1EZ3A

Crystal structure of the neuronal t-snare syntaxin-1a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
124
structure length
124
Chain Sequence
RDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords SYNTAXIN-1A
publication title Structural analysis of the neuronal SNARE protein syntaxin-1A.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 59
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ez3A00
1FEWA 4JEUB 2XHEB 1G73A 1FIOA 2DNXA 5M4YA 4JEHB 1BR0A 1S94A 1EZ3A 3C98B 4TX5A 1HS7A 3LG7A 5LG4A
chains in the Genus database with same CATH superfamily
5FMNA 5KDMC 3O1IA 2M6IA 1B7TA 4X20E 3MACA 2BVMA 1HNZT 3EHZA 2UUAT 2VKJA 2KXPB 3ZEFB 2CCQA 4QXHB 2SPCA 3AEDA 3R6NA 3SFEA 2CM0A 4OHFA 2CLYC 3GN5B 3RIUA 2LJLA 2ZM2A 3ZYLA 4BAYB 4ZI2D 2VL0A 4JYAT 5AQNB 2YDRA 4O4JE 4KUMB 3NRXA 4JI5T 1XZYA 3OJAA 4CN4A 4AXPA 2UU9T 3AA7B 2VKOA 4ZHQE 2M6BA 1UK5A 3OVUA 4OYJA 3L09A 5HXRA 1MIYA 4DR7T 3CPZA 2HPLA 4YSZA 2BBJA 4GK0E 3V5SA 4PK5A 1ZEEA 3K8PC 1BR2A 2MTQA 1BR1A 2HN1A 1UCUA 1FMWA 3DTOA 4QH1A 3ZYKA 5AQKB 2NOXA 2LSJA 2H7OA 3KBUA 2W61A 1SA0E 3WAKA 3QOFA 3FZHB 2NTYA 4ILCA 2DHRA 4GKKT 2PTFA 3PUYF 2X0HA 2LHNA 1X79A 4IDOA 4DR5T 4JI7T 3C4XA 4O2AE 3SRZA 3P4WA 4C91A 1O3XA 2AXDS 4CN1A 5AQIB 5HWYA 5FY7A 2NW7A 3E0ZA 3I0QA 5AQVB 3F31A 4HFHA 2V5DA 4PW8A 2IIUA 5JRCB 3HKEE 2YDSA 4WZXA 3ZC0A 3AB3B 1DU2A 4CI1B 3Q5WA 3RI5A 1Y01A 2ODUA 4H9QC 2VVNA 3LK2B 3PUZF 4YHHT 1MMAA 2BBHA 3KV6A 3LK42 5LBMA 5LJNA 2MYSA 4I55E 4UF0B 4ZS3A 4HWCA 2WQYA 3P4QA 1IBMT 2Y8DA 2AE9A 5FNVE 2QGSA 5ABFB 2A2FX 3P4RA 5FP3A 3FZLB 4I43B 2WB5A 1ZOYA 2ZM8A 2VB6A 2C5IT 4YXDA 3HI2A 3C51A 3KV4A 2H3RA 2W66A 5C8YE 4LF5T 3EUHA 3LG7A 4O4HE 3P50A 5L3DB 3PU3A 3AE9A 4ZI7E 3PJAJ 3W15B 3RKGA 3HKBE 2Q9QC 2LRKA 2MOZA 4CXYA 2BZBA 2DLRA 1J5WA 5L4EA 5LHHB 2CPTA 3WI3A 5HEOA 3RQUA 2UXNB 3AE2A 4DIDB 2LLYA 2BG9E 2NR4A 5LJMA 1Z8UA 2JMHA 2Q9QA 3TLSA 3DJBA 1SE7A 1HR0T 2VVSA 4HFVA 2ZLYA 4JEHB 2M67A 4JI2T 3PUGA 2D9DA 2X9YA 4TWFA 2VURA 4DV4T 3ZN1B 3AAIA 1LVFA 5F3JA 4EGWA 4YLHA 2IC6A 3I9WA 4JEUB 2YN6A 3P8CD 5JDNA 2V6XA 4ZI2C 3UUNA 4UVCB 3CQGB 4IIJE 4PAGA 5LCYA 4BJMA 1US7B 4ERRA 2JQHA 3ZMVB 4B3RT 5FY1A 2WCAA 1YKHB 4AKHA 3UQ4A 5HYAA 3AAAB 3RYIE 5JRCA 4HFCA 2YEVC 2V26A 4K0KT 4HFBA 1W9RA 3FHNA 4TV8E 4DVDA 4HN9A 4A98A 1UX5A 4JI8T 3ZKRA 3FBLA 2BKNA 4IT4A 3ETVA 4IDNA 3SOLA 4UF0A 2ACZA 2UXCT 3LJCA 3PUWF 4CZZB 4EEDA 1XDPA 3N9NA 4PK6A 1OEDB 5ABFA 2XQ9A 3CMLA 4MALA 4U2ZA 3AE8A 3GA8A 3KINB 3K3OA 1QSDA 5JDMA 5JVDE 3UUXB 5LB7B 2UXBT 2XQ3A 1G73A 2J47A 2XTLA 2XQ5A 4LF9T 3UT5E 4TZ4C 5ETWA 5DJQC 3OKQA 2CRBA 2XQ4A 4TV9E 1FJGT 1N32T 3JAFA 5AQRB 3EABA 2N1GA 4P09A 2CE7A 3CK6A 5F8PA 4ASKA 1XMOT 2WZIA 4ZXLA 2KINB 3SWHA 1QUUA 1MMGA 4YHJA 4UXNB 4XAXB 3EDVA 3M3ZB 3SFDA 1IJ6A 2E2AA 5JDQA 2XASB 4O8SA 3CX8B 5AQLB 2D5UA 3CIRA 3F2EA 5FL1A 4QX8B 5LMUT 5BMVE 2DCFA 4DMWA 4X64T 4KBMB 5IYZE 4K0UA 4E7SA 2UUBT 2HN2A 2WU5A 1ZHCA 3HR0A 2BVLA 3AEFA 3RRWA 3AXJA 3HL6A 2LKGA 2C5JA 4TX5A 2E9XB 2KWIB 4EV6A 4DV6T 2LSKA 3ZMUB 4NUVA 1OXZA 4UIGA 4L0RA 4JV5T 2I0MA 4DR2T 1AJ3A 4UR9A 2UXDT 4AKLA 3PUAA 1E7PA 4DUYT 3RYFE 4WW0A 3N9PA 2L8KA 4U33A 4I50E 4B3ST 4EAHA 2JJ9A 1WR0A 2L9QA 1M62A 4DR4T 3UU8A 3LDQB 1KFYA 2CHNA 4GYSA 1MIWA 1LKXA 2H89A 3VRAA 3EAMA 3RYCE 4PK4A 2XAGB 5E0OA 1OEDA 3K3QC 2LE8A 5JR9B 1FMVA 2RP4A 5KX5E 4G2AA 1Z0PA 3VHLA 3AAEB 3RKOA 4EYYR 5FXXA 2V7MA 2PJQA 1CHUA 4ZI3D 1W0BA 3RQWA 4TUYE 3U3IA 2QYWA 3F57A 2HPJA 5AQUB 2Y48B 3TLVA 3X1DA 5M4YA 4HFDA 4OYKA 1D1BA 5TAOA 1HS7A 2XAQB 1UGOA 3ZT6A 1KNPA 4YY3T 2R6GF 3UULA 2H88A 3JADA 1HX8A 3I9YA 2LOPA 4N78D 5DABA 2H7VC 2D0UA 3NZQA 4O4IE 3BK9A 5HXSA 3E22E 3IA3A 3UFGA 2C0SA 4HKAA 5HCMA 1WYBA 2BS3A 4EIWA 5ABEA 2WMOA 3MKDA 2WSSV 2KT9A 3HA4A 2A3DA 4LF8T 4U7YA 3TLUA 2FUPA 4HWHA 5HEHA 2NW8A 4ILBA 3QK6A 3VR9A 2LSYA 2VASA 3GMIA 2QA7A 2N2NA 4TNWA 4UELA 1WFDA 1N33T 2X68A 2LM9A 3CX6B 3FB2A 2W62A 3TLTA 3T1HT 2D0TA 1CUNA 3UFEA 5HEUA 2L3LA 2V7IA 1VCSA 5FVKA 1E1HB 2FJBA 2XM2A 2X67A 4OK0A 2J4GA 3BQKA 4V1Av 5DQVA 1S94A 4ZZCA 4L5GA 4LMJA 2WDQA 5JDHA 5CJ5A 3BQLA 2IW5B 5L3EB 3N9LA 1HG2A 3JC6C 1T7SA 5F5WA 1IAPA 2IC9A 2YU1A 4IHJE 2K24A 4PJJA 2N9DA 1ZV4X 2XUEA 3KV5A 4X62T 2RPAA 2X9XA 3A7MA 4PNIA 2J62A 4LFCT 5JR9A 5IWAT 2WMNA 3ANWB 4OFZA 4DO0A 4B6XA 3AEBA 4QKNA 4HTEA 2KMFA 5LNKA 1X9BA 2K9AA 3FBZA 4UVAB 