1IBLT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1iblT00
4DV0T 4DR1T 1IBMT 1N32T 2UXDT 1IBKT 4OX9T 4DR7T 4DV7T 3OTOT 1HNZT 2VQFT 4DR3T 4X65T 1HNWT 4KHPT 4JI6T 3T1HT 4B3RT 4JI1T 2ZM6T 2E5LT 4LFAT 4DV5T 4GKJT 4LFBT 4DV6T 4JI2T 5LMUT 4YHHT 5BR8T 4NXMT 4JYAT 4JI0T 2F4VT 4B3TT 4LF6T 4YY3T 4B3ST 4DV3T 2UUCT 2UXCT 1IBLT 4AQYT 1J5ET 4JI8T 4NXNT 4DV1T 4DR6T 2HHHT 1FJGT 4JI5T 4LF5T 5IWAT 4DV4T 4B3MT 1XMOT 2UUAT 4DR4T 1XMQT 1N34T 4DV2T 4JI3T 4DR5T 4LF9T 4LF8T 2UUBT 4LFCT 1HR0T 5LMNT 4X64T 1N36T 4X62T 1N33T 4X66T 4JV5T 4JI7T 1XNQT 1XNRT 4K0KT 3T1YT 1HNXT 4DUYT 4LF7T 4GKKT 2VQET 1I94T 4LF4T 2UU9T 4DR2T 4JI4T 4DUZT 2UXBT
chains in the Genus database with same CATH superfamily
2CA5A 4X5TA 2QVAA 4AIUA 2X9WA 5M4YA 4X65T 4PK5A 2ZLYA 2DCFA 5LHIB 3P4WA 1AJ3A 4GKJT 3CQXC 2CPTA 2CXFA 1KF6A 3L8RA 4KP3C 3TLUA 3ZMTB 5LBQB 2MBGA 5LHHB 2W61A 3C98B 3JC6D 1HX8A 1W0AA 2YN6A 3N9QA 2CBIA 1UGOA 4IDNA 3ZMUB 2C5KT 3RLFF 2UUCT 1ZEEA 3P4QA 4AQYT 3EDVA 3N2KE 4DR6T 5AQFB 4IDOA 1KFYA 1OXZA 4NPPA 1FJGT 1YQ3A 1ZHCA 4ILUA 3BQLA 3K1SA 2YKSA 4CN1A 4HFIA 2RPAA 3OYXA 4LF9T 2W2UA 2FJDA 4PAGA 4H9QC 3KBUA 4XZCA 4HTEA 3AE5A 4P0BA 1ZKEA 2LOPA 1N36T 4AISA 2V6YA 4J2CA 1LVKA 2KZ7B 5LYJE 4DUYT 3N9OA 4UEMA 3TLVA 3IHRA 2WDRA 1NWMX 3KV9A 2PTFA 4IE4A 4WNKA 1VRBA 2WDQA 2FJBA 3ESLA 3AVSA 2HH7A 3SS1A 1FMVA 3L39A 3HKBE 2W0GA 4QWNB 2K24A 3PTRB 2LRKA 4GIWA 4KHPT 3CK6A 5L3DB 4LMLA 4HWCA 3WAJA 2LKGA 3PUGA 2XASB 2K5BB 4JEUB 4I43B 5HAXA 4B3TT 3C64A 5J1GA 3OKQA 1NEKA 2CLYC 5L4EA 1H7CA 4QKNA 3FZFB 4JI8T 3D0TA 4JI5T 5IHYA 3PU8A 4CI2B 2LLYA 2XUEA 4HFEA 5HYAA 2UUAT 4YXDA 5HEGA 3IA3A 4V1Av 4DVDA 4UXNB 2BG9A 1UURA 4NUVA 5LMNT 3OBVE 3EDUA 2NR4A 4PNIA 1WLXA 5FXZA 1WR0A 2QA7A 1HX1B 1KK7A 2YOEA 4MLKA 3T8OA 5LG3A 3LK3B 5CA1E 2XQ7A 1OEDA 4CXXA 2XAJB 4IHJE 1S35A 5FL0A 2FUPA 3MKDA 2Q9QC 3CQCB 3UU3A 3AE4A 2DLRA 5EZYE 4OX9T 2XQ6A 3V5SA 5C3JA 3LBXA 2WU2A 4IL4A 3DJBA 1ZV4X 3RKOA 1MIYA 3F31A 4GYSA 3PUWF 1ZP0A 4O2AE 3ZT7A 2NOXA 4XAXB 2XAGB 3NVOA 3J9X1 5AQMB 2ZM8A 4YY3T 4E7ZA 3RRWA 2OA5A 5BMVE 3UU4A 5JR9A 2FJAA 4QX7B 3J7Yq 1YXRA 4DR4T 1XMQT 2M67A 3AE9A 2WCAA 3RYFE 2D5UA 5HXSA 2I0MA 1BR2A 4X64T 5AQQB 4HFBA 2K3WA 2XAHB 3CKDA 4JUYA 3Q5WA 4AKIA 5FP3A 4HWDA 2VQET 3ONLC 5L47A 5LHGB 2V5DA 3N2GE 3KBTA 2VURA 3AE1A 2BS3A 4DR1T 1N32T 2CXDA 4U7IA 2VASA 3OTOT 4QH5A 2V6YB 5F8PA 3UU8A 5GONE 5HXHA 2AE9A 2BG9C 4JI6T 3Q9DA 4AKRB 4AI6A 5LGTB 1SHZC 3VR9A 2L9QA 5LMUT 5L3CB 2BDEA 4HWHA 2YK0A 4B3ST 2H7VC 3VRAA 3RGLA 2CEAA 4U33A 1FEWA 4CQIA 3RYHE 3UU6A 3FXEB 1IJ5A 2HHHT 1BR1A 4HFVA 4KHZF 4QH1A 5FNVE 5JH7E 5FYMA 2YU1A 1X79A 4MBQA 1WR6A 1HTJF 4TUYE 4GK0E 1HCIA 2QYWA 2V1DB 5AFUL 2HN1A 3ZKRA 1U4QA 1Y01A 1HNXT 4DO0A 2NP9A 1YKHB 3KDSE 4I0UA 2UU9T 2BBJA 3I9WA 1JNRA 5DQVA 4CN6A 3ZC1A 5DABA 1T7SA 4EZ4A 5H6QB 4TV8E 2MYSA 4HWFA 5ABFA 3CWZB 2VKDA 4DR7T 2V7KA 3K3QC 2KXPB 3ZCJA 1W09A 3HI2A 3EUHA 2JRKA 4ADZA 2LE8A 2X51A 5KDMC 4ZZBA 2MOZA 2L8KA 3UTKA 2E9XD 3A7MA 1OEDB 2CHOA 3NWIA 4PJMA 2CWYA 2LKHA 2KINB 5AQJB 2CXLA 4OYJA 