1IBLT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1iblT00
4GKKT 1N33T 4B3ST 4JI2T 5LMNT 1IBLT 1HNWT 3OTOT 2UUAT 4LF7T 4JI4T 1N32T 4NXMT 2VQET 4LF4T 1XMQT 5LMUT 4JV5T 1HR0T 4X66T 4X62T 3T1YT 2UXCT 4AQYT 4JI8T 4LFAT 2UUBT 4DUZT 2E5LT 2ZM6T 4DUYT 3T1HT 4YY3T 4DR1T 4JI0T 4DV4T 4NXNT 4DR3T 4K0KT 4KHPT 5IWAT 1I94T 1N36T 4DV1T 4OX9T 4LF6T 4DR5T 1HNXT 2F4VT 4B3RT 4GKJT 1XMOT 4B3TT 4LFBT 4DV7T 4JI7T 1XNQT 2UXDT 1FJGT 2UUCT 2UXBT 4JYAT 4X65T 4LF9T 1HNZT 4DR6T 4B3MT 5BR8T 4DV3T 4DR7T 4YHHT 1N34T 2HHHT 4DV5T 4DV0T 1IBKT 4DR2T 4DV2T 1IBMT 4JI1T 4LF8T 2VQFT 1XNRT 2UU9T 4DR4T 4X64T 4JI6T 4LF5T 4LFCT 4DV6T 1J5ET 4JI5T 4JI3T
chains in the Genus database with same CATH superfamily
2DI4A 3E22E 1D0ZA 2WQYA 4JI2T 4MFRA 4BA9A 3FZMB 3KBTA 3N9MA 1WRDA 4XZCA 3A8YC 3N9LA 4E7SA 2B76A 4CI3B 3PDYA 5L2LA 2W0GA 3MA9A 4O8SA 1IBLT 4HTEA 2KINB 5LG3A 1HF8A 1W0AA 2XUEA 5AQPB 3ABVA 4EB6E 2M67A 4CXYA 2WZHA 4NXMT 2VQET 4NUUA 5JH7E 4WW0A 5LMUT 2X0YA 3MXZA 3QB5A 1HR0T 2UXCT 2BDEA 5AQOB 3E08A 3RC3A 1S94A 2KT9A 4ZS2A 3ZT5A 4HN9A 3LK42 4ZZCA 2HN2A 2YDRA 5H6RB 1FEWA 1ZKEA 1WLXA 2A72A 5CA0E 1IAPA 2UXXB 3M65A 4YSYA 2UUBT 4NUVA 4DMVA 3K3OA 4DUZT 4LMJA 3ZN1B 4DUYT 2JQHA 2RA1A 5LYJE 3T1HT 2PBIA 3F57A 2VL8A 4XAXB 4WYVA 4YY3T 2Z6EA 3UU5A 4V1Av 3ANWB 3QC9A 1LKXA 2OV9A 2B1EA 3BQKA 2KZ7B 2ZM2A 3BQLA 3QOFA 4TV9E 2L3LA 3HR0A 1OEDC 3PUGA 3RI5A 3RRCA 3AAEB 4A98A 4DVDA 3O1JA 3UUXB 2BBHA 5J2TE 3A7MA 1BR4A 3PUVF 4JEHB 1N36T 1I94T 1G8XA 3LBXA 4OK0A 4CXXA 2YINA 1D1CA 2KSRA 3CX7B 4X1YE 2M6BA 3GN5A 5DJQC 3SFDA 5EK4A 1MIVA 3ZEFB 2WWVA 3PUSA 4GK5E 3HKDE 3G06A 3JADA 2LRKA 4ILAA 3T8OA 4ZI3D 3C4XA 4ZS3A 3PUAA 5FL1A 5JQGE 3GN5B 3OJAA 3NBXX 3P8CD 1X79A 2JMKA 4JUYA 1BR0A 2XQ9A 3J7Yq 5L4HA 4DR1T 2LSKA 3AA7B 3C50A 4CI2B 2WDQA 3ZJ1A 4JLEA 4B3TT 2XQ4A 4DV7T 3KV9A 2QVAA 3AE9A 3I0QA 4AKRB 2A3DA 3PUYF 1XNQT 3CIRA 4PK5A 4H63H 4ZI2C 1BR2A 2OA5A 5LNKA 3FZLB 4PFOA 5JVDE 2NW7A 2YU2A 2N2NA 2W4XA 5JR9C 1WYBA 2VK9A 3IEEA 4UV8B 4U74A 3AXJA 3K3NA 4UXNB 5F8PA 2E9XD 2VVNA 2RPAA 4OYJA 4O4HE 2X51A 3RYFE 1VCTA 3ZT6A 3UU6A 4X65T 1D0XA 1X9BA 3AEFA 2LSGA 2Q9QB 4DV3T 3FZFB 4AQFC 3RRWA 2WM9A 4EYYR 3OPCA 3HL6A 4IDPA 4DV5T 4I4TE 1BR1A 2X0HA 2MPKA 3N5LA 4YLHA 2ACZA 2KWHA 3D0TA 5KDMC 2LE8A 1XDOA 2V5DA 3CQGB 4Z8XA 3X1DA 1VCSA 2UXNB 1HCIA 2EHOC 2X9WA 1W9RA 4YTPA 4ZHQE 2IAKA 2PFVA 2RP4A 3DTOA 3KV4A 4KI0F 4LF8T 3TLSA 2XQ5A 2LOSA 3CQXC 3OVUA 4O2BE 1UX5A 4O2AE 4OYKA 5AQUB 5FVLA 4QXHB 3VU7H 4NIQA 1XNRT 2EHOD 2NP9A 4KMCA 3AE1A 3LSVA 3UU3A 2JQKA 5ABEA 2PG8A 5AQHB 4AI6A 2XHEB 3ZPOA 3ESLA 3ZYLA 4HEAA 1E1HB 3RPUA 4COFA 3VR9A 4MALA 4TNWA 3F31A 3ONLC 1UUSA 4ASKA 4GOUA 2ACXA 4ZXLA 2Q9QD 2CHNA 2WCAA 4H9OC 5EZYE 3N2GE 4TZ4C 5FXVA 3CQCB 2LOPA 5AQIB 5HXSA 4JI3T 1G73A 3AEDA 2X9YA 3C64A 4B6XA 5M4YA 4U2YA 2BG9A 1KK7A 4PW8A 1N33T 2F4VT 2WSSV 3QB5K 4L9IA 3O9XA 2CXLA 1MMAA 3AVSA 4PJJA 3RYHE 2V7MA 1HG2A 2DWGA 2IDOB 3MACA 3PU8A 4WBOA 2BZBA 3DP7A 5LHIB 5LMNT 4LF5T 1WCRA 3LFMA 3RYIE 4N78D 3SS1A 5E0OA 5JR9B 1WR0A 4LF7T 2LSIA 