2CM0A

The pub domain functions as a p97 binding module in human peptide n-glycanase.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
GSASPAVAELCQNTPETFLEASKLLLTYADAILRNPNDEAARSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PEPTIDE N-GLYCANASE HOMOLOG
publication title The Pub Domain Functions as a P97 Binding Module in Human Peptide N-Glycanase.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cm0A00
4P0BA 4OYJA 4P09A 2D5UA 4OYKA 5LJMA 4JUYA 2HPJA 5LJNA 2HPLA 2CM0A 4P0AA 2CCQA
chains in the Genus database with same CATH superfamily
2IHR1 5L4HA 2HPJA 3P4RA 4LMJA 5JDFA 5JDMA 4QWNB 5FL0A 1WCRA 4V1Av 2ZM8A 2NWBA 4QHOA 1MNDA 3P8CD 3OKQA 3PJAJ 2QVAA 3UUMA 4PK5A 4EGWA 3CQXC 5C8YE 2PTFA 4I55E 4EEBA 4DUYT 3PUVF 2LOSA 3ZLIA 4LF9T 3RYFE 3RIUC 2RP4A 3ZJ2A 2X0HA 2XAJB 5JDLA 1XMOT 4IIJE 3LK42 2PJQA 3ZYLA 4X64T 4QH5A 5JVDE 2BS4A 4CN4A 2J1DG 5L4EA 2MTQA 1V9DA 3PUZF 3L3PA 2MAWA 2V7JA 3FXDB 2LSYA 3NRXA 4HFHA 1XDPA 4X1KE 4DV1T 4YXDA 2Z6EA 1N34T 2Y8DA 3HL6A 4TN7B 4DMWA 5LNKA 1FMVA 3KBTA 5J2UE 2BG9A 2QA7A 3ZMVB 5LBMA 3I0OA 3L39A 1LVKA 2XQ7A 2HN1A 3FZMB 3CKDA 4ZZCA 1S94A 3HKEE 2G0UA 4H63H 1UUSA 5L2LA 5HWXA 2VKHA 4X62T 4YSXA 2X0LB 2JMHA 2XSAA 4HE8A 2WWVA 3RC3A 4QKNA 5ABHA 5FXZA 2IC9A 4EYYR 2RA1A 4JI2T 4J2CA 4ZZBA 3AAEB 1HFAA 1QUUA 3ANWA 1QSDA 2BVMA 4BJMA 1IAPA 2M67A 4JI5T 4IL4A 2CE7A 3NVOA 2FJDA 2XQ5A 4L9IA 3N2GE 3UU6A 4HWDA 2ZM6T 4IGUA 2HHHT 1N36T 3ONLC 2CM0A 1Y01A 2W61A 3UUNA 4X65T 4NXNT 1J1JA 5LBQB 2V6YA 2ODUA 3OJAA 5HAXA 3PUQA 3T1YT 5AQSB 3UQ4A 4KX6A 4UEMA 2VL0A 2CXDA 1YW0A 3PUWF 2LOPA 3MJXA 3KBUA 4IE5A 5KX5E 5FNVE 4K0KT 3C4WA 2V1DB 3C64A 3PUAA 4H63V 1N32T 4CN6A 3QUJA 