1Z8UA

Crystal structure of oxidized alpha hemoglobin bound to ahsp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
ALLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Structure of oxidized alpha-haemoglobin bound to AHSP reveals a protective mechanism for haem.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1z8uA00
3Q5EA 1Z8UA 1W0AA 3QNUA 3IA3A 3OVUA 4IDNA 4IDQA 4IDOA 4IDPA 3X1DA 3Q5DA 3QOFA 1W0BA 1Y01A 1XZYA 1W09A
chains in the Genus database with same CATH superfamily
3HKEE 2CWYA 3EUHA 2IC6A 3H37A 2J1DG 3HR0A 1IJ6A 5FL0A 1HR0T 2BVMA 3PJAA 4EAHA 3RHWA 3OTOT 4IDNA 3SWHA 3CIRA 3UU4A 3UQ4A 1YKEB 2HHHT 1H7CA 1VCSA 2X68A 3TLSA 1HFAA 4EGWA 4NIQA 3T1YT 3ZMZB 4H9OC 4GKKT 3CQGB 4GYRA 2EHOC 3ZC1A 3TLWA 3HKBE 3OPCA 2WWVA 4HWDA 4CXXA 4EZ4A 2VVSA 3ZSSA 4ZZCA 3CVRA 2RPAA 2WAUA 3PU3A 1E1HB 3N2OA 4Z8XA 3CMLA 4EEBA 1N32T 5AQJB 1W9RA 4ERRA 1YW0A 1QLBA 5LGTB 1YD8G 3TLVA 2L3LA 3V5UA 3U3IA 1Z8UA 2PTFA 1T8BA 3GA8A 4JI8T 5JTGA 4U31A 3F31A 1KF6A 4IE0A 2K5BB 3O1HA 1FIOA 2YDRA 3PJAJ 4QXHB 5ABFB 2C0SA 4LF8T 3CKDA 3EAMA 4DVDA 1MIWA 2Q9QB 1D1CA 4DIDB 3BQIA 3CX8B 2LSGA 3ETUA 3F57A 4KHZF 2MYSA 2XHEB 2CHNA 4DBRA 2UUAT 4PJLA 2WWUA 5HXCA 4YHJA 4ZHQE 4IDPA 1HX1B 5LBQB 4X1YE 4BA9A 1US7B 3AB3B 5EK2A 4DR2T 1FMWA 3OYXA 3UUNA 3UT5E 5L4HA 4LF9T 1LVFA 2WS3A 3O1IA 4P0BA 3J7Yq 4U7YA 4JI1T 4IE4A 1G73A 1D1BA 1JNRA 2PJQA 2IDOB 3P4WA 5HEGA 3FZLB 3J9X1 5HYAA 2KWIB 4GYSA 4P1NA 5HAXA 2UXCT 2XQYA 3AE3A 4DR1T 3LDQB 5L3EB 2JQKA 1B7TA 2A9UA 3JAFA 2D9DA 4HFDA 1WR0A 3TLTA 2VKJA 3ZCJA 2W61A 5FMNA 2CCQA 2YK0A 1KFYA 2WB5A 5LP6E 4IGUA 4BJMA 4HFBA 1KNPA 3FHNA 3OKQA 1SHZC 1EZ3A 2WSSV 4I43B 2CLYC 2W62A 5AFUL 4H9QC 4X62T 4AQYT 5LNKA 1NWMX 3ZMVB 2PFVA 1WYBA 2XAFB 3AE5A 3UTKA 2SPCA 1UK5A 4HFHA 2XSBA 4CI3B 3N9MA 4GK0E 5FXVA 1HTJF 3JAEA 3AEGA 5JDHA 4X5TA 2BDEA 1IAPA 2LKHA 2NP9A 3PE0A 3ZYMA 2BG9A 5L4EA 3RKOA 2ZM8A 4QH4A 4OHFA 4JV5T 2MTQA 4DUZT 3RX6A 3D0TA 1NEKA 5FVKA 3IBPA 2OV9A 2E9XB 4ASKA 3AAIA 4Z91A 5CFBA 4KBMB 2XAHB 5L3CB 3AA6B 2Y6XA 1XMQT 4B3MT 4AKRB 4YSXA 2UUBT 3C64A 2V8SV 4NXNT 1KEYA 2IAKA 1VOMA 3B57A 3LBXA 2VQET 5FY1A 4YTPA 1BR1A 3R6NA 2VKHA 2XASB 2XUEA 2JPFA 2XAQB 3IHRA 5HWYA 3NRYA 3ZT6A 2WMOA 3L09A 2CXDA 2H89A 2W4XA 4H9SE 1W0BA 1T72A 2JMHA 3AE6A 2YINA 4ZOLE 3VKGA 1HCIA 1QSDA 4MLKA 5AQPB 5HWXA 5E0OA 2CBJA 3MK7C 2VK9A 3RPUA 4A97A 4OYKA 3RYIE 3C51A 3OVUA 3UU6A 1MIYA 1VRBA 2WDVA 4AQFA 4DV4T 3KV5A 4LF5T 2XQ9A 5EZYE 5JR9A 3FZKB 3T8OA 1XZYA 3CX7B 2A3DA 4H9NC 5LHIB 2NTXA 4NPPA 3KDSE 2E8IA 3NKZA 1UX5A 4TNVA 4DV3T 2EHOB 4WNKA 5EK4A 2N2NA 4O4IE 2WBLA 4GK5E 2VQFT 4ZS3A 5AQHB 3LK42 3Q5WA 5DABA 3WAJA 2BG9C 3VKHA 3B13A 2ACZA 4Z90A 2WP9A 4CN4A 3Q2MA 3FZMB 4UVBB 3PURA 5AQOB 3AE1A 3JADA 1WLXA 2BVLA 5AQNB 1BR0A 