4K0UA 3ZJ1A 5AQVB 3LBXB 2WSSV 4TN7B 2KWIB 1VCTA 3RI5A 2LJLA 4LF5T 5F5WA 5HEUA 3HR0A 3L3PA 2LM2A 1N34T 4DV2T 1T72A 1XWMA 1HF8A 2XQ9A 5AQPB 5J2UE 3RF1A 4JEHB 3PUYF 2WQYA 2H7OA 1E2AA 3P7IA 5JDLA 2X68A 5JR9B 4HE8A 3SOLA 3N5LA 3PV0F 3PUSA 1HS7A 3Q2MA 4EOZB 5JRCA 4DNDA 4YHJA 1IBMT 1IBKT 5H6RB 4IREA 2BS4A 3AA7B 3W15B 2CM0A 4IE7A 1Z8UA 4Z90A 2JJ9A 2ZM6T 2E5LT 3HKDE 1J5WA 4YTPA 5JDQA 4NXMT 3O4XE 1EZ3A 4CI1B 3KV4A 3B57A 2LHRA 2K9AA 3K3OA 3WI3A 4HWIB 4U2ZA 5AQNB 2UXCT 2A3DA 2W66A 3QB5A 5AQIB 2XAQB 2LSGA 4UIGA 3FBLA 2BVLA 3N2OA 5HWXA 2C5IT 1NAFA 4LF8T 4H9OC 5AQKB 2XTLA 4P1NA 2B76A 4EYUA 1WYBA 3ZMVB 4X1IE 4ZI3C 3AAIA 2Q9QA 4YSYA 2XAFB 1LKXA 3A8YC 3PURA 5AQUB 4QXCB 5J0ZA 5L3FB 1WYCA 4UV9B 3RPUA 3KV6A 4DV0T 4AKLA 1W9RA 3GA8A 3KFWX 2XQ4A 4G2AA 1MIVA 3UFEA 3RHWA 3UT5E 1HNWT 1WRDA 4H9PC 3JCFA 2PG8A 3KVBA 2V8SV 3I9YA 3RYCE 1SA0E 3LG7A 4G63A 2EHOD 5LJNA 3C4XA 3TLTA 3ZC0A 4ANJA 3NKZA 5AQSB 5L3BB 2DNXA 1GQEA 2I6HA 2CHNA 1SE7A 2YDRA 5ABFB 1WFDA 4IE5A 4A56A 3ZMZB 4Z8XA 4KI0F 5EK4A 2KWHA 1J1JA 4WBNE 2E9XC 4EYYR 4PJNA 3R6NA 4DMWA 5LA6E 1CUNA 3AA6B 2IUBA 2BZBA 1D0YA 4QH4A 4EIWA 2Y6XA 4DV4T 4ASKA 4EEBA 5KX5E 5FL1A 3CQGB 4TNVA 3Q5EA 2H88A 4QXHB 4FI5A 3H37A 4H9RC 3AXJA 4YJ2E 3O1JA 2IHR1 3QK6A 2ODVA 5F3JA 3GN5A 4L0RA 2I59A 1UCUA 4EXTA 4PJJA 2MTQA 3LJCA 5JREA 2UXXB 4OHFA 3G06A 3UFGA 4NUUA 3UUMA 1VCSA 3AE7A 4PJLA 2FBWA 4O4HE 2G0UA 3AEEA 4DMVA 2P9BA 3NBXX 2LSYA 2W67A 4UR9A 3A5XA 3HA4A 4ZI7E 3F57A 1ZOYA 4DV7T 3RQWA 5DJQC 2XQYA 4ZOLE 1T98A 4PFPA 1X9BA 3NZQA 2V7JA 3MA9A 4O4IE 4LFBT 2E5VA 2VWAA 3ZSTA 1B7TA 5HXCA 3E08A 3MK7C 3MACA 5JRCB 3FBZA 2JIWA 4M1PA 2W4XA 4AQFC 2E2AA 4OYKA 3AE3A 3LFMA 2CLYB 4BA9A 3P50A 2W00A 1IAPA 4KUMB 3ZMSB 1R8IA 4X20E 2FJEA 3N9MA 3ZCIA 5C2TA 5HXEA 2PJQA 2WWVA 3M3ZB 4IL9A 3JADA 2X9XA 3CMLA 2ZM2A 3JC6C 5A1LA 2WBLA 4I4TE 2MPKA 2HPJA 3L09A 4HEAA 4OK0A 4U72A 2XZEA 1FMWA 1BR0A 3QUJA 3B13A 1MMDA 1HG5A 4JLEA 1Y64B 2BG9E 3SRZA 2Q9QB 3AE8A 2BS2A 5C8YE 2PBIA 4ZXLA 2X67A 3B5MA 1JNZA 2WU5A 3MZKB 2V5CA 3PUVF 5TAOA 2J1DG 3AVRA 2X9YA 2E8IA 2QRXA 5LCYA 4JYAT 2LRLA 5HEOA 4IDZA 2A2FX 4JI0T 1OEDE 3TLSA 2W62A 4U2YA 5AQGB 4DV3T 2A72A 2XSAA 5FKYA 2L3LA 5LP6E 2XQ8A 4O4LE 2EHOC 2ES0A 2WWUA 5JVDE 3C4WA 1KEYA 5HXRA 1BR4A 1YKEB 2H89A 4O4JE 3OYZA 3ETVA 2IIUA 2X0HA 3PDYA 2WY2A 4PFOA 4ZZCA 2D0TA 1UK5A 1MNEA 2UUBT 3AAAB 1MMGA 5FMNA 3VKHA 2M6BA 3FHNA 4TV9E 3ZT6A 5DQWA 5IUXA 3Q5DA 4QXBB 4QHOA 3DP7A 2OV9A 4K0KT 5FY7A 3PUQA 4IDPA 4LF7T 4HN9A 3C51A 4GKKT 2HN2A 2B1EA 5HWYA 2KSRA 4JI4T 2M6IA 1D1AA 3H3AA 2NW7A 3HKCE 1XDPA 3ABVA 3IEEA 3GN5B 1HNZT 5JQGE 3CX7B 3UQ7A 3NRXA 4QX8B 4F8HA 4LFAT 1D0ZA 2UXNB 4IDQA 3SFDA 2BG9B 4JI2T 4BAYB 2ACZA 2DHRA 4U3CA 5FVKA 2XM1A 2QGSA 4P09A 2YDSA 1M62A 1G73A 5AQLB 1YQ4A 1HFAA 3AEDA 2YDQA 2NW9A 1UX4A 4PK4A 3RYIE 5IWAT 5AQHB 2DL1A 2XHEB 2NTYA 4Q25A 2BKPA 4ERRA 1KNZA 4ISTA 2LM9A 3K3NA 5FVLA 3ZPOA 4TX5A 3DTOA 4XBFB 3SFEA 1MNDA 2J62A 4JV5T 5CJ5A 1CHUA 5IYZE 4A97A 3P4RA 2KLQA 1DU2A 4ILCA 3P4PA 3AEAA 1YW0A 2VKJA 4JBWF 4ZHQE 