4YSZA 4QH4A 3EI0A 5JR9B 2LSIA 1DU2A 5KMGP 2H89A 5H6QB 2CWYA 2W63A 3O1IA 5FP3A 4IL9A 2IMLA 4L5GA 1BR1A 2BKPA 4PFPA 3FZHB 4O4JE 4OHFA 3K3OA 1NEKA 4IT4A 1G73A 3AEAA 3E08A 1W9RA 4H9OC 5L3BB 3C4XA 1CHUA 1UK5A 2H7OA 3P7IA 1OXZA 2WU5A 4YTMA 5JR9C 2KWIB 5LXTE 3ZJ1A 2VVNA 5AQVB 3N2OA 3EABA 3P50A 4EB6E 3AE9A 1MIYA 3JCFA 4JI3T 5LCYA 4JUYA 3OYXA 4KHPT 3GMIA 4ZXLA 4GK5E 5ABFB 2EHOD 2LLYA 2ZM0A 4WNKA 4PJLA 3VU7H 3HKCE 5JDGA 4YT0A 1XNQT 5LOVE 2LEHA 3MKDA 4UV8B 2XQ9A 1FIOA 4EOZB 2DL1A 4ASKA 1UURA 2X67A 5JQGE 1IBMT 1QLBA 5AQTB 3PJAA 2X9HA 4GOUA 4O2AE 4TX5A 4ZOLE 3RKOA 2VK9A 4ILBA 1LRZA 4ISSA 4IDNA 2KMFA 4ZI7E 2YEVC 3O4XE 4B6XA 2LSGA 4CN1A 4A98A 5CFBA 4H9QC 1ZP0A 5JRCB 4HFVA 2W66A 3RRCA 5JDQA 5F3JA 3BQKA 3RRWA 2CCQA 5FYMA 5FY7A 4PK6A 4OYJA 1N33T 4Z90A 1E7PA 4X1IE 1T7SA 1HF8A 3JC6D 4Z91A 2XQAA 3RYCE 1HS7A 2PFVA 2HH7A 3G06A 2XQ6A 2KT9A 2L8KA 4WW0A 4KMCA 2VB6A 1YQ3A 1CUNA 2NW9A 2WP9A 3CX6B 2XQYA 3QB5K 3FZFB 2MPKA 3FZKB 1E2AA 1KFYA 4AQYT 3VHLA 1WYBA 3ZN1B 1XZYA 3SFEA 4A56A 3Q5EA 2UUBT 1FMWA 4NXMT 3TLSA 4KHZF 3MACA 5FKYA 2XPKA 3K3QC 2X9YA 4U72A 1ZKEA 5LGUB 2A9UA 3N9MA 4CXWA 2VL8A 3N9OA 4NUVA 3QC9A 2D9DA 3EVYA 3GA8A 4O4LE 2BKNA 5CGMA 1OEDB 1W0AA 3LG7A 5DABA 4TUYE 3RKGA 1HNWT 4ZI3D 4JI8T 4P0AA 2EHOB 3HKBE 1T72A 2V7LA 1KEYA 3RYIE 4I50E 3UUBA 1SHZC 4XAXB 4CI3B 4DV7T 3FXEB 3BQLA 3RQWA 2VKOA 4A97A 2JQHA 4ZI2C 2X0YA 3C4ZA 2QRXA 4YLHA 3RC8A 3MXZA 3CPZA 3NKZA 3W15B 1OEDC 2LRLA 1R8IA 4DNDA 5HCMA 2JQQA 5L47A 1ZHCA 5IWAT 2LSJA 3AB3B 4JI1T 3HKDE 4JEUB 2CXFA 2XAFB 5BR8T 4JBWF 5L3FB 4CXYA 3NZPA 5ABEA 3P4SA 4QXBB 4NUUA 3NZQA 2X9WA 5LB7B 4NPPA 2UUCT 4WBNE 3WI3A 4PFOA 3PU3A 5JDNA 5L3GB 5LMUT 4EXTA 3ZT5A 