WQY A;  2OV9 A;  3ZST A;  4C90 A;  1KK7 A;  4HTE A;  1HS7 A;  4TX5 A;  3P4P A;  2BS3 A;  4TNW A;  1OWA A;  4EEB A;  2YU2 A;  1HNZ T;  4B3M T;  2JQH A;  2VQE T;  4F6R C;  5KDM C;  3FXD B;  4HFB A;  4IDZ A;  3AB3 B;  4BJN A;  5EK4 A;  4O2B E;  2Y6X A;  3AEC A;  1BR0 A;  3TLT A;  3PUQ A;  5AQH B;  4YTP A;  4JEU B;  4F8H A;  1M7K A;  3EUH A;  5AQQ B;  1S94 A;  2FJE A;  2IDO B;  1ZEE A;  2WSS V;  4HFC A;  4WBO A;  2XQ6 A;  5AQT B;  2BBH A;  3FBL A;  3I0O A;  2VAS A;  4LF4 T;  3RYC E;  2Y8D A;  2V6X A;  1JNZ A;  3ANW A;  1T98 A;  3ZYM A;  1NEN A;  4YSY A;  1L0V A;  3L09 A;  1DU2 A;  4U7Y A;  4DV6 T;  1UUR A;  5F3J A;  4YSX A;  4HFI A;  5LCY A;  3JAD A;  4OX9 T;  3MKD A;  2RP4 A;  5J2U E;  2Y48 B;  3EI0 A;  3PTR B;  3ZLI A;  3F2E A;  4TZ4 C;  1IBL T;  1MMA A;  4O2A E;  4XZC A;  1KNZ A;  2D0U A;  2E9X B;  3ZC1 A;  2LM9 A;  2QVA A;  5BMV E;  4HWD A;  5AQU B;  2EHO D;  2JJ9 A;  4TN7 B;  4JI8 T;  4FJO A;  3RRW A;  2VK9 A;  4WW0 A;  3OPC A;  2CCQ A;  5FVL A;  1IAP A;  4JI2 T;  5DQW A;  3ZYK A;  2BZB A;  1Y64 B;  3HI2 A;  5KX5 E;  5C2T A;  3IEE A;  3GN5 A;  4HWI B;  4DV4 T;  2JPF A;  2UXB T;  3LK4 2;  1N34 T;  5LGT B;  4KHZ F;  2WDR A;  3VHL A;  4FI5 A;  2LHR A;  3QC9 A;  2X9Y A;  3V5S A;  4IDN A;  2XAS B;  3SFD A;  1XDP A;  4AKI A;  3RRC A;  4AKG A;  3QOF A;  3LBX A;  2M6I A;  4EB6 E;  3AA7 B;  4HKA A;  4TV8 E;  4LMJ A;  3N2K E;  3CKD A;  3KVB A;  5L3B B;  4WNK A;  3UUL A;  4LML A;  3N2O A;  3Q5W A;  1CHU A;  4MFR A;  2W4X A;  3BK9 A;  5HXH A;  4CXY A;  3EHZ A;  4OYJ A;  4DV0 T;  4IDO A;  3ZT6 A;  3HR0 A;  3ONX A;  1LVK A;  3K3O A;  1MND A;  2JQ9 A;  2XUE A;  3RQU A;  2CE7 A;  3LSV A;  4WBN E;  4PFO A;  3F57 A;  1FIO A;  4U3C A;  3HKC E;  5L3F B;  4DND A;  1UX4 A;  4IDQ A;  1KEY A;  5J0Z A;  4YFS A;  2WU2 A;  4U2Y A;  4IDP A;  4DR5 T;  3S4U A;  3MXZ A;  2KMF A;  3AAA B;  3AEA A;  2YDQ A;  2B1E A;  4BA9 A;  1YQ3 A;  4P1N A;  4DUY T;  3RYI E;  4KI0 F;  4ZI7 E;  3PUG A;  4CXX A;  5ADX L;  2WMO A;  2XQ7 A;  3AAI A;  4TV9 E;  4Z90 A;  1VRB A;  5JDF A;  4GIW A;  3MAC A;  3AEE A;  3PV0 F;  1D0Z A;  5LMN T;  3Q5D A;  5DAB A;  1UCU A;  5FY0 A;  3MZK B;  2UXD T;  4DR7 T;  5L47 A;  3CPZ A;  4PK4 A;  3N9N A;  2W2U A;  3KDS E;  3UFE A;  2BG9 