2X66A 4HFDA 3IBPA 2IW5B 5ETWA 2VQFT 4DR3T 4C90A 5LOVE 5J2TE 4JI1T 2LSJA 4DV5T 2E9XA 1QLBA 4DV6T 3PJAA 2V7LA 4CZZB 3NZPA 5LB7B 3N9LA 3AE2A 3ONXA 2D9DA 3LK42 2A9UA 1QSDA 2BVMA 4F6RC 3QC9A 1E1HB 2PFVA 1IJ6A 1U5PA 4Z91A 2JMHA 4NXNT 4ILBA 2MAWA 2LSKA 2DI4A 3AA1B 1SUMB 3RH3A 2XY8B 2WS3A 3VR8A 3EVYA 5LGNB 5EK3A 4LFCT 5LG4A 1OWAA 4DBQA 2VK9A 2Y8DA 2W63A 1I6ZA 2CBJA 4AQGA 1XNQT 4GOUA 3HKEE 4ZS3A 1D1BA 2C0SA 1UUSA 2ZMAA 3BQIA 5FY1A 3PUXF 2WP9A 3MXZA 4HKAA 3R84B 2UXDT 4TZ4C 2JQ9A 5ABGA 1MMNA 3I1AA 1D0XA 3RQUA 1XDOA 3C50A 3MJXA 4A98A 3RX6A 4PK6A 4P0AA 4AQFA 4UVBB 3X1DA 4ZEYA 1UX5A 1MIWA 3ONJA 4DBRA 2LHNA 4EAHA 4YSXA 4KMCA 3ZYKA 5CA0E 2D2SA 2DWKA 2Y48B 4TWHA 4ZI2D 1MMAA 3RIUC 1KNRA 5L4HA 2SPCA 4YFSA 4B3MT 3WAKA 4H63V 4DR5T 2D0UA 3EAMA 3P8CD 3VHLA 2WMNA 3VU7H 2HPLA 3ZYMA 5L2LA 1N33T 5KXJA 4DIDB 3C4ZA 4JI7T 2VVSA 3T1YT 3AECA 2V7IA 3JAEA 3O1HA 4ILAA 1M7KA 3FB2A 1I94T 2ODUA 3OVUA 4EZHA 4YJ3E 5ABEA 2CWOA 3AE6A 5LXTE 4A5XA 3FZLB 3RC8A 1WCRA 2WZIA 4YTMA 2JMKA 2XJ7A 2OLTA 4X1YE 4MFRA 4BJMA 4CXYA 4TWFA 4ISSA 1T8BA 2EHOA 1NENA 3I0QA 5AQRB 5ABHA 4UVCB 2BKNA 4U74A 2WB5A 3U3IA 4O2BE 3AEFA 2K48A 5JDGA 4EB6E 2JQKA 4H9NC 4C91A 3CPZA 5L3EB 1IBLT 4ZS2A 4DV1T 2E9XB 2NTXA 2WM9A 4LMKA 3RRCA 1XMOT 4GK5E 4YSZA 3UUBA 3H3MA 1O3XA 3UUNA 4EGWA 3M65A 2YU2A 3VKGA 3FXDB 4UF0A 3SWHA 4E7SA 5E0OA 3LK2B 4AXPA 3GWHA 4X66T 3QB5K 2N1GA 4WBOA 2WDVA 4MALA 3PE0A 2RA1A 3E22E 3ZT5A 4DR2T 4KX6A 1US7B 4IE0A 4YT0A 5HCJA 3ZJ2A 4DUZT 2X0LB 1YD8G 3KINB 3F2EA 2V6XA 3UQ4A 3N9NA 2YEVC 3T1HT 3UULA 3ZSSA 5CGMA 4HGAA 3CX6B 2JQQA 4U7YA 3OPCA 4PW8A 1IZNB 4YHHT 5BR8T 2VKOA 3ZEFB 2VB6A 4I55E 3O1IA 2AXDS 3ZN1B 4OFZA 1V9DA 2ZM0A 2ACXA 3I0OA 3OJAA 2XM2A 2KNDA 2VKHA 5LJMA 1QUUA 1J5ET 4UV8B 4WW0A 4NIQA 4JI3T 3UUXB 3AAEB 4O8SA 4ZI2C 2C5JA 3ETUA 3ANWA 1L0VA 3ZYLA 2JQHA 2X0YA 1HR0T 4B6XA 4H9SE 3CIRA 3JAFA 5HCMA 3BK9A 4X62T 3E0ZA 2DWGA 3O9XA 2XQ5A 1XNRT 1KNPA 3K8PC 3AEGA 3P4SA 2IMLA 3S4UA 3CX8B 4LF4T 4FJOA 3PUAA 1W0BA 5AQTB 4GYRA 2IC9A 2CMRA 5KMGP 3QOFA 3RIFA 3KVAA 4L9IA 5AQOB 2NWBA 2X9HA 1HG2A 3TKLB 3Q5XA 2N9DA 1OEDC 3RKGA 2V26A 3AB3B 5FXVA 4B3RT 2XSBA 3RC3A 2LT3A 3EI0A 4MHCA 3KV5A 3AXJB 3CVRA 3LSVA 4IT4A 4IGUA 4UVAB 3FZKB 3NRYA 2R6GF 4ZI3D 1VOMA 2GK9A 2IAKA 1E7PA 3FZMB 4I50E 1LVFA 2J47A 2WMOA 3PJAJ 2WAUA 4TWDA 4IE6A 5LNKA 2N2NA 5FXWA 2EHOB 5HEHA 4BJNA 4AKGA 2BKOA 2Z6EA 3HL6A 2XQAA 5FY0A 2XPKA 3N9PA 3PUZF 2V7MA 2XQ3A 4U31A 2IC6A 5JR9C 3UU5A 4KBMB 2VL8A 2IDOB 3TLWA 4HFHA 4N78D 3VRBA 2VVNA 5ADXL 5HEJA 2LOSA 1XZYA 4EEDA 5JDHA 3EHZA 5LBMA 1Z0PA 2CCQA 1FIOA 4CXWA 2BBHA 4UF0B 4LMJA 5CFBA 4L5GA 2J4GA 3PU3A 3QNUA 3FZHB 2H3RA 5L3GB 5JDNA 4CN4A 1LRZA 2KT9A 3U78A 3RIUA 1G8XA 3BQKA 4COFA 5CB4E 3LDQB 2F4VT 4YLHA 5JDMA 4LF6T 4AKHA 2LEHA 2WZHA 3ZN0B 5EK2A 2KMFA 2YINA 4TNWA 3V5UA 2JPFA 2RP4A 5LGUB 4WYVA 4X1KE 4HFCA 4UELA 3IF8B 2LSIA 2CE7A 5FXXA 3AA0B 2VL0A 2CRBA 1S94A 3GMIA 2NW8A 1D1CA 3RIAA 2Q9QD 4YTNA 3EABA 4EV6A 5JDFA 5JTGA 4H63H 4CI3B 4IIJE 3ZLIA 3AEBA 4WZXA 2UXBT 3ANWB
