1Z8UA

Crystal structure of oxidized alpha hemoglobin bound to ahsp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
ALLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Structure of oxidized alpha-haemoglobin bound to AHSP reveals a protective mechanism for haem.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 33
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1z8uA00
4IDNA 3Q5DA 4IDQA 3X1DA 4IDOA 4IDPA 3QNUA 1XZYA 1Z8UA 3OVUA 1W0AA 1W09A 3IA3A 3Q5EA 3QOFA 1Y01A 1W0BA
chains in the Genus database with same CATH superfamily
2LJLA 3AVSA 4LFBT 2XAQB 1FMVA 4AQGA 3ZCJA 3O4XE 5FXVA 1OWAA 3BQKA 2A72A 3ZKRA 4TZ4C 1KF6A 4LFCT 4X66T 1JNZA 2X9HA 4WNKA 4X62T 3N2OA 4IE4A 3NRYA 2H7OA 5LGTB 4NXNT 4XZCA 4JYAT 4IREA 2OLTA 4AKGA 4TWHA 5DQWA 1WLXA 5LHHB 4PK6A 4JI3T 1BR0A 4QH4A 2K48A 4L5GA 3UULA 2LT3A 4DR2T 5BMVE 3PUYF 3TLTA 3NZPA 1KNPA 4QX7B 5HXRA 2X0HA 4JI5T 4YXDA 3PU3A 4PFPA 4DV4T 4E7SA 4O4HE 2NTXA 1IJ6A 3RX6A 2CXFA 3O1JA 5JDMA 2ODVA 2XAGB 2XAFB 2YU1A 5HEUA 2ZM6T 3CX8B 5LA6E 5HYAA 2EHOD 2ZM2A 5AQKB 3AAEB 5EK3A 4DV6T 4WBNE 5L3BB 3OPCA 4PAGA 4DV3T 2IC6A 4TUYE 3VR9A 2OV9A 4LMKA 2BG9B 5AQQB 5HEOA 3KVAA 2J62A 5JVDE 2E9XB 3V5SA 4AQYT 2IIUA 1X9BA 4QH5A 2H3RA 5AQGB 2CEAA 1XDPA 3P4SA 1CUNA 2J47A 2VVSA 4GKKT 4EGWA 2L3LA 5L4HA 3OJAA 5BR8T 3IEEA 3DJBA 3N9QA 5IHYA 1N36T 3TLWA 3EDVA 2WU2A 3E22E 3LDQB 3ZYKA 2UXCT 4YSXA 2UUBT 2WS3A 3N2KE 3AE4A 5JDLA 4PK4A 2UXNB 4ISTA 3K1SA 1GQEA 4GKJT 4TNWA 3AAAB 2VKOA 4OFZA 2X9XA 2V6XA 3AE6A 2BDEA 2CA5A 4JV5T 3ZN1B 5LBMA 5JREA 4PFOA 4LMJA 5L2LA 1OEDC 2V6YB 3C50A 2BS3A 3AE3A 1WYBA 5FKYA 4UV9B 4QXHB 3EI0A 4H9RC 4CXYA 1KNZA 3C64A 3GN5A 1NAFA 4EAHA 5F3JA 4HEAA 3ZJ1A 5KDMC 4ANJA 2A2FX 4U7YA 2LSIA 3A5XA 3HKDE 3L39A 3EAMA 3ABVA 1T72A 2LOPA 2XQ4A 2RPAA 5H6RB 1D1BA 5LHGB 3ZC1A 2QYWA 1YW0A 4YTMA 3RI5A 4UVCB 3C4ZA 3AEDA 4PJMA 2A3DA 4YLHA 2XQ9A 2QVAA 4O2BE 4G63A 1OEDA 5CFBA 4O8SA 2XHEB 2X67A 4L9IA 2XQAA 2HPLA 2VL8A 3LBXA 3RYHE 4YHHT 3N9LA 2Y48B 2YEVC 2L8KA 3RIAA 2BG9E 1HNXT 1ZHCA 3FZLB 4IGUA 3KINB 2KT9A 3TKLB 2WWVA 3O9XA 4I55E 3WAKA 4BJMA 3JCFA 4CXXA 2W00A 1YQ4A 4JI0T 1UK5A 5JRCA 4I43B 4YTPA 2JMHA 3HR0A 4NPPA 1S35A 4CN1A 4AKRB 4MLKA 2V7LA 2CBJA 3NRXA 2X66A 4JEHB 4GIWA 1T98A 2E2AA 2CBIA 3E0ZA 5JDFA 2MBGA 3UU8A 1QUUA 4IE0A 2PFVA 3RQWA 4ZOLE 4AI6A 5EK2A 5AQIB 3VHLA 3NVOA 4X1YE 2DCFA 5F8PA 1D0YA 4EB6E 4QXCB 2L9QA 2W66A 5FYMA 4C91A 4DV7T 4HN9A 1YQ3A 2I0MA 4DUZT 2CE7A 2WM9A 3K8PC 4XAXB 3LK42 4BJNA 4XBFB 3PUAA 2LKHA 1KEYA 2V5CA 5HXHA 2K9AA 1W9RA 3T8OA 3OTOT 2EHOC 4H9SE 3P7IA 4A98A 1ZKEA 4CZZB 2H7VC 4TX5A 2QA7A 5AQJB 2M67A 2YDQA 2M6BA 3KV6A 3M65A 1MNEA 1SUMB 3RQUA 2KLQA 3P4WA 4HKAA 1UCUA 3QNUA 3ZMUB 1Z8UA 2G0UA 1UUSA 1IBKT 2CXLA 1LKXA 4YSYA 4O4LE 1LVFA 4LF5T 