2IC9A 3I1AA 3H3AA 1V9DA 5F8PA 1Y64B 3UUBA 3GWHA 4LMKA 2WY2A 4IREA 3C4WA 3EHZA 3NZQA 3Q5XA 4O2BE 2DWGA 4L0RA 3PUWF 1KNZA 3ABVA 1WRDA 3CPZA 3WI3A 3QNUA 3N9PA 5AQQB 3MZKB 3ANWB 3BQKA 2D0TA 4HEAA 4B3RT 4DMWA 4HKAA 3KBUA 4CQIA 3K3NA 2DL1A 3PUQA 4HFVA 2JRKA 2ES0A 4U7IA 1SUMB 3AECA 2X9HA 3I0QA 4IL4A 2NR4A 5JR9C 4F8HA 5H6RB 4WYVA 3ZMUB 5AQLB 4EV6A 4EYUA 5FXZA 3KBTA 1I6ZA 5KDMC 2D5UA 1UX4A 5CA0E 2W67A 1WFDA 1OEDA 2VL8A 4CXWA 2Q9QD 1ZP0A 1OXZA 2YDQA 4JUYA 2BS2A 5LXTE 5ABEA 3RH3A 2RP4A 4CXYA 5BR8T 1W0AA 5AQRB 2M67A 2YOEA 1XWMA 5IHYA 4UEMA 5L3BB 1MMAA 2CXLA 3EVYA 2ZMAA 4QXBB 2FJEA 2I0MA 3ZN0B 3FBZA 4H63H 4GOUA 4XZCA 1Y01A 3AAEB 4H9PC 2Y48B 1LVKA 4I0UA 4IHJE 3ETVA 2CA5A 4O4HE 4FI5A 4COFA 4B3ST 2BKNA 1XDPA 2XJ7A 4NUUA 5FKYA 2Z6EA 4QWNB 4B3TT 1MMGA 2OLTA 1IBKT 2PG8A 5FYMA 5CJ5A 5LB7B 2V6YB 2BKOA 3N9QA 4JEUB 4JLEA 3I0OA 3AA0B 5LHGB 3AAAB 2LM2A 3ZCIA 3AEBA 2X9WA 4TWHA 1J5ET 3KV9A 3P8CD 2JIWA 3A7MA 3AE8A 1GQEA 4CN6A 3AA1B 2V7IA 3KVAA 2ZM2A 2J62A 4MHCA 4QX8B 5KX5E 3K8PC 2XY8B 4JI3T 2VASA 1LKXA 3C98B 5JDGA 2H88A 1UGOA 4M1PA 3Q5DA 3SS1A 5L3GB 4WBNE 4XAXB 2K24A 3U78A 5L3FB 1G8XA 3QC9A 2VKDA 4YHHT 3CQCB 2X0HA 4QHOA 4KP3C 4ZXLA 2LKGA 1U5PA 4BJNA 3FBLA 4ZI2D 2XSAA 2W2UA 2CM0A 4PW8A 2JMKA 4UR9A 3UUXB 1OEDC 2CMRA 4TUYE 4K0KT 3FB2A 3RC8A 4JYAT 1FMVA 4YFSA 5LMNT 4NUVA 4PK5A 3UUMA 2KINB 4AISA 3GN5B 4QX7B 2DNXA 1J5WA 2LSKA 4U2ZA 2IMLA 3ZT5A 3VR8A 3N9OA 3RYCE 2E9XD 3PUSA 4DV5T 3AE4A 2LRKA 2CRBA 1YQ3A 4TN7B 2XQ5A 5J2UE 4LFAT 4HWHA 3ZKRA 3PV0F 5ABFA 5JDFA 3FXDB 2H7VC 4PFPA 2KLQA 1E2AA 2BBHA 2Q9QA 2XPKA 3RQWA 2NTYA 1U4QA 2UUCT 2CHOA 4KX6A 2V7LA 3A8YC 1WCRA 4DV0T 2FBWA 5ABHA 3UFGA 3RYHE 5CB4E 2CE7A 2WCAA 1D0YA 4MBQA 4YSYA 4UIGA 4YTMA 4PAGA 2WDRA 4X66T 3MKDA 3KINB 2QGSA 3P4QA 3HKDE 1CHUA 5CA1E 3C50A 2VKOA 5HXSA 2X0LB 1D0XA 2ODVA 3PUGA 3P4PA 2LRLA 2LSJA 3NVOA 2CBIA 3LG7A 5DQVA 3VHLA 2BBJA 1UURA 2C5KT 2D2SA 4TX5A 1MIVA 4J2CA 4X1KE 4HWFA 1YQ4A 3JCFA 1SE7A 4DR5T 3LFMA 5F5WA 1R8IA 2QRXA 4I50E 3DTOA 3ZJ1A 4TV8E 1S94A 4YTNA 3Q9DA 3N2KE 3SFEA 3O4XE 4JBWF 3ZMTB 5LGUB 4P0AA 5TAOA 2VB6A 2QYWA 3L3PA 4CI2B 2W63A 2IW5B 3ZJ2A 3E0ZA 4AKLA 2RA1A 5FL1A 4IDQA 3BQLA 2VWAA 2NW9A 4YSZA 2WDQA 1HNZT 2CPTA 5HXRA 2A2FX 5JQGE 5LG3A 2Q9QC 3ZC0A 4JI2T 1M62A 3SRZA 5L2LA 4DMVA 2XAGB 3K3OA 1I94T 1KK7A 3UU8A 4TNWA 3VRAA 4DV1T 4IDOA 3RC3A 3MA9A 4U74A 4AIUA 2V26A 4MALA 3ZT7A 2XQ3A 5ABGA 5AQKB 1HS7A 4L5GA 4CI1B 4IE6A 2E9XA 3ONLC 3R84B 3EABA 4DV7T 2KWHA 3X1DA 3EI0A 4BAYB 4IE7A 4LFCT 4A5XA 3OJAA 5JH7E 1D0ZA 1ZHCA 2E5LT 3RKGA 2X0YA 2W66A 2B1EA 4DR4T 4PJMA 2XTLA 2HN2A 4EXTA 3PUYF 3L39A 4KHPT 3CK6A 3AXJB 4WZXA 4UF0B 5KXJA 2LHNA 3RYFE 3VU7H 1UUSA 5LOVE 5GONE 2X51A 3ZYKA 4DR6T 2V5CA 4U33A 1XNQT 3KV4A 2YKSA 4MFRA 2YN6A 2DHRA 3SFDA 