5HXCA 3AE5A 5FKYA 4X1YE 2BKOA 3GN5A 2XY8B 4DV7T 2JRKA 2X9HA 1D0ZA 4A56A 5CGMA 4NPPA 3KDSE 3PTRB 3VR8A 2V7JA 1IZNB 3WAJA 2XAHB 4PJMA 3A8YC 1VCTA 4TWHA 4DMVA 1HNXT 1N34T 1KNRA 2X0LB 4EEBA 1D1CA 3ZMTB 5CB4E 3I1AA 2LEHA 4O2BE 1MNDA 1J5ET 3ZLIA 4ISSA 5L47A 4A97A 4DBRA 2YU2A 3R84B 2XSBA 2V5CA 2A9UA 1YXRA 4HWDA 3E08A 1L0VA 3K3NA 4MBQA 4GK5E 1HX1B 4YSXA 1WCRA 2LHRA 2XQAA 5AQSB 2FJDA 4L9IA 5EK4A 1LVKA 4ZI3C 1U4QA 3MXZA 3PUXF 2CMRA 2CHOA 4F8HA 4HFEA 3T1YT 3RIFA 1HFAA 2BG9B 4G63A 4CQIA 5L3BB 2QRXA 2UUCT 2WWVA 4YT0A 2PBIA 4NXNT 2JQQA 2A72A 3ZN0B 2DWGA 3N5LA 5CA1E 2PG8A 5HEJA 4CI2B 3J9X1 5L3GB 2P9BA 3UTKA 3RC8A 5IHYA 4EZHA 2XQ6A 3AVRA 4AQYT 3NZPA 4JI0T 2QVAA 4CXWA 2X66A 1YKEB 3RYHE 1UURA 3EVYA 4DNDA 3IBPA 5LGNB 2CA5A 2OV9A 5LBQB 2E9XD 4YTMA 3HKDE 5AQFB 4IREA 3T8OA 4EOZB 5A1LA 3LSVA 2Y6XA 5J1GA 5HEGA 3UU5A 5AQOB 4IL9A 5CFBA 1OWAA 4F6RC 2Z6EA 3IF8B 3UU6A 2WZHA 5H6QB 2EHOB 2K3WA 5AQPB 3MJXA 2VWAA 1YQ4A 5JQGE 4B3MT 2JQ9A 5LG4A 1KNZA 2XSAA 4UV8B 4PJNA 4AQGA 1T72A 3RPUA 2MBGA 2VQFT 2XQ8A 3ABVA 4H9PC 1UUSA 4DR3T 4Q25A 5L3FB 3CQXC 5AQHB 3JC6D 3O1HA 4DV5T 4B3TT 4HWIB 4GOUA 3P7IA 4DUZT 4TNVA 2JPFA 2BG9C 2IHR1 2CLYB 1XWMA 4ILAA 1D0YA 1KEYA 4JUYA 4HE8A 4NXMT 1YQ3A 2XQYA 3N2OA 4LF7T 3ZMSB 4EB6E 4UVBB 2WDRA 3NRYA 1UX4A 2W00A 5ABGA 5J2TE 2BG9A 4AQFA 2W4XA 4I4TE 2W63A 3HKCE 4NIQA 3NWIA 2OLTA 4NUUA 1KK7A 2LSGA 3AE4A 3ZJ1A 3PDYA 4U74A 3V5UA 3ETUA 2YINA 3VKGA 4IE5A 3C4WA 4GIWA 1IJ5A 2OA5A 1OEDC 2CXFA 3KVAA 1HF8A 3FXEB 2B76A 2WWUA 1NEKA 4CXXA 3B5MA 2CBJA 5L3CB 4ANJA 1FEWA 2XPKA 4GYRA 3L8RA 4QH5A 2PFVA 3QC9A 2JQKA 2ZM6T 3AVSA 1SUMB 1EZ3A 2KLQA 1HCIA 3CKDA 4IE4A 3N9MA 4U72A 4KHZF 1WLXA 3ZC1A 2K48A 2YDQA 3C98B 4ISTA 3AE7A 4QX7B 4EZ4A 4LFAT 4X5TA 2DNXA 2HHHT 4UEMA 2NW9A 3LK3B 4AKIA 3CVRA 3LBXB 2WY2A 2WDVA 4ZS2A 5L4HA 2VL8A 4KI0F 4U31A 3OYXA 3N2GE 5FL0A 5AQJB 1YD8G 2E5LT 4YTPA 5JREA 3GWHA 1NWMX 4TN7B 2DWKA 5LP6E 4WBNE 4KHPT 1I94T 4KMCA 3RRCA 3ONXA 4X65T 5KXJA 5KMGP 5LOVE 3ZYMA 4YJ3E 4P0AA 1J1JA 2LT3A 4AISA 4LF4T 4YSYA 4ZOLE 4OX9T 2E9XC 4YTNA 3AE3A 2XHEB 3P4PA 2CBIA 3UQ7A 3RGLA 3H3AA 3C64A 3OTOT 2FBWA 3C50A 1ZKEA 2X51A 1WRDA 4IDQA 2ACXA 3QB5K 4BA9A 1VRBA 4IE0A 2Q9QB 3UUBA 2I59A 3RH3A 3AA6B 2VKHA 2E9XA 1VOMA 2ES0A 2WP9A 3UU4A 3A5XA 1E2AA 2BS4A 5ABHA 4E7ZA 4P0BA 3ZJ2A 3ZT5A 2CWOA 3LFMA 3H3MA 2W0GA 1I6ZA 5LXTE 4Z90A 5J0ZA 4QWNB 1MMNA 5JR9C 3G06A 5LGUB 4QHOA 1NAFA 1D1AA 3KVBA 3PU8A 4ADZA 2VKDA 4LF6T 4MHCA 2MPKA 5C3JA 3AE6A 1U5PA 4WNKA 4PFPA 3B57A 1XMQT 4JI1T 2DL1A 4H9NC 3O1JA 2XM1A 3N2KE 3KBTA 4U3CA 4M1PA 3ZCIA 3ZCJA 2E5VA 2KZ7B 2JIWA 2LOSA 1D0XA 3MZKB 4XBFB 3FXDB 3KV9A 3RX6A 5LA6E 3LBXA 4I0UA 2XAJB 5EK2A 3UUMA 1W09A 5FXWA 3QB5A 3AEAA 2X0YA 1HNWT 5BR8T 1T8BA 3OBVE 5LYJE 3OPCA 3L39A 5AQGB 5JDFA 3AECA 3RC3A 3ZT7A 1T98A 4YJ2E 2LSIA 5AQQB 4UV9B 1IBKT 3ZMZB 3NBXX 3VKHA 1JNRA 2YOEA 5LG3A 2V6YB 3Q5EA 2NP9A 3EI0A 2V7KA 2FJAA 5HXEA 2WS3A 5EZYE 5FXVA 4IDPA 1V9DA 2XJ7A 4WBOA 2FJEA 2W2UA 2BDEA 2NTXA 2EHOD 4PFOA 5J2UE 4EYUA 4CN6A 2CXLA 4HWFA 3PUVF 2VQET 1HTJF 4H63V 5FXZA 1G8XA 3EDUA 3PV0F 4JBWF 3AEGA 2F4VT 4JI6T 2IMLA 3PURA 1Y64B 3MK7C 4EXTA 3OYZA 4IDZA 2IUBA 4YFSA 2KNDA 3AA0B 3QUJA 2ZM0A 4H63H 4JLEA 2CXDA 3PUSA 1IBLT 4HFIA 4C90A 3L3PA 1WR6A 3FZKB 2JMKA 1HG5A 2BKPA 4O4LE 5EK3A 3AXJB 3RF1A 5ADXL 2B1EA 3CX7B 1BR4A 1XNRT 4IE6A 2V1DB 3M65A 2KWHA 5H6RB 1ZP0A 1MNEA 5JDGA 4XZCA 4LMLA 2C5KT 4BJNA 3JAEA 4JI3T 3UU3A 1OEDE 4COFA 1XNQT 4KX6A 5LMNT 4X66T 3D0TA 5JDLA 5CA0E 4AKRB 3ANWA 3DP7A 5AFUL 2NWBA 5LHIB 3U78A 2GK9A 3KFWX 3RLFF 4QXCB 4JI4T 5IUXA 3P4SA 5HCJA 3FZMB 4DR6T 3BQIA 2RA1A 3I0OA 3PUQA 2E8IA 5FY0A 4H9OC 1H7CA 3S4UA 4DV3T 3IHRA 2K5BB 2I6HA 3NVOA 4AI6A 1M7KA 4DV1T 2UXXB 4KP3C 3PE0A 5L2LA 3ZSTA 4MLKA 2WBLA 3Q2MA 2CWYA 5FYMA 4LMKA 1MMDA 2V6YA 3B13A 4DV2T 3N9OA 3MA9A 1WYCA 3RIAA 2X9WA 5AQTB 4WYVA 3AE1A 3CWZB 1GQEA 4ZEYA 2ODVA 3O4XE 4J2CA 3VRBA 2LRLA 2J1DG 2XZEA 4FI5A 2YKSA 3ONLC 2G0UA 2WU2A 1QLBA 4AQFC 3ZPOA 1KF6A 4IGUA 4U2YA 3TKLB 1MIVA 3FZFB 2DI4A 4TWDA 3NKZA 4ILUA 3C4ZA 3H37A 5JTGA 4PJLA 4HGAA 3Q5DA 4LFBT 4MFRA 5HAXA 4X1KE 1S35A 3PJAA 2ZMAA 1SHZC 2YK0A 5LHGB 2BS2A 1NENA 1W0AA 3ESLA 2CEAA 4DV0T 4U7IA 3AA1B 4X1IE 2IDOB 1R8IA 1JNZA 3Q5XA 3ONJA 4GKJT 3J7Yq 1FIOA 4QXBB 4H9RC 3AEEA 4QH4A 2W67A 3VU7H 2D2SA 5C2TA 3N9QA 4CI3B 4IL4A 3IEEA 2V8SV 4AIUA 3Q9DA 3JCFA 5HXHA 1YW0A 4FJOA 5LGTB 5JH7E 4Z91A 5AQMB 1BR0A 1LRZA 2V7LA 2IAKA 3ZSSA 3SS1A 2EHOC 5GONE 4HEAA 2Q9QD 4DBQA 3K1SA 4IE7A 4A5XA 3TLWA 2WM9A 5HWXA 4DR1T 4P1NA 2XQ7A 2KSRA 1XDOA 5FVLA 5DQWA 2VK9A 4Z8XA 2XAFB 3RHWA 2MAWA 2HH7A 2LKHA 3QNUA 4ZZBA 4AKGA 4H9SE 2WAUA 3RIUC 2LM2A 3O9XA 1N36T 2EHOA 3CQCB
