2CM0A

The pub domain functions as a p97 binding module in human peptide n-glycanase.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'GSASPAVAELCQNTPETFLEASKLLLTYADAILRNPNDEAARSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE N-GLYCANASE HOMOLOG
publication title The Pub Domain Functions as a P97 Binding Module in Human Peptide N-Glycanase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cm0A00
4OYKA 4OYJA 4P09A 2HPJA 4P0BA 4P0AA 2CM0A 5LJNA 5LJMA 2D5UA 2CCQA 2HPLA 4JUYA
chains in the Genus database with same CATH superfamily
1MNEA 3KV4A 2CE7A 3AA0B 1J5ET 2RP4A 4IE4A 4NUUA 3ZEFB 2M67A 3OYZA 5EZYE 4H63H 4HN9A 2BVLA 4DMWA 3SS1A 4AQGA 4P1NA 2OV9A 1M7KA 3A8YC 3SWHA 4WW0A 3N9LA 2W00A 4TNWA 1T8BA 4LMKA 3Q5EA 3ZPOA 4EZHA 2WWVA 2UXCT 3O9XA 3OYXA 3UQ7A 1ZP0A 4CI2B 1IJ5A 5LNKA 2YN6A 5LG4A 4COFA 4U2YA 1Z0PA 2DNXA 4LMLA 4DR1T 2PG8A 3PURA 3JADA 4X1IE 5HXCA 5JDNA 3O4XE 2UXDT 1UURA 3X1DA 2ODUA 3N2OA 4IIJE 4UV8B 1T98A 2IDOB 2EHOD 3J9X1 4NXMT 5LMNT 4U74A 4IL9A 3IEEA 4IDQA 4JLEA 2YU2A 2GK9A 4N78D 4EAHA 4JI5T 3I0OA 5ABFB 4J2CA 1VCSA 3RRCA 4DR5T 2VB6A 3FBLA 2Q9QB 2KZ7B 4JI3T 3N9QA 1WCRA 4EXTA 2NTYA 1BR4A 1FIOA 4UVAB 2V1DB 1QLBA 5AQRB 5ADXL 4ZS2A 3UU3A 3LK2B 4GYSA 2YEVC 4CQIA 3IA3A 3MK7C 5FY0A 1BR0A 3C4WA 1T7SA 1HR0T 3ZC0A 5E0OA 2IMLA 1N32T 4EYUA 1HS7A 3TLUA 3ZYMA 4AXPA 2CA5A 2X0LB 3OJAA 2WB5A 3QB5K 1LRZA 4YT0A 5FXWA 4HFVA 1Z8UA 5LJNA 3N9PA 2XQ4A 1NENA 1D1AA 3AE6A 4U33A 4X5TA 3K1SA 1JNRA 4X62T 3ZJ1A 4ZXLA 2CCQA 2VURA 3FXDB 5AQGB 4JEUB 3C51A 2I6HA 2UXXB 3PU3A 4CXWA 5LOVE 3HR0A 4E7SA 4CI1B 3RLFF 1OEDE 2X9HA 5L2LA 4MHCA 4JYAT 4EB6E 3CX7B 2MBGA 4DMVA 3UUXB 1YW0A 5DQVA 2NR4A 2LHNA 3CKDA 1UCUA 2ZMAA 5IYZE 2XAGB 3LK42 4E7ZA 2LOPA 2WSSV 2LRLA 2CXDA 4ISSA 4U31A 2V26A 4DV1T 4LF6T 2W66A 2WBLA 4AQFC 4KX6A 3AE5A 1HNZT 1UUSA 4QKNA 2OA5A 1FMVA 2LE8A 1EZ3A 2E9XB 1MMDA 3EDUA 4JV5T 2WZHA 3AAAB 2ODVA 2V5CA 3AE9A 5AQVB 1ZOYA 2FBWA 3PDYA 4PK5A 3MZKB 3EDVA 4H9RC 4EEDA 2B76A 4Z91A 2X67A 5AQLB 2JJ9A 5FNVE 2WQYA 4FJOA 1XDPA 2JMKA 2KMFA 3RX6A 2XQ3A 1MMNA 3UU8A 3C4XA 2JQQA 2CXLA 3W15B 3VRBA 2HPJA 3C4ZA 1MIWA 3PJAA 5L3FB 3AE7A 4HWCA 2L9QA 3Q5XA 4G63A 2PFVA 2HN1A 2PTFA 3ZCJA 1NAFA 1XWMA 1VRBA 2V7KA 3ZSTA 2E5LT 5HXRA 3PTRB 2XQ8A 5HXSA 1FMWA 2CPTA 4OYKA 5JDGA 2XQ5A 5L4EA 3TLWA 3C64A 4O4IE 3L39A 4V1Av 3ZN0B 1W0AA 4DR7T 4KI0F 3BQLA 4U7IA 3CK6A 1SHZC 4HWDA 5L47A 3NRXA 3E22E 4IDNA 4HFHA 4ISTA 2LKGA 3CX6B 4X1KE 2N1GA 3I1AA 3KV6A 5C8YE 3HL6A 4HFIA 1IZNB 4YSXA 2K24A 4BJMA 3R6NA 3E0ZA 2X51A 5FMNA 1Y64B 3KV9A 1UX4A 1AJ3A 2J62A 3PUXF 5AQMB 4U2ZA 1YKEB 3TKLB 1MIYA 3AECA 1IAPA 2BG9B 3AEGA 3RGLA 4QH4A 4MFRA 1BR2A 4PJJA 2H88A 5FL0A 4GK0E 3ZMUB 2P9BA 1XNQT 2PBIA 5JR9B 2KT9A 5CJ5A 2XY8B 5FXXA 3UUMA 2YKSA 4AKGA 4ZEYA 3PE0A 3M65A 4IE7A 3U3IA 4IE6A 5JQGE 4JI6T 1UX5A 4AQYT 5JDMA 4YHHT 1ZEEA 4WBNE 5H6RB 2XTLA 2LOSA 1XZYA 2XPKA 3ZCIA 4HTEA 3CX8B 1E7PA 3EHZA 4LF8T 3QC9A 2KINB 1S94A 5C2TA 2IHR1 1I94T 4HWIB 2ZLYA 3P4RA 4YTMA 5HXEA 3HKCE 4PNIA 3HA4A 1X9BA 4PFPA 3VKHA 4DV0T 4LMJA 1D0YA 1FEWA 3U78A 3SFEA 2E2AA 3ZMSB 4MALA 4AKLA 3KV5A 4ZI7E 1N34T 5IUXA 3H37A 3AE1A 2HPLA 3T1HT 2LT3A 4PAGA 2X9XA 4Z8XA 4Q25A 5AQQB 2V7LA 4TV8E 3UFEA 2H7VC 5ABEA 5AQJB 1J5WA 5AQFB 3T8OA 3RRWA 2V5DA 4IDOA 2LHRA 2ACXA 2HN2A 1VCTA 1UGOA 2EHOB 2XSAA 3N9OA 3QOFA 2UXNB 1NWMX 4ZZCA 4DBRA 2XQ9A 1J1JA 2DI4A 4DBQA 5FVLA 2Y6XA 2I0MA 4PJLA 3RYHE 5JDQA 3ONXA 2E9XC 3NWIA 3ZMTB 3ZLIA 5J2UE 4JI1T 3UU4A 2W63A 2VASA 2BS4A 1W09A 3BQKA 2X9WA 3OPCA 5LHGB 1M62A 3QK6A 1YKHB 2W4XA 4MBQA 4GOUA 5LBMA 3F57A 3CPZA 4UXNB 2RPAA 4DIDB 4GK5E 5ABFA 4ANJA 3RPUA 3AE3A 4WBOA 3SRZA 4HKAA 2K48A 3AE2A 4Z90A 2VVNA 2Q9QA 4A56A 3ZYLA 5BR8T 3ESLA 2KLQA 2UUAT 4B6XA 1HF8A 4DV4T 5KDMC 1T72A 2NP9A 2V6XA 4L0RA 2G0UA 3AEDA 2JIWA 4KHZF 2X0HA 2Y8DA 3RF1A 3FZLB 4AKHA 3ANWB 3E08A 2NOXA 3PU8A 1KNPA 3PUYF 4C90A 1R8IA 3GA8A 3HI2A 5LG3A 1O3XA 1IJ6A 1N36T 3LG7A 4HE8A 3CQCB 3P4WA 4JUYA 3RYFE 5HCJA 4TWHA 5LJMA 1UK5A 3IF8B 4MLKA 3UT5E 4I55E 4F6RC 1US7B 3FXEB 1FJGT 5IHYA 3PJAJ 4IDZA 2BS3A 5LCYA 5DABA 5L3DB 4NXNT 2VK9A 2J1DG 2V6YB 2H89A 4LFAT 3FZFB 2LSGA 1OEDB 3SFDA 4IHJE 2V7MA 2WU2A 2WZIA 1D0XA 2BG9C 4CXYA 4NIQA 3NKZA 4EEBA 4JBWF 4I4TE 2N2NA 4QX8B 2Z6EA 3B13A 2Q9QD 3NVOA 3RHWA 3NRYA 2XJ7A 3NZQA 2J47A 5IWAT 4B3MT 1XMQT 2LRKA 