1ZEEA 4HWCA 4UVAB 5LGNB 3LK2B 3I9YA 4IL9A 2LEHA 2XQ8A 5JRCB 2WU2A 4DR3T 3N9LA 2NOXA 4A56A 5AQTB 4TWFA 4ZZBA 2KNDA 1IBLT 5AQSB 4O2AE 1T98A 1XMOT 2G0UA 3B5MA 3O1JA 3S4UA 2J4GA 4E7SA 4ZI2C 3N2GE 2MOZA 1D1AA 5C3JA 3RIAA 4PK4A 3ZEFB 5ETWA 4EZHA 3CX6B 1BR2A 2EHOA 2C5IT 2LHRA 2ZM6T 1S35A 4JI7T 3C4XA 4KI0F 2VVNA 2WM9A 5FXXA 4EEDA 2HN1A 2XAJB 4PNIA 4DNDA 1SA0E 3EDUA 1N33T 4DO0A 3QB5K 5LCYA 3UU5A 2KMFA 2E9XC 3QOFA 4ILUA 4AQFC 4ILBA 3RI5A 1YXRA 4U72A 2ZLYA 2C5JA 5M4YA 2X67A 3N5LA 4HFCA 5FXWA 2V1DB 5FNVE 3RIUA 3AEFA 4Q25A 3ZMSB 2BG9E 4PJJA 3UU3A 2X9XA 3PUVF 3OYZA 2FJBA 3ZLIA 2YDSA 2LJLA 4YY3T 1XNRT 2BS4A 3HKCE 1AJ3A 4ILCA 3ANWA 3AVSA 4QH1A 4JI6T 5JDLA 4LF7T 4FJOA 3UULA 2V7JA 4ILAA 2KSRA 2MBGA 2NW8A 5AQFB 4TWDA 1OWAA 3IF8B 4ZS2A 2IIUA 2LOPA 2NWBA 5LJMA 2H7OA 4LMJA 1XDOA 2LLYA 3PTRB 4X20E 3QUJA 3DJBA 2V7KA 2A72A 1FJGT 3O9XA 5JREA 3P4RA 4IT4A 4AI6A 4P09A 2KZ7B 2LOSA 5DQWA 3EDVA 2Y8DA 4G2AA 4PJNA 2CLYB 4H63V 2DCFA 3AEDA 4O4JE 4DUYT 3VR9A 2N9DA 1IJ5A 4OYJA 2XQ4A 5LMUT 4PK6A 3M3ZB 1WR6A 4O4LE 2P9BA 3RQUA 3FXEB 5AQGB 1BR4A 4H9RC 3P7IA 1HNWT 4GKJT 4PFOA 5HCMA 4B6XA 2V7MA 3WAKA 3LK3B 2X66A 1HF8A 3RIUC 3FZFB 1X9BA 4KUMB 3K1SA 5AQIB 3Q5EA 2DI4A 2B76A 2M6IA 3KVBA 3SOLA 4LF6T 3F2EA 5IYZE 5LBMA 5FVLA 1N36T 2XQ6A 3A5XA 2LSIA 3RIFA 4EOZB 2XZEA 4V1Av 3MACA 4DBQA 3JC6D 5EK3A 2V6YA 4HGAA 3QK6A 2DWKA 5J1GA 1HX8A 1MNDA 2K3WA 4HFEA 3TKLB 4EYYR 1JNZA 3FZHB 1ZKEA 1IBMT 3C4ZA 1O3XA 2LSYA 4CN1A 2IUBA 4K0UA 3NWIA 3G06A 5HEHA 4WBOA 3ONJA 1CUNA 1QUUA 1N34T 2K48A 4U2YA 4G63A 4ISSA 3AEEA 3AE9A 1LRZA 3TLUA 1J1JA 4X65T 2FJDA 4UV8B 2XQAA 5AQMB 4JI5T 5HXHA 4UXNB 2WZIA 1ZV4X 5FY7A 2LT3A 3P50A 5JDQA 3UFEA 5J2TE 5LHHB 2WZHA 4C91A 2I6HA 2E5VA 1Z0PA 1W09A 3DP7A 2GK9A 4HWIB 3E08A 3GN5A 2XM2A 2YU1A 5FY0A 5HEUA 5FP3A 2V6XA 2BG9B 3PUAA 2KXPB 1OEDE 1T7SA 2ODUA 4AXPA 3IA3A 4TZ4C 1L0VA 3ZYLA 4OX9T 2XM1A 5BMVE 2LM9A 2XQ7A 2I59A 2R6GF 4ZI3C 5CGMA 5A1LA 2W0GA 1NAFA 4U3CA 2CXFA 3LJCA 1E7PA 2BS3A 2QA7A 4IDZA 2EHOD 2CWOA 2BKPA 5H6QB 4QKNA 4LF4T 4AKIA 2ACXA 3LBXB 4OK0A 2UXNB 3E22E 2JJ9A 2JQHA 2J47A 5F3JA 3RLFF 3IEEA 3RRCA 4LMLA 4JI0T 3PUZF 3RF1A 3PUXF 4NXMT 2UXBT 5KMGP 4YXDA 2H3RA 4ADZA 3AEAA 3AE2A 4HFIA 3MXZA 1HG5A 2JQ9A 4HE8A 5L3DB 4XBFB 2OA5A 2MAWA 2IHR1 2KT9A 3HL6A 5JR9B 1WYCA 4L9IA 5C8YE 2WU5A 1HG2A 5JDNA 4I55E 5IWAT 5HCJA 1NENA 4X1IE 2UXDT 4ISTA 4O8SA 5JDMA 4DV2T 3ZPOA 4UVCB 2LE8A 4UV9B 2WQYA 4F6RC 4YT0A 2HPJA 4ZI7E 2V5DA 3W15B 1VCTA 2D0UA 4WW0A 4JEHB 5LJNA 4ZEYA 3QB5A 2PBIA 3LSVA 1MMDA 1MMNA 1M7KA 1DU2A 2VL0A 2YEVC 2K9AA 5J0ZA 1IZNB 2DLRA 2AE9A 2L9QA 2WMNA 3CQXC 5LYJE 4EB6E 1X79A 3M65A 3ZSTA 2E2AA 1FEWA 3MJXA 4C90A 3RGLA 4IIJE 2QVAA 3BK9A 1UCUA 3ESLA 4QH5A 4YLHA 5L47A 3CWZB 5HEOA 5LA6E 3KV6A 5JVDE 2HPLA 4GIWA 