chains in the Genus database with same CATH topology
2VKDA 3MXZA 2CMRA 3EDVA 5FMNA 4MHCA 5KDMC 3O1IA 1B7TA 4X20E 1IJ6A 4UXNB 1U5PA 5JDQA 4WNKA 2XASB 4PFPA 3MACA 4O8SA 3B57A 3CX8B 2BVMA 2D5UA 1HFAA 3F2EA 4H9NC 2VKJA 3O1JA 4QX8B 2KXPB 3N2KE 3KBTA 3ZEFB 2CCQA 2DCFA 4G63A 4QXHB 2SPCA 4CQIA 4DMWA 5BMVE 5L3BB 4M1PA 3ZCIA 3ZCJA 3R6NA 4KBMB 2CM0A 4OHFA 2CLYC 3GN5B 5IYZE 2KZ7B 4K0UA 4E7SA 2LOSA 2PBIA 1D0XA 2LJLA 2ZM2A 2JQQA 2A72A 3ZN0B 2DWGA 3ZYLA 4BAYB 3MZKB 3N5LA 4XBFB 4ZI2D 5CA1E 2PG8A 1ZHCA 3HR0A 3FXDB 4CI2B 2BVLA 3KV9A 3RX6A 3J9X1 5L3GB 5LA6E 2P9BA 3RRWA 3LBXA 3UTKA 3RC8A 2XAJB 5EK2A 5IHYA 3UUMA 5FXWA 4O4JE 4EZHA 4KUMB 3AVRA 3HL6A 3NRXA 3NZPA 3OBVE 5LYJE 3OJAA 4AXPA 4CXWA 2C5JA 2X66A 1YKEB 5JDFA 3RYHE 4TX5A 3EVYA 3RC3A 3AA7B 2VKOA 4ZHQE 4DNDA 1T98A 2E9XB 3IBPA 2KWIB 2CA5A 2LSIA 4YJ2E 5LGNB 4OYJA 4UV9B 3L09A 5HXRA 5LBQB 3ZMZB 3NBXX 1MIYA 2E9XD 2LSKA 3ZMUB 4NUVA 3CPZA 3HKDE 2HPLA 3VKHA 1OXZA 4GK0E 3V5SA 4PK5A 1ZEEA 3K8PC 4UIGA 3T8OA 4EOZB 1BR2A 5A1LA 4L0RA 2Y6XA 2MTQA 5J1GA 1BR1A 2NP9A 2V7KA 1AJ3A 1UCUA 5HXEA 1FMWA 5EZYE 4AKLA 1OWAA 3DTOA 3PUAA 5FXVA 4F6RC 1V9DA 4WBOA 3ZYKA 3RYFE 2Z6EA 3IF8B 2NOXA 2LSJA 2H7OA 2BDEA 3KBUA 4WW0A 2W61A 3N9PA 2L8KA 1SA0E 5H6QB 2EHOB 4I50E 3MJXA 2VWAA 2NTXA 3WAKA 5JQGE 4EAHA 2JJ9A 2EHOD 4PFOA 5J2UE 2L9QA 4EYUA 5LG4A 1KNZA 2NTYA 2CXLA 2DHRA 4UV8B 1HTJF 4H63V 5FXZA 4PJNA 4AQGA 1G8XA 3EDUA 4GYSA 3RPUA 2LHNA 1X79A 1MIWA 3C4XA 4O2AE 3SRZA 2MBGA 1LKXA 4C91A 3PURA 1O3XA 1Y64B 3MK7C 3RYCE 4PK4A 4EXTA 3OYZA 2XAGB 4IDZA 5E0OA 5HWYA 5FY7A 4YFSA 4H9PC 3K3QC 2KNDA 2LE8A 5JR9B 1FMVA 3AA0B 3QUJA 5L3FB 2RP4A 3CQXC 5KX5E 2ZM0A 4G2AA 2NW7A 3E0ZA 4H63H 1Z0PA 3I0QA 3AAEB 3VHLA 3RKOA 4EYYR 4JLEA 3F31A 5FXXA 3JC6D 2CXDA 2V7MA 3O1HA 3PUSA 2PJQA 4PW8A 4ZI3D 5JRCB 3HKEE 4TUYE 3U3IA 4C90A 3L3PA 1WR6A 3F57A 2HPJA 3ZC0A 2JMKA 3AB3B 4CI1B 2Y48B 4GOUA 3P7IA 3Q5WA 1HG5A 4O4LE 5EK3A 5M4YA 5ADXL 2JPFA 2ODUA 2B1EA 4H9QC 3CX7B 1BR4A 3LK2B 4OYKA 4IE6A 2V1DB 3M65A 1D1BA 2KWHA 5H6RB 1MMAA 5TAOA 1HS7A 2XAQB 3KV6A 1MNEA 3LK42 2CLYB 5JDGA 5LBMA 5LJNA 4XZCA 2MYSA 4I55E 4UF0B 1D0YA 4ZS3A 2C5KT 4BJNA 4JUYA 3UULA 4HE8A 2Y8DA 5FNVE 1HX8A 3I9YA 2LOPA 4N78D 2QGSA 2XQYA 2A2FX 3N2OA 2H7VC 5DABA 5FP3A 4I43B 3ZMSB 2D0UA 3NZQA 4O4IE 4EB6E 3BK9A 4UVBB 5HXSA 2ZM8A 3NRYA 1UX4A 2VB6A 3E22E 2C5IT 2W00A 5J2TE 4AQFA 2C0SA 4HKAA 4I4TE 3HI2A 1WYBA 2W63A 3HKCE 4NUUA 3C51A 3D0TA 5JDLA 4EIWA 5CA0E 1KK7A 4AKRB 3ANWA 2LSGA 3DP7A 3ZJ1A 2WMOA 3PDYA 4U74A 3KV4A 3MKDA 3V5UA 2H3RA 5C8YE 2WSSV 2KT9A 5AFUL 2NWBA 3ETUA 3EUHA 3HA4A 2A3DA 2YINA 3LG7A 3U78A 5LHIB 2GK9A 3VKGA 3KFWX 4QXCB 4O4HE 5L3DB 4IE5A 3C4WA 4GIWA 1IJ5A 2OA5A 3BQIA 2NW8A 3PU3A 4ZI7E 3QK6A 2RA1A 2CXFA 3I0OA 3W15B 3HKBE 3PUQA 2Q9QC 2LSYA 2VASA 2MOZA 4CXYA 2BZBA 3KVAA 1HF8A 2E8IA 3GMIA 3FXEB 5FY0A 2WWUA 1H7CA 4H9OC 2DLRA 2QA7A 3S4UA 4CXXA 3IHRA 5L3CB 2K5BB 2N2NA 4AI6A 4ANJA 5LHHB 4UELA 2UXXB 1FEWA 3WI3A 4GYRA 4KP3C 3PE0A 2X68A 5L2LA 2PFVA 2LM9A 3CX6B 3QC9A 3FB2A 2UXNB 2W62A 3AVSA 2D0TA 1CUNA 3UFEA 1EZ3A 4MLKA 2WBLA 2L3LA 2KLQA 2V7IA 1HCIA 3Q2MA 1E1HB 2CWYA 2X67A 3CKDA 4IE4A 5FYMA 3N9MA 4OK0A 5LJMA 4U72A 1MMDA 3BQKA 4V1Av 5DQVA 1S94A 3B13A 4L5GA 3N9OA 2JMHA 2Q9QA 3MA9A 1WYCA 2X9WA 1WLXA 3ZC1A 5JDHA 2K48A 3DJBA 3C98B 4ISTA 4QX7B 4EZ4A 4HFVA 2DNXA 2ZLYA 3CWZB 4JEHB 4UEMA 2NW9A 3LK3B 3BQLA 2IW5B 4AKIA 2M67A 2ODVA 3N9LA 1HG2A 3JC6C 5L3EB 3PUGA 3CVRA 2X9YA 3O4XE 4J2CA 2J1DG 3LBXB 1IAPA 4FI5A 3ZN1B 2IC9A 2G0UA 2YU1A 2K24A 3AAIA 4IHJE 1LVFA 5F3JA 4ZS2A 4PJJA 2IC6A 3I9WA 4YLHA 2N9DA 1ZV4X 4AQFC 4JEUB 3ZPOA 2XUEA 3KV5A 2VL8A 3OYXA 3N2GE 4IGUA 3TKLB 1MIVA 3P8CD 2DI4A 5JDNA 4ZI2C 1YD8G 2X9XA 3UUNA 4UVCB 3CQGB 4PNIA 5JREA 4IIJE 3GWHA 4ILUA 1NWMX 4PAGA 3C4ZA 5LCYA 3H37A 5JR9A 4TN7B 1US7B 4PJLA 4BJMA 2DWKA 2WMNA 4HGAA 4ERRA 3ANWB 4OFZA 5LP6E 4DO0A 3ZMVB 4MFRA 4B6XA 5FY1A 4WBNE 1YKHB 4AKHA 5HAXA 4QKNA 4KMCA 4X1KE 5HYAA 1S35A 4HTEA 2KMFA 3AAAB 3ONXA 3RRCA 5LNKA 2K9AA 3FBZA 2ZMAA 4UVAB 