3CMLA 4ILCA 1MMNA 4IE0A 4ZS3A 2V8SV 2LT3A 1T8BA 1M62A 1D0XA 2WSSV 4Z8XA 3N9PA 5H6RB 4P1NA 1IJ5A 4O8SA 2V7IA 2NR4A 4OFZA 3JADA 3UUXB 5TAOA 2BG9B 5IYZE 4QH1A 5EZYE 4U2YA 3H37A 2YKSA 2JQKA 1NENA 4O2BE 5ADXL 1UX4A 2AE9A 2FJBA 5J1GA 4IREA 1NAFA 3IF8B 4LFBT 2IW5B 1SE7A 3ZPOA 5HXEA 4AI6A 3LK2B 4M1PA 2KLQA 5HEHA 2UXXB 4TV9E 4HN9A 3ZC1A 4AQFC 2BG9C 2VASA 2C5JA 1MIWA 2WBLA 2V6XA 2XY8B 5HEGA 2MYSA 3FHNA 3ANWB 2XSBA 1XDOA 4UVAB 3M65A 3ZCJA 2V5CA 2Q9QD 4YHJA 3RF1A 2HPLA 2WQYA 2VURA 4U7YA 4YHHT 4YJ2E 2C5IT 2LHRA 2ACXA 2X51A 3A5XA 5LG4A 4MALA 4TV8E 3VKHA 3GN5A 3O9XA 4I43B 1D0ZA 4DUZT 2Y6XA 4IE7A 2V6YB 2VQFT 5CB4E 3FB2A 1HR0T 3KV6A 2WZHA 2YK0A 1NWMX 2E9XD 3KVBA 4FJOA 5ETWA 3EDUA 3UFEA 4BA9A 2NOXA 4HWFA 4TWDA 2K9AA 1HX1B 5AQRB 3PDYA 2UXBT 3S4UA 2XUEA 3AXJA 2LRKA 2XASB 5FVLA 4TWHA 5HXCA 4UVCB 5E0OA 4JI7T 2PG8A 2WZIA 3J7Yq 2IDOB 5KDMC 2CRBA 3AE2A 2IC6A 3ZYMA 1VRBA 4IDOA 2XQ8A 3PUGA 3OVUA 4MFRA 1U4QA 2VKJA 1Z8UA 3CVRA 5JTGA 2CHNA 2R6GF 2WAUA 2FJEA 3DTOA 4PW8A 2J4GA 2N9DA 3AA6B 4DO0A 1D1BA 3R6NA 4ZHQE 5EK4A 3UU4A 1BR0A 4ILAA 3E22E 4EEDA 2NP9A 2W4XA 5L3EB 2JPFA 3AE8A 3QNUA 3KFWX 3PV0F 1WR6A 3TLWA 2V26A 2HN2A 4UV9B 4B3MT 1S35A 1L0VA 1I6ZA 4GIWA 3MK7C 4F6RC 3LDQB 1ZOYA 2CWOA 3RQUA 4X1YE 4IDPA 4GYRA 3ZMSB 3AVRA 4IDZA 3JAEA 2OV9A 2BBHA 2BS3A 4PK4A 2MOZA 4EZ4A 2DCFA 2XJ7A 3ABVA 4XZCA 1AJ3A 4KI0F 4E7SA 2FBWA 2FJAA 3EDVA 3HA4A 2D0UA 1Y64B 5J0ZA 1KF6A 2VWAA 3I0QA 2CBJA 4U2ZA 3CK6A 3RI5A 3B13A 3H3MA 5FXXA 4EAHA 5LHHB 4AXPA 2E5VA 2RPAA 4FI5A 3JAFA 3PUYF 4X5TA 4LF8T 4HTEA 5DJQC 1IJ6A 2LKHA 2K24A 5AQJB 2BS2A 2Q9QA 5LHGB 2DNXA 3IA3A 1HG5A 3TLUA 4PJNA 3U3IA 4EIWA 1VOMA 1SA0E 4N78D 2M6IA 2LHNA 2VKDA 