1YKHB 3L8RA 3GMIA 4ZI3D 1MNEA 3UQ7A 3JC6C 5HXEA 5ADXL 3I9WA 3AXJA 1HNXT 4HTEA 3AA7B 2ZM0A 4UF0A 2NW7A 4YJ2E 3NBXX 5IUXA 3V5SA 2M6BA 4I4TE 2L8KA 1OEDB 3NRXA 3RRWA 4A98A 4CZZB 3T1HT 2JQQA 4X64T 4LFBT 4YJ3E 4AKGA 3P4SA 5JRCA 4IE5A 2F4VT 2FUPA 4JI4T 1ZOYA 3K3QC 2FJAA 4ANJA 4QXCB 3HI2A 2HH7A 1KNRA 2N1GA 2UXXB 4KMCA 2CEAA 3NZPA 5AQVB 5LG4A 3N9NA 5AQUB 4AKHA 3H3MA 3VRBA 4AQGA 5C2TA 4N78D 4EIWA 3PDYA 2UU9T 2X9YA 3PU8A 2MPKA 4E7ZA 3AE7A 2AXDS 3ZN1B 5HEJA 2W00A 3HA4A 3ONXA 4TV9E 4UELA 2YU2A 3KFWX 3OBVE 4OFZA 4HN9A 2VURA 4DV6T 4DR7T 3AVRA 2BZBA 5DJQC
chains in the Genus database with same CATH topology
3Q5EA 1Z8UA 1W0AA 3QNUA 3IA3A 3OVUA 4IDNA 4IDQA 4IDOA 4IDPA 3X1DA 3Q5DA 3QOFA 1W0BA 1Y01A 1XZYA 1W09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5E A;  1Z8U A;  1W0A A;  3QNU A;  3IA3 A;  3OVU A;  4IDN A;  4IDQ A;  4IDO A;  4IDP A;  3X1D A;  3Q5D A;  3QOF A;  1W0B A;  1Y01 A;  1XZY A;  1W09 A; 
#chains in the Genus database with same CATH topology
 3HKE E;  2CWY A;  3EUH A;  2IC6 A;  3H37 A;  2J1D G;  3HR0 A;  1IJ6 A;  5FL0 A;  1HR0 T;  2BVM A;  3PJA A;  4EAH A;  3RHW A;  3OTO T;  4IDN A;  3SWH A;  3CIR A;  3UU4 A;  3UQ4 A;  1YKE B;  2HHH T;  1H7C A;  1VCS A;  2X68 A;  3TLS A;  1HFA A;  4EGW A;  4NIQ A;  3T1Y T;  3ZMZ B;  4H9O C;  4GKK T;  3CQG B;  4GYR A;  2EHO C;  3ZC1 A;  3TLW A;  3HKB E;  3OPC A;  2WWV A;  4HWD A;  4CXX A;  4EZ4 A;  2VVS A;  3ZSS A;  4ZZC A;  3CVR A;  2RPA A;  2WAU A;  3PU3 A;  1E1H B;  3N2O A;  4Z8X A;  3CML A;  4EEB A;  1N32 T;  5AQJ B;  1W9R A;  4ERR A;  1YW0 A;  1QLB A;  5LGT B;  1YD8 G;  3TLV A;  2L3L A;  3V5U A;  3U3I A;  1Z8U A;  2PTF A;  1T8B A;  3GA8 A;  4JI8 T;  5JTG A;  4U31 A;  3F31 A;  1KF6 A;  4IE0 A;  2K5B B;  3O1H A;  1FIO A;  2YDR A;  3PJA J;  4QXH B;  5ABF B;  2C0S A;  4LF8 T;  3CKD A;  3EAM A;  4DVD A;  1MIW A;  2Q9Q B;  1D1C A;  4DID B;  3BQI A;  3CX8 B;  2LSG A;  3ETU A;  3F57 A;  4KHZ F;  2MYS A;  2XHE B;  2CHN A;  4DBR A;  2UUA T;  4PJL A;  2WWU A;  5HXC A;  4YHJ A;  4ZHQ E;  4IDP A;  1HX1 B;  5LBQ B;  4X1Y E;  4BA9 A;  1US7 B;  3AB3 B;  5EK2 A;  4DR2 T;  1FMW A;  3OYX A;  3UUN A;  3UT5 E;  5L4H A;  4LF9 T;  1LVF A;  2WS3 A;  3O1I A;  4P0B A;  3J7Y q;  4U7Y A;  4JI1 T;  4IE4 A;  1G73 A;  1D1B A;  1JNR A;  2PJQ A;  2IDO B;  3P4W A;  5HEG A;  3FZL B;  3J9X 1;  5HYA A;  2KWI B;  4GYS A;  4P1N A;  5HAX A;  2UXC T;  2XQY A;  3AE3 A;  4DR1 T;  3LDQ B;  5L3E B;  2JQK A;  1B7T A;  2A9U A;  3JAF A;  2D9D A;  4HFD A;  1WR0 A;  3TLT A;  2VKJ A;  3ZCJ A;  2W61 A;  5FMN A;  2CCQ A;  2YK0 A;  1KFY A;  2WB5 A;  5LP6 E;  4IGU A;  4BJM A;  4HFB A;  1KNP A;  3FHN A;  3OKQ A;  1SHZ C;  1EZ3 A;  2WSS V;  4I43 B;  2CLY C;  2W62 A;  