1EZ3A

Crystal structure of the neuronal t-snare syntaxin-1a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
124
structure length
124
Chain Sequence
b'RDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTAXIN-1A
publication title Structural analysis of the neuronal SNARE protein syntaxin-1A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 59
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ez3A00
1FEWA 2DNXA 4JEHB 1HS7A 1FIOA 1BR0A 3LG7A 5LG4A 1S94A 1EZ3A 1G73A 3C98B 4TX5A 2XHEB 5M4YA 4JEUB
chains in the Genus database with same CATH superfamily
4JI0T 1YKHB 4H63H 3KV4A 3RPUA 3CX8B 4IE6A 2E9XD 3E08A 2KSRA 1R8IA 3RF1A 4PJJA 1UX5A 2W63A 4JI3T 2PG8A 2VURA 2JQHA 3AXJA 4DV5T 4JBWF 3PURA 3DTOA 1KEYA 1ZV4X 4ILUA 5AFUL 5LMNT 4EYUA 2D0TA 4IREA 5JDFA 2ODUA 4U33A 3RYIE 4DV6T 3LSVA 1XNQT 1US7B 2XQ3A 2M6BA 4ZI3C 3JC6D 2K3WA 1WR6A 3HI2A 3MJXA 2N9DA 3ESLA 5FP3A 2V7MA 4QH4A 2VL0A 3RIUA 5EK4A 3M65A 5L3EB 5IWAT 1QUUA 4GIWA 5EK3A 4KMCA 4DV0T 3N2OA 3NKZA 4AI6A 4DR6T 4PJNA 2BBHA 5KDMC 2J62A 2CXFA 3Q5EA 2NW9A 5FNVE 2HH7A 5AQFB 3ZPOA 3P7IA 1MMGA 5FVLA 3GN5B 3UFEA 2YOEA 3EI0A 5AQJB 5AQKB 2MOZA 4KX6A 1KNZA 3ZN0B 2QVAA 4C90A 1N34T 3NBXX 4G2AA 5KMGP 5ADXL 2H3RA 2LKGA 2MYSA 3ZC1A 4JUYA 3F31A 2M6IA 3R6NA 3WI3A 4YSYA 5FXWA 2HPLA 2C5KT 4IL9A 3ZMTB 4KBMB 1E1HB 2WWVA 2XAGB 2H7OA 3M3ZB 2CLYC 4UVBB 5GONE 2V6YA 4TWFA 2VQET 1HF8A 3K3QC 2DHRA 1FMVA 3OVUA 2XM1A 2CHNA 4DR3T 3RQUA 1T8BA 3OKQA 4IE5A 2HN1A 2KXPB 4Z91A 4TZ4C 4CXWA 4ZI2C 4HGAA 3TKLB 2KWIB 2YINA 3SS1A 2BKPA 3W15B 2X0YA 1LKXA 4HFHA 1HS7A 3ZJ1A 3SRZA 4B3ST 4DV4T 2WDRA 2L9QA 3FB2A 3AEFA 3ZJ2A 4X1KE 4U7IA 2XSAA 2CXDA 1D1CA 3RRCA 4ZOLE 4YSZA 5JDQA 3WAJA 5L3BB 1ZHCA 3O1HA 1IJ5A 3N9MA 4LFCT 5LJMA 1G73A 3MK7C 2MPKA 3QB5A 1XWMA 4YFSA 1QSDA 3ZEFB 2XAQB 1UGOA 2MAWA 3KBTA 3VR9A 4AQFA 3AE5A 3GWHA 3CIRA 3VRBA 4PK5A 4UV8B 4NUVA 3TLWA 2JQQA 4LF5T 3CVRA 2CLYB 4V1Av 2V5DA 5ABFA 2OA5A 1G8XA 4AKHA 3A7MA 5AQHB 4CQIA 4DMVA 5BMVE 2YK0A 3LK2B 1T72A 3N9PA 3AE1A 3LK42 4H9NC 2X0LB 2Q9QD 1X9BA 2F4VT 2ES0A 3FZKB 4WYVA 4YXDA 4H9PC 1IJ6A 2BG9A 3AVRA 3K1SA 3I9YA 5LB7B 4IE0A 2WZHA 2BS4A 4H9SE 4IL4A 4JEHB 5JDMA 5AQTB 3ZT6A 3CMLA 2VVSA 4MALA 2UXCT 2LOSA 1S35A 2NP9A 4UVCB 4HN9A 4UVAB 4YTPA 2XASB 4EGWA 3LJCA 2X9YA 2E5LT 1OEDE 4O8SA 4LF4T 5LHHB 2CXLA 5JREA 2XQAA 2RPAA 3TLVA 2XUEA 4GK5E 5JDHA 2BVMA 3IF8B 5ETWA 5FXVA 1KNRA 4ZS3A 2ZM8A 3PUGA 3PUQA 1ZOYA 4QKNA 1HR0T 5LGUB 2D2SA 1IAPA 3ZMSB 3TLTA 2PBIA 2IDOB 2A72A 4XBFB 4O4JE 3HA4A 3B13A 4DV7T 5JDLA 1SE7A 4JI1T 2Y6XA 2V26A 5BR8T 5L3CB 2UUAT 4DV2T 3AXJB 3A8YC 3ETVA 1MIWA 2E9XA 4IDQA 1AJ3A 3EHZA 1XZYA 4WZXA 5DQVA 5LMUT 3QNUA 3SFDA 4EV6A 4JI8T 2Z6EA 3CQGB 2QGSA 1Z0PA 2NW7A 2VWAA 3O4XE 4YJ2E 1KNPA 2B76A 2V5CA 2VKDA 3Q5XA 3ANWA 3K3OA 5LNKA 5HXSA 2YDRA 4QXCB 3CQCB 3N5LA 4WNKA 5FY7A 3GMIA 2NTYA 4ZZCA 3L09A 4ISTA 1HCIA 4OYJA 3ZLIA 5JVDE 2WY2A 5C8YE 5M4YA 3SWHA 3C50A 2BZBA 5AQIB 5L3DB 4PJLA 1T7SA 4TV9E 1HNXT 4CZZB 2LSYA 2CWYA 1VRBA 3BQLA 3VU7H 3HKCE 3MA9A 3T8OA 4GYRA 2D5UA 2BKNA 4LMKA 4HKAA 4IDNA 4G63A 4TV8E 3P4PA 3C4WA 4HWCA 4IGUA 4ILCA 4X64T 2AE9A 1NWMX 2X9XA 2ZM0A 3P8CD 5HXEA 1QLBA 5JDGA 5KXJA 4XZCA 4A56A 4ZI3D 4DV1T 1MIVA 4AQFC 5L47A 4YTMA 4BJNA 2EHOD 3ONXA 1XDPA 5FYMA 4IE7A 4QHOA 4TNWA 1J5ET 2BDEA 2V6YB 2WU2A 4PW8A 3JADA 3AE2A 3E0ZA 5HEJA 5C2TA 4HWFA 4JI7T 3ONLC 5AQQB 3FZFB 1DU2A 2G0UA 1SHZC 5AQVB 5JR9A 1D1AA 2WMOA 3ZYLA 3KVAA 4JI5T 4DUZT 2IMLA 4JLEA 4EZHA 2BG9C 3PU3A 4Z90A 2CCQA 4DV3T 3CWZB 2BKOA 3FXEB 5LYJE 4HFDA 2H88A 5LHGB 4HFEA 4ERRA 2P9BA 4JI2T 3UU4A 5L3GB 2DLRA 4ISSA 2VKOA 2WZIA 4N78D 4P0BA 1YQ4A 4AQGA 5LJNA 2WS3A 2QRXA 4EZ4A 1W09A 2DWKA 4HFIA 5HWXA 4HTEA 1WCRA 4CN1A 4YLHA 4B3RT 2V1DB 4JYAT 2CBIA 4X1YE 1CHUA 5F5WA 5EK2A 3AE7A 3C98B 3SOLA 3ZKRA 2V7KA 3FZHB 3Q2MA 2K5BB 4CI2B 3O9XA 2JRKA 2RA1A 4IDPA 2LEHA 2X0HA 1O3XA 3ZMUB 5ABFB 2Y48B 2IAKA 3EVYA 2FJDA 5J1GA 4TWHA 1X79A 3L8RA 3JAFA 1I6ZA 2BS3A 2IUBA 2E9XC 2NWBA 2A3DA 5L4EA 4U74A 3IA3A 3OYXA 3UQ7A 2HHHT 4J2CA 4UXNB 5CA1E 4FJOA 3Q5DA 3RI5A 3RHWA 3HKEE 2BG9B 4U3CA 3U78A 2Q9QA 5HCMA 2FJBA 2E5VA 2YDQA 3FXDB 3C64A 4PAGA 2J4GA 2X9HA 3JC6C 3QC9A 3PUZF 3UULA 2BVLA 3RKGA 2XQ4A 4CI1B 3P50A 4QWNB 3KV6A 3KVBA 2WP9A 1W0AA 3B5MA 3BQKA 4COFA 2XQ8A 5F3JA 4YSXA 2YU1A 3WAKA 5H6QB 2DWGA 4ASKA 1D1BA 4AISA 5LXTE 