2CM0A

The pub domain functions as a p97 binding module in human peptide n-glycanase.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
GSASPAVAELCQNTPETFLEASKLLLTYADAILRNPNDEAARSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE N-GLYCANASE HOMOLOG
publication title The Pub Domain Functions as a P97 Binding Module in Human Peptide N-Glycanase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cm0A00
2CM0A 4OYKA 4P09A 2CCQA 4JUYA 4P0AA 2HPJA 4P0BA 2HPLA 4OYJA 5LJNA 2D5UA 5LJMA
chains in the Genus database with same CATH superfamily
2NR4A 1X9BA 2IC6A 4HFEA 3HI2A 2LJLA 2WBLA 3EUHA 3IHRA 3P4PA 2K9AA 2YN6A 3ZN0B 2R6GF 1XWMA 3QNUA 3RRCA 3KINB 2Z6EA 4XZCA 3P8CD 4YSYA 3UTKA 5LGUB 4KUMB 3PU8A 4GK0E 3LJCA 3RYFE 2D2SA 5L4HA 4YHHT 3RIUA 2Y6XA 3RIFA 5ABFA 4B3ST 2LE8A 5ADXL 2HH7A 2WDVA 4WW0A 1IJ6A 1HNZT 1ZOYA 4IDQA 3K3QC 1SHZC 3N9LA 3L8RA 2UXBT 4JUYA 2X0HA 5LCYA 2FBWA 4J2CA 1N32T 2XZEA 5JRCB 5KDMC 2YDQA 5CJ5A 2BDEA 3QB5A 4QHOA 2V6YA 2V5DA 4NXMT 5LBMA 1AJ3A 5DABA 4PJNA 5C3JA 2XASB 3E22E 3M3ZB 4ZXLA 5HEOA 3UFGA 3IF8B 3KV6A 3Q5WA 2IHR1 3UUBA 3LG7A 2BBJA 3GN5A 5IUXA 3RQUA 5FXWA 3PDYA 1N34T 3RHWA 4PFPA 2LSIA 4PJJA 2WP9A 4F6RC 4IE4A 2LSJA 2XY8B 2JIWA 4I4TE 4U33A 4GIWA 3UFEA 4X5TA 3AA1B 2L8KA 5LJMA 3RYHE 1NEKA 2V1DB 2XUEA 5LOVE 1FEWA 2V7JA 4G2AA 2HHHT 4U72A 2DNXA 3ANWA 1G73A 4H63H 1XZYA 1MMAA 4YTNA 3CQGB 3QB5K 3AVSA 2KZ7B 2KSRA 3V5UA 3CIRA 3AEEA 5KXJA 3J7Yq 3MXZA 2V5CA 3K1SA 4AKGA 1DU2A 2G0UA 3NRYA 3LDQB 4HKAA 2WM9A 2X0YA 4DNDA 3K8PC 4IE6A 1IZNB 4DV2T 2VQET 2OA5A 1WLXA 3UU5A 4DV3T 2IAKA 3BQLA 3MZKB 2KXPB 3UULA 4O4HE 1ZHCA 2BG9B 3UUXB 2W63A 4X1YE 3RH3A 3PV0F 1WR0A 4U7IA 1HNWT 3GMIA 4KP3C 2UXDT 3J9X1 4ISTA 4U7YA 2VB6A 3MKDA 5FL1A 2J62A 3MK7C 4L0RA 4TWDA 2WY2A 4AIUA 5FXXA 1NENA 4HFVA 5JVDE 3KV4A 4L9IA 3TLUA 3OPCA 3OBVE 4H9PC 2CHOA 2X0LB 3CPZA 2UXCT 3OVUA 4X66T 1E7PA 1OEDC 2CE7A 3AE7A 3CWZB 3O9XA 4IREA 4IIJE 1H7CA 3ZC0A 3PUQA 5LA6E 4GKJT 4EAHA 4WYVA 1NWMX 5HAXA 5J0ZA 4OK0A 4B3TT 2C5KT 3ABVA 3RLFF 2XQAA 2WS3A 3AEDA 2I59A 2Y8DA 2J1DG 1M62A 2L3LA 2H88A 2VVSA 5HEJA 1R8IA 4IDPA 3N9PA 3WI3A 4DV0T 4OX9T 3PURA 3ONJA 5HXHA 2M6BA 1WRDA 4HWFA 3JAEA 2YINA 3B5MA 3JC6C 5L4EA 5IHYA 4YSZA 4PAGA 5HXEA 4PJLA 1J1JA 4O2BE 4G63A 2MBGA 4JLEA 2BKPA 3PJAA 2D0UA 5JRCA 2UUAT 3DP7A 2YU2A 3TLWA 2DI4A 3KBTA 5LJNA 3RYIE 3N9MA 3CQXC 2CXLA 5GONE 3Q5XA 2DWGA 2Q9QB 3U78A 1W9RA 3A5XA 4DUZT 5LG3A 2CWOA 2YOEA 3UU3A 4CXYA 3RQWA 5AQUB 2CRBA 4OYKA 1FJGT 3AE5A 2CCQA 3PUZF 2EHOB 1Y01A 4UVAB 2W0GA 2RP4A 2WWUA 5HXSA 3SFDA 1XNQT 3X1DA 4UVCB 1QLBA 4ASKA 2ZM6T 2XQ5A 4YSXA 4TX5A 3KDSE 1XMOT 2BS2A 1IBLT 1Y64B 5FNVE 1W0AA 2CXDA 1E1HB 2H3RA 4NXNT 2ACZA 2KLQA 2PBIA 4HWIB 2CBJA 2E5VA 5CA1E 2K48A 4O8SA 2XQ7A 3KFWX 1L0VA 1FMVA 2Q9QD 1UCUA 5HEUA 4QXBB 5AQKB 5C8YE 1YD8G 4UR9A 3RKOA 2LSGA 1M7KA 3SRZA 3JAFA 5JQGE 4X65T 3FZMB 3ZT5A 4UIGA 3TLVA 1YW0A 1BR2A 2ODVA 2EHOD 4YLHA 3MA9A 3LBXB 3N2GE 1MNEA 3N2KE 2XPKA 3SFEA 4AQGA 2AXDS 1JNZA 3VRAA 3VKGA 4TN7B 1U4QA 2WSSV 4KHZF 3ETVA 4EEBA 1VCTA 5JDHA 4PK6A 4HWDA 3UT5E 5DJQC 4ZEYA 3I0QA 2WWVA 3PJAJ 3T1YT 1ZP0A 2H7OA 2BZBA 2X66A 2BG9A 4XBFB 4PNIA 1V9DA 5L3CB 3P50A 2MOZA 3ZYKA 1MMNA 2LT3A 4GK5E 2KWIB 1HNXT 1I94T 3WAKA 5JTGA 2XM2A 4CQIA 2YEVC 4DR2T 2OV9A 1HG2A 1YXRA 1YQ3A 4LFBT 3I1AA 4LFCT 4JBWF 2LHNA 4P09A 4CI1B 5H6QB 3AAEB 5BR8T 2JMKA 2UXXB 1HS7A 3UU4A 4B3RT 2VURA 3UQ4A 5CB4E 3SWHA 2VK9A 1XNRT 3EVYA 5L3EB 4U2YA 2VWAA 3IA3A 2X67A 3KV5A 1MIVA 2KINB 5LHHB 4O4JE 2FUPA 5FXVA 4IT4A 2XQ8A 4EGWA 2BKNA 1HX1B 4TNVA 4K0UA 4WBOA 2E5LT 2W4XA 4Q25A 4X1IE 1D0ZA 4E7ZA 3AEAA 2SPCA 5EZYE 2E8IA 1ZV4X 5AQSB 2CA5A 4COFA 5HEHA 2LKGA 3P4SA 4QH1A 3KVAA 2LOPA 4HFHA 4KMCA 5L2LA 1S94A 5BMVE 3I9WA 1KEYA 3C4ZA 5A1LA 1J5WA 2ZLYA 3RX6A 3ZJ2A 3ZSSA 3KBUA 3R6NA 2F4VT 1U5PA 4ADZA 1MIWA 3C4XA 4PJMA 2ES0A 4A97A 3NKZA 5TAOA 3GWHA 4I43B 2CEAA 4LF6T 2N9DA 2J47A 2Q9QA 4ZHQE 4WBNE 3K3NA 2MPKA 2CM0A 1E2AA 4ZI2C 4JV5T 3OTOT 5JDLA 1MNDA 5EK3A 4U74A 3PE0A 2ACXA 3QC9A 1OWAA 4ZI7E 4ZS2A 4C90A 2EHOA 2NW7A 2NWBA 1ZKEA 4CXXA 4LF9T 1T72A 3G06A 2KT9A 3L09A 1WCRA 4AISA 4LFAT 2HN1A 4WZXA 2UU9T 4XAXB 2WQYA 1LVFA 2IIUA 5AQHB 2LRKA 4BA9A 5AQIB 2LEHA 2WDQA 4ILAA 1B7TA 3FZFB 3C98B 4KI0F 5JR9B 3ZSTA 1HFAA 2WZHA 5F3JA 2HN2A 5L3FB 5FY0A 4ZI3C 2W62A 3CX7B 3VR9A 2I0MA 2M6IA 