4TNVA 4EV6A 1YXRA 5LGTB 4U3CA 3TLTA 2NTYA 2QGSA 2N2NA 1KNZA 4H9SE 2KXPB 4WBOA 3UU5A 3ETUA 4UF0A 3RGLA 1XNRT 4ERRA 5FY1A 4EZHA 4CI2B 4HWCA 5C3JA 3MA9A 2F4VT 2YDRA 5FVKA 4AISA 5FXVA 3AE4A 1XWMA 2E9XA 4YFSA 2V5DA 4OYKA 3AA1B 5HEUA 1MMGA 1IZNB 2NTXA 2YU1A 5HXHA 4MLKA 3X1DA 2IAKA 4X20E 4LF6T 4IE4A 2X66A 1MMDA 5HEOA 5DQWA 1YKEB 5AQUB 4COFA 3BQIA 4GKKT 4JEHB 4OK0A 3ZSSA 3ZSTA 4CI1B 3F57A 1WR0A 3VKGA 1HG2A 3ZMUB 2IIUA 3N9QA 2W0GA 3AVSA 4DV0T 2I0MA 2WDQA 3ZYKA 4CXXA 4TNWA 5J2TE 2WWUA 2W2UA 3R84B 3NBXX 2E8IA 3NWIA 1J5WA 4JI0T 4DR6T 2WMOA 5FXWA 4X66T 2YDQA 5AQKB 3N9NA 4AQGA 1HNXT 2AXDS 3V5UA 4UELA 2V7KA 3K8PC 3EUHA 1W0BA 3AEBA 2M6BA 5HEJA 4HKAA 5AQLB 5F5WA 3ETVA 4DR7T 3BK9A 4LF5T 4G63A 3U78A 4DMVA 2DHRA 2I6HA 2E5LT 3UFGA 3LBXA 3B5MA 4O4HE 4YY3T 4HWIB 2KZ7B 2UXNB 5BMVE 4HGAA 2VQET 5HCJA 4P0BA 3Q9DA 2JQ9A 2EHOC 3PURA 2YINA 4DBQA 1KK7A 5HWYA 3ZMZB 4YSYA 2WDRA 3RX6A 2N1GA 1VCSA 2W62A 2CPTA 2D0TA 1G8XA 4DR2T 2LJLA 3HI2A 2L3LA 4GKJT 3LK3B 3AECA 3OPCA 1WRDA 5CA0E 4PJMA 4DV3T 4QXHB 4DR5T 2BVLA 3QOFA 4A5XA 2ZLYA 3EHZA 4TWFA 2JIWA 5CJ5A 4UIGA 3L8RA 1FJGT 3PUXF 3PTRB 2D2SA 1US7B 4JI6T 2C5KT 3DP7A 3VR9A 3IEEA 2H3RA 5LHIB 4OX9T 4AKLA 3O1HA 3I1AA 2ODVA 1M7KA 3JC6C 4QX8B 5LA6E 3SS1A 3AEEA 3GN5B 1MMAA 3UQ7A 5HXRA 2LM9A 3RIUA 4UXNB 3PUSA 1UCUA 4K0UA 4DVDA 2L9QA 1OEDE 2JRKA 5JDHA 5M4YA 3GWHA 3AE7A 4DR4T 3K1SA 3ESLA 1HCIA 3CQGB 4Q25A 1HX8A 3WAKA 5AQQB 3AA0B 3V5SA 2UXDT 2XAGB 4DV5T 3VRBA 2KINB 2X9XA 3IBPA 3HR0A 4LFAT 3AXJB 4BJNA 3I9WA 4B3ST 2JJ9A 2SPCA 2YU2A 3ZC0A 2OA5A 4G2AA 5AQFB 2CMRA 2E2AA 4DBRA 4AQFA 2D5UA 2YN6A 4ADZA 3J9X1 3AEDA 4LF7T 3DJBA 4QXCB 4H9NC 1IBKT 3M3ZB 4HEAA 2K5BB 2BDEA 