1Z8UA

Crystal structure of oxidized alpha hemoglobin bound to ahsp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
ALLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Structure of oxidized alpha-haemoglobin bound to AHSP reveals a protective mechanism for haem.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 33
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1z8uA00
4IDNA 3QNUA 1Z8UA 3Q5EA 1Y01A 3X1DA 1W0BA 4IDQA 1W0AA 3Q5DA 4IDOA 4IDPA 3QOFA 1XZYA 1W09A 3OVUA 3IA3A
chains in the Genus database with same CATH superfamily
5L3FB 3C4WA 4LF5T 3HL6A 4MBQA 4QH4A 4DR2T 1HX1B 3EABA 3RYHE 5FL1A 2I6HA 2V6YA 4TUYE 5J2UE 4GYRA 1N34T 1YQ4A 2WDVA 2NTYA 3VR8A 4PK6A 4KUMB 4DV5T 5EK3A 3AXJA 3ZEFB 4LF9T 2XSAA 1VRBA 4I55E 3LJCA 1MIWA 2E9XC 3PUXF 4AQFA 3C98B 2E5VA 1XMQT 3D0TA 3AA1B 5DABA 2W4XA 5KXJA 3FBLA 3RLFF 1KK7A 4NPPA 2WS3A 3A7MA 4GYSA 3EAMA 2YKSA 1JNZA 3QOFA 5AQVB 2V7IA 4JEUB 3RHWA 3ZT6A 2X66A 2OA5A 5ABGA 3AE4A 2WCAA 5LG3A 3CIRA 4JI2T 4PJJA 2WY2A 4BJNA 2VKOA 3RRCA 2X9YA 4DR7T 2SPCA 2LSKA 5JRCA 4O4LE 4YSZA 2LKGA 4X64T 5AQIB 3GN5B 2YU1A 2VASA 5JREA 4IE4A 3BQIA 2K48A 1KF6A 4F6RC 1VOMA 4QX7B 4YHJA 5L4HA 4TX5A 4NUVA 5FY1A 4TWDA 1XNRT 2WWUA 5L3BB 1Z8UA 2Q9QC 4IDQA 2LSGA 3CK6A 5JVDE 4OFZA 3I0OA 5JDMA 3UU8A 2V26A 1MMAA 2BG9E 2EHOA 4U33A 1XDOA 1BR0A 1HNWT 5FVKA 4YSYA 4YTPA 4AKGA 3B57A 3UU3A 3TLVA 4AKHA 4M1PA 4IDZA 4N78D 4X1KE 4HFDA 1YW0A 2A2FX 4O8SA 2J1DG 2K9AA 4UEMA 2FJBA 3RRWA 1T7SA 1OWAA 1Z0PA 4WYVA 2BBJA 5FXZA 2ES0A 1WFDA 2X9WA 4DV6T 4B3TT 4O2BE 2NW7A 4QH1A 1J5ET 3ZC1A 3ONXA 4YXDA 5AQPB 5A1LA 3GWHA 4Z91A 3AEDA 4YT0A 2R6GF 3OBVE 3AVSA 3MK7C 1XMOT 2BG9A 2IMLA 5BR8T 4ZHQE 1W0BA 1XZYA 1OXZA 3BQKA 4CN4A 2V7JA 4ZEYA 4ASKA 5LB7B 3Q9DA 3U3IA 3RKOA 3CX7B 4LFAT 4HGAA 4AI6A 2LT3A 3RI5A 2WU5A 5AQMB 4EYYR 1OEDE 4ILAA 3ZSTA 3QB5K 3UULA 2UXNB 3LBXB 4FI5A 4X5TA 4AXPA 5HCMA 3AEGA 2EHOD 5HCJA 1N33T 3QNUA 2XASB 5J1GA 5F8PA 2KWHA 3N9MA 3VU7H 3ZJ2A 5C3JA 1SA0E 5LG4A 3EHZA 4TNVA 3KVAA 2D9DA 3WI3A 3GA8A 3AB3B 3KV4A 3UUNA 2HH7A 3FHNA 3L3PA 4IL9A 3UUXB 2KT9A 2V8SV 3SWHA 4UVAB 4X65T 1OEDC 4JEHB 3TLWA 3O4XE 4ZOLE 3T1HT 1MNDA 3FZMB 4ZS2A 2B1EA 3PUSA 2LSJA 2VQET 2NW9A 1D1BA 2DWKA 2VL0A 4U3CA 2H89A 4NUUA 2BVLA 5M4YA 2L9QA 3CX8B 3VR9A 4EEBA 4EIWA 2G0UA 2XQ5A 3TLSA 3N9PA 3E22E 4CI3B 4L9IA 2N2NA 2KLQA 2V1DB 3RF1A 1UCUA 4IE0A 1T98A 1H7CA 3O1IA 4JYAT 4JBWF 3S4UA 5HXEA 5LJNA 2LOPA 2CRBA 2E9XB 2X0HA 4BJMA 4XBFB 4DR4T 2ACZA 2N1GA 5HYAA 3ANWB 5JQGE 2OLTA 5J2TE 5HAXA 2J62A 2D5UA 1Y64B 3L09A 1ZP0A 2BBHA 2JPFA 3OYXA 1MNEA 3GN5A 3N2KE 4C90A 3AA0B 4LFCT 4B6XA 5AQRB 3PDYA 2LM9A 4B3MT 3JAFA 5KMGP 1FIOA 4EGWA 2BS2A 4ILUA 4AQGA 3AEEA 2QA7A 2JMKA 1DU2A 4P1NA 3AECA 2XJ7A 2I0MA 2YEVC 1T72A 3O9XA 2LHRA 2CXDA 