1Z8UA

Crystal structure of oxidized alpha hemoglobin bound to ahsp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
ALLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of oxidized alpha-haemoglobin bound to AHSP reveals a protective mechanism for haem.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
molecule keywords Alpha-hemoglobin stabilizing protein
total genus 33
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1z8uA00
3Q5DA 3X1DA 3OVUA 1W09A 4IDOA 3IA3A 4IDPA 1W0AA 1W0BA 1Y01A 3Q5EA 1Z8UA 3QOFA 3QNUA 4IDNA 1XZYA 4IDQA
chains in the Genus database with same CATH superfamily
5IWAT 1JNZA 4ZS2A 5C2TA 2Y6XA 5FY1A 4B3MT 2CXLA 4I55E 4TWHA 1XNRT 4JYAT 4XAXB 2WDRA 5JREA 2D0UA 3CIRA 4NUUA 1S94A 5L47A 3VKGA 1E1HB 2L3LA 2OV9A 2YK0A 3AE1A 2MBGA 2CRBA 4CXWA 3BQIA 5AQMB 3B5MA 1BR0A 3KVAA 4DNDA 1OEDE 4H63V 1XZYA 5FMNA 1UCUA 3N9OA 3RIUC 4CN1A 5ABFB 4YY3T 4DR5T 3ZT6A 5CJ5A 1YQ3A 4HWDA 1HNXT 3SOLA 2CBJA 3CMLA 4LF7T 1R8IA 2I6HA 2YEVC 5AQJB 1UGOA 1EZ3A 3N2OA 3PE0A 4CN6A 3S4UA 1UUSA 5CFBA 4LFCT 2XASB 3GWHA 3LG7A 2BKOA 5IHYA 4O2AE 4ILBA 2BG9C 4QKNA 4TZ4C 3W15B 2JQKA 3RC3A 4DBQA 2V8SV 2WB5A 3ZCIA 2W62A 1US7B 4IE0A 3GN5B 5AQLB 3U3IA 4IT4A 3WI3A 2ZM0A 4AISA 3EI0A 4FJOA 4EGWA 1IZNB 4AXPA 2D2SA 2VURA 1LVFA 4ANJA 3OJAA 3UUNA 2Y8DA 4JUYA 2FBWA 5ETWA 5LXTE 1FJGT 5KDMC 3RYIE 3RYFE 4DV4T 2VASA 4V1Av 4X65T 3EUHA 2H89A 5DQWA 4LFBT 1HFAA 2XAFB 3LK2B 4IE5A 4U7IA 4LF4T 4XBFB 3UUXB 4HFHA 5LHIB 1T8BA 1D1BA 2WM9A 4I43B 3LBXA 1ZV4X 3ZT5A 2RP4A 1FIOA 3ZT7A 3P4QA 5J0ZA 3OBVE 5LMNT 3FB2A 1HCIA 3RIAA 3AE5A 1IJ6A 4B3TT 4PJLA 3ESLA 1KEYA 1NEKA 4KBMB 2KLQA 4U33A 1ZKEA 3HKBE 4PW8A 2UXCT 1MMDA 1L0VA 2WBLA 4DV5T 3IEEA 1QLBA 3R6NA 2LM2A 1N36T 4HEAA 2AE9A 5JR9B 2W00A 2Q9QB 5LBMA 3RC8A 3I9YA 1AJ3A 3AXJB 4JI5T 4O4LE 2LSGA 4ZOLE 3TLUA 2EHOC 3AEFA 4AKLA 3WAJA 2XPKA 3P50A 4AKGA 4JI6T 5J2UE 2JIWA 3JAFA 1UURA 3BQKA 4FI5A 4HWHA 4EEDA 2H7OA 5HWXA 5JTGA 1V9DA 2BDEA 4PJJA 3LSVA 3O1IA 4NXMT 2M6IA 2V7KA 2W66A 3FZKB 2X68A 3Q5DA 3F2EA 2E5LT 2JQHA 3PJAJ 4EZHA 2D0TA 1WR0A 4C90A 2NTXA 3AE3A 4ZS3A 2XY8B 3PUZF 2VKDA 2PFVA 1YKHB 2X67A 3F31A 4I4TE 5FNVE 3V5UA 2DI4A 4JLEA 3ZEFB 5BR8T 1YW0A 1SA0E 4ZI3C 2BZBA 3AA7B 3J7Yq 5L3BB 3NWIA 3RGLA 3ZYMA 1MIYA 3VRAA 3PUSA 3OYZA 1HX1B 2J47A 2MAWA 4X20E 5HEGA 3I0QA 3AE7A 2Q9QA 4A97A 4EB6E 3QNUA 3FHNA 2L8KA 2M67A 4I50E 4YJ2E 1O3XA 2C0SA 3T1YT 4QXBB 1ZEEA 2KWHA 2LJLA 3FZMB 4K0UA 3K3NA 1B7TA 5FXZA 3A5XA 4UXNB 2KXPB 4LMLA 2NW9A 3HKEE 4EIWA 5AQRB 4K0KT 4OHFA 2KSRA 2IMLA 2XJ7A 4OFZA 2LE8A 2CA5A 3UT5E 2Q9QD 3ZYKA 1Z8UA 4A5XA 2NW7A 2HPLA 3B13A 3FXEB 3BK9A 4YT0A 2LSIA 2XSAA 3ZLIA 3RPUA 4NUVA 5F3JA 3UQ7A 4DV0T 2ES0A 4UVBB 3RIFA 4WYVA 2J62A 4LFAT 1IJ5A 2D9DA 2IHR1 3P7IA 5HXRA 1KFYA 2BVMA 4DR1T 