3P4QA 2GK9A 3RHWA 1X79A 5DQVA 4WZXA 2VVSA 3AE5A 3KDSE 3ZT6A 3SFDA 2LM2A 1BR2A 5LGNB 2IUBA 1YQ4A 4GYSA 3ZT7A 3Q5XA 3RLFF 2CBIA 1D1AA 4LF4T 3ZMTB 4ZI3C 5LP6E 4I4TE 4NIQA 4IDQA 2A72A 1WYCA 3ZEFB 2X68A 4C91A 4ILUA 2WS3A 5EK3A 4KBMB 2KNDA 2XM1A 3AAIA 4DIDB 4E7ZA 5LG3A 4ZEYA 2ZMAA 2I59A 5F8PA 2MBGA 3SWHA 4WYVA 4CQIA 4PAGA 3C50A 4JV5T 5LMNT 4O4IE 4JI4T 2DWKA 3ONXA 2CLYB 4U31A 2ZM2A 5KXJA 2BG9E 4JLEA 1KNPA 5L3CB 3OYZA 4C90A 4AKRB 1KNRA 5LJMA 1YKHB 2WMNA 2J47A 3C51A 4YTPA 3Q5WA 4B3TT 3IHRA 5FY0A 4ANJA 4UVBB 3UU3A 3UT5E 3T8OA 3ZCIA 4KP3C 3OTOT 2W67A 5CA1E 3UULA 2V7MA 4PJJA 2CA5A 4ZS2A 2CLYC 3KINB 2DLRA 4HFEA 4LMLA 2WDVA 1JNRA 4I0UA 1ZEEA 2J62A 3RH3A 2B76A 3EAMA 4YJ3E 4HFDA 3F31A 4XBFB 5AQMB 4LFCT 2H7VC 1LVFA 1WLXA 2Q9QB 3P4PA 2XAHB 1GQEA 4ZI2D 2XM2A 2FUPA 2B1EA 5IUXA 4H9PC 3QB5A 1ZV4X 4DR3T 2WY2A 3FBZA 5JR9A 4MBQA 2K48A 3P4WA 4ISTA 3N9LA 2PBIA 2DWGA 4AKGA 2XQ4A 4KUMB 3LSVA 4UF0B 1O3XA 1EZ3A 5GONE 1W09A 2QYWA 3AA7B 1HNZT 2XTLA 1H7CA 5AFUL 4UR9A 4QX7B 4IHJE 3A7MA 2Q9QC 5AQIB 2E9XB 1MNEA 1UX5A 1B7TA 2C0SA 5HYAA 3SOLA 3Q2MA 4U33A 3D0TA 2WU2A 5C2TA 4AKHA 4HFIA 5AQGB 2UXCT 2CEAA 4JYAT 4DR1T 2JMKA 2XAQB 2A3DA 3AE3A 2BZBA 4DV2T 4HFBA 3KV5A 2XZEA 5ABFA 3A8YC 4B3RT 1X9BA 5L3DB 2E9XC 5AQOB 3L09A 3ONJA 2CHOA 1T98A 3CIRA 3N2KE 4IE6A 3WAJA 2K3WA 1D1CA 2XQ3A 1OWAA 3CX8B 2WB5A 3TKLB 4AIUA 5FMNA 2UUAT 4MHCA 3I9YA 3C98B 3E0ZA 3O1JA 3RIFA 3KVAA 3RIAA 3LFMA 3MZKB 5FL1A 4EYUA 1J5ET 2ES0A 4U7IA 4LMKA 5LJNA 1IBLT 2OLTA 3B57A 5JRCA 4AKIA 2NW7A 1D0YA 4PNIA 4YTNA 3K3NA 3PE0A 5AQNB 3CQCB 4F8HA 3AEFA 4HFCA 3T1HT 1Z0PA 3AE1A 5LYJE 4TZ4C 3LBXB 2YDSA 2P9BA 3SRZA 3QK6A 2LKGA 3FZLB 3VR8A 4CZZB 2A2FX 3KV9A 