3P4WA 3PUSA 1N33T 1IBMT 3UT5E 3AA7B 4P0AA 2KT9A 5CGMA 3OTOT 3N2KE 4P1NA 5ABEA 2AXDS 4LF8T 1UURA 3CQXC 3S4UA 2C0SA 3IHRA 3SFEA 1MIYA 3A5XA 1GQEA 3RYCE 4PK4A 2I59A 2LSJA 4IDZA 2E9XB 3NVOA 3JCFA 1IZNB 3AEEA 2WBLA 3F2EA 2XPKA 4EEDA 2WM9A 5J2UE 4GOUA 4IHJE 3TLUA 1YXRA 3IBPA 4O4IE 2WDQA 5DABA 3ANWB 4WW0A 4EYYR 4LFAT 5JR9C 1CUNA 3I0QA 2VB6A 4AKGA 2LKHA 3N9QA 3VKHA 4DNDA 4K0KT 4ZI7E 4PK6A 2VL8A 1WYBA 3ZN1B 1T98A 1D0XA 3RX6A 2ZM6T 3NRYA 3CKDA 1MNEA 2C5JA 4DBRA 4Z8XA 4B3MT 3P4SA 3AE3A 1UX4A 2V7LA 4UF0A 3HKDE 3AEDA 3EUHA 3NWIA 3ZCJA 4GKJT 3N2GE 1FEWA 2FUPA 5L2LA 1U4QA 3CK6A 5J2TE 2BS2A 2CBJA 5AQRB 2OLTA 5A1LA 5FMNA 4BJMA 3RIUC 5AQLB 3NZPA 3MACA 4YHHT 2XHEB 3X1DA 4E7ZA 4X20E 3D0TA 3DP7A 4ILAA 3BQIA 2L8KA 2CMRA 3AECA 2LHNA 2YN6A 2VKJA 3OBVE 2QA7A 2EHOA 1NENA 3PDYA 4KHPT 1ZP0A 1WLXA 3ZMVB 3RIFA 4EEBA 3MZKB 2WWUA 5JR9B 4DUYT 4LF7T 3G06A 3FBLA 3AE8A 2UXXB 5HAXA 1IBLT 3P4RA 3AAAB 5F8PA 3FBZA 3KV5A 4UR9A 4UIGA 2XAJB 1WR0A 3N9OA 5HWYA 2DNXA 5HXRA 5JQGE 2Q9QC 2K9AA 2W0GA 2V7JA 3RIAA 2FBWA 3VR8A 5HYAA 1M7KA 4PJMA 4HWDA 3RYHE 1WYCA 4ZHQE 5H6RB 3VHLA 2UU9T 5FY1A 4ZS2A 1N36T 3ZC0A 5EZYE 1YQ3A 5L3FB 5LGNB 3C4XA 5TAOA 1IBKT 4HWHA 5DQWA 2LSKA 2W4XA 1W0BA 3ZYMA 2W66A 2J47A 1NAFA 5LOVE 3UFGA 2N1GA 4DIDB 3L39A 3Q9DA 4E7SA 1HG5A 2V6XA 3UUNA 3OPCA 4PFPA 4X5TA 2XJ7A 1OXZA 3AE9A 3HR0A 2N2NA 1MMNA 2LE8A 1YKEB 4ILBA 3V5SA 4ANJA 2RP4A 4DR1T 2ZMAA 3ZSTA 3CX7B 3O1IA 1OEDA 4A98A 2ACXA 5LA6E 3K8PC 2XQYA 3UUMA 3FHNA 1Y01A 4I55E 3I9WA 2IC6A 1EZ3A 2HPJA 4X65T 2WDVA 3UU6A 1HTJF 3PU8A 2MBGA 2BBJA 2Q9QB 2CM0A 3RH3A 4I43B 2R6GF 2CEAA 1ZEEA 3ZMZB 1M62A 4IDOA 4WBNE 2LT3A 3KBUA 4B6XA 2PJQA 3C4ZA 5LHIB 3AA1B 4OX9T 3F57A 2WU5A 3RC8A 4YTNA 5LP6E 2C5IT 5LGTB 2WMNA 3EDUA 2LJLA 3RGLA 2ZLYA 5HEHA 3H37A 3RLFF 1SA0E 4PFOA 3AAIA 3PE0A 3KDSE 2H89A 3ZT7A 3AA0B 3UU8A 2X68A 4MBQA 2D0UA 2E8IA 2JIWA 2KNDA 5IHYA 4DR4T 4X1IE 1SUMB 2JQ9A 2W61A 2XQ7A 3Q5WA 4TX5A 4UV9B 1HNWT 2VKHA 4L9IA 2MTQA 3AEBA 1MNDA 3LBXA 3K3NA 2WQYA 5IUXA 5LG4A 4OHFA 2NR4A 4JV5T 4B3TT 4H63V 1WFDA 3FZMB 4U2YA 2IW5B 4CXXA 5AQPB 1B7TA 3ZSSA 4O2AE 5KX5E 2A2FX 2ODVA 1E7PA 5FXXA 2EHOC 5HXHA 3QB5K 1D0ZA 2KZ7B 3U3IA 3UQ4A 3VRAA 5IYZE 1HNZT 4QH1A 2LHRA 3QUJA 2XY8B 2ZM2A 5C3JA 4ZI2D 5CB4E 4HWIB 4GYSA 3L3PA 5HXCA 4EXTA 2IC9A 2XZEA 3AAEB 2XQ9A 4P09A 2W00A 2X67A 3EABA 3MKDA 4TUYE 4JI6T 5JRCA 3CX6B 3BK9A 2K48A 4TNVA 1U5PA 4C91A 1LRZA 1YW0A 4I4TE 4UF0B 5LBMA 1UCUA 4OFZA 1XDOA 3ETUA 2LRKA 2XTLA 5AQUB 1ZKEA 4L5GA 3E22E 3C51A 2LOPA 4EB6E 4HFVA 1J1JA 1S94A 3UU3A 4MFRA 3ZCIA 4DBQA 2KINB 4O4HE 2WAUA 5LG3A 2CWOA 2DCFA 4MHCA 4LF9T 1LVKA 2X9WA 2UUBT 2M67A 4LMJA 4CI3B 4TN7B 3KV9A 4JEUB 4U7YA 2D9DA 2BG9E 2FJAA 4NXNT 4UELA 3NRXA 2EHOB 2W2UA 1OEDC 4DR5T 2IIUA 3RKOA 2LM9A 1KK7A 4KI0F 2PFVA 2LRLA 3HL6A 4ADZA 2A9UA 4DO0A 4QX7B 3PV0F 2E2AA 2KMFA 5FL1A 3CPZA 3AEAA 3IEEA 3V5UA 3RC3A 4I50E 3ONJA 3N9NA 5AQGB 3PUWF 2LM2A 4AKIA 4I0UA 2CA5A 3J9X1 4IIJE 2FJEA 3J7Yq 3TLSA 3PUAA 4X62T 3OYZA 2XQ6A 2GK9A 3LFMA 3AA6B 2KWHA 4YJ3E 3PUXF 5AQOB 5LCYA 1JNZA 3AEGA 1J5WA 3I1AA 2SPCA 3FZLB 3PUYF 5JDNA 4H9RC 1KFYA 2I6HA 5HEGA 3QK6A 3HKBE 3PJAJ 4U72A 1UUSA 3UUBA 2PTFA 3T1YT 4Q25A 3VKGA 2WSSV 1MMDA 2VVNA 4XAXB 1D0YA 4AXPA 1H7CA 4O4LE 4BAYB 5ABGA 4ZXLA 2YEVC 2X66A 2ACZA 1XNRT 2NOXA 2LLYA 1BR2A 1BR0A 1NEKA 4MLKA 3GN5A 1OEDB 2V8SV 4AKLA 2CE7A 4KHZF 5JTGA 1WRDA 4PNIA 5CJ5A 4NPPA 4DR7T 3AE6A 2XSBA 1OWAA 5HEUA 4EIWA 5FY0A 5L4HA 4AKRB 4IE4A 4KP3C 2L3LA 4LF6T 4HE8A 1Y64B 3P4QA 4JI4T 3AE4A 2YDSA 3PUVF 2W67A 4QX8B 1BR4A 1N32T 2KLQA 3NZQA 3ZYKA 4EAHA 2JQKA 4AIUA 4KUMB 4ZEYA 4OK0A 2JMKA 3UTKA 2UXDT 4K0UA 2DL1A 4OYKA 4H9OC 1HX8A 2VQFT 4HFBA 2H7VC 2I0MA 2NW8A 5HEOA 2X51A 5AQSB 5LBQB 1FIOA 3ZT5A 3LDQB 2V7IA 4YY3T 2CHOA 3LG7A 1W9RA 1XMQT 4DMWA 4L0RA 1HX1B 4M1PA 1VCTA 4F8HA 4A5XA 3T1HT 3PJAA 3O1JA 3RRWA 4X66T 3OJAA 5FKYA 2QYWA 3QOFA 5DJQC 3LBXB 3RYFE 5FXZA 4WBOA 2J1DG 4HEAA 4DR2T 3R84B 4YHJA 4NUUA 3RQWA 3ABVA 4IT4A 5CFBA 2UXNB 4CN4A 2LSGA 4A97A 2JJ9A 1MMAA 3H3AA 4YT0A 4AQYT 2YU2A 4NIQA 3DJBA 5CA0E 2DI4A 1FJGT 1YD8G 1FMWA 4UEMA 5J0ZA 2OV9A 1BR1A 4U31A 5JH7E 3GA8A 3I0OA 2VASA 2WB5A 2IHR1 4QXHB 1HG2A 2YKSA 2XAHB 4FI5A 3N9LA 3PTRB 3MXZA 3AVSA 4GK0E 3B57A 3JAEA 1Z8UA 2XM2A 1V9DA 4CN6A 2CPTA 5JRCB 2XAFB 2XQ5A 3UUXB 2JMHA 2B1EA 4EOZB 4LFBT 1XMOT 4LMLA 2UUCT 2W62A 4U2ZA 2HN2A 4QH5A 2NTXA 3UU5A 5AQNB 3KFWX 4DVDA 4F6RC 5E0OA 3EDVA 1VCSA 5FVKA 2VK9A 4GKKT 1HFAA 2WCAA 5HCJA 1VOMA 4O2BE 4HFCA 1KF6A 3AB3B 2JPFA 5ABHA 2UXBT 5FL0A 2K24A 3H3MA 1UK5A 1LVFA 2LSIA 3LK3B 2Y8DA 1E2AA 4TWDA 1L0VA 2CRBA 3KINB 4H9QC 1I94T 5AQMB 4ZZBA 3EAMA 4QXBB 1JNRA 4BA9A 4NXMT 4CXYA