3A8YC 3I9YA 4JEUB 2UUBT 2C5IT 2JQKA 3HL6A 2C5JA 1HR0T 4ZS3A 4N78D 4DV5T 2Y48B 3ZMSB 2DWKA 1OEDE 1VRBA 4JI4T 5HYAA 4QH5A 3AXJB 3B57A 3MJXA 1J5ET 2JRKA 3AEBA 1KFYA 3K3OA 3IBPA 2IW5B 4DV4T 4EZHA 2KNDA 4OYJA 3CMLA 4IE0A 3Q5DA 5LHGB 3AVRA 2RA1A 2FJDA 2QRXA 4H9SE 5FY1A 4B6XA 4NUVA 2XQ9A 4DBQA 4HE8A 2JJ9A 3PUWF 4EEDA 2DCFA 3AB3B 2RPAA 3JADA 4DO0A 4EIWA 4ILUA 2KMFA 1X79A 1GQEA 2CLYC 2ZM0A 2VL0A 5E0OA 5JREA 4AQYT 3ZMUB 3ZMVB 5LYJE 3VHLA 2V7KA 4YJ2E 2NW8A 2JMHA 4IHJE 3C4WA 3P4RA 2QA7A 4X1KE 4UEMA 2E9XB 3O1HA 2BG9C 1BR1A 2UXNB 2NTXA 5J1GA 2QGSA 3ZN1B 4UXNB 3ZC1A 5CGMA 5AQGB 5LMUT 3PUYF 1LKXA 2XM1A 4QXCB 4O2AE 2LLYA 2JQ9A 5IWAT 3LFMA 3E08A 2XAQB 5ABFB 3AEGA 2VKHA 3DJBA 1G8XA 4CI3B 3FXEB 1HTJF 4C91A 2X68A 5L47A 4DUYT 4YHJA 2CMRA 3FHNA 3SOLA 3HKBE 3MACA 4IDZA 5L3DB 3O1IA 2A3DA 3CVRA 3RIUC 5HCJA 4DIDB 4X20E 4JI2T 1MMDA 2V7LA 4PW8A 2E9XD 5FL0A 4IGUA 4I55E 4CN1A 3RPUA 3PU3A 2P9BA 3L39A 3CK6A 3Q5EA 2X9WA 3FBLA 3N9OA 4E7SA 3D0TA 2YU1A 4UELA 4JI5T 4HN9A 1QSDA 5DQVA 3F57A 3HKEE 4EOZB 4B3MT 3GN5B 3AAIA 5AQOB 3NWIA 3OKQA 3RGLA 5AQLB 4HEAA 2WCAA 5LHIB 4QH4A 5KX5E 3ONLC 4MLKA 1IAPA 2GK9A 1T98A 2XQ6A 4AKRB 4AKHA 4P0BA 4LF5T 1IBMT 3EABA 2BS3A 3B13A 3CX8B 3AE2A 4OHFA 3RI5A 2BVMA 3AEFA 1UUSA 3ZEFB 4K0KT 3AA6B 2Q9QC 4OFZA 5AQJB 5JR9A 2BKOA 2BBHA 1CUNA 4ILBA 2XQYA 2X9YA 2FJAA 3P4QA 4X64T 3RC8A 3UU6A 4EB6E 4HFBA 5ABHA 2VVNA 1W0BA 1HG5A 4BAYB 4ZZCA 3S4UA 3EI0A 4EV6A 4HWCA 3RRWA 3AAAB 2EHOC 3RIAA 1UX4A 2JPFA 3C50A 2A72A 1XDOA 3WAJA 4JI6T 5J2TE 3AE4A 5ABGA 3F31A 1BR0A 5HXRA 4Z8XA 4AXPA 4TV8E 1D1CA 1T7SA 5CFBA 3FZLB 3AXJA 3PUGA 2XAFB 3N9NA 4KHPT 3ZT6A 4HFCA 4TV9E 4L5GA 3PTRB 4IL4A 2W61A 3BQIA 2UUCT 5HXCA 4UVBB 4X62T 2MYSA 4HGAA 5LP6E 2LSKA 2ZM8A 4KBMB 2KWHA 2K24A 4DR7T 1Z0PA 3ZMZB 4DV7T 2VQFT 3H3AA 3EDUA 4LF7T 2I6HA 1S35A 5HWYA 4GOUA 5AQRB 3AECA 3ZJ1A 4GYSA 5FY7A 1I6ZA 3C51A 5AQMB 3TLTA 1OXZA 3A7MA 4AQFA 3ZLIA 4DBRA 2X9XA 3P7IA 4H9NC 1N36T 3P4WA 3BK9A 2LRLA 5AQFB 5EK4A 2DL1A 2DHRA 2YKSA 2LHRA 2E9XA 2XSBA 1YQ4A 2XQ4A 2J4GA 4NUUA 4ZZBA 3W15B 5AQPB 2C0SA 3H37A 3BQKA 4CI2B 4DR1T 4YTMA 2WMNA 3VKHA 4YTPA 3QOFA 4IDOA 3QUJA 3NVOA 4DR6T 2L9QA 5LMNT 2V7MA 5F5WA 5IYZE 3U3IA 2XAJB 3RF1A 3DTOA 2QYWA 3PUSA 2PJQA 3VU7H 4MALA 2WU2A 3ZYMA 4H63V 2W67A 4HWHA 5ETWA 4ERRA 3RC3A 4ISSA 4UF0B 5LG4A 3KVBA 4H9OC 3T8OA 4JYAT 4DMVA 4MHCA 5F8PA 4MBQA 3UU8A 2A9UA 4AKIA 3LK42 4GYRA 4YT0A 5JDNA 1KF6A 2LKHA 4H9QC 2WB5A 1MMGA 2B76A 2V7IA 5C2TA 5EK2A 1LVKA 3PUVF 3Q2MA 5JDFA 4TZ4C 4LF4T 2WDRA 2IMLA 2W00A 5AFUL 2YDSA 3OYZA 5LGNB 4JI8T 2B1EA 2PTFA 4LMKA 4ZI2D 4YJ3E 5KMGP 1JNRA 2E2AA 3C64A 5LBQB 3OJAA 3ZKRA 1D0XA 4EXTA 3R84B 2D9DA 2WMOA 3TLSA 2V26A 3T1HT 4QWNB 4V1Av 2VKJA 3LK3B 3FBZA 2OLTA 3L3PA 4JI3T 1FIOA 1HCIA 3ZCJA 4IE5A 3ZT7A 2JQQA 4IE7A 4M1PA 5FKYA 1XDPA 3M65A 3CQCB 1D0YA 5L3BB 2K5BB 3UUMA 2WZIA 2NOXA 3V5SA 1SE7A 1WYCA 3CX6B 4ZI3D 2ZMAA 3UQ7A 4DR5T 3ZCIA 2PFVA 5J2UE 2DLRA 4JI7T 3LBXA 3EHZA 5FXZA 4I0UA 4QKNA 4ANJA 3NBXX 1O3XA 1WFDA 1OEDB 4GKKT 2CLYB 2W2UA 4JI1T 5AQNB 2CHNA 5HWXA 4CXWA 4P1NA 4IDNA 5JR9C 2FJBA 3AE9A 2BG9E 3NRXA 3IEEA 3RKGA 3NZPA 5AQTB 2MAWA 4HFDA 3N2OA 2YK0A 4ILCA 2NP9A 2K3WA 2XHEB 4NIQA 4U2ZA 3EAMA 3AE1A 2PG8A 4HTEA 3O4XE 2VASA 3OYXA 2W66A 2XSAA 4DMWA 2X51A 3SS1A 3O1JA 5JH7E 5L3GB 4PK4A 5LB7B 2YDRA 3I0OA 5M4YA 4MFRA 5HEGA 5DQWA 3VR8A 1T8BA 1IJ5A 3AE6A 1KK7A 2CBIA 2WAUA 4U31A 3ETUA 4DR4T 4F8HA 2IUBA 4U3CA 1SA0E 3ZMTB 3Q9DA 4WNKA 2XQ3A 2N2NA 3E0ZA 3UUNA 1LRZA 3ONXA 4DVDA 2D5UA 3RYCE 3HR0A 4P0AA 2FJEA 1WYBA 2BS4A 4PK5A 5AQQB 1KNPA 4YY3T 4A98A 4LMJA 4AQFC 4UV9B 3FZHB 3KV9A 1FMWA 4YXDA 1KNZA 4CZZB 5FVLA 1UX5A 3JC6D 2ODUA 4TNWA 3PUAA 2QVAA 3JCFA 3N9QA 4FI5A 4H9RC 2E9XC 1W09A 2V6YB 5JDQA 5LGTB 1IBKT 4UF0A 4EZ4A 4TWHA 2HPLA 2N1GA 4TUYE 4CN6A 1SUMB 4NPPA 1VCSA 4O4LE 4QXHB 1NAFA 2IC9A 4IL9A 5JDGA 4QX7B 2X9HA 3EDVA 2CPTA 2LSYA 4CN4A 3QK6A 3H3MA 1WR6A 5ABEA 3FXDB 3VRBA 4YFSA 4A5XA 1D1AA 2H89A 2H7VC 4DR3T 5FMNA 4DV6T 4LMLA 4JEHB 2A2FX 3FZKB 4ZOLE 4JI0T 3ANWB 4TWFA 2V8SV 1KNRA 2XAGB 2ZM2A 2LM9A 3PUXF 3AE3A 2LM2A 5FYMA 2JQHA 1VOMA 1US7B 3CKDA 2NW9A 4FJOA 4O4IE 4UV8B 4EYUA 1D1BA 2XAHB 3AA7B 1UK5A 2CXFA 3LK2B 5AQVB 3F2EA 2VKDA 5FP3A 4HFIA 1QUUA 5JDMA 1BR4A 2NTYA 1CHUA 4I50E 2HPJA 2CWYA 3ZPOA 2VKOA 1Z8UA 3GA8A 1ZEEA 2AE9A 3AE8A 2M67A 3NZQA 4QX8B 2MTQA 1OEDA 4AI6A 2V6XA 5CA0E 5LXTE 4Z91A 5H6RB 5FVKA 5HCMA 2LOSA 3ESLA 1XMQT 4BJNA 4Z90A 1MIYA 3N5LA 2WU5A 4A56A 3HKDE 3AA0B 4AKLA 1EZ3A 4BJMA 4PFOA 1HX8A 3HKCE 1N33T 1YKHB 1UGOA 2XJ7A 4EYYR 2D0TA 2VL8A 2IDOB 4KX6A 4LF8T 1HF8A 2XTLA 4DV1T 3LSVA 3FB2A 3HA4A 1UURA 3TKLB 2BVLA 5LNKA 1YKEB 3ZYLA