5AFU L;  4H9Q C;  4X62 T;  4AQY T;  5LNK A;  1NWM X;  3ZMV B;  2PFV A;  1WYB A;  2XAF B;  3AE5 A;  3UTK A;  2SPC A;  1UK5 A;  4HFH A;  2XSB A;  4CI3 B;  3N9M A;  4GK0 E;  5FXV A;  1HTJ F;  3JAE A;  3AEG A;  5JDH A;  4X5T A;  2BDE A;  1IAP A;  2LKH A;  2NP9 A;  3PE0 A;  3ZYM A;  2BG9 A;  5L4E A;  3RKO A;  2ZM8 A;  4QH4 A;  4OHF A;  4JV5 T;  2MTQ A;  4DUZ T;  3RX6 A;  3D0T A;  1NEK A;  5FVK A;  3IBP A;  2OV9 A;  2E9X B;  4ASK A;  3AAI A;  4Z91 A;  5CFB A;  4KBM B;  2XAH B;  5L3C B;  3AA6 B;  2Y6X A;  1XMQ T;  4B3M T;  4AKR B;  4YSX A;  2UUB T;  3C64 A;  2V8S V;  4NXN T;  1KEY A;  2IAK A;  1VOM A;  3B57 A;  3LBX A;  2VQE T;  5FY1 A;  4YTP A;  1BR1 A;  3R6N A;  2VKH A;  2XAS B;  2XUE A;  2JPF A;  2XAQ B;  3IHR A;  5HWY A;  3NRY A;  3ZT6 A;  2WMO A;  3L09 A;  2CXD A;  2H89 A;  2W4X A;  4H9S E;  1W0B A;  1T72 A;  2JMH A;  3AE6 A;  2YIN A;  4ZOL E;  3VKG A;  1HCI A;  1QSD A;  4MLK A;  5AQP B;  5HWX A;  5E0O A;  2CBJ A;  3MK7 C;  2VK9 A;  3RPU A;  4A97 A;  4OYK A;  3RYI E;  3C51 A;  3OVU A;  3UU6 A;  1MIY A;  1VRB A;  2WDV A;  4AQF A;  4DV4 T;  3KV5 A;  4LF5 T;  2XQ9 A;  5EZY E;  5JR9 A;  3FZK B;  3T8O A;  1XZY A;  3CX7 B;  2A3D A;  4H9N C;  5LHI B;  2NTX A;  4NPP A;  3KDS E;  2E8I A;  3NKZ A;  1UX5 A;  4TNV A;  4DV3 T;  2EHO B;  4WNK A;  5EK4 A;  2N2N A;  4O4I E;  2WBL A;  4GK5 E;  2VQF T;  4ZS3 A;  5AQH B;  3LK4 2;  3Q5W A;  5DAB A;  3WAJ A;  2BG9 C;  3VKH A;  3B13 A;  2ACZ A;  4Z90 A;  2WP9 A;  4CN4 A;  3Q2M A;  3FZM B;  4UVB B;  3PUR A;  5AQO B;  3AE1 A;  3JAD A;  1WLX A;  2BVL A;  5AQN B;  1BR0 A;  2IC9 A;  3I1A A;  3H3A A;  1V9D A;  5F8P A;  1Y64 B;  3UUB A;  3GWH A;  4LMK A;  2WY2 A;  4IRE A;  3C4W A;  3EHZ A;  3NZQ A;  3Q5X A;  4O2B E;  2DWG A;  4L0R A;  3PUW F;  1KNZ A;  3ABV A;  1WRD A;  3CPZ A;  3WI3 A;  3QNU A;  3N9P A;  5AQQ B;  3MZK B;  3ANW B;  3BQK A;  2D0T A;  4HEA A;  4B3R T;  4DMW A;  4HKA A;  3KBU A;  4CQI A;  3K3N A;  2DL1 A;  3PUQ A;  4HFV A;  2JRK A;  2ES0 A;  4U7I A;  1SUM B;  3AEC A;  2X9H A;  3I0Q A;  4IL4 A;  2NR4 A;  5JR9 C;  4F8H A;  5H6R B;  4WYV A;  3ZMU B;  5AQL B;  4EV6 A;  4EYU A;  5FXZ A;  3KBT A;  1I6Z A;  5KDM C;  2D5U A;  1UX4 A;  5CA0 E;  2W67 A;  1WFD A;  1OED A;  2VL8 A;  4CXW A;  2Q9Q D;  1ZP0 A;  1OXZ A;  2YDQ A;  4JUY A;  2BS2 A;  5LXT E;  5ABE A;  3RH3 A;  2RP4 A;  4CXY A;  5BR8 T;  1W0A A;  5AQR B;  2M67 A;  2YOE A;  1XWM A;  5IHY A;  4UEM A;  5L3B B;  1MMA A;  2CXL A;  3EVY A;  2ZMA A;  4QXB B;  2FJE A;  2I0M A;  3ZN0 B;  3FBZ A;  4H63 H;  4GOU A;  4XZC A;  1Y01 A;  3AAE B;  4H9P C;  2Y48 B;  1LVK A;  4I0U A;  4IHJ E;  3ETV A;  2CA5 A;  4O4H E;  4FI5 A;  4COF A;  4B3S T;  2BKN A;  1XDP A;  2XJ7 A;  4NUU A;  5FKY A;  