2Y48B 4I50E 1ZHCA 2IAKA 2CMRA 1ZV4X 2CEAA 3UU5A 2LSYA 4QX7B 3B5MA 2NTXA 1XMOT 2E9XA 4X20E 3UU6A 3WI3A 4X65T 4FI5A 1WR6A 4B3TT 4JI2T 2BKNA 3LK3B 1Y01A 5HEJA 4BAYB 2DLRA 2V8SV 1WYBA 2CBIA 3ZT6A 4JI8T 2FJAA 3AEBA 2C5IT 1IBMT 4I0UA 3TLSA 4HFCA 4OYJA 3RC3A 3HKBE 4H9SE 4PK4A 2MOZA 4EYYR 2BZBA 3RH3A 1HCIA 2FJBA 5JRCA 3HKDE 3EABA 5L4HA 3KFWX 2VKHA 3FHNA 4K0KT 1DU2A 5M4YA 2UUCT 2CLYC 4IE0A 5FY7A 2XAFB 3P4SA 2M6IA 1VOMA 5JRCB 4EV6A 4UF0A 2D0UA 2WU5A 2XASB 4LFCT 4TV9E 5LP6E 2BBHA 4BA9A 2WDRA 4P0BA 5FKYA 3RKGA 2JQKA 4ZI2D 1G8XA 3UUBA 4UF0B 3EUHA 3Q2MA 3QUJA 5LGUB 3RIFA 5HWYA 2UUBT 4LF9T 1HG2A 1MMAA 2SPCA 2KWHA 2IC9A 3K3QC 4K0UA 5FXVA 3CMLA 3RQUA 2W0GA 2E9XD 3AAEB 3AA1B 4QXHB 4CZZB 4OHFA 2D5UA 2NWBA 3RIAA 4H9OC 3FZKB 4XBFB 3BK9A 1B7TA 3AEFA 3MKDA 4YFSA 2LSIA 1LVFA 3NBXX 3JAEA 2K3WA 1WFDA 2E8IA 3QNUA 4DNDA 4KMCA 1W9RA 4TX5A 2WCAA 3RYCE 3PUSA 3RKOA 2FJEA 2L3LA 2YOEA 1IBLT 4UIGA 1G73A 2A9UA 2BDEA 3DTOA 2LEHA 2BG9A 4UELA 4HEAA 1H7CA 1WR0A 3ZMVB 1HTJF 3P4PA 4QH1A 5F8PA 5JR9A 4JI4T 3JCFA 5LGTB 2LM9A 2ZM6T 4GKJT 5KXJA 4PJNA 3TLVA 3KVBA 4F8HA 4DV5T 2LJLA 2QVAA 4LF5T 5HYAA 3KVAA 5J0ZA 3C98B 3CQXC 2MAWA 3L8RA 3JAFA 5F5WA 2ZM2A 1XNRT 3VR9A 4EIWA 3ETUA 4WZXA 4YLHA 3I9WA 5AQIB 5H6QB 2H7OA 4O2BE 1SE7A 3LBXB 4WNKA 2Q9QC 4O8SA 2NW8A 4H63V 2YDSA 4AKIA 4TZ4C 2I59A 1W0BA 3RIUA 4DUYT 3N2KE 5HEUA 3M3ZB 2JQHA 5HAXA 5AQKB 2X0YA 1KNRA 3P7IA 3H3AA 4YJ3E 2V7JA 4DV3T 3FB2A 2XQYA 4G2AA 3ZC1A 4I43B 5HCMA 2VL0A 3KINB 2X68A 1HFAA 3PUVF 5LHHB 4XZCA 2W67A 4KBMB 3I9YA 5LBQB 5HEOA 3S4UA 5LYJE 3LJCA 2KNDA 3AE4A 2XQ6A 2XSBA 3UUNA 4P09A 4ZI3D 1GQEA 1X79A 4TUYE 2MYSA 2UXBT 3ZN1B 4U72A 3FZMB 3BQIA 4YSYA 2LM2A 2IW5B 3PUAA 4YXDA 3GWHA 2WM9A 4O4LE 4OX9T 2EHOA 1BR1A 4IL4A 1KFYA 4B3RT 3ETVA 5CB4E 3ZT5A 3CIRA 4UVCB 2VWAA 2LKHA 4GYRA 2CHNA 2A3DA 2YINA 2PJQA 2JRKA 3Q5DA 4TWDA 3PV0F 2B1EA 1OWAA 2BBJA 4ZI2C 4JI7T 5LGNB 5ABGA 3GMIA 1ZKEA 3AVRA 2R6GF 5J2TE 1HNWT 5JDHA 4GIWA 3O1JA 5JH7E 4X64T 3ZSSA 5DJQC 3P8CD 1SA0E 2J4GA 4H9NC 3ZYKA 3G06A 2D2SA 4QWNB 2QA7A 4QXBB 4ASKA 5LB7B 3C50A 4KUMB 2JMHA 2JQ9A 3VR8A 4DV7T 3VRAA 2VQET 5FXZA 2WP9A 2L8KA 3F31A 3I0QA 3CWZB 2NW9A 3ZJ2A 3ONJA 3AE8A 3UFGA 3MA9A 3AAIA 3PUGA 2IC6A 2XM1A 3J7Yq 2W2UA 1MMGA 1QUUA 3OKQA 5AQSB 4BJNA 4UR9A 4CN1A 2LSJA 2CHOA 4L5GA 4DV6T 5A1LA 2VL8A 5L3CB 3V5UA 2ZM8A 5EK3A 2XUEA 1LVKA 5KMGP 3UTKA 3ANWA 2F4VT 5FVKA 4ZS3A 4IREA 4ZZBA 1CHUA 3L09A 2FJDA 3MJXA 1YQ3A 5AQUB 3V5SA 2UU9T 2W62A 3UQ4A 5J1GA 3CVRA 2IIUA 4DR6T 3OBVE 4ILCA 2A2FX 3AA6B 4IDPA 3R84B 3PUZF 2ES0A 4CN6A 5HWXA 4AI6A 4DR2T 3N9NA 5FYMA 4U7YA 2BKOA 4CXXA 2M6BA 4H9QC 5C3JA 2MPKA 2XZEA 3VU7H 4U3CA 4QH5A 1WLXA 5JTGA 2KSRA 2V6YA 4DVDA 2LLYA 1WYCA 2QGSA 2OLTA 2QYWA 5TAOA 1OEDA 3UULA 5CA0E 5HEGA 4PK6A 4PJMA 2AXDS 4HFDA 3N2GE 3AB3B 3L3PA 4GKKT 2CRBA 3PUWF 3FZHB 3B57A 5L3BB 2VKJA 2XHEB 2E5VA 5AQNB 4ZI3C 5LHIB 2H3RA 2VKOA 2YU1A 1KK7A 4CN4A 4EOZB 5JR9C 1U4QA 2JPFA 2WDQA 5HXHA 3EI0A 4QXCB 2NW7A 4HWFA 3VHLA 2HH7A 4CI3B 4LFBT 4DO0A 1L0VA 4OFZA 3A5XA 4YJ2E 5JDLA 1V9DA 3JC6D 2C5JA 1WRDA 1HG5A 2BS2A 5L3GB 2BVMA 3VKGA 1YXRA 3OTOT 4H9PC 1XDOA 1CUNA 1SUMB 2CWOA 5AQPB 5FP3A 3TLTA 4JEHB 3RQWA 2QRXA 4ILAA 4UVBB 4EGWA 3EAMA 2ACZA 3RIUC 2DHRA 2YDQA 4TNVA 5LMUT 4LF7T 5ETWA 4HWHA 3F2EA 2AE9A 4YTPA 4LF4T 3ABVA 4O4HE 2KWIB 2BKPA 5AQOB 2D0TA 3P50A 3OVUA 2X66A 1KF6A 3WAKA 4P0AA 3AA7B 2IUBA 4A98A 2XAHB 4NPPA 3T1YT 4YTNA 3LFMA 1YQ4A 2XAQB 3AVSA 2WY2A 3Q5WA 2LSKA 4PFOA 5AFUL 4AKRB 2RA1A 5AQHB 4YHJA 3O1IA 2N9DA 2C0SA 1HNXT 1HX1B 2MTQA 4HFEA 3ZKRA 2EHOC 3P4QA 1N33T 2VVSA 3RC8A 2KXPB 3N9MA 4UV9B 3DP7A 1HX8A 4NUVA 5JREA 4OK0A 2CXFA 2WS3A 3WAJA 5LA6E 3D0TA 3PUQA 4HGAA 3MXZA 4IT4A 2DWKA 2YK0A 2YDRA 1NEKA 4DUZT 3QB5A 1MNDA 4ZOLE 2WDVA 4A97A 2D9DA 3K3NA 3SOLA 1I6ZA 4A5XA 5AQTB 5HEHA 4YY3T 3KDSE 1D1BA 3RI5A 5FL1A 1YD8G 2A72A 5DQWA 5KX5E 5GONE 4IE5A 4TWFA 1D0ZA 4YSZA 4X1YE 1JNZA 3LBXA 4QHOA 3ZT7A 5L3EB 2HHHT 4M1PA 1MIVA 2CM0A 2DL1A 3CQGB 3IHRA 1KNZA 5EK4A 2WMNA 4TN7B 4AISA 2X9YA 2K9AA 2XM2A 5EK2A 4IGUA 1U5PA 2ZM0A 2BG9E 4UEMA 1LKXA 4EZ4A 1IBKT 2XAJB 1S35A 5BMVE 2XQ7A 3GN5A 3AEEA 5ABHA 3NZPA 3O1HA 4ERRA 4L9IA 4DR3T 5JDFA 4AQFA 1OXZA 3RYIE 2V7IA 3KBTA 3H3MA 4WYVA 1QSDA 2FUPA 5CFBA 3MACA 5CA1E 4DV2T 3IBPA 3KBUA 3AXJA 3JC6C 2CWYA 3GN5B 4ILUA 5CGMA 3K8PC 5F3JA 4KHPT 3HKEE 2K5BB 4DR4T 3LSVA 4ZHQE 3AXJB 2WAUA 3ONLC 4ILBA 4B3ST 5LXTE 2VQFT 5JVDE 2CBJA 3K3OA 2VKDA 2XQAA 4PW8A 1OEDC 3A7MA 3LDQB 2CLYB 3Q9DA 4O2AE 4XAXB 2WWUA 3ZMZB 4HFBA 1D1CA 4JI0T 1E1HB 4ADZA 1E2AA 2W61A 2DCFA 4AIUA 4C91A 4X66T 3FBZA 3EVYA 2WMOA 3DJBA 5FY1A 3N5LA 1KEYA 4KP3C 2C5KT 4O4JE 3AEAA 2DWGA