chains in the Genus database with same CATH topology
5JREA 3ZMUB 2IC6A 4ASKA 3OJAA 3HI2A 2LJLA 2WBLA 3ZMVB 5LYJE 3EUHA 1D0XA 4TX5A 3IHRA 3VHLA 2V7KA 4EXTA 2K9AA 3R84B 3KDSE 4YJ2E 2NW8A 2JMHA 4IHJE 1Y64B 2WMOA 3ZN0B 3C4WA 2QA7A 5FNVE 4X1KE 2CXDA 2V26A 1E1HB 3RRCA 3KINB 2H3RA 2Z6EA 3P8CD 4QWNB 2KLQA 2E9XB 4UEMA 2PBIA 4XZCA 3UTKA 5LGUB 3O1HA 1BR1A 4KUMB 4V1Av 3PU8A 2VKJA 3LK3B 4GK0E 2UXNB 3LJCA 3RYFE 2D2SA 3FBZA 2NTXA 3L3PA 1FIOA 5J1GA 2QGSA 1HCIA 3ZCJA 3ZN1B 5CA1E 2K48A 4O8SA 4IE5A 3KFWX 1FMVA 4UXNB 3ZC1A 2Q9QD 2JQQA 4IE7A 2Y6XA 1UCUA 4M1PA 1LKXA 4QXCB 5LBQB 4O2AE 3M65A 3LFMA 3E08A 3CQCB 2XAQB 4QXBB 5C8YE 1D0YA 1YD8G 2VKHA 3DJBA 5L3BB 1G8XA 2LE8A 3RKOA 2K5BB 4CI3B 5ADXL 2HH7A 3FXEB 1HTJF 2LSGA 3UUMA 3SRZA 2NOXA 4WW0A 3V5SA 4C91A 2X68A 5JQGE 4YHJA 1WYCA 3CX6B 4ZI3D 2ZMAA 3ZCIA 2PFVA 5J2UE 4UIGA 2DLRA 1YW0A 1BR2A 1IJ6A 2CMRA 2ODVA 3FHNA 3LBXA 2EHOD 4YLHA 3MA9A 3K3QC 3LBXB 3N2GE 1MNEA 5FXZA 3N2KE 1SHZC 4QKNA 4ANJA 3NBXX 3N9LA 1O3XA 4AQGA 4JUYA 3SOLA 3HKBE 3MACA 3VKGA 5LCYA 4IDZA 5L3DB 3O1IA 1U4QA 2WSSV 4TN7B 3ETVA 2CLYB 5JDHA 4PK6A 2A3DA 4J2CA 3UT5E 5JRCB 5DJQC 5KDMC 5HWXA 4CXWA 3CVRA 3I0QA 2BDEA 5JR9C 4X20E 1MMDA 4QHOA 2V7LA 4PW8A 2E9XD 4IGUA 5LBMA 1AJ3A 4I55E 3NRXA 3RPUA 3PU3A 2P9BA 2H7OA 5DABA 2BZBA 2X66A 2X9WA 3FBLA 4PJNA 3N9OA 3IEEA 2XASB 3E22E 4E7SA 3D0TA 2YU1A 4XBFB 3NZPA 4PNIA 4UELA 1V9DA 5L3CB 3IF8B 3KV6A 3N2OA 3Q5WA 4HN9A 2YK0A 1QSDA 5DQVA 2NP9A 2MOZA 3F57A 3HKEE 3LG7A 3ZYKA 1MMNA 4EOZB 2XHEB 2LT3A 3GN5A 4GK5E 3GN5B 5FXWA 2KWIB 3PDYA 3AAIA 4PFPA 2PG8A 3OKQA 3WAKA 2LSIA 4HTEA 3O4XE 4PJJA 4CQIA 2VASA 2YEVC 4HEAA 1HG2A 4F6RC 3OYXA 4IE4A 5LHIB 5KX5E 2LSJA 3I1AA 4I4TE 2LHNA 4DMWA 4P09A 4MLKA 1IAPA 2X51A 3SS1A 3O1JA 5JH7E 2GK9A 4CI1B 1T98A 5H6QB 4AKRB 5L3GB 4AKHA 4GIWA 3UFEA 4P0BA 4PK4A 3AAEB 3AA1B 2L8KA 5LJMA 2JMKA 2UXXB 3B13A 3CX8B 3I0OA 3RYHE 4MFRA 5M4YA 1HS7A 4OHFA 5DQWA 2V1DB 1IJ5A 2XUEA 2BVMA 5LOVE 5CB4E 3SWHA 1FEWA 2V7JA 4G2AA 1KK7A 2VK9A 3EVYA 2WAUA 4U72A 5L3EB 3ZEFB 3ETUA 2DNXA 3ANWA 3AA6B 1G73A 2Q9QC 4H63H 4OFZA 1MMAA 2VWAA 5JR9A 2X67A 3KV5A 1MIVA 1SA0E 3CQGB 3ZMTB 1CUNA 3AVSA 2KINB 3Q9DA 4WNKA 5LHHB 2KZ7B 2N2NA 2XQYA 3E0ZA 3UUNA 1LRZA 3V5UA 2X9YA 4O4JE 3ONXA 3J7Yq 3MXZA 5FXVA 4DVDA 2D5UA 3RC8A 3RYCE 4EB6E 3HR0A 4P0AA 1WYBA 5E0OA 1HG5A 4K0UA 4BAYB 4WBOA 4AKGA 4PK5A 3S4UA 4X1IE 2G0UA 3NRYA 1D0ZA 3RRWA 3AAAB 2EHOC 1UX4A 2JPFA 3C50A 4E7ZA 2SPCA 2A72A 5EZYE 2E8IA 1ZV4X 4AQFC 3WAJA 4UV9B 4HKAA 5J2TE 2CA5A 2WM9A 3KV9A 1FMWA 3F31A 1BR0A 1KNZA 5HXRA 4CZZB 4Z8XA 3KVAA 2LOPA 4AXPA 4DNDA 4KMCA 4TV8E 1D1CA 1UX5A 5L2LA 1S94A 3JC6D 2ODUA 3K8PC 5BMVE 3I9WA 3PUAA 3C4ZA 5A1LA 3N9QA 4IE6A 1IZNB 2ZLYA 3RX6A 3PUGA 3ZJ2A 3KBUA 3R6NA 4FI5A 4H9RC 2XAFB 3N9NA 1U5PA 2E9XC 2OA5A 1WLXA 4ADZA 2IAKA 5JDQA 5LGTB 1MIWA 3BQLA 3C4XA 4PJMA 3MZKB 2ES0A 2KXPB 4UF0A 4TV9E 4L5GA 3PTRB 3UULA 4EZ4A 2W61A 3BQIA 4O4HE 2HPLA 1ZHCA 2N1GA 2W63A 4TUYE 4X1YE 5TAOA 3RH3A 3UUXB 5HXCA 4UVBB 3GWHA 4I43B 2CEAA 3GMIA 4KP3C 2N9DA 3J9X1 2Q9QA 4ISTA 2MYSA 2VB6A 3MKDA 4HGAA 5LP6E 4ZHQE 2LSKA 2ZM8A 4KBMB 4O4LE 4WBNE 3MK7C 3K3NA 2CM0A 2KWHA 2K24A 4QXHB 4L0RA 1Z0PA 3ZMZB 1NAFA 2IC9A 4ZI2C 5JDGA 5FXXA 4QX7B 4HFVA 5JVDE 5JDLA 2X9HA 3H3AA 1MNDA 3EDUA 3KV4A 1S35A 3EDVA 5EK3A 4U74A 3PE0A 4L9IA 5HWYA 4GOUA 2LSYA 2ACXA 3QK6A 3QC9A 3OBVE 4H9PC 1WR6A 1OWAA 4ZI7E 3ZJ1A 4GYSA 5FY7A 4ZS2A 2X0LB 2EHOA 2NW7A 3FXDB 3C51A 4C90A 3CPZA 4YFSA 1OXZA 2NWBA 1D1AA 1ZKEA 4CXXA 2H7VC 4AQFA 2CE7A 5FMNA 2KT9A 3L09A 3CWZB 3O9XA 4XAXB 4IIJE 3ZLIA 1H7CA 4JEHB 3ZC0A 4DBRA 2A2FX 2X9XA 3P7IA 1LVFA 3PUQA 4BA9A 4H9NC 5LA6E 2LEHA 4ZOLE 1B7TA 1NWMX 3BK9A 4EAHA 3ANWB 5EK4A 5HAXA 3C98B 2DHRA 2XAGB 2LHRA 2E9XA 5JR9B 4OK0A 2C5KT 1HFAA 2ZM2A 2LM9A 5F3JA 2I59A 2Y8DA 2J1DG 4NUUA 2L3LA 3W15B 5FYMA 5L3FB 2C0SA 3H37A 3BQKA 5FY0A 4CI2B 1VOMA 4ZI3C 2W62A 1US7B 2WMNA 3CKDA 3CX7B 2NW9A 4FJOA 3VKHA 3N9PA 4O4IE 4UV8B 4EYUA 1D1BA 2XAHB 3WI3A 3AA7B 2CXFA 3LK2B 3QUJA 3F2EA 3I9YA 4JEUB 3PURA 5HXHA 