1YD8G 2KSRA 2NW8A 4L0RA 4BAYB 2CXLA 3RPUA 2ACZA 5JREA 5JH7E 1U5PA 3VRAA 1VCTA 2LSKA 3TLVA 4GK0E 3FBLA 4H9RC 3CWZB 1MIVA 3CX7B 5IHYA 2UU9T 2H88A 5A1LA 1UGOA 3AE6A 1SUMB 2KWHA 2BBJA 1JNZA 3F2EA 3Q5DA 1I94T 3ZN0B 4DV4T 2WCAA 2DI4A 2Y48B 3UU8A 1E1HB 2BKOA 5AQHB 1WFDA 1FEWA 5HXSA 3AAAB 3NRYA 3UTKA 1LKXA 3H3AA 4HWHA 1BR4A 1OEDA 2YOEA 1HTJF 2LE8A 3PU8A 3OBVE 5ABGA 4DV6T 2WM9A 4U74A 2EHOA 5EK2A 3RYHE 1XMQT 3AEGA 4P09A 5AQPB 2W00A 3LJCA 3N5LA 3ZKRA 2XHEB 3KV4A
chains in the Genus database with same CATH topology
2VWAA 3I0QA 2HPJA 4A56A 5LP6E 4I4TE 5JDFA 5JDMA 3B13A 1FMWA 2A72A 5FXXA 1WYCA 3ZEFB 2X68A 4C91A 4ILUA 3MACA 4QWNB 5EK3A 4KBMB 3K3QC 2KNDA 3AAIA 4V1Av 4E7ZA 2ZM8A 4EAHA 2NWBA 4QHOA 1MNDA 5LHHB 2X9YA 4U72A 1ZKEA 2ZMAA 5LGUB 3P8CD 4AXPA 2I59A 3OKQA 5F8PA 2MBGA 3N9MA 4FI5A 3UUMA 4CXWA 3SWHA 2VL8A 3N9OA 4PK5A 4NUVA 3C50A 4PAGA 3QC9A 3CQXC 3EVYA 3GA8A 4I55E 4O4IE 5C8YE 4O4LE 2LOSA 3ZLIA 2DWKA 3RYFE 4HTEA 5DJQC 2RP4A 3ZJ2A 1IJ6A 2XAJB 3LG7A 5DABA 2K24A 4TUYE 5JDLA 4IIJE 3LK42 2PJQA 3ONXA 3ZYLA 2CLYB 4ZI3D 2ZM2A 2Q9QA 4P0AA 5JVDE 5LHGB 4JLEA 2DNXA 2J1DG 5L3CB 2EHOB 2MTQA 3OYZA 1HG5A 3HKBE 1V9DA 4C90A 4AKRB 4PJNA 3L3PA 3U3IA 2V7LA 4EIWA 1VOMA 5LJMA 1SA0E 3RYIE 1YKHB 2V7JA 4I50E 4N78D 2LHNA 1SHZC 2VKDA 2WMNA 3FXDB 4XAXB 2LSYA 3FXEB 4CI3B 3NRXA 5LGTB 3BQLA 3C51A 4X1KE 2VKOA 2NTYA 3Q5WA 2QGSA 2N2NA 1KNZA 4H9SE 2KXPB 3IHRA 4WBOA 5FY0A 2Z6EA 4ZI2C 2Y8DA 4ANJA 4UVBB 3ETUA 3C4ZA 3UT5E 3HL6A 4TN7B 4UF0A 4YLHA 1FMVA 3T8OA 4DMWA 5LNKA 3RC8A 3ZCIA 3KBTA 3MXZA 4ERRA 5FY1A 4EZHA 4CI2B 4KP3C 3CPZA 3W15B 5J2UE 3MA9A 2QA7A 3ZMVB 4DNDA 5LBMA 3I0OA 5CA1E 3UULA 5FXVA 2JQQA 2V7MA 4PJJA 1ZHCA 