chains in the Genus database with same CATH topology
1MNEA 3KV4A 1WLXA 2CE7A 3AA0B 4MFRA 1BR2A 2CLYC 4PJJA 4IE0A 5FY7A 2XAFB 4DVDA 1VOMA 1WYCA 4GK0E 2QGSA 5JRCB 3ZMUB 2P9BA 2RP4A 5TAOA 4IE4A 4NUUA 3ZEFB 2PBIA 5JR9B 2KT9A 3UULA 4UF0A 2D0UA 2M67A 3OYZA 5FXXA 5EZYE 2XASB 5CA0E 4H63H 4HN9A 3UUMA 4TV9E 4PK6A 5LP6E 4AKGA 4PJMA 2BVLA 4BA9A 4DMWA 3SS1A 4AQGA 4P0BA 3N2GE 3PE0A 3SWHA 3M65A 4IE7A 3U3IA 4IE6A 4ZI2D 1G8XA 3AB3B 3L3PA 4WW0A 5JQGE 3N9LA 2W00A 1UX5A 3ZPOA 4UF0B 4EZHA 5JDMA 1ZEEA 3EUHA 4WBNE 5H6RB 3O9XA 3B57A 3OYXA 2XTLA 5L3BB 3Q2MA 3QUJA 5LGUB 5HWYA 2VKJA 2XHEB 4CI2B 1IJ5A 2LOSA 1HG2A 3ZCIA 5LNKA 1MMAA 4HTEA 4ZI3C 5LHIB 5LG4A 2SPCA 3CX8B 2KWHA 2IC9A 3K3QC 2H3RA 2VKOA 4K0UA 5FXVA 3QC9A 1Z0PA 3CMLA 2KINB 2YU1A 2DNXA 2W0GA 1KK7A 1S94A 4EOZB 2PG8A 5JR9C 3PURA 4X1IE 1U4QA 2E9XD 2JPFA 3AAEB 3AA1B 5HXCA 2ZLYA 5HXHA 4QXCB 2NW7A 5JDNA 4QXHB 3VHLA 2HH7A 3O4XE 4CI3B 4CZZB 4OHFA 2D5UA 4DO0A 2NWBA 2ODUA 4H9OC 3N2OA 4IIJE 3HKCE 4UV8B 5HXEA 4XBFB 3BK9A 1B7TA 3A5XA 4OFZA 3MKDA 1T98A 2LSIA 4YFSA 4YJ2E 4PNIA 2EHOD 1LVFA 5JDLA 1V9DA 3HA4A 2C5JA 1WRDA 3JC6D 3NBXX 2E8IA 1HG5A 3J9X1 4DNDA 4KMCA 4PFPA 3VKHA 5L3GB 4U74A 2BVMA 3VKGA 4TX5A 1D0YA 4H9PC 3RYCE 1FEWA 1CUNA 3IEEA 3PUSA 3U78A 2CWOA 3RKOA 4JLEA 3ZMSB 2L3LA 2YU2A 2GK9A 4N78D 4EAHA 4MALA 4UIGA 5FP3A 4AKLA 1G73A 4JEHB 2BDEA 3DTOA 3I0OA 4J2CA 2LEHA 3KV5A 4ZI7E 4UELA 4HEAA 1H7CA 3H37A 3RRCA 4UVBB 2VB6A 3FBLA 2HPLA 2Q9QB 3ZMVB 2KZ7B 2LT3A 4PAGA 3N9QA 2X9XA 4Z8XA 1HTJF 5F8PA 2DHRA 5JR9A 4EXTA 2NTYA 1BR4A 2V7LA 1FIOA 4UVAB 4TV8E 3UFEA 5LGTB 2V1DB 2LM9A 2H7VC 4PJNA 3KVBA 5ADXL 2LJLA 4ZS2A 3LK2B 4GYSA 5ETWA 2YEVC 4CQIA 5HYAA 3KVAA 3T8OA 3F2EA 3C98B 3CQXC 3MK7C 5FY0A 3RRWA 1BR0A 3C4WA 2LHRA 3ZC0A 2ACXA 5E0OA 4EYUA 2EHOB 1HS7A 2ZM2A 4O4HE 2KWIB 3N9OA 3ZYMA 4AXPA 2CA5A 2X0LB 3OJAA 4EIWA 3ETUA 2D0TA 4YLHA 3I9WA 2UXNB 1LRZA 2X66A 5H6QB 5FXWA 2H7OA 4HFVA 1NWMX 4O2BE 3WAKA 5LJNA 4P0AA 3AA7B 3N9PA 4DBRA 3LBXB 4WNKA 2DI4A 1D1AA 2Q9QC 2XAHB 4DBQA 4O8SA 2NW8A 3LFMA 2Y6XA 2XAQB 4H63V 3AVSA 4PJLA 3RYHE 5JDQA 4AKIA 3Q5WA 2LSKA 4TZ4C 4PFOA 2I59A 3ONXA 5AFUL 3ZJ1A 4AKRB 2RA1A 2E9XC 4YHJA 3N2KE 3O1IA 3ZMTB 3ZLIA 2CCQA 2N9DA 5J2UE 3FXDB 5HAXA 2C0SA 2W63A 4JEUB 2VASA 3C51A 2MTQA 3P7IA 3H3AA 3BQKA 4YJ3E 2X9WA 2UXXB 2V7JA 3PU3A 2EHOC 3FB2A 2XQYA 4G2AA 3ZC1A 4I43B 4CXWA 5LOVE 5LHGB 3HR0A 3KINB 3QK6A 1YKHB 4MBQA 4E7SA 2X68A 4GOUA 4CI1B 5LBMA 3F57A 3CPZA 3RC8A 2KXPB 3N9MA 1HFAA 4UXNB 4UV9B 5LHHB 3DP7A 4XZCA 2X9HA 5L2LA 4GK5E 1HX8A 4NUVA 4ANJA 5JREA 4KBMB 3I9YA 4MHCA 3RPUA 4OK0A 4EB6E 2CXFA 5LBQB 3CX7B 4WBOA 3SRZA 4HKAA 2K48A 2MBGA 4DMVA 3UUXB 3S4UA 5LYJE 3LJCA 1YW0A 5DQVA 2KNDA 5LA6E 2Q9QA 2LHNA 3CKDA 1UCUA 2ZMAA 3D0TA 3WAJA 5IYZE 4A56A 3ZYLA 3PUQA 2XAGB 3ESLA 3MXZA 4HGAA 4P09A 3LK42 3UUNA 4ZI3D 2DWKA 4E7ZA 2YK0A 2KLQA 1X79A 2LOPA 4TUYE 5M4YA 2MYSA 3ZN1B 1MNDA 1HF8A 4U72A 4ZOLE 4B6XA 5KDMC 2WSSV 3K3NA 2CXDA 3BQIA 3SOLA 2IW5B 4ISSA 3PUAA 2NP9A 3GWHA 4L0RA 2WM9A 2G0UA 2V26A 3KDSE 4O4LE 1D1BA 2Y8DA 2WBLA 2EHOA 1BR1A 4AQFC 1YD8G 3ETVA 4QKNA 5CB4E 4AKHA 2OA5A 3ANWB 1FMVA 2LE8A 4UVCB 2VWAA 3E08A 2A72A 2NOXA 1EZ3A 2E9XB 4GYRA 1MMDA 3PU8A 5DQWA 3EDUA 5KX5E 5GONE 4IE5A 3AAAB 2ODVA 1D0ZA 2A3DA 2YINA 4X1YE 2PJQA 2JRKA 4C90A 3LBXA 4QHOA 3GA8A 3HI2A 5L3EB 3PDYA 4PK5A 1O3XA 2B1EA 4M1PA 1OWAA 4ZI2C 3MZKB 1MIVA 2CM0A 3EDVA 1IJ6A 3CQGB 4H9RC 3IHRA 5LGNB 3LG7A 1KNZA 3GMIA 4HE8A 5EK4A 1ZKEA 2WMNA 3AVRA 3CQCB 2X67A 2JJ9A 5J2TE 4TN7B 3RYFE 4JUYA 2X9YA 2K9AA 5JDHA 4GIWA 3O1JA 5FNVE 5EK2A 5JH7E 4FJOA 5LJMA 2JMKA 4IGUA 2KMFA 1U5PA 3IF8B 5DJQC 2ZM0A 3RX6A 3P8CD 4MLKA 3UT5E 1SA0E 4H9NC 4UEMA 3ZYKA 4I55E 4F6RC 1LKXA 1US7B 4EZ4A 1MMNA 3FXEB 2XAJB 1S35A 5IHYA 2D2SA 5BMVE 4IDZA 3GN5A 4QWNB 2QA7A 4QXBB 3C4XA 4ASKA 3NZPA 2JQQA 2CXLA 3O1HA 5LCYA 4ERRA 3C50A 4KUMB 4L9IA 5JDFA 3W15B 5DABA 4AQFA 5L3DB 1OXZA 2JMHA 2HPJA 3C4ZA 1MIWA 3RYIE 5L3FB 2V7IA 3KBTA 2L9QA 3Q5XA 2VK9A 2J1DG 2PFVA 4G63A 1QSDA 3MACA 5CA1E 3IBPA 2LSGA 3KBUA 