2L9QA 2C5IT 2V7MA 5IYZE 2VKDA 3HL6A 2C5JA 3U3IA 1WRDA 2XAJB 5FP3A 1QUUA 2YINA 5JDMA 1BR4A 3JC6C 2NTYA 5IHYA 4I50E 4ZS3A 4N78D 2HPJA 4PAGA 5HXEA 2CWYA 4PJLA 2Y48B 3DTOA 3ZMSB 2VKOA 3ZPOA 2DWKA 3PUSA 1VRBA 3GA8A 2PJQA 3VU7H 1ZEEA 5HYAA 4MALA 4O2BE 4G63A 2M67A 3B57A 3NZQA 3ZYMA 4QX8B 4H63V 2MBGA 5ETWA 2MTQA 4JLEA 3MJXA 4AI6A 5CA0E 2JRKA 4ERRA 2D0UA 3RC3A 5LXTE 5H6RB 5JRCA 3K3OA 4ISSA 4UF0B 3IBPA 2IW5B 3DP7A 2LOSA 5LG4A 2YU2A 3KVBA 3ESLA 4H9OC 4EZHA 2DI4A 4BJNA 3KBTA 2KNDA 4OYJA 3T8OA 5LJNA 3RYIE 3N9MA 4DMVA 1MIYA 3CMLA 3CQXC 3N5LA 2CXLA 4MHCA 5F8PA 5GONE 4IE0A 4A56A 3Q5XA 4MBQA 2DWGA 2Q9QB 3HKDE 3U78A 3AA0B 3A5XA 4AKIA 4AKLA 5LHGB 3AVRA 1EZ3A 2CWOA 3LK42 2RA1A 4BJMA 4GYRA 4PFOA 1HX8A 5JDNA 4CXYA 5FY1A 4H9SE 3HKCE 4B6XA 4NUVA 4H9QC 1MMGA 1YKHB 4HE8A 4DBQA 2JJ9A 4EYYR 2D0TA 2DCFA 2V7IA 3AB3B 4OYKA 2VL8A 1LVKA 5EK2A 2CCQA 3Q2MA 5JDFA 1HF8A 4TZ4C 2XTLA 2W00A 5AFUL 4DO0A 3OYZA 4EIWA 5LGNB 2EHOB 2B1EA 4UVAB 3FB2A 2W0GA 4ILUA 2RP4A 4ZI2D 2WWUA 2KMFA 3HA4A 4YJ3E 1X79A 2CLYC 2ZM0A 3TKLB 5HXSA 5KMGP 2BVLA 5LNKA 1YKEB 3ZYLA 3C64A 4UVCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CM0 A;  4OYK A;  4P09 A;  2CCQ A;  4JUY A;  4P0A A;  2HPJ A;  4P0B A;  2HPL A;  4OYJ A;  5LJN A;  2D5U A;  5LJM A; 
#chains in the Genus database with same CATH topology
 2NR4 A;  1X9B A;  2IC6 A;  4HFE A;  3HI2 A;  2LJL A;  2WBL A;  3EUH A;  3IHR A;  3P4P A;  2K9A A;  2YN6 A;  3ZN0 B;  2R6G F;  1XWM A;  3QNU A;  3RRC A;  3KIN B;  2Z6E A;  4XZC A;  3P8C D;  4YSY A;  3UTK A;  5LGU B;  4KUM B;  3PU8 A;  4GK0 E;  3LJC A;  3RYF E;  2D2S A;  5L4H A;  4YHH T;  3RIU A;  2Y6X A;  3RIF A;  5ABF A;  4B3S T;  2LE8 A;  5ADX L;  2HH7 A;  2WDV A;  4WW0 A;  1IJ6 A;  1HNZ T;  1ZOY A;  4IDQ A;  3K3Q C;  1SHZ C;  3N9L A;  3L8R A;  2UXB T;  4JUY A;  2X0H A;  5LCY A;  2FBW A;  4J2C A;  1N32 T;  2XZE A;  5JRC B;  5KDM C;  2YDQ A;  5CJ5 A;  2BDE A;  3QB5 A;  4QHO A;  2V6Y A;  2V5D A;  4NXM T;  5LBM A;  1AJ3 A;  5DAB A;  4PJN A;  5C3J A;  2XAS B;  3E22 E;  3M3Z B;  4ZXL A;  5HEO A;  3UFG A;  3IF8 B;  3KV6 A;  3Q5W A;  2IHR 1;  3UUB A;  3LG7 A;  2BBJ A;  3GN5 A;  5IUX A;  3RQU A;  5FXW A;  3PDY A;  1N34 T;  3RHW A;  4PFP A;  2LSI A;  4PJJ A;  2WP9 A;  4F6R C;  4IE4 A;  2LSJ A;  2XY8 B;  2JIW A;  4I4T E;  4U33 A;  4GIW A;  3UFE A;  4X5T A;  3AA1 B;  2L8K A;  5LJM A;  3RYH E;  1NEK A;  2V1D B;  2XUE A;  5LOV E;  1FEW A;  2V7J A;  4G2A A;  2HHH T;  4U72 A;  2DNX A;  3ANW A;  1G73 A;  4H63 H;  1XZY A;  1MMA A;  4YTN A;  3CQG B;  3QB5 K;  3AVS A;  2KZ7 B;  2KSR A;  3V5U A;  3CIR A;  3AEE A;  5KXJ A;  3J7Y q;  3MXZ A;  2V5C A;  3K1S A;  4AKG A;  1DU2 A;  2G0U A;  3NRY A;  3LDQ B;  4HKA A;  2WM9 A;  2X0Y A;  4DND A;  3K8P C;  4IE6 A;  1IZN B;  4DV2 T;  2VQE T;  2OA5 A;  1WLX A;  3UU5 A;  4DV3 T;  2IAK A;  3BQL A;  3MZK B;  2KXP B;  3UUL A;  4O4H E;  1ZHC A;  2BG9 B;  3UUX B;  2W63 A;  4X1Y E;  3RH3 A;  3PV0 F;  1WR0 A;  4U7I A;  1HNW T;  3GMI A;  4KP3 C;  2UXD T;  3J9X 1;  4IST A;  4U7Y A;  2VB6 A;  3MKD A;  5FL1 A;  2J62 A;  3MK7 C;  4L0R A;  4TWD A;  2WY2 A;  4AIU A;  5FXX A;  1NEN A;  4HFV A;  5JVD E;  3KV4 A;  4L9I A;  3TLU A;  3OPC A;  3OBV E;  4H9P C;  2CHO A;  2X0L B;  3CPZ A;  2UXC T;  3OVU A;  4X66 T;  1E7P A;  1OED C;  2CE7 A;  3AE7 A;  3CWZ B;  3O9X A;  4IRE A;  4IIJ E;  1H7C A;  3ZC0 A;  3PUQ A;  5LA6 E;  4GKJ T;  4EAH A;  4WYV A;  1NWM X;  5HAX A;  5J0Z A;  4OK0 A;  4B3T T;  2C5K T;  3ABV A;  3RLF F;  2XQA A;  2WS3 A;  3AED A;  2I59 A;  2Y8D A;  2J1D G;  1M62 A;  2L3L A;  2H88 A;  2VVS A;  5HEJ A;  1R8I A;  4IDP A;  3N9P A;  3WI3 A;  4DV0 T;  4OX9 T;  3PUR A;  3ONJ A;  5HXH A;  2M6B A;  1WRD A;  4HWF A;  3JAE A;  2YIN A;  3B5M A;  3JC6 C;  5L4E A;  5IHY A;  4YSZ A;  4PAG A;  5HXE A;  4PJL A;  1J1J A;  4O2B E;  4G63 A;  2MBG A;  4JLE A;  2BKP A;  3PJA A;  2D0U A;  5JRC A;  2UUA T;  3DP7 A;  2YU2 A;  3TLW A;  2DI4 A;  3KBT A;  5LJN A;  3RYI E;  3N9M A;  3CQX C;  2CXL A;  5GON E;  3Q5X A;  2DWG A;  2Q9Q B;  3U78 A;  1W9R A;  3A5X A;  4DUZ T;  5LG3 A;  2CWO A;  2YOE A;  3UU3 A;  4CXY A;  3RQW A;  5AQU B;  2CRB A;  4OYK A;  1FJG T;  3AE5 A;  2CCQ A;  3PUZ F;  2EHO B;  1Y01 A;  4UVA B;  2W0G A;  2RP4 A;  2WWU A;  5HXS A;  3SFD A;  