chains in the Genus database with same CATH topology
2KINB 3O4XE 2C5JA 1YKHB 4O4HE 4YJ2E 2WAUA 4H63H 4DBRA 3KV4A 2CWOA 2DCFA 4Z8XA 3RPUA 2VKDA 3CX8B 4IE6A 4MHCA 3Q5XA 2E9XD 3E08A 3ANWA 3K3OA 1UX4A 4PJJA 1UX5A 2W63A 5LNKA 2V7LA 5HXSA 2PG8A 4QXCB 1LVKA 4UF0A 2X9WA 3HKDE 2M67A 3EUHA 3PURA 3DTOA 4CI3B 3ZCJA 4TN7B 3CQCB 3KV9A 3N2GE 1FEWA 3N5LA 4JEUB 4WNKA 1ZV4X 3GMIA 2NTYA 5FY7A 4ILUA 5L2LA 5AFUL 1U4QA 4MFRA 4UELA 4EYUA 5J2TE 2D0TA 3L09A 5JDFA 2ODUA 3NRXA 3RYIE 2EHOB 4ISTA 1HCIA 1US7B 4OYJA 5A1LA 3ZLIA 5JVDE 3RKOA 2LM9A 1KK7A 5FMNA 4ZI3C 4BJMA 3JC6D 2PFVA 5C8YE 5M4YA 3SWHA 1WR6A 3C50A 3NZPA 2BZBA 3HL6A 3MACA 5L3DB 4ADZA 3HI2A 4DO0A 4PJLA 2XHEB 4QX7B 4E7ZA 4TV9E 3MJXA 4X20E 2N9DA 3ESLA 5FP3A 3D0TA 3DP7A 4CZZB 2LSYA 2CWYA 2V7MA 2KMFA 1VRBA 3BQLA 3VU7H 3HKCE 3CPZA 3IEEA 3BQIA 3MA9A 3V5UA 2L8KA 3RC3A 5EK4A 3M65A 3T8OA 4I50E 5L3EB 2CMRA 3N9NA 4GYRA 2D5UA 1QUUA 4GIWA 2LHNA 4HKAA 5EK3A 4AKIA 4KMCA 2VKJA 3OBVE 4G63A 2QA7A 4TV8E 2EHOA 3C4WA 3N2OA 3PDYA 4AI6A 2CA5A 3J9X1 4PJNA 4IGUA 4IIJE 3J7Yq 1WLXA 3PUAA 3ZMVB 3MZKB 3OYZA 2WWUA 1NWMX 2X9XA 5JR9B 2GK9A 2ZM0A 3LFMA 3P8CD 5HXEA 3AA6B 3FBLA 2UXXB 5KDMC 2KWHA 5HAXA 5JDGA 2CXFA 4XZCA 4A56A 4ZI3D 3AAAB 4YJ3E 1MIVA 5F8PA 5FNVE 2NW9A 2HH7A 5LCYA 3FBZA 3KV5A 3ZPOA 4UIGA 2XAJB 3I1AA 4AQFC 2SPCA 3P7IA 4BJNA 1MMGA 3N9OA 5HWYA 2DNXA 2EHOD 3ONXA 5HXRA 5FYMA 5JDNA 4IE7A 3GN5B 4QHOA 4H9RC 3UFEA 5JQGE 2Q9QC 2K9AA 2MOZA 3QK6A 3HKBE 2W0GA 2BDEA 4U72A 4PW8A 2V7JA 1KNZA 3E0ZA 3ZN0B 3VKGA 2WSSV 1MMDA 4C90A 3NBXX 5HYAA 4XAXB 4PJMA 4G2AA 1D0YA 5KMGP 5ADXL 4AXPA 2H3RA 2G0UA 1H7CA 1SHZC 2MYSA 4O4LE 5JR9A 3RYHE 1WYCA 4BAYB 3ZC1A 4ZHQE 5H6RB 3VHLA 1D1AA 4JUYA 5FY1A 4ZS2A 2WMOA 2YEVC 3ZC0A 5EZYE 2X66A 3F31A 5L3FB 5LGNB 3C4XA 5TAOA 3ZYLA 3R6NA 3WI3A 3KVAA 5DQWA 2LSKA 5FXWA 2HPLA 2NOXA 1BR2A 2C5KT 1BR0A 4JLEA 4EZHA 3ZYMA 3PU3A 4KBMB 3ZMTB 4MLKA 3GN5A 1NAFA 1E1HB 2CCQA 2XAGB 5LOVE 2H7OA 4AKLA 3CWZB 2CE7A 2CLYC 4UVBB 5GONE 2N1GA 3FXEB 3Q9DA 4E7SA 5LYJE 1HG5A 1HF8A 1WRDA 3K3QC 4PNIA 3UUNA 2DHRA 5LHGB 4ERRA 4PFPA 1FMVA 2P9BA 1OWAA 4EIWA 3OKQA 1OXZA 5L3GB 5FY0A 2DLRA 4IE5A 4ISSA 4AKRB 2VKOA 2KXPB 4IE4A 4N78D 3HR0A 2N2NA 4KP3C 2L3LA 4P0BA 4TZ4C 4AQGA 4HE8A 4CXWA 1Y64B 1MMNA 4ZI2C 4HGAA 2LE8A 1YKEB 3TKLB 3V5SA 4ANJA 5LJNA 2RP4A 2KWIB 4EZ4A 2ZMAA 2YINA 3CX7B 3O1IA 3SS1A 2DWKA 4QX8B 1BR4A 5HWXA 2ACXA 2KLQA 4HTEA 3NZQA 3W15B 3ZYKA 4EAHA 1LKXA 4YLHA 4KUMB 5LA6E 1HS7A 2V1DB 3K8PC 2XQYA 3UUMA 3FHNA 4OK0A 2JMKA 3SRZA 3ZJ1A 4I55E 4X1YE 3UTKA 2L9QA 3FB2A 4K0UA 4OYKA 5EK2A 3ZJ2A 4X1KE 3I9WA 4H9OC 2IC6A 1EZ3A 2HPJA 3C98B 3SOLA 1HX8A 1HTJF 2CXDA 3PU8A 1D1CA 3RRCA 2MBGA 2V7KA 3Q2MA 2H7VC 2K5BB 4CI2B 3O9XA 4ZOLE 2JRKA 2RA1A 2LEHA 2Q9QB 2CM0A 1O3XA 5JDQA 3WAJA 5L3BB 1ZHCA 2NW8A 3RH3A 4I43B 2CEAA 1IJ5A 3O1HA 2X51A 2Y48B 2IAKA 3N9MA 5LBQB 3EVYA 3ZMUB 1ZEEA 3ZMZB 1FIOA 5J1GA 5LJMA 1G73A 3MK7C 4WBNE 1X79A 2LT3A 3KBUA 4B6XA 2V7IA 2PJQA 3LG7A 2E9XC 2NWBA 4YFSA 2A3DA 3C4ZA 4DMWA 5LHIB 3AA1B 4U74A 3F57A 4L0RA 1QSDA 3RC8A 3ZEFB 2XAQB 4M1PA 5LP6E 2C5IT 3OYXA 5LGTB 2WMNA 3KBTA 3O1JA 4J2CA 3RRWA 4AQFA 4UXNB 5CA1E 4FJOA 3EDUA 3OJAA 3GWHA 2LJLA 5DJQC 2ZLYA 3HKEE 3LBXB 4PK5A 3RYFE 5FXZA 4UV8B 3H37A 4WBOA 2J1DG 4HEAA 4NUVA 2Q9QA 3U78A 2JQQA 3CVRA 1SA0E 3R84B 2CLYB 4PFOA 4YHJA 4V1Av 3AAIA 4NUUA 3PE0A 2OA5A 3FXDB 3KDSE 3C64A 4PAGA 2X9HA 3JC6C 3AA0B 1G8XA 4AKHA 2X68A 4MBQA 4CQIA 2D0UA 4DMVA 2E8IA 5BMVE 2UXNB 2YK0A 2KNDA 3LK2B 5IHYA 3QC9A 2LSGA 2JJ9A 3UULA 1MMAA 3H3AA 4X1IE 2BVLA 3N9PA 2W61A 3Q5WA 4CI1B 3LK42 4TX5A 4H9NC 2YU2A 2X0LB 4QWNB 4UV9B 3KV6A 2Q9QD 3DJBA 3KVBA 5CA0E 2DI4A 2VKHA 1YD8G 4L9IA 2ES0A 2MTQA 1MNDA 4H9PC 1FMWA 3LBXA 1IJ6A 3BQKA 4UEMA 3AVRA 5F3JA 1BR1A 3I9YA 3K3NA 5JH7E 5LG4A 4IE0A 2YU1A 4OHFA 3GA8A 5H6QB 3WAKA 3I0OA 2DWGA 4H9SE 4JEHB 5JDMA 4H63V 2VASA 4ASKA 4QXHB 3CMLA 4MALA 2IW5B 1HG2A 4CXXA 2XAHB 1B7TA 1D1BA 5LXTE 2LOSA 4FI5A 4O2AE 1S35A 3N9LA 2NP9A 3PUSA 3PTRB 4UVCB 3MXZA 4HN9A 4UVAB 3UT5E 3AA7B 4P0AA 