5FXZA 4IHJE 2V7MA 3JC6C 2L8KA 2CWYA 3GN5B 3F31A 3I0QA 3CWZB 2NW9A 3ZJ2A 3FHNA 3ZCJA 1NAFA 1D0XA 3MA9A 4CXYA 3AAIA 4ILUA 3PUGA 3K8PC 2IC6A 1VRBA 2N2NA 2V7KA 4I4TE 4QX8B 5F3JA 2Z6EA 3B13A 5HXRA 3PTRB 2Q9QD 5HXSA 3J7Yq 1MMGA 1QUUA 3HKEE 3OKQA 2K5BB 1FMWA 4OYKA 4BJNA 3NRYA 5JDGA 3NZQA 2LSJA 4ZHQE 2WAUA 2Y48B 3C64A 4I50E 1ZHCA 4L5GA 2IAKA 4O4IE 5A1LA 2VL8A 5L3CB 2CMRA 3V5UA 2ZM8A 5EK3A 2XUEA 1ZV4X 4V1Av 5LXTE 1LVKA 3ZN0B 2CEAA 2LSYA 5JVDE 5KMGP 3UTKA 4QX7B 2NTXA 3BQLA 3ANWA 3K3OA 2VKDA 1SHZC 2E9XA 4X20E 4PW8A 3WI3A 4ZS3A 4FI5A 1WR6A 2CLYB 3LK3B 3Q9DA 3L09A 3NRXA 3E22E 4ISTA 3MJXA 4O2AE 4BAYB 2DLRA 3CX6B 4X1KE 1WYBA 2N1GA 3I1AA 3KV6A 3V5SA 2C5IT 4XAXB 5C8YE 2W62A 2WWUA 3ZMZB 1D1CA 3HL6A 1E1HB 3CVRA 5J1GA 4ADZA 1IZNB 3OBVE 2A2FX 2K24A 3AA6B 4OYJA 2W61A 3R84B 3RC3A 3HKBE 4H9SE 2DCFA 2ES0A 4PK4A 4C91A 4BJMA 3FBZA 2MOZA 3EVYA 3R6NA 3E0ZA 2WMOA 5HWXA 4EYYR 2BZBA 4AI6A 2X51A 3DJBA 3RH3A 5FY1A 1HCIA 3N5LA 3N9NA 5JRCA 5FMNA 1Y64B 3KV9A 3HKDE 1UX4A 5FYMA 1AJ3A 3KFWX 4KP3C 4CXXA 4H9QC 2C5KT 4O4JE 2VKHA 1YKEB 3TKLB 3VU7H 1MIYA 1IAPA 2DWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYK A;  4OYJ A;  4P09 A;  2HPJ A;  4P0B A;  4P0A A;  2CM0 A;  5LJN A;  5LJM A;  2D5U A;  2CCQ A;  2HPL A;  4JUY A; 
#chains in the Genus database with same CATH topology
 1MNE A;  3KV4 A;  2CE7 A;  3AA0 B;  1J5E T;  2RP4 A;  4IE4 A;  4NUU A;  3ZEF B;  2M67 A;  3OYZ A;  5EZY E;  4H63 H;  4HN9 A;  2BVL A;  4DMW A;  3SS1 A;  4AQG A;  4P1N A;  2OV9 A;  1M7K A;  3A8Y C;  3SWH A;  4WW0 A;  3N9L A;  2W00 A;  4TNW A;  1T8B A;  4LMK A;  3Q5E A;  3ZPO A;  4EZH A;  2WWV A;  2UXC T;  3O9X A;  3OYX A;  3UQ7 A;  1ZP0 A;  4CI2 B;  1IJ5 A;  5LNK A;  2YN6 A;  5LG4 A;  4COF A;  4U2Y A;  1Z0P A;  2DNX A;  4LML A;  4DR1 T;  2PG8 A;  3PUR A;  3JAD A;  4X1I E;  5HXC A;  5JDN A;  3O4X E;  2UXD T;  1UUR A;  3X1D A;  2ODU A;  3N2O A;  4IIJ E;  4UV8 B;  1T98 A;  2IDO B;  2EHO D;  3J9X 1;  4NXM T;  5LMN T;  4U74 A;  4IL9 A;  3IEE A;  4IDQ A;  4JLE A;  2YU2 A;  2GK9 A;  4N78 D;  4EAH A;  4JI5 T;  3I0O A;  5ABF B;  4J2C A;  1VCS A;  3RRC A;  4DR5 T;  2VB6 A;  3FBL A;  2Q9Q B;  2KZ7 B;  4JI3 T;  3N9Q A;  1WCR A;  4EXT A;  2NTY A;  1BR4 A;  1FIO A;  4UVA B;  2V1D B;  1QLB A;  5AQR B;  5ADX L;  4ZS2 A;  3UU3 A;  3LK2 B;  4GYS A;  2YEV C;  4CQI A;  3IA3 A;  3MK7 C;  5FY0 A;  1BR0 A;  3C4W A;  1T7S A;  1HR0 T;  3ZC0 A;  5E0O A;  2IML A;  1N32 T;  4EYU A;  1HS7 A;  3TLU A;  3ZYM A;  4AXP A;  2CA5 A;  2X0L B;  3OJA A;  2WB5 A;  3QB5 K;  1LRZ A;  4YT0 A;  5FXW A;  4HFV A;  1Z8U A;  5LJN A;  3N9P A;  2XQ4 A;  1NEN A;  1D1A A;  3AE6 A;  4U33 A;  4X5T A;  3K1S A;  1JNR A;  4X62 T;  3ZJ1 A;  4ZXL A;  2CCQ A;  2VUR A;  3FXD B;  5AQG B;  4JEU B;  3C51 A;  2I6H A;  2UXX B;  3PU3 A;  4CXW A;  5LOV E;  3HR0 A;  4E7S A;  4CI1 B;  3RLF F;  1OED E;  2X9H A;  5L2L A;  4MHC A;  4JYA T;  4EB6 E;  3CX7 B;  2MBG A;  4DMV A;  3UUX B;  1YW0 A;  5DQV A;  2NR4 A;  2LHN A;  3CKD A;  1UCU A;  2ZMA A;  5IYZ E;  2XAG B;  3LK4 2;  4E7Z A;  2LOP A;  2WSS V;  2LRL A;  2CXD A;  4ISS A;  4U31 A;  2V26 A;  4DV1 T;  4LF6 T;  2W66 A;  2WBL A;  4AQF C;  4KX6 A;  3AE5 A;  1HNZ T;  1UUS A;  4QKN A;  2OA5 A;  1FMV A;  2LE8 A;  1EZ3 A;  2E9X B;  1MMD A;  3EDU A;  4JV5 T;  2WZH A;  3AAA B;  2ODV A;  2V5C A;  3AE9 A;  5AQV B;  1ZOY A;  2FBW A;  3PDY A;  4PK5 A;  3MZK B;  3EDV A;  4H9R C;  4EED A;  2B76 A;  4Z91 A;  2X67 A;  5AQL B;  2JJ9 A;  5FNV E;  2WQY A;  4FJO A;  1XDP A;  2JMK A;  2KMF A;  3RX6 A;  2XQ3 A;  1MMN A;  3UU8 A;  3C4X A;  2JQQ A;  2CXL A;  3W15 B;  3VRB A;  2HPJ A;  3C4Z A;  1MIW A;  3PJA A;  5L3F B;  3AE7 A;  4HWC A;  2L9Q A;  3Q5X A;  4G63 A;  2PFV A;  2HN1 A;  2PTF A;  3ZCJ A;  1NAF A;  1XWM A;  1VRB A;  2V7K A;  3ZST A;  2E5L T;  5HXR A;  3PTR B;  2XQ8 A;  5HXS A;  1FMW A;  2CPT A;  4OYK A;  5JDG A;  2XQ5 A;  5L4E A;  3TLW A;  3C64 A;  4O4I E;  3L39 A;  4V1A v;  3ZN0 B;  1W0A A;  4DR7 T;  4KI0 F;  3BQL A;  4U7I A;  3CK6 A;  1SHZ C;  4HWD A;  5L47 A;  3NRX A;  3E22 E;  4IDN A;  4HFH A;  4IST A;  2LKG A;  3CX6 B;  4X1K E;  2N1G A;  3I1A A;  3KV6 A;  5C8Y E;  3HL6 A;  4HFI A;  1IZN B;  4YSX A;  2K24 A;  4BJM A;  3R6N A;  3E0Z A;  2X51 A;  5FMN A;  1Y64 B;  3KV9 A;  