2XQ3A 2AXDS 4I50E 5LGNB 1CUNA 3PJAA 2BDEA 2ZM0A 5LHIB 5JDQA 1W09A 4J2CA 2C5JA 1HX8A 4HFHA 4EZHA 2XZEA 4HWDA 2Q9QB 2CE7A 4IDPA 5JR9C 5DQVA 2LRKA 4E7SA 2XHEB 2Y48B 5DJQC 2L8KA 3J7Yq 2CXFA 1E2AA 2CLYC 5LMNT 4AKRB 2M6IA 5GONE 4GOUA 4OHFA 4U72A 5HEHA 3PU3A 3PUAA 2NOXA 3ZYKA 2NW8A 1HCIA 2X51A 3H3MA 3KDSE 2NTXA 3E0ZA 2WDRA 1ZEEA 3A5XA 3AEFA 3RYFE 4EEDA 3ETUA 4GKKT 1LVKA 4G63A 2W2UA 4DV7T 5CGMA 1IAPA 3CPZA 3KFWX 4AIUA 3N9LA 2ACXA 4UV8B 2L3LA 3LBXA 4XZCA 5L3EB 4LF7T 2CBJA 4WNKA 5JDGA 3G06A 2W61A 4OYKA 4EZ4A 3RQWA 4L0RA 4JI0T 2XQ9A 4TV8E 4UELA 2WZHA 1O3XA 3ONJA 2LSIA 4C91A 5FYMA 4HFBA 3F57A 2IDOB 3I9WA 3N5LA 5ETWA 1MMNA 2CCQA 2MYSA 4HWFA 4MALA 4DV1T 4PK5A 4A5XA 4HE8A 4DR3T 4ADZA 4QX8B 3B13A 4IHJE 4DR5T 5AQSB 4NXMT 3O1HA 5LA6E 4O2AE 5AQOB 5JDLA 4ISTA 2XAJB 3Q5DA 2UUAT 2XTLA 3AE2A 4PAGA 4K0UA 1FJGT 5HWXA 2Y6XA 4O4JE 4OX9T 2VB6A 3ZC0A 5IUXA 5LBQB 3C4ZA 2LLYA 2LRLA 2KNDA 1I94T 3RQUA 2HHHT 2E9XA 2M67A 2YDRA 2ODUA 1IBKT 1BR1A 3WAJA 3ZSSA 5CB4E 3ANWA 3OVUA 3DP7A 3TKLB 1NEKA 3LSVA 4PFOA 3UUMA 3RYIE 3IF8B 5FY0A 2XAHB 1Y01A 5EK4A 1SHZC 3N9QA 4HFEA 2NR4A 2DWGA 4X66T 4QWNB 1XDPA 3HKBE 3EUHA 3ZMUB 1FMWA 3EI0A 2UXCT 1QLBA 4TN7B 3N9OA 5CFBA 1JNRA 1V9DA 2VVSA 1HFAA 4HFVA 3B5MA 1U4QA 2V5DA 1WR0A 4H63H 4YTNA 3M3ZB 4H9OC 1KNZA 1XNQT 1YKHB 4LF4T 5LJMA 2YK0A 3W15B 1S94A 3IBPA 2X0YA 4IIJE 3AE3A 1YKEB 5AQLB 3UFEA 3UUBA 4QXHB 4O4HE 3L39A 3ZN1B 3NVOA 3LK42 3PURA 2XAQB 2BVMA 1WRDA 2Q9QA 2HPJA 1ZHCA 2W63A 5JTGA 4H9NC 1WLXA 2AE9A 1KNPA 1MMDA 2JQKA 4CXWA 2V7MA 3IHRA 3FBZA 4IE5A 2IC6A 2KXPB 1WCRA 2E9XD 2VURA 5L2LA 2X9HA 2BG9C 3VRAA 4HWCA 3VKGA 2VKJA 4PNIA 2UU9T 3P4QA 2UUCT 2VWAA 4BAYB 1ZKEA 5JR9B 4U31A 2ZMAA 4FJOA 1HG5A 4GK0E 5LOVE 1ZOYA 2WSSV 3P50A 1LRZA 3QC9A 5EK2A 3PU8A 2JQHA 4DR6T 3I9YA 1UGOA 4TWHA 4AKLA 2YINA 4H9RC 4UVCB 2XQAA 4LMLA 5LXTE 5FNVE 3U78A 3LG7A 3RIAA 3HA4A 4A97A 4JI3T 2N9DA 4YJ2E 4DUZT 5HWYA 4IREA 2JQQA 1YQ3A 5BMVE 2X9XA 4I0UA 4ISSA 5IWAT 3AAIA 4PJMA 2BKOA 3ZYMA 4X1YE 2CPTA 4JI8T 1M7KA 2C0SA 4B3RT 2D0UA 1KFYA 2WP9A 4HFIA 3J9X1 4ZS3A 3SS1A 4U7IA 2BZBA 4TNWA 3I0QA 1R8IA 4IL4A 2XPKA 5H6RB 2WZIA 4CN6A 5ADXL 3AE7A 2WQYA 3MJXA 4DNDA 2WU2A 3NKZA 4L5GA 3LDQB 2QGSA 2V5CA 2YN6A 4G2AA 3VHLA 3RX6A 3NRYA 3NRXA 5H6QB 2YOEA 4IDNA 2DI4A 3ZKRA 2VK9A 2C5KT 3O1JA 3K3OA 4KHPT 2RPAA 4V1Av 2CWYA 3UTKA 3JC6C 4TV9E 3CQGB 3NBXX 1G8XA 4DVDA 2Y8DA 5F5WA 2WAUA 2NWBA 4P09A 2BS4A 1FEWA 4MHCA 2C5IT 3SFDA 4QHOA 4O4IE 5AQJB 1SUMB 4JI6T 1VCSA 4YY3T 2D0TA 3K8PC 1MMGA 2VKDA 4ILCA 1B7TA 3P4RA 2P9BA 3FB2A 5JDFA 3QK6A 4ZI7E 4H9QC 2WWVA 4WBOA 2XAFB 1E7PA 4YHHT 1T8BA 3NZPA 2YU2A 5EZYE 2KZ7B 1IBMT 5HEOA 1IZNB 5LP6E 1HNXT 3PUWF 1J5WA 3ZN0B 4MLKA 2X67A 2Z6EA 2XQ6A 5L4EA 3V5SA 3PUZF 5HEUA 2H88A 4U2ZA 5HEJA 5L3CB 2FBWA 2M6BA 