A;  4E7Z A;  2XQA A;  5CB4 E;  1T7S A;  3T8O A;  1X9B A;  3PDY A;  3SS1 A;  2ZM0 A;  4O4H E;  4DMW A;  5CFB A;  2QA7 A;  4IE7 A;  2VB6 A;  3DTO A;  4H9S E;  2XSB A;  2JQK A;  4QX8 B;  2MBG A;  3OTO T;  1E2A A;  2KIN B;  3NRX A;  1H7C A;  5BR8 T;  2XQ8 A;  2L3L A;  4X62 T;  1MIW A;  2V8S V;  1HFA A;  4TWH A;  3EAM A;  3E22 E;  4UVA B;  3NRY A;  4H9P C;  5L2L A;  3ZC0 A;  2B76 A;  4PW8 A;  3C98 B;  4Z91 A;  2X0H A;  3KBT A;  2GK9 A;  3C4X A;  5FXX A;  4H9R C;  3KV5 A;  2WMN A;  1QLB A;  3ZT7 A;  2NTY A;  4UXN B;  1WR0 A;  3KVA A;  4NUU A;  1ZHC A;  3ZJ2 A;  5FXW A;  4TUY E;  1MMN A;  4U72 A;  5L3D B;  4ILB A;  3ZMV B;  5IHY A;  4YSZ A;  2CBJ A;  5LG4 A;  5AQJ B;  3LDQ B;  1VCS A;  2ZM6 T;  4K0K T;  1X79 A;  4I43 B;  4JI6 T;  5E0O A;  2CA5 A;  3P4W A;  3AA6 B;  3H3M A;  5TAO A;  3M65 A;  4DV7 T;  4I55 E;  1OED B;  3KIN B;  1W09 A;  4JBW F;  1HCI A;  2UUB T;  3UTK A;  3OBV E;  3RX6 A;  2IML A;  3QUJ A;  4IL4 A;  3ZCI A;  4ZI2 C;  4EOZ B;  5GON E;  1FMW A;  1SUM B;  3MJX A;  3ZMT B;  2V26 A;  4P09 A;  3FXE B;  3LFM A;  4U7I A;  2A9U A;  2E8I A;  3KV9 A;  4PJL A;  1IZN B;  3F31 A;  5AQN B;  5LJM A;  1T8B A;  2A72 A;  4X65 T;  4QH5 A;  5FNV E;  2E5L T;  3K8P C;  4EED A;  3ZN0 B;  3RF1 A;  3H3A A;  2X9H A;  1XNQ T;  3AE7 A;  3FB2 A;  4YJ3 E;  1ZV4 X;  2VL0 A;  2XTL A;  3IF8 B;  4QH1 A;  3P7I A;  2BVM A;  3UQ7 A;  5L4H A;  3RC8 A;  4IT4 A;  4CN6 A;  3RPU A;  2WCA A;  3N9O A;  3TLS A;  1HX8 A;  3AA1 B;  5FL0 A;  4ZS3 A;  5H6Q B;  2V6Y B;  2H7V C;  4U33 A;  1D1C A;  2JMH A;  3IHR A;  4UEL A;  2XM2 A;  2MAW A;  3U78 A;  2X68 A;  2J47 A;  2EHO B;  3QNU A;  3HL6 A;  4B3S T;  3NBX X;  2D0T A;  2XZE A;  1YKH B;  3OJA A;  2XY8 B;  2YKS A;  3CVR A;  3V5U A;  4QH4 A;  2YK0 A;  2X9X A;  2ZM2 A;  4EXT A;  4PJJ A;  3P4Q A;  2PBI A;  4QXB B;  1U5P A;  4PK5 A;  1KNP A;  4EV6 A;  3CQX C;  5H6R B;  4LF9 T;  4YY3 T;  4DBR A;  2DWG A;  4X1K E;  2WWU A;  3C4W A;  3GA8 A;  1WYC A;  4UF0 B;  5FP3 A;  4X5T A;  4BJM A;  5FXZ A;  3UUX B;  3O1J A;  4DR1 T;  3OKQ A;  3N2G E;  2K9A A;  2LKG A;  5DJQ C;  4IE6 A;  3SOL A;  4IST A;  2ODU A;  5AQF B;  4NXM T;  2K5B B;  3UUN A;  3OYZ A;  3KBU A;  2EHO C;  2D2S A;  2C5K T;  2LSK A;  5HEG A;  5FMN A;  4UV8 