1E7PA 3J9X1 1J1JA 4DIDB 1SHZC 4IE5A 2IMLA 4CQIA 3UUNA 3N5LA 4DV2T 4DV5T 1Z0PA 1R8IA 4P1NA 5C3JA 1HG2A 3I1AA 5LGNB 3ANWA 4Z8XA 5HEJA 3GN5B 3C51A 3CQGB 5JR9A 1XMOT 1CHUA 3AA7B 3KVBA 1NWMX 4UV8B 2ACXA 4H9OC 2XQ3A 1MIVA 4CXWA 3ZMSB 3AXJA 5L3GB 5LXTE 5ABFA 2CRBA 2EHOA 4JI2T 1FJGT 1T7SA 4QXBB 4DR7T 3VU7H 4HWHA 5AQLB 4F6RC 5LNKA 1M7KA 3KV5A 4WBOA 2YU2A 3SFDA 2IC9A 4DBQA 3ETUA 3OVUA 3N9PA 3U3IA 3C4WA 3L8RA 2MYSA 2ACZA 5ADXL 1KK7A 2PBIA 4B3ST 2KSRA 1BR4A 5FP3A 4TNVA 3N2GE 2WP9A 2N2NA 1OEDB 2LSJA 5KMGP 2WZHA 4YT0A 3AB3B 4ZS3A 3ZMVB 1QLBA 3LBXB 2LSGA 3FXEB 3CWZB 4EOZB 2BKPA 4JEUB 3RKOA 2XAHB 1XWMA 2XQ8A 3R6NA 5FY7A 3ZPOA 2NTYA 4DBRA 4B3TT 3PUWF 3WAJA 1YKEB 2K24A 3RYFE 2V1DB 3AE5A 2IDOB 3UUXB 2NOXA 4DR4T 5JRCB 5LG3A 2FJDA 2E5LT 4UXNB 2HN2A 3VRAA 2NWBA 3MJXA 4CN4A 3LSVA 1XNQT 4YJ2E 4QH1A 1KNRA 1XNRT 3V5UA 4ZEYA 2H88A 3X1DA 4GYSA 2NR4A 1XMQT 5GONE 2WQYA 4X64T 4ILAA 4MBQA 3FZMB 5HXCA 3CVRA 5FVKA 1VRBA 4YSZA 2VVNA 4LF7T 2V7KA 4EEBA 2VQET 1IBMT 2CCQA 5J1GA 3MXZA 2VL0A 5KXJA 4O4JE 1NENA 2BKOA 3B5MA 4JBWF 3AA0B 3RC8A 3PDYA 4AISA 4JUYA 5AQHB 3OKQA 4WZXA 4TV9E 5FXXA 3HKCE 4IDQA 5LGUB 1LRZA 4X5TA 2UXDT 3ZJ2A 5F5WA 2CM0A 5AQPB 4ILCA 3N9OA 3ZN0B 4OHFA 3EDUA 4JI6T 1EZ3A 1G73A 4O4IE 1VCSA 4A56A 4ZZCA 2KWHA 2W67A 1WCRA 4A5XA 2C0SA 3N9MA 2XJ7A 2QGSA 4EEDA 3F31A 2DHRA 3TLVA 3E08A 4DV1T 2XY8B 2FJEA 4LF6T 5IWAT 4IDOA 2C5IT 1I6ZA 2I6HA 5EZYE 3FBZA 4ZHQE 4H63H 4KP3C 1OEDE 3PUQA 1AJ3A 3W15B 2Y8DA 3KFWX 2XQ5A 5FL1A 1IZNB 2WU5A 2VKDA 3ANWB 3Q9DA 5JR9B 3B57A 5AQUB 4ZXLA 3HKBE 3PURA 5CA0E 2Y6XA 2BBHA 4JI8T 5AQFB 3ZCIA 3AXJB 2ODUA 3LK3B 5TAOA 5ABFB 1HNZT 2IAKA 4QKNA 4ZI3D 3AEBA 3IHRA 3QUJA 2EHOB 3UQ7A 4LFAT 2X0YA 4DR5T 3K3OA 4ZI7E 1HG5A 4HWCA 1U5PA 4IDNA 3Q2MA 1W0BA 2VURA 3ZT5A 2WSSV 4COFA 3VKGA 4UEMA 1BR1A 4ASKA 1ZV4X 2J4GA 2D0UA 3MKDA 3I0QA 5JTGA 1UGOA 2XZEA 1N33T 5H6QB 1W09A 1MMDA 5HXEA 5AQOB 5FNVE 4HWIB 3LK2B 4HTEA 4KBMB 3Q5XA 2MOZA 1YD8G 1US7B 3H3MA 2FJAA 2AXDS 2LHNA 2XSAA 4FJOA 1FIOA 5L3FB 3HI2A 5KX5E 4E7ZA 1T8BA 5AQNB 3ZSTA 3KV4A 2MPKA 2W4XA 3RC3A 5LOVE 3PUZF 3UT5E 2UU9T 3KDSE 2R6GF 3ZSSA 1XZYA 3RRWA 3UUBA 2IHR1 5CB4E 3RYIE 4L0RA 2OA5A 4U2YA 3KBUA 4AIUA 4ZI2D 1WR0A 4DMVA 4BAYB 1UX5A 2XPKA 2Q9QD 1YXRA 3RIUC 2FUPA 2JQKA 2WDVA 2WZIA 1B7TA 4H63V 2KZ7B 4NIQA 2C5JA 3GWHA 3Q5WA 1Y64B 2M6IA 2NW9A 2LM9A 4ERRA 1VCTA 4U72A 3UUMA 2HH7A 4OYKA 3UU3A 3ETVA 3GMIA 3C4XA 1MMGA 2LOSA 1UURA 1I94T 3EHZA 4PJNA 3UQ4A 2WMOA 3SRZA 4U3CA 1N32T 3CX7B 4HWFA 2LEHA 5CJ5A 3A8YC 4UIGA 2BVMA 1HF8A 3ZYMA 3HL6A 2A9UA 4I0UA 4MHCA 5JR9C 3AEEA 5A1LA 1KFYA 2CPTA 3CK6A 4UF0A 3BQLA 5LB7B 2KINB 4AKHA 5JQGE 3AEGA 3MA9A 2JQ9A 2ES0A 1ZOYA 3A7MA 4KI0F 2N1GA 4DMWA 4PJJA 1U4QA 2QRXA 1D0XA 3RIUA 4CI2B 4EYUA 2PJQA 2NW7A 3PUSA 2YOEA 4ILBA 