chains in the Genus database with same CATH topology
4DV0T 4DR1T 1IBMT 1N32T 2UXDT 1IBKT 4OX9T 4DR7T 4DV7T 3OTOT 1HNZT 2VQFT 4DR3T 4X65T 1HNWT 4KHPT 4JI6T 3T1HT 4B3RT 4JI1T 2ZM6T 2E5LT 4LFAT 4DV5T 4GKJT 4LFBT 4DV6T 4JI2T 5LMUT 4YHHT 5BR8T 4NXMT 4JYAT 4JI0T 2F4VT 4B3TT 4LF6T 4YY3T 4B3ST 4DV3T 2UUCT 2UXCT 1IBLT 4AQYT 1J5ET 4JI8T 4NXNT 4DV1T 4DR6T 2HHHT 1FJGT 4JI5T 4LF5T 5IWAT 4DV4T 4B3MT 1XMOT 2UUAT 4DR4T 1XMQT 1N34T 4DV2T 4JI3T 4DR5T 4LF9T 4LF8T 2UUBT 4LFCT 1HR0T 5LMNT 4X64T 1N36T 4X62T 1N33T 4X66T 4JV5T 4JI7T 1XNQT 1XNRT 4K0KT 3T1YT 1HNXT 4DUYT 4LF7T 4GKKT 2VQET 1I94T 4LF4T 2UU9T 4DR2T 4JI4T 4DUZT 2UXBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 T;  4DR1 T;  1IBM T;  1N32 T;  2UXD T;  1IBK T;  4OX9 T;  4DR7 T;  4DV7 T;  3OTO T;  1HNZ T;  2VQF T;  4DR3 T;  4X65 T;  1HNW T;  4KHP T;  4JI6 T;  3T1H T;  4B3R T;  4JI1 T;  2ZM6 T;  2E5L T;  4LFA T;  4DV5 T;  4GKJ T;  4LFB T;  4DV6 T;  4JI2 T;  5LMU T;  4YHH T;  5BR8 T;  4NXM T;  4JYA T;  4JI0 T;  2F4V T;  4B3T T;  4LF6 T;  4YY3 T;  4B3S T;  4DV3 T;  2UUC T;  2UXC T;  1IBL T;  4AQY T;  1J5E T;  4JI8 T;  4NXN T;  4DV1 T;  4DR6 T;  2HHH T;  1FJG T;  4JI5 T;  4LF5 T;  5IWA T;  4DV4 T;  4B3M T;  1XMO T;  2UUA T;  4DR4 T;  1XMQ T;  1N34 T;  4DV2 T;  4JI3 T;  4DR5 T;  4LF9 T;  4LF8 T;  2UUB T;  4LFC T;  1HR0 T;  5LMN T;  4X64 T;  1N36 T;  4X62 T;  1N33 T;  4X66 T;  4JV5 T;  4JI7 T;  1XNQ T;  1XNR T;  4K0K T;  3T1Y T;  1HNX T;  4DUY T;  4LF7 T;  4GKK T;  2VQE T;  1I94 T;  4LF4 T;  2UU9 T;  4DR2 T;  4JI4 T;  4DUZ T;  2UXB T; 
#chains in the Genus database with same CATH topology
 2CA5 A;  4X5T A;  2QVA A;  4AIU A;  2X9W A;  5M4Y A;  4X65 T;  4PK5 A;  2ZLY A;  2DCF A;  5LHI B;  3P4W A;  1AJ3 A;  4GKJ T;  3CQX C;  2CPT A;  2CXF A;  1KF6 A;  3L8R A;  4KP3 C;  3TLU A;  3ZMT B;  5LBQ B;  2MBG A;  5LHH B;  2W61 A;  3C98 B;  3JC6 D;  1HX8 A;  1W0A A;  2YN6 A;  3N9Q A;  2CBI A;  1UGO A;  4IDN A;  3ZMU B;  2C5K T;  3RLF F;  2UUC T;  1ZEE A;  3P4Q A;  4AQY T;  3EDV A;  3N2K E;  4DR6 T;  5AQF B;  4IDO A;  1KFY A;  1OXZ A;  4NPP A;  1FJG T;  1YQ3 A;  1ZHC A;  4ILU A;  3BQL A;  3K1S A;  2YKS A;  4CN1 A;  4HFI A;  2RPA A;  3OYX A;  4LF9 T;  2W2U A;  2FJD A;  4PAG A;  4H9Q C;  3KBU A;  4XZC A;  4HTE A;  3AE5 A;  4P0B A;  1ZKE A;  2LOP A;  1N36 T;  4AIS A;  2V6Y A;  4J2C A;  1LVK A;  2KZ7 B;  5LYJ E;  4DUY T;  3N9O A;  4UEM A;  3TLV A;  3IHR A;  2WDR A;  1NWM X;  3KV9 A;  2PTF A;  4IE4 A;  4WNK A;  1VRB A;  2WDQ A;  2FJB A;  3ESL A;  3AVS A;  2HH7 A;  3SS1 A;  1FMV A;  3L39 A;  3HKB E;  2W0G A;  4QWN B;  2K24 A;  3PTR B;  2LRK A;  4GIW A;  4KHP T;  3CK6 A;  5L3D B;  4LML A;  4HWC A;  3WAJ A;  2LKG A;  3PUG A;  2XAS B;  2K5B B;  4JEU B;  4I43 B;  5HAX A;  4B3T T;  3C64 A;  5J1G A;  3OKQ A;  1NEK A;  2CLY C;  5L4E A;  1H7C A;  4QKN A;  3FZF B;  4JI8 T;  3D0T A;  4JI5 T;  5IHY A;  3PU8 A;  4CI2 B;  2LLY A;  2XUE A;  4HFE A;  5HYA A;  2UUA T;  4YXD A;  5HEG A;  3IA3 A;  4V1A v;  4DVD A;  4UXN