1UX4 A;  1AJ3 A;  2J62 A;  3PUX F;  5AQM B;  4U2Z A;  1YKE B;  3TKL B;  1MIY A;  3AEC A;  1IAP A;  2BG9 B;  3AEG A;  3RGL A;  4QH4 A;  4MFR A;  1BR2 A;  4PJJ A;  2H88 A;  5FL0 A;  4GK0 E;  3ZMU B;  2P9B A;  1XNQ T;  2PBI A;  5JR9 B;  2KT9 A;  5CJ5 A;  2XY8 B;  5FXX A;  3UUM A;  2YKS A;  4AKG A;  4ZEY A;  3PE0 A;  3M65 A;  4IE7 A;  3U3I A;  4IE6 A;  5JQG E;  4JI6 T;  1UX5 A;  4AQY T;  5JDM A;  4YHH T;  1ZEE A;  4WBN E;  5H6R B;  2XTL A;  2LOS A;  1XZY A;  2XPK A;  3ZCI A;  4HTE A;  3CX8 B;  1E7P A;  3EHZ A;  4LF8 T;  3QC9 A;  2KIN B;  1S94 A;  5C2T A;  2IHR 1;  1I94 T;  4HWI B;  2ZLY A;  3P4R A;  4YTM A;  5HXE A;  3HKC E;  4PNI A;  3HA4 A;  1X9B A;  4PFP A;  3VKH A;  4DV0 T;  4LMJ A;  1D0Y A;  1FEW A;  3U78 A;  3SFE A;  2E2A A;  3ZMS B;  4MAL A;  4AKL A;  3KV5 A;  4ZI7 E;  1N34 T;  5IUX A;  3H37 A;  3AE1 A;  2HPL A;  3T1H T;  2LT3 A;  4PAG A;  2X9X A;  4Z8X A;  4Q25 A;  5AQQ B;  2V7L A;  4TV8 E;  3UFE A;  2H7V C;  5ABE A;  5AQJ B;  1J5W A;  5AQF B;  3T8O A;  3RRW A;  2V5D A;  4IDO A;  2LHR A;  2ACX A;  2HN2 A;  1VCT A;  1UGO A;  2EHO B;  2XSA A;  3N9O A;  3QOF A;  2UXN B;  1NWM X;  4ZZC A;  4DBR A;  2XQ9 A;  1J1J A;  2DI4 A;  4DBQ A;  5FVL A;  2Y6X A;  2I0M A;  4PJL A;  3RYH E;  5JDQ A;  3ONX A;  2E9X C;  3NWI A;  3ZMT B;  3ZLI A;  5J2U E;  4JI1 T;  3UU4 A;  2W63 A;  2VAS A;  2BS4 A;  1W09 A;  3BQK A;  2X9W A;  3OPC A;  5LHG B;  1M62 A;  3QK6 A;  1YKH B;  2W4X A;  4MBQ A;  4GOU A;  5LBM A;  3F57 A;  3CPZ A;  4UXN B;  2RPA A;  4DID B;  4GK5 E;  5ABF A;  4ANJ A;  3RPU A;  3AE3 A;  4WBO A;  3SRZ A;  4HKA A;  2K48 A;  3AE2 A;  4Z90 A;  2VVN A;  2Q9Q A;  4A56 A;  3ZYL A;  5BR8 T;  3ESL A;  2KLQ A;  2UUA T;  4B6X A;  1HF8 A;  4DV4 T;  5KDM C;  1T72 A;  2NP9 A;  2V6X A;  4L0R A;  2G0U A;  3AED A;  2JIW A;  4KHZ F;  2X0H A;  2Y8D A;  3RF1 A;  3FZL B;  4AKH A;  3ANW B;  3E08 A;  2NOX A;  3PU8 A;  1KNP A;  3PUY F;  4C90 A;  1R8I A;  3GA8 A;  3HI2 A;  5LG3 A;  1O3X A;  1IJ6 A;  1N36 T;  3LG7 A;  4HE8 A;  3CQC B;  3P4W A;  4JUY A;  3RYF E;  5HCJ A;  4TWH A;  5LJM A;  1UK5 A;  3IF8 B;  4MLK A;  3UT5 E;  4I55 E;  4F6R C;  1US7 B;  3FXE B;  1FJG T;  5IHY A;  3PJA J;  4IDZ A;  2BS3 A;  5LCY A;  5DAB A;  5L3D B;  4NXN T;  2VK9 A;  2J1D G;  2V6Y B;  2H89 A;  4LFA T;  3FZF B;  2LSG A;  1OED B;  3SFD A;  4IHJ E;  2V7M A;  2WU2 A;  2WZI A;  1D0X A;  2BG9 C;  4CXY A;  4NIQ A;  3NKZ A;  4EEB A;  4JBW F;  4I4T E;  2N2N A;  4QX8 B;  2Z6E A;  3B13 A;  2Q9Q D;  3NVO A;  3RHW A;  3NRY A;  2XJ7 A;  3NZQ A;  2J47 A;  5IWA T;  4B3M T;  1XMQ T;  2LRK A;  2Y48 B;  4I50 E;  1ZHC A;  2IAK A;  2CMR A;  1ZV4 X;  2CEA A;  3UU5 A;  2LSY A;  4QX7 B;  3B5M A;  2NTX A;  1XMO T;  2E9X A;  4X20 E;  3UU6 A;  3WI3 A;  4X65 T;  4FI5 A;  1WR6 A;  4B3T T;  4JI2 T;  2BKN A;  3LK3 B;  1Y01 A;  5HEJ A;  4BAY B;  2DLR A;  2V8S V;  1WYB A;  2CBI A;  3ZT6 A;  4JI8 T;  2FJA A;  3AEB A;  2C5I T;  1IBM T;  4I0U A;  3TLS A;  4HFC A;  4OYJ A;  3RC3 A;  3HKB E;  4H9S E;  4PK4 A;  2MOZ A;  4EYY R;  2BZB A;  3RH3 A;  1HCI A;  2FJB A;  5JRC A;  3HKD E;  3EAB A;  5L4H A;  3KFW X;  2VKH A;  3FHN A;  4K0K T;  1DU2 A;  5M4Y A;  2UUC T;  2CLY C;  4IE0 A;  5FY7 A;  2XAF B;  3P4S A;  2M6I A;  1VOM A;  5JRC B;  4EV6 A;  4UF0 A;  2D0U A;  2WU5 A;  2XAS B;  4LFC T;  4TV9 E;  5LP6 E;  2BBH A;  4BA9 A;  2WDR A;  4P0B A;  5FKY A;  3RKG A;  2JQK A;  4ZI2 D;  1G8X A;  3UUB A;  4UF0 B;  3EUH A;  3Q2M A;  3QUJ A;  5LGU B;  3RIF A;  5HWY A;  2UUB T;  4LF9 T;  1HG2 A;  1MMA A;  2SPC A;  2KWH A;  2IC9 A;  3K3Q C;  4K0U A;  5FXV A;  3CML A;  3RQU A;  2W0G A;  2E9X D;  3AAE B;  3AA1 B;  4QXH B;  4CZZ B;  4OHF A;  2D5U A;  2NWB A;  3RIA A;  4H9O C;  3FZK B;  4XBF B;  3BK9 A;  1B7T A;  3AEF A;  3MKD A;  4YFS A;  2LSI A;  1LVF A;  3NBX X;  3JAE A;  2K3W A;  1WFD A;  2E8I A;  3QNU A;  4DND A;  4KMC A;  1W9R A;  4TX5 A;  2WCA A;  3RYC E;  3PUS A;  3RKO A;  2FJE A;  2L3L A;  2YOE A;  1IBL T;  4UIG A;  1G73 A;  2A9U A;  2BDE A;  3DTO A;  2LEH A;  2BG9 A;  4UEL A;  4HEA A;  1H7C A;  1WR0 A;  3ZMV B;  1HTJ F;  3P4P A;  4QH1 A;  5F8P A;  5JR9 A;  4JI4 T;  3JCF A;  5LGT B;  2LM9 A;  2ZM6 T;  4GKJ T;  5KXJ A;  4PJN A;  3TLV A;  3KVB A;  4F8H A;  4DV5 T;  2LJL A;  2QVA A;  4LF5 