2W0GA 4ANJA 2UXBT 4EV6A 2J47A 3P4WA 4U7YA 1UURA 5AQFB 3HKEE 4Q25A 3C64A 3V5UA 3PTRB 3EDVA 5ABEA 4CI2B 4DUYT 3AVRA 2VKHA 2KWIB 2WM9A 1WYBA 4PJLA 3RIUC 4HWHA 4ZZCA 3CKDA 2W62A 4DBRA 3ETVA 3FZHB 3CVRA 2LHNA 3PUVF 5DQWA 3SOLA 4HFCA 5L47A 4Z90A 1WR6A 1I6ZA 4KX6A 1CHUA 3AA6B 3OPCA 5J0ZA 5TAOA 2A9UA 2CWOA 4UVBB 3KINB 5LGUB 3AE9A 2ODVA 1HF8A 2UXXB 5AQKB 3RH3A 1L0VA 3FZFB 5ABFB 4CQIA 2H3RA 2IAKA 3K1SA 4QKNA 5JR9A 4TZ4C 2LJLA 2PTFA 4HTEA 4ERRA 2K3WA 4ZI3D 2LM2A 3C4XA 2XSBA 3FXEB 2BG9B 4B3ST 2IIUA 2HN2A 3EDUA 3AEAA 5HXRA 4U74A 1X79A 4EB6E 3VRBA 5JH7E 5AQNB 1NAFA 1HR0T 2FJDA 5FP3A 4KMCA 3QB5A 4GK5E 3F2EA 4NXNT 2IC9A 1IBLT 4H9SE 2VQFT 3PE0A 3L8RA 3KV5A 4JI1T 3Q5XA 4JLEA 2V7LA 3BQLA 4YSXA 3RGLA 5FY7A 2JIWA 5AQHB 4YJ3E 2BKPA 3LK3B 3MKDA 4IT4A 4LF6T 4IE6A 4ZXLA 2IW5B 1N36T 2LEHA 2E8IA 3HI2A 4GKJT 1W9RA 3IA3A 2CBIA 5JDNA 3Q5EA 3P4SA 2JQ9A 2W67A 4I43B 4AQFC 3AAAB 4CXXA 1IJ6A 1UK5A 1YD8G 5LMUT 3M65A 5FXWA 2H7OA 1U5PA 3A8YC 2LKHA 3UU4A 3KV6A 1AJ3A 4A98A 3P4PA 4IE7A 2F4VT 1OEDB 2XM2A 5KX5E 2W66A 3N2GE 1KEYA 2FUPA 3UQ4A 3AE6A 3BK9A 4CN1A 5FMNA 5FXVA 3H3AA 3JADA 3CWZB 3RYCE 4ZI2D 4LF8T 2CMRA 2JJ9A 2QVAA 2CHNA 3OYZA 2H7VC 2GK9A 2J4GA 4QH5A 5HXHA 1LKXA 2X0LB 3X1DA 1HNZT 1US7B 2D2SA 1NENA 1G73A 3TLTA 4YLHA 1ZV4X 2CM0A 3DTOA 1X9BA 3R84B 4IGUA 4DV3T 4IDOA 1D0XA 2EHOC 2YDSA 3ZMZB 2HPLA 3C50A 2WBLA 3SFEA 3FZKB 4AISA 1BR2A 2LE8A 3ZPOA 2V6XA 4DR1T 4EYUA 1MIYA 4KBMB 2X68A 4WZXA 4KP3C 4Z8XA 2V7KA 2JMHA 1HS7A 2XUEA 3MACA 3WAKA 1BR4A 2DNXA 2VL8A 2XQ7A 1N32T 2WMNA 1YXRA 3PUGA 1S35A 5LHGB 4UXNB 3ZMVB 3EVYA 3AA7B 4HEAA 2CEAA 3NWIA 2QYWA 4AKIA 4ZZBA 4X20E 4XAXB 4JUYA 3HKDE 3RC8A 1HTJF 3K3QC 3OKQA 2XM1A 2FJEA 2OV9A 3PUQA 3F31A 4YFSA 5L3GB 2FJAA 5ABFA 4CZZB 1M62A 3FZLB 4ILBA 1LVFA 3H37A 3VKHA 4KI0F 3RC3A 2CLYB 2LSYA 4X62T 3FXDB 5C8YE 2KINB 4JI5T 3AAEB 2HN1A 4K0KT 3CMLA 2CHOA 3R6NA 5LNKA 4UF0B 2DHRA 2IHR1 4PJNA 1XWMA 2KSRA 5ABHA 2MAWA 3TLUA 4JI4T 5IHYA 2PG8A 5L3DB 3GMIA 4QXBB 5LYJE 3PJAJ 4DMWA 2MTQA 4COFA 2Q9QD 2WDQA 2K24A 2I59A 3OJAA 5FXXA 4UV9B 4KHZF 4AQYT 2JRKA 4DBQA 3SRZA 5LGTB 4JI7T 4I4TE 2K5BB 2XQ8A 1UX5A 4EOZB 1FMVA 2BS3A 5HXCA 4UIGA 4DV0T 2V6YB 2UUBT 4X1IE 4CI1B 5AQTB 3N9NA 1GQEA 4LMJA 4H9PC 5LCYA 1W0AA 2ZM8A 4P0BA 2CXLA 5AQUB 3AXJB 4NIQA 1OEDA 3DJBA 4OYJA 2B76A 2XQ4A 5AFUL 3MZKB 1SE7A 1KNRA 4DO0A 3UQ7A 3HKCE 2PBIA 3OTOT 5HEGA 2MBGA 2MPKA 4U2YA 5F3JA 5CA1E 3PV0F 5CJ5A 3ZJ1A 3ABVA 4PK4A 5CA0E 1D1AA 2DL1A 3E08A 3UT5E 4EAHA 3RIFA 5E0OA 4HKAA 4YTMA 4PFPA 3UU6A 4ZI3C 3ZLIA 3C51A 3CX6B 2E2AA 2PJQA 5FL0A 4WBNE 5JRCB 2W00A 3N2OA 2XQYA 3AE5A 4CXYA 4LFBT 3HR0A 4H63V 3P7IA 4DIDB 2DCFA 3UU5A 3KV9A 2VVNA 1UX4A 5IYZE 3CQXC 2ZM2A 5C2TA 3Q5WA 3Q2MA 3KBUA 3ZMSB 2YDQA 3T8OA 3JCFA 2EHOB 5AQQB 4EXTA 3NZQA 3ONLC 