3FB2A 4UR9A 2XQ7A 4IT4A 3RF1A 5L47A 4U2ZA 2B76A 3G06A 3JC6D 3TLSA 2VKHA 5AQTB 3GA8A 2X0LB 4ZZBA 2DWKA 3QB5A 4HFIA 4LF8T 2P9BA 3ZC0A 3FXDB 3AE1A 5AFUL 2W62A 2WCAA 5J2TE 3MZKB 2ZM8A 4U31A 5L3EB 3AE2A 3HA4A 3T1HT 4U7IA 2X9WA 3MK7C 3PU8A 4UVAB 2CWOA 5FXZA 3H37A 3B13A 2YN6A 4NXMT 2LLYA 3R84B 1IBLT 2C5KT 2E8IA 4AQFC 2VQFT 4HFEA 2WB5A 4P0BA 2FBWA 4UVBB 2KWIB 2UUCT 1VOMA 4ILUA 1E1HB 4ADZA 3LJCA 5IUXA 4AKIA 4YY3T 4P0AA 2KNDA 2WDRA 2W0GA 3CPZA 4B3RT 4LMLA 1S94A 5DABA 5CGMA 3K3NA 3ONXA 4HFVA 4QX8B 4ZI3C 4GYRA 4O2AE 2H89A 4HWDA 5IYZE 3SWHA 2ZMAA 3RIFA 4HE8A 3UU5A 2CHNA 4KHPT 1ZP0A 3CQCB 1M62A 2JIWA 5ABEA 3PUXF 2ZM0A 3NKZA 1D1AA 5LJNA 1G8XA 4CN6A 3PJAJ 2D0TA 4IIJE 3P8CD 2K3WA 5FMNA 1IJ5A 5LJMA 3N9NA 3QC9A 5HWXA 4Z90A 5DJQC 4AQFA 5E0OA 2DLRA 5LMNT 5JDHA 3AA1B 1OXZA 2WWUA 4YTNA 2LRKA 4P09A 2E9XD 3PUVF 2MAWA 4X65T 2LE8A 2B1EA 4CI3B 3AE9A 2WBLA 2JPFA 3O1IA 1MIYA 3ZMTB 2JJ9A 1W0AA 5J0ZA 3PJAA 4HFBA 1HS7A 3IBPA 1HX1B 3DP7A 2LSKA 1WFDA 5FVLA 2XASB 5HCJA 4HFHA 2D9DA 4ZI2C 2YINA 4PNIA 2XTLA 4U33A 2N9DA 2Q9QC 4ISSA 3TLUA 4I4TE 1FMWA 2X68A 3NBXX 4UF0B 5C2TA 1QSDA 4EIWA 2W61A 2CLYC 3CQXC 4K0UA 3AEFA 4CI1B 2SPCA 2F4VT 4IE7A 3M3ZB 3S4UA 1N34T 1D0ZA 4OK0A 4NUVA 4A97A 1HTJF 2VWAA 2NP9A 3ONLC 3ZMZB 3K3QC 5CA1E 3VKHA 4IHJE 1MIWA 2LM2A 3CKDA 2X51A 2BBJA 5LCYA 2UUAT 3QB5K 4X1IE 2BS2A 4OYJA 5LG4A 4MFRA 3I9WA 2Q9QA 4C90A 5HWYA 2V7IA 3HKEE 2KXPB 5HEGA 3Q5EA 2VKJA 3AE7A 3T1YT 3IF8B 2VK9A 3SOLA 1HNWT 4GOUA 3JC6C 4JI1T 3L09A 3EABA 4DR1T 3PV0F 5AQRB 3JAEA 3QK6A 2I59A 4V1Av 3AEAA 2FJBA 4GK5E 4DV0T 2V5DA 4KMCA 3LFMA 3FBLA 3UTKA 2XAJB 4TV8E 2WDQA 4I50E 2D2SA 4JI7T 1DU2A 3RPUA 3FZKB 4FI5A 2JMKA 4IL4A 1X79A 3O1HA 5JH7E 4KUMB 4YHJA 4QWNB 5FXWA 1WR6A 2PG8A 4DR3T 5HCMA 3ZEFB 2PTFA 4X20E 5J2UE 2UXXB 4WW0A 3RKGA 3ZYLA 4IDZA 5L3CB 2BVLA 3JAFA 3ZT7A 4H9NC 3I0OA 5DQVA 3EUHA 3UFEA 2JRKA 1E2AA 2IUBA 2LSYA 2XM2A 1BR2A 3OBVE 5JDNA 4EXTA 3MACA 3NWIA 5AQMB 2HPJA 2RA1A 2MTQA 2BS4A 3D0TA 3LG7A 4HFDA 3WI3A 3JADA 3ESLA 2WMNA 4M1PA 4N78D 4IL9A 1O3XA 5HAXA 2WY2A 1H7CA 2X9YA 2YDRA 2Z6EA 2CXDA 1J5WA 3FHNA 4JLEA 1NEKA 1WRDA 3AECA 3CIRA 2HN1A 4DO0A 4EYYR 5LHIB 1WYCA 2XSBA 5LBQB 3RRCA 2DWGA 3SFEA 3RLFF 5JDGA 1FEWA 3IA3A 2V7MA 4BA9A 5AQSB 5AQVB 2BZBA 2BG9C 3P4RA 2E9XC 3VRBA 1UX4A 2CHOA 4LF4T 3P50A 3UU4A 3J7Yq 3ZT6A 3U78A 4YJ3E 4PJLA 3P4QA 4Q25A 3PTRB 3RYCE 4TWDA 4H9PC 1V9DA 3DTOA 2AE9A 3Q5DA 1SE7A 2CMRA 3AAIA 1XDOA 3CX6B 5EK4A 5M4YA 1MMAA 4DR6T 1SA0E 1D1CA 3RHWA 4X1KE 4JI4T 2HHHT 5L3DB 3AE8A 2LRLA 2IW5B 1JNRA 3L3PA 2DI4A 2V7JA 2RP4A 4AKLA 2XQ6A 3QOFA 4KX6A 4KHZF 1J5ET 3BK9A 1HX8A 2YKSA 1Y01A 1ZEEA 2XM1A 2NW8A 2UXBT 2BKNA 3EVYA 4TN7B 3FZFB 4EZHA 4DVDA 3PUGA 3F57A 4LF9T 1HCIA 2KMFA 4IDPA 4K0KT 4AXPA 2E5VA 3KBTA 4H9QC 3ZLIA 1LVKA 