1N34T 4JI1T 1XDPA 3HL6A 3J9X1 5KX5E 1CHUA 5M4YA 3VHLA 2LSJA 3ZN0B 2UU9T 3LK3B 3ETVA 4QH4A 4WZXA 2E9XA 1Y01A 2ACXA 1MNEA 5LNKA 2QYWA 2BVLA 1U5PA 2HHHT 3EAMA 3IBPA 5ABEA 4X66T 4GYRA 5AQGB 4PJMA 2CHNA 5FYMA 4EYUA 1OWAA 1T72A 3GN5A 5HXEA 2IIUA 4IDZA 4H9NC 4WNKA 4HFEA 4EV6A 2KINB 3LFMA 3C64A 1HX8A 3AAAB 3MA9A 3CX6B 5HEOA 2A3DA 3RF1A 4PNIA 3N9QA 3RX6A 4A56A 4E7SA 5LCYA 3UU4A 1QSDA 1FEWA 1G8XA 2CCQA 2XAQB 1GQEA 1M62A 3AEAA 4YHJA 3RRWA 5CGMA 4OX9T 2UXBT 2C5KT 5HXHA 4DV6T 3C51A 1S35A 4MFRA 5HCMA 3IA3A 2LOSA 2FJEA 1BR1A 4CN4A 1UX5A 2XQ7A 5JDNA 4DV1T 4DR2T 2A72A 2DL1A 5AQIB 3RI5A 1E2AA 3C98B 4E7ZA 2XM2A 2IC6A 3P4PA 4HFBA 1XWMA 2KZ7B 4WW0A 3UTKA 1HS7A 2HN2A 3FZHB 3N9LA 4PK5A 4X5TA 5FY7A 2YDRA 4MHCA 4DUZT 3I1AA 3AE9A 4B6XA 3UU6A 3CX8B 1NENA 3ZMZB 5DQVA 5AQPB 2DNXA 5LGUB 3WAKA 4PFOA 4X1KE 5FXWA 5ABHA 5L3GB 3TLWA 4DR7T 4GKKT 1OEDC 2IAKA 4U31A 2B1EA 2E2AA 4HKAA 4O8SA 2KMFA 3JCFA 1E7PA 2JQ9A 3AE8A 3LK42 3AEBA 3AXJA 3CQCB 5AQSB 5LG4A 3P4SA 1M7KA 5HEUA 4DUYT 4PFPA 3OYXA 3AECA 4OK0A 5L3CB 4JI8T 2XZEA 2J1DG 2WCAA 3VU7H 2PJQA 2V26A 3MJXA 2MYSA 4YTMA 3VR9A 3PUYF 4DV7T 3AEDA 3DJBA 2XQ6A 1U4QA 3L8RA 4B3ST 3V5SA 2BG9E 2DWKA 2XSBA 3L3PA 3ZSTA 1NAFA 2LKHA 4F6RC 5E0OA 5L4EA 2E9XD 5BMVE 2UUAT 1D0ZA 5JQGE 1UX4A 5HCJA 3E22E 2UUBT 3UULA 5JDGA 3PURA 5H6QB 1IBLT 2UXNB 3KV4A 2N1GA 1FMVA 5EK4A 2WU5A 2PTFA 2XQ3A 1LRZA 2V6XA 3F57A 2BG9A 2VKHA 3FBLA 4UELA 5FP3A 5FVKA 3ZKRA 2CLYB 2LHRA 4YXDA 1HTJF 3C4WA 3T8OA 3TLTA 2V5CA 2W2UA 1MNDA 3VKHA 1SHZC 2E8IA 2CMRA 2WSSV 3FXDB 4U72A 3JC6C 2VL8A 4YFSA 5EZYE 3UFGA 5J2TE 4H9SE 2W61A 3PDYA 4HFIA 4U3CA 4MALA 4COFA 4DVDA 2VB6A 1LKXA 4WBNE 2X0LB 1YXRA 3H3MA 2M6BA 3O1HA 3TLVA 3NKZA 3ZC1A 3ZCJA 4GIWA 3KINB 1KNPA 4CI2B 3ZC0A 2ZM8A 2XTLA 3BQLA 3LJCA 4IDPA 3Q5EA 5HXSA 3HKDE 5DJQC 2ODVA 1MIWA 5JRCB 2MOZA 3JADA 3FZFB 4YHHT 4UF0B 3G06A 4YLHA 4ZI3D 5LMUT 2CBIA 5AQHB 5H6RB 4BAYB 3N9NA 5DABA 4AI6A 2QGSA 3CK6A 2YOEA 2V7JA 1HG2A 4IE6A 3ONJA 2BS2A 4IL9A 5JRCA 5L2LA 2XQAA 2WMNA 2YN6A 2EHOD 2W63A 5LBQB 2NOXA 2AXDS 2CLYC 1WYBA 2E9XB 3IHRA 2FJBA 4M1PA 3PTRB 3ONLC 3ETUA 1WLXA 2DWGA 3HKCE 1WYCA 3L39A 3TKLB 2YINA 4OYKA 3PV0F 4UVAB 1HNZT 4LF6T 2H7VC 3CX7B 5F8PA 4CXXA 4ZZCA 5JVDE 2H3RA 4HWFA 4TN7B 4UR9A 4DMWA 2EHOA 4G63A 1NWMX 4X1YE 2VQFT 1D0YA 3DTOA 3UUBA 2X51A 3MACA 4QXCB 2V5DA 3X1DA 2D5UA 3AE2A 4EOZB 4ADZA 5EK2A 2ZLYA 2BBHA 3C4XA 3GA8A 4ASKA 3N2GE 4CI1B 2RA1A 5AQOB 5IYZE 2L9QA 2K5BB 3R84B 3U78A 3OTOT 5AQKB 4IGUA 3RRCA 5L3FB 4U7YA 4IHJE 1LVKA 3AA6B 4YTNA 3NRYA 3SRZA 5FL1A 2UXXB 5LA6E 5JR9A 3T1HT 4Q25A 1XMOT 4TNVA 2UUCT 4QX8B 2ZM6T 3P8CD 1WR6A 2HN1A 4H9RC 3UU5A 2BBJA 3ZSSA 5A1LA 5CA0E 1T98A 5LGNB 1D1CA 2CWYA 5AQUB 2K48A 1UK5A 2LKGA 2W67A 3ANWA 3ZMUB 2VQET 4DIDB 4TV9E 3MKDA 3Q5XA 5KXJA 2XQ5A 