T;  5HYA A;  3KVA A;  5J0Z A;  3C98 B;  3CQX C;  2MAW A;  3L8R A;  3JAF A;  5F5W A;  2ZM2 A;  1XNR T;  3VR9 A;  4EIW A;  3ETU A;  4WZX A;  4YLH A;  3I9W A;  5AQI B;  5H6Q B;  2H7O A;  4O2B E;  1SE7 A;  3LBX B;  4WNK A;  2Q9Q C;  4O8S A;  2NW8 A;  4H63 V;  2YDS A;  4AKI A;  4TZ4 C;  2I59 A;  1W0B A;  3RIU A;  4DUY T;  3N2K E;  5HEU A;  3M3Z B;  2JQH A;  5HAX A;  5AQK B;  2X0Y A;  1KNR A;  3P7I A;  3H3A A;  4YJ3 E;  2V7J A;  4DV3 T;  3FB2 A;  2XQY A;  4G2A A;  3ZC1 A;  4I43 B;  5HCM A;  2VL0 A;  3KIN B;  2X68 A;  1HFA A;  3PUV F;  5LHH B;  4XZC A;  2W67 A;  4KBM B;  3I9Y A;  5LBQ B;  5HEO A;  3S4U A;  5LYJ E;  3LJC A;  2KND A;  3AE4 A;  2XQ6 A;  2XSB A;  3UUN A;  4P09 A;  4ZI3 D;  1GQE A;  1X79 A;  4TUY E;  2MYS A;  2UXB T;  3ZN1 B;  4U72 A;  3FZM B;  3BQI A;  4YSY A;  2LM2 A;  2IW5 B;  3PUA A;  4YXD A;  3GWH A;  2WM9 A;  4O4L E;  4OX9 T;  2EHO A;  1BR1 A;  4IL4 A;  1KFY A;  4B3R T;  3ETV A;  5CB4 E;  3ZT5 A;  3CIR A;  4UVC B;  2VWA A;  2LKH A;  4GYR A;  2CHN A;  2A3D A;  2YIN A;  2PJQ A;  2JRK A;  3Q5D A;  4TWD A;  3PV0 F;  2B1E A;  1OWA A;  2BBJ A;  4ZI2 C;  4JI7 T;  5LGN B;  5ABG A;  3GMI A;  1ZKE A;  3AVR A;  2R6G F;  5J2T E;  1HNW T;  5JDH A;  4GIW A;  3O1J A;  5JH7 E;  4X64 T;  3ZSS A;  5DJQ C;  3P8C D;  1SA0 E;  2J4G A;  4H9N C;  3ZYK A;  3G06 A;  2D2S A;  4QWN B;  2QA7 A;  4QXB B;  4ASK A;  5LB7 B;  3C50 A;  4KUM B;  2JMH A;  2JQ9 A;  3VR8 A;  4DV7 T;  3VRA A;  2VQE T;  5FXZ A;  2WP9 A;  2L8K A;  3F31 A;  3I0Q A;  3CWZ B;  2NW9 A;  3ZJ2 A;  3ONJ A;  3AE8 A;  3UFG A;  3MA9 A;  3AAI A;  3PUG A;  2IC6 A;  2XM1 A;  3J7Y q;  2W2U A;  1MMG A;  1QUU A;  3OKQ A;  5AQS B;  4BJN A;  4UR9 A;  4CN1 A;  2LSJ A;  2CHO A;  4L5G A;  4DV6 T;  5A1L A;  2VL8 A;  5L3C B;  3V5U A;  2ZM8 A;  5EK3 A;  2XUE A;  1LVK A;  5KMG P;  3UTK A;  3ANW A;  2F4V T;  5FVK A;  4ZS3 A;  4IRE A;  4ZZB A;  1CHU A;  3L09 A;  2FJD A;  3MJX A;  1YQ3 A;  5AQU B;  3V5S A;  2UU9 T;  2W62 A;  3UQ4 A;  5J1G A;  3CVR A;  2IIU A;  4DR6 T;  3OBV E;  4ILC A;  2A2F X;  3AA6 B;  4IDP A;  3R84 B;  3PUZ F;  2ES0 A;  4CN6 A;  5HWX A;  4AI6 A;  4DR2 T;  3N9N A;  5FYM A;  4U7Y A;  2BKO A;  4CXX A;  2M6B A;  4H9Q C;  5C3J A;  2MPK A;  2XZE A;  3VU7 H;  4U3C A;  4QH5 A;  1WLX A;  5JTG A;  2KSR A;  2V6Y A;  4DVD A;  2LLY A;  1WYC A;  2QGS A;  2OLT A;  2QYW A;  5TAO A;  1OED A;  3UUL A;  5CA0 E;  5HEG A;  4PK6 A;  4PJM A;  2AXD S;  4HFD A;  3N2G E;  3AB3 B;  3L3P A;  4GKK T;  2CRB A;  3PUW F;  3FZH B;  3B57 A;  5L3B B;  2VKJ A;  2XHE B;  2E5V A;  5AQN B;  4ZI3 C;  5LHI B;  2H3R A;  2VKO A;  2YU1 A;  1KK7 A;  4CN4 A;  4EOZ B;  5JR9 C;  1U4Q A;  2JPF A;  2WDQ A;  5HXH A;  3EI0 A;  4QXC B;  2NW7 A;  4HWF A;  3VHL A;  2HH7 A;  4CI3 B;  4LFB T;  4DO0 A;  1L0V A;  4OFZ A;  3A5X A;  4YJ2 E;  5JDL A;  1V9D A;  3JC6 D;  2C5J A;  1WRD A;  1HG5 A;  2BS2 A;  5L3G B;  2BVM A;  3VKG A;  1YXR A;  3OTO T;  4H9P C;  1XDO A;  1CUN A;  1SUM B;  2CWO A;  5AQP B;  5FP3 A;  3TLT A;  4JEH B;  3RQW A;  2QRX A;  4ILA A;  4UVB B;  4EGW A;  3EAM A;  2ACZ A;  3RIU C;  2DHR A;  2YDQ A;  4TNV A;  5LMU T;  4LF7 T;  5ETW A;  4HWH A;  3F2E A;  2AE9 A;  4YTP A;  4LF4 T;  3ABV A;  4O4H E;  2KWI B;  2BKP A;  5AQO B;  2D0T A;  3P50 A;  3OVU A;  2X66 A;  1KF6 A;  3WAK A;  4P0A A;  3AA7 B;  2IUB A;  4A98 A;  2XAH B;  4NPP A;  3T1Y T;  4YTN A;  3LFM A;  1YQ4 A;  2XAQ B;  3AVS A;  2WY2 A;  3Q5W A;  2LSK A;  4PFO A;  5AFU L;  4AKR B;  2RA1 A;  5AQH B;  4YHJ A;  3O1I A;  2N9D A;  2C0S A;  1HNX T;  1HX1 B;  2MTQ A;  4HFE A;  3ZKR A;  2EHO C;  3P4Q A;  1N33 T;  2VVS A;  3RC8 A;  2KXP B;  3N9M A;  4UV9 B;  3DP7 A;  1HX8 A;  4NUV A;  5JRE A;  4OK0 A;  2CXF A;  2WS3 A;  3WAJ A;  5LA6 E;  3D0T A;  3PUQ A;  4HGA A;  3MXZ A;  4IT4 A;  2DWK A;  2YK0 A;  2YDR A;  1NEK A;  4DUZ T;  3QB5 A;  1MND A;  4ZOL E;  2WDV A;  4A97 A;  2D9D A;  3K3N A;  3SOL A;  1I6Z A;  4A5X A;  5AQT B;  5HEH A;  4YY3 T;  3KDS E;  1D1B A;  3RI5 A;  5FL1 A;  1YD8 G;  2A72 A;  5DQW A;  5KX5 E;  5GON E;  4IE5 A;  4TWF A;  1D0Z A;  4YSZ A;  4X1Y E;  1JNZ A;  3LBX A;  4QHO A;  3ZT7 A;  5L3E B;  2HHH T;  4M1P A;  1MIV A;  2CM0 A;  2DL1 A;  3CQG B;  3IHR A;  1KNZ A;  5EK4 A;  2WMN A;  4TN7 B;  4AIS A;  2X9Y A;  2K9A