2W66A 4IT4A 4JI4T 3ZYMA 2V26A 5F5WA 5FNVE 2WDVA 5ABFB 2BVLA 2L8KA 3RIFA 4AKHA 5LG4A 2YDQA 2VASA 3UTKA 4LF4T 5ETWA 1XMQT 3RC8A 2EHOA 5LGUB 2YOEA 3P4WA 3AVRA 4IE6A 5HWXA 2CWOA 3SRZA 4X66T 4U2ZA 4NPPA 3NRYA 1MIYA 1OEDA 2X0LB 5AQKB 3CK6A 5CFBA 4AQYT 2XQ3A 3K1SA 5AQNB 3VHLA 3RH3A 3A5XA 3N9PA 3ZKRA 3PE0A 4U31A 1GQEA 4X5TA 3BQIA 2M6IA 5FKYA 4OFZA 3VRBA 3FB2A 1XWMA 5ABFA 2WU5A 3UUBA 2HPJA 2J4GA 1OEDE 2XQ6A 2VVSA 4IE7A 4ILBA 3ZSSA 1ZV4X 5A1LA 5CA1E 4CI1B 4XBFB 4DV4T 4NXNT 2WWUA 3AE3A 2BG9C 5L4EA 1NENA 2VKHA 2BBJA 2WMNA 3Q5WA 4IDQA 3AE5A 3FZKB 5HEGA 3ZCJA 5IUXA 2CBIA 1CUNA 3E0ZA 1WR6A 4HWCA 4JI1T 3WAJA 4JEUB 4OX9T 3AE6A 1SUMB 4H9QC 4DR5T 2JQ9A 3HKBE 4KP3C 3RGLA 2NR4A 1Y01A 3OBVE 3UUMA 4ILUA 2D0TA 2H7OA 4WNKA 2XAQB 1Z8UA 4QH1A 3UU8A 3LBXB 5L3GB 2BG9E 2YDSA 4ADZA 1KEYA 4LFBT 4PK6A 2KWIB 3JAEA 3TLTA 1IJ6A 1OEDB 5AQRB 4MBQA 5LXTE 1MNEA 3VKHA 2E8IA 2JQQA 2X66A 3JAFA 5LBMA 5EK2A 5LHGB 2K48A 5DQVA 5AQFB 1MMNA 5AQQB 1D0YA 1E7PA 2LSYA 2WMOA 4X1KE 3SFEA 5LB7B 4LF9T 4HFIA 1UCUA 5AQMB 4IREA 4YJ3E 2XM2A 5JR9A 3KFWX 2J62A 2E5VA 1E2AA 4YTMA 2K5BB 3L8RA 5JRCB 2LSJA 3EI0A 2H3RA 3GMIA 3L09A 2J47A 3MK7C 4EV6A 3M3ZB 5FY7A 2VKOA 3SOLA 3U78A 5HCMA 5L3CB 4YSXA 1M62A 5F3JA 2ZLYA 4ZI3C 3IA3A 5L3FB 3IHRA 4IIJE 4DV2T 1LRZA 3ZC0A 5FXWA 3C51A 5GONE 4ZOLE 2E9XB 2WDRA 4L5GA 3TLVA 3N2OA 2E9XC 3EABA 2CA5A 3P4SA 3ZT7A 5FYMA 1ZP0A 3ONJA 3NKZA 4HFBA 3LJCA 3B13A 4HGAA 4UIGA 1YKHB 5HEHA 1ZHCA 2CHOA 4ERRA 4GIWA 4AKLA 2JPFA 4DBQA 1W09A 5JDMA 2Q9QC 2YEVC 4UVAB 4MHCA 1MIWA 2MAWA 3H37A 4AQGA 2C5JA 2XAFB 2L9QA 4BJMA 4GYRA 4EZHA 3FXEB 1L0VA 2LLYA 3P4QA 5KMGP 4F6RC 2QGSA 3O1IA 3ZCIA 5ADXL 1YQ4A 3FBZA 3P4PA 4GYSA 4ISTA 1KNPA 3ZYKA 2A9UA 5J0ZA 5HYAA 2KMFA 2FBWA 2XSAA 4IL4A 4B3ST 4FJOA 2EHOB 3QNUA 1T7SA 1UK5A 2IMLA 2V7LA 2KNDA 2D2SA 5FMNA 3L3PA 3PV0F 3K3QC 4UV9B 2IIUA 3AE7A 5L3BB 5JDQA 3P4RA 3AA6B 3F2EA 4QH5A 5AQGB 2QYWA 5H6QB 2DWKA 5JRCA 4O4JE 5LHHB 2ZMAA 4ZEYA 5C8YE 2VURA 2BG9B 3EHZA 2XQYA 3KVAA 3NWIA 5FXZA 4KUMB 4QXCB 3U3IA 2D5UA 4PJMA 1XDPA 3PJAJ 1S35A 3Q5XA 4CQIA 2LJLA 2YU1A 4X62T 1DU2A 4JI8T 2CMRA 1HS7A 2NW8A 2DLRA 3FBLA 2XY8B 4G63A 3LDQB 1T98A 1Z0PA 2BS2A 3V5SA 3AEEA 4I43B 5LOVE 4LFAT 4EOZB 3ANWA 2OLTA 1YXRA 2V5CA 3KV6A 3B57A 4ISSA 4QX7B 5L3DB 5TAOA 2XASB 4KX6A 5LJMA 1ZEEA 4PJNA 2XZEA 3Q5EA 1HX8A 3NRXA 1JNRA 4L0RA 4PFPA 4ZI2D 5C3JA 3EDVA 4IE5A 5LA6E 3UFEA 3AAAB 4JI0T 2W61A 4IDNA 3AE2A 5HXCA 3VRAA 4EZ4A 3QK6A 4E7ZA 3TLUA 5JDGA 4DR3T 4KHPT 4Q25A 5HXHA 2I59A 2FJDA 1LVKA 2FJBA 4IHJE 2CWYA 4ILCA 3V5UA 1KNZA 4U3CA 4BAYB 4EXTA 5HWYA 4YFSA 5FP3A 1WYCA 3RQUA 5FXXA 3AA0B 4WZXA 4PJLA 3C4ZA 1HNXT 1IJ5A 2YK0A 4A5XA 2FJAA 4M1PA 4DMWA 4HFDA 3RX6A 2C0SA 5HEOA 2NW9A 3TKLB 4A56A 3R84B 1SA0E 2CPTA 2W63A 1KFYA 2CXDA 1NEKA 2LM2A 2XPKA 3CVRA 3HA4A 3HI2A 4DBRA 3P7IA 5LJNA 3AA1B 2K3WA 2HN1A 2WP9A 5JDLA 3RIUA 3UU4A 3UT5E 1SE7A 3O4XE 2WBLA 2CCQA 2CXFA 1I6ZA 2G0UA 2MYSA 5JDNA 1FJGT 3MZKB 2UXDT 3OYZA 4IDZA 3GWHA 4QKNA 3W15B 5HXEA 4JYAT 3IBPA 4HFEA 4P0BA 2XM1A 3ZSTA 5ABHA 