3RYIE 5JRCA 5HXCA 1SHZC 2YK0A 2YEVC 2V26A 5LOVE 3ZYMA 5KMGP 5LHGB 4YJ3E 4P0AA 3ESLA 2CEAA 2LT3A 3FHNA 3AA1B 4TV8E 4X1IE 4X1YE 4DVDA 4ZOLE 3Q5XA 3GN5A 4HN9A 3J7Yq 1FIOA 1UX5A 4QXBB 4H9RC 2JRKA 2E9XC 1D0ZA 2X9HA 4A56A 3VU7H 3KDSE 3FBLA 3PTRB 2D2SA 2XHEB 3N9QA 4CI3B 3IEEA 2V7JA 1IZNB 3Q9DA 3WAJA 3ETVA 3SOLA 5HXHA 2XAHB 4UF0A 3H3AA 1YW0A 4FJOA 3LJCA 4PJMA 3C64A 5LGTB 5JH7E 4CZZB 1BR0A 3C50A 4DMVA 1ZKEA 1LRZA 2X51A 3N9NA 2V7LA 1WRDA 4PK6A 3CMLA 4MALA 2IAKA 2ACXA 2X0LB 4BA9A 3SS1A 1VRBA 4IE0A 2Q9QB 2I59A 3RH3A 1D1CA 3ZMTB 3AA6B 5CB4E 2EHOC 3GA8A 3I1AA 5GONE 2LEHA 3K3OA 3KINB 4O2BE 1MNDA 1QSDA 4HEAA 2Q9QD 4DBQA 2VKHA 3ZLIA 2E9XA 4ISSA 1VOMA 5JDMA 4IE7A 2ES0A 5JVDE 3UUXB 2WM9A 3A5XA 5HWXA 4DBRA 1G73A 4E7ZA 2XTLA 2YU2A 4P0BA 3UT5E 3ZJ2A 4TZ4C 2CWOA 3R84B 5ETWA 5DJQC 3LFMA 3OKQA 2W0GA 5DQWA 2VK9A 4Z8XA 4TV9E 5LXTE 2XAFB 2N1GA 2HH7A 3E08A 4P09A 2CE7A 3K3NA 4MBQA 4AKGA 4QWNB 1MMNA 4GK5E 5JR9C 5F8PA 5LGUB 4ASKA 4H9SE 2WAUA 2LHRA 4QHOA 1NAFA 3O9XA 2EHOA 1D1AA 2KINB 3SWHA 1QUUA 4L9IA 1MMGA 3KVBA 5EK4A 1LVKA 4ZI3C 3PU8A 1U4QA 4YHJA 4ADZA 3CQCB 4XAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEW A;  4JEU B;  2XHE B;  1G73 A;  1FIO A;  2DNX A;  5M4Y A;  4JEH B;  1BR0 A;  1S94 A;  1EZ3 A;  3C98 B;  4TX5 A;  1HS7 A;  3LG7 A;  5LG4 A; 
#chains in the Genus database with same CATH topology
 5FMN A;  5KDM C;  3O1I A;  2M6I A;  1B7T A;  4X20 E;  3MAC A;  2BVM A;  1HNZ T;  3EHZ A;  2UUA T;  2VKJ A;  2KXP B;  3ZEF B;  2CCQ A;  4QXH B;  2SPC A;  3AED A;  3R6N A;  3SFE A;  2CM0 A;  4OHF A;  2CLY C;  3GN5 B;  3RIU A;  2LJL A;  2ZM2 A;  3ZYL A;  4BAY B;  4ZI2 D;  2VL0 A;  4JYA T;  5AQN B;  2YDR A;  4O4J E;  4KUM B;  3NRX A;  4JI5 T;  1XZY A;  3OJA A;  4CN4 A;  4AXP A;  2UU9 T;  3AA7 B;  2VKO A;  4ZHQ E;  2M6B A;  1UK5 A;  3OVU A;  4OYJ A;  3L09 A;  5HXR A;  1MIY A;  4DR7 T;  3CPZ A;  2HPL A;  4YSZ A;  2BBJ A;  4GK0 E;  3V5S A;  4PK5 A;  1ZEE A;  3K8P C;  1BR2 A;  2MTQ A;  1BR1 A;  2HN1 A;  1UCU A;  1FMW A;  3DTO A;  4QH1 A;  3ZYK A;  5AQK B;  2NOX A;  2LSJ A;  2H7O A;  3KBU A;  2W61 A;  1SA0 E;  3WAK A;  3QOF A;  3FZH B;  2NTY A;  4ILC A;  2DHR A;  4GKK T;  2PTF A;  3PUY F;  2X0H A;  2LHN A;  1X79 A;  4IDO A;  4DR5 T;  4JI7 T;  3C4X A;  4O2A E;  3SRZ A;  3P4W A;  4C91 A;  1O3X A;  2AXD S;  4CN1 A;  5AQI B;  5HWY A;  5FY7 A;  2NW7 A;  3E0Z A;  3I0Q A;  5AQV B;  3F31 A;  4HFH A;  2V5D A;  4PW8 A;  2IIU A;  5JRC B;  3HKE E;  2YDS A;  4WZX A;  3ZC0 A;  3AB3 B;  1DU2 A;  4CI1 B;  3Q5W A;  3RI5 A;  1Y01 A;  2ODU A;  4H9Q C;  2VVN A;  3LK2 B;  3PUZ F;  4YHH T;  1MMA A;  2BBH A;  3KV6 A;  3LK4 2;  5LBM A;  5LJN A;  2MYS A;  4I55 E;  4UF0 B;  4ZS3 A;  4HWC A;  2WQY A;  3P4Q A;  1IBM T;  2Y8D A;  2AE9 A;  5FNV E;  2QGS A;  5ABF B;  2A2F X;  3P4R A;  5FP3 A;  3FZL B;  4I43 B;  2WB5 A;  1ZOY A;  2ZM8 A;  2VB6 A;  2C5I T;  4YXD A;  3HI2 A;  3C51 A;  3KV4 A;  2H3R A;  2W66 A;  5C8Y E;  4LF5 T;  3EUH A;  3LG7 A;  4O4H E;  3P50 A;  5L3D B;  3PU3 A;  3AE9 A;  4ZI7 E;  3PJA J;  3W15 B;  3RKG A;  3HKB E;  2Q9Q C;  2LRK A;  2MOZ A;  4CXY A;  2BZB A;  2DLR A;  1J5W A;  5L4E A;  5LHH B;  2CPT A;  3WI3 A;  5HEO A;  3RQU A;  2UXN B;  3AE2 A;  4DID B;  2LLY A;  2BG9 E;  2NR4 A;  5LJM A;  1Z8U A;  2JMH A;  2Q9Q A;  3TLS A;  3DJB A;  1SE7 A;  1HR0 T;  2VVS A;  4HFV A;  2ZLY A;  4JEH B;  2M67 A;  4JI2 T;  3PUG A;  2D9D A;  2X9Y A;  4TWF A;  2VUR A;  4DV4 T;  3ZN1 B;  3AAI A;  1LVF A;  5F3J A;  4EGW A;  4YLH A;  2IC6 A;  3I9W A;  4JEU B;  2YN6 A;  3P8C D;  5JDN A;  2V6X A;  4ZI2 C;  3UUN A;  4UVC B;  3CQG B;  4IIJ E;  4PAG A;  5LCY A;  4BJM A;  1US7 B;  4ERR A;  2JQH A;  3ZMV B;  4B3R T;  5FY1 A;  2WCA A;  1YKH B;  4AKH A;  3UQ4 A;  5HYA A;  3AAA B;  3RYI E;  5JRC A;  4HFC A;  2YEV C;  2V26 A;  4K0K T;  4HFB A;  1W9R A;  3FHN A;  4TV8 E;  4DVD A;  4HN9 A;  4A98 A;  1UX5 A;  4JI8 T;  3ZKR A;  3FBL A;  2BKN A;  4IT4 A;  3ETV A;  4IDN A;  3SOL A;  4UF0 A;  2ACZ A;  2UXC T;  3LJC A;  3PUW F;  4CZZ B;  4EED A;  1XDP A;  3N9N A;  4PK6 A;  1OED B;  5ABF A;  2XQ9 A;  3CML A;  4MAL A;  4U2Z A;  3AE8 A;  3GA8 A;  3KIN B;  3K3O A;  1QSD A;  5JDM A;  5JVD E;  3UUX B;  5LB7 B;  2UXB T;  2XQ3 A;  1G73 A;  2J47 A;  2XTL A;  2XQ5 A;  4LF9 T;  3UT5 E;  