2KT9A 2XASB 3AVSA 5KX5E 4GK0E 2A2FX 3LJCA 2X9YA 3B57A 2ODVA 3N2KE 4O8SA 5LHHB 1V9DA 2CXLA 2EHOC 5FXXA 3CQXC 5HXHA 1D0ZA 5JRCB 2XAFB 5JREA 3S4UA 2C0SA 2KZ7B 2JMHA 3IHRA 2XUEA 3UUXB 4GK5E 1MIYA 2B1EA 3A5XA 5JDHA 2BVMA 3U3IA 3IF8B 3RYCE 4PK4A 5IYZE 2I59A 5ETWA 4EOZB 5FXVA 2LHRA 4ZS3A 2ZM8A 2LSJA 3PUGA 3PUQA 2W62A 4IDZA 3QUJA 2E9XB 4QKNA 5LGUB 2D2SA 1IAPA 3ZMSB 1IZNB 2WBLA 2ZM2A 3F2EA 2NTXA 2PBIA 4ZI2D 2A72A 2WM9A 5J2UE 3KFWX 4GOUA 4DVDA 5CB4E 4GYSA 3L3PA 4IHJE 5HXCA 4F6RC 5E0OA 2IC9A 4EXTA 3EDVA 4XBFB 3AAEB 4O4JE 2VK9A 3HA4A 2W00A 4P09A 1HFAA 2X67A 3B13A 3MKDA 4TUYE 3IBPA 4O4IE 1VOMA 5JDLA 5JRCA 4O2BE 2Y6XA 2V26A 5DABA 3CX6B 3AB3B 5L3CB 2JPFA 3ANWB 3BK9A 4WW0A 4EYYR 2K48A 5JR9C 1U5PA 1CUNA 4C91A 1LRZA 1YW0A 2K24A 4I4TE 4UF0B 3I0QA 1UCUA 5LBMA 3ETVA 1LVFA 1MIWA 2E9XA 2VB6A 2LSIA 3LK3B 2Y8DA 4OFZA 1AJ3A 4AKGA 3N9QA 3ETUA 5DQVA 2XTLA 3VKHA 3KINB 4H9QC 4DNDA 2Z6EA 3CQGB 1ZKEA 4ZI7E 4L5GA 2QGSA 3E22E 4PK6A 2VL8A 4QXBB 1Z0PA 1WYBA 2LOPA 3C51A 3ZN1B 1T98A 1D0XA 4EB6E 3RX6A 4HFVA 4BA9A 1S94A 4CXYA 2NW7A 2VWAA 3NRYA 3ZCIA 3CKDA 1MNEA 4DBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEW A;  2DNX A;  4JEH B;  1HS7 A;  1FIO A;  1BR0 A;  3LG7 A;  5LG4 A;  1S94 A;  1EZ3 A;  1G73 A;  3C98 B;  4TX5 A;  2XHE B;  5M4Y A;  4JEU B; 
#chains in the Genus database with same CATH topology
 4JI0 T;  1YKH B;  4H63 H;  3KV4 A;  3RPU A;  3CX8 B;  4IE6 A;  2E9X D;  3E08 A;  2KSR A;  1R8I A;  3RF1 A;  4PJJ A;  1UX5 A;  2W63 A;  4JI3 T;  2PG8 A;  2VUR A;  2JQH A;  3AXJ A;  4DV5 T;  4JBW F;  3PUR A;  3DTO A;  1KEY A;  1ZV4 X;  4ILU A;  5AFU L;  5LMN T;  4EYU A;  2D0T A;  4IRE A;  5JDF A;  2ODU A;  4U33 A;  3RYI E;  4DV6 T;  3LSV A;  1XNQ T;  1US7 B;  2XQ3 A;  2M6B A;  4ZI3 C;  3JC6 D;  2K3W A;  1WR6 A;  3HI2 A;  3MJX A;  2N9D A;  3ESL A;  5FP3 A;  2V7M A;  4QH4 A;  2VL0 A;  3RIU A;  5EK4 A;  3M65 A;  5L3E B;  5IWA T;  1QUU A;  4GIW A;  5EK3 A;  4KMC A;  4DV0 T;  3N2O A;  3NKZ A;  4AI6 A;  4DR6 T;  4PJN A;  2BBH A;  5KDM C;  2J62 A;  2CXF A;  3Q5E A;  2NW9 A;  5FNV E;  2HH7 A;  5AQF B;  3ZPO A;  3P7I A;  1MMG A;  5FVL A;  3GN5 B;  3UFE A;  2YOE A;  3EI0 A;  5AQJ B;  5AQK B;  2MOZ A;  4KX6 A;  1KNZ A;  3ZN0 B;  2QVA A;  4C90 A;  1N34 T;  3NBX X;  4G2A A;  5KMG P;  5ADX L;  2H3R A;  2LKG A;  2MYS A;  3ZC1 A;  4JUY A;  3F31 A;  2M6I A;  3R6N A;  3WI3 A;  4YSY A;  5FXW A;  2HPL A;  2C5K T;  4IL9 A;  3ZMT B;  4KBM B;  1E1H B;  2WWV A;  2XAG B;  2H7O A;  3M3Z B;  2CLY C;  4UVB B;  5GON E;  2V6Y A;  4TWF A;  2VQE T;  1HF8 A;  3K3Q C;  2DHR A;  1FMV A;  3OVU A;  2XM1 A;  2CHN A;  4DR3 T;  3RQU A;  1T8B A;  3OKQ A;  4IE5 A;  2HN1 A;  2KXP B;  4Z91 A;  4TZ4 C;  4CXW A;  4ZI2 C;  4HGA A;  3TKL B;  2KWI B;  2YIN A;  3SS1 A;  2BKP A;  3W15 B;  2X0Y A;  1LKX A;  4HFH A;  1HS7 A;  3ZJ1 A;  3SRZ A;  4B3S T;  4DV4 T;  2WDR A;  2L9Q A;  3FB2 A;  3AEF A;  3ZJ2 A;  4X1K E;  4U7I A;  2XSA A;  2CXD A;  1D1C A;  3RRC A;  4ZOL E;  4YSZ A;  5JDQ A;  3WAJ A;  5L3B B;  1ZHC A;  3O1H A;  1IJ5 A;  3N9M A;  4LFC T;  5LJM A;  1G73 A;  3MK7 C;  2MPK A;  3QB5 A;  1XWM A;  4YFS A;  1QSD A;  3ZEF B;  2XAQ B;  1UGO A;  2MAW A;  3KBT A;  3VR9 A;  4AQF A;  3AE5 A;  3GWH A;  3CIR A;  3VRB A;  4PK5 A;  4UV8 B;  4NUV A;  3TLW A;  2JQQ A;  4LF5 T;  3CVR A;  2CLY B;  4V1A v;  2V5D A;  5ABF A;  2OA5 A;  1G8X A;  4AKH A;  3A7M A;  5AQH B;  4CQI A;  4DMV A;  5BMV E;  2YK0 A;  3LK2 B;  1T72 A;  3N9P A;  3AE1 A;  3LK4 2;  4H9N C;  2X0L B;  2Q9Q D;  1X9B A;  2F4V T;  2ES0 A;  3FZK B;  4WYV A;  4YXD A;  4H9P C;  1IJ6 A;  2BG9 A;  3AVR A;  3K1S A;  3I9Y A;  5LB7 B;  4IE0 A;  2WZH A;  2BS4 A;  4H9S E;  4IL4 A;  4JEH B;  5JDM A;  5AQT B;  3ZT6 A;  3CML A;  2VVS A;  4MAL A;  2UXC T;  2LOS A;  1S35 A;  2NP9 A;  4UVC B;  4HN9 A;  4UVA B;  4YTP A;  2XAS B;  4EGW A;  3LJC A;  2X9Y A;  2E5L T;  1OED E;  4O8S A;  4LF4 T;  5LHH B;  2CXL A;  5JRE A;  2XQA A;  2RPA A;  3TLV A;  2XUE A;  4GK5 E;  5JDH A;  2BVM A;  3IF8 B;  5ETW A;  5FXV A;  1KNR A;  4ZS3 A;  2ZM8 A;  3PUG A;  3PUQ A;  1ZOY A;  4QKN A;  1HR0 T;  5LGU B;  2D2S A;  1IAP A;  3ZMS B;  3TLT A;  2PBI A;  2IDO B;  2A72 A;  4XBF B;  4O4J E;  3HA4 A;  3B13 A;  4DV7 T;  5JDL A;  1SE7 A;  4JI1 T;  2Y6X A;  2V26 A;  5BR8 