2WS3A 5AQSB 3VKGA 4ZI7E 1HNZT 2ODVA 4B3MT 3PUZF 5BR8T 4QH4A 1MMGA 3Q5DA 5FY0A 1MNDA 1D1AA 2NOXA 2MTQA 3KINB 3I9YA 4YHJA 5HEUA 1D1BA 2LEHA 3PJAA 3RKGA 2CEAA 4YHHT 1N34T 2CLYC 4IDOA 2HHHT 3ZMUB 4P0AA 2HH7A 4BJNA 2XJ7A 2XAHB 3ETUA 2DCFA 1H7CA 4OHFA 2CE7A 2YN6A 2QRXA 4H9RC 4KHZF 5HCJA 3J9X1 4YXDA 5IYZE 5C2TA 2N9DA 4DV0T 1IBKT 4I55E 3Q2MA 4O4IE 2H7VC 4PK4A 3EAMA 4DR2T 2K9AA 2LKGA 2N1GA 3C98B 3ZMSB 1AJ3A 4IGUA 5FVKA 5CGMA 2W67A 4UEMA 2WB5A 2C5IT 3DJBA 3S4UA 4KBMB 3Q9DA 4TNVA 2UU9T 4X1IE 3WAKA 4DR4T 2K24A 3R6NA 2J1DG 4TX5A 2ZM8A 4CN4A 2X9XA 4UVCB 2VWAA 3PUWF 3SWHA 4C90A 1US7B 3ZJ2A 3H3AA 3RIUC 2JIWA 3I0OA 4G2AA 2IC9A 3GA8A 3CX6B 2Y6XA 3LK3B 3UQ4A 4DNDA 2JJ9A 2CRBA 4F8HA 4U7IA 1UGOA 2FUPA 3O1HA 1FMVA 2ODUA 4MLKA 5FY1A 3RQWA 4JI5T 4TWFA 3NZPA 3OYXA 4QX8B 4UR9A 2HPLA 3NZQA 1HTJF 3JC6D 5LBQB 2LM9A 4ANJA 2LKHA 2WAUA 5AQVB 4GKKT 2LHRA 3AAIA 3IF8B 3PU3A 2WU2A 3AE4A 4O4LE 3JCFA 4A97A 5LGNB 1QUUA 3AXJB 4IE0A 5DQWA 3P50A 2XQ8A 1J5WA 2XQAA 1HNWT 1FMWA 3OTOT 2UUAT 4HWHA 2XAJB 5DABA 2H89A 2X67A 4P1NA 4AQFA 2X9HA 3AB3B 2MBGA 4U7YA 4JBWF 4TV8E 4HFHA 2V7JA 3CMLA 4TWHA 1J1JA 3ZLIA 1U4QA 1SHZC 2W62A 1N32T 4AKGA 1UURA 4AISA 1FIOA 3N9NA 4JV5T 4IL9A 1YW0A 2XAGB 3AEAA 3KBUA 1YD8G 3HKEE 2LRLA 5HXRA 4EEBA 1HX1B 2C5KT 2KXPB 3T1YT 3RHWA 1T72A 1OWAA 5IHYA 3RYCE 1KNRA 4UF0A 4WBNE 3OKQA 1U5PA 4QHOA 3KVBA 4Z91A 2V1DB 2DL1A 4TWDA 4EGWA 2FJEA 5HEJA 4TN7B 2IW5B 4DIDB 2VB6A 3MKDA 3ZN0B 4YTNA 2V7IA 2E5LT 2PTFA 5AQLB 2ZM6T 1QLBA 3HKCE 1IZNB 4GK0E 5HAXA 3UULA 3ZMZB 5KX5E 2AXDS 2MOZA 3BK9A 4UELA 4H9SE 2I6HA 2W00A 4FI5A 2QA7A 5EK3A 2DHRA 4YJ2E 2LT3A 4AIUA 5LGTB 3CWZB 4K0KT 3FXDB 1R8IA 1XZYA 2Q9QA 4QWNB 1VOMA 1UX4A 1VRBA 3MJXA 4EEDA 1YKEB 3N9QA 4DV1T 2VL0A 5AFUL 3FHNA 3AEGA 4CXWA 2PJQA 3QUJA 4J2CA 4LMKA 4U33A 4TUYE 3CX8B 4X20E 5ABGA 2H88A 5FL0A 2JMHA 2Y8DA 3I1AA 3JC6C 5JDFA 3ONXA 1QSDA 4LF6T 4B3RT 2IC6A 3CKDA 5CB4E 2YKSA 5JTGA 3RKOA 4GKJT 2CLYB 3N9OA 1V9DA 4EIWA 2VKDA 2V6YB 1ZOYA 1NWMX 2XSBA 4I0UA 5BMVE 2BKNA 3AECA 2E2AA 1XMOT 2R6GF 2NTXA 2JRKA 2WZIA 5J1GA 1B7TA 4H9PC 3TLWA 3KDSE 3PTRB 4H9NC 2V7KA 4JI7T 3ZMTB 5J2UE 2AE9A 2P9BA 2WY2A 4P09A 4UF0B 2UUCT 5CJ5A 2XQ7A 1JNZA 3PUQA 5LP6E 2X68A 3RLFF 2UXBT 2BKOA 5AQJB 2E9XA 3H3MA 2V6XA 1EZ3A 2XTLA 4HWDA 3N2KE 4Z90A 1KF6A 3UQ7A 4DR6T 4LMLA 4IE4A 4EAHA 5IWAT 3EDUA 4HWIB 2DNXA 4UVBB 3ZMVB 4YT0A 2ES0A 5JDHA 5JREA 4DR7T 1MMDA 4AXPA 3KV5A 3UUNA 2I0MA 4HWFA 1YQ3A 1OXZA 2BS3A 2A2FX 2NWBA 3FZHB 1M7KA 3LG7A 3PUXF 4YSZA 2BKPA 3PURA 4PNIA 1LVFA 1NAFA 3B5MA 1O3XA 3I9WA 5L3EB 2D0UA 2W2UA 3C4WA 3ZC1A 2SPCA 4ZZBA 4QXBB 3LK2B 3RIAA 4HFVA 1IBMT 3ETVA 4EYUA 2GK9A 3AEBA 2VQFT 4CZZB 4CN6A 1Y64B 2V8SV 1CHUA 5AQTB 3CPZA 2KLQA 4HKAA 3EVYA 4HFCA 4X64T 4AKIA 2CBJA 4K0UA 3RF1A 4C91A 1T8BA 4PAGA 4I50E 2D9DA 2IHR1 3NVOA 3UFGA 1W0BA 2V6YA 5LCYA 2BS4A 3VR8A 4JI6T 2ZM0A 3AE8A 4HE8A 2Y48B 2IUBA 2VKJA 1HG5A 2NTYA 4DO0A 5KXJA 5L47A 1WFDA 2BVMA 2CM0A 4H63V 4U72A 3L39A 3K8PC 3WI3A 4CN1A 4LFCT 4DV6T 1J5ET 3EUHA 2LHNA 1HFAA