2Z6E A;  4QWN B;  4B3T T;  1MMG A;  2OLT A;  1IBK T;  2PG8 A;  5FYM A;  5CJ5 A;  5LB7 B;  2V6Y B;  2BKO A;  3N9Q A;  4JEU B;  4JLE A;  3I0O A;  3AA0 B;  5LHG B;  3AAA B;  2LM2 A;  3ZCI A;  3AEB A;  2X9W A;  4TWH A;  1J5E T;  3KV9 A;  3P8C D;  2JIW A;  3A7M A;  3AE8 A;  1GQE A;  4CN6 A;  3AA1 B;  2V7I A;  3KVA A;  2ZM2 A;  2J62 A;  4MHC A;  4QX8 B;  5KX5 E;  3K8P C;  2XY8 B;  4JI3 T;  2VAS A;  1LKX A;  3C98 B;  5JDG A;  2H88 A;  1UGO A;  4M1P A;  3Q5D A;  3SS1 A;  5L3G B;  4WBN E;  4XAX B;  2K24 A;  3U78 A;  5L3F B;  1G8X A;  3QC9 A;  2VKD A;  4YHH T;  3CQC B;  2X0H A;  4QHO A;  4KP3 C;  4ZXL A;  2LKG A;  1U5P A;  4BJN A;  3FBL A;  4ZI2 D;  2XSA A;  2W2U A;  2CM0 A;  4PW8 A;  2JMK A;  4UR9 A;  3UUX B;  1OED C;  2CMR A;  4TUY E;  4K0K T;  3FB2 A;  3RC8 A;  4JYA T;  1FMV A;  4YFS A;  5LMN T;  4NUV A;  4PK5 A;  3UUM A;  2KIN B;  4AIS A;  3GN5 B;  4QX7 B;  2DNX A;  1J5W A;  2LSK A;  4U2Z A;  2IML A;  3ZT5 A;  3VR8 A;  3N9O A;  3RYC E;  2E9X D;  3PUS A;  4DV5 T;  3AE4 A;  2LRK A;  2CRB A;  1YQ3 A;  4TN7 B;  2XQ5 A;  5J2U E;  4LFA T;  4HWH A;  3ZKR A;  3PV0 F;  5ABF A;  5JDF A;  3FXD B;  2H7V C;  4PFP A;  2KLQ A;  1E2A A;  2BBH A;  2Q9Q A;  2XPK A;  3RQW A;  2NTY A;  1U4Q A;  2UUC T;  2CHO A;  4KX6 A;  2V7L A;  3A8Y C;  1WCR A;  4DV0 T;  2FBW A;  5ABH A;  3UFG A;  3RYH E;  5CB4 E;  2CE7 A;  2WCA A;  1D0Y A;  4MBQ A;  4YSY A;  4UIG A;  4YTM A;  4PAG A;  2WDR A;  4X66 T;  3MKD A;  3KIN B;  2QGS A;  3P4Q A;  3HKD E;  1CHU A;  5CA1 E;  3C50 A;  2VKO A;  5HXS A;  2X0L B;  1D0X A;  2ODV A;  3PUG A;  3P4P A;  2LRL A;  2LSJ A;  3NVO A;  2CBI A;  3LG7 A;  5DQV A;  3VHL A;  2BBJ A;  1UUR A;  2C5K T;  2D2S A;  4TX5 A;  1MIV A;  4J2C A;  4X1K E;  4HWF A;  1YQ4 A;  3JCF A;  1SE7 A;  4DR5 T;  3LFM A;  5F5W A;  1R8I A;  2QRX A;  4I50 E;  3DTO A;  3ZJ1 A;  4TV8 E;  1S94 A;  4YTN A;  3Q9D A;  3N2K E;  3SFE A;  3O4X E;  4JBW F;  3ZMT B;  5LGU B;  4P0A A;  5TAO A;  2VB6 A;  2QYW A;  3L3P A;  4CI2 B;  2W63 A;  2IW5 B;  3ZJ2 A;  3E0Z A;  4AKL A;  2RA1 A;  5FL1 A;  4IDQ A;  3BQL A;  2VWA A;  2NW9 A;  4YSZ A;  2WDQ A;  1HNZ T;  2CPT A;  5HXR A;  2A2F X;  5JQG E;  5LG3 A;  2Q9Q C;  3ZC0 A;  4JI2 T;  1M62 A;  3SRZ A;  5L2L A;  4DMV A;  2XAG B;  3K3O A;  1I94 T;  1KK7 A;  3UU8 A;  4TNW A;  3VRA A;  4DV1 T;  4IDO A;  3RC3 A;  3MA9 A;  4U74 A;  4AIU A;  2V26 A;  4MAL A;  3ZT7 A;  2XQ3 A;  5ABG A;  5AQK B;  1HS7 A;  4L5G A;  4CI1 B;  4IE6 A;  2E9X A;  3ONL C;  3R84 B;  3EAB A;  4DV7 T;  2KWH A;  3X1D A;  3EI0 A;  4BAY B;  4IE7 A;  4LFC T;  4A5X A;  3OJA A;  5JH7 E;  1D0Z A;  1ZHC A;  2E5L T;  3RKG A;  2X0Y A;  2W66 A;  2B1E A;  4DR4 T;  4PJM A;  2XTL A;  2HN2 A;  4EXT A;  3PUY F;  3L39 