T;  5L3C B;  2UUA T;  4DV2 T;  3AXJ B;  3A8Y C;  3ETV A;  1MIW A;  2E9X A;  4IDQ A;  1AJ3 A;  3EHZ A;  1XZY A;  4WZX A;  5DQV A;  5LMU T;  3QNU A;  3SFD A;  4EV6 A;  4JI8 T;  2Z6E A;  3CQG B;  2QGS A;  1Z0P A;  2NW7 A;  2VWA A;  3O4X E;  4YJ2 E;  1KNP A;  2B76 A;  2V5C A;  2VKD A;  3Q5X A;  3ANW A;  3K3O A;  5LNK A;  5HXS A;  2YDR A;  4QXC B;  3CQC B;  3N5L A;  4WNK A;  5FY7 A;  3GMI A;  2NTY A;  4ZZC A;  3L09 A;  4IST A;  1HCI A;  4OYJ A;  3ZLI A;  5JVD E;  2WY2 A;  5C8Y E;  5M4Y A;  3SWH A;  3C50 A;  2BZB A;  5AQI B;  5L3D B;  4PJL A;  1T7S A;  4TV9 E;  1HNX T;  4CZZ B;  2LSY A;  2CWY A;  1VRB A;  3BQL A;  3VU7 H;  3HKC E;  3MA9 A;  3T8O A;  4GYR A;  2D5U A;  2BKN A;  4LMK A;  4HKA A;  4IDN A;  4G63 A;  4TV8 E;  3P4P A;  3C4W A;  4HWC A;  4IGU A;  4ILC A;  4X64 T;  2AE9 A;  1NWM X;  2X9X A;  2ZM0 A;  3P8C D;  5HXE A;  1QLB A;  5JDG A;  5KXJ A;  4XZC A;  4A56 A;  4ZI3 D;  4DV1 T;  1MIV A;  4AQF C;  5L47 A;  4YTM A;  4BJN A;  2EHO D;  3ONX A;  1XDP A;  5FYM A;  4IE7 A;  4QHO A;  4TNW A;  1J5E T;  2BDE A;  2V6Y B;  2WU2 A;  4PW8 A;  3JAD A;  3AE2 A;  3E0Z A;  5HEJ A;  5C2T A;  4HWF A;  4JI7 T;  3ONL C;  5AQQ B;  3FZF B;  1DU2 A;  2G0U A;  1SHZ C;  5AQV B;  5JR9 A;  1D1A A;  2WMO A;  3ZYL A;  3KVA A;  4JI5 T;  4DUZ T;  2IML A;  4JLE A;  4EZH A;  2BG9 C;  3PU3 A;  4Z90 A;  2CCQ A;  4DV3 T;  3CWZ B;  2BKO A;  3FXE B;  5LYJ E;  4HFD A;  2H88 A;  5LHG B;  4HFE A;  4ERR A;  2P9B A;  4JI2 T;  3UU4 A;  5L3G B;  2DLR A;  4ISS A;  2VKO A;  2WZI A;  4N78 D;  4P0B A;  1YQ4 A;  4AQG A;  5LJN A;  2WS3 A;  2QRX A;  4EZ4 A;  1W09 A;  2DWK A;  4HFI A;  5HWX A;  4HTE A;  1WCR A;  4CN1 A;  4YLH A;  4B3R T;  2V1D B;  4JYA T;  2CBI A;  4X1Y E;  1CHU A;  5F5W A;  5EK2 A;  3AE7 A;  3C98 B;  3SOL A;  3ZKR A;  2V7K A;  3FZH B;  3Q2M A;  2K5B B;  4CI2 B;  3O9X A;  2JRK A;  2RA1 A;  4IDP A;  2LEH A;  2X0H A;  1O3X A;  3ZMU B;  5ABF B;  2Y48 B;  2IAK A;  3EVY A;  2FJD A;  5J1G A;  4TWH A;  1X79 A;  3L8R A;  3JAF A;  1I6Z A;  2BS3 A;  2IUB A;  2E9X C;  2NWB A;  2A3D A;  5L4E A;  4U74 A;  3IA3 A;  3OYX A;  3UQ7 A;  2HHH T;  4J2C A;  4UXN B;  5CA1 E;  4FJO A;  3Q5D A;  3RI5 A;  3RHW A;  3HKE E;  2BG9 B;  4U3C A;  3U78 A;  2Q9Q A;  5HCM A;  2FJB A;  2E5V A;  2YDQ A;  3FXD B;  3C64 A;  4PAG A;  2J4G A;  2X9H A;  3JC6 C;  3QC9 A;  3PUZ F;  3UUL A;  2BVL A;  3RKG A;  2XQ4 A;  4CI1 B;  3P50 A;  4QWN B;  3KV6 A;  3KVB A;  2WP9 A;  1W0A A;  3B5M A;  3BQK A;  4COF A;  2XQ8 A;  5F3J A;  4YSX A;  2YU1 A;  3WAK A;  5H6Q B;  2DWG A;  4ASK A;  1D1B A;  4AIS A;  5LXT E;  3P4W A;  3PUS A;  1N33 T;  1IBM T;  3UT5 E;  3AA7 B;  4P0A A;  2KT9 A;  5CGM A;  3OTO T;  3N2K E;  4P1N A;  5ABE A;  2AXD S;  4LF8 T;  1UUR A;  3CQX C;  3S4U A;  2C0S A;  3IHR A;  3SFE A;  1MIY A;  3A5X A;  1GQE A;  3RYC E;  4PK4 A;  2I59 A;  2LSJ A;  4IDZ A;  2E9X B;  3NVO A;  3JCF A;  1IZN B;  3AEE A;  2WBL A;  3F2E A;  2XPK A;  4EED A;  2WM9 A;  5J2U E;  4GOU A;  4IHJ E;  3TLU A;  1YXR A;  3IBP A;  4O4I E;  2WDQ A;  5DAB A;  3ANW B;  4WW0 A;  4EYY R;  4LFA T;  5JR9 C;  1CUN A;  3I0Q A;  2VB6 A;  4AKG A;  2LKH A;  3N9Q A;  3VKH A;  4DND A;  4K0K T;  4ZI7 E;  4PK6 A;  2VL8 A;  1WYB A;  3ZN1 B;  1T98 A;  1D0X A;  3RX6 A;  2ZM6 T;  3NRY A;  3CKD A;  1MNE A;  2C5J A;  4DBR A;  4Z8X A;  4B3M T;  3P4S A;  3AE3 A;  1UX4 A;  2V7L A;  4UF0 A;  3HKD E;  3AED A;  3EUH A;  3NWI A;  3ZCJ A;  4GKJ T;  3N2G E;  1FEW A;  2FUP A;  5L2L A;  1U4Q A;  3CK6 A;  5J2T E;  2BS2 A;  2CBJ A;  5AQR B;  2OLT A;  5A1L A;  5FMN A;  4BJM A;  3RIU C;  5AQL B;  3NZP A;  3MAC A;  4YHH T;  2XHE B;  3X1D A;  4E7Z A;  4X20 E;  3D0T A;  3DP7 A;  4ILA A;  3BQI A;  2L8K A;  2CMR A;  3AEC A;  2LHN A;  2YN6 A;  2VKJ A;  3OBV E;  2QA7 A;  2EHO A;  1NEN A;  3PDY A;  4KHP T;  1ZP0 A;  1WLX A;  3ZMV B;  3RIF A;  4EEB A;  3MZK B;  2WWU A;  5JR9 B;  4DUY T;  4LF7 T;  3G06 A;  3FBL A;  3AE8 A;  2UXX B;  5HAX A;  1IBL T;  3P4R A;  3AAA B;  5F8P A;  3FBZ A;  3KV5 A;  4UR9 A;  4UIG A;  2XAJ B;  1WR0 A;  3N9O A;  5HWY A;  2DNX A;  5HXR A;  5JQG E;  2Q9Q C;  2K9A A;  2W0G A;  2V7J A;  3RIA A;  2FBW A;  3VR8 A;  5HYA A;  1M7K A;  4PJM A;  4HWD A;  3RYH E;  1WYC A;  4ZHQ E;  5H6R B;  3VHL A;  2UU9 T;  5FY1 A;  