2CA5A 1D1CA 3CQCB 3KVBA 5JDHA 2WMOA 3MXZA 2E5LT 1IJ5A 1UUSA 1D0ZA 4F8HA 4TWFA 2QRXA 3ZYLA 1E1HB 4HWIB 3ZT5A 4E7ZA 3AEBA 2XAGB 2A3DA 4GIWA 3ZCJA 4DV4T 3AE1A 3JC6D 3LK2B 3RIUA 3AE8A 5AQGB 3QUJA 1VCTA 5FVLA 4ZI2C 3RPUA 1QSDA 2DLRA 1J1JA 3JAEA 5HXSA 2ZM6T 4P0AA 4UR9A 2WB5A 3PUYF 3MA9A 2MOZA 3UFGA 4DMVA 1NWMX 3P8CD 1QUUA 4A56A 2XY8B 4PW8A 2IUBA 3I1AA 3K3NA 1MIVA 3IEEA 2ZLYA 1EZ3A 5KDMC 2LOSA 4UF0A 2PFVA 4JV5T 3LFMA 3ZCIA 2KMFA 3ZMTB 4MFRA 1HG2A 5FKYA 3T1YT 2A72A 2NP9A 3ESLA 2RA1A 5LBMA 2RP4A 4DV2T 3KBTA 5LHHB 2BKNA 1D0YA 4OK0A 4LMKA 4QXCB 3RKGA 2UXDT 1WYCA 3ZT7A 4WW0A 4BA9A 4HN9A
chains in the Genus database with same CATH topology
4IDNA 3QNUA 1Z8UA 3Q5EA 1Y01A 3X1DA 1W0BA 4IDQA 1W0AA 3Q5DA 4IDOA 4IDPA 3QOFA 1XZYA 1W09A 3OVUA 3IA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDN A;  3QNU A;  1Z8U A;  3Q5E A;  1Y01 A;  3X1D A;  1W0B A;  4IDQ A;  1W0A A;  3Q5D A;  4IDO A;  4IDP A;  3QOF A;  1XZY A;  1W09 A;  3OVU A;  3IA3 A; 
#chains in the Genus database with same CATH topology
 5L3F B;  3C4W A;  4LF5 T;  3HL6 A;  4MBQ A;  4QH4 A;  4DR2 T;  1HX1 B;  3EAB A;  3RYH E;  5FL1 A;  2I6H A;  2V6Y A;  4TUY E;  5J2U E;  4GYR A;  1N34 T;  1YQ4 A;  2WDV A;  2NTY A;  3VR8 A;  4PK6 A;  4KUM B;  4DV5 T;  5EK3 A;  3AXJ A;  3ZEF B;  4LF9 T;  2XSA A;  1VRB A;  4I55 E;  3LJC A;  1MIW A;  2E9X C;  3PUX F;  4AQF A;  3C98 B;  2E5V A;  1XMQ T;  3D0T A;  3AA1 B;  5DAB A;  2W4X A;  5KXJ A;  3FBL A;  3RLF F;  1KK7 A;  4NPP A;  2WS3 A;  3A7M A;  4GYS A;  3EAM A;  2YKS A;  1JNZ A;  3QOF A;  5AQV B;  2V7I A;  4JEU B;  3RHW A;  3ZT6 A;  2X66 A;  2OA5 A;  5ABG A;  3AE4 A;  2WCA A;  5LG3 A;  3CIR A;  4JI2 T;  4PJJ A;  2WY2 A;  4BJN A;  2VKO A;  3RRC A;  2X9Y A;  4DR7 T;  2SPC A;  2LSK A;  5JRC A;  4O4L E;  4YSZ A;  2LKG A;  4X64 T;  5AQI B;  3GN5 B;  2YU1 A;  2VAS A;  5JRE A;  4IE4 A;  3BQI A;  2K48 A;  1KF6 A;  4F6R C;  1VOM A;  4QX7 B;  4YHJ A;  5L4H A;  4TX5 A;  4NUV A;  5FY1 A;  4TWD A;  1XNR T;  2WWU A;  5L3B B;  1Z8U A;  2Q9Q C;  4IDQ A;  2LSG A;  3CK6 A;  5JVD E;  4OFZ A;  3I0O A;  5JDM A;  3UU8 A;  2V26 A;  1MMA A;  2BG9 E;  2EHO A;  4U33 A;  1XDO A;  1BR0 A;  1HNW T;  5FVK A;  4YSY A;  4YTP A;  4AKG A;  3B57 A;  3UU3 A;  3TLV A;  4AKH A;  4M1P A;  4IDZ A;  4N78 D;  4X1K E;  4HFD A;  1YW0 A;  2A2F X;  4O8S A;  2J1D G;  2K9A A;  4UEM A;  2FJB A;  3RRW A;  1T7S A;  1OWA A;  1Z0P A;  4WYV A;  2BBJ A;  5FXZ A;  2ES0 A;  1WFD A;  2X9W A;  4DV6 T;  4B3T T;  4O2B E;  2NW7 A;  4QH1 A;  1J5E T;  3ZC1 A;  3ONX A;  4YXD A;  5AQP B;  5A1L A;  3GWH A;  4Z91 A;  3AED A;  4YT0 A;  2R6G F;  3OBV E;  3AVS A;  3MK7 C;  1XMO T;  2BG9 A;  2IML A;  5BR8 T;  4ZHQ E;  1W0B A;  1XZY A;  1OXZ A;  3BQK A;  