chains in the Genus database with same CATH topology
4GKKT 1N33T 4B3ST 4JI2T 5LMNT 1IBLT 1HNWT 3OTOT 2UUAT 4LF7T 4JI4T 1N32T 4NXMT 2VQET 4LF4T 1XMQT 5LMUT 4JV5T 1HR0T 4X66T 4X62T 3T1YT 2UXCT 4AQYT 4JI8T 4LFAT 2UUBT 4DUZT 2E5LT 2ZM6T 4DUYT 3T1HT 4YY3T 4DR1T 4JI0T 4DV4T 4NXNT 4DR3T 4K0KT 4KHPT 5IWAT 1I94T 1N36T 4DV1T 4OX9T 4LF6T 4DR5T 1HNXT 2F4VT 4B3RT 4GKJT 1XMOT 4B3TT 4LFBT 4DV7T 4JI7T 1XNQT 2UXDT 1FJGT 2UUCT 2UXBT 4JYAT 4X65T 4LF9T 1HNZT 4DR6T 4B3MT 5BR8T 4DV3T 4DR7T 4YHHT 1N34T 2HHHT 4DV5T 4DV0T 1IBKT 4DR2T 4DV2T 1IBMT 4JI1T 4LF8T 2VQFT 1XNRT 2UU9T 4DR4T 4X64T 4JI6T 4LF5T 4LFCT 4DV6T 1J5ET 4JI5T 4JI3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK T;  1N33 T;  4B3S T;  4JI2 T;  5LMN T;  1IBL T;  1HNW T;  3OTO T;  2UUA T;  4LF7 T;  4JI4 T;  1N32 T;  4NXM T;  2VQE T;  4LF4 T;  1XMQ T;  5LMU T;  4JV5 T;  1HR0 T;  4X66 T;  4X62 T;  3T1Y T;  2UXC T;  4AQY T;  4JI8 T;  4LFA T;  2UUB T;  4DUZ T;  2E5L T;  2ZM6 T;  4DUY T;  3T1H T;  4YY3 T;  4DR1 T;  4JI0 T;  4DV4 T;  4NXN T;  4DR3 T;  4K0K T;  4KHP T;  5IWA T;  1I94 T;  1N36 T;  4DV1 T;  4OX9 T;  4LF6 T;  4DR5 T;  1HNX T;  2F4V T;  4B3R T;  4GKJ T;  1XMO T;  4B3T T;  4LFB T;  4DV7 T;  4JI7 T;  1XNQ T;  2UXD T;  1FJG T;  2UUC T;  2UXB T;  4JYA T;  4X65 T;  4LF9 T;  1HNZ T;  4DR6 T;  4B3M T;  5BR8 T;  4DV3 T;  4DR7 T;  4YHH T;  1N34 T;  2HHH T;  4DV5 T;  4DV0 T;  1IBK T;  4DR2 T;  4DV2 T;  1IBM T;  4JI1 T;  4LF8 T;  2VQF T;  1XNR T;  2UU9 T;  4DR4 T;  4X64 T;  4JI6 T;  4LF5 T;  4LFC T;  4DV6 T;  1J5E T;  4JI5 T;  4JI3 T; 
#chains in the Genus database with same CATH topology
 2DI4 A;  3E22 E;  1D0Z A;  2WQY A;  4JI2 T;  4MFR A;  4BA9 A;  3FZM B;  3KBT A;  3N9M A;  1WRD A;  4XZC A;  3A8Y C;  3N9L A;  4E7S A;  2B76 A;  4CI3 B;  3PDY A;  5L2L A;  2W0G A;  3MA9 A;  4O8S A;  1IBL T;  4HTE A;  2KIN B;  5LG3 A;  1HF8 A;  1W0A A;  2XUE A;  5AQP B;  3ABV A;  4EB6 E;  2M67 A;  4CXY A;  2WZH A;  4NXM T;  2VQE T;  4NUU A;  5JH7 E;  4WW0 A;  5LMU T;  2X0Y A;  3MXZ A;  3QB5 A;  1HR0 T;  2UXC T;  2BDE A;  5AQO B;  3E08 A;  3RC3 A;  1S94 A;  2KT9 A;  4ZS2 A;  3ZT5 A;  4HN9 A;  3LK4 2;  4ZZC A;  2HN2 A;  2YDR A;  5H6R B;  1FEW A;  1ZKE A;  1WLX A;  2A72 A;  5CA0 E;  1IAP A;  2UXX B;  3M65 A;  4YSY A;  2UUB T;  4NUV A;  4DMV A;  3K3O A;  4DUZ T;  4LMJ A;  3ZN1 B;  4DUY T;  2JQH A;  2RA1 A;  5LYJ E;  3T1H T;  2PBI A;  3F57 A;  2VL8 A;  4XAX B;  4WYV A;  4YY3 T;  2Z6E A;  3UU5 A;  4V1A v;  3ANW B;  3QC9 A;  1LKX A;  2OV9 A;  2B1E A;  3BQK A;  2KZ7 B;  2ZM2 A;  3BQL A;  3QOF A;  4TV9 E;  2L3L A;  3HR0 A;  1OED C;  3PUG A;  3RI5 A;  3RRC A;  3AAE B;  4A98 A;  4DVD A;  3O1J A;  3UUX B;  2BBH A;  5J2T E;  3A7M A;  1BR4 A;  3PUV F;  4JEH B;  1N36 T;  1I94 T;  1G8X A;  3LBX A;  4OK0 A;  4CXX A;  2YIN A;  1D1C A;  2KSR A;  3CX7 B;  4X1Y E;  2M6B A;  3GN5 A;  5DJQ C;  3SFD A;  5EK4 A;  1MIV A;  3ZEF B;  2WWV A;  3PUS A;  4GK5 E;  3HKD E;  3G06 A;  3JAD A;  2LRK A;  4ILA A;  3T8O A;  4ZI3 D;  3C4X A;  4ZS3 A;  3PUA A;  5FL1 A;  5JQG E;  3GN5 B;  3OJA A;  3NBX X;  3P8C D;  1X79 A;  2JMK A;  4JUY A;  1BR0 A;  2XQ9 A;  3J7Y q;  5L4H A;  4DR1 T;  2LSK A;  3AA7 B;  3C50 A;  4CI2 B;  2WDQ A;  3ZJ1 A;  4JLE A;  4B3T T;  2XQ4 A;  4DV7 T;  3KV9 A;  2QVA A;  3AE9 A;  3I0Q A;  4AKR B;  2A3D A;  3PUY F;  1XNQ T;  3CIR A;  4PK5 A;  4H63 H;  4ZI2 C;  1BR2 A;  2OA5 A;  5LNK A;  3FZL B;  4PFO A;  5JVD E;  2NW7 A;  2YU2 A;  2N2N A;  2W4X A;  5JR9 C;  1WYB A;  2VK9 A;  3IEE A;  4UV8 B;  4U74 A;  3AXJ A;  3K3N A;  4UXN B;  5F8P A;  2E9X D;  2VVN A;  2RPA A;  4OYJ A;  4O4H E;  2X51 A;  3RYF E;  1VCT A;  3ZT6 A;  3UU6 A;  4X65 T;  1D0X A;  1X9B A;  3AEF A;  2LSG A;  2Q9Q B;  4DV3 T;  3FZF B;  4AQF C;  3RRW A;  2WM9 A;  4EYY R;  3OPC A;  3HL6 A;  4IDP A;  4DV5 T;  4I4T E;  1BR1 A;  2X0H A;  2MPK A;  3N5L A;  4YLH A;  2ACZ A;  2KWH A;  3D0T A;  5KDM C;  2LE8 A;  1XDO A;  2V5D A;  3CQG B;  4Z8X A;  3X1D A;  1VCS A;  2UXN B;  1HCI A;  2EHO C;  2X9W A;  1W9R A;  4YTP A;  4ZHQ E;  2IAK A;  2PFV A;  2RP4 A;  3DTO A;  3KV4 A;  4KI0 F;  4LF8 T;  3TLS A;  2XQ5 A;  2LOS A;  3CQX C;  3OVU A;  4O2B E;  1UX5 A;  4O2A E;  4OYK A;  5AQU B;  5FVL A;  4QXH B;  3VU7 H;  4NIQ A;  1XNR T;  2EHO D;  2NP9 A;  4KMC A;  3AE1 A;  3LSV A;  3UU3 A;  2JQK A;  5ABE A;  2PG8 A;  5AQH B;  4AI6 A;  2XHE B;  3ZPO A;  3ESL A;  3ZYL A;  4HEA A;  1E1H B;  3RPU A;  4COF A;  3VR9 A;  4MAL A;  4TNW A;  3F31 A;  3ONL C;  1UUS A;  4ASK A;  4GOU A;  2ACX A;  4ZXL A;  2Q9Q D;  2CHN A;  2WCA A;  4H9O C;  5EZY E;  3N2G E;  4TZ4 C;  5FXV A;  3CQC B;  2LOP A;  5AQI B;  5HXS A;  4JI3 T;  1G73 A;  3AED A;  2X9Y A;  3C64 A;  4B6X A;  5M4Y A;  4U2Y A;  2BG9 A;  1KK7 A;  4PW8 A;  1N33 T;  2F4V T;  2WSS V;  3QB5 K;  4L9I A;  3O9X A;  2CXL A;  1MMA A;  3AVS A;  4PJJ A;  3RYH E;  2V7M A;  1HG2 A;  2DWG A;  2IDO B;  3MAC A;  3PU8 A;  4WBO A;  2BZB A;  3DP7 A;  5LHI B;  5LMN T;  4LF5 T;  1WCR A;  3LFM A;  3RYI E;  4N78 D;  3SS1 A;  5E0O A;  5JR9 B;  1WR0 A;  4LF7 T;  2LSI A;  2W66 A;  4IT4 A;  4JI4 T;  3ZYM A;  2V26 A;  5F5W A;  5FNV E;  2WDV A;  5ABF B;  2BVL A;  2L8K A;  3RIF A;  4AKH A;  5LG4 A;  2YDQ A;  2VAS A;  3UTK A;  4LF4 T;  5ETW A;  1XMQ T;  3RC8 A;  2EHO A;  5LGU B;  2YOE A;  3P4W A;  3AVR A;  4IE6 A;  5HWX A;  2CWO A;  3SRZ A;  4X66 T;  4U2Z A;  4NPP A;  3NRY A;  1MIY A;  1OED A;  2X0L B;  5AQK B;  3CK6 A;  5CFB A;  4AQY T;  2XQ3 A;  3K1S A;  5AQN B;  3VHL A;  3RH3 A;  3A5X A;  3N9P A;  3ZKR A;  3PE0 A;  4U31 A;  1GQE A;  4X5T A;  3BQI A;  2M6I A;  5FKY A;  4OFZ A;  3VRB A;  3FB2 A;  1XWM A;  5ABF A;  2WU5 A;  3UUB A;  2HPJ A;  2J4G A;  1OED E;  2XQ6 A;  2VVS A;  4IE7 A;  4ILB A;  3ZSS A;  1ZV4 X;  5A1L A;  5CA1 E;  4CI1 B;  4XBF B;  4DV4 T;  4NXN T;  2WWU A;  3AE3 A;  2BG9 C;  5L4E A;  1NEN A;  2VKH A;  2BBJ A;  2WMN A;  3Q5W A;  4IDQ A;  3AE5 A;  3FZK B;  5HEG A;  3ZCJ A;  5IUX A;  2CBI A;  1CUN A;  3E0Z A;  1WR6 A;  4HWC A;  4JI1 T;  3WAJ A;  4JEU B;  