B;  2BG9 A;  1UUR A;  4NUV A;  5LMN T;  3OBV E;  3EDU A;  2NR4 A;  4PNI A;  1WLX A;  5FXZ A;  1WR0 A;  2QA7 A;  1HX1 B;  1KK7 A;  2YOE A;  4MLK A;  3T8O A;  5LG3 A;  3LK3 B;  5CA1 E;  2XQ7 A;  1OED A;  4CXX A;  2XAJ B;  4IHJ E;  1S35 A;  5FL0 A;  2FUP A;  3MKD A;  2Q9Q C;  3CQC B;  3UU3 A;  3AE4 A;  2DLR A;  5EZY E;  4OX9 T;  2XQ6 A;  3V5S A;  5C3J A;  3LBX A;  2WU2 A;  4IL4 A;  3DJB A;  1ZV4 X;  3RKO A;  1MIY A;  3F31 A;  4GYS A;  3PUW F;  1ZP0 A;  4O2A E;  3ZT7 A;  2NOX A;  4XAX B;  2XAG B;  3NVO A;  3J9X 1;  5AQM B;  2ZM8 A;  4YY3 T;  4E7Z A;  3RRW A;  2OA5 A;  5BMV E;  3UU4 A;  5JR9 A;  2FJA A;  4QX7 B;  3J7Y q;  1YXR A;  4DR4 T;  1XMQ T;  2M67 A;  3AE9 A;  2WCA A;  3RYF E;  2D5U A;  5HXS A;  2I0M A;  1BR2 A;  4X64 T;  5AQQ B;  4HFB A;  2K3W A;  2XAH B;  3CKD A;  4JUY A;  3Q5W A;  4AKI A;  5FP3 A;  4HWD A;  2VQE T;  3ONL C;  5L47 A;  5LHG B;  2V5D A;  3N2G E;  3KBT A;  2VUR A;  3AE1 A;  2BS3 A;  4DR1 T;  1N32 T;  2CXD A;  4U7I A;  2VAS A;  3OTO T;  4QH5 A;  2V6Y B;  5F8P A;  3UU8 A;  5GON E;  5HXH A;  2AE9 A;  2BG9 C;  4JI6 T;  3Q9D A;  4AKR B;  4AI6 A;  5LGT B;  1SHZ C;  3VR9 A;  2L9Q A;  5LMU T;  5L3C B;  2BDE A;  4HWH A;  2YK0 A;  4B3S T;  2H7V C;  3VRA A;  3RGL A;  2CEA A;  4U33 A;  1FEW A;  4CQI A;  3RYH E;  3UU6 A;  3FXE B;  1IJ5 A;  2HHH T;  1BR1 A;  4HFV A;  4KHZ F;  4QH1 A;  5FNV E;  5JH7 E;  5FYM A;  2YU1 A;  1X79 A;  4MBQ A;  1WR6 A;  1HTJ F;  4TUY E;  4GK0 E;  1HCI A;  2QYW A;  2V1D B;  5AFU L;  2HN1 A;  3ZKR A;  1U4Q A;  1Y01 A;  1HNX T;  4DO0 A;  2NP9 A;  1YKH B;  3KDS E;  4I0U A;  2UU9 T;  2BBJ A;  3I9W A;  1JNR A;  5DQV A;  4CN6 A;  3ZC1 A;  5DAB A;  1T7S A;  4EZ4 A;  5H6Q B;  4TV8 E;  2MYS A;  4HWF A;  5ABF A;  3CWZ B;  2VKD A;  4DR7 T;  2V7K A;  3K3Q C;  2KXP B;  3ZCJ A;  1W09 A;  3HI2 A;  3EUH A;  2JRK A;  4ADZ A;  2LE8 A;  2X51 A;  5KDM C;  4ZZB A;  2MOZ A;  2L8K A;  3UTK A;  2E9X D;  3A7M A;  1OED B;  2CHO A;  3NWI A;  4PJM A;  2CWY A;  2LKH A;  2KIN B;  5AQJ B;  2CXL A;  4OYJ A;  4K0U A;  3ZJ1 A;  5AQV B;  3LBX B;  2WSS V;  4TN7 B;  2KWI B;  1VCT A;  3RI5 A;  2LJL A;  4LF5 T;  5F5W A;  5HEU A;  3HR0 A;  3L3P A;  2LM2 A;  1N34 T;  4DV2 T;  1T72 A;  1XWM A;  1HF8 A;  2XQ9 A;  5AQP B;  5J2U E;  3RF1 A;  4JEH B;  3PUY F;  2WQY A;  2H7O A;  1E2A A;  3P7I A;  5JDL A;  2X68 A;  5JR9 B;  4HE8 A;  3SOL A;  3N5L A;  3PV0 F;  3PUS A;  1HS7 A;  3Q2M A;  4EOZ B;  5JRC A;  4DND A;  4YHJ A;  1IBM T;  1IBK T;  5H6R B;  4IRE A;  2BS4 A;  3AA7 B;  3W15 B;  2CM0 A;  4IE7 A;  1Z8U A;  4Z90 A;  2JJ9 A;  2ZM6 T;  2E5L T;  3HKD E;  1J5W A;  4YTP A;  5JDQ A;  4NXM T;  3O4X E;  1EZ3 A;  4CI1 B;  3KV4 A;  3B57 A;  2LHR A;  2K9A A;  3K3O A;  3WI3 A;  4HWI B;  4U2Z A;  5AQN B;  2UXC T;  2A3D A;  2W66 A;  3QB5 A;  5AQI B;  2XAQ B;  2LSG A;  4UIG A;  3FBL A;  2BVL A;  3N2O A;  5HWX A;  2C5I T;  1NAF A;  4LF8 T;  4H9O C;  5AQK B;  2XTL A;  4P1N A;  2B76 A;  4EYU A;  1WYB A;  3ZMV B;  4X1I E;  4ZI3 C;  