1XNQ T;  3X1D A;  4UVC B;  1QLB A;  4ASK A;  2ZM6 T;  2XQ5 A;  4YSX A;  4TX5 A;  3KDS E;  1XMO T;  2BS2 A;  1IBL T;  1Y64 B;  5FNV E;  1W0A A;  2CXD A;  1E1H B;  2H3R A;  4NXN T;  2ACZ A;  2KLQ A;  2PBI A;  4HWI B;  2CBJ A;  2E5V A;  5CA1 E;  2K48 A;  4O8S A;  2XQ7 A;  3KFW X;  1L0V A;  1FMV A;  2Q9Q D;  1UCU A;  5HEU A;  4QXB B;  5AQK B;  5C8Y E;  1YD8 G;  4UR9 A;  3RKO A;  2LSG A;  1M7K A;  3SRZ A;  3JAF A;  5JQG E;  4X65 T;  3FZM B;  3ZT5 A;  4UIG A;  3TLV A;  1YW0 A;  1BR2 A;  2ODV A;  2EHO D;  4YLH A;  3MA9 A;  3LBX B;  3N2G E;  1MNE A;  3N2K E;  2XPK A;  3SFE A;  4AQG A;  2AXD S;  1JNZ A;  3VRA A;  3VKG A;  4TN7 B;  1U4Q A;  2WSS V;  4KHZ F;  3ETV A;  4EEB A;  1VCT A;  5JDH A;  4PK6 A;  4HWD A;  3UT5 E;  5DJQ C;  4ZEY A;  3I0Q A;  2WWV A;  3PJA J;  3T1Y T;  1ZP0 A;  2H7O A;  2BZB A;  2X66 A;  2BG9 A;  4XBF B;  4PNI A;  1V9D A;  5L3C B;  3P50 A;  2MOZ A;  3ZYK A;  1MMN A;  2LT3 A;  4GK5 E;  2KWI B;  1HNX T;  1I94 T;  3WAK A;  5JTG A;  2XM2 A;  4CQI A;  2YEV C;  4DR2 T;  2OV9 A;  1HG2 A;  1YXR A;  1YQ3 A;  4LFB T;  3I1A A;  4LFC T;  4JBW F;  2LHN A;  4P09 A;  4CI1 B;  5H6Q B;  3AAE B;  5BR8 T;  2JMK A;  2UXX B;  1HS7 A;  3UU4 A;  4B3R T;  2VUR A;  3UQ4 A;  5CB4 E;  3SWH A;  2VK9 A;  1XNR T;  3EVY A;  5L3E B;  4U2Y A;  2VWA A;  3IA3 A;  2X67 A;  3KV5 A;  1MIV A;  2KIN B;  5LHH B;  4O4J E;  2FUP A;  5FXV A;  4IT4 A;  2XQ8 A;  4EGW A;  2BKN A;  1HX1 B;  4TNV A;  4K0U A;  4WBO A;  2E5L T;  2W4X A;  4Q25 A;  4X1I E;  1D0Z A;  4E7Z A;  3AEA A;  2SPC A;  5EZY E;  2E8I A;  1ZV4 X;  5AQS B;  2CA5 A;  4COF A;  5HEH A;  2LKG A;  3P4S A;  4QH1 A;  3KVA A;  2LOP A;  4HFH A;  4KMC A;  5L2L A;  1S94 A;  5BMV E;  3I9W A;  1KEY A;  3C4Z A;  5A1L A;  1J5W A;  2ZLY A;  3RX6 A;  3ZJ2 A;  3ZSS A;  3KBU A;  3R6N A;  2F4V T;  1U5P A;  4ADZ A;  1MIW A;  3C4X A;  4PJM A;  2ES0 A;  4A97 A;  3NKZ A;  5TAO A;  3GWH A;  4I43 B;  2CEA A;  4LF6 T;  2N9D A;  2J47 A;  2Q9Q A;  4ZHQ E;  4WBN E;  3K3N A;  2MPK A;  2CM0 A;  1E2A A;  4ZI2 C;  4JV5 T;  3OTO T;  5JDL A;  1MND A;  5EK3 A;  4U74 A;  3PE0 A;  2ACX A;  3QC9 A;  1OWA A;  4ZI7 E;  4ZS2 A;  4C90 A;  2EHO A;  2NW7 A;  2NWB A;  1ZKE A;  4CXX A;  4LF9 T;  1T72 A;  3G06 A;  2KT9 A;  3L09 A;  1WCR A;  4AIS A;  4LFA T;  2HN1 A;  4WZX A;  2UU9 T;  4XAX B;  2WQY A;  1LVF A;  2IIU A;  5AQH B;  2LRK A;  4BA9 A;  5AQI B;  2LEH A;  2WDQ A;  4ILA A;  1B7T A;  3FZF B;  3C98 B;  4KI0 F;  5JR9 B;  3ZST A;  1HFA A;  2WZH A;  5F3J A;  2HN2 A;  5L3F B;  5FY0 A;  4ZI3 C;  2W62 A;  3CX7 B;  3VR9 A;  2I0M A;  2M6I A;  3A8Y C;  3I9Y A;  4JEU B;  2UUB T;  2C5I T;  2JQK A;  3HL6 A;  2C5J A;  1HR0 T;  4ZS3 A;  4N78 D;  4DV5 T;  2Y48 B;  3ZMS B;  2DWK A;  1OED E;  1VRB A;  4JI4 T;  5HYA A;  4QH5 A;  3AXJ B;  3B57 A;  3MJX A;  1J5E T;  2JRK A;  3AEB A;  1KFY A;  3K3O A;  3IBP A;  2IW5 B;  4DV4 T;  4EZH A;  2KND A;  4OYJ A;  3CML A;  4IE0 A;  3Q5D A;  5LHG B;  3AVR A;  2RA1 A;  2FJD A;  2QRX A;  4H9S E;  5FY1 A;  4B6X A;  4NUV A;  2XQ9 A;  4DBQ A;  4HE8 A;  2JJ9 A;  3PUW F;  4EED A;  2DCF A;  3AB3 B;  2RPA A;  3JAD A;  4DO0 A;  4EIW A;  4ILU A;  2KMF A;  1X79 A;  1GQE A;  2CLY C;  2ZM0 A;  2VL0 A;  5E0O A;  5JRE A;  4AQY T;  3ZMU B;  3ZMV B;  5LYJ E;  3VHL A;  2V7K A;  4YJ2 E;  2NW8 A;  2JMH A;  4IHJ E;  3C4W A;  3P4R A;  2QA7 A;  4X1K E;  4UEM A;  2E9X B;  3O1H A;  2BG9 C;  1BR1 A;  2UXN B;  2NTX A;  5J1G A;  2QGS A;  3ZN1 B;  4UXN B;  3ZC1 A;  5CGM A;  5AQG B;  5LMU T;  3PUY F;  1LKX A;  2XM1 A;  4QXC B;  4O2A E;  2LLY A;  2JQ9 A;  5IWA T;  3LFM A;  3E08 A;  2XAQ B;  5ABF B;  3AEG A;  2VKH A;  3DJB A;  1G8X A;  4CI3 B;  3FXE B;  1HTJ F;  4C91 A;  2X68 A;  5L47 A;  4DUY T;  4YHJ A;  2CMR A;  3FHN A;  3SOL A;  3HKB E;  3MAC A;  4IDZ A;  5L3D B;  3O1I A;  2A3D A;  3CVR A;  3RIU C;  5HCJ A;  4DID B;  4X20 E;  4JI2 T;  1MMD A;  2V7L A;  4PW8 A;  2E9X D;  5FL0 A;  4IGU A;  4I55 E;  4CN1 A;  3RPU A;  3PU3 A;  2P9B A;  3L39 A;  3CK6 A;  3Q5E A;  2X9W A;  3FBL A;  3N9O A;  4E7S A;  3D0T A;  2YU1 A;  4UEL A;  4JI5 T;  4HN9 A;  1QSD A;  5DQV A;  3F57 A;  3HKE E;  4EOZ B;  4B3M T;  3GN5 B;  3AAI A;  5AQO B;  3NWI A;  3OKQ A;  3RGL A;  5AQL B;  4HEA A;  2WCA A;  5LHI B;  4QH4 A;  5KX5 E;  