4ZS2 A;  1N36 T;  3ZC0 A;  5EZY E;  1YQ3 A;  5L3F B;  5LGN B;  3C4X A;  5TAO A;  1IBK T;  4HWH A;  5DQW A;  2LSK A;  2W4X A;  1W0B A;  3ZYM A;  2W66 A;  2J47 A;  1NAF A;  5LOV E;  3UFG A;  2N1G A;  4DID B;  3L39 A;  3Q9D A;  4E7S A;  1HG5 A;  2V6X A;  3UUN A;  3OPC A;  4PFP A;  4X5T A;  2XJ7 A;  1OXZ A;  3AE9 A;  3HR0 A;  2N2N A;  1MMN A;  2LE8 A;  1YKE B;  4ILB A;  3V5S A;  4ANJ A;  2RP4 A;  4DR1 T;  2ZMA A;  3ZST A;  3CX7 B;  3O1I A;  1OED A;  4A98 A;  2ACX A;  5LA6 E;  3K8P C;  2XQY A;  3UUM A;  3FHN A;  1Y01 A;  4I55 E;  3I9W A;  2IC6 A;  1EZ3 A;  2HPJ A;  4X65 T;  2WDV A;  3UU6 A;  1HTJ F;  3PU8 A;  2MBG A;  2BBJ A;  2Q9Q B;  2CM0 A;  3RH3 A;  4I43 B;  2R6G F;  2CEA A;  1ZEE A;  3ZMZ B;  1M62 A;  4IDO A;  4WBN E;  2LT3 A;  3KBU A;  4B6X A;  2PJQ A;  3C4Z A;  5LHI B;  3AA1 B;  4OX9 T;  3F57 A;  2WU5 A;  3RC8 A;  4YTN A;  5LP6 E;  2C5I T;  5LGT B;  2WMN A;  3EDU A;  2LJL A;  3RGL A;  2ZLY A;  5HEH A;  3H37 A;  3RLF F;  1SA0 E;  4PFO A;  3AAI A;  3PE0 A;  3KDS E;  2H89 A;  3ZT7 A;  3AA0 B;  3UU8 A;  2X68 A;  4MBQ A;  2D0U A;  2E8I A;  2JIW A;  2KND A;  5IHY A;  4DR4 T;  4X1I E;  1SUM B;  2JQ9 A;  2W61 A;  2XQ7 A;  3Q5W A;  4TX5 A;  4UV9 B;  1HNW T;  2VKH A;  4L9I A;  2MTQ A;  3AEB A;  1MND A;  3LBX A;  3K3N A;  2WQY A;  5IUX A;  5LG4 A;  4OHF A;  2NR4 A;  4JV5 T;  4B3T T;  4H63 V;  1WFD A;  3FZM B;  4U2Y A;  2IW5 B;  4CXX A;  5AQP B;  1B7T A;  3ZSS A;  4O2A E;  5KX5 E;  2A2F X;  2ODV A;  1E7P A;  5FXX A;  2EHO C;  5HXH A;  3QB5 K;  1D0Z A;  2KZ7 B;  3U3I A;  3UQ4 A;  3VRA A;  5IYZ E;  1HNZ T;  4QH1 A;  2LHR A;  3QUJ A;  2XY8 B;  2ZM2 A;  5C3J A;  4ZI2 D;  5CB4 E;  4HWI B;  4GYS A;  3L3P A;  5HXC A;  4EXT A;  2IC9 A;  2XZE A;  3AAE B;  2XQ9 A;  4P09 A;  2W00 A;  2X67 A;  3EAB A;  3MKD A;  4TUY E;  4JI6 T;  5JRC A;  3CX6 B;  3BK9 A;  2K48 A;  4TNV A;  1U5P A;  4C91 A;  1LRZ A;  1YW0 A;  4I4T E;  4UF0 B;  5LBM A;  1UCU A;  4OFZ A;  1XDO A;  3ETU A;  2LRK A;  2XTL A;  5AQU B;  1ZKE A;  4L5G A;  3E22 E;  3C51 A;  2LOP A;  4EB6 E;  4HFV A;  1J1J A;  1S94 A;  3UU3 A;  4MFR A;  3ZCI A;  4DBQ A;  2KIN B;  4O4H E;  2WAU A;  5LG3 A;  2CWO A;  2DCF A;  4MHC A;  4LF9 T;  1LVK A;  2X9W A;  2UUB T;  2M67 A;  4LMJ A;  4CI3 B;  4TN7 B;  3KV9 A;  4JEU B;  4U7Y A;  2D9D A;  2BG9 E;  2FJA A;  4NXN T;  4UEL A;  3NRX A;  2EHO B;  2W2U A;  1OED C;  4DR5 T;  2IIU A;  3RKO A;  2LM9 A;  1KK7 A;  4KI0 F;  2PFV A;  2LRL A;  3HL6 A;  4ADZ A;  2A9U A;  4DO0 A;  4QX7 B;  3PV0 F;  2E2A A;  2KMF A;  5FL1 A;  3CPZ A;  3AEA A;  3IEE A;  3V5U A;  3RC3 A;  4I50 E;  3ONJ A;  3N9N A;  5AQG B;  3PUW F;  2LM2 A;  4AKI A;  4I0U A;  2CA5 A;  3J9X 1;  4IIJ E;  2FJE A;  3J7Y q;  3TLS A;  3PUA A;  4X62 T;  3OYZ A;  2XQ6 A;  2GK9 A;  3LFM A;  3AA6 B;  2KWH A;  4YJ3 E;  3PUX F;  5AQO B;  5LCY A;  1JNZ A;  3AEG A;  1J5W A;  3I1A A;  2SPC A;  3FZL B;  3PUY F;  5JDN A;  4H9R C;  1KFY A;  2I6H A;  5HEG A;  3QK6 A;  3HKB E;  3PJA J;  4U72 A;  1UUS A;  3UUB A;  2PTF A;  3T1Y T;  4Q25 A;  3VKG A;  2WSS V;  1MMD A;  2VVN A;  4XAX B;  1D0Y A;  4AXP A;  1H7C A;  4O4L E;  4BAY B;  5ABG A;  4ZXL A;  2YEV C;  2X66 A;  2ACZ A;  1XNR T;  2NOX A;  2LLY A;  1BR2 A;  1BR0 A;  1NEK A;  4MLK A;  3GN5 A;  1OED B;  2V8S V;  4AKL A;  2CE7 A;  4KHZ F;  5JTG A;  1WRD A;  4PNI A;  5CJ5 A;  4NPP A;  4DR7 T;  3AE6 A;  2XSB A;  1OWA A;  5HEU A;  4EIW A;  5FY0 A;  5L4H A;  4AKR B;  4IE4 A;  4KP3 C;  2L3L A;  4LF6 T;  4HE8 A;  1Y64 B;  3P4Q A;  4JI4 T;  3AE4 A;  2YDS A;  3PUV F;  2W67 A;  4QX8 B;  1BR4 A;  1N32 T;  2KLQ A;  3NZQ A;  3ZYK A;  4EAH A;  2JQK A;  4AIU A;  4KUM B;  4ZEY A;  4OK0 A;  2JMK A;  3UTK A;  2UXD T;  4K0U A;  2DL1 A;  4OYK A;  4H9O C;  1HX8 A;  2VQF T;  4HFB A;  2H7V C;  2I0M A;  2NW8 A;  5HEO A;  2X51 A;  5AQS B;  5LBQ B;  1FIO A;  3ZT5 A;  3LDQ B;  2V7I A;  4YY3 T;  2CHO A;  3LG7 A;  1W9R A;  1XMQ T;  4DMW A;  4L0R A;  1HX1 B;  4M1P A;  1VCT A;  4F8H A;  4A5X A;  3T1H T;  3PJA A;  3O1J A;  3RRW A;  4X66 T;  3OJA A;  5FKY A;  2QYW A;  3QOF A;  5DJQ C;  3LBX B;  3RYF E;  5FXZ A;  4WBO A;  2J1D G;  4HEA A;  4DR2 T;  3R84 B;  4YHJ A;  4NUU A;  3RQW A;  3ABV A;  4IT4 A;  5CFB A;  2UXN B;  4CN4 A;  2LSG A;  4A97 A;  2JJ9 A;  1MMA A;  3H3A A;  