A;  2XM2 A;  5EK2 A;  4IGU A;  1U5P A;  2ZM0 A;  2BG9 E;  4UEM A;  1LKX A;  4EZ4 A;  1IBK T;  2XAJ B;  1S35 A;  5BMV E;  2XQ7 A;  3GN5 A;  3AEE A;  5ABH A;  3NZP A;  3O1H A;  4ERR A;  4L9I A;  4DR3 T;  5JDF A;  4AQF A;  1OXZ A;  3RYI E;  2V7I A;  3KBT A;  3H3M A;  4WYV A;  1QSD A;  2FUP A;  5CFB A;  3MAC A;  5CA1 E;  4DV2 T;  3IBP A;  3KBU A;  3AXJ A;  3JC6 C;  2CWY A;  3GN5 B;  4ILU A;  5CGM A;  3K8P C;  5F3J A;  4KHP T;  3HKE E;  2K5B B;  4DR4 T;  3LSV A;  4ZHQ E;  3AXJ B;  2WAU A;  3ONL C;  4ILB A;  4B3S T;  5LXT E;  2VQF T;  5JVD E;  2CBJ A;  3K3O A;  2VKD A;  2XQA A;  4PW8 A;  1OED C;  3A7M A;  3LDQ B;  2CLY B;  3Q9D A;  4O2A E;  4XAX B;  2WWU A;  3ZMZ B;  4HFB A;  1D1C A;  4JI0 T;  1E1H B;  4ADZ A;  1E2A A;  2W61 A;  2DCF A;  4AIU A;  4C91 A;  4X66 T;  3FBZ A;  3EVY A;  2WMO A;  3DJB A;  5FY1 A;  3N5L A;  1KEY A;  4KP3 C;  2C5K T;  4O4J E;  3AEA A;  2DWG A; 
#chains in the Genus database with same CATH homology
 1MNE A;  3KV4 A;  1WLX A;  2CE7 A;  3AA0 B;  4MFR A;  1BR2 A;  2CLY C;  4PJJ A;  4IE0 A;  5FY7 A;  2XAF B;  4DVD A;  1VOM A;  1WYC A;  4GK0 E;  2QGS A;  5JRC B;  3ZMU B;  2P9B A;  2RP4 A;  5TAO A;  4IE4 A;  4NUU A;  3ZEF B;  2PBI A;  5JR9 B;  2KT9 A;  3UUL A;  4UF0 A;  2D0U A;  2M67 A;  3OYZ A;  5FXX A;  5EZY E;  2XAS B;  5CA0 E;  4H63 H;  4HN9 A;  3UUM A;  4TV9 E;  4PK6 A;  5LP6 E;  4AKG A;  4PJM A;  2BVL A;  4BA9 A;  4DMW A;  3SS1 A;  4AQG A;  4P0B A;  3N2G E;  3PE0 A;  3SWH A;  3M65 A;  4IE7 A;  3U3I A;  4IE6 A;  4ZI2 D;  1G8X A;  3AB3 B;  3L3P A;  4WW0 A;  5JQG E;  3N9L A;  2W00 A;  1UX5 A;  3ZPO A;  4UF0 B;  4EZH A;  5JDM A;  1ZEE A;  3EUH A;  4WBN E;  5H6R B;  3O9X A;  3B57 A;  3OYX A;  2XTL A;  5L3B B;  3Q2M A;  3QUJ A;  5LGU B;  5HWY A;  2VKJ A;  2XHE B;  4CI2 B;  1IJ5 A;  2LOS A;  1HG2 A;  3ZCI A;  5LNK A;  1MMA A;  4HTE A;  4ZI3 C;  5LHI B;  5LG4 A;  2SPC A;  3CX8 B;  2KWH A;  2IC9 A;  3K3Q C;  2H3R A;  2VKO A;  4K0U A;  5FXV A;  3QC9 A;  1Z0P A;  3CML A;  2KIN B;  2YU1 A;  2DNX A;  2W0G A;  1KK7 A;  1S94 A;  4EOZ B;  2PG8 A;  5JR9 C;  3PUR A;  4X1I E;  1U4Q A;  2E9X D;  2JPF A;  3AAE B;  3AA1 B;  5HXC A;  2ZLY A;  5HXH A;  4QXC B;  2NW7 A;  5JDN A;  4QXH B;  3VHL A;  2HH7 A;  3O4X E;  4CI3 B;  4CZZ B;  4OHF A;  2D5U A;  4DO0 A;  2NWB A;  2ODU A;  4H9O C;  3N2O A;  4IIJ E;  3HKC E;  4UV8 B;  5HXE A;  4XBF B;  3BK9 A;  1B7T A;  3A5X A;  4OFZ A;  3MKD A;  1T98 A;  2LSI A;  4YFS A;  4YJ2 E;  4PNI A;  2EHO D;  1LVF A;  5JDL A;  1V9D A;  3HA4 A;  2C5J A;  1WRD A;  3JC6 D;  3NBX X;  2E8I A;  1HG5 A;  3J9X 1;  4DND A;  4KMC A;  4PFP A;  3VKH A;  5L3G B;  4U74 A;  2BVM A;  3VKG A;  4TX5 A;  1D0Y A;  4H9P C;  3RYC E;  1FEW A;  1CUN A;  3IEE A;  3PUS A;  3U78 A;  2CWO A;  3RKO A;  4JLE A;  3ZMS B;  2L3L A;  2YU2 A;  2GK9 A;  4N78 D;  4EAH A;  4MAL A;  4UIG A;  5FP3 A;  4AKL A;  1G73 A;  4JEH B;  2BDE A;  3DTO A;  3I0O A;  4J2C A;  2LEH A;  3KV5 A;  4ZI7 E;  4UEL A;  4HEA A;  1H7C A;  3H37 A;  3RRC A;  4UVB B;  2VB6 A;  3FBL A;  2HPL A;  2Q9Q B;  3ZMV B;  2KZ7 B;  2LT3 A;  4PAG A;  3N9Q A;  2X9X A;  4Z8X A;  1HTJ F;  5F8P A;  2DHR A;  5JR9 A;  4EXT A;  2NTY A;  1BR4 A;  2V7L A;  1FIO A;  4UVA B;  4TV8 E;  3UFE A;  5LGT B;  2V1D B;  2LM9 A;  2H7V C;  4PJN A;  3KVB A;  5ADX L;  2LJL A;  4ZS2 A;  3LK2 B;  4GYS A;  5ETW A;  2YEV C;  4CQI A;  5HYA A;  3KVA A;  3T8O A;  3F2E A;  3C98 B;  3CQX C;  3MK7 C;  5FY0 A;  3RRW A;  1BR0 A;  3C4W A;  2LHR A;  3ZC0 A;  2ACX A;  5E0O A;  4EYU A;  2EHO B;  1HS7 A;  2ZM2 A;  4O4H E;  2KWI B;  3N9O A;  3ZYM A;  4AXP A;  2CA5 A;  2X0L B;  3OJA A;  4EIW A;  3ETU A;  2D0T A;  4YLH A;  3I9W A;  2UXN B;  1LRZ A;  2X66 A;  5H6Q B;  5FXW A;  2H7O A;  4HFV A;  1NWM X;  4O2B E;  3WAK A;  5LJN A;  4P0A A;  3AA7 B;  3N9P A;  4DBR A;  3LBX B;  4WNK A;  2DI4 A;  1D1A A;  2Q9Q C;  2XAH B;  4DBQ A;  4O8S A;  2NW8 A;  3LFM A;  2Y6X A;  2XAQ B;  4H63 V;  3AVS A;  4PJL A;  3RYH E;  5JDQ A;  4AKI A;  3Q5W A;  2LSK A;  4TZ4 C;  4PFO A;  2I59 A;  3ONX A;  5AFU L;  3ZJ1 A;  4AKR B;  2RA1 A;  2E9X C;  4YHJ A;  3N2K E;  3O1I A;  3ZMT B;  3ZLI A;  2CCQ A;  2N9D A;  5J2U E;  3FXD B;  5HAX A;  2C0S A;  2W63 A;  4JEU B;  2VAS A;  3C51 A;  2MTQ A;  3P7I A;  3H3A