3ONL C;  4MLK A;  1IAP A;  2GK9 A;  1T98 A;  2XQ6 A;  4AKR B;  4AKH A;  4P0B A;  4LF5 T;  1IBM T;  3EAB A;  2BS3 A;  3B13 A;  3CX8 B;  3AE2 A;  4OHF A;  3RI5 A;  2BVM A;  3AEF A;  1UUS A;  3ZEF B;  4K0K T;  3AA6 B;  2Q9Q C;  4OFZ A;  5AQJ B;  5JR9 A;  2BKO A;  2BBH A;  1CUN A;  4ILB A;  2XQY A;  2X9Y A;  2FJA A;  3P4Q A;  4X64 T;  3RC8 A;  3UU6 A;  4EB6 E;  4HFB A;  5ABH A;  2VVN A;  1W0B A;  1HG5 A;  4BAY B;  4ZZC A;  3S4U A;  3EI0 A;  4EV6 A;  4HWC A;  3RRW A;  3AAA B;  2EHO C;  3RIA A;  1UX4 A;  2JPF A;  3C50 A;  2A72 A;  1XDO A;  3WAJ A;  4JI6 T;  5J2T E;  3AE4 A;  5ABG A;  3F31 A;  1BR0 A;  5HXR A;  4Z8X A;  4AXP A;  4TV8 E;  1D1C A;  1T7S A;  5CFB A;  3FZL B;  3AXJ A;  3PUG A;  2XAF B;  3N9N A;  4KHP T;  3ZT6 A;  4HFC A;  4TV9 E;  4L5G A;  3PTR B;  4IL4 A;  2W61 A;  3BQI A;  2UUC T;  5HXC A;  4UVB B;  4X62 T;  2MYS A;  4HGA A;  5LP6 E;  2LSK A;  2ZM8 A;  4KBM B;  2KWH A;  2K24 A;  4DR7 T;  1Z0P A;  3ZMZ B;  4DV7 T;  2VQF T;  3H3A A;  3EDU A;  4LF7 T;  2I6H A;  1S35 A;  5HWY A;  4GOU A;  5AQR B;  3AEC A;  3ZJ1 A;  4GYS A;  5FY7 A;  1I6Z A;  3C51 A;  5AQM B;  3TLT A;  1OXZ A;  3A7M A;  4AQF A;  3ZLI A;  4DBR A;  2X9X A;  3P7I A;  4H9N C;  1N36 T;  3P4W A;  3BK9 A;  2LRL A;  5AQF B;  5EK4 A;  2DL1 A;  2DHR A;  2YKS A;  2LHR A;  2E9X A;  2XSB A;  1YQ4 A;  2XQ4 A;  2J4G A;  4NUU A;  4ZZB A;  3W15 B;  5AQP B;  2C0S A;  3H37 A;  3BQK A;  4CI2 B;  4DR1 T;  4YTM A;  2WMN A;  3VKH A;  4YTP A;  3QOF A;  4IDO A;  3QUJ A;  3NVO A;  4DR6 T;  2L9Q A;  5LMN T;  2V7M A;  5F5W A;  5IYZ E;  3U3I A;  2XAJ B;  3RF1 A;  3DTO A;  2QYW A;  3PUS A;  2PJQ A;  3VU7 H;  4MAL A;  2WU2 A;  3ZYM A;  4H63 V;  2W67 A;  4HWH A;  5ETW A;  4ERR A;  3RC3 A;  4ISS A;  4UF0 B;  5LG4 A;  3KVB A;  4H9O C;  3T8O A;  4JYA T;  4DMV A;  4MHC A;  5F8P A;  4MBQ A;  3UU8 A;  2A9U A;  4AKI A;  3LK4 2;  4GYR A;  4YT0 A;  5JDN A;  1KF6 A;  2LKH A;  4H9Q C;  2WB5 A;  1MMG A;  2B76 A;  2V7I A;  5C2T A;  5EK2 A;  1LVK A;  3PUV F;  3Q2M A;  5JDF A;  4TZ4 C;  4LF4 T;  2WDR A;  2IML A;  2W00 A;  5AFU L;  2YDS A;  3OYZ A;  5LGN B;  4JI8 T;  2B1E A;  2PTF A;  4LMK A;  4ZI2 D;  4YJ3 E;  5KMG P;  1JNR A;  2E2A A;  3C64 A;  5LBQ B;  3OJA A;  3ZKR A;  1D0X A;  4EXT A;  3R84 B;  2D9D A;  2WMO A;  3TLS A;  2V26 A;  3T1H T;  4QWN B;  4V1A v;  2VKJ A;  3LK3 B;  3FBZ A;  2OLT A;  3L3P A;  4JI3 T;  1FIO A;  1HCI A;  3ZCJ A;  4IE5 A;  3ZT7 A;  2JQQ A;  4IE7 A;  4M1P A;  5FKY A;  1XDP A;  3M65 A;  3CQC B;  1D0Y A;  5L3B B;  2K5B B;  3UUM A;  2WZI A;  2NOX A;  3V5S A;  1SE7 A;  1WYC A;  3CX6 B;  4ZI3 D;  2ZMA A;  3UQ7 A;  4DR5 T;  3ZCI A;  2PFV A;  5J2U E;  2DLR A;  4JI7 T;  3LBX A;  3EHZ A;  5FXZ A;  4I0U A;  4QKN A;  4ANJ A;  3NBX X;  1O3X A;  1WFD A;  1OED B;  4GKK T;  2CLY B;  2W2U A;  4JI1 T;  5AQN B;  2CHN A;  5HWX A;  4CXW A;  4P1N A;  4IDN A;  5JR9 C;  2FJB A;  3AE9 A;  2BG9 E;  3NRX A;  3IEE A;  3RKG A;  3NZP A;  5AQT B;  2MAW A;  4HFD A;  3N2O A;  2YK0 A;  4ILC A;  2NP9 A;  2K3W A;  2XHE B;  4NIQ A;  4U2Z A;  3EAM A;  3AE1 A;  2PG8 A;  4HTE A;  3O4X E;  2VAS A;  3OYX A;  2W66 A;  2XSA A;  4DMW A;  2X51 A;  3SS1 A;  3O1J A;  5JH7 E;  5L3G B;  4PK4 A;  5LB7 B;  2YDR A;  3I0O A;  5M4Y A;  4MFR A;  5HEG A;  5DQW A;  3VR8 A;  1T8B A;  1IJ5 A;  3AE6 A;  1KK7 A;  2CBI A;  2WAU A;  4U31 A;  3ETU A;  4DR4 T;  4F8H A;  2IUB A;  4U3C A;  1SA0 E;  3ZMT B;  3Q9D A;  4WNK A;  2XQ3 A;  2N2N A;  3E0Z A;  3UUN A;  1LRZ A;  3ONX A;  4DVD A;  2D5U A;  3RYC E;  3HR0 A;  4P0A A;  2FJE A;  1WYB A;  2BS4 A;  4PK5 A;  5AQQ B;  1KNP A;  4YY3 T;  4A98 A;  4LMJ A;  4AQF C;  4UV9 B;  3FZH B;  3KV9 A;  1FMW A;  4YXD A;  1KNZ A;  4CZZ B;  5FVL A;  1UX5 A;  3JC6 D;  2ODU A;  4TNW A;  3PUA A;  2QVA A;  3JCF A;  3N9Q A;  4FI5 A;  4H9R C;  2E9X C;  1W09 A;  2V6Y B;  5JDQ A;  5LGT B;  1IBK T;  4UF0 A;  4EZ4 A;  4TWH A;  2HPL A;  2N1G A;  4TUY E;  4CN6 A;  1SUM B;  4NPP A;  1VCS A;  4O4L E;  4QXH B;  1NAF A;  2IC9 A;  4IL9 A;  5JDG A;  4QX7 B;  2X9H A;  3EDV A;  2CPT A;  2LSY A;  4CN4 A;  3QK6 A;  3H3M A;  1WR6 A;  5ABE A;  3FXD B;  3VRB A;  4YFS A;  4A5X A;  1D1A A;  2H89 A;  2H7V C;  4DR3 T;  5FMN A;  4DV6 T;  4LML A;  4JEH B;  2A2F X;  3FZK B;  4ZOL E;  4JI0 T;  3ANW