2LSJA 4ZS2A 2CLYC 1LVKA 3KINB 2E9XA 4YFSA 2DLRA 4OYKA 3AB3B 3AA1B 3HKDE 1MMGA 1IZNB 2NTXA 2YU1A 4JEUB 5HXHA 4MLKA 2CXFA 2XAFB 3CKDA 1S94A 2IAKA 4X20E 1ZEEA 3HKEE 2G0UA 4H63H 3RH3A 4IE4A 2X66A 1MMDA 5L2LA 5L3FB 4CXYA 3NZPA 5HWXA 5DQWA 2VKHA 4YJ3E 1YKEB 3BQIA 2X0LB 2JMHA 3F31A 4QXBB 4NUUA 4JEHB 4XBFB 3NZQA 4HE8A 2X9WA 2H7VC 3RC3A 4OK0A 1LVFA 1WLXA 2Q9QB 4QKNA 4WBNE 3WI3A 4CI1B 2XAHB 4PFOA 3PU3A 5JDNA 5L3GB 3F57A 4ZI2D 4EXTA 3CMLA 5FXZA 2B1EA 3VKGA 2IC9A 1HG2A 4EYYR 3ZMUB 2RA1A 3N9QA 4J2CA 1MMNA 4H9PC 2W0GA 1ZV4X 3AAEB 1HFAA 4IE0A 4ZS3A 3AVSA 2LT3A 3FBZA 1QUUA 5JR9A 4MBQA 2K48A 3ZYKA 1D0XA 2WSSV 3ANWA 4ISTA 3N9PA 1QSDA 3N9LA 4Z8XA 2BVMA 4BJMA 4CXXA 2PBIA 5H6RB 5J2TE 1IAPA 2DWGA 2M67A 2WWUA 1IJ5A 4AKGA 3R84B 4KUMB 4O8SA 3NBXX 2V7IA 4UF0B 1O3XA 1EZ3A 4OFZA 5GONE 2CE7A 2E8IA 3AA7B 3UUXB 2XTLA 5TAOA 4CQIA 1H7CA 5AFUL 4QX7B 4L9IA 5IYZE 4IHJE 2WMOA 5FXWA 3N2GE 5EZYE 3N9NA 4AQGA 4IGUA 2Q9QC 3H37A 2E9XB 3V5UA 2CM0A 4UELA 2V7KA 3K8PC 2W61A 3UUNA 4O2BE 1MNEA 1UX5A 5ADXL 1B7TA 1UX4A 2C0SA 3EUHA 5LBQB 2ODUA 3OJAA 5HAXA 3PUQA 5J1GA 5HYAA 4HKAA 3SOLA 3Q2MA 3D0TA 1NAFA 3IF8B 4UEMA 3ETVA 4AKHA 3BK9A 2CXDA 4G63A 2IW5B 3U78A 1YW0A 2CEAA 4DMVA 2LOPA 3ZPOA 2DHRA 5HXEA 4AI6A 2JMKA 3LK2B 4M1PA 2KLQA 3MJXA 3KBUA 4IE5A 2UXXB 2XAQB 2A3DA 5KX5E 2BZBA 5FNVE 4TV9E 3KV4A 4HN9A 3ZC1A 4AQFC 3C4WA 2V1DB 3C64A 2VASA 3KV5A 2C5JA 3PUAA 4H63V 3QUJA 3LBXA 1MIWA 2WBLA 4O4HE 5L3DB 5JR9B 2LSIA 2KZ7B 5KMGP 5H6QB 2CWYA 2E9XC 2MYSA 3FHNA 3ANWB 3L09A 2W63A 4UVAB 3M65A 3O1IA 5FP3A 3ZCJA 2Q9QD 4YHJA 2UXNB 5BMVE 1T98A 4HGAA 3N2KE 4IE6A 3WAJA 2HPLA 1D1CA 4L5GA 1BR1A 4PFPA 4P0BA 3Q9DA 4O4JE 4OHFA 3K3OA 2EHOC 1OWAA 