A;  3BQK A;  4YJ3 E;  2X9W A;  2UXX B;  2V7J A;  3PU3 A;  2EHO C;  3FB2 A;  2XQY A;  4G2A A;  3ZC1 A;  4I43 B;  4CXW A;  5LOV E;  5LHG B;  3HR0 A;  3KIN B;  3QK6 A;  1YKH B;  4MBQ A;  4E7S A;  2X68 A;  4GOU A;  4CI1 B;  5LBM A;  3F57 A;  3CPZ A;  3RC8 A;  2KXP B;  3N9M A;  1HFA A;  4UXN B;  4UV9 B;  5LHH B;  3DP7 A;  4XZC A;  2X9H A;  5L2L A;  4GK5 E;  1HX8 A;  4NUV A;  4ANJ A;  5JRE A;  4KBM B;  3I9Y A;  4MHC A;  3RPU A;  4OK0 A;  4EB6 E;  2CXF A;  5LBQ B;  3CX7 B;  4WBO A;  3SRZ A;  4HKA A;  2K48 A;  2MBG A;  4DMV A;  3UUX B;  3S4U A;  5LYJ E;  3LJC A;  1YW0 A;  5DQV A;  2KND A;  5LA6 E;  2Q9Q A;  2LHN A;  3CKD A;  1UCU A;  2ZMA A;  3D0T A;  3WAJ A;  5IYZ E;  4A56 A;  3ZYL A;  3PUQ A;  2XAG B;  3ESL A;  3MXZ A;  4HGA A;  4P09 A;  3LK4 2;  3UUN A;  4ZI3 D;  2DWK A;  4E7Z A;  2YK0 A;  2KLQ A;  1X79 A;  2LOP A;  4TUY E;  5M4Y A;  2MYS A;  3ZN1 B;  1MND A;  1HF8 A;  4U72 A;  4ZOL E;  4B6X A;  5KDM C;  2WSS V;  3K3N A;  2CXD A;  3BQI A;  3SOL A;  2IW5 B;  4ISS A;  3PUA A;  2NP9 A;  3GWH A;  4L0R A;  2WM9 A;  2G0U A;  2V26 A;  3KDS E;  4O4L E;  1D1B A;  2Y8D A;  2WBL A;  2EHO A;  1BR1 A;  4AQF C;  1YD8 G;  3ETV A;  4QKN A;  5CB4 E;  4AKH A;  2OA5 A;  3ANW B;  1FMV A;  2LE8 A;  4UVC B;  2VWA A;  3E08 A;  2A72 A;  2NOX A;  1EZ3 A;  2E9X B;  4GYR A;  1MMD A;  3PU8 A;  5DQW A;  3EDU A;  5KX5 E;  5GON E;  4IE5 A;  3AAA B;  2ODV A;  1D0Z A;  2A3D A;  2YIN A;  4X1Y E;  2PJQ A;  2JRK A;  4C90 A;  3LBX A;  4QHO A;  3GA8 A;  3HI2 A;  5L3E B;  3PDY A;  4PK5 A;  1O3X A;  2B1E A;  4M1P A;  1OWA A;  4ZI2 C;  3MZK B;  1MIV A;  2CM0 A;  3EDV A;  1IJ6 A;  3CQG B;  4H9R C;  3IHR A;  5LGN B;  3LG7 A;  1KNZ A;  3GMI A;  4HE8 A;  5EK4 A;  1ZKE A;  2WMN A;  3AVR A;  3CQC B;  2X67 A;  2JJ9 A;  5J2T E;  4TN7 B;  3RYF E;  4JUY A;  2X9Y A;  2K9A A;  5JDH A;  4GIW A;  3O1J A;  5FNV E;  5EK2 A;  5JH7 E;  4FJO A;  5LJM A;  2JMK A;  4IGU A;  2KMF A;  1U5P A;  3IF8 B;  5DJQ C;  2ZM0 A;  3RX6 A;  3P8C D;  4MLK A;  3UT5 E;  1SA0 E;  4H9N C;  4UEM A;  3ZYK A;  4I55 E;  4F6R C;  1LKX A;  1US7 B;  4EZ4 A;  1MMN A;  3FXE B;  2XAJ B;  1S35 A;  5IHY A;  2D2S A;  5BMV E;  4IDZ A;  3GN5 A;  4QWN B;  2QA7 A;  4QXB B;  3C4X A;  4ASK A;  3NZP A;  2JQQ A;  2CXL A;  3O1H A;  5LCY A;  4ERR A;  3C50 A;  4KUM B;  4L9I A;  5JDF A;  3W15 B;  5DAB A;  4AQF A;  5L3D B;  1OXZ A;  2JMH A;  2HPJ A;  3C4Z A;  1MIW A;  3RYI E;  5L3F B;  2V7I A;  3KBT A;  2L9Q A;  3Q5X A;  2VK9 A;  2J1D G;  2PFV A;  4G63 A;  1QSD A;  3MAC A;  5CA1 E;  3IBP A;  2LSG A;  3KBU A;  5FXZ A;  4IHJ E;  2V7M A;  3JC6 C;  2L8K A;  2CWY A;  3GN5 B;  3F31 A;  3I0Q A;  3CWZ B;  2NW9 A;  3ZJ2 A;  3FHN A;  3ZCJ A;  1NAF A;  1D0X A;  3MA9 A;  4CXY A;  3AAI A;  4ILU A;  3PUG A;  3K8P C;  2IC6 A;  1VRB A;  2N2N A;  2V7K A;  4I4T E;  4QX8 B;  5F3J A;  2Z6E A;  3B13 A;  5HXR A;  3PTR B;  2Q9Q D;  5HXS A;  3J7Y q;  1MMG A;  1QUU A;  3HKE E;  3OKQ A;  2K5B B;  1FMW A;  4OYK A;  4BJN A;  3NRY A;  5JDG A;  3NZQ A;  2LSJ A;  4ZHQ E;  2WAU A;  2Y48 B;  3C64 A;  4I50 E;  1ZHC A;  4L5G A;  2IAK A;  4O4I E;  5A1L A;  2VL8 A;  5L3C B;  2CMR A;  3V5U A;  2ZM8 A;  5EK3 A;  2XUE A;  1ZV4 X;  4V1A v;  5LXT E;  1LVK A;  3ZN0 B;  2CEA A;  2LSY A;  5JVD E;  5KMG P;  3UTK A;  4QX7 B;  2NTX A;  3BQL A;  3ANW A;  3K3O A;  2VKD A;  1SHZ C;  2E9X A;  4X20 E;  4PW8 A;  3WI3 A;  4ZS3 A;  4FI5 A;  1WR6 A;  2CLY B;  3LK3 B;  3Q9D A;  3L09 A;  3NRX A;  3E22 E;  4IST A;  3MJX A;  4O2A E;  4BAY B;  2DLR A;  3CX6 B;  4X1K E;  1WYB A;  2N1G A;  3I1A A;  3KV6 A;  3V5S A;  2C5I T;  4XAX B;  5C8Y E;  2W62 A;  2WWU A;  3ZMZ B;  1D1C A;  3HL6 A;  1E1H B;  3CVR A;  5J1G A;  4ADZ A;  1IZN B;  3OBV E;  2A2F X;  2K24 A;  3AA6 B;  4OYJ A;  2W61 A;  3R84 B;  3RC3 A;  3HKB E;  4H9S E;  2DCF A;  2ES0 A;  4PK4 A;  4C91 A;  4BJM A;  3FBZ A;  2MOZ A;  3EVY A;  3R6N A;  3E0Z A;  2WMO A;  5HWX A;  4EYY R;  2BZB A;  4AI6 A;  2X51 A;  3DJB A;  3RH3 A;  5FY1 A;  1HCI A;  3N5L A;  3N9N A;  5JRC A;  5FMN A;  1Y64 B;  3KV9 A;  3HKD E;  1UX4 A;  5FYM A;  1AJ3 A;  3KFW X;  4KP3 C;  4CXX A;  4H9Q C;  2C5K T;  4O4J E;  2VKH A;  1YKE B;  3TKL B;  3VU7 H;  1MIY A;  1IAP A;  2DWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...