4OX9 T;  3AE6 A;  1SUM B;  4H9Q C;  4DR5 T;  2JQ9 A;  3HKB E;  4KP3 C;  3RGL A;  2NR4 A;  1Y01 A;  3OBV E;  3UUM A;  4ILU A;  2D0T A;  2H7O A;  4WNK A;  2XAQ B;  1Z8U A;  4QH1 A;  3UU8 A;  3LBX B;  5L3G B;  2BG9 E;  2YDS A;  4ADZ A;  1KEY A;  4LFB T;  4PK6 A;  2KWI B;  3JAE A;  3TLT A;  1IJ6 A;  1OED B;  5AQR B;  4MBQ A;  5LXT E;  1MNE A;  3VKH A;  2E8I A;  2JQQ A;  2X66 A;  3JAF A;  5LBM A;  5EK2 A;  5LHG B;  2K48 A;  5DQV A;  5AQF B;  1MMN A;  5AQQ B;  1D0Y A;  1E7P A;  2LSY A;  2WMO A;  4X1K E;  3SFE A;  5LB7 B;  4LF9 T;  4HFI A;  1UCU A;  5AQM B;  4IRE A;  4YJ3 E;  2XM2 A;  5JR9 A;  3KFW X;  2J62 A;  2E5V A;  1E2A A;  4YTM A;  2K5B B;  3L8R A;  5JRC B;  2LSJ A;  3EI0 A;  2H3R A;  3GMI A;  3L09 A;  2J47 A;  3MK7 C;  4EV6 A;  3M3Z B;  5FY7 A;  2VKO A;  3SOL A;  3U78 A;  5HCM A;  5L3C B;  4YSX A;  1M62 A;  5F3J A;  2ZLY A;  4ZI3 C;  3IA3 A;  5L3F B;  3IHR A;  4IIJ E;  4DV2 T;  1LRZ A;  3ZC0 A;  5FXW A;  3C51 A;  5GON E;  4ZOL E;  2E9X B;  2WDR A;  4L5G A;  3TLV A;  3N2O A;  2E9X C;  3EAB A;  2CA5 A;  3P4S A;  3ZT7 A;  5FYM A;  1ZP0 A;  3ONJ A;  3NKZ A;  4HFB A;  3LJC A;  3B13 A;  4HGA A;  4UIG A;  1YKH B;  5HEH A;  1ZHC A;  2CHO A;  4ERR A;  4GIW A;  4AKL A;  2JPF A;  4DBQ A;  1W09 A;  5JDM A;  2Q9Q C;  2YEV C;  4UVA B;  4MHC A;  1MIW A;  2MAW A;  3H37 A;  4AQG A;  2C5J A;  2XAF B;  2L9Q A;  4BJM A;  4GYR A;  4EZH A;  3FXE B;  1L0V A;  2LLY A;  3P4Q A;  5KMG P;  4F6R C;  2QGS A;  3O1I A;  3ZCI A;  5ADX L;  1YQ4 A;  3FBZ A;  3P4P A;  4GYS A;  4IST A;  1KNP A;  3ZYK A;  2A9U A;  5J0Z A;  5HYA A;  2KMF A;  2FBW A;  2XSA A;  4IL4 A;  4B3S T;  4FJO A;  2EHO B;  3QNU A;  1T7S A;  1UK5 A;  2IML A;  2V7L A;  2KND A;  2D2S A;  5FMN A;  3L3P A;  3PV0 F;  3K3Q C;  4UV9 B;  2IIU A;  3AE7 A;  5L3B B;  5JDQ A;  3P4R A;  3AA6 B;  3F2E A;  4QH5 A;  5AQG B;  2QYW A;  5H6Q B;  2DWK A;  5JRC A;  4O4J E;  5LHH B;  2ZMA A;  4ZEY A;  5C8Y E;  2VUR A;  2BG9 B;  3EHZ A;  2XQY A;  3KVA A;  3NWI A;  5FXZ A;  4KUM B;  4QXC B;  3U3I A;  2D5U A;  4PJM A;  1XDP A;  3PJA J;  1S35 A;  3Q5X A;  4CQI A;  2LJL A;  2YU1 A;  4X62 T;  1DU2 A;  4JI8 T;  2CMR A;  1HS7 A;  2NW8 A;  2DLR A;  3FBL A;  2XY8 B;  4G63 A;  3LDQ B;  1T98 A;  1Z0P A;  2BS2 A;  3V5S A;  3AEE A;  4I43 B;  5LOV E;  4LFA T;  4EOZ B;  3ANW A;  2OLT A;  1YXR A;  2V5C A;  3KV6 A;  3B57 A;  4ISS A;  4QX7 B;  5L3D B;  5TAO A;  2XAS B;  4KX6 A;  5LJM A;  1ZEE A;  4PJN A;  2XZE A;  3Q5E A;  1HX8 A;  3NRX A;  1JNR A;  4L0R A;  4PFP A;  4ZI2 D;  5C3J A;  3EDV A;  4IE5 A;  5LA6 E;  3UFE A;  3AAA B;  4JI0 T;  2W61 A;  4IDN A;  3AE2 A;  5HXC A;  3VRA A;  4EZ4 A;  3QK6 A;  4E7Z A;  3TLU A;  5JDG A;  4DR3 T;  4KHP T;  4Q25 A;  5HXH A;  2I59 A;  2FJD A;  1LVK A;  2FJB A;  4IHJ E;  2CWY A;  4ILC A;  3V5U A;  1KNZ A;  4U3C A;  4BAY B;  4EXT A;  5HWY A;  4YFS A;  5FP3 A;  1WYC A;  3RQU A;  5FXX A;  3AA0 B;  4WZX A;  4PJL A;  3C4Z A;  1HNX T;  1IJ5 A;  2YK0 A;  4A5X A;  2FJA A;  4M1P