4YT0 A;  4AQY T;  2YU2 A;  4NIQ A;  3DJB A;  5CA0 E;  2DI4 A;  1FJG T;  1YD8 G;  1FMW A;  4UEM A;  5J0Z A;  2OV9 A;  1BR1 A;  4U31 A;  5JH7 E;  3GA8 A;  3I0O A;  2VAS A;  2WB5 A;  2IHR 1;  4QXH B;  1HG2 A;  2YKS A;  2XAH B;  4FI5 A;  3N9L A;  3PTR B;  3MXZ A;  3AVS A;  4GK0 E;  3B57 A;  3JAE A;  1Z8U A;  2XM2 A;  1V9D A;  4CN6 A;  2CPT A;  5JRC B;  2XAF B;  2XQ5 A;  3UUX B;  2JMH A;  2B1E A;  4EOZ B;  4LFB T;  1XMO T;  4LML A;  2UUC T;  2W62 A;  4U2Z A;  2HN2 A;  4QH5 A;  2NTX A;  3UU5 A;  5AQN B;  3KFW X;  4DVD A;  4F6R C;  5E0O A;  3EDV A;  1VCS A;  5FVK A;  2VK9 A;  4GKK T;  1HFA A;  2WCA A;  5HCJ A;  1VOM A;  4O2B E;  4HFC A;  1KF6 A;  3AB3 B;  2JPF A;  5ABH A;  2UXB T;  5FL0 A;  2K24 A;  3H3M A;  1UK5 A;  1LVF A;  2LSI A;  3LK3 B;  2Y8D A;  1E2A A;  4TWD A;  1L0V A;  2CRB A;  3KIN B;  4H9Q C;  1I94 T;  5AQM B;  4ZZB A;  3EAM A;  4QXB B;  1JNR A;  4BA9 A;  4NXM T;  4CXY A; 
#chains in the Genus database with same CATH homology
 2KIN B;  3O4X E;  2C5J A;  1YKH B;  4O4H E;  4YJ2 E;  2WAU A;  4H63 H;  4DBR A;  3KV4 A;  2CWO A;  2DCF A;  4Z8X A;  3RPU A;  2VKD A;  3CX8 B;  4IE6 A;  4MHC A;  3Q5X A;  2E9X D;  3E08 A;  3ANW A;  3K3O A;  1UX4 A;  4PJJ A;  1UX5 A;  2W63 A;  5LNK A;  2V7L A;  5HXS A;  2PG8 A;  4QXC B;  1LVK A;  4UF0 A;  2X9W A;  3HKD E;  2M67 A;  3EUH A;  3PUR A;  3DTO A;  4CI3 B;  3ZCJ A;  4TN7 B;  3CQC B;  3KV9 A;  3N2G E;  1FEW A;  3N5L A;  4JEU B;  4WNK A;  1ZV4 X;  3GMI A;  2NTY A;  5FY7 A;  4ILU A;  5L2L A;  5AFU L;  1U4Q A;  4MFR A;  4UEL A;  4EYU A;  5J2T E;  2D0T A;  3L09 A;  5JDF A;  2ODU A;  3NRX A;  3RYI E;  2EHO B;  4IST A;  1HCI A;  1US7 B;  4OYJ A;  5A1L A;  3ZLI A;  5JVD E;  3RKO A;  2LM9 A;  1KK7 A;  5FMN A;  4ZI3 C;  4BJM A;  3JC6 D;  2PFV A;  5C8Y E;  5M4Y A;  3SWH A;  1WR6 A;  3C50 A;  3NZP A;  2BZB A;  3HL6 A;  3MAC A;  5L3D B;  4ADZ A;  3HI2 A;  4DO0 A;  4PJL A;  2XHE B;  4QX7 B;  4E7Z A;  4TV9 E;  3MJX A;  4X20 E;  2N9D A;  3ESL A;  5FP3 A;  3D0T A;  3DP7 A;  4CZZ B;  2LSY A;  2CWY A;  2V7M A;  2KMF A;  1VRB A;  3BQL A;  3VU7 H;  3HKC E;  3CPZ A;  3IEE A;  3BQI A;  3MA9 A;  3V5U A;  2L8K A;  3RC3 A;  5EK4 A;  3M65 A;  3T8O A;  4I50 E;  5L3E B;  2CMR A;  3N9N A;  4GYR A;  2D5U A;  1QUU A;  4GIW A;  2LHN A;  4HKA A;  5EK3 A;  4AKI A;  4KMC A;  2VKJ A;  3OBV E;  4G63 A;  2QA7 A;  4TV8 E;  2EHO A;  3C4W A;  3N2O A;  3PDY A;  4AI6 A;  2CA5 A;  3J9X 1;  4PJN A;  4IGU A;  4IIJ E;  3J7Y q;  1WLX A;  3PUA A;  3ZMV B;  3MZK B;  3OYZ A;  2WWU A;  1NWM X;  2X9X A;  5JR9 B;  2GK9 A;  2ZM0 A;  3LFM A;  3P8C D;  5HXE A;  3AA6 B;  3FBL A;  2UXX B;  5KDM C;  2KWH A;  5HAX A;  5JDG A;  2CXF A;  4XZC A;  4A56 A;  4ZI3 D;  3AAA B;  4YJ3 E;  1MIV A;  5F8P A;  5FNV E;  2NW9 A;  2HH7 A;  5LCY A;  3FBZ A;  3KV5 A;  3ZPO A;  4UIG A;  2XAJ B;  3I1A A;  4AQF C;  2SPC A;  3P7I A;  4BJN A;  1MMG A;  3N9O A;  5HWY A;  2DNX A;  2EHO D;  3ONX A;  5HXR A;  5FYM A;  5JDN A;  4IE7 A;  3GN5 B;  4QHO A;  4H9R C;  3UFE A;  5JQG E;  2Q9Q C;  2K9A A;  2MOZ A;  3QK6 A;  3HKB E;  2W0G A;  2BDE A;  4U72 A;  4PW8 A;  2V7J A;  1KNZ A;  3E0Z A;  3ZN0 B;  3VKG A;  2WSS V;  1MMD A;  4C90 A;  3NBX X;  5HYA A;  4XAX B;  4PJM A;  4G2A A;  1D0Y A;  5KMG P;  5ADX L;  4AXP A;  2H3R A;  2G0U A;  1H7C A;  1SHZ C;  2MYS A;  4O4L E;  5JR9 A;  3RYH E;  1WYC A;  4BAY B;  3ZC1 A;  4ZHQ E;  5H6R B;  3VHL A;  1D1A A;  4JUY A;  5FY1 A;  4ZS2 A;  2WMO A;  2YEV C;  3ZC0 A;  5EZY E;  2X66 A;  3F31 A;  5L3F B;  5LGN B;  3C4X A;  5TAO A;  3ZYL A;  3R6N A;  3WI3 A;  3KVA A;  5DQW A;  2LSK A;  5FXW A;  2HPL A;  2NOX A;  1BR2 A;  2C5K T;  1BR0 A;  4JLE A;  4EZH A;  3ZYM A;  3PU3 A;  4KBM B;  3ZMT B;  4MLK A;  3GN5 A;  1NAF A;  1E1H B;  2CCQ A;  2XAG B;  5LOV E;  2H7O A;  4AKL A;  3CWZ B;  2CE7 A;  2CLY C;  4UVB B;  5GON E;  2N1G A;  3FXE B;  3Q9D A;  4E7S A;  5LYJ E;  1HG5 A;  1HF8 A;  1WRD A;  3K3Q C;  4PNI A;  3UUN A;  2DHR A;  5LHG B;  4ERR A;  4PFP A;  1FMV A;  2P9B A;  1OWA A;  4EIW A;  3OKQ A;  1OXZ A;  5L3G B;  5FY0 A;  2DLR A;  4IE5 A;  4ISS A;  4AKR B;  2VKO A;  2KXP B;  4IE4 A;  4N78 D;  3HR0 A;  2N2N A;  4KP3 C;  2L3L A;  4P0B A;  4TZ4 C;  4AQG A;  4HE8 A;  4CXW A;  1Y64 B;  1MMN A;  4ZI2 C;  4HGA A;  2LE8 