4CN4 A;  2V7J A;  4ZEY A;  4ASK A;  5LB7 B;  3Q9D A;  3U3I A;  3RKO A;  3CX7 B;  4LFA T;  4HGA A;  4AI6 A;  2LT3 A;  3RI5 A;  2WU5 A;  5AQM B;  4EYY R;  1OED E;  4ILA A;  3ZST A;  3QB5 K;  3UUL A;  2UXN B;  3LBX B;  4FI5 A;  4X5T A;  4AXP A;  5HCM A;  3AEG A;  2EHO D;  5HCJ A;  1N33 T;  3QNU A;  2XAS B;  5J1G A;  5F8P A;  2KWH A;  3N9M A;  3VU7 H;  3ZJ2 A;  5C3J A;  1SA0 E;  5LG4 A;  3EHZ A;  4TNV A;  3KVA A;  2D9D A;  3WI3 A;  3GA8 A;  3AB3 B;  3KV4 A;  3UUN A;  2HH7 A;  3FHN A;  3L3P A;  4IL9 A;  3UUX B;  2KT9 A;  2V8S V;  3SWH A;  4UVA B;  4X65 T;  1OED C;  4JEH B;  3TLW A;  3O4X E;  4ZOL E;  3T1H T;  1MND A;  3FZM B;  4ZS2 A;  2B1E A;  3PUS A;  2LSJ A;  2VQE T;  2NW9 A;  1D1B A;  2DWK A;  2VL0 A;  4U3C A;  2H89 A;  4NUU A;  2BVL A;  5M4Y A;  2L9Q A;  3CX8 B;  3VR9 A;  4EEB A;  4EIW A;  2G0U A;  2XQ5 A;  3TLS A;  3N9P A;  3E22 E;  4CI3 B;  4L9I A;  2N2N A;  2KLQ A;  2V1D B;  3RF1 A;  1UCU A;  4IE0 A;  1T98 A;  1H7C A;  3O1I A;  4JYA T;  4JBW F;  3S4U A;  5HXE A;  5LJN A;  2LOP A;  2CRB A;  2E9X B;  2X0H A;  4BJM A;  4XBF B;  4DR4 T;  2ACZ A;  2N1G A;  5HYA A;  3ANW B;  5JQG E;  2OLT A;  5J2T E;  5HAX A;  2J62 A;  2D5U A;  1Y64 B;  3L09 A;  1ZP0 A;  2BBH A;  2JPF A;  3OYX A;  1MNE A;  3GN5 A;  3N2K E;  4C90 A;  3AA0 B;  4LFC T;  4B6X A;  5AQR B;  3PDY A;  2LM9 A;  4B3M T;  3JAF A;  5KMG P;  1FIO A;  4EGW A;  2BS2 A;  4ILU A;  4AQG A;  3AEE A;  2QA7 A;  2JMK A;  1DU2 A;  4P1N A;  3AEC A;  2XJ7 A;  2I0M A;  2YEV C;  1T72 A;  3O9X A;  2LHR A;  2CXD A;  2XQ3 A;  2AXD S;  4I50 E;  5LGN B;  1CUN A;  3PJA A;  2BDE A;  2ZM0 A;  5LHI B;  5JDQ A;  1W09 A;  4J2C A;  2C5J A;  1HX8 A;  4HFH A;  4EZH A;  2XZE A;  4HWD A;  2Q9Q B;  2CE7 A;  4IDP A;  5JR9 C;  5DQV A;  2LRK A;  4E7S A;  2XHE B;  2Y48 B;  5DJQ C;  2L8K A;  3J7Y q;  2CXF A;  1E2A A;  2CLY C;  5LMN T;  4AKR B;  2M6I A;  5GON E;  4GOU A;  4OHF A;  4U72 A;  5HEH A;  3PU3 A;  3PUA A;  2NOX A;  3ZYK A;  2NW8 A;  1HCI A;  2X51 A;  3H3M A;  3KDS E;  2NTX A;  3E0Z A;  2WDR A;  1ZEE A;  3A5X A;  3AEF A;  3RYF E;  4EED A;  3ETU A;  4GKK T;  1LVK A;  4G63 A;  2W2U A;  4DV7 T;  5CGM A;  1IAP A;  3CPZ A;  3KFW X;  4AIU A;  3N9L A;  2ACX A;  4UV8 B;  2L3L A;  3LBX A;  4XZC A;  5L3E B;  4LF7 T;  2CBJ A;  4WNK A;  5JDG A;  3G06 A;  2W61 A;  4OYK A;  4EZ4 A;  3RQW A;  4L0R A;  4JI0 T;  2XQ9 A;  4TV8 E;  4UEL A;  2WZH A;  1O3X A;  3ONJ A;  2LSI A;  4C91 A;  5FYM A;  4HFB A;  3F57 A;  2IDO B;  3I9W A;  3N5L A;  5ETW A;  1MMN A;  2CCQ A;  2MYS A;  4HWF A;  4MAL A;  4DV1 T;  4PK5 A;  4A5X A;  4HE8 A;  4DR3 T;  4ADZ A;  4QX8 B;  3B13 A;  4IHJ E;  4DR5 T;  5AQS B;  4NXM T;  3O1H A;  5LA6 E;  4O2A E;  5AQO B;  5JDL A;  4IST A;  2XAJ B;  3Q5D A;  2UUA T;  2XTL A;  3AE2 A;  4PAG A;  4K0U A;  1FJG T;  5HWX A;  2Y6X A;  4O4J E;  4OX9 T;  2VB6 A;  3ZC0 A;  5IUX A;  5LBQ B;  3C4Z A;  2LLY A;  2LRL A;  2KND A;  1I94 T;  3RQU A;  2HHH T;  2E9X A;  2M67 A;  2YDR A;  2ODU A;  1IBK T;  1BR1 A;  3WAJ A;  3ZSS A;  5CB4 E;  3ANW A;  3OVU A;  3DP7 A;  3TKL B;  1NEK A;  3LSV A;  4PFO A;  3UUM A;  3RYI E;  3IF8 B;  5FY0 A;  2XAH B;  1Y01 A;  5EK4 A;  1SHZ C;  3N9Q A;  4HFE A;  2NR4 A;  2DWG A;  4X66 T;  4QWN B;  1XDP A;  3HKB E;  3EUH A;  3ZMU B;  1FMW A;  3EI0 A;  2UXC T;  1QLB A;  4TN7 B;  3N9O A;  5CFB A;  1JNR A;  1V9D A;  2VVS A;  1HFA A;  4HFV A;  3B5M A;  1U4Q A;  2V5D A;  1WR0 A;  4H63 H;  4YTN A;  3M3Z B;  4H9O C;  1KNZ A;  1XNQ T;  1YKH B;  4LF4 T;  5LJM A;  2YK0 A;  3W15 B;  1S94 A;  3IBP A;  2X0Y A;  4IIJ E;  3AE3 A;  1YKE B;  5AQL B;  3UFE A;  3UUB A;  4QXH B;  4O4H E;  3L39 A;  3ZN1 B;  3NVO A;  3LK4 2;  3PUR A;  2XAQ B;  2BVM A;  1WRD A;  2Q9Q A;  2HPJ A;  1ZHC A;  2W63 A;  5JTG A;  4H9N C;  1WLX A;  2AE9 A;  1KNP A;  1MMD A;  2JQK A;  4CXW A;  2V7M A;  3IHR A;  3FBZ A;  4IE5 A;  2IC6 A;  2KXP B;  1WCR A;  2E9X D;  2VUR A;  5L2L A;  2X9H A;  2BG9 C;  3VRA A;  4HWC A;  3VKG A;  2VKJ A;  4PNI A;  2UU9 T;  3P4Q A;  2UUC T;  2VWA A;  4BAY B;  1ZKE A;  5JR9 B;  4U31 A;  2ZMA A;  4FJO A;  1HG5 A;  4GK0 E;  5LOV E;  1ZOY A;  2WSS V;  3P50 A;  1LRZ A;  3QC9 A;  5EK2 A;  3PU8 A;  2JQH A;  4DR6 T;  3I9Y A;  1UGO A;  4TWH A;  4AKL A;  2YIN A;  4H9R C;  4UVC B;  2XQA A;  4LML A;  5LXT E;  5FNV E;  3U78 A;  3LG7 A;  3RIA A;  3HA4 A;  4A97 A;  4JI3 T;  2N9D A;  4YJ2 E;  4DUZ T;  5HWY A;  4IRE A;  2JQQ A;  1YQ3 A;  5BMV E;  2X9X A;  4I0U A;  4ISS A;  5IWA T;  3AAI A;  4PJM A;  2BKO A;  3ZYM A;  4X1Y E;  2CPT A;  4JI8 T;  1M7K A;  2C0S A;  4B3R T;  2D0U A;  1KFY A;  2WP9 A;  4HFI A;  3J9X 1;  4ZS3 A;  3SS1 A;  4U7I A;  2BZB A;  4TNW A;  3I0Q A;  1R8I A;  4IL4 A;  2XPK A;  5H6R B;  2WZI A;  4CN6 A;  5ADX L;  3AE7 A;  2WQY A;  3MJX A;  4DND A;  2WU2 A;  3NKZ A;  4L5G A;  3LDQ B;  2QGS A;  2V5C A;  2YN6 A;  4G2A A;  3VHL A;  3RX6 A;  3NRY A;  3NRX A;  5H6Q B;  2YOE A;  4IDN A;  2DI4 A;  3ZKR A;  2VK9 A;  2C5K T;  3O1J A;  3K3O A;  4KHP T;  2RPA A;  4V1A v;  2CWY A;  3UTK A;  3JC6 C;  4TV9 E;  3CQG B;  3NBX X;  1G8X A;  4DVD A;  2Y8D A;  5F5W A;  2WAU A;  2NWB A;  4P09 A;  2BS4 A;  1FEW A;  4MHC A;  2C5I T;  3SFD A;  4QHO A;  4O4I E;  5AQJ B;  1SUM B;  4JI6 T;  1VCS A;  4YY3 T;  2D0T A;  3K8P C;  1MMG A;  2VKD A;  4ILC A;  1B7T A;  3P4R A;  2P9B A;  3FB2 A;  5JDF A;  3QK6 A;  4ZI7 E;  4H9Q C;  2WWV A;  4WBO A;  2XAF B;  1E7P A;  4YHH T;  1T8B A;  3NZP A;  2YU2 A;  5EZY E;  2KZ7 B;  1IBM T;  5HEO A;  1IZN B;  