3AAI A;  2Q9Q A;  4YSY A;  2XAF B;  1LKX A;  3A8Y C;  3PUR A;  5AQU B;  4QXC B;  5J0Z A;  5L3F B;  1WYC A;  4UV9 B;  3RPU A;  3KV6 A;  4DV0 T;  4AKL A;  1W9R A;  3GA8 A;  3KFW X;  2XQ4 A;  4G2A A;  1MIV A;  3UFE A;  3RHW A;  3UT5 E;  1HNW T;  1WRD A;  4H9P C;  3JCF A;  2PG8 A;  3KVB A;  2V8S V;  3I9Y A;  3RYC E;  1SA0 E;  3LG7 A;  4G63 A;  2EHO D;  5LJN A;  3C4X A;  3TLT A;  3ZC0 A;  4ANJ A;  3NKZ A;  5AQS B;  5L3B B;  2DNX A;  1GQE A;  2I6H A;  2CHN A;  1SE7 A;  2YDR A;  5ABF B;  1WFD A;  4IE5 A;  4A56 A;  3ZMZ B;  4Z8X A;  4KI0 F;  5EK4 A;  2KWH A;  1J1J A;  4WBN E;  2E9X C;  4EYY R;  4PJN A;  3R6N A;  4DMW A;  5LA6 E;  1CUN A;  3AA6 B;  2IUB A;  2BZB A;  1D0Y A;  4QH4 A;  4EIW A;  2Y6X A;  4DV4 T;  4ASK A;  4EEB A;  5KX5 E;  5FL1 A;  3CQG B;  4TNV A;  3Q5E A;  2H88 A;  4QXH B;  4FI5 A;  3H37 A;  4H9R C;  3AXJ A;  4YJ2 E;  3O1J A;  2IHR 1;  3QK6 A;  2ODV A;  5F3J A;  3GN5 A;  4L0R A;  2I59 A;  1UCU A;  4EXT A;  4PJJ A;  2MTQ A;  3LJC A;  5JRE A;  2UXX B;  4OHF A;  3G06 A;  3UFG A;  4NUU A;  3UUM A;  1VCS A;  3AE7 A;  4PJL A;  2FBW A;  4O4H E;  2G0U A;  3AEE A;  4DMV A;  2P9B A;  3NBX X;  2LSY A;  2W67 A;  4UR9 A;  3A5X A;  3HA4 A;  4ZI7 E;  3F57 A;  1ZOY A;  4DV7 T;  3RQW A;  5DJQ C;  2XQY A;  4ZOL E;  1T98 A;  4PFP A;  1X9B A;  3NZQ A;  2V7J A;  3MA9 A;  4O4I E;  4LFB T;  2E5V A;  2VWA A;  3ZST A;  1B7T A;  5HXC A;  3E08 A;  3MK7 C;  3MAC A;  5JRC B;  3FBZ A;  2JIW A;  4M1P A;  2W4X A;  4AQF C;  2E2A A;  4OYK A;  3AE3 A;  3LFM A;  2CLY B;  4BA9 A;  3P50 A;  2W00 A;  1IAP A;  4KUM B;  3ZMS B;  1R8I A;  4X20 E;  2FJE A;  3N9M A;  3ZCI A;  5C2T A;  5HXE A;  2PJQ A;  2WWV A;  3M3Z B;  4IL9 A;  3JAD A;  2X9X A;  3CML A;  2ZM2 A;  3JC6 C;  5A1L A;  2WBL A;  4I4T E;  2MPK A;  2HPJ A;  3L09 A;  4HEA A;  4OK0 A;  4U72 A;  2XZE A;  1FMW A;  1BR0 A;  3QUJ A;  3B13 A;  1MMD A;  1HG5 A;  4JLE A;  1Y64 B;  2BG9 E;  3SRZ A;  2Q9Q B;  3AE8 A;  2BS2 A;  5C8Y E;  2PBI A;  4ZXL A;  2X67 A;  3B5M A;  1JNZ A;  2WU5 A;  3MZK B;  2V5C A;  3PUV F;  5TAO A;  2J1D G;  3AVR A;  2X9Y A;  2E8I A;  2QRX A;  5LCY A;  4JYA T;  2LRL A;  5HEO A;  4IDZ A;  2A2F X;  4JI0 T;  1OED E;  3TLS A;  2W62 A;  4U2Y A;  5AQG B;  4DV3 T;  2A72 A;  2XSA A;  5FKY A;  2L3L A;  5LP6 E;  2XQ8 A;  4O4L E;  2EHO C;  2ES0 A;  2WWU A;  5JVD E;  3C4W A;  1KEY A;  5HXR A;  1BR4 A;  1YKE B;  2H89 A;  4O4J E;  3OYZ A;  3ETV A;  2IIU A;  2X0H A;  3PDY A;  2WY2 A;  4PFO A;  4ZZC A;  2D0T A;  1UK5 A;  1MNE A;  2UUB T;  3AAA B;  1MMG A;  5FMN A;  3VKH A;  2M6B A;  3FHN A;  4TV9 E;  3ZT6 A;  5DQW A;  5IUX A;  3Q5D A;  4QXB B;  4QHO A;  3DP7 A;  2OV9 A;  4K0K T;  5FY7 A;  3PUQ A;  4IDP A;  4LF7 T;  4HN9 A;  3C51 A;  4GKK T;  2HN2 A;  2B1E A;  5HWY A;  2KSR A;  4JI4 T;  2M6I A;  1D1A A;  3H3A A;  2NW7 A;  3HKC E;  1XDP A;  3ABV A;  3IEE A;  3GN5 B;  1HNZ T;  5JQG E;  3CX7 B;  3UQ7 A;  3NRX A;  4QX8 B;  4F8H A;  4LFA T;  1D0Z A;  2UXN B;  4IDQ A;  3SFD A;  2BG9 