B;  4MBQ A;  2X67 A;  3ZKR A;  2BDE A;  4WZX A;  2W0G A;  1UUS A;  3LK2 B;  4DV5 T;  4A5X A;  5LG3 A;  3AEF A;  2UXX B;  2ZMA A;  4QX7 B;  2CXL A;  2XQ3 A;  4O8S A;  4X1I E;  5LHH B;  4OHF A;  1NWM X;  5IWA T;  4X66 T;  1D1B A;  2NW9 A;  3L39 A;  5AQM B;  4JI1 T;  1HX1 B;  3EDV A;  3GMI A;  1Z8U A;  4IGU A;  3VRA A;  2M67 A;  3AE4 A;  4UR9 A;  3RYH E;  5LMU T;  2MTQ A;  2VUR A;  2BG9 E;  4A56 A;  5EZY E;  3QK6 A;  1N36 T;  1XMQ T;  1B7T A;  5CA0 E;  2PG8 A;  3VU7 H;  4IHJ E;  4DV2 T;  4YLH A;  2FJD A;  2CHN A;  3ONL C;  1HNW T;  4LMK A;  2CPT A;  3SRZ A;  2YDR A;  4PNI A;  2HH7 A;  3K3N A;  5LP6 E;  2YIN A;  3C51 A;  2DHR A;  2CXD A;  2Q9Q B;  2W63 A;  3M3Z B;  4AKR B;  3KV4 A;  4LF6 T;  5ABF A;  2WWV A;  3AE5 A;  2KWI B;  2PFV A;  2E9X C;  3FZF B;  2VVS A;  2VQF T;  2H7O A;  5F8P A;  2WB5 A;  2LSI A;  3BQL A;  4TWF A;  4X20 E;  4EIW A;  4PJM A;  4YHH T;  4U74 A;  4UV9 B;  5HXS A;  4E7S A;  1G8X A;  1QSD A;  4XBF B;  4HWF A;  3UFG A;  4B3T T;  2KND A;  1ZKE A;  4QXH B;  1XWM A;  4KUM B;  4LFB T;  2VKH A;  4GK0 E;  3Q2M A;  4UVB B;  5JDL A;  4BAY B;  3SFE A;  2Q9Q C;  2QRX A;  2WDV A;  3FBZ A;  3FZM B;  2J1D G;  2C5J A;  5JDM A;  3AEB A;  3ZT5 A;  2HN1 A;  2NOX A;  3OYX A;  3I9Y A;  3VR8 A; 
#chains in the Genus database with same CATH homology
 4DR5 T;  5BR8 T;  4DV2 T;  4NXN T;  4X62 T;  1I94 T;  4GKK T;  1N32 T;  4JI5 T;  4LF9 T;  1HNW T;  4DUY T;  4YY3 T;  4LFC T;  4LF5 T;  4LF4 T;  4X65 T;  4DR1 T;  2E5L T;  1HR0 T;  4NXM T;  1IBM T;  4LF8 T;  4DR6 T;  1XNQ T;  4LF6 T;  1IBK T;  4DV6 T;  2F4V T;  4AQY T;  4OX9 T;  4B3R T;  4DV3 T;  2VQF T;  4DV5 T;  4GKJ T;  5LMN T;  4DR4 T;  2UXD T;  4DR7 T;  1IBL T;  2UUC T;  4DUZ T;  4KHP T;  4YHH T;  1N33 T;  2ZM6 T;  4K0K T;  2HHH T;  4LFA T;  4DV0 T;  4JI4 T;  1XNR T;  2UUA T;  4JI6 T;  4DV1 T;  2UXC T;  4B3T T;  4JYA T;  1HNZ T;  4B3M T;  5IWA T;  4DV7 T;  4JI3 T;  4X66 T;  4JI8 T;  1HNX T;  4JI1 T;  2VQE T;  4JI7 T;  4LFB T;  4B3S T;  4DR3 T;  1XMO T;  2UUB T;  5LMU T;  4JI2 T;  4LF7 T;  1N36 T;  4X64 T;  1XMQ T;  2UU9 T;  1J5E T;  3T1H T;  4JI0 T;  4JV5 T;  3OTO T;  3T1Y T;  4DV4 T;  2UXB T;  1N34 T;  1FJG T;  4DR2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...