4TZ4 C;  5ETW A;  5DJQ C;  3OKQ A;  2CRB A;  2XQ4 A;  4TV9 E;  1FJG T;  1N32 T;  3JAF A;  5AQR B;  3EAB A;  2N1G A;  4P09 A;  2CE7 A;  3CK6 A;  5F8P A;  4ASK A;  1XMO T;  2WZI A;  4ZXL A;  2KIN B;  3SWH A;  1QUU A;  1MMG A;  4YHJ A;  4UXN B;  4XAX B;  3EDV A;  3M3Z B;  3SFD A;  1IJ6 A;  2E2A A;  5JDQ A;  2XAS B;  4O8S A;  3CX8 B;  5AQL B;  2D5U A;  3CIR A;  3F2E A;  5FL1 A;  4QX8 B;  5LMU T;  5BMV E;  2DCF A;  4DMW A;  4X64 T;  4KBM B;  5IYZ E;  4K0U A;  4E7S A;  2UUB T;  2HN2 A;  2WU5 A;  1ZHC A;  3HR0 A;  2BVL A;  3AEF A;  3RRW A;  3AXJ A;  3HL6 A;  2LKG A;  2C5J A;  4TX5 A;  2E9X B;  2KWI B;  4EV6 A;  4DV6 T;  2LSK A;  3ZMU B;  4NUV A;  1OXZ A;  4UIG A;  4L0R A;  4JV5 T;  2I0M A;  4DR2 T;  1AJ3 A;  4UR9 A;  2UXD T;  4AKL A;  3PUA A;  1E7P A;  4DUY T;  3RYF E;  4WW0 A;  3N9P A;  2L8K A;  4U33 A;  4I50 E;  4B3S T;  4EAH A;  2JJ9 A;  1WR0 A;  2L9Q A;  1M62 A;  4DR4 T;  3UU8 A;  3LDQ B;  1KFY A;  2CHN A;  4GYS A;  1MIW A;  1LKX A;  2H89 A;  3VRA A;  3EAM A;  3RYC E;  4PK4 A;  2XAG B;  5E0O A;  1OED A;  3K3Q C;  2LE8 A;  5JR9 B;  1FMV A;  2RP4 A;  5KX5 E;  4G2A A;  1Z0P A;  3VHL A;  3AAE B;  3RKO A;  4EYY R;  5FXX A;  2V7M A;  2PJQ A;  1CHU A;  4ZI3 D;  1W0B A;  3RQW A;  4TUY E;  3U3I A;  2QYW A;  3F57 A;  2HPJ A;  5AQU B;  2Y48 B;  3TLV A;  3X1D A;  5M4Y A;  4HFD A;  4OYK A;  1D1B A;  5TAO A;  1HS7 A;  2XAQ B;  1UGO A;  3ZT6 A;  1KNP A;  4YY3 T;  2R6G F;  3UUL A;  2H88 A;  3JAD A;  1HX8 A;  3I9Y A;  2LOP A;  4N78 D;  5DAB A;  2H7V C;  2D0U A;  3NZQ A;  4O4I E;  3BK9 A;  5HXS A;  3E22 E;  3IA3 A;  3UFG A;  2C0S A;  4HKA A;  5HCM A;  1WYB A;  2BS3 A;  4EIW A;  5ABE A;  2WMO A;  3MKD A;  2WSS V;  2KT9 A;  3HA4 A;  2A3D A;  4LF8 T;  4U7Y A;  3TLU A;  2FUP A;  4HWH A;  5HEH A;  2NW8 A;  4ILB A;  3QK6 A;  3VR9 A;  2LSY A;  2VAS A;  3GMI A;  2QA7 A;  2N2N A;  4TNW A;  4UEL A;  1WFD A;  1N33 T;  2X68 A;  2LM9 A;  3CX6 B;  3FB2 A;  2W62 A;  3TLT A;  3T1H T;  2D0T A;  1CUN A;  3UFE A;  5HEU A;  2L3L A;  2V7I A;  1VCS A;  5FVK A;  1E1H B;  2FJB A;  2XM2 A;  2X67 A;  4OK0 A;  2J4G A;  3BQK A;  4V1A v;  5DQV A;  1S94 A;  4ZZC A;  4L5G A;  4LMJ A;  2WDQ A;  5JDH A;  5CJ5 A;  3BQL A;  2IW5 B;  5L3E B;  3N9L A;  1HG2 A;  3JC6 C;  1T7S A;  5F5W A;  1IAP A;  2IC9 A;  2YU1 A;  4IHJ E;  2K24 A;  4PJJ A;  2N9D A;  1ZV4 X;  2XUE A;  3KV5 A;  4X62 T;  2RPA A;  2X9X A;  3A7M A;  4PNI A;  2J62 A;  4LFC T;  5JR9 A;  5IWA T;  2WMN A;  3ANW B;  4OFZ A;  4DO0 A;  4B6X A;  3AEB A;  4QKN A;  4HTE A;  2KMF A;  5LNK A;  1X9B A;  2K9A A;  3FBZ A;  4UVA B;  5HXC A;  3AE5 A;  5FKY A;  4X1Y E;  2BKO A;  3GN5 A;  2XY8 B;  4DV7 T;  2JRK A;  2X9H A;  1D0Z A;  4A56 A;  5CGM A;  4NPP A;  3KDS E;  3PTR B;  3VR8 A;  2V7J A;  1IZN B;  3WAJ A;  2XAH B;  4PJM A;  3A8Y C;  1VCT A;  4TWH A;  4DMV A;  1HNX T;  1N34 T;  1KNR A;  2X0L B;  4EEB A;  1D1C A;  3ZMT B;  5CB4 E;  3I1A A;  2LEH A;  4O2B E;  1MND A;  1J5E T;  3ZLI A;  4ISS A;  5L47 A;  4A97 A;  4DBR A;  2YU2 A;  3R84 B;  2XSB A;  2V5C A;  2A9U A;  1YXR A;  4HWD A;  3E08 A;  1L0V A;  3K3N A;  4MBQ A;  4GK5 E;  1HX1 B;  4YSX A;  1WCR A;  2LHR A;  2XQA A;  5AQS B;  2FJD A;  4L9I A;  5EK4 A;  1LVK A;  4ZI3 C;  1U4Q A;  3MXZ A;  3PUX F;  2CMR A;  2CHO A;  4F8H A;  4HFE A;  3T1Y T;  3RIF A;  1HFA A;  2BG9 B;  4G63 A;  4CQI A;  5L3B B;  2QRX A;  2UUC T;  2WWV A;  4YT0 A;  2PBI A;  4NXN T;  2JQQ A;  2A72 A;  3ZN0 B;  2DWG A;  3N5L A;  5CA1 E;  2PG8 A;  5HEJ A;  4CI2 B;  3J9X 1;  5L3G B;  2P9B A;  3UTK A;  3RC8 A;  5IHY A;  4EZH A;  2XQ6 A;  3AVR A;  4AQY T;  3NZP A;  4JI0 T;  2QVA A;  4CXW A;  2X66 A;  1YKE B;  3RYH E;  1UUR A;  3EVY A;  4DND A;  3IBP A;  5LGN B;  2CA5 A;  2OV9 A;  5LBQ B;  2E9X D;  4YTM A;  3HKD E;  5AQF B;  4IRE A;  3T8O A;  4EOZ B;  5A1L A;  3LSV A;  2Y6X A;  5J1G A;  5HEG A;  3UU5 A;  5AQO B;  4IL9 A;  5CFB A;  1OWA A;  4F6R C;  2Z6E A;  3IF8 B;  3UU6 A;  2WZH A;  5H6Q B;  2EHO B;  2K3W A;  5AQP B;  3MJX A;  2VWA A;  1YQ4 A;  5JQG E;  4B3M T;  2JQ9 A;  5LG4 A;  1KNZ A;  2XSA A;  4UV8 B;  4PJN A;  4AQG A;  1T72 A;  3RPU A;  2MBG A;  2VQF T;  2XQ8 A;  3ABV A;  4H9P C;  1UUS A;  4DR3 T;  4Q25 A;  5L3F B;  3CQX C;  5AQH B;  3JC6 D;  3O1H A;  4DV5 T;  4B3T T;  4HWI B;  