3UQ4A 2X9XA 2DLRA 5FY0A 1QUUA 1YD8G 3K3OA 3C4ZA 4IIJE 2XUEA 5AQFB 4GKJT 2KWIB 4GOUA 1J5WA 2EHOB 2OA5A 4O2BE 4DV3T 4KHPT 2LSYA 2YU1A 3PUXF 2XQ8A 4JEUB 5HAXA 5HEHA 4QH1A 4ILCA 4P1NA 1ZHCA 3MK7C 2BS4A 3EHZA 3C50A 2XAGB 3UUMA 3HA4A 4DR3T 2X0HA 2DCFA 2IUBA 3CQXC 3Q5WA 3I0OA 4C91A 4NPPA 4QXHB 1FMWA 2R6GF 4HE8A 1MMNA 5KMGP 1MMAA 2X9WA 4P0BA 1J1JA 2I59A 2VKJA 2W0GA 3AEGA 3LDQB 5HEJA 5JR9C 4GYSA 4ISSA 3O4XE 2WWUA 3EABA 4ISTA 3QB5A 3UFEA 4JEHB 1VRBA 4ZXLA 2XQYA 4EZ4A 1HG5A 2X9HA 4CZZB 2E5VA 4TX5A 2B76A 2XQ9A 4JI2T 3JAEA 4KI0F 4X64T 4BJNA 2CWOA 3QB5K 3RKOA 4CI3B 2LEHA 3CVRA 4AQFC 3OKQA 2JMHA 2WMOA 3NVOA 5C8YE 3N9PA 2XHEB 4EXTA 3M65A 3KV6A 4O4JE 2NR4A 3QK6A 1T7SA 3D0TA 4GK5E 2OLTA 2Z6EA 4MLKA 3ZMVB 3OVUA 3AE6A 3KV9A 4AKHA 3CQGB 3ZPOA 2WS3A 2LT3A 1Y64B 2LHNA 3NZPA 2JMKA 2XQ4A 4GK0E 4F8HA 4JV5T 2LSKA 2YDQA 2LRKA 3QUJA 4BJMA 1N32T 2WAUA 3FZLB 3MXZA 1VOMA 2V6YB 2W4XA 1I94T 4AQYT 4L0RA 2IDOB 3A7MA 2YKSA 3AVSA 3OPCA 4IREA 5LB7B 2X66A 4J2CA 5LG3A 5LYJE 4ZHQE 1IBMT 2MPKA 2WDVA 2ZMAA 4H63H 1VCTA 2CXFA 2QVAA 2YU2A 3RQWA 5JDLA 4DV2T 4QX7B 4CQIA 3AVRA 4X62T 2J4GA 1XNQT 2CPTA 5JDQA 4XZCA 5JDFA 2LM9A 1I6ZA 1D0XA 2V6YA 2VWAA 3AA1B 3KBTA 2WZHA 3KDSE 3P4RA 2ZM2A 3EVYA 3Q9DA 3AEEA 4H9PC 2HPJA 3L09A 3RHWA 3N2KE 1W0BA 1YQ4A 3JC6D 4BA9A 2BKPA 2ODUA 2BS3A 3FBZA 2CEAA 3IF8B 1MMGA 3E08A 5FVLA 1KNZA 3VR8A 3RYCE 3PJAA 3ZJ2A 2C5JA 3PUAA 4L5GA 2WY2A 1WCRA 3RIUA 2X0YA 3UU8A 4AIUA 5CA1E 3HI2A 1DU2A 5LP6E 4HFCA 4ZEYA 3K1SA 5IUXA 4PK4A 5ABGA 4IDOA 3ZN1B 4ZI2D 3O9XA 3UU3A 2WWVA 2NP9A 2V1DB 4JI3T 4N78D 2Y48B 3SS1A 4ILAA 4LF5T 4HFDA 2CHOA 3MZKB 4I0UA 1H7CA 2NTYA 3ZYLA 5JH7E 2G0UA 1ZP0A 1G73A 3NBXX 4X1IE 2K24A 4IE7A 5FKYA 5GONE 4ZI2C 2V7LA 3H3AA 4HTEA 2X9YA 2VK9A 2DHRA 5AQTB 1X79A 2QA7A 2VVNA 2CXDA 5AFUL 4IDNA 2KNDA 4UVCB 3SFEA 1J5ET 4O4HE 4H9OC 3ZMTB 2RPAA 2YDSA 2GK9A 1KF6A 2VKOA 2H88A 3A8YC 4HFVA 1W9RA 3DP7A 4CXYA 4IE4A 3ANWB 3AE4A 4PAGA 5LOVE 1SE7A 2A9UA 4QWNB 3AB3B 2N2NA 3KVBA 4Z8XA 4DR4T 3Q2MA 2QRXA 4JI0T 4HWCA 4JI7T 1W0AA 3GMIA 4YSZA 3QOFA 1OXZA 4KP3C 2UXDT 2F4VT 5LHGB 1IAPA 2JQQA 2E9XC 1N33T 2CE7A 5FXVA 4Z91A 1KNRA 3NRXA 2PBIA 3CPZA 1HR0T 1X9BA 4JI4T 2LRLA 4DO0A 1XMQT 4G2AA 5LHHB 3CWZB 2Q9QC 3PU8A 4AKIA 2WQYA 2WZIA 2N9DA 4TUYE 2V7IA 2FJDA 4YJ3E 2CM0A 1MIVA 3I9WA 1CUNA 3ZJ1A 4O4IE 4A98A 3RYHE 1IBKT 3M3ZB 4ILUA 4WBOA 2VL0A 3O1JA 5L4HA 4ZZBA 5LJNA 4LF9T 1HNWT 3K3QC 2MTQA 5AQQB 2HH7A 3ABVA 3NZQA 4YSYA 1D1AA 3PUVF 2JRKA 5FXXA 2V7MA 4UV8B 3KV5A 3PU3A 4Z90A 3AAEB 3EDUA 5FL0A 3RH3A 2IW5B 1BR2A 3ZMSB 4U2ZA 5LJMA 5JDMA 5J1GA 3RKGA 2KT9A 4AQGA 3SWHA 4UIGA 3PUWF 3QC9A 3AA0B 4EEBA 3LBXB 2WU2A 4L9IA 5TAOA 5L3EB 2ACZA 4ZI7E 2FJAA 4PJNA 3P4WA 1VCSA 4KMCA 2XAHB 2LOPA 5ABFA 4UF0A 3VRBA 4ERRA 1WFDA 2LLYA 4YSXA 2I0MA 2NWBA 2K3WA 4DMVA 2C5IT 4H9QC 3HR0A 4P0AA 2VVSA 2XAJB 1JNRA 2FUPA 4NIQA 1SUMB 4YTPA 1Z0PA 1XDOA 3PUQA 4U74A 2WP9A 1W09A 3RLFF 4TWFA 3E0ZA 4HGAA 1OEDB 4HWIB 4TV8E 2BKNA 3CKDA 5AQVB 3K8PC 4IL4A 2NW8A 5L3DB 3N5LA 5HYAA 3N9MA 1YKEB 3ONXA 4P09A 3H37A 4AKRB 2A2FX 3TLSA 4AQFA 4KX6A 2JPFA 4QH5A 5HXCA 4TNWA 3KFWX 3PUGA 4HN9A 3AAIA 2XM1A 4IDQA 5EK3A 5JDHA 4B3RT 3RQUA 2K9AA 2IC9A 2JJ9A 2P9BA 3EDVA 4LMJA 5LGTB 5C3JA 4KUMB 1HF8A 4TWDA 5F5WA 5HWYA 2PG8A 1WRDA 1KK7A 1ZOYA 1BR4A 4UEMA 4LF8T 4EAHA 4DBRA 2SPCA 4DR6T 4LMKA 5ADXL 4OYJA 4QHOA 2BG9B 4NXNT 5AQNB 4PK6A 4EYYR 3KBUA 4UV9B 4KHZF 4JBWF 4U2YA 2WDQA 3SFDA 4MBQA 5CB4E 1OEDA 3B57A
chains in the Genus database with same CATH topology
3Q5DA 3X1DA 3OVUA 1W09A 4IDOA 3IA3A 4IDPA 1W0AA 1W0BA 1Y01A 3Q5EA 1Z8UA 3QOFA 3QNUA 4IDNA 1XZYA 4IDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5D A;  3X1D A;  3OVU A;  1W09 A;  4IDO A;  3IA3 A;  4IDP A;  1W0A A;  1W0B A;  1Y01 A;  3Q5E A;  1Z8U A;  3QOF A;  3QNU A;  4IDN A;  1XZY A;  4IDQ A; 
#chains in the Genus database with same CATH topology
 5IWA T;  1JNZ A;  4ZS2 A;  5C2T A;  2Y6X A;  5FY1 A;  4B3M T;  2CXL A;  4I55 E;  4TWH A;  1XNR T;  4JYA T;  4XAX B;  2WDR A;  5JRE A;  2D0U A;  3CIR A;  4NUU A;  1S94 A;  5L47 A;  3VKG A;  1E1H B;  2L3L A;  2OV9 A;  2YK0 A;  3AE1 A;  2MBG A;  2CRB A;  4CXW A;  3BQI A;  5AQM B;  3B5M A;  1BR0 A;  3KVA A;  4DND A;  1OED E;  4H63 V;  1XZY A;  5FMN A;  1UCU A;  3N9O A;  3RIU C;  4CN1 A;  5ABF B;  4YY3 T;  4DR5 T;  3ZT6 A;  5CJ5 A;  1YQ3 A;  4HWD A;  1HNX T;  3SOL A;  2CBJ A;  3CML A;  4LF7 T;  1R8I A;  2I6H A;  2YEV C;  5AQJ B;  1UGO A;  1EZ3 A;  3N2O A;  3PE0 A;  4CN6 A;  3S4U A;  1UUS A;  5CFB A;  4LFC T;  2XAS B;  3GWH A;  3LG7 A;  2BKO A;  5IHY A;  4O2A E;  4ILB A;  2BG9 C;  4QKN A;  4TZ4 C;  3W15 B;  2JQK A;  3RC3 A;  4DBQ A;  2V8S V;  2WB5 A;  3ZCI A;  2W62 A;  1US7 B;  4IE0 A;  3GN5 B;  5AQL B;  3U3I A;  4IT4 A;  3WI3 A;  2ZM0 A;  4AIS A;  3EI0 A;  4FJO A;  4EGW A;  1IZN B;  4AXP A;  2D2S A;  2VUR A;  1LVF A;  4ANJ A;  3OJA A;  3UUN A;  2Y8D A;  4JUY A;  2FBW A;  5ETW A;  5LXT E;  1FJG T;  5KDM C;  3RYI E;  3RYF E;  4DV4 T;  2VAS A;  4V1A v;  4X65 T;  3EUH A;  2H89 A;  5DQW A;  4LFB T;  1HFA A;  2XAF B;  3LK2 B;  4IE5 A;  4U7I A;  4LF4 T;  4XBF B;  3UUX B;  4HFH A;  5LHI B;  1T8B A;  1D1B A;  2WM9 A;  4I43 B;  3LBX A;  1ZV4 X;  3ZT5 A;  2RP4 A;  1FIO A;  3ZT7 A;  3P4Q A;  5J0Z A;  3OBV E;  5LMN T;  3FB2 A;  1HCI A;  3RIA A;  3AE5 A;  1IJ6 A;  4B3T T;  4PJL A;  3ESL A;  1KEY A;  1NEK A;  4KBM B;  2KLQ A;  4U33 A;  1ZKE A;  3HKB E;  4PW8 A;  2UXC T;  1MMD A;  1L0V A;  2WBL A;  4DV5 T;  3IEE A;  1QLB A;  3R6N A;  2LM2 A;  1N36 T;  4HEA A;  2AE9 A;  5JR9 B;  2W00 A;  2Q9Q B;  5LBM A;  3RC8 A;  3I9Y A;  1AJ3 A;  3AXJ B;  4JI5 T;  4O4L E;  2LSG A;  4ZOL E;  3TLU A;  2EHO C;  3AEF A;  4AKL A;  3WAJ A;  2XPK A;  3P50 A;  4AKG A;  4JI6 T;  5J2U E;  2JIW A;  3JAF A;  1UUR A;  3BQK A;  4FI5 A;  4HWH A;  4EED A;  2H7O A;  5HWX A;  5JTG A;  1V9D A;  2BDE A;  4PJJ A;  3LSV A;  3O1I A;  4NXM T;  2M6I A;  2V7K A;  2W66 A;  3FZK B;  2X68 A;  3Q5D A;  3F2E A;  2E5L T;  2JQH A;  3PJA J;  4EZH A;  2D0T A;  1WR0 A;  4C90 A;  2NTX A;  3AE3 A;  4ZS3 A;  2XY8 B;  3PUZ F;  2VKD A;  2PFV A;  1YKH B;  2X67 A;  3F31 A;  4I4T E;  5FNV E;  3V5U A;  2DI4 A;  4JLE A;  3ZEF B;  5BR8 T;  1YW0 A;  1SA0 E;  4ZI3 C;  2BZB A;  3AA7 B;  3J7Y q;  5L3B B;  3NWI A;  3RGL A;  3ZYM A;  1MIY A;  3VRA A;  3PUS A;  3OYZ A;  1HX1 B;  2J47 A;  2MAW A;  4X20 E;  5HEG A;  3I0Q A;  3AE7 A;  2Q9Q A;  4A97 A;  4EB6 E;  3QNU A;  3FHN A;  2L8K A;  2M67 A;  4I50 E;  4YJ2 E;  1O3X A;  2C0S A;  3T1Y T;  4QXB B;  1ZEE A;  2KWH A;  2LJL A;  3FZM B;  4K0U A;  3K3N A;  1B7T A;  5FXZ A;  3A5X A;  4UXN B;  2KXP B;  4LML A;  2NW9 A;  3HKE E;  4EIW A;  5AQR B;  4K0K T;  4OHF A;  2KSR A;  2IML A;  2XJ7 A;  4OFZ A;  2LE8 A;  2CA5 A;  3UT5 E;  2Q9Q D;  3ZYK A;  1Z8U A;  4A5X A;  2NW7 A;  2HPL A;  3B13 A;  3FXE B;  3BK9 A;  4YT0 A;  2LSI A;  2XSA A;  3ZLI A;  3RPU A;  4NUV A;  5F3J A;  3UQ7 A;  4DV0 T;  2ES0 A;  4UVB B;  3RIF A;  4WYV A;  2J62 A;  4LFA T;  1IJ5 A;  2D9D A;  2IHR 1;  3P7I A;  5HXR A;  1KFY A;  2BVM A;  4DR1 T;  1N34 T;  4JI1 T;  1XDP A;  3HL6 A;  3J9X 1;  5KX5 E;  1CHU A;  5M4Y A;  3VHL A;  2LSJ A;  3ZN0 B;  2UU9 T;  3LK3 B;  3ETV A;  4QH4 A;  4WZX A;  2E9X A;  1Y01 A;  2ACX A;  1MNE A;  5LNK A;  2QYW A;  2BVL A;  1U5P A;  2HHH T;  3EAM A;  3IBP A;  5ABE A;  4X66 T;  4GYR A;  5AQG B;  4PJM A;  2CHN A;  5FYM A;  4EYU A;  1OWA A;  1T72 A;  3GN5 A;  5HXE A;  2IIU A;  4IDZ A;  4H9N C;  4WNK A;  4HFE A;  4EV6 A;  2KIN B;  3LFM A;  3C64 A;  1HX8 A;  3AAA B;  3MA9 A;  3CX6 B;  5HEO A;  2A3D A;  3RF1 A;  4PNI A;  3N9Q A;  3RX6 A;  4A56 A;  4E7S A;  5LCY A;  3UU4 A;  1QSD A;  1FEW A;  1G8X A;  2CCQ A;  2XAQ B;  1GQE A;  1M62 A;  3AEA A;  4YHJ A;  3RRW A;  5CGM A;  4OX9 T;  2UXB T;  2C5K T;  5HXH A;  4DV6 T;  3C51 A;  1S35 A;  4MFR A;  5HCM A;  3IA3 A;  2LOS A;  2FJE A;  1BR1 A;  4CN4 A;  1UX5 A;  2XQ7 A;  5JDN A;  4DV1 T;  4DR2 T;  2A72 A;  2DL1 A;  5AQI B;  3RI5 A;  1E2A A;  3C98 B;  4E7Z A;  2XM2 A;  2IC6 A;  3P4P A;  4HFB A;  1XWM A;  2KZ7 B;  4WW0 A;  3UTK A;  1HS7 A;  2HN2 A;  3FZH B;  3N9L A;  4PK5 A;  4X5T A;  5FY7 A;  2YDR A;  4MHC A;  4DUZ T;  3I1A A;  3AE9 A;  4B6X A;  3UU6 A;  3CX8 B;  1NEN A;  3ZMZ B;  5DQV A;  5AQP B;  2DNX A;  5LGU B;  3WAK A;  4PFO A;  4X1K E;  5FXW A;  5ABH A;  5L3G B;  3TLW A;  4DR7 T;  4GKK T;  1OED C;  2IAK A;  4U31 A;  2B1E A;  2E2A A;  4HKA A;  4O8S A;  2KMF A;  3JCF A;  1E7P A;  2JQ9 A;  3AE8 A;  3LK4 2;  3AEB A;  3AXJ A;  3CQC B;  5AQS B;  5LG4 A;  3P4S A;  1M7K A;  5HEU A;  4DUY T;  4PFP A;  3OYX A;  3AEC A;  4OK0 A;  5L3C B;  4JI8 T;  2XZE A;  2J1D G;  2WCA A;  3VU7 H;  2PJQ A;  2V26 A;  3MJX A;  2MYS A;  4YTM A;  3VR9 A;  3PUY F;  4DV7 T;  3AED A;  3DJB A;  2XQ6 A;  1U4Q A;  3L8R A;  4B3S T;  3V5S A;  2BG9 E;  2DWK A;  2XSB A;  3L3P A;  3ZST A;  1NAF A;  2LKH A;  4F6R C;  5E0O A;  5L4E A;  2E9X D;  5BMV E;  2UUA T;  1D0Z A;  5JQG E;  1UX4 A;  5HCJ A;  3E22 E;  2UUB T;  3UUL A;  5JDG A;  3PUR A;  5H6Q B;  1IBL T;  2UXN B;  3KV4 A;  2N1G A;  1FMV A;  5EK4 A;  2WU5 A;  2PTF A;  2XQ3 A;  1LRZ A;  2V6X A;  3F57 A;  2BG9 A;  2VKH A;  3FBL A;  4UEL A;  5FP3 A;  5FVK A;  3ZKR A;  2CLY B;  2LHR A;  4YXD A;  1HTJ F;  3C4W A;  3T8O A;  3TLT A;  2V5C A;  2W2U A;  1MND A;  3VKH A;  1SHZ C;  2E8I A;  2CMR A;  2WSS V;  3FXD B;  4U72 A;  3JC6 C;  2VL8 A;  4YFS A;  5EZY E;  3UFG A;  5J2T E;  4H9S E;  2W61 A;  3PDY A;  4HFI A;  4U3C A;  4MAL A;  4COF A;  4DVD A;  2VB6 A;  1LKX A;  4WBN E;  2X0L B;  1YXR A;  3H3M A;  2M6B A;  3O1H A;  3TLV A;  3NKZ A;  3ZC1 A;  3ZCJ A;  4GIW A;  3KIN B;  1KNP A;  4CI2 B;  3ZC0 A;  2ZM8 A;  2XTL A;  3BQL A;  3LJC A;  4IDP A;  3Q5E A;  5HXS A;  3HKD E;  5DJQ C;  2ODV A;  1MIW A;  5JRC B;  2MOZ A;  3JAD A;  3FZF B;  4YHH T;  4UF0 B;  3G06 A;  4YLH A;  4ZI3 D;  5LMU T;  2CBI A;  5AQH B;  5H6R B;  4BAY B;  3N9N A;  5DAB A;  4AI6 A;  2QGS A;  3CK6 A;  2YOE A;  2V7J A;  1HG2 A;  4IE6 A;  3ONJ A;  2BS2 A;  4IL9 A;  5JRC A;  5L2L A;  2XQA A;  2WMN A;  2YN6 A;  2EHO D;  2W63 A;  5LBQ B;  2NOX A;  2AXD S;  2CLY C;  1WYB A;  2E9X B;  3IHR A;  2FJB A;  4M1P A;  3PTR B;  3ONL C;  3ETU A;  1WLX A;  2DWG A;  3HKC E;  1WYC A;  3L39 A;  3TKL B;  2YIN A;  4OYK A;  3PV0 F;  4UVA B;  1HNZ T;  4LF6 T;  2H7V C;  3CX7 B;  5F8P A;  4CXX A;  4ZZC A;  5JVD E;  2H3R A;  4HWF A;  4TN7 B;  4UR9 A;  4DMW A;  2EHO A;  4G63 A;  1NWM X;  4X1Y E;  2VQF T;  1D0Y A;  3DTO A;  3UUB A;  2X51 A;  3MAC A;  4QXC B;  2V5D A;  3X1D A;  2D5U A;  3AE2 A;  4EOZ B;  4ADZ A;  5EK2 A;  2ZLY A;  2BBH A;  3C4X A;  3GA8 A;  4ASK A;  3N2G E;  4CI1 B;  2RA1 A;  5AQO B;  5IYZ E;  2L9Q A;  2K5B B;  3R84 B;  3U78 A;  3OTO T;  5AQK B;  4IGU A;  3RRC A;  5L3F B;  4U7Y A;  4IHJ E;  1LVK A;  3AA6 B;  4YTN A;  3NRY A;  3SRZ A;  5FL1 A;  2UXX B;  5LA6 E;  5JR9 A;  3T1H T;  4Q25 A;  1XMO T;  4TNV A;  2UUC T;  4QX8 B;  2ZM6 T;  3P8C D;  1WR6 A;  2HN1 A;  4H9R C;  3UU5 A;  2BBJ A;  3ZSS A;  5A1L A;  5CA0 E;  1T98 A;  5LGN B;  1D1C A;  2CWY A;  5AQU B;  2K48 A;  1UK5 A;  2LKG A;  2W67 A;  3ANW A;  3ZMU B;  2VQE T;  4DID B;  4TV9 E;  3MKD A;  3Q5X A;  5KXJ A;  2XQ5 A;  3UQ4 A;  2X9X A;  2DLR A;  5FY0 A;  1QUU A;  1YD8 G;  3K3O A;  3C4Z A;  4IIJ E;  2XUE A;  5AQF B;  4GKJ T;  2KWI B;  4GOU A;  1J5W A;  2EHO B;  2OA5 A;  4O2B E;  4DV3 T;  4KHP T;  2LSY A;  2YU1 A;  3PUX F;  2XQ8 A;  4JEU B;  5HAX A;  5HEH A;  4QH1 A;  4ILC A;  4P1N A;  1ZHC A;  3MK7 C;  2BS4 A;  3EHZ A;  3C50 A;  2XAG B;  3UUM A;  3HA4 A;  4DR3 T;  2X0H A;  2DCF A;  2IUB A;  3CQX C;  3Q5W A;  3I0O A;  4C91 A;  4NPP A;  4QXH B;  1FMW A;  2R6G F;  4HE8 A;  1MMN A;  5KMG P;  1MMA A;  2X9W A;  4P0B A;  1J1J A;  2I59 A;  2VKJ A;  2W0G A;  3AEG A;  3LDQ B;  5HEJ A;  5JR9 C;  4GYS A;  4ISS A;  3O4X E;  2WWU A;  3EAB A;  4IST A;  3QB5 A;  3UFE A;  4JEH B;  1VRB A;  4ZXL A;  2XQY A;  4EZ4 A;  1HG5 A;  2X9H A;  4CZZ B;  2E5V A;  4TX5 A;  2B76 A;  2XQ9 A;  4JI2 T;  3JAE A;  4KI0 F;  4X64 T;  4BJN A;  2CWO A;  3QB5 K;  3RKO A;  4CI3 B;  2LEH A;  3CVR A;  4AQF C;  3OKQ A;  2JMH A;  2WMO A;  3NVO A;  5C8Y E;  3N9P A;  2XHE B;  4EXT A;  3M65 A;  3KV6 A;  4O4J E;  2NR4 A;  3QK6 A;  1T7S A;  3D0T A;  4GK5 E;  2OLT A;  2Z6E A;  4MLK A;  3ZMV B;  3OVU A;  3AE6 A;  3KV9 A;  4AKH A;  3CQG B;  3ZPO A;  2WS3 A;  2LT3 A;  1Y64 B;  2LHN A;  3NZP A;  2JMK A;  2XQ4 A;  4GK0 E;  4F8H A;  4JV5 T;  2LSK A;  2YDQ A;  2LRK A;  3QUJ A;  4BJM A;  1N32 T;  2WAU A;  3FZL B;  3MXZ A;  1VOM A;  2V6Y B;  2W4X A;  1I94 T;  4AQY T;  4L0R A;  2IDO B;  3A7M A;  2YKS A;  3AVS A;  3OPC A;  4IRE A;  5LB7 B;  2X66 A;  4J2C A;  5LG3 A;  5LYJ E;  4ZHQ E;  1IBM T;  2MPK A;  2WDV A;  2ZMA A;  4H63 H;  1VCT A;  2CXF A;  2QVA A;  2YU2 A;  3RQW A;  5JDL A;  4DV2 T;  4QX7 B;  4CQI A;  3AVR A;  4X62 T;  2J4G A;  1XNQ T;  2CPT A;  5JDQ A;  4XZC A;  5JDF A;  2LM9 A;  1I6Z A;  1D0X A;  2V6Y A;  2VWA A;  3AA1 B;  3KBT A;  2WZH A;  3KDS E;  3P4R A;  2ZM2 A;  3EVY A;  3Q9D A;  3AEE A;  4H9P C;  2HPJ A;  3L09 A;  3RHW A;  3N2K E;  1W0B A;  1YQ4 A;  3JC6 D;  4BA9 A;  2BKP A;  2ODU A;  2BS3 A;  3FBZ A;  2CEA A;  3IF8 B;  1MMG A;  3E08 A;  5FVL A;  1KNZ A;  3VR8 A;  3RYC E;  3PJA A;  3ZJ2 A;  2C5J A;  3PUA A;  4L5G A;  2WY2 A;  1WCR A;  3RIU A;  2X0Y A;  3UU8 A;  4AIU A;  5CA1 E;  3HI2 A;  1DU2 A;  5LP6 E;  4HFC A;  4ZEY A;  3K1S A;  5IUX A;  4PK4 A;  5ABG A;  4IDO A;  3ZN1 B;  4ZI2 D;  3O9X A;  3UU3 A;  2WWV A;  2NP9 A;  2V1D B;  4JI3 T;  4N78 D;  2Y48 B;  3SS1 A;  4ILA A;  4LF5 T;  4HFD A;  2CHO A;  3MZK B;  4I0U A;  1H7C A;  2NTY A;  3ZYL A;  5JH7 E;  2G0U A;  1ZP0 A;  1G73 A;  3NBX X;  4X1I E;  2K24 A;  4IE7 A;  5FKY A;  5GON E;  4ZI2 C;  2V7L A;  3H3A A;  4HTE A;  2X9Y A;  2VK9 A;  2DHR A;  5AQT B;  1X79 A;  2QA7 A;  2VVN A;  2CXD A;  5AFU L;  4IDN A;  2KND A;  4UVC B;  3SFE A;  1J5E T;  4O4H E;  4H9O C;  3ZMT B;  2RPA A;  2YDS A;  2GK9 A;  1KF6 A;  2VKO A;  2H88 A;  3A8Y C;  4HFV A;  1W9R A;  3DP7 A;  4CXY A;  4IE4 A;  3ANW B;  3AE4 A;  4PAG A;  5LOV E;  1SE7 A;  2A9U A;  4QWN B;  3AB3 B;  2N2N A;  3KVB A;  4Z8X A;  4DR4 T;  3Q2M A;  2QRX A;  4JI0 T;  4HWC A;  4JI7 T;  1W0A A;  3GMI A;  4YSZ A;  3QOF A;  1OXZ A;  4KP3 C;  2UXD T;  2F4V T;  5LHG B;  1IAP A;  2JQQ A;  2E9X C;  1N33 T;  2CE7 A;  5FXV A;  4Z91 A;  1KNR A;  3NRX A;  2PBI A;  3CPZ A;  1HR0 T;  1X9B A;  4JI4 T;  2LRL A;  4DO0 A;  1XMQ T;  4G2A A;  5LHH B;  3CWZ B;  2Q9Q C;  3PU8 A;  4AKI A;  2WQY A;  2WZI A;  2N9D A;  4TUY E;  2V7I A;  2FJD A;  4YJ3 E;  2CM0 A;  1MIV A;  3I9W A;  1CUN A;  3ZJ1 A;  4O4I E;  4A98 A;  3RYH E;  1IBK T;  3M3Z B;  4ILU A;  4WBO A;  2VL0 A;  3O1J A;  5L4H A;  4ZZB A;  5LJN A;  4LF9 T;  1HNW T;  3K3Q C;  2MTQ A;  5AQQ B;  2HH7 A;  3ABV A;  3NZQ A;  4YSY A;  1D1A A;  3PUV F;  2JRK A;  5FXX A;  2V7M A;  4UV8 B;  3KV5 A;  3PU3 A;  4Z90 A;  3AAE B;  3EDU A;  5FL0 A;  3RH3 A;  2IW5 B;  1BR2 A;  3ZMS B;  4U2Z A;  5LJM A;  5JDM A;  5J1G A;  3RKG A;  2KT9 A;  4AQG A;  3SWH A;  4UIG A;  3PUW F;  3QC9 A;  3AA0 B;  4EEB A;  3LBX B;  2WU2 A;  4L9I A;  5TAO A;  5L3E B;  2ACZ A;  4ZI7 E;  2FJA A;  4PJN A;  3P4W A;  1VCS A;  4KMC A;  2XAH B;  2LOP A;  5ABF A;  4UF0 A;  3VRB A;  4ERR A;  1WFD A;  2LLY A;  4YSX A;  2I0M A;  2NWB A;  2K3W A;  4DMV A;  2C5I T;  4H9Q C;  3HR0 A;  4P0A A;  2VVS A;  2XAJ B;  1JNR A;  2FUP A;  4NIQ A;  1SUM B;  4YTP A;  1Z0P A;  1XDO A;  3PUQ A;  4U74 A;  2WP9 A;  1W09 A;  3RLF F;  4TWF A;  3E0Z A;  4HGA A;  1OED B;  4HWI B;  4TV8 E;  2BKN A;  3CKD A;  5AQV B;  3K8P C;  4IL4 A;  2NW8 A;  5L3D B;  3N5L A;  5HYA A;  3N9M A;  1YKE B;  3ONX A;  4P09 A;  3H37 A;  4AKR B;  2A2F X;  3TLS A;  4AQF A;  4KX6 A;  2JPF A;  4QH5 A;  5HXC A;  4TNW A;  3KFW X;  3PUG A;  4HN9 A;  3AAI A;  2XM1 A;  4IDQ A;  5EK3 A;  5JDH A;  4B3R T;  3RQU A;  2K9A A;  2IC9 A;  2JJ9 A;  2P9B A;  3EDV A;  4LMJ A;  5LGT B;  5C3J A;  4KUM B;  1HF8 A;  4TWD A;  5F5W A;  5HWY A;  2PG8 A;  1WRD A;  1KK7 A;  1ZOY A;  1BR4 A;  4UEM A;  4LF8 T;  4EAH A;  4DBR A;  2SPC A;  4DR6 T;  4LMK A;  5ADX L;  4OYJ A;  4QHO A;  2BG9 B;  4NXN T;  5AQN B;  4PK6 A;  4EYY R;  3KBU A;  4UV9 B;  4KHZ F;  4JBW F;  4U2Y A;  2WDQ A;  3SFD A;  4MBQ A;  5CB4 E;  1OED A;  3B57 A; 
#chains in the Genus database with same CATH homology
 3Q5D A;  3X1D A;  3OVU A;  1W09 A;  4IDO A;  3IA3 A;  4IDP A;  1W0A A;  1W0B A;  1Y01 A;  3Q5E A;  1Z8U A;  3QOF A;  3QNU A;  4IDN A;  1XZY A;  4IDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...