A;  1YKE B;  3TKL B;  3V5S A;  4ANJ A;  5LJN A;  2RP4 A;  2KWI B;  4EZ4 A;  2ZMA A;  2YIN A;  3CX7 B;  3O1I A;  3SS1 A;  2DWK A;  4QX8 B;  1BR4 A;  5HWX A;  2ACX A;  2KLQ A;  4HTE A;  3NZQ A;  3W15 B;  3ZYK A;  4EAH A;  1LKX A;  4YLH A;  4KUM B;  5LA6 E;  1HS7 A;  2V1D B;  3K8P C;  2XQY A;  3UUM A;  3FHN A;  4OK0 A;  2JMK A;  3SRZ A;  3ZJ1 A;  4I55 E;  4X1Y E;  3UTK A;  2L9Q A;  3FB2 A;  4K0U A;  4OYK A;  5EK2 A;  3ZJ2 A;  4X1K E;  3I9W A;  4H9O C;  2IC6 A;  1EZ3 A;  2HPJ A;  3C98 B;  3SOL A;  1HX8 A;  1HTJ F;  2CXD A;  3PU8 A;  1D1C A;  3RRC A;  2MBG A;  2V7K A;  3Q2M A;  2H7V C;  2K5B B;  4CI2 B;  3O9X A;  4ZOL E;  2JRK A;  2RA1 A;  2LEH A;  2Q9Q B;  2CM0 A;  1O3X A;  5JDQ A;  3WAJ A;  5L3B B;  1ZHC A;  2NW8 A;  3RH3 A;  4I43 B;  2CEA A;  1IJ5 A;  3O1H A;  2X51 A;  2Y48 B;  2IAK A;  3N9M A;  5LBQ B;  3EVY A;  3ZMU B;  1ZEE A;  3ZMZ B;  1FIO A;  5J1G A;  5LJM A;  1G73 A;  3MK7 C;  4WBN E;  1X79 A;  2LT3 A;  3KBU A;  4B6X A;  2V7I A;  2PJQ A;  3LG7 A;  2E9X C;  2NWB A;  4YFS A;  2A3D A;  3C4Z A;  4DMW A;  5LHI B;  3AA1 B;  4U74 A;  3F57 A;  4L0R A;  1QSD A;  3RC8 A;  3ZEF B;  2XAQ B;  4M1P A;  5LP6 E;  2C5I T;  3OYX A;  5LGT B;  2WMN A;  3KBT A;  3O1J A;  4J2C A;  3RRW A;  4AQF A;  4UXN B;  5CA1 E;  4FJO A;  3EDU A;  3OJA A;  3GWH A;  2LJL A;  5DJQ C;  2ZLY A;  3HKE E;  3LBX B;  4PK5 A;  3RYF E;  5FXZ A;  4UV8 B;  3H37 A;  4WBO A;  2J1D G;  4HEA A;  4NUV A;  2Q9Q A;  3U78 A;  2JQQ A;  3CVR A;  1SA0 E;  3R84 B;  2CLY B;  4PFO A;  4YHJ A;  4V1A v;  3AAI A;  4NUU A;  3PE0 A;  2OA5 A;  3FXD B;  3KDS E;  3C64 A;  4PAG A;  2X9H A;  3JC6 C;  3AA0 B;  1G8X A;  4AKH A;  2X68 A;  4MBQ A;  4CQI A;  2D0U A;  4DMV A;  2E8I A;  5BMV E;  2UXN B;  2YK0 A;  2KND A;  3LK2 B;  5IHY A;  3QC9 A;  2LSG A;  2JJ9 A;  3UUL A;  1MMA A;  3H3A A;  4X1I E;  2BVL A;  3N9P A;  2W61 A;  3Q5W A;  4CI1 B;  3LK4 2;  4TX5 A;  4H9N C;  2YU2 A;  2X0L B;  4QWN B;  4UV9 B;  3KV6 A;  2Q9Q D;  3DJB A;  3KVB A;  5CA0 E;  2DI4 A;  2VKH A;  1YD8 G;  4L9I A;  2ES0 A;  2MTQ A;  1MND A;  4H9P C;  1FMW A;  3LBX A;  1IJ6 A;  3BQK A;  4UEM A;  3AVR A;  5F3J A;  1BR1 A;  3I9Y A;  3K3N A;  5JH7 E;  5LG4 A;  4IE0 A;  2YU1 A;  4OHF A;  3GA8 A;  5H6Q B;  3WAK A;  3I0O A;  2DWG A;  4H9S E;  4JEH B;  5JDM A;  4H63 V;  2VAS A;  4ASK A;  4QXH B;  3CML A;  4MAL A;  2IW5 B;  1HG2 A;  4CXX A;  2XAH B;  1B7T A;  1D1B A;  5LXT E;  2LOS A;  4FI5 A;  4O2A E;  1S35 A;  3N9L A;  2NP9 A;  3PUS A;  3PTR B;  4UVC B;  3MXZ A;  4HN9 A;  4UVA B;  3UT5 E;  3AA7 B;  4P0A A;  2KT9 A;  2XAS B;  3AVS A;  5KX5 E;  4GK0 E;  2A2F X;  3LJC A;  2X9Y A;  3B57 A;  2ODV A;  3N2K E;  4O8S A;  5LHH B;  1V9D A;  2CXL A;  2EHO C;  5FXX A;  3CQX C;  5HXH A;  1D0Z A;  5JRC B;  2XAF B;  5JRE A;  3S4U A;  2C0S A;  2KZ7 B;  2JMH A;  3IHR A;  2XUE A;  3UUX B;  4GK5 E;  1MIY A;  2B1E A;  3A5X A;  5JDH A;  2BVM A;  3U3I A;  3IF8 B;  3RYC E;  4PK4 A;  5IYZ E;  2I59 A;  5ETW A;  4EOZ B;  5FXV A;  2LHR A;  4ZS3 A;  2ZM8 A;  2LSJ A;  3PUG A;  3PUQ A;  2W62 A;  4IDZ A;  3QUJ A;  2E9X B;  4QKN A;  5LGU B;  2D2S A;  1IAP A;  3ZMS B;  1IZN B;  2WBL A;  2ZM2 A;  3F2E A;  2NTX A;  2PBI A;  4ZI2 D;  2A72 A;  2WM9 A;  5J2U E;  3KFW X;  4GOU A;  4DVD A;  5CB4 E;  4GYS A;  3L3P A;  4IHJ E;  5HXC A;  4F6R C;  5E0O A;  2IC9 A;  4EXT A;  3EDV A;  4XBF B;  3AAE B;  4O4J E;  2VK9 A;  3HA4 A;  2W00 A;  4P09 A;  1HFA A;  2X67 A;  3B13 A;  3MKD A;  4TUY E;  3IBP A;  4O4I E;  1VOM A;  5JDL A;  5JRC A;  4O2B E;  2Y6X A;  2V26 A;  5DAB A;  3CX6 B;  3AB3 B;  5L3C B;  2JPF A;  3ANW B;  3BK9 A;  4WW0 A;  4EYY R;  2K48 A;  5JR9 C;  1U5P A;  1CUN A;  4C91 A;  1LRZ A;  1YW0 A;  2K24 A;  4I4T E;  4UF0 B;  3I0Q A;  1UCU A;  5LBM A;  3ETV A;  1LVF A;  1MIW A;  2E9X A;  2VB6 A;  2LSI A;  3LK3 B;  2Y8D A;  4OFZ A;  1AJ3 A;  4AKG A;  3N9Q A;  3ETU A;  5DQV A;  2XTL A;  3VKH A;  3KIN B;  4H9Q C;  4DND A;  2Z6E A;  3CQG B;  1ZKE A;  4ZI7 E;  4L5G A;  2QGS A;  3E22 E;  4PK6 A;  2VL8 A;  4QXB B;  1Z0P A;  1WYB A;  2LOP A;  3C51 A;  3ZN1 B;  1T98 A;  1D0X A;  4EB6 E;  3RX6 A;  4HFV A;  4BA9 A;  1S94 A;  4CXY A;  2NW7 A;  2VWA A;  3NRY A;  3ZCI A;  3CKD A;  1MNE A;  4DBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...