5LP6 E;  1HNX T;  3PUW F;  1J5W A;  3ZN0 B;  4MLK A;  2X67 A;  2Z6E A;  2XQ6 A;  5L4E A;  3V5S A;  3PUZ F;  5HEU A;  2H88 A;  4U2Z A;  5HEJ A;  5L3C B;  2FBW A;  2M6B A;  2W0G A;  4ANJ A;  2UXB T;  4EV6 A;  2J47 A;  3P4W A;  4U7Y A;  1UUR A;  5AQF B;  3HKE E;  4Q25 A;  3C64 A;  3V5U A;  3PTR B;  3EDV A;  5ABE A;  4CI2 B;  4DUY T;  3AVR A;  2VKH A;  2KWI B;  2WM9 A;  1WYB A;  4PJL A;  3RIU C;  4HWH A;  4ZZC A;  3CKD A;  2W62 A;  4DBR A;  3ETV A;  3FZH B;  3CVR A;  2LHN A;  3PUV F;  5DQW A;  3SOL A;  4HFC A;  5L47 A;  4Z90 A;  1WR6 A;  1I6Z A;  4KX6 A;  1CHU A;  3AA6 B;  3OPC A;  5J0Z A;  5TAO A;  2A9U A;  2CWO A;  4UVB B;  3KIN B;  5LGU B;  3AE9 A;  2ODV A;  1HF8 A;  2UXX B;  5AQK B;  3RH3 A;  1L0V A;  3FZF B;  5ABF B;  4CQI A;  2H3R A;  2IAK A;  3K1S A;  4QKN A;  5JR9 A;  4TZ4 C;  2LJL A;  2PTF A;  4HTE A;  4ERR A;  2K3W A;  4ZI3 D;  2LM2 A;  3C4X A;  2XSB A;  3FXE B;  2BG9 B;  4B3S T;  2IIU A;  2HN2 A;  3EDU A;  3AEA A;  5HXR A;  4U74 A;  1X79 A;  4EB6 E;  3VRB A;  5JH7 E;  5AQN B;  1NAF A;  1HR0 T;  2FJD A;  5FP3 A;  4KMC A;  3QB5 A;  4GK5 E;  3F2E A;  4NXN T;  2IC9 A;  1IBL T;  4H9S E;  2VQF T;  3PE0 A;  3L8R A;  3KV5 A;  4JI1 T;  3Q5X A;  4JLE A;  2V7L A;  3BQL A;  4YSX A;  3RGL A;  5FY7 A;  2JIW A;  5AQH B;  4YJ3 E;  2BKP A;  3LK3 B;  3MKD A;  4IT4 A;  4LF6 T;  4IE6 A;  4ZXL A;  2IW5 B;  1N36 T;  2LEH A;  2E8I A;  3HI2 A;  4GKJ T;  1W9R A;  3IA3 A;  2CBI A;  5JDN A;  3Q5E A;  3P4S A;  2JQ9 A;  2W67 A;  4I43 B;  4AQF C;  3AAA B;  4CXX A;  1IJ6 A;  1UK5 A;  1YD8 G;  5LMU T;  3M65 A;  5FXW A;  2H7O A;  1U5P A;  3A8Y C;  2LKH A;  3UU4 A;  3KV6 A;  1AJ3 A;  4A98 A;  3P4P A;  4IE7 A;  2F4V T;  1OED B;  2XM2 A;  5KX5 E;  2W66 A;  3N2G E;  1KEY A;  2FUP A;  3UQ4 A;  3AE6 A;  3BK9 A;  4CN1 A;  5FMN A;  5FXV A;  3H3A A;  3JAD A;  3CWZ B;  3RYC E;  4ZI2 D;  4LF8 T;  2CMR A;  2JJ9 A;  2QVA A;  2CHN A;  3OYZ A;  2H7V C;  2GK9 A;  2J4G A;  4QH5 A;  5HXH A;  1LKX A;  2X0L B;  3X1D A;  1HNZ T;  1US7 B;  2D2S A;  1NEN A;  1G73 A;  3TLT A;  4YLH A;  1ZV4 X;  2CM0 A;  3DTO A;  1X9B A;  3R84 B;  4IGU A;  4DV3 T;  4IDO A;  1D0X A;  2EHO C;  2YDS A;  3ZMZ B;  2HPL A;  3C50 A;  2WBL A;  3SFE A;  3FZK B;  4AIS A;  1BR2 A;  2LE8 A;  3ZPO A;  2V6X A;  4DR1 T;  4EYU A;  1MIY A;  4KBM B;  2X68 A;  4WZX A;  4KP3 C;  4Z8X A;  2V7K A;  2JMH A;  1HS7 A;  2XUE A;  3MAC A;  3WAK A;  1BR4 A;  2DNX A;  2VL8 A;  2XQ7 A;  1N32 T;  2WMN A;  1YXR A;  3PUG A;  1S35 A;  5LHG B;  4UXN B;  3ZMV B;  3EVY A;  3AA7 B;  4HEA A;  2CEA A;  3NWI A;  2QYW A;  4AKI A;  4ZZB A;  4X20 E;  4XAX B;  4JUY A;  3HKD E;  3RC8 A;  1HTJ F;  3K3Q C;  3OKQ A;  2XM1 A;  2FJE A;  2OV9 A;  3PUQ A;  3F31 A;  4YFS A;  5L3G B;  2FJA A;  5ABF A;  4CZZ B;  1M62 A;  3FZL B;  4ILB A;  1LVF A;  3H37 A;  3VKH A;  4KI0 F;  3RC3 A;  2CLY B;  2LSY A;  4X62 T;  3FXD B;  5C8Y E;  2KIN B;  4JI5 T;  3AAE B;  2HN1 A;  4K0K T;  3CML A;  2CHO A;  3R6N A;  5LNK A;  4UF0 B;  2DHR A;  2IHR 1;  4PJN A;  1XWM A;  2KSR A;  5ABH A;  2MAW A;  3TLU A;  4JI4 T;  5IHY A;  2PG8 A;  5L3D B;  3GMI A;  4QXB B;  5LYJ E;  3PJA J;  4DMW A;  2MTQ A;  4COF A;  2Q9Q D;  2WDQ A;  2K24 A;  2I59 A;  3OJA A;  5FXX A;  4UV9 B;  4KHZ F;  4AQY T;  2JRK A;  4DBQ A;  3SRZ A;  5LGT B;  4JI7 T;  4I4T E;  2K5B B;  2XQ8 A;  1UX5 A;  4EOZ B;  1FMV A;  2BS3 A;  5HXC A;  4UIG A;  4DV0 T;  2V6Y B;  2UUB T;  4X1I E;  4CI1 B;  5AQT B;  3N9N A;  1GQE A;  4LMJ A;  4H9P C;  5LCY A;  1W0A A;  2ZM8 A;  4P0B A;  2CXL A;  5AQU B;  3AXJ B;  4NIQ A;  1OED A;  3DJB A;  4OYJ A;  2B76 A;  2XQ4 A;  5AFU L;  3MZK B;  1SE7 A;  1KNR A;  4DO0 A;  3UQ7 A;  3HKC E;  2PBI A;  3OTO T;  5HEG A;  2MBG A;  2MPK A;  4U2Y A;  5F3J A;  5CA1 E;  3PV0 F;  5CJ5 A;  3ZJ1 A;  3ABV A;  4PK4 A;  5CA0 E;  1D1A A;  2DL1 A;  3E08 A;  3UT5 E;  4EAH A;  3RIF A;  5E0O A;  4HKA A;  4YTM A;  4PFP A;  3UU6 A;  4ZI3 C;  3ZLI A;  3C51 A;  3CX6 B;  2E2A A;  2PJQ A;  5FL0 A;  4WBN E;  5JRC B;  2W00 A;  3N2O A;  2XQY A;  3AE5 A;  4CXY A;  4LFB T;  3HR0 A;  4H63 V;  3P7I A;  4DID B;  2DCF A;  3UU5 A;  3KV9 A;  2VVN A;  1UX4 A;  5IYZ E;  3CQX C;  2ZM2 A;  5C2T A;  3Q5W A;  3Q2M A;  3KBU A;  3ZMS B;  2YDQ A;  3T8O A;  3JCF A;  2EHO B;  5AQQ B;  4EXT A;  3NZQ A;  3ONL C;  2CA5 A;  1D1C A;  3CQC B;  3KVB A;  5JDH A;  2WMO A;  3MXZ A;  2E5L T;  1IJ5 A;  1UUS A;  1D0Z A;  4F8H A;  4TWF A;  2QRX A;  3ZYL A;  1E1H B;  4HWI B;  3ZT5 A;  4E7Z A;  3AEB A;  2XAG B;  2A3D A;  4GIW A;  3ZCJ A;  4DV4 T;  3AE1 A;  3JC6 D;  3LK2 B;  3RIU A;  3AE8 A;  5AQG B;  3QUJ A;  1VCT A;  5FVL A;  4ZI2 C;  3RPU A;  1QSD A;  2DLR A;  1J1J A;  3JAE A;  5HXS A;  2ZM6 T;  4P0A A;  4UR9 A;  2WB5 A;  3PUY F;  3MA9 A;  2MOZ A;  3UFG A;  4DMV A;  1NWM X;  3P8C D;  1QUU A;  4A56 A;  2XY8 B;  4PW8 A;  2IUB A;  3I1A A;  3K3N A;  1MIV A;  3IEE A;  2ZLY A;  1EZ3 A;  5KDM C;  2LOS A;  4UF0 A;  2PFV A;  4JV5 T;  3LFM A;  3ZCI A;  2KMF A;  3ZMT B;  4MFR A;  1HG2 A;  5FKY A;  3T1Y T;  2A72 A;  2NP9 A;  3ESL A;  2RA1 A;  5LBM A;  2RP4 A;  4DV2 T;  3KBT A;  5LHH B;  2BKN A;  1D0Y A;  4OK0 A;  4LMK A;  4QXC B;  3RKG A;  2UXD T;  1WYC A;  3ZT7 A;  4WW0 A;  4BA9 A;  4HN9 A; 
#chains in the Genus database with same CATH homology
 4IDN A;  3QNU A;  1Z8U A;  3Q5E A;  1Y01 A;  3X1D A;  1W0B A;  4IDQ A;  1W0A A;  3Q5D A;  4IDO A;  4IDP A;  3QOF A;  1XZY A;  1W09 A;  3OVU A;  3IA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...