4GOU A;  3P7I A;  4DUZ T;  4TNV A;  2JPF A;  2BG9 C;  2IHR 1;  2CLY B;  1XWM A;  4ILA A;  1D0Y A;  1KEY A;  4JUY A;  4HE8 A;  4NXM T;  1YQ3 A;  2XQY A;  3N2O A;  4LF7 T;  3ZMS B;  4EB6 E;  4UVB B;  2WDR A;  3NRY A;  1UX4 A;  2W00 A;  5ABG A;  5J2T E;  2BG9 A;  4AQF A;  2W4X A;  4I4T E;  2W63 A;  3HKC E;  4NIQ A;  3NWI A;  2OLT A;  4NUU A;  1KK7 A;  2LSG A;  3AE4 A;  3ZJ1 A;  3PDY A;  4U74 A;  3V5U A;  3ETU A;  2YIN A;  3VKG A;  4IE5 A;  3C4W A;  4GIW A;  1IJ5 A;  2OA5 A;  1OED C;  2CXF A;  3KVA A;  1HF8 A;  3FXE B;  2B76 A;  2WWU A;  1NEK A;  4CXX A;  3B5M A;  2CBJ A;  5L3C B;  4ANJ A;  1FEW A;  2XPK A;  4GYR A;  3L8R A;  4QH5 A;  2PFV A;  3QC9 A;  2JQK A;  2ZM6 T;  3AVS A;  1SUM B;  1EZ3 A;  2KLQ A;  1HCI A;  3CKD A;  4IE4 A;  3N9M A;  4U72 A;  4KHZ F;  1WLX A;  3ZC1 A;  2K48 A;  2YDQ A;  3C98 B;  4IST A;  3AE7 A;  4QX7 B;  4EZ4 A;  4LFA T;  4X5T A;  2DNX A;  2HHH T;  4UEM A;  2NW9 A;  3LK3 B;  4AKI A;  3CVR A;  3LBX B;  2WY2 A;  2WDV A;  4ZS2 A;  5L4H A;  2VL8 A;  4KI0 F;  4U31 A;  3OYX A;  3N2G E;  5FL0 A;  5AQJ B;  1YD8 G;  2E5L T;  4YTP A;  5JRE A;  3GWH A;  1NWM X;  4TN7 B;  2DWK A;  5LP6 E;  4WBN E;  4KHP T;  1I94 T;  4KMC A;  3RRC A;  3ONX A;  4X65 T;  5KXJ A;  5KMG P;  5LOV E;  3ZYM A;  4YJ3 E;  4P0A A;  1J1J A;  2LT3 A;  4AIS A;  4LF4 T;  4YSY A;  4ZOL E;  4OX9 T;  2E9X C;  4YTN A;  3AE3 A;  2XHE B;  3P4P A;  2CBI A;  3UQ7 A;  3RGL A;  3H3A A;  3C64 A;  3OTO T;  2FBW A;  3C50 A;  1ZKE A;  2X51 A;  1WRD A;  4IDQ A;  2ACX A;  3QB5 K;  4BA9 A;  1VRB A;  4IE0 A;  2Q9Q B;  3UUB A;  2I59 A;  3RH3 A;  3AA6 B;  2VKH A;  2E9X A;  1VOM A;  2ES0 A;  2WP9 A;  3UU4 A;  3A5X A;  1E2A A;  2BS4 A;  5ABH A;  4E7Z A;  4P0B A;  3ZJ2 A;  3ZT5 A;  2CWO A;  3LFM A;  3H3M A;  2W0G A;  1I6Z A;  5LXT E;  4Z90 A;  5J0Z A;  4QWN B;  1MMN A;  5JR9 C;  3G06 A;  5LGU B;  4QHO A;  1NAF A;  1D1A A;  3KVB A;  3PU8 A;  4ADZ A;  2VKD A;  4LF6 T;  4MHC A;  2MPK A;  5C3J A;  3AE6 A;  1U5P A;  4WNK A;  4PFP A;  3B57 A;  1XMQ T;  4JI1 T;  2DL1 A;  4H9N C;  3O1J A;  2XM1 A;  3N2K E;  3KBT A;  4U3C A;  4M1P A;  3ZCI A;  3ZCJ A;  2E5V A;  2KZ7 B;  2JIW A;  2LOS A;  1D0X A;  3MZK B;  4XBF B;  3FXD B;  3KV9 A;  3RX6 A;  5LA6 E;  3LBX A;  4I0U A;  2XAJ B;  5EK2 A;  3UUM A;  1W09 A;  5FXW A;  3QB5 A;  3AEA A;  2X0Y A;  1HNW T;  5BR8 T;  1T8B A;  3OBV E;  5LYJ E;  3OPC A;  3L39 A;  5AQG B;  5JDF A;  3AEC A;  3RC3 A;  3ZT7 A;  1T98 A;  4YJ2 E;  2LSI A;  5AQQ B;  4UV9 B;  1IBK T;  3ZMZ B;  3NBX X;  3VKH A;  1JNR A;  2YOE A;  5LG3 A;  2V6Y B;  3Q5E A;  2NP9 A;  3EI0 A;  2V7K A;  2FJA A;  5HXE A;  2WS3 A;  5EZY E;  5FXV A;  4IDP A;  1V9D A;  2XJ7 A;  4WBO A;  2FJE A;  2W2U A;  2BDE A;  2NTX A;  2EHO D;  4PFO A;  5J2U E;  4EYU A;  4CN6 A;  2CXL A;  4HWF A;  3PUV F;  2VQE T;  1HTJ F;  4H63 V;  5FXZ A;  1G8X A;  3EDU A;  3PV0 F;  4JBW F;  3AEG A;  2F4V T;  4JI6 T;  2IML A;  3PUR A;  1Y64 B;  3MK7 C;  4EXT A;  3OYZ A;  4IDZ A;  2IUB A;  4YFS A;  2KND A;  3AA0 B;  3QUJ A;  2ZM0 A;  4H63 H;  4JLE A;  2CXD A;  3PUS A;  1IBL T;  4HFI A;  4C90 A;  3L3P A;  1WR6 A;  3FZK B;  2JMK A;  1HG5 A;  2BKP A;  4O4L E;  5EK3 A;  3AXJ B;  3RF1 A;  5ADX L;  2B1E A;  3CX7 B;  1BR4 A;  1XNR T;  4IE6 A;  2V1D B;  3M65 A;  2KWH A;  5H6R B;  1ZP0 A;  1MNE A;  5JDG A;  4XZC A;  4LML A;  2C5K T;  4BJN A;  3JAE A;  4JI3 T;  3UU3 A;  1OED E;  4COF A;  1XNQ T;  4KX6 A;  5LMN T;  4X66 T;  3D0T A;  5JDL A;  5CA0 E;  4AKR B;  3ANW A;  3DP7 A;  5AFU L;  2NWB A;  5LHI B;  3U78 A;  2GK9 A;  3KFW X;  3RLF F;  4QXC B;  4JI4 T;  5IUX A;  3P4S A;  5HCJ A;  3FZM B;  4DR6 T;  3BQI A;  2RA1 A;  3I0O A;  3PUQ A;  2E8I A;  5FY0 A;  4H9O C;  1H7C A;  3S4U A;  4DV3 T;  3IHR A;  2K5B B;  2I6H A;  3NVO A;  4AI6 A;  1M7K A;  4DV1 T;  2UXX B;  4KP3 C;  3PE0 A;  5L2L A;  3ZST A;  4MLK A;  2WBL A;  3Q2M A;  2CWY A;  5FYM A;  4LMK A;  1MMD A;  2V6Y A;  3B13 A;  4DV2 T;  3N9O A;  3MA9 A;  1WYC A;  3RIA A;  2X9W A;  5AQT B;  4WYV A;  3AE1 A;  3CWZ B;  1GQE A;  4ZEY A;  2ODV A;  3O4X E;  4J2C A;  3VRB A;  2LRL A;  2J1D G;  2XZE A;  4FI5 A;  2YKS A;  3ONL C;  2G0U A;  2WU2 A;  1QLB A;  4AQF C;  3ZPO A;  1KF6 A;  4IGU A;  4U2Y A;  3TKL B;  1MIV A;  3FZF B;  2DI4 A;  4TWD A;  3NKZ A;  