2D5UA 4U74A 2BG9A 4NUUA 3OYXA 4QHOA 2E9XA 5LMUT 4HFCA 2Q9QB 4ZS2A 4B3MT 5L4EA 3ONJA 5C8YE 4YFSA 2CWYA 4DUYT 2V26A 3OYZA 1MMNA 3F2EA 2DNXA 2JQQA 4Z91A 5LP6E 4PK5A 1HR0T 4TWFA 2JQHA 2CLYB 2K5BB 3P4PA 1IAPA 3RGLA 3H3AA 4UELA 2YK0A 4HGAA 5FY1A 2GK9A 5HXSA 5ABGA 1YKHB 1HFAA 2W63A 5ABHA 4J2CA 3C98B 3FZHB 2LKGA 2WAUA 3CMLA 4IE6A 4EV6A 5FY0A 4F8HA 2V6YA 2XQYA 1L0VA 2LHRA 2XUEA 4DNDA 2DL1A 2V8SV 2VB6A 5ETWA 4GK0E 4PW8A 2VASA 2ZLYA 3NZQA 3PE0A 3I9YA 1MNDA 3AVRA 5JDQA 2YDSA 3AA6B 3UU6A 4B6XA 3KV9A 3UFGA 4WYVA 5LYJE 4MALA 5HEHA 4OX9T 3SS1A 3VR8A 4EZ4A 4G2AA 2W2UA 3BQIA 3RH3A 2J1DG 5FL0A
chains in the Genus database with same CATH topology
4IDNA 3Q5DA 4IDQA 3X1DA 4IDOA 4IDPA 3QNUA 1XZYA 1Z8UA 3OVUA 1W0AA 1W09A 3IA3A 3Q5EA 3QOFA 1Y01A 1W0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDN A;  3Q5D A;  4IDQ A;  3X1D A;  4IDO A;  4IDP A;  3QNU A;  1XZY A;  1Z8U A;  3OVU A;  1W0A A;  1W09 A;  3IA3 A;  3Q5E A;  3QOF A;  1Y01 A;  1W0B A; 
#chains in the Genus database with same CATH topology
 2LJL A;  3AVS A;  4LFB T;  2XAQ B;  1FMV A;  4AQG A;  3ZCJ A;  3O4X E;  5FXV A;  1OWA A;  3BQK A;  2A72 A;  3ZKR A;  4TZ4 C;  1KF6 A;  4LFC T;  4X66 T;  1JNZ A;  2X9H A;  4WNK A;  4X62 T;  3N2O A;  4IE4 A;  3NRY A;  2H7O A;  5LGT B;  4NXN T;  4XZC A;  4JYA T;  4IRE A;  2OLT A;  4AKG A;  4TWH A;  5DQW A;  1WLX A;  5LHH B;  4PK6 A;  4JI3 T;  1BR0 A;  4QH4 A;  2K48 A;  4L5G A;  3UUL A;  2LT3 A;  4DR2 T;  5BMV E;  3PUY F;  3TLT A;  3NZP A;  1KNP A;  4QX7 B;  5HXR A;  2X0H A;  4JI5 T;  4YXD A;  3PU3 A;  4PFP A;  4DV4 T;  4E7S A;  4O4H E;  2NTX A;  1IJ6 A;  3RX6 A;  2CXF A;  3O1J A;  5JDM A;  2ODV A;  2XAG B;  2XAF B;  2YU1 A;  5HEU A;  2ZM6 T;  3CX8 B;  5LA6 E;  5HYA A;  2EHO D;  2ZM2 A;  5AQK B;  3AAE B;  5EK3 A;  4DV6 T;  4WBN E;  5L3B B;  3OPC A;  4PAG A;  4DV3 T;  2IC6 A;  4TUY E;  3VR9 A;  2OV9 A;  4LMK A;  2BG9 B;  5AQQ B;  5HEO A;  3KVA A;  2J62 A;  5JVD E;  2E9X B;  3V5S A;  4AQY T;  2IIU A;  1X9B A;  4QH5 A;  2H3R A;  5AQG B;  2CEA A;  1XDP A;  3P4S A;  1CUN A;  2J47 A;  2VVS A;  4GKK T;  4EGW A;  2L3L A;  5L4H A;  3OJA A;  5BR8 T;  3IEE A;  3DJB A;  3N9Q A;  5IHY A;  1N36 T;  3TLW A;  3EDV A;  2WU2 A;  3E22 E;  3LDQ B;  3ZYK A;  2UXC T;  4YSX A;  2UUB T;  2WS3 A;  3N2K E;  3AE4 A;  5JDL A;  4PK4 A;  2UXN B;  4IST A;  3K1S A;  1GQE A;  4GKJ T;  4TNW A;  3AAA B;  2VKO A;  4OFZ A;  2X9X A;  2V6X A;  3AE6 A;  2BDE A;  2CA5 A;  4JV5 T;  3ZN1 B;  5LBM A;  5JRE A;  4PFO A;  4LMJ A;  5L2L A;  1OED C;  2V6Y B;  3C50 A;  2BS3 A;  3AE3 A;  1WYB A;  5FKY A;  4UV9 B;  4QXH B;  3EI0 A;  4H9R C;  4CXY A;  1KNZ A;  3C64 A;  3GN5 A;  1NAF A;  4EAH A;  5F3J A;  4HEA A;  3ZJ1 A;  5KDM C;  4ANJ A;  