B;  4TWF A;  2V8S V;  1KNR A;  2XAG B;  2ZM2 A;  2LM9 A;  3PUX F;  3AE3 A;  2LM2 A;  5FYM A;  2JQH A;  1VOM A;  1US7 B;  3CKD A;  2NW9 A;  4FJO A;  4O4I E;  4UV8 B;  4EYU A;  1D1B A;  2XAH B;  3AA7 B;  1UK5 A;  2CXF A;  3LK2 B;  5AQV B;  3F2E A;  2VKD A;  5FP3 A;  4HFI A;  1QUU A;  5JDM A;  1BR4 A;  2NTY A;  1CHU A;  4I50 E;  2HPJ A;  2CWY A;  3ZPO A;  2VKO A;  1Z8U A;  3GA8 A;  1ZEE A;  2AE9 A;  3AE8 A;  2M67 A;  3NZQ A;  4QX8 B;  2MTQ A;  1OED A;  4AI6 A;  2V6X A;  5CA0 E;  5LXT E;  4Z91 A;  5H6R B;  5FVK A;  5HCM A;  2LOS A;  3ESL A;  1XMQ T;  4BJN A;  4Z90 A;  1MIY A;  3N5L A;  2WU5 A;  4A56 A;  3HKD E;  3AA0 B;  4AKL A;  1EZ3 A;  4BJM A;  4PFO A;  1HX8 A;  3HKC E;  1N33 T;  1YKH B;  1UGO A;  2XJ7 A;  4EYY R;  2D0T A;  2VL8 A;  2IDO B;  4KX6 A;  4LF8 T;  1HF8 A;  2XTL A;  4DV1 T;  3LSV A;  3FB2 A;  3HA4 A;  1UUR A;  3TKL B;  2BVL A;  5LNK A;  1YKE B;  3ZYL A; 
#chains in the Genus database with same CATH homology
 5JRE A;  3ZMU B;  2IC6 A;  4ASK A;  3OJA A;  3HI2 A;  2LJL A;  2WBL A;  3ZMV B;  5LYJ E;  3EUH A;  1D0X A;  4TX5 A;  3IHR A;  3VHL A;  2V7K A;  4EXT A;  2K9A A;  3R84 B;  3KDS E;  4YJ2 E;  2NW8 A;  2JMH A;  4IHJ E;  1Y64 B;  2WMO A;  3ZN0 B;  3C4W A;  2QA7 A;  5FNV E;  4X1K E;  2CXD A;  2V26 A;  1E1H B;  3RRC A;  3KIN B;  2H3R A;  2Z6E A;  3P8C D;  4QWN B;  2KLQ A;  2E9X B;  4UEM A;  2PBI A;  4XZC A;  3UTK A;  5LGU B;  3O1H A;  1BR1 A;  4KUM B;  4V1A v;  3PU8 A;  2VKJ A;  3LK3 B;  4GK0 E;  2UXN B;  3LJC A;  3RYF E;  2D2S A;  3FBZ A;  2NTX A;  3L3P A;  1FIO A;  5J1G A;  2QGS A;  1HCI A;  3ZCJ A;  3ZN1 B;  5CA1 E;  2K48 A;  4O8S A;  4IE5 A;  3KFW X;  1FMV A;  4UXN B;  3ZC1 A;  2Q9Q D;  2JQQ A;  4IE7 A;  2Y6X A;  1UCU A;  4M1P A;  1LKX A;  4QXC B;  5LBQ B;  4O2A E;  3M65 A;  3LFM A;  3E08 A;  3CQC B;  2XAQ B;  4QXB B;  5C8Y E;  1D0Y A;  1YD8 G;  2VKH A;  3DJB A;  5L3B B;  1G8X A;  2LE8 A;  3RKO A;  2K5B B;  4CI3 B;  5ADX L;  2HH7 A;  3FXE B;  1HTJ F;  2LSG A;  3UUM A;  3SRZ A;  2NOX A;  4WW0 A;  3V5S A;  4C91 A;  2X68 A;  5JQG E;  4YHJ A;  1WYC A;  3CX6 B;  4ZI3 D;  2ZMA A;  3ZCI A;  2PFV A;  5J2U E;  4UIG A;  2DLR A;  1YW0 A;  1BR2 A;  1IJ6 A;  2CMR A;  2ODV A;  3FHN A;  3LBX A;  2EHO D;  4YLH A;  3MA9 A;  3K3Q C;  3LBX B;  3N2G E;  1MNE A;  5FXZ A;  3N2K E;  1SHZ C;  4QKN A;  4ANJ A;  3NBX X;  3N9L A;  1O3X A;  4AQG A;  4JUY A;  3SOL A;  3HKB E;  3MAC A;  3VKG A;  5LCY A;  4IDZ A;  5L3D B;  3O1I A;  1U4Q A;  2WSS V;  4TN7 B;  3ETV A;  2CLY B;  5JDH A;  4PK6 A;  2A3D A;  4J2C A;  3UT5 E;  5JRC B;  5DJQ C;  5KDM C;  5HWX A;  4CXW A;  3CVR A;  3I0Q A;  2BDE A;  5JR9 C;  4X20 E;  1MMD A;  4QHO A;  2V7L A;  4PW8 A;  2E9X D;  4IGU A;  5LBM A;  1AJ3 A;  4I55 E;  3NRX A;  3RPU A;  3PU3 A;  2P9B A;  2H7O A;  5DAB A;  2BZB A;  2X66 A;  2X9W A;  3FBL A;  4PJN A;  3N9O A;  3IEE A;  2XAS B;  3E22 E;  4E7S A;  3D0T A;  2YU1 A;  4XBF B;  3NZP A;  4PNI A;  4UEL A;  1V9D A;  5L3C B;  3IF8 B;  3KV6 A;  3N2O A;  3Q5W A;  4HN9 A;  2YK0 A;  1QSD A;  5DQV A;  2NP9 A;  2MOZ A;  3F57 A;  3HKE E;  3LG7 A;  3ZYK A;  1MMN A;  4EOZ B;  2XHE B;  2LT3 A;  3GN5 A;  4GK5 E;  3GN5 B;  5FXW A;  2KWI B;  3PDY A;  3AAI A;  4PFP A;  2PG8 A;  3OKQ A;  3WAK A;  2LSI A;  4HTE A;  3O4X E;  4PJJ A;  4CQI A;  2VAS A;  2YEV C;  4HEA A;  1HG2 A;  4F6R C;  3OYX A;  4IE4 A;  5LHI B;  5KX5 E;  2LSJ A;  3I1A A;  4I4T E;  2LHN A;  4DMW A;  4P09 A;  4MLK A;  1IAP A;  2X51 A;  3SS1 A;  3O1J A;  5JH7 E;  2GK9 A;  4CI1 B;  1T98 A;  5H6Q B;  4AKR B;  5L3G B;  4AKH A;  4GIW A;  3UFE A;  4P0B A;  4PK4 A;  3AAE B;  3AA1 B;  2L8K A;  5LJM A;  2JMK A;  2UXX B;  3B13 A;  3CX8 B;  3I0O A;  3RYH E;  4MFR A;  5M4Y A;  1HS7 A;  4OHF A;  5DQW A;  2V1D B;  1IJ5 A;  2XUE A;  2BVM A;  5LOV E;  5CB4 E;  3SWH A;  1FEW A;  2V7J A;  4G2A A;  1KK7 A;  2VK9 A;  3EVY A;  2WAU A;  4U72 A;  5L3E B;  3ZEF B;  3ETU A;  2DNX A;  3ANW A;  3AA6 B;  1G73 A;  2Q9Q C;  4H63 H;  4OFZ A;  1MMA A;  2VWA A;  5JR9 A;  2X67 A;  3KV5 A;  1MIV A;  1SA0 E;  3CQG B;  3ZMT B;  1CUN A;  3AVS A;  2KIN B;  3Q9D A;  4WNK A;  5LHH B;  2KZ7 B;  2N2N A;  2XQY A;  3E0Z A;  3UUN A;  1LRZ A;  3V5U A;  2X9Y A;  4O4J E;  3ONX A;  3J7Y q;  3MXZ A;  5FXV A;  4DVD A;  2D5U