A;  4DMW A;  4HFD A;  3RX6 A;  2C0S A;  5HEO A;  2NW9 A;  3TKL B;  4A56 A;  3R84 B;  1SA0 E;  2CPT A;  2W63 A;  1KFY A;  2CXD A;  1NEK A;  2LM2 A;  2XPK A;  3CVR A;  3HA4 A;  3HI2 A;  4DBR A;  3P7I A;  5LJN A;  3AA1 B;  2K3W A;  2HN1 A;  2WP9 A;  5JDL A;  3RIU A;  3UU4 A;  3UT5 E;  1SE7 A;  3O4X E;  2WBL A;  2CCQ A;  2CXF A;  1I6Z A;  2G0U A;  2MYS A;  5JDN A;  1FJG T;  3MZK B;  2UXD T;  3OYZ A;  4IDZ A;  3GWH A;  4QKN A;  3W15 B;  5HXE A;  4JYA T;  3IBP A;  4HFE A;  4P0B A;  2XM1 A;  3ZST A;  5ABH A;  2WS3 A;  5AQS B;  3VKG A;  4ZI7 E;  1HNZ T;  2ODV A;  4B3M T;  3PUZ F;  5BR8 T;  4QH4 A;  1MMG A;  3Q5D A;  5FY0 A;  1MND A;  1D1A A;  2NOX A;  2MTQ A;  3KIN B;  3I9Y A;  4YHJ A;  5HEU A;  1D1B A;  2LEH A;  3PJA A;  3RKG A;  2CEA A;  4YHH T;  1N34 T;  2CLY C;  4IDO A;  2HHH T;  3ZMU B;  4P0A A;  2HH7 A;  4BJN A;  2XJ7 A;  2XAH B;  3ETU A;  2DCF A;  1H7C A;  4OHF A;  2CE7 A;  2YN6 A;  2QRX A;  4H9R C;  4KHZ F;  5HCJ A;  3J9X 1;  4YXD A;  5IYZ E;  5C2T A;  2N9D A;  4DV0 T;  1IBK T;  4I55 E;  3Q2M A;  4O4I E;  2H7V C;  4PK4 A;  3EAM A;  4DR2 T;  2K9A A;  2LKG A;  2N1G A;  3C98 B;  3ZMS B;  1AJ3 A;  4IGU A;  5FVK A;  5CGM A;  2W67 A;  4UEM A;  2WB5 A;  2C5I T;  3DJB A;  3S4U A;  4KBM B;  3Q9D A;  4TNV A;  2UU9 T;  4X1I E;  3WAK A;  4DR4 T;  2K24 A;  3R6N A;  2J1D G;  4TX5 A;  2ZM8 A;  4CN4 A;  2X9X A;  4UVC B;  2VWA A;  3PUW F;  3SWH A;  4C90 A;  1US7 B;  3ZJ2 A;  3H3A A;  3RIU C;  2JIW A;  3I0O A;  4G2A A;  2IC9 A;  3GA8 A;  3CX6 B;  2Y6X A;  3LK3 B;  3UQ4 A;  4DND A;  2JJ9 A;  2CRB A;  4F8H A;  4U7I A;  1UGO A;  2FUP A;  3O1H A;  1FMV A;  2ODU A;  4MLK A;  5FY1 A;  3RQW A;  4JI5 T;  4TWF A;  3NZP A;  3OYX A;  4QX8 B;  4UR9 A;  2HPL A;  3NZQ A;  1HTJ F;  3JC6 D;  5LBQ B;  2LM9 A;  4ANJ A;  2LKH A;  2WAU A;  5AQV B;  4GKK T;  2LHR A;  3AAI A;  3IF8 B;  3PU3 A;  2WU2 A;  3AE4 A;  4O4L E;  3JCF A;  4A97 A;  5LGN B;  1QUU A;  3AXJ B;  4IE0 A;  5DQW A;  3P50 A;  2XQ8 A;  1J5W A;  2XQA A;  1HNW T;  1FMW A;  3OTO T;  2UUA T;  4HWH A;  2XAJ B;  5DAB A;  2H89 A;  2X67 A;  4P1N A;  4AQF A;  2X9H A;  3AB3 B;  2MBG A;  4U7Y A;  4JBW F;  4TV8 E;  4HFH A;  2V7J A;  3CML A;  4TWH A;  1J1J A;  3ZLI A;  1U4Q A;  1SHZ C;  2W62 A;  1N32 T;  4AKG A;  1UUR A;  4AIS A;  1FIO A;  3N9N A;  4JV5 T;  4IL9 A;  1YW0 A;  2XAG B;  3AEA A;  3KBU A;  1YD8 G;  3HKE E;  2LRL A;  5HXR A;  4EEB A;  1HX1 B;  2C5K T;  2KXP B;  3T1Y T;  3RHW A;  1T72 A;  1OWA A;  5IHY A;  3RYC E;  1KNR A;  4UF0 A;  4WBN E;  3OKQ A;  1U5P A;  4QHO A;  3KVB A;  4Z91 A;  2V1D B;  2DL1 A;  4TWD A;  4EGW A;  2FJE A;  5HEJ A;  4TN7 B;  2IW5 B;  4DID B;  2VB6 A;  3MKD A;  3ZN0 B;  4YTN A;  2V7I A;  2E5L T;  2PTF A;  5AQL B;  2ZM6 T;  1QLB A;  3HKC E;  1IZN B;  4GK0 E;  5HAX A;  3UUL A;  3ZMZ B;  5KX5 E;  2AXD S;  2MOZ A;  3BK9 A;  4UEL A;  4H9S E;  2I6H A;  2W00 A;  4FI5 A;  2QA7 A;  5EK3 A;  2DHR A;  4YJ2 E;  2LT3 A;  4AIU A;  5LGT B;  3CWZ B;  4K0K T;  3FXD B;  