B;  4JI2 T;  4BAY B;  2ACZ A;  2DHR A;  4U3C A;  5FVK A;  2XM1 A;  2QGS A;  4P09 A;  2YDS A;  1M62 A;  1G73 A;  5AQL B;  1YQ4 A;  1HFA A;  3AED A;  2YDQ A;  2NW9 A;  1UX4 A;  4PK4 A;  3RYI E;  5IWA T;  5AQH B;  2DL1 A;  2XHE B;  2NTY A;  4Q25 A;  2BKP A;  4ERR A;  1KNZ A;  4IST A;  2LM9 A;  3K3N A;  5FVL A;  3ZPO A;  4TX5 A;  3DTO A;  4XBF B;  3SFE A;  1MND A;  2J62 A;  4JV5 T;  5CJ5 A;  1CHU A;  5IYZ E;  4A97 A;  3P4R A;  2KLQ A;  1DU2 A;  4ILC A;  3P4P A;  3AEA A;  1YW0 A;  2VKJ A;  4JBW F;  4ZHQ E;  2X66 A;  4HFD A;  3IBP A;  2IW5 B;  5ETW A;  2VQF T;  4DR3 T;  4C90 A;  5LOV E;  5J2T E;  4JI1 T;  2LSJ A;  4DV5 T;  2E9X A;  1QLB A;  4DV6 T;  3PJA A;  2V7L A;  4CZZ B;  3NZP A;  5LB7 B;  3N9L A;  3AE2 A;  3ONX A;  2D9D A;  3LK4 2;  2A9U A;  1QSD A;  2BVM A;  4F6R C;  3QC9 A;  1E1H B;  2PFV A;  1IJ6 A;  1U5P A;  4Z91 A;  2JMH A;  4NXN T;  4ILB A;  2MAW A;  2LSK A;  2DI4 A;  3AA1 B;  1SUM B;  3RH3 A;  2XY8 B;  2WS3 A;  3VR8 A;  3EVY A;  5LGN B;  5EK3 A;  4LFC T;  5LG4 A;  1OWA A;  4DBQ A;  2VK9 A;  2Y8D A;  2W63 A;  1I6Z A;  2CBJ A;  4AQG A;  1XNQ T;  4GOU A;  3HKE E;  4ZS3 A;  1D1B A;  2C0S A;  1UUS A;  2ZMA A;  3BQI A;  5FY1 A;  3PUX F;  2WP9 A;  3MXZ A;  4HKA A;  3R84 B;  2UXD T;  4TZ4 C;  2JQ9 A;  5ABG A;  1MMN A;  3I1A A;  1D0X A;  3RQU A;  1XDO A;  3C50 A;  3MJX A;  4A98 A;  3RX6 A;  4PK6 A;  4P0A A;  4AQF A;  4UVB B;  3X1D A;  4ZEY A;  1UX5 A;  1MIW A;  3ONJ A;  4DBR A;  2LHN A;  4EAH A;  4YSX A;  4KMC A;  3ZYK A;  5CA0 E;  2D2S A;  2DWK A;  2Y48 B;  4TWH A;  4ZI2 D;  1MMA A;  3RIU C;  1KNR A;  5L4H A;  2SPC A;  4YFS A;  4B3M T;  3WAK A;  4H63 V;  4DR5 T;  2D0U A;  3EAM A;  3P8C D;  3VHL A;  2WMN A;  3VU7 H;  2HPL A;  3ZYM A;  5L2L A;  1N33 T;  5KXJ A;  4DID B;  3C4Z A;  4JI7 T;  2VVS A;  3T1Y T;  3AEC A;  2V7I A;  3JAE A;  3O1H A;  4ILA A;  1M7K A;  3FB2 A;  1I94 T;  2ODU A;  3OVU A;  4EZH A;  4YJ3 E;  5ABE A;  2CWO A;  3AE6 A;  5LXT E;  4A5X A;  3FZL B;  3RC8 A;  1WCR A;  2WZI A;  4YTM A;  2JMK A;  2XJ7 A;  2OLT A;  4X1Y E;  4MFR A;  4BJM A;  4CXY A;  4TWF A;  4ISS A;  1T8B A;  2EHO A;  1NEN A;  3I0Q A;  5AQR B;  5ABH A;  4UVC B;  2BKN A;  4U74 A;  2WB5 A;  3U3I A;  4O2B E;  3AEF A;  2K48 A;  5JDG A;  4EB6 E;  2JQK A;  4H9N C;  4C91 A;  3CPZ A;  5L3E B;  1IBL T;  4ZS2 A;  4DV1 T;  2E9X B;  2NTX A;  2WM9 A;  4LMK A;  3RRC A;  1XMO T;  4GK5 E;  4YSZ A;  3UUB A;  3H3M A;  1O3X A;  3UUN A;  4EGW A;  3M65 A;  2YU2 A;  3VKG A;  3FXD B;  4UF0 A;  3SWH A;  4E7S A;  5E0O A;  3LK2 B;  4AXP A;  3GWH A;  4X66 T;  3QB5 K;  2N1G A;  4WBO A;  2WDV A;  4MAL A;  3PE0 A;  2RA1 A;  3E22 E;  3ZT5 A;  4DR2 T;  4KX6 A;  1US7 B;  4IE0 A;  4YT0 A;  5HCJ A;  3ZJ2 A;  4DUZ T;  2X0L B;  1YD8 G;  3KIN B;  3F2E A;  2V6X A;  3UQ4 A;  3N9N A;  2YEV C;  3T1H T;  3UUL A;  3ZSS A;  5CGM A;  4HGA A;  3CX6 B;  2JQQ A;  4U7Y A;  3OPC A;  4PW8 A;  1IZN B;  4YHH T;  5BR8 T;  2VKO A;  3ZEF B;  2VB6 A;  4I55 E;  3O1I A;  2AXD S;  