A;  3RC8 A;  3RYC E;  4EB6 E;  3HR0 A;  4P0A A;  1WYB A;  5E0O A;  1HG5 A;  4K0U A;  4BAY B;  4WBO A;  4AKG A;  4PK5 A;  3S4U A;  4X1I E;  2G0U A;  3NRY A;  1D0Z A;  3RRW A;  3AAA B;  2EHO C;  1UX4 A;  2JPF A;  3C50 A;  4E7Z A;  2SPC A;  2A72 A;  5EZY E;  2E8I A;  1ZV4 X;  4AQF C;  3WAJ A;  4UV9 B;  4HKA A;  5J2T E;  2CA5 A;  2WM9 A;  3KV9 A;  1FMW A;  3F31 A;  1BR0 A;  1KNZ A;  5HXR A;  4CZZ B;  4Z8X A;  3KVA A;  2LOP A;  4AXP A;  4DND A;  4KMC A;  4TV8 E;  1D1C A;  1UX5 A;  5L2L A;  1S94 A;  3JC6 D;  2ODU A;  3K8P C;  5BMV E;  3I9W A;  3PUA A;  3C4Z A;  5A1L A;  3N9Q A;  4IE6 A;  1IZN B;  2ZLY A;  3RX6 A;  3PUG A;  3ZJ2 A;  3KBU A;  3R6N A;  4FI5 A;  4H9R C;  2XAF B;  3N9N A;  1U5P A;  2E9X C;  2OA5 A;  1WLX A;  4ADZ A;  2IAK A;  5JDQ A;  5LGT B;  1MIW A;  3BQL A;  3C4X A;  4PJM A;  3MZK B;  2ES0 A;  2KXP B;  4UF0 A;  4TV9 E;  4L5G A;  3PTR B;  3UUL A;  4EZ4 A;  2W61 A;  3BQI A;  4O4H E;  2HPL A;  1ZHC A;  2N1G A;  2W63 A;  4TUY E;  4X1Y E;  5TAO A;  3RH3 A;  3UUX B;  5HXC A;  4UVB B;  3GWH A;  4I43 B;  2CEA A;  3GMI A;  4KP3 C;  2N9D A;  3J9X 1;  2Q9Q A;  4IST A;  2MYS A;  2VB6 A;  3MKD A;  4HGA A;  5LP6 E;  4ZHQ E;  2LSK A;  2ZM8 A;  4KBM B;  4O4L E;  4WBN E;  3MK7 C;  3K3N A;  2CM0 A;  2KWH A;  2K24 A;  4QXH B;  4L0R A;  1Z0P A;  3ZMZ B;  1NAF A;  2IC9 A;  4ZI2 C;  5JDG A;  5FXX A;  4QX7 B;  4HFV A;  5JVD E;  5JDL A;  2X9H A;  3H3A A;  1MND A;  3EDU A;  3KV4 A;  1S35 A;  3EDV A;  5EK3 A;  4U74 A;  3PE0 A;  4L9I A;  5HWY A;  4GOU A;  2LSY A;  2ACX A;  3QK6 A;  3QC9 A;  3OBV E;  4H9P C;  1WR6 A;  1OWA A;  4ZI7 E;  3ZJ1 A;  4GYS A;  5FY7 A;  4ZS2 A;  2X0L B;  2EHO A;  2NW7 A;  3FXD B;  3C51 A;  4C90 A;  3CPZ A;  4YFS A;  1OXZ A;  2NWB A;  1D1A A;  1ZKE A;  4CXX A;  2H7V C;  4AQF A;  2CE7 A;  5FMN A;  2KT9 A;  3L09 A;  3CWZ B;  3O9X A;  4XAX B;  4IIJ E;  3ZLI A;  1H7C A;  4JEH B;  3ZC0 A;  4DBR A;  2A2F X;  2X9X A;  3P7I A;  1LVF A;  3PUQ A;  4BA9 A;  4H9N C;  5LA6 E;  2LEH A;  4ZOL E;  1B7T A;  1NWM X;  3BK9 A;  4EAH A;  3ANW B;  5EK4 A;  5HAX A;  3C98 B;  2DHR A;  2XAG B;  2LHR A;  2E9X A;  5JR9 B;  4OK0 A;  2C5K T;  1HFA A;  2ZM2 A;  2LM9 A;  5F3J A;  2I59 A;  2Y8D A;  2J1D G;  4NUU A;  2L3L A;  3W15 B;  5FYM A;  5L3F B;  2C0S A;  3H37 A;  3BQK A;  5FY0 A;  4CI2 B;  1VOM A;  4ZI3 C;  2W62 A;  1US7 B;  2WMN A;  3CKD A;  3CX7 B;  2NW9 A;  4FJO A;  3VKH A;  3N9P A;  4O4I E;  4UV8 B;  4EYU A;  1D1B A;  2XAH B;  3WI3 A;  3AA7 B;  2CXF A;  3LK2 B;  3QUJ A;  3F2E A;  3I9Y A;  4JEU B;  3PUR A;  5HXH A;  2L9Q A;  2C5I T;  2V7M A;  5IYZ E;  2VKD A;  3HL6 A;  2C5J A;  3U3I A;  1WRD A;  2XAJ B;  5FP3 A;  1QUU A;  2YIN A;  5JDM A;  1BR4 A;  3JC6 C;  2NTY A;  5IHY A;  4I50 E;  4ZS3 A;  4N78 D;  2HPJ A;  4PAG A;  5HXE A;  2CWY A;  4PJL A;  2Y48 B;  3DTO A;  3ZMS B;  2VKO A;  3ZPO A;  2DWK A;  3PUS A;  1VRB A;  3GA8 A;  2PJQ A;  3VU7 H;  1ZEE A;  5HYA A;  4MAL A;  4O2B E;  4G63 A;  2M67 A;  3B57 A;  3NZQ A;  3ZYM A;  4QX8 B;  4H63 V;  2MBG A;  5ETW A;  2MTQ A;  4JLE A;  3MJX A;  4AI6 A;  5CA0 E;  2JRK A;  4ERR A;  2D0U A;  3RC3 A;  5LXT E;  5H6R B;  5JRC A;  3K3O A;  4ISS A;  4UF0 B;  3IBP A;  2IW5 B;  3DP7 A;  2LOS A;  5LG4 A;  2YU2 A;  3KVB A;  3ESL A;  4H9O C;  4EZH A;  2DI4 A;  4BJN A;  3KBT A;  2KND A;  4OYJ A;  3T8O A;  5LJN A;  3RYI E;  3N9M A;  4DMV A;  1MIY A;  3CML A;  3CQX C;  3N5L A;  2CXL A;  4MHC A;  5F8P A;  5GON E;  4IE0 A;  4A56 A;  3Q5X A;  4MBQ A;  2DWG A;  2Q9Q B;  3HKD E;  3U78 A;  3AA0 B;  3A5X A;  4AKI A;  4AKL A;  5LHG B;  3AVR A;  1EZ3 A;  2CWO A;  3LK4 2;  2RA1 A;  4BJM A;  4GYR A;  4PFO A;  1HX8 A;  5JDN A;  4CXY A;  5FY1 A;  4H9S E;  3HKC E;  4B6X A;  4NUV A;  4H9Q C;  1MMG A;  1YKH B;  4HE8 A;  4DBQ A;  2JJ9 A;  4EYY R;  2D0T A;  2DCF A;  2V7I A;  3AB3 B;  4OYK A;  2VL8 A;  1LVK A;  5EK2 A;  2CCQ A;  3Q2M A;  5JDF A;  1HF8 A;  4TZ4 C;  2XTL A;  2W00 A;  5AFU L;  4DO0 A;  3OYZ A;  4EIW A;  5LGN B;  2EHO B;  2B1E A;  4UVA B;  3FB2 A;  2W0G A;  4ILU A;  2RP4 A;  4ZI2 D;  2WWU A;  2KMF A;  3HA4 A;  4YJ3 E;  1X79 A;  2CLY C;  2ZM0 A;  3TKL B;  5HXS A;  5KMG P;  2BVL A;  5LNK A;  1YKE B;  3ZYL A;  3C64 A;  4UVC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...