1R8I A;  1XZY A;  2Q9Q A;  4QWN B;  1VOM A;  1UX4 A;  1VRB A;  3MJX A;  4EED A;  1YKE B;  3N9Q A;  4DV1 T;  2VL0 A;  5AFU L;  3FHN A;  3AEG A;  4CXW A;  2PJQ A;  3QUJ A;  4J2C A;  4LMK A;  4U33 A;  4TUY E;  3CX8 B;  4X20 E;  5ABG A;  2H88 A;  5FL0 A;  2JMH A;  2Y8D A;  3I1A A;  3JC6 C;  5JDF A;  3ONX A;  1QSD A;  4LF6 T;  4B3R T;  2IC6 A;  3CKD A;  5CB4 E;  2YKS A;  5JTG A;  3RKO A;  4GKJ T;  2CLY B;  3N9O A;  1V9D A;  4EIW A;  2VKD A;  2V6Y B;  1ZOY A;  1NWM X;  2XSB A;  4I0U A;  5BMV E;  2BKN A;  3AEC A;  2E2A A;  1XMO T;  2R6G F;  2NTX A;  2JRK A;  2WZI A;  5J1G A;  1B7T A;  4H9P C;  3TLW A;  3KDS E;  3PTR B;  4H9N C;  2V7K A;  4JI7 T;  3ZMT B;  5J2U E;  2AE9 A;  2P9B A;  2WY2 A;  4P09 A;  4UF0 B;  2UUC T;  5CJ5 A;  2XQ7 A;  1JNZ A;  3PUQ A;  5LP6 E;  2X68 A;  3RLF F;  2UXB T;  2BKO A;  5AQJ B;  2E9X A;  3H3M A;  2V6X A;  1EZ3 A;  2XTL A;  4HWD A;  3N2K E;  4Z90 A;  1KF6 A;  3UQ7 A;  4DR6 T;  4LML A;  4IE4 A;  4EAH A;  5IWA T;  3EDU A;  4HWI B;  2DNX A;  4UVB B;  3ZMV B;  4YT0 A;  2ES0 A;  5JDH A;  5JRE A;  4DR7 T;  1MMD A;  4AXP A;  3KV5 A;  3UUN A;  2I0M A;  4HWF A;  1YQ3 A;  1OXZ A;  2BS3 A;  2A2F X;  2NWB A;  3FZH B;  1M7K A;  3LG7 A;  3PUX F;  4YSZ A;  2BKP A;  3PUR A;  4PNI A;  1LVF A;  1NAF A;  3B5M A;  1O3X A;  3I9W A;  5L3E B;  2D0U A;  2W2U A;  3C4W A;  3ZC1 A;  2SPC A;  4ZZB A;  4QXB B;  3LK2 B;  3RIA A;  4HFV A;  1IBM T;  3ETV A;  4EYU A;  2GK9 A;  3AEB A;  2VQF T;  4CZZ B;  4CN6 A;  1Y64 B;  2V8S V;  1CHU A;  5AQT B;  3CPZ A;  2KLQ A;  4HKA A;  3EVY A;  4HFC A;  4X64 T;  4AKI A;  2CBJ A;  4K0U A;  3RF1 A;  4C91 A;  1T8B A;  4PAG A;  4I50 E;  2D9D A;  2IHR 1;  3NVO A;  3UFG A;  1W0B A;  2V6Y A;  5LCY A;  2BS4 A;  3VR8 A;  4JI6 T;  2ZM0 A;  3AE8 A;  4HE8 A;  2Y48 B;  2IUB A;  2VKJ A;  1HG5 A;  2NTY A;  4DO0 A;  5KXJ A;  5L47 A;  1WFD A;  2BVM A;  2CM0 A;  4H63 V;  4U72 A;  3L39 A;  3K8P C;  3WI3 A;  4CN1 A;  4LFC T;  4DV6 T;  1J5E T;  3EUH A;  2LHN A;  1HFA A; 
#chains in the Genus database with same CATH homology
 4GKK T;  1N33 T;  4B3S T;  4JI2 T;  5LMN T;  1IBL T;  1HNW T;  3OTO T;  2UUA T;  4LF7 T;  4JI4 T;  1N32 T;  4NXM T;  2VQE T;  4LF4 T;  1XMQ T;  5LMU T;  4JV5 T;  1HR0 T;  4X66 T;  4X62 T;  3T1Y T;  2UXC T;  4AQY T;  4JI8 T;  4LFA T;  2UUB T;  4DUZ T;  2E5L T;  2ZM6 T;  4DUY T;  3T1H T;  4YY3 T;  4DR1 T;  4JI0 T;  4DV4 T;  4NXN T;  4DR3 T;  4K0K T;  4KHP T;  5IWA T;  1I94 T;  1N36 T;  4DV1 T;  4OX9 T;  4LF6 T;  4DR5 T;  1HNX T;  2F4V T;  4B3R T;  4GKJ T;  1XMO T;  4B3T T;  4LFB T;  4DV7 T;  4JI7 T;  1XNQ T;  2UXD T;  1FJG T;  2UUC T;  2UXB T;  4JYA T;  4X65 T;  4LF9 T;  1HNZ T;  4DR6 T;  4B3M T;  5BR8 T;  4DV3 T;  4DR7 T;  4YHH T;  1N34 T;  2HHH T;  4DV5 T;  4DV0 T;  1IBK T;  4DR2 T;  4DV2 T;  1IBM T;  4JI1 T;  4LF8 T;  2VQF T;  1XNR T;  2UU9 T;  4DR4 T;  4X64 T;  4JI6 T;  4LF5 T;  4LFC T;  4DV6 T;  1J5E T;  4JI5 T;  4JI3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...