4ILU A;  3C4Z A;  3H37 A;  5JTG A;  4PJL A;  4HGA A;  3Q5D A;  4LFB T;  4MFR A;  5HAX A;  4X1K E;  1S35 A;  3PJA A;  2ZMA A;  1SHZ C;  2YK0 A;  5LHG B;  2BS2 A;  1NEN A;  1W0A A;  3ESL A;  2CEA A;  4DV0 T;  4U7I A;  3AA1 B;  4X1I E;  2IDO B;  1R8I A;  1JNZ A;  3Q5X A;  3ONJ A;  4GKJ T;  3J7Y q;  1FIO A;  4QXB B;  4H9R C;  3AEE A;  4QH4 A;  2W67 A;  3VU7 H;  2D2S A;  5C2T A;  3N9Q A;  4CI3 B;  4IL4 A;  3IEE A;  2V8S V;  4AIU A;  3Q9D A;  3JCF A;  5HXH A;  1YW0 A;  4FJO A;  5LGT B;  5JH7 E;  4Z91 A;  5AQM B;  1BR0 A;  1LRZ A;  2V7L A;  2IAK A;  3ZSS A;  3SS1 A;  2EHO C;  5GON E;  4HEA A;  2Q9Q D;  4DBQ A;  3K1S A;  4IE7 A;  4A5X A;  3TLW A;  2WM9 A;  5HWX A;  4DR1 T;  4P1N A;  2XQ7 A;  2KSR A;  1XDO A;  5FVL A;  5DQW A;  2VK9 A;  4Z8X A;  2XAF B;  3RHW A;  2MAW A;  2HH7 A;  2LKH A;  3QNU A;  4ZZB A;  4AKG A;  4H9S E;  2WAU A;  3RIU C;  2LM2 A;  3O9X A;  1N36 T;  2EHO A;  3CQC B; 
#chains in the Genus database with same CATH homology
 2VKD A;  3MXZ A;  2CMR A;  3EDV A;  5FMN A;  4MHC A;  5KDM C;  3O1I A;  1B7T A;  4X20 E;  1IJ6 A;  4UXN B;  1U5P A;  5JDQ A;  4WNK A;  2XAS B;  4PFP A;  3MAC A;  4O8S A;  3B57 A;  3CX8 B;  2BVM A;  2D5U A;  1HFA A;  3F2E A;  4H9N C;  2VKJ A;  3O1J A;  4QX8 B;  2KXP B;  3N2K E;  3KBT A;  3ZEF B;  2CCQ A;  2DCF A;  4G63 A;  4QXH B;  2SPC A;  4CQI A;  4DMW A;  5BMV E;  5L3B B;  4M1P A;  3ZCI A;  3ZCJ A;  3R6N A;  4KBM B;  2CM0 A;  4OHF A;  2CLY C;  3GN5 B;  5IYZ E;  2KZ7 B;  4K0U A;  4E7S A;  2LOS A;  2PBI A;  1D0X A;  2LJL A;  2ZM2 A;  2JQQ A;  2A72 A;  3ZN0 B;  2DWG A;  3ZYL A;  4BAY B;  3MZK B;  3N5L A;  4XBF B;  4ZI2 D;  5CA1 E;  2PG8 A;  1ZHC A;  3HR0 A;  3FXD B;  4CI2 B;  2BVL A;  3KV9 A;  3RX6 A;  3J9X 1;  5L3G B;  5LA6 E;  2P9B A;  3RRW A;  3LBX A;  3UTK A;  3RC8 A;  2XAJ B;  5EK2 A;  5IHY A;  3UUM A;  5FXW A;  4O4J E;  4EZH A;  4KUM B;  3AVR A;  3HL6 A;  3NRX A;  3NZP A;  3OBV E;  5LYJ E;  3OJA A;  4AXP A;  4CXW A;  2C5J A;  2X66 A;  1YKE B;  5JDF A;  3RYH E;  4TX5 A;  3EVY A;  3RC3 A;  3AA7 B;  2VKO A;  4ZHQ E;  4DND A;  1T98 A;  2E9X B;  3IBP A;  2KWI B;  2CA5 A;  2LSI A;  4YJ2 E;  5LGN B;  4OYJ A;  4UV9 B;  3L09 A;  5HXR A;  5LBQ B;  3ZMZ B;  3NBX X;  1MIY A;  2E9X D;  2LSK A;  3ZMU B;  4NUV A;  3CPZ A;  3HKD E;  2HPL A;  3VKH A;  1OXZ A;  4GK0 E;  3V5S A;  4PK5 A;  1ZEE A;  3K8P C;  4UIG A;  3T8O A;  4EOZ B;  1BR2 A;  5A1L A;  4L0R A;  2Y6X A;  2MTQ A;  5J1G A;  1BR1 A;  2NP9 A;  2V7K A;  1AJ3 A;  1UCU A;  5HXE A;  1FMW A;  5EZY E;  4AKL A;  1OWA A;  3DTO A;  3PUA A;  5FXV A;  4F6R C;  1V9D A;  4WBO A;  3ZYK A;  3RYF E;  2Z6E A;  3IF8 B;  2NOX A;  2LSJ A;  2H7O A;  2BDE A;  3KBU A;  4WW0 A;  2W61 A;  3N9P A;  2L8K A;  1SA0 E;  5H6Q B;  2EHO B;  4I50 E;  3MJX A;  2VWA A;  2NTX A;  3WAK A;  5JQG E;  4EAH A;  2JJ9 A;  2EHO D;  4PFO A;  5J2U E;  2L9Q A;  4EYU A;  5LG4 A;  1KNZ A;  2NTY A;  2CXL A;  2DHR A;  4UV8 B;  1HTJ F;  4H63 V;  5FXZ A;  4PJN A;  4AQG A;  1G8X A;  3EDU A;  4GYS A;  3RPU A;  2LHN A;  1X79 A;  1MIW A;  3C4X A;  4O2A E;  3SRZ A;  2MBG A;  1LKX A;  4C91 A;  3PUR A;  1O3X A;  1Y64 B;  3MK7 C;  3RYC E;  4PK4 A;  4EXT A;  3OYZ A;  2XAG B;  4IDZ A;  5E0O A;  5HWY A;  5FY7 A;  4YFS A;  4H9P C;  3K3Q C;  2KND A;  2LE8 A;  5JR9 B;  1FMV A;  3AA0 B;  3QUJ A;  5L3F B;  2RP4 A;  3CQX C;  5KX5 E;  2ZM0 A;  4G2A A;  2NW7 A;  3E0Z A;  4H63 H;  1Z0P A;  3I0Q A;  3AAE B;  3VHL A;  3RKO A;  4EYY R;  4JLE A;  3F31 A;  5FXX A;  3JC6 D;  2CXD A;  2V7M A;  3O1H A;  3PUS A;  2PJQ A;  4PW8 A;  4ZI3 D;  5JRC B;  3HKE E;  4TUY E;  3U3I A;  4C90 A;  3L3P A;  1WR6 A;  3F57 A;  2HPJ A;  3ZC0 A;  2JMK A;  3AB3 B;  4CI1 B;  2Y48 B;  4GOU A;  3P7I A;  3Q5W A;  1HG5 A;  4O4L E;  5EK3 A;  5M4Y A;  5ADX L;  2JPF A;  2ODU A;  2B1E A;  4H9Q C;  3CX7 B;  1BR4 A;  3LK2 B;  4OYK A;  4IE6 A;  2V1D B;  3M65 A;  1D1B A;  2KWH A;  5H6R B;  1MMA A;  5TAO A;  1HS7 A;  2XAQ B;  3KV6 A;  1MNE A;  3LK4 2;  2CLY B;  5JDG A;  5LBM A;  5LJN A;  4XZC A;  2MYS A;  4I55 E;  4UF0 B;  1D0Y A;  4ZS3 A;  2C5K T;  4BJN A;  4JUY A;  3UUL A;  4HE8 A;  2Y8D A;  5FNV E;  1HX8 A;  3I9Y A;  2LOP A;  4N78 D;  2QGS A;  2XQY A;  2A2F X;  3N2O A;  2H7V C;  5DAB A;  5FP3 A;  4I43 B;  3ZMS B;  2D0U