3CX8B 3TKLB 4YJ2E 2C5IT 5FMNA 3PURA 2LHRA 2ACXA 2X51A 4MHCA 1G73A 2YINA 3E08A 4DBQA 3A5XA 1KK7A 3I9YA 3C98B 4H9OC 5LG4A 4MALA 5L3BB 5HWYA 3ZMZB 3C4XA 4TV8E 3VKHA 3GN5A 3O9XA 3E0ZA 3O1JA 4I43B 3KVAA 3RX6A 1D0ZA 2H7OA 2Y6XA 3P7IA 2N1GA 2W62A 3LFMA 1OXZA 4IE7A 3MZKB 2D0TA 4EYUA 1G8XA 2ES0A 5CB4E 5JR9C 3FB2A 2KWIB 2LJLA 3HI2A 3KV6A 2L3LA 3ZJ1A 5LJNA 5LXTE 2YK0A 3B57A 1NWMX 3N2OA 5JRCA 4AKIA 4EB6E 2NW7A 2E9XD 1D0YA 3KVBA 3LK3B 4PNIA 4FJOA 1WRDA 3K3NA 3PE0A 3CQCB 5CA0E 4PJMA 1MIYA 4QXHB 5ETWA 3EDUA 3UFEA 5LCYA 2BVLA 4JUYA 3OYXA 4BA9A 2NOXA 3GMIA 2K9AA 2ZLYA 3PDYA 1Z0PA 4UIGA 4GK5E 5LYJE 2EHOD 3S4UA 4TZ4C 3LBXB 2XUEA 2ZM0A 4WNKA 4PJLA 2XASB 3VU7H 4ZI3C 3HKCE 2P9BA 3PTRB 5JDGA 2D2SA 1US7B 3SRZA 5HXCA 5LOVE 3QK6A 2LEHA 4UVCB 5E0OA 3MKDA 2C5KT 4UV8B 2PG8A 3DP7A 3J7Yq 1FIOA 4EOZB 4CZZB 3IEEA 2A2FX 2H3RA 4ASKA 5KDMC 5LHIB 3KV9A 1YD8G 2X67A 4AKLA 2NW8A 5JQGE 3O1HA 4L0RA 4BAYB 3I1AA 2ODVA 2IC6A 2CXLA 2X9HA 3RPUA 4GOUA 3ZYMA 1VRBA 3JC6C 4QX8B 4O2AE 4TX5A 4ZOLE 3RKOA 2VK9A 5LA6E 3PUGA 3SS1A 1LRZA 5JREA 4ISSA 5JH7E 1U5PA 3GN5B 4MFRA 1U4QA 2VKJA 2KMFA 2LSKA 4ZI7E 3CVRA 4GK0E 3FBLA 1MMAA 2YEVC 3CWZB 4H9RC 1MIVA 3CX7B 2WAUA 5HXRA 2LM9A 3DTOA 5IHYA 4PW8A 2N9DA 3O4XE 3AA6B 4B6XA 4UXNB 2LSGA 4H9QC 5A1LA 3PUSA 4DO0A 4HFVA 5JRCB 1D1BA 1UCUA 3R6NA 2KWHA 4ZHQE 5EK4A 4K0UA 4DVDA 2L9QA 3RRCA 5JDHA 2JRKA 5JDQA 5M4YA 3GWHA 5F3JA 3BQKA 3F2EA 3RRWA 1BR0A 3ESLA 2CCQA 3E22E 2NP9A 1HCIA 3CQGB 5FYMA 5FY7A 1HX8A 4PK6A 3WAKA 3ZN0B 3AA0B 3V5SA 5L3EB 2JPFA 2XAGB 4OYJA 2KINB 2X9XA 3IBPA 3HR0A 2DI4A 4BJNA 2Y48B 2JJ9A 3KFWX 2SPCA 1WR6A 2YU2A 1E1HB 2V26A 3ZC0A 4X1IE 4UV9B 1S35A 1HF8A 2OA5A 3JC6D 4G2AA 3MK7C 4GