1Z8UA

Crystal structure of oxidized alpha hemoglobin bound to ahsp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
b'ALLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Structure of oxidized alpha-haemoglobin bound to AHSP reveals a protective mechanism for haem.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 33
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1z8uA00
4IDNA 4IDPA 3Q5DA 3QOFA 4IDOA 1W0AA 3IA3A 3OVUA 3X1DA 1Z8UA 1W0BA 1XZYA 3QNUA 1Y01A 4IDQA 1W09A 3Q5EA
chains in the Genus database with same CATH superfamily
1S94A 2WDRA 3CX7B 5AQUB 4I0UA 1HTJF 2E9XB 4GYSA 4IDZA 4YSZA 4EEDA 2VL8A 4PAGA 5HXRA 4DR5T 2N9DA 3LK42 3ZCIA 1CUNA 1ZV4X 4NPPA 4HE8A 4ZZCA 2WU2A 4ANJA 1WYBA 5DABA 3RYHE 1VRBA 4HFDA 3NZPA 3BQLA 3PUVF 3PUAA 3SFDA 4H9RC 4B3RT 3P4RA 4YHJA 5A1LA 3C4WA 3N9NA 4IHJE 3LSVA 4FI5A 4PNIA 4JBWF 2FJAA 4UVAB 3R84B 3Q2MA 2WP9A 2MTQA 4EIWA 3A8YC 1LKXA 4DR6T 2WMNA 1HNWT 1IBMT 3CQCB 1YQ3A 1W0BA 2ODUA 2BBJA 1MIWA 3AXJB 1UX5A 5F8PA 4LF8T 3RGLA 2DI4A 3ONJA 4IDOA 4HTEA 5KXJA 3RYCE 3ZEFB 3B57A 4B3MT 2IIUA 2CHOA 3CQGB 3N9PA 4AQGA 1I94T 5C2TA 1J5ET 2DNXA 3P7IA 4OYJA 3CX6B 2V26A 5J1GA 3IEEA 4BAYB 2F4VT 4O4IE 3H3AA 1FJGT 3T1HT 3HKEE 2XQ9A 2PFVA 4TUYE 3I9YA 3AE5A 3FHNA 2X0LB 2WSSV 1BR4A 5HWYA 3P50A 5LGTB 3RYFE 3MACA 4AI6A 3N2OA 5JDMA 1NENA 3AE3A 2MBGA 3AA0B 5HAXA 5FKYA 2WY2A 4UV9B 2JPFA 3O9XA 5AQQB 2XASB 4KHPT 2EHOA 3AEEA 4YXDA 4C91A 3BQIA 5LG3A 2PG8A 1FEWA 1KF6A 2LT3A 3OYXA 4ZHQE 4JI1T 2X0YA 5AQVB 4TV8E 2XTLA 2BS3A 2ZMAA 5C3JA 4OFZA 4ADZA 5ADXL 2WQYA 3FZHB 2NOXA 4I55E 5AQOB 3PURA 1MMDA 4X64T 1OEDE 3C50A 4H9NC 3ZCJA 5CA0E 5JQGE 1HS7A 2V7JA 5JDNA 2E5VA 2D0TA 2BVLA 3FZLB 4ZI3D 4IL4A 2QVAA 2G0UA 3RRCA 5JDQA 2E8IA 4ISSA 5JH7E 1NAFA 4V1Av 3GMIA 5L3CB 1XDPA 2W2UA 2X0HA 1UCUA 4KMCA 3AE7A 2XQ3A 2X9WA 3KVBA 4X65T 2V5DA 2SPCA 3UUXB 2BG9B 4KP3C 3LFMA 1R8IA 5L3BB 3E08A 4GKKT 3JC6C 3ZLIA 3J7Yq 5C8YE 2LM2A 1BR0A 2E9XA 2VK9A 3O4XE 3OYZA 1HX8A 1D1AA 1T7SA 5EK2A 4QH1A 3KV5A 3GWHA 4YJ3E 5AQIB 2J47A 1LVKA 5J2TE 4CI3B 2CBIA 3N9MA 3SWHA 3LK2B 4X20E 2NWBA 5LYJE 4DV3T 3LBXB 5IWAT 4Z90A 3AAIA 2A2FX 2CXFA 1KEYA 1ZEEA 3MZKB 1GQEA 4ZI7E 3I1AA 2V7MA 5JREA 1MMAA 5DQWA 5ABFA 4WZXA 5ABGA 4A97A 4QXHB 4ZOLE 4K0KT 5HXCA 2H89A 2K3WA 3N9LA 4EOZB 2XAGB 1X79A 4GIWA 5L47A 2IAKA 4UELA 3CX8B 3OPCA 2K48A 4HWHA 2CWOA 1IJ5A 4MBQA 3ZN1B 3W15B 2LJLA 4FJOA 4JEHB 4O4LE 3J9X1 1ZP0A 4WYVA 3OBVE 3I0QA 1OEDC 3HL6A 2L3LA 3N5LA 4JI5T 3MK7C 3JAFA 2HPJA 5AQGB 5HXSA 2X9HA 4H9QC 3CWZB 2W61A 2I59A 2JQHA 2UXXB 2W67A 4JI4T 4EEBA 4BJNA 4CN6A 3P8CD 1BR1A 5AQMB 2MAWA 1G73A 4H9OC 3S4UA 1HR0T 1HFAA 5J0ZA 2VASA 5FXVA 2K9AA 2KINB 4HFBA 3ZJ1A 1KNZA 3IBPA 4YTMA 2M6BA 5AQPB 4AKLA 4A56A 5ABEA 1UX4A 3IA3A 3N9OA 4GKJT 4QH4A 3RHWA 3NRXA 3TLTA 1N32T 2I0MA 5AQTB 2XQ6A 3AE4A 4DV6T 1VOMA 2BVMA 4ILCA 1E1HB 4EZHA 5FY7A 5JR9C 1N33T 2LOPA 3PUZF 2UUBT 4TX5A 4J2CA 3KV4A 1VCTA 3PE0A 3ZN0B 5AQSB 1J5WA 3DJBA 5BR8T 3IF8B 3ETVA 5AQRB 1SE7A 4HKAA 3LK3B 2CE7A 4JI3T 1O3XA 2CLYB 4YFSA 1IBLT 3ZKRA 4DR7T 4X5TA 2CHNA 2LSKA 2C5KT 4IDQA 4HEAA 4KHZF 2R6GF 2EHOB 4PFOA 5LJNA 4AQYT 1D0YA 1OXZA 2X68A 4O2AE 4U7YA 4ZI3C 4EYUA 3ZC0A 5EZYE 4ZXLA 2WWVA 4U74A 5HWXA 3EDVA 1B7TA 5LGUB 5E0OA 2CBJA 4ERRA 3Q5WA 5LA6E 4UIGA 2AE9A 2CEAA 3RRWA 2DLRA 5FVKA 1CHUA 2Y8DA 3GA8A 4P1NA 5FL0A 4U7IA 2D9DA 4AQFA 2KMFA 5GONE 2LSGA 2OV9A 2LEHA 1XDOA 2CXLA 3DTOA 2BBHA 4HWIB 1N36T 1XZYA 2HHHT 4X1IE 4XBFB 1EZ3A 2JMHA 2X66A 3DP7A 3E0ZA 4NIQA 4Q25A 3RKGA 2V8SV 5CJ5A 1SA0E 3PUSA 2GK9A 4N78D 3QB5A 3PV0F 4LF4T 3NKZA 5HEGA 3EABA 3U78A 3MXZA 3LBXA 4L9IA 3N2KE 2YDQA 3V5SA 4H63H 2RPAA 5HCJA 1VCSA 5CGMA 3GN5A 3HI2A 2UXDT 2VVSA 1UK5A 3UU6A 2UXBT 1HNXT 2X9XA 3ZMSB 3UUNA 4U33A 3PUWF 3ABVA 3AVRA 4B6XA 4TNWA 3TLWA 1WR6A 2W4XA 3VU7H 4DV4T 2BKOA 2XQ4A 5ABFB 4ILAA 3CVRA 5HEHA 3AA7B 1Z0PA 2IW5B 2WWUA 1HCIA 2XJ7A 1D1CA 3Q9DA 2KXPB 2C5IT 2IMLA 2XAHB 2Q9QA 2LKHA 3KV6A 4I43B 2NW8A 3Q5DA 3I0OA 1HG2A 5AQKB 2BZBA 3RLFF 2YN6A 2XAFB 4ZI2D 2B1EA 2VL0A 4LMKA 4NUUA 3AEAA 4IL9A 2L8KA 4I4TE 5FP3A 2VQET 4TNVA 4JI0T 3AAEB 2NTYA 3PUYF 1XNRT 1OWAA 4EXTA 3RF1A 4TN7B 3AEGA 2XQ7A 3AA1B 5CFBA 1JNRA 2CM0A 3CKDA 4O4JE 3UU5A 4P09A 4WNKA 2FBWA 3AEBA 3E22E 2DL1A 2YU1A 4JI6T 1M7KA 4CQIA 5LMUT 5KDMC 3WAJA 2RA1A 2WDVA 4KI0F 1N34T 2H7OA 2JRKA 2WCAA 2W63A 3Q5XA 2BS2A 5DJQC 2XSAA 3VKGA 5M4YA 5CB4E 1HG5A 1ZKEA 5CA1E 2LHNA 1QSDA 4G63A 1WRDA 1Y64B 2XQAA 3K3NA 4LMLA 4B3ST 1IJ6A 2KWIB 3QK6A 3ONXA 3WI3A 4IE6A 4QHOA 4ASKA 2X9YA 3UULA 2VKDA 1H7CA 4O2BE 3RIUC 1KK7A 3ETUA 3IHRA 2YDRA 3PTRB 3ZSTA 3KINB 4C90A 3PU8A 4UF0B 5LHHB 2YU2A 4PK4A 2JQKA 3ANWB 5AQJB 4CI1B 4DBQA 4DV0T 2VKJA 4IE5A 3SOLA 3PUGA 4MALA 4A5XA 3CQXC 3ZT6A 2BG9C 4DR2T 3PJAJ 4ZS3A 1HNZT 4QX8B 2FUPA 2CWYA 4PW8A 2PTFA 4U2YA 3AA6B 2QA7A 5FVLA 3KBTA 4TWHA 2XAJB 4QH5A 3K8PC 2WMOA 2A72A 5FXZA 4O8SA 3MJXA 5JDHA 4DBRA 4AKRB 3TLUA 3OJAA 2MYSA 4E7ZA 3RIAA 5F5WA 1L0VA 3AAAB 4IE4A 2E9XD 2NW7A 3B13A 4PFPA 4EB6E 1J1JA 1BR2A 2XM1A 2M6IA 2J1DG 3L3PA 3PUXF 2OA5A 2KWHA 3K3OA 5HXHA 2XUEA 3UFEA 2UUAT 4U2ZA 3ZMVB 4DV1T 3UQ4A 3UT5E 3AE9A 2XQ8A 4CN1A 3GN5B 5JRCB 5HEUA 5HXEA 3N9QA 2YOEA 4JLEA 3ZMZB 1US7B 3LG7A 1HX1B 2P9BA 5AFUL 3L09A 1I6ZA 4B3TT 2CCQA 4JUYA 4KUMB 4PJMA 4H63V 4HWFA 1IBKT 4TWDA 3RIFA 2YK0A 2VB6A 4WBNE 3AB3B 2LOSA 3QOFA 4LMJA 1W0AA 4F8HA 3T8OA 4U3CA 4DIDB 4ZI2C 3VR8A 4ISTA 3TLVA 4CI2B 2UU9T 2Q9QB 4PJJA 4QWNB 3JCFA 2CA5A 3VRAA 1OEDB 2QGSA 3KBUA 3AVSA 3BK9A 5LNKA 4M1PA 1XNQT 2I6HA 3C51A 4HFIA 4YTPA 4ZEYA 2WU5A 3HKCE 5HYAA 1WFDA 4UVCB 3VKHA 4JI8T 2MOZA 5LOVE 2BDEA 1U4QA 1LRZA 2K5BB 1DU2A 3SFEA 2H3RA 2LRKA 3JADA 5KX5E 1WYCA 1YW0A 3F57A 1MNDA 2ES0A 3AE8A 4Z8XA 3V5UA 2CLYC 5JDFA 4ZZBA 2ODVA 4YY3T 2BS4A 4AXPA 2VKOA 2H88A 5LG4A 4OX9T 2E5LT 1MMNA 3OVUA 2EHOC 2CRBA 2A3DA 5L4EA 3SRZA 3L39A 5AQNB 2UUCT 5JR9B 2BKNA 2HN1A 5LBQB 3RX6A 4JI7T 3MA9A 5H6RB 2ACXA 1W9RA 4EYYR 5ETWA 4DVDA 3RKOA 3FBZA 4UF0A 4PJNA 3I9WA 1YKHB 3ANWA 4YTNA 5L4HA 3NWIA 5FL1A 4K0UA 2D2SA 1QUUA 5F3JA 4WBOA 4OK0A 2Z6EA 4UXNB 5LBMA 4AIUA 3EI0A 4AKIA 5LGNB 3AE6A 3UU3A 4LFAT 4U31A 2LE8A 3A5XA 3VRBA 2W62A 3HR0A 4HN9A 2HN2A 2XQ5A 4EV6A 1E2AA 4QXBB 2ZLYA 2AXDS 2WB5A 2PBIA 2VWAA 2MPKA 5J2UE 4EAHA 3RI5A 2E9XC 4NXNT 3EAMA 2DCFA 4IE0A 4GK5E 3MKDA 2D5UA 2KNDA 3O1JA 4TZ4C 4O4HE 1T98A 2YKSA 4UVBB 3C4XA 5L2LA 1HF8A 4YSYA 4I50E 3KDSE 5JRCA 3QC9A 3H37A 2W00A 2RP4A 3O1HA 3C98B 1SUMB 3C4ZA 2X67A 3EVYA 2NR4A 2WS3A 4YJ2E 2Y6XA 2VQFT 3P4PA 4DV5T 1Y01A 4LF7T 3UU4A 4HFVA 2LKGA 4COFA 2DHRA 2A9UA 3UU8A 4LF9T 2JQ9A 1MMGA 4DMWA 2V6YB 5IUXA 2JMKA 1QLBA 4IREA 1UURA 1ZOYA 1UGOA 3ZJ2A 4GYRA 2BG9E 2JQQA 5TAOA 5LJMA 4LF6T 3EDUA 1OEDA 4JI2T 2WZIA 3UUMA 4LF5T 3TKLB 4E7SA 4QKNA 1T72A 1IZNB 3C64A 3FXEB 2KZ7B 2Q9QD 2L9QA 4CZZB 4NXMT 2K24A 4TV9E 4P0AA 4OHFA 3PUQA 3A7MA 2CPTA 1KFYA 4YLHA 5LB7B 2KT9A 4ILUA 5L3EB 2ZM6T 2XHEB 1E7PA 2UXCT 5KMGP 3EHZA 4UR9A 3RC8A 2XPKA 2J62A 4MHCA 4MFRA 3HKDE 4HFEA 2NW9A 5L3DB 5JR9A 5AQHB 4X1KE 1XMOT 4PK5A 3ESLA 4A98A 3RH3A 3NBXX 2N1GA 3ZYKA 4CXXA 3ZYMA 5BMVE 3PDYA 3K3QC 2EHOD 3Q5EA 2WBLA 5AQLB 2V5CA 2C5JA 2ZM8A 3F31A 4DUYT 3AEFA 3RC3A 1MNEA 2B76A 3NRYA 3H3MA 4KX6A 1FIOA 4DR4T 2IHR1 5JTGA 4AKGA 1U5PA 2W66A 4CXWA 2LHRA 4X66T 3UQ7A 5JDLA 3CK6A 1FMWA 4EGWA 1SHZC 3AE2A 4HWCA 4QXCB 4CN4A 4ZS2A 4CXYA 1V9DA 2LM9A 3L8RA 3HKBE 4AQFC 2WAUA 4DR1T 3ZC1A 2ACZA 2XZEA 3X1DA 2LSIA 1YXRA 5IHYA 4X1YE 1KNPA 2V1DB 3WAKA 5LMNT 3UUBA 2LRLA 3FB2A 1IAPA 1Z8UA 5JVDE 2M67A 3LDQB 1W09A 2J4GA 4YT0A 5FYMA 4YSXA 4P0BA 1YQ4A 5FNVE 2FJDA 5LP6E 4XAXB 4GOUA 4IDNA 3KFWX 5L3GB 4UEMA 3M3ZB 3CPZA 4HWDA 2PJQA 4NUVA 2CMRA 1AJ3A 3ZYLA 4DUZT 3ONLC 2Y48B 1MIVA 1WLXA 2C0SA 1G8XA 3M65A 4YHHT 4Z91A 2V6YA 5FXWA 2ZM0A 4BJMA 2YINA 3TLSA 2XAQB 3VHLA 2D0UA 2WZHA 4TWFA 2VVNA 2XSBA 3K1SA 4JV5T 2IC6A 3QB5K 1UUSA 3SS1A 4JEUB 2X51A 2HH7A 5ABHA 2XQYA 3FZMB 1XMQT 3FBLA 4GK0E 1LVFA 1T8BA 4L5GA 2V6XA 3AXJA 4IE7A 3NVOA 4IT4A 2VKHA 3VR9A 3OTOT 2Q9QC 3KVAA 4WW0A 5LCYA 3FZFB 3LJCA 2NTXA 2FJBA 1FMVA 1MIYA 1NEKA 3FZKB 4KBMB 5HEOA 2N2NA 5FMNA 2E2AA 4HFHA 4UV8B 2HPLA 4HFCA 4DV2T 3D0TA 2IC9A 1ZHCA 1KNRA 3KV9A 3QUJA 4DNDA 2WDQA 3N2GE 2LLYA 2KSRA 3ZSSA 5FXXA 4LFBT 1D0XA 4AKHA 3AE1A 2VURA 2LSYA 3BQKA 2ZM2A 2YEVC 4IDPA 4JYAT 3PJAA 2V7KA 2OLTA 5JDGA 5L3FB 3R6NA 3HA4A 3JAEA 4IGUA 2QRXA 3CIRA 3ZT7A 5HEJA 3QNUA 2JJ9A 4H9PC 4ILBA 3P4QA 4DR3T 2W0GA 5AQFB 1D1BA 2XY8B 3FXDB 2JIWA 2QYWA 2CXDA 5H6QB 2IDOB 2BKPA 3U3IA 3G06A 3O1IA 3P4SA 4L0RA 4MLKA 3F2EA 3T1YT 3NZQA 3UTKA 5FY0A 2UXNB 1WR0A 4DO0A 4XZCA 5EK3A 5LXTE 3ZPOA 3P4WA 2KLQA 2V7LA 4DV7T 1YKEB 4IIJE 2WM9A 3CMLA 4OYKA 3EUHA 1NWMX 4HGAA 4QX7B 3RPUA 3RIUA 2H7VC 4EZ4A 2DWGA 4X62T 4H9SE 3ZMTB 1XWMA 4DMVA 5LHIB 1M62A 2V7IA 3PU3A 1X9BA 3ZT5A 3AEDA 4PJLA 5FY1A 3RQUA 2BG9A 3RQWA 2IUBA 5EK4A 4LFCT 5HCMA 5LHGB 4BA9A 3RYIE 3UFGA 4PK6A 2FJEA 2NP9A 4G2AA 1JNZA 5DQVA 2XM2A 1S35A 1YD8G 1D0ZA 3OKQA 2LSJA 4F6RC 2DWKA 4AISA 3ZMUB 3JC6D 2YDSA 3AECA 1WCRA 5IYZE 3B5MA 4U72A
chains in the Genus database with same CATH topology
4IDNA 4IDPA 3Q5DA 3QOFA 4IDOA 1W0AA 3IA3A 3OVUA 3X1DA 1Z8UA 1W0BA 1XZYA 3QNUA 1Y01A 4IDQA 1W09A 3Q5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDN A;  4IDP A;  3Q5D A;  3QOF A;  4IDO A;  1W0A A;  3IA3 A;  3OVU A;  3X1D A;  1Z8U A;  1W0B A;  1XZY A;  3QNU A;  1Y01 A;  4IDQ A;  1W09 A;  3Q5E A; 
#chains in the Genus database with same CATH topology
 1S94 A;  2WDR A;  3CX7 B;  5AQU B;  4I0U A;  1HTJ F;  2E9X B;  4GYS A;  4IDZ A;  4YSZ A;  4EED A;  2VL8 A;  4PAG A;  5HXR A;  4DR5 T;  2N9D A;  3LK4 2;  3ZCI A;  1CUN A;  1ZV4 X;  4NPP A;  4HE8 A;  4ZZC A;  2WU2 A;  4ANJ A;  1WYB A;  5DAB A;  3RYH E;  1VRB A;  4HFD A;  3NZP A;  3BQL A;  3PUV F;  3PUA A;  3SFD A;  4H9R C;  4B3R T;  3P4R A;  4YHJ A;  5A1L A;  3C4W A;  3N9N A;  4IHJ E;  3LSV A;  4FI5 A;  4PNI A;  4JBW F;  2FJA A;  4UVA B;  3R84 B;  3Q2M A;  2WP9 A;  2MTQ A;  4EIW A;  3A8Y C;  1LKX A;  4DR6 T;  2WMN A;  1HNW T;  1IBM T;  3CQC B;  1YQ3 A;  1W0B A;  2ODU A;  2BBJ A;  1MIW A;  3AXJ B;  1UX5 A;  5F8P A;  4LF8 T;  3RGL A;  2DI4 A;  3ONJ A;  4IDO A;  4HTE A;  5KXJ A;  3RYC E;  3ZEF B;  3B57 A;  4B3M T;  2IIU A;  2CHO A;  3CQG B;  3N9P A;  4AQG A;  1I94 T;  5C2T A;  1J5E T;  2DNX A;  3P7I A;  4OYJ A;  3CX6 B;  2V26 A;  5J1G A;  3IEE A;  4BAY B;  2F4V T;  4O4I E;  3H3A A;  1FJG T;  3T1H T;  3HKE E;  2XQ9 A;  2PFV A;  4TUY E;  3I9Y A;  3AE5 A;  3FHN A;  2X0L B;  2WSS V;  1BR4 A;  5HWY A;  3P50 A;  5LGT B;  3RYF E;  3MAC A;  4AI6 A;  3N2O A;  5JDM A;  1NEN A;  3AE3 A;  2MBG A;  3AA0 B;  5HAX A;  5FKY A;  2WY2 A;  4UV9 B;  2JPF A;  3O9X A;  5AQQ B;  2XAS B;  4KHP T;  2EHO A;  3AEE A;  4YXD A;  4C91 A;  3BQI A;  5LG3 A;  2PG8 A;  1FEW A;  1KF6 A;  2LT3 A;  3OYX A;  4ZHQ E;  4JI1 T;  2X0Y A;  5AQV B;  4TV8 E;  2XTL A;  2BS3 A;  2ZMA A;  5C3J A;  4OFZ A;  4ADZ A;  5ADX L;  2WQY A;  3FZH B;  2NOX A;  4I55 E;  5AQO B;  3PUR A;  1MMD A;  4X64 T;  1OED E;  3C50 A;  4H9N C;  3ZCJ A;  5CA0 E;  5JQG E;  1HS7 A;  2V7J A;  5JDN A;  2E5V A;  2D0T A;  2BVL A;  3FZL B;  4ZI3 D;  4IL4 A;  2QVA A;  2G0U A;  3RRC A;  5JDQ A;  2E8I A;  4ISS A;  5JH7 E;  1NAF A;  4V1A v;  3GMI A;  5L3C B;  1XDP A;  2W2U A;  2X0H A;  1UCU A;  4KMC A;  3AE7 A;  2XQ3 A;  2X9W A;  3KVB A;  4X65 T;  2V5D A;  2SPC A;  3UUX B;  2BG9 B;  4KP3 C;  3LFM A;  1R8I A;  5L3B B;  3E08 A;  4GKK T;  3JC6 C;  3ZLI A;  3J7Y q;  5C8Y E;  2LM2 A;  1BR0 A;  2E9X A;  2VK9 A;  3O4X E;  3OYZ A;  1HX8 A;  1D1A A;  1T7S A;  5EK2 A;  4QH1 A;  3KV5 A;  3GWH A;  4YJ3 E;  5AQI B;  2J47 A;  1LVK A;  5J2T E;  4CI3 B;  2CBI A;  3N9M A;  3SWH A;  3LK2 B;  4X20 E;  2NWB A;  5LYJ E;  4DV3 T;  3LBX B;  5IWA T;  4Z90 A;  3AAI A;  2A2F X;  2CXF A;  1KEY A;  1ZEE A;  3MZK B;  1GQE A;  4ZI7 E;  3I1A A;  2V7M A;  5JRE A;  1MMA A;  5DQW A;  5ABF A;  4WZX A;  5ABG A;  4A97 A;  4QXH B;  4ZOL E;  4K0K T;  5HXC A;  2H89 A;  2K3W A;  3N9L A;  4EOZ B;  2XAG B;  1X79 A;  4GIW A;  5L47 A;  2IAK A;  4UEL A;  3CX8 B;  3OPC A;  2K48 A;  4HWH A;  2CWO A;  1IJ5 A;  4MBQ A;  3ZN1 B;  3W15 B;  2LJL A;  4FJO A;  4JEH B;  4O4L E;  3J9X 1;  1ZP0 A;  4WYV A;  3OBV E;  3I0Q A;  1OED C;  3HL6 A;  2L3L A;  3N5L A;  4JI5 T;  3MK7 C;  3JAF A;  2HPJ A;  5AQG B;  5HXS A;  2X9H A;  4H9Q C;  3CWZ B;  2W61 A;  2I59 A;  2JQH A;  2UXX B;  2W67 A;  4JI4 T;  4EEB A;  4BJN A;  4CN6 A;  3P8C D;  1BR1 A;  5AQM B;  2MAW A;  1G73 A;  4H9O C;  3S4U A;  1HR0 T;  1HFA A;  5J0Z A;  2VAS A;  5FXV A;  2K9A A;  2KIN B;  4HFB A;  3ZJ1 A;  1KNZ A;  3IBP A;  4YTM A;  2M6B A;  5AQP B;  4AKL A;  4A56 A;  5ABE A;  1UX4 A;  3IA3 A;  3N9O A;  4GKJ T;  4QH4 A;  3RHW A;  3NRX A;  3TLT A;  1N32 T;  2I0M A;  5AQT B;  2XQ6 A;  3AE4 A;  4DV6 T;  1VOM A;  2BVM A;  4ILC A;  1E1H B;  4EZH A;  5FY7 A;  5JR9 C;  1N33 T;  2LOP A;  3PUZ F;  2UUB T;  4TX5 A;  4J2C A;  3KV4 A;  1VCT A;  3PE0 A;  3ZN0 B;  5AQS B;  1J5W A;  3DJB A;  5BR8 T;  3IF8 B;  3ETV A;  5AQR B;  1SE7 A;  4HKA A;  3LK3 B;  2CE7 A;  4JI3 T;  1O3X A;  2CLY B;  4YFS A;  1IBL T;  3ZKR A;  4DR7 T;  4X5T A;  2CHN A;  2LSK A;  2C5K T;  4IDQ A;  4HEA A;  4KHZ F;  2R6G F;  2EHO B;  4PFO A;  5LJN A;  4AQY T;  1D0Y A;  1OXZ A;  2X68 A;  4O2A E;  4U7Y A;  4ZI3 C;  4EYU A;  3ZC0 A;  5EZY E;  4ZXL A;  2WWV A;  4U74 A;  5HWX A;  3EDV A;  1B7T A;  5LGU B;  5E0O A;  2CBJ A;  4ERR A;  3Q5W A;  5LA6 E;  4UIG A;  2AE9 A;  2CEA A;  3RRW A;  2DLR A;  5FVK A;  1CHU A;  2Y8D A;  3GA8 A;  4P1N A;  5FL0 A;  4U7I A;  2D9D A;  4AQF A;  2KMF A;  5GON E;  2LSG A;  2OV9 A;  2LEH A;  1XDO A;  2CXL A;  3DTO A;  2BBH A;  4HWI B;  1N36 T;  1XZY A;  2HHH T;  4X1I E;  4XBF B;  1EZ3 A;  2JMH A;  2X66 A;  3DP7 A;  3E0Z A;  4NIQ A;  4Q25 A;  3RKG A;  2V8S V;  5CJ5 A;  1SA0 E;  3PUS A;  2GK9 A;  4N78 D;  3QB5 A;  3PV0 F;  4LF4 T;  3NKZ A;  5HEG A;  3EAB A;  3U78 A;  3MXZ A;  3LBX A;  4L9I A;  3N2K E;  2YDQ A;  3V5S A;  4H63 H;  2RPA A;  5HCJ A;  1VCS A;  5CGM A;  3GN5 A;  3HI2 A;  2UXD T;  2VVS A;  1UK5 A;  3UU6 A;  2UXB T;  1HNX T;  2X9X A;  3ZMS B;  3UUN A;  4U33 A;  3PUW F;  3ABV A;  3AVR A;  4B6X A;  4TNW A;  3TLW A;  1WR6 A;  2W4X A;  3VU7 H;  4DV4 T;  2BKO A;  2XQ4 A;  5ABF B;  4ILA A;  3CVR A;  5HEH A;  3AA7 B;  1Z0P A;  2IW5 B;  2WWU A;  1HCI A;  2XJ7 A;  1D1C A;  3Q9D A;  2KXP B;  2C5I T;  2IML A;  2XAH B;  2Q9Q A;  2LKH A;  3KV6 A;  4I43 B;  2NW8 A;  3Q5D A;  3I0O A;  1HG2 A;  5AQK B;  2BZB A;  3RLF F;  2YN6 A;  2XAF B;  4ZI2 D;  2B1E A;  2VL0 A;  4LMK A;  4NUU A;  3AEA A;  4IL9 A;  2L8K A;  4I4T E;  5FP3 A;  2VQE T;  4TNV A;  4JI0 T;  3AAE B;  2NTY A;  3PUY F;  1XNR T;  1OWA A;  4EXT A;  3RF1 A;  4TN7 B;  3AEG A;  2XQ7 A;  3AA1 B;  5CFB A;  1JNR A;  2CM0 A;  3CKD A;  4O4J E;  3UU5 A;  4P09 A;  4WNK A;  2FBW A;  3AEB A;  3E22 E;  2DL1 A;  2YU1 A;  4JI6 T;  1M7K A;  4CQI A;  5LMU T;  5KDM C;  3WAJ A;  2RA1 A;  2WDV A;  4KI0 F;  1N34 T;  2H7O A;  2JRK A;  2WCA A;  2W63 A;  3Q5X A;  2BS2 A;  5DJQ C;  2XSA A;  3VKG A;  5M4Y A;  5CB4 E;  1HG5 A;  1ZKE A;  5CA1 E;  2LHN A;  1QSD A;  4G63 A;  1WRD A;  1Y64 B;  2XQA A;  3K3N A;  4LML A;  4B3S T;  1IJ6 A;  2KWI B;  3QK6 A;  3ONX A;  3WI3 A;  4IE6 A;  4QHO A;  4ASK A;  2X9Y A;  3UUL A;  2VKD A;  1H7C A;  4O2B E;  3RIU C;  1KK7 A;  3ETU A;  3IHR A;  2YDR A;  3PTR B;  3ZST A;  3KIN B;  4C90 A;  3PU8 A;  4UF0 B;  5LHH B;  2YU2 A;  4PK4 A;  2JQK A;  3ANW B;  5AQJ B;  4CI1 B;  4DBQ A;  4DV0 T;  2VKJ A;  4IE5 A;  3SOL A;  3PUG A;  4MAL A;  4A5X A;  3CQX C;  3ZT6 A;  2BG9 C;  4DR2 T;  3PJA J;  4ZS3 A;  1HNZ T;  4QX8 B;  2FUP A;  2CWY A;  4PW8 A;  2PTF A;  4U2Y A;  3AA6 B;  2QA7 A;  5FVL A;  3KBT A;  4TWH A;  2XAJ B;  4QH5 A;  3K8P C;  2WMO A;  2A72 A;  5FXZ A;  4O8S A;  3MJX A;  5JDH A;  4DBR A;  4AKR B;  3TLU A;  3OJA A;  2MYS A;  4E7Z A;  3RIA A;  5F5W A;  1L0V A;  3AAA B;  4IE4 A;  2E9X D;  2NW7 A;  3B13 A;  4PFP A;  4EB6 E;  1J1J A;  1BR2 A;  2XM1 A;  2M6I A;  2J1D G;  3L3P A;  3PUX F;  2OA5 A;  2KWH A;  3K3O A;  5HXH A;  2XUE A;  3UFE A;  2UUA T;  4U2Z A;  3ZMV B;  4DV1 T;  3UQ4 A;  3UT5 E;  3AE9 A;  2XQ8 A;  4CN1 A;  3GN5 B;  5JRC B;  5HEU A;  5HXE A;  3N9Q A;  2YOE A;  4JLE A;  3ZMZ B;  1US7 B;  3LG7 A;  1HX1 B;  2P9B A;  5AFU L;  3L09 A;  1I6Z A;  4B3T T;  2CCQ A;  4JUY A;  4KUM B;  4PJM A;  4H63 V;  4HWF A;  1IBK T;  4TWD A;  3RIF A;  2YK0 A;  2VB6 A;  4WBN E;  3AB3 B;  2LOS A;  3QOF A;  4LMJ A;  1W0A A;  4F8H A;  3T8O A;  4U3C A;  4DID B;  4ZI2 C;  3VR8 A;  4IST A;  3TLV A;  4CI2 B;  2UU9 T;  2Q9Q B;  4PJJ A;  4QWN B;  3JCF A;  2CA5 A;  3VRA A;  1OED B;  2QGS A;  3KBU A;  3AVS A;  3BK9 A;  5LNK A;  4M1P A;  1XNQ T;  2I6H A;  3C51 A;  4HFI A;  4YTP A;  4ZEY A;  2WU5 A;  3HKC E;  5HYA A;  1WFD A;  4UVC B;  3VKH A;  4JI8 T;  2MOZ A;  5LOV E;  2BDE A;  1U4Q A;  1LRZ A;  2K5B B;  1DU2 A;  3SFE A;  2H3R A;  2LRK A;  3JAD A;  5KX5 E;  1WYC A;  1YW0 A;  3F57 A;  1MND A;  2ES0 A;  3AE8 A;  4Z8X A;  3V5U A;  2CLY C;  5JDF A;  4ZZB A;  2ODV A;  4YY3 T;  2BS4 A;  4AXP A;  2VKO A;  2H88 A;  5LG4 A;  4OX9 T;  2E5L T;  1MMN A;  3OVU A;  2EHO C;  2CRB A;  2A3D A;  5L4E A;  3SRZ A;  3L39 A;  5AQN B;  2UUC T;  5JR9 B;  2BKN A;  2HN1 A;  5LBQ B;  3RX6 A;  4JI7 T;  3MA9 A;  5H6R B;  2ACX A;  1W9R A;  4EYY R;  5ETW A;  4DVD A;  3RKO A;  3FBZ A;  4UF0 A;  4PJN A;  3I9W A;  1YKH B;  3ANW A;  4YTN A;  5L4H A;  3NWI A;  5FL1 A;  4K0U A;  2D2S A;  1QUU A;  5F3J A;  4WBO A;  4OK0 A;  2Z6E A;  4UXN B;  5LBM A;  4AIU A;  3EI0 A;  4AKI A;  5LGN B;  3AE6 A;  3UU3 A;  4LFA T;  4U31 A;  2LE8 A;  3A5X A;  3VRB A;  2W62 A;  3HR0 A;  4HN9 A;  2HN2 A;  2XQ5 A;  4EV6 A;  1E2A A;  4QXB B;  2ZLY A;  2AXD S;  2WB5 A;  2PBI A;  2VWA A;  2MPK A;  5J2U E;  4EAH A;  3RI5 A;  2E9X C;  4NXN T;  3EAM A;  2DCF A;  4IE0 A;  4GK5 E;  3MKD A;  2D5U A;  2KND A;  3O1J A;  4TZ4 C;  4O4H E;  1T98 A;  2YKS A;  4UVB B;  3C4X A;  5L2L A;  1HF8 A;  4YSY A;  4I50 E;  3KDS E;  5JRC A;  3QC9 A;  3H37 A;  2W00 A;  2RP4 A;  3O1H A;  3C98 B;  1SUM B;  3C4Z A;  2X67 A;  3EVY A;  2NR4 A;  2WS3 A;  4YJ2 E;  2Y6X A;  2VQF T;  3P4P A;  4DV5 T;  1Y01 A;  4LF7 T;  3UU4 A;  4HFV A;  2LKG A;  4COF A;  2DHR A;  2A9U A;  3UU8 A;  4LF9 T;  2JQ9 A;  1MMG A;  4DMW A;  2V6Y B;  5IUX A;  2JMK A;  1QLB A;  4IRE A;  1UUR A;  1ZOY A;  1UGO A;  3ZJ2 A;  4GYR A;  2BG9 E;  2JQQ A;  5TAO A;  5LJM A;  4LF6 T;  3EDU A;  1OED A;  4JI2 T;  2WZI A;  3UUM A;  4LF5 T;  3TKL B;  4E7S A;  4QKN A;  1T72 A;  1IZN B;  3C64 A;  3FXE B;  2KZ7 B;  2Q9Q D;  2L9Q A;  4CZZ B;  4NXM T;  2K24 A;  4TV9 E;  4P0A A;  4OHF A;  3PUQ A;  3A7M A;  2CPT A;  1KFY A;  4YLH A;  5LB7 B;  2KT9 A;  4ILU A;  5L3E B;  2ZM6 T;  2XHE B;  1E7P A;  2UXC T;  5KMG P;  3EHZ A;  4UR9 A;  3RC8 A;  2XPK A;  2J62 A;  4MHC A;  4MFR A;  3HKD E;  4HFE A;  2NW9 A;  5L3D B;  5JR9 A;  5AQH B;  4X1K E;  1XMO T;  4PK5 A;  3ESL A;  4A98 A;  3RH3 A;  3NBX X;  2N1G A;  3ZYK A;  4CXX A;  3ZYM A;  5BMV E;  3PDY A;  3K3Q C;  2EHO D;  3Q5E A;  2WBL A;  5AQL B;  2V5C A;  2C5J A;  2ZM8 A;  3F31 A;  4DUY T;  3AEF A;  3RC3 A;  1MNE A;  2B76 A;  3NRY A;  3H3M A;  4KX6 A;  1FIO A;  4DR4 T;  2IHR 1;  5JTG A;  4AKG A;  1U5P A;  2W66 A;  4CXW A;  2LHR A;  4X66 T;  3UQ7 A;  5JDL A;  3CK6 A;  1FMW A;  4EGW A;  1SHZ C;  3AE2 A;  4HWC A;  4QXC B;  4CN4 A;  4ZS2 A;  4CXY A;  1V9D A;  2LM9 A;  3L8R A;  3HKB E;  4AQF C;  2WAU A;  4DR1 T;  3ZC1 A;  2ACZ A;  2XZE A;  3X1D A;  2LSI A;  1YXR A;  5IHY A;  4X1Y E;  1KNP A;  2V1D B;  3WAK A;  5LMN T;  3UUB A;  2LRL A;  3FB2 A;  1IAP A;  1Z8U A;  5JVD E;  2M67 A;  3LDQ B;  1W09 A;  2J4G A;  4YT0 A;  5FYM A;  4YSX A;  4P0B A;  1YQ4 A;  5FNV E;  2FJD A;  5LP6 E;  4XAX B;  4GOU A;  4IDN A;  3KFW X;  5L3G B;  4UEM A;  3M3Z B;  3CPZ A;  4HWD A;  2PJQ A;  4NUV A;  2CMR A;  1AJ3 A;  3ZYL A;  4DUZ T;  3ONL C;  2Y48 B;  1MIV A;  1WLX A;  2C0S A;  1G8X A;  3M65 A;  4YHH T;  4Z91 A;  2V6Y A;  5FXW A;  2ZM0 A;  4BJM A;  2YIN A;  3TLS A;  2XAQ B;  3VHL A;  2D0U A;  2WZH A;  4TWF A;  2VVN A;  2XSB A;  3K1S A;  4JV5 T;  2IC6 A;  3QB5 K;  1UUS A;  3SS1 A;  4JEU B;  2X51 A;  2HH7 A;  5ABH A;  2XQY A;  3FZM B;  1XMQ T;  3FBL A;  4GK0 E;  1LVF A;  1T8B A;  4L5G A;  2V6X A;  3AXJ A;  4IE7 A;  3NVO A;  4IT4 A;  2VKH A;  3VR9 A;  3OTO T;  2Q9Q C;  3KVA A;  4WW0 A;  5LCY A;  3FZF B;  3LJC A;  2NTX A;  2FJB A;  1FMV A;  1MIY A;  1NEK A;  3FZK B;  4KBM B;  5HEO A;  2N2N A;  5FMN A;  2E2A A;  4HFH A;  4UV8 B;  2HPL A;  4HFC A;  4DV2 T;  3D0T A;  2IC9 A;  1ZHC A;  1KNR A;  3KV9 A;  3QUJ A;  4DND A;  2WDQ A;  3N2G E;  2LLY A;  2KSR A;  3ZSS A;  5FXX A;  4LFB T;  1D0X A;  4AKH A;  3AE1 A;  2VUR A;  2LSY A;  3BQK A;  2ZM2 A;  2YEV C;  4IDP A;  4JYA T;  3PJA A;  2V7K A;  2OLT A;  5JDG A;  5L3F B;  3R6N A;  3HA4 A;  3JAE A;  4IGU A;  2QRX A;  3CIR A;  3ZT7 A;  5HEJ A;  3QNU A;  2JJ9 A;  4H9P C;  4ILB A;  3P4Q A;  4DR3 T;  2W0G A;  5AQF B;  1D1B A;  2XY8 B;  3FXD B;  2JIW A;  2QYW A;  2CXD A;  5H6Q B;  2IDO B;  2BKP A;  3U3I A;  3G06 A;  3O1I A;  3P4S A;  4L0R A;  4MLK A;  3F2E A;  3T1Y T;  3NZQ A;  3UTK A;  5FY0 A;  2UXN B;  1WR0 A;  4DO0 A;  4XZC A;  5EK3 A;  5LXT E;  3ZPO A;  3P4W A;  2KLQ A;  2V7L A;  4DV7 T;  1YKE B;  4IIJ E;  2WM9 A;  3CML A;  4OYK A;  3EUH A;  1NWM X;  4HGA A;  4QX7 B;  3RPU A;  3RIU A;  2H7V C;  4EZ4 A;  2DWG A;  4X62 T;  4H9S E;  3ZMT B;  1XWM A;  4DMV A;  5LHI B;  1M62 A;  2V7I A;  3PU3 A;  1X9B A;  3ZT5 A;  3AED A;  4PJL A;  5FY1 A;  3RQU A;  2BG9 A;  3RQW A;  2IUB A;  5EK4 A;  4LFC T;  5HCM A;  5LHG B;  4BA9 A;  3RYI E;  3UFG A;  4PK6 A;  2FJE A;  2NP9 A;  4G2A A;  1JNZ A;  5DQV A;  2XM2 A;  1S35 A;  1YD8 G;  1D0Z A;  3OKQ A;  2LSJ A;  4F6R C;  2DWK A;  4AIS A;  3ZMU B;  3JC6 D;  2YDS A;  3AEC A;  1WCR A;  5IYZ E;  3B5M A;  4U72 A; 
#chains in the Genus database with same CATH homology
 4IDN A;  4IDP A;  3Q5D A;  3QOF A;  4IDO A;  1W0A A;  3IA3 A;  3OVU A;  3X1D A;  1Z8U A;  1W0B A;  1XZY A;  3QNU A;  1Y01 A;  4IDQ A;  1W09 A;  3Q5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...