2A2F X;  4U7Y A;  2LSI A;  3A5X A;  3HKD E;  3L39 A;  3EAM A;  3ABV A;  1T72 A;  2LOP A;  2XQ4 A;  2RPA A;  5H6R B;  1D1B A;  5LHG B;  3ZC1 A;  2QYW A;  1YW0 A;  4YTM A;  3RI5 A;  4UVC B;  3C4Z A;  3AED A;  4PJM A;  2A3D A;  4YLH A;  2XQ9 A;  2QVA A;  4O2B E;  4G63 A;  1OED A;  5CFB A;  4O8S A;  2XHE B;  2X67 A;  4L9I A;  2XQA A;  2HPL A;  2VL8 A;  3LBX A;  3RYH E;  4YHH T;  3N9L A;  2Y48 B;  2YEV C;  2L8K A;  3RIA A;  2BG9 E;  1HNX T;  1ZHC A;  3FZL B;  4IGU A;  3KIN B;  2KT9 A;  3TKL B;  2WWV A;  3O9X A;  4I55 E;  3WAK A;  4BJM A;  3JCF A;  4CXX A;  2W00 A;  1YQ4 A;  4JI0 T;  1UK5 A;  5JRC A;  4I43 B;  4YTP A;  2JMH A;  3HR0 A;  4NPP A;  1S35 A;  4CN1 A;  4AKR B;  4MLK A;  2V7L A;  2CBJ A;  3NRX A;  2X66 A;  4JEH B;  4GIW A;  1T98 A;  2E2A A;  2CBI A;  3E0Z A;  5JDF A;  2MBG A;  3UU8 A;  1QUU A;  4IE0 A;  2PFV A;  3RQW A;  4ZOL E;  4AI6 A;  5EK2 A;  5AQI B;  3VHL A;  3NVO A;  4X1Y E;  2DCF A;  5F8P A;  1D0Y A;  4EB6 E;  4QXC B;  2L9Q A;  2W66 A;  5FYM A;  4C91 A;  4DV7 T;  4HN9 A;  1YQ3 A;  2I0M A;  4DUZ T;  2CE7 A;  2WM9 A;  3K8P C;  4XAX B;  3LK4 2;  4BJN A;  4XBF B;  3PUA A;  2LKH A;  1KEY A;  2V5C A;  5HXH A;  2K9A A;  1W9R A;  3T8O A;  3OTO T;  2EHO C;  4H9S E;  3P7I A;  4A98 A;  1ZKE A;  4CZZ B;  2H7V C;  4TX5 A;  2QA7 A;  5AQJ B;  2M67 A;  2YDQ A;  2M6B A;  3KV6 A;  3M65 A;  1MNE A;  1SUM B;  3RQU A;  2KLQ A;  3P4W A;  4HKA A;  1UCU A;  3QNU A;  3ZMU B;  1Z8U A;  2G0U A;  1UUS A;  1IBK T;  2CXL A;  1LKX A;  4YSY A;  4O4L E;  1LVF A;  4LF5 T;  1E7P A;  3J9X 1;  1J1J A;  4DID B;  1SHZ C;  4IE5 A;  2IML A;  4CQI A;  3UUN A;  3N5L A;  4DV2 T;  4DV5 T;  1Z0P A;  1R8I A;  4P1N A;  5C3J A;  1HG2 A;  3I1A A;  5LGN B;  3ANW A;  4Z8X A;  5HEJ A;  3GN5 B;  3C51 A;  3CQG B;  5JR9 A;  1XMO T;  1CHU A;  3AA7 B;  3KVB A;  1NWM X;  4UV8 B;  2ACX A;  4H9O C;  2XQ3 A;  1MIV A;  4CXW A;  3ZMS B;  3AXJ A;  5L3G B;  5LXT E;  5ABF A;  2CRB A;  2EHO A;  4JI2 T;  1FJG T;  1T7S A;  4QXB B;  4DR7 T;  3VU7 H;  4HWH A;  5AQL B;  4F6R C;  5LNK A;  1M7K A;  3KV5 A;  4WBO A;  2YU2 A;  3SFD A;  2IC9 A;  4DBQ A;  3ETU A;  3OVU A;  3N9P A;  3U3I A;  3C4W A;  3L8R A;  2MYS A;  2ACZ A;  5ADX L;  1KK7 A;  2PBI A;  4B3S T;  2KSR A;  1BR4 A;  5FP3 A;  4TNV A;  3N2G E;  2WP9 A;  2N2N A;  1OED B;  2LSJ A;  5KMG P;  2WZH A;  4YT0 A;  3AB3 B;  4ZS3 A;  3ZMV B;  1QLB A;  3LBX B;  2LSG A;  3FXE B;  3CWZ B;  4EOZ B;  2BKP A;  4JEU B;  3RKO A;  2XAH B;  1XWM A;  2XQ8 A;  3R6N A;  5FY7 A;  3ZPO A;  2NTY A;  4DBR A;  4B3T T;  3PUW F;  3WAJ A;  1YKE B;  2K24 A;  3RYF E;  2V1D B;  3AE5 A;  2IDO B;  3UUX B;  2NOX A;  4DR4 T;  5JRC B;  5LG3 A;  2FJD A;  2E5L T;  4UXN B;  2HN2 A;  3VRA A;  2NWB A;  3MJX