A;  4KHP T;  3CK6 A;  3AXJ B;  4WZX A;  4UF0 B;  5KXJ A;  2LHN A;  3RYF E;  3VU7 H;  1UUS A;  5LOV E;  5GON E;  2X51 A;  3ZYK A;  4DR6 T;  2V5C A;  4U33 A;  1XNQ T;  3KV4 A;  2YKS A;  4MFR A;  2YN6 A;  2DHR A;  3SFD A;  1ZEE A;  4HWC A;  4UVA B;  5LGN B;  3LK2 B;  3I9Y A;  4IL9 A;  2LEH A;  2XQ8 A;  5JRC B;  2WU2 A;  4DR3 T;  3N9L A;  2NOX A;  4A56 A;  5AQT B;  4TWF A;  4ZZB A;  2KND A;  1IBL T;  5AQS B;  4O2A E;  1T98 A;  1XMO T;  2G0U A;  3B5M A;  3O1J A;  3S4U A;  2J4G A;  4E7S A;  4ZI2 C;  3N2G E;  2MOZ A;  1D1A A;  5C3J A;  3RIA A;  4PK4 A;  3ZEF B;  5ETW A;  4EZH A;  3CX6 B;  1BR2 A;  2EHO A;  2C5I T;  2LHR A;  2ZM6 T;  1S35 A;  4JI7 T;  3C4X A;  4KI0 F;  2VVN A;  2WM9 A;  5FXX A;  4EED A;  2HN1 A;  2XAJ B;  4PNI A;  4DND A;  1SA0 E;  3EDU A;  1N33 T;  4DO0 A;  3QB5 K;  5LCY A;  3UU5 A;  2KMF A;  2E9X C;  3QOF A;  4ILU A;  4AQF C;  4ILB A;  3RI5 A;  1YXR A;  4U72 A;  2ZLY A;  2C5J A;  5M4Y A;  2X67 A;  3N5L A;  4HFC A;  5FXW A;  2V1D B;  5FNV E;  3RIU A;  3AEF A;  4Q25 A;  3ZMS B;  2BG9 E;  4PJJ A;  3UU3 A;  2X9X A;  3PUV F;  3OYZ A;  2FJB A;  3ZLI A;  2YDS A;  2LJL A;  4YY3 T;  1XNR T;  2BS4 A;  3HKC E;  1AJ3 A;  4ILC A;  3ANW A;  3AVS A;  4QH1 A;  4JI6 T;  5JDL A;  4LF7 T;  4FJO A;  3UUL A;  2V7J A;  4ILA A;  2KSR A;  2MBG A;  2NW8 A;  5AQF B;  4TWD A;  1OWA A;  3IF8 B;  4ZS2 A;  2IIU A;  2LOP A;  2NWB A;  5LJM A;  2H7O A;  4LMJ A;  1XDO A;  2LLY A;  3PTR B;  4X20 E;  3QUJ A;  3DJB A;  2V7K A;  2A72 A;  1FJG T;  3O9X A;  5JRE A;  3P4R A;  4IT4 A;  4AI6 A;  4P09 A;  2KZ7 B;  2LOS A;  5DQW A;  3EDV A;  2Y8D A;  4G2A A;  4PJN A;  2CLY B;  4H63 V;  2DCF A;  3AED A;  4O4J E;  4DUY T;  3VR9 A;  2N9D A;  1IJ5 A;  4OYJ A;  2XQ4 A;  5LMU T;  4PK6 A;  3M3Z B;  1WR6 A;  4O4L E;  2P9B A;  3RQU A;  3FXE B;  5AQG B;  1BR4 A;  4H9R C;  3P7I A;  1HNW T;  4GKJ T;  4PFO A;  5HCM A;  4B6X A;  2V7M A;  3WAK A;  3LK3 B;  2X66 A;  1HF8 A;  3RIU C;  3FZF B;  1X9B A;  4KUM B;  3K1S A;  5AQI B;  3Q5E A;  2DI4 A;  2B76 A;  2M6I A;  3KVB A;  3SOL A;  4LF6 T;  3F2E A;  5IYZ E;  5LBM A;  5FVL A;  1N36 T;  2XQ6 A;  3A5X A;  2LSI A;  3RIF A;  4EOZ B;  2XZE A;  4V1A v;  3MAC A;  4DBQ A;  3JC6 D;  5EK3 A;  2V6Y A;  4HGA A;  3QK6 A;  2DWK A;  5J1G A;  1HX8 A;  1MND A;  2K3W A;  4HFE A;  3TKL B;  4EYY R;  1JNZ A;  3FZH B;  1ZKE A;  1IBM T;  3C4Z A;  1O3X A;  2LSY A;  4CN1 A;  2IUB A;  4K0U A;  3NWI A;  3G06 A;  5HEH A;  4WBO A;  3ONJ A;  1CUN A;  1QUU A;  1N34 T;  2K48 A;  4U2Y A;  4G63 A;  4ISS A;  3AEE A;  3AE9 A;  1LRZ A;  3TLU A;  1J1J A;  4X65 T;  2FJD A;  4UV8 B;  2XQA A;  5AQM B;  4JI5 T;  5HXH A;  4UXN B;  2WZI A;  1ZV4 X;  5FY7 A;  2LT3 A;  3P50 A;  5JDQ A;  3UFE A;  