3ZN1 B;  4OFZ A;  1V9D A;  2ZM0 A;  2ACX A;  3I0O A;  3OJA A;  2XM2 A;  2KND A;  2VKH A;  5LJM A;  1QUU A;  1J5E T;  4UV8 B;  4WW0 A;  4NIQ A;  4JI3 T;  3UUX B;  3AAE B;  4O8S A;  4ZI2 C;  2C5J A;  3ETU A;  3ANW A;  1L0V A;  3ZYL A;  2JQH A;  2X0Y A;  1HR0 T;  4B6X A;  4H9S E;  3CIR A;  3JAF A;  5HCM A;  3BK9 A;  4X62 T;  3E0Z A;  2DWG A;  3O9X A;  2XQ5 A;  1XNR T;  1KNP A;  3K8P C;  3AEG A;  3P4S A;  2IML A;  3S4U A;  3CX8 B;  4LF4 T;  4FJO A;  3PUA A;  1W0B A;  5AQT B;  4GYR A;  2IC9 A;  2CMR A;  5KMG P;  3QOF A;  3RIF A;  3KVA A;  4L9I A;  5AQO B;  2NWB A;  2X9H A;  1HG2 A;  3TKL B;  3Q5X A;  2N9D A;  1OED C;  3RKG A;  2V26 A;  3AB3 B;  5FXV A;  4B3R T;  2XSB A;  3RC3 A;  2LT3 A;  3EI0 A;  4MHC A;  3KV5 A;  3AXJ B;  3CVR A;  3LSV A;  4IT4 A;  4IGU A;  4UVA B;  3FZK B;  3NRY A;  2R6G F;  4ZI3 D;  1VOM A;  2GK9 A;  2IAK A;  1E7P A;  3FZM B;  4I50 E;  1LVF A;  2J47 A;  2WMO A;  3PJA J;  2WAU A;  4TWD A;  4IE6 A;  5LNK A;  2N2N A;  5FXW A;  2EHO B;  5HEH A;  4BJN A;  4AKG A;  2BKO A;  2Z6E A;  3HL6 A;  2XQA A;  5FY0 A;  2XPK A;  3N9P A;  3PUZ F;  2V7M A;  2XQ3 A;  4U31 A;  2IC6 A;  5JR9 C;  3UU5 A;  4KBM B;  2VL8 A;  2IDO B;  3TLW A;  4HFH A;  4N78 D;  3VRB A;  2VVN A;  5ADX L;  5HEJ A;  2LOS A;  1XZY A;  4EED A;  5JDH A;  3EHZ A;  5LBM A;  1Z0P A;  2CCQ A;  1FIO A;  4CXW A;  2BBH A;  4UF0 B;  4LMJ A;  5CFB A;  4L5G A;  2J4G A;  3PU3 A;  3QNU A;  3FZH B;  2H3R A;  5L3G B;  5JDN A;  4CN4 A;  1LRZ A;  2KT9 A;  3U78 A;  3RIU A;  1G8X A;  3BQK A;  4COF A;  5CB4 E;  3LDQ B;  2F4V T;  4YLH A;  5JDM A;  4LF6 T;  4AKH A;  2LEH A;  2WZH A;  3ZN0 B;  5EK2 A;  2KMF A;  2YIN A;  4TNW A;  3V5U A;  2JPF A;  2RP4 A;  5LGU B;  4WYV A;  4X1K E;  4HFC A;  4UEL A;  3IF8 B;  2LSI A;  2CE7 A;  5FXX A;  3AA0 B;  2VL0 A;  2CRB A;  1S94 A;  3GMI A;  2NW8 A;  1D1C A;  3RIA A;  2Q9Q D;  4YTN A;  3EAB A;  4EV6 A;  5JDF A;  5JTG A;  4H63 H;  4CI3 B;  4IIJ E;  3ZLI A;  3AEB A;  4WZX A;  2UXB T;  3ANW B; 
#chains in the Genus database with same CATH homology
 4DV0 T;  4DR1 T;  1IBM T;  1N32 T;  2UXD T;  1IBK T;  4OX9 T;  4DR7 T;  4DV7 T;  3OTO T;  1HNZ T;  2VQF T;  4DR3 T;  4X65 T;  1HNW T;  4KHP T;  4JI6 T;  3T1H T;  4B3R T;  4JI1 T;  2ZM6 T;  2E5L T;  4LFA T;  4DV5 T;  4GKJ T;  4LFB T;  4DV6 T;  4JI2 T;  5LMU T;  4YHH T;  5BR8 T;  4NXM T;  4JYA T;  4JI0 T;  2F4V T;  4B3T T;  4LF6 T;  4YY3 T;  4B3S T;  4DV3 T;  2UUC T;  2UXC T;  1IBL T;  4AQY T;  1J5E T;  4JI8 T;  4NXN T;  4DV1 T;  4DR6 T;  2HHH T;  1FJG T;  4JI5 T;  4LF5 T;  5IWA T;  4DV4 T;  4B3M T;  1XMO T;  2UUA T;  4DR4 T;  1XMQ T;  1N34 T;  4DV2 T;  4JI3 T;  4DR5 T;  4LF9 T;  4LF8 T;  2UUB T;  4LFC T;  1HR0 T;  5LMN T;  4X64 T;  1N36 T;  4X62 T;  1N33 T;  4X66 T;  4JV5 T;  4JI7 T;  1XNQ T;  1XNR T;  4K0K T;  3T1Y T;  1HNX T;  4DUY T;  4LF7 T;  4GKK T;  2VQE T;  1I94 T;  4LF4 T;  2UU9 T;  4DR2 T;  4JI4 T;  4DUZ T;  2UXB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...