A;  4CN4 A;  3LSV A;  1XNQ T;  4YJ2 E;  4QH1 A;  1KNR A;  1XNR T;  3V5U A;  4ZEY A;  2H88 A;  3X1D A;  4GYS A;  2NR4 A;  1XMQ T;  5GON E;  2WQY A;  4X64 T;  4ILA A;  4MBQ A;  3FZM B;  5HXC A;  3CVR A;  5FVK A;  1VRB A;  4YSZ A;  2VVN A;  4LF7 T;  2V7K A;  4EEB A;  2VQE T;  1IBM T;  2CCQ A;  5J1G A;  3MXZ A;  2VL0 A;  5KXJ A;  4O4J E;  1NEN A;  2BKO A;  3B5M A;  4JBW F;  3AA0 B;  3RC8 A;  3PDY A;  4AIS A;  4JUY A;  5AQH B;  3OKQ A;  4WZX A;  4TV9 E;  5FXX A;  3HKC E;  4IDQ A;  5LGU B;  1LRZ A;  4X5T A;  2UXD T;  3ZJ2 A;  5F5W A;  2CM0 A;  5AQP B;  4ILC A;  3N9O A;  3ZN0 B;  4OHF A;  3EDU A;  4JI6 T;  1EZ3 A;  1G73 A;  4O4I E;  1VCS A;  4A56 A;  4ZZC A;  2KWH A;  2W67 A;  1WCR A;  4A5X A;  2C0S A;  3N9M A;  2XJ7 A;  2QGS A;  4EED A;  3F31 A;  2DHR A;  3TLV A;  3E08 A;  4DV1 T;  2XY8 B;  2FJE A;  4LF6 T;  5IWA T;  4IDO A;  2C5I T;  1I6Z A;  2I6H A;  5EZY E;  3FBZ A;  4ZHQ E;  4H63 H;  4KP3 C;  1OED E;  3PUQ A;  1AJ3 A;  3W15 B;  2Y8D A;  3KFW X;  2XQ5 A;  5FL1 A;  1IZN B;  2WU5 A;  2VKD A;  3ANW B;  3Q9D A;  5JR9 B;  3B57 A;  5AQU B;  4ZXL A;  3HKB E;  3PUR A;  5CA0 E;  2Y6X A;  2BBH A;  4JI8 T;  5AQF B;  3ZCI A;  3AXJ B;  2ODU A;  3LK3 B;  5TAO A;  5ABF B;  1HNZ T;  2IAK A;  4QKN A;  4ZI3 D;  3AEB A;  3IHR A;  3QUJ A;  2EHO B;  3UQ7 A;  4LFA T;  2X0Y A;  4DR5 T;  3K3O A;  4ZI7 E;  1HG5 A;  4HWC A;  1U5P A;  4IDN A;  3Q2M A;  1W0B A;  2VUR A;  3ZT5 A;  2WSS V;  4COF A;  3VKG A;  4UEM A;  1BR1 A;  4ASK A;  1ZV4 X;  2J4G A;  2D0U A;  3MKD A;  3I0Q A;  5JTG A;  1UGO A;  2XZE A;  1N33 T;  5H6Q B;  1W09 A;  1MMD A;  5HXE A;  5AQO B;  5FNV E;  4HWI B;  3LK2 B;  4HTE A;  4KBM B;  3Q5X A;  2MOZ A;  1YD8 G;  1US7 B;  3H3M A;  2FJA A;  2AXD S;  2LHN A;  2XSA A;  4FJO A;  1FIO A;  5L3F B;  3HI2 A;  5KX5 E;  4E7Z A;  1T8B A;  5AQN B;  3ZST A;  3KV4 A;  2MPK A;  2W4X A;  3RC3 A;  5LOV E;  3PUZ F;  3UT5 E;  2UU9 T;  3KDS E;  2R6G F;  3ZSS A;  1XZY A;  3RRW A;  3UUB A;  2IHR 1;  5CB4 E;  3RYI E;  4L0R A;  2OA5 A;  4U2Y A;  3KBU A;  4AIU A;  4ZI2 D;  1WR0 A;  4DMV A;  4BAY B;  1UX5 A;  2XPK A;  2Q9Q D;  1YXR A;  3RIU C;  2FUP A;  2JQK A;  2WDV A;  2WZI A;  1B7T A;  4H63 V;  2KZ7 B;  4NIQ A;  2C5J A;  3GWH A;  3Q5W A;  1Y64 B;  2M6I A;  2NW9 A;  2LM9 A;  4ERR A;  1VCT A;  4U72 A;  3UUM A;  2HH7 A;  4OYK A;  3UU3 A;  3ETV A;  3GMI A;  3C4X A;  1MMG A;  2LOS A;  1UUR A;  1I94 T;  3EHZ A;  4PJN A;  3UQ4 A;  2WMO A;  3SRZ A;  4U3C A;  1N32 T;  3CX7 B;  4HWF A;  2LEH A;  5CJ5 A;  3A8Y C;  4UIG A;  2BVM A;  1HF8 A;  3ZYM A;  3HL6 A;  2A9U A;  4I0U A;  4MHC A;  5JR9 C;  3AEE A;  5A1L A;  1KFY A;  2CPT A;  3CK6 A;  4UF0 A;  3BQL A;  5LB7 B;  2KIN B;  4AKH A;  5JQG E;  3AEG A;  3MA9 A;  2JQ9 A;  2ES0 A;  1ZOY A;  3A7M A;  4KI0 F;  2N1G A;  4DMW A;  4PJJ A;  1U4Q A;  2QRX A;  1D0X A;  3RIU A;  4CI2 B;  4EYU A;  2PJQ A;  2NW7 A;  3PUS A;  2YOE A;  4ILB A;  3FB2 A;  4UR9 A;  2XQ7 A;  4IT4 A;  3RF1 A;  5L47 A;  4U2Z A;  2B76 A;  3G06 A;  3JC6 D;  3TLS A;  2VKH A;  5AQT B;  3GA8 A;  2X0L B;  4ZZB A;  2DWK A;  3QB5 A;  4HFI A;  4LF8 T;  2P9B A;  3ZC0 A;  3FXD B;  3AE1 A;  5AFU L;  2W62 A;  2WCA A;  5J2T E;  3MZK B;  2ZM8 A;  4U31 A;  5L3E B;  3AE2 A;  3HA4 A;  3T1H T;  4U7I A;  2X9W A;  3MK7 C;  3PU8 A;  4UVA B;  2CWO A;  5FXZ A;  3H37 A;  3B13 A;  2YN6 A;  4NXM T;  2LLY A;  3R84 B;  1IBL T;  2C5K T;  2E8I A;  4AQF C;  2VQF T;  4HFE A;  2WB5 A;  4P0B A;  2FBW A;  4UVB B;  2KWI B;  2UUC T;  1VOM A;  4ILU A;  1E1H B;  4ADZ A;  3LJC A;  5IUX A;  4AKI A;  4YY3 T;  4P0A A;  2KND A;  2WDR A;  2W0G A;  3CPZ A;  4B3R T;  4LML A;  1S94 A;  5DAB A;  5CGM A;  3K3N A;  3ONX A;  4HFV A;  4QX8 B;  4ZI3 C;  4GYR A;  4O2A E;  2H89 A;  4HWD A;  5IYZ E;  3SWH A;  2ZMA A;  3RIF A;  4HE8 A;  3UU5 A;  2CHN A;  4KHP T;  1ZP0 A;  3CQC B;  1M62 A;  2JIW A;  5ABE A;  3PUX F;  2ZM0 A;  3NKZ A;  1D1A A;  5LJN A;  1G8X A;  4CN6 A;  3PJA J;  2D0T A;  4IIJ E;  3P8C D;  2K3W A;  5FMN A;  1IJ5 A;  5LJM A;  3N9N A;  3QC9 A;  5HWX A;  4Z90 A;  5DJQ C;  4AQF A;  5E0O A;  2DLR A;  5LMN T;  5JDH A;  3AA1 B;  1OXZ A;  2WWU A;  4YTN A;  2LRK A;  4P09 A;  2E9X D;  3PUV F;  2MAW A;  4X65 T;  2LE8 A;  2B1E A;  4CI3 B;  3AE9 A;  2WBL A;  2JPF A;  3O1I A;  1MIY A;  3ZMT B;  2JJ9 A;  1W0A A;  5J0Z A;  3PJA A;  4HFB A;  1HS7 A;  3IBP A;  1HX1 B;  3DP7 A;  2LSK A;  1WFD A;  5FVL A;  2XAS B;  5HCJ A;  4HFH A;  2D9D A;  4ZI2 C;  2YIN A;  4PNI A;  2XTL A;  4U33 A;  2N9D A;  2Q9Q C;  4ISS A;  3TLU A;  4I4T E;  1FMW A;  2X68 A;  3NBX X;  4UF0 B;  5C2T A;  1QSD A;  4EIW A;  2W61 A;  2CLY C;  3CQX C;  4K0U A;  3AEF A;  4CI1 B;  2SPC A;  2F4V T;  4IE7 A;  3M3Z B;  3S4U A;  1N34 T;  1D0Z A;  4OK0 A;  4NUV A;  4A97 A;  1HTJ F;  2VWA A;  2NP9 A;  3ONL C;  3ZMZ B;  3K3Q C;  5CA1 E;  3VKH A;  4IHJ E;  1MIW A;  2LM2 A;  3CKD A;  2X51 A;  2BBJ A;  5LCY A;  2UUA T;  3QB5 K;  4X1I E;  2BS2 A;  4OYJ A;  5LG4 A;  4MFR A;  3I9W A;  2Q9Q A;  4C90 A;  5HWY A;  2V7I A;  3HKE E;  2KXP B;  5HEG A;  3Q5E A;  2VKJ A;  3AE7 A;  3T1Y T;  3IF8 B;  2VK9 A;  3SOL A;  1HNW T;  4GOU A;  3JC6 C;  4JI1 T;  3L09 A;  3EAB A;  4DR1 T;  3PV0 F;  5AQR B;  3JAE A;  3QK6 A;  2I59 A;  4V1A v;  3AEA A;  2FJB A;  4GK5 E;  4DV0 T;  2V5D A;  4KMC A;  3LFM A;  3FBL A;  3UTK A;  2XAJ B;  4TV8 E;  2WDQ A;  4I50 E;  2D2S A;  4JI7 T;  1DU2 A;  3RPU A;  3FZK B;  4FI5 A;  2JMK A;  4IL4 A;  1X79 A;  3O1H A;  5JH7 E;  4KUM B;  4YHJ A;  4QWN B;  5FXW A;  1WR6 A;  2PG8 A;  4DR3 T;  5HCM A;  3ZEF B;  2PTF A;  4X20 E;  5J2U E;  2UXX B;  4WW0 A;  3RKG A;  3ZYL A;  4IDZ A;  5L3C B;  2BVL A;  3JAF A;  3ZT7 A;  4H9N C;  3I0O A;  5DQV A;  3EUH A;  3UFE A;  2JRK A;  1E2A A;  2IUB A;  2LSY A;  2XM2 A;  1BR2 A;  3OBV E;  5JDN A;  4EXT A;  3MAC A;  3NWI A;  5AQM B;  2HPJ A;  2RA1 A;  2MTQ A;  2BS4 A;  3D0T A;  3LG7 A;  4HFD A;  3WI3 A;  3JAD A;  3ESL A;  2WMN A;  4M1P A;  4N78 D;  4IL9 A;  1O3X A;  5HAX A;  2WY2 A;  1H7C A;  2X9Y A;  2YDR A;  2Z6E A;  2CXD A;  1J5W A;  3FHN A;  4JLE A;  1NEK A;  1WRD A;  3AEC A;  3CIR A;  2HN1 A;  4DO0 A;  4EYY R;  5LHI B;  1WYC A;  2XSB A;  5LBQ B;  3RRC A;  2DWG A;  3SFE A;  3RLF F;  5JDG A;  1FEW A;  3IA3 A;  2V7M A;  4BA9 A;  5AQS B;  5AQV B;  2BZB A;  2BG9 C;  3P4R A;  2E9X C;  3VRB A;  1UX4 A;  2CHO A;  4LF4 T;  3P50 A;  3UU4 A;  3J7Y q;  3ZT6 A;  3U78 A;  4YJ3 E;  4PJL A;  3P4Q A;  4Q25 A;  3PTR B;  3RYC E;  4TWD A;  4H9P C;  1V9D A;  3DTO A;  2AE9 A;  3Q5D A;  1SE7 A;  2CMR A;  3AAI A;  1XDO A;  3CX6 B;  5EK4 A;  5M4Y A;  1MMA A;  4DR6 T;  1SA0 E;  1D1C A;  3RHW A;  4X1K E;  4JI4 T;  2HHH T;  5L3D B;  3AE8 A;  2LRL A;  2IW5 B;  1JNR A;  3L3P A;  2DI4 A;  2V7J A;  2RP4 A;  4AKL A;  2XQ6 A;  3QOF A;  4KX6 A;  4KHZ F;  1J5E T;  3BK9 A;  1HX8 A;  2YKS A;  1Y01 A;  1ZEE A;  2XM1 A;  2NW8 A;  2UXB T;  2BKN A;  3EVY A;  4TN7 B;  3FZF B;  4EZH A;  4DVD A;  3PUG A;  3F57 A;  4LF9 T;  1HCI A;  2KMF A;  4IDP A;  4K0K T;  4AXP A;  2E5V A;  3KBT A;  4H9Q C;  3ZLI A;  1LVK A;  2D5U A;  4U74 A;  2BG9 A;  4NUU A;  3OYX A;  4QHO A;  2E9X A;  5LMU T;  4HFC A;  2Q9Q B;  4ZS2 A;  4B3M T;  5L4E A;  3ONJ A;  5C8Y E;  4YFS A;  2CWY A;  4DUY T;  2V26 A;  3OYZ A;  1MMN A;  3F2E A;  2DNX A;  2JQQ A;  4Z91 A;  5LP6 E;  4PK5 A;  1HR0 T;  4TWF A;  2JQH A;  2CLY B;  2K5B B;  3P4P A;  1IAP A;  3RGL A;  3H3A A;  4UEL A;  2YK0 A;  4HGA A;  5FY1 A;  2GK9 A;  5HXS A;  5ABG A;  1YKH B;  1HFA A;  2W63 A;  5ABH A;  4J2C A;  3C98 B;  3FZH B;  2LKG A;  2WAU A;  3CML A;  4IE6 A;  4EV6 A;  5FY0 A;  4F8H A;  2V6Y A;  2XQY A;  1L0V A;  2LHR A;  2XUE A;  4DND A;  2DL1 A;  2V8S V;  2VB6 A;  5ETW A;  4GK0 E;  4PW8 A;  2VAS A;  2ZLY A;  3NZQ A;  3PE0 A;  3I9Y A;  1MND A;  3AVR A;  5JDQ A;  2YDS A;  3AA6 B;  3UU6 A;  4B6X A;  3KV9 A;  3UFG A;  4WYV A;  5LYJ E;  4MAL A;  5HEH A;  4OX9 T;  3SS1 A;  3VR8 A;  4EZ4 A;  4G2A A;  2W2U A;  3BQI A;  3RH3 A;  2J1D G;  5FL0 A; 
#chains in the Genus database with same CATH homology
 4IDN A;  3Q5D A;  4IDQ A;  3X1D A;  4IDO A;  4IDP A;  3QNU A;  1XZY A;  1Z8U A;  3OVU A;  1W0A A;  1W09 A;  3IA3 A;  3Q5E A;  3QOF A;  1Y01 A;  1W0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...