5J2T E;  5LHH B;  2WZH A;  4C91 A;  2I6H A;  2E5V A;  1Z0P A;  1W09 A;  3DP7 A;  2GK9 A;  4HWI B;  3E08 A;  3GN5 A;  2XM2 A;  2YU1 A;  5FY0 A;  5HEU A;  5FP3 A;  2V6X A;  2BG9 B;  3PUA A;  2KXP B;  1OED E;  1T7S A;  2ODU A;  4AXP A;  3IA3 A;  4TZ4 C;  1L0V A;  3ZYL A;  4OX9 T;  2XM1 A;  5BMV E;  2LM9 A;  2XQ7 A;  2I59 A;  2R6G F;  4ZI3 C;  5CGM A;  5A1L A;  2W0G A;  1NAF A;  4U3C A;  2CXF A;  3LJC A;  1E7P A;  2BS3 A;  2QA7 A;  4IDZ A;  2EHO D;  2CWO A;  2BKP A;  5H6Q B;  4QKN A;  4LF4 T;  4AKI A;  2ACX A;  3LBX B;  4OK0 A;  2UXN B;  3E22 E;  2JJ9 A;  2JQH A;  2J47 A;  5F3J A;  3RLF F;  3IEE A;  3RRC A;  4LML A;  4JI0 T;  3PUZ F;  3RF1 A;  3PUX F;  4NXM T;  2UXB T;  5KMG P;  4YXD A;  2H3R A;  4ADZ A;  3AEA A;  3AE2 A;  4HFI A;  3MXZ A;  1HG5 A;  2JQ9 A;  4HE8 A;  5L3D B;  4XBF B;  2OA5 A;  2MAW A;  2IHR 1;  2KT9 A;  3HL6 A;  5JR9 B;  1WYC A;  4L9I A;  5C8Y E;  2WU5 A;  1HG2 A;  5JDN A;  4I55 E;  5IWA T;  5HCJ A;  1NEN A;  4X1I E;  2UXD T;  4IST A;  4O8S A;  5JDM A;  4DV2 T;  3ZPO A;  4UVC B;  2LE8 A;  4UV9 B;  2WQY A;  4F6R C;  4YT0 A;  2HPJ A;  4ZI7 E;  2V5D A;  3W15 B;  1VCT A;  2D0U A;  4WW0 A;  4JEH B;  5LJN A;  4ZEY A;  3QB5 A;  2PBI A;  3LSV A;  1MMD A;  1MMN A;  1M7K A;  1DU2 A;  2VL0 A;  2YEV C;  2K9A A;  5J0Z A;  1IZN B;  2DLR A;  2AE9 A;  2L9Q A;  2WMN A;  3CQX C;  5LYJ E;  4EB6 E;  1X79 A;  3M65 A;  3ZST A;  2E2A A;  1FEW A;  3MJX A;  4C90 A;  3RGL A;  4IIJ E;  2QVA A;  3BK9 A;  1UCU A;  3ESL A;  4QH5 A;  4YLH A;  5L47 A;  3CWZ B;  5HEO A;  5LA6 E;  3KV6 A;  5JVD E;  2HPL A;  4GIW A;  1YKH B;  3L8R A;  3GMI A;  4ZI3 D;  1MNE A;  3UQ7 A;  3JC6 C;  5HXE A;  5ADX L;  3I9W A;  3AXJ A;  1HNX T;  4HTE A;  3AA7 B;  2ZM0 A;  4UF0 A;  2NW7 A;  4YJ2 E;  3NBX X;  5IUX A;  3V5S A;  2M6B A;  4I4T E;  2L8K A;  1OED B;  3NRX A;  3RRW A;  4A98 A;  4CZZ B;  3T1H T;  2JQQ A;  4X64 T;  4LFB T;  4YJ3 E;  4AKG A;  3P4S A;  5JRC A;  4IE5 A;  2F4V T;  2FUP A;  4JI4 T;  1ZOY A;  3K3Q C;  2FJA A;  4ANJ A;  4QXC B;  3HI2 A;  2HH7 A;  1KNR A;  2N1G A;  2UXX B;  4KMC A;  2CEA A;  3NZP A;  5AQV B;  5LG4 A;  3N9N A;  5AQU B;  4AKH A;  3H3M A;  3VRB A;  4AQG A;  5C2T A;  4N78 D;  4EIW A;  3PDY A;  2UU9 T;  2X9Y A;  3PU8 A;  2MPK A;  4E7Z A;  3AE7 A;  2AXD S;  3ZN1 B;  5HEJ A;  2W00 A;  3HA4 A;  3ONX A;  4TV9 E;  4UEL A;  2YU2 A;  3KFW X;  3OBV E;  4OFZ A;  4HN9 A;  2VUR A;  4DV6 T;  4DR7 T;  3AVR A;  2BZB A;  5DJQ C; 
#chains in the Genus database with same CATH homology
 3Q5E A;  1Z8U A;  1W0A A;  3QNU A;  3IA3 A;  3OVU A;  4IDN A;  4IDQ A;  4IDO A;  4IDP A;  3X1D A;  3Q5D A;  3QOF A;  1W0B A;  1Y01 A;  1XZY A;  1W09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...