A;  3NZQ A;  4O4I E;  4EB6 E;  3BK9 A;  4UVB B;  5HXS A;  2ZM8 A;  3NRY A;  1UX4 A;  2VB6 A;  3E22 E;  2C5I T;  2W00 A;  5J2T E;  4AQF A;  2C0S A;  4HKA A;  4I4T E;  3HI2 A;  1WYB A;  2W63 A;  3HKC E;  4NUU A;  3C51 A;  3D0T A;  5JDL A;  4EIW A;  5CA0 E;  1KK7 A;  4AKR B;  3ANW A;  2LSG A;  3DP7 A;  3ZJ1 A;  2WMO A;  3PDY A;  4U74 A;  3KV4 A;  3MKD A;  3V5U A;  2H3R A;  5C8Y E;  2WSS V;  2KT9 A;  5AFU L;  2NWB A;  3ETU A;  3EUH A;  3HA4 A;  2A3D A;  2YIN A;  3LG7 A;  3U78 A;  5LHI B;  2GK9 A;  3VKG A;  3KFW X;  4QXC B;  4O4H E;  5L3D B;  4IE5 A;  3C4W A;  4GIW A;  1IJ5 A;  2OA5 A;  3BQI A;  2NW8 A;  3PU3 A;  4ZI7 E;  3QK6 A;  2RA1 A;  2CXF A;  3I0O A;  3W15 B;  3HKB E;  3PUQ A;  2Q9Q C;  2LSY A;  2VAS A;  2MOZ A;  4CXY A;  2BZB A;  3KVA A;  1HF8 A;  2E8I A;  3GMI A;  3FXE B;  5FY0 A;  2WWU A;  1H7C A;  4H9O C;  2DLR A;  2QA7 A;  3S4U A;  4CXX A;  3IHR A;  5L3C B;  2K5B B;  2N2N A;  4AI6 A;  4ANJ A;  5LHH B;  4UEL A;  2UXX B;  1FEW A;  3WI3 A;  4GYR A;  4KP3 C;  3PE0 A;  2X68 A;  5L2L A;  2PFV A;  2LM9 A;  3CX6 B;  3QC9 A;  3FB2 A;  2UXN B;  2W62 A;  3AVS A;  2D0T A;  1CUN A;  3UFE A;  1EZ3 A;  4MLK A;  2WBL A;  2L3L A;  2KLQ A;  2V7I A;  1HCI A;  3Q2M A;  1E1H B;  2CWY A;  2X67 A;  3CKD A;  4IE4 A;  5FYM A;  3N9M A;  4OK0 A;  5LJM A;  4U72 A;  1MMD A;  3BQK A;  4V1A v;  5DQV A;  1S94 A;  3B13 A;  4L5G A;  3N9O A;  2JMH A;  2Q9Q A;  3MA9 A;  1WYC A;  2X9W A;  1WLX A;  3ZC1 A;  5JDH A;  2K48 A;  3DJB A;  3C98 B;  4IST A;  4QX7 B;  4EZ4 A;  4HFV A;  2DNX A;  2ZLY A;  3CWZ B;  4JEH B;  4UEM A;  2NW9 A;  3LK3 B;  3BQL A;  2IW5 B;  4AKI A;  2M67 A;  2ODV A;  3N9L A;  1HG2 A;  3JC6 C;  5L3E B;  3PUG A;  3CVR A;  2X9Y A;  3O4X E;  4J2C A;  2J1D G;  3LBX B;  1IAP A;  4FI5 A;  3ZN1 B;  2IC9 A;  2G0U A;  2YU1 A;  2K24 A;  3AAI A;  4IHJ E;  1LVF A;  5F3J A;  4ZS2 A;  4PJJ A;  2IC6 A;  3I9W A;  4YLH A;  2N9D A;  1ZV4 X;  4AQF C;  4JEU B;  3ZPO A;  2XUE A;  3KV5 A;  2VL8 A;  3OYX A;  3N2G E;  4IGU A;  3TKL B;  1MIV A;  3P8C D;  2DI4 A;  5JDN A;  4ZI2 C;  1YD8 G;  2X9X A;  3UUN A;  4UVC B;  3CQG B;  4PNI A;  5JRE A;  4IIJ E;  3GWH A;  4ILU A;  1NWM X;  4PAG A;  3C4Z A;  5LCY A;  3H37 A;  5JR9 A;  4TN7 B;  1US7 B;  4PJL A;  4BJM A;  2DWK A;  2WMN A;  4HGA A;  4ERR A;  3ANW B;  4OFZ A;  5LP6 E;  4DO0 A;  3ZMV B;  4MFR A;  4B6X A;  5FY1 A;  4WBN E;  1YKH B;  4AKH A;  5HAX A;  4QKN A;  4KMC A;  4X1K E;  5HYA A;  1S35 A;  4HTE A;  2KMF A;  3AAA B;  3ONX A;  3RRC A;  5LNK A;  2K9A A;  3FBZ A;  2ZMA A;  4UVA B;  3RYI E;  5JRC A;  5HXC A;  1SHZ C;  2YK0 A;  2YEV C;  2V26 A;  5LOV E;  3ZYM A;  5KMG P;  5LHG B;  4YJ3 E;  4P0A A;  3ESL A;  2CEA A;  2LT3 A;  3FHN A;  3AA1 B;  4TV8 E;  4X1I E;  4X1Y E;  4DVD A;  4ZOL E;  3Q5X A;  3GN5 A;  4HN9 A;  3J7Y q;  1FIO A;  1UX5 A;  4QXB B;  4H9R C;  2JRK A;  2E9X C;  1D0Z A;  2X9H A;  4A56 A;  3VU7 H;  3KDS E;  3FBL A;  3PTR B;  2D2S A;  2XHE B;  3N9Q A;  4CI3 B;  3IEE A;  2V7J A;  1IZN B;  3Q9D A;  3WAJ A;  3ETV A;  3SOL A;  5HXH A;  2XAH B;  4UF0 A;  3H3A A;  1YW0 A;  4FJO A;  3LJC A;  4PJM A;  3C64 A;  5LGT B;  5JH7 E;  4CZZ B;  1BR0 A;  3C50 A;  4DMV A;  1ZKE A;  1LRZ A;  2X51 A;  3N9N A;  2V7L A;  1WRD A;  4PK6 A;  3CML A;  4MAL A;  2IAK A;  2ACX A;  2X0L B;  4BA9 A;  3SS1 A;  1VRB A;  4IE0 A;  2Q9Q B;  2I59 A;  3RH3 A;  1D1C A;  3ZMT B;  3AA6 B;  5CB4 E;  2EHO C;  3GA8 A;  3I1A A;  5GON E;  2LEH A;  3K3O A;  3KIN B;  4O2B E;  1MND A;  1QSD A;  4HEA A;  2Q9Q D;  4DBQ A;  2VKH A;  3ZLI A;  2E9X A;  4ISS A;  1VOM A;  5JDM A;  4IE7 A;  2ES0 A;  5JVD E;  3UUX B;  2WM9 A;  3A5X A;  5HWX A;  4DBR A;  1G73 A;  4E7Z A;  2XTL A;  2YU2 A;  4P0B A;  3UT5 E;  3ZJ2 A;  4TZ4 C;  2CWO A;  3R84 B;  5ETW A;  5DJQ C;  3LFM A;  3OKQ A;  2W0G A;  5DQW A;  2VK9 A;  4Z8X A;  4TV9 E;  5LXT E;  2XAF B;  2N1G A;  2HH7 A;  3E08 A;  4P09 A;  2CE7 A;  3K3N A;  4MBQ A;  4AKG A;  4QWN B;  1MMN A;  4GK5 E;  5JR9 C;  5F8P A;  5LGU B;  4ASK A;  4H9S E;  2WAU A;  2LHR A;  4QHO A;  1NAF A;  3O9X A;  2EHO A;  1D1A A;  2KIN B;  3SWH A;  1QUU A;  4L9I A;  1MMG A;  3KVB A;  5EK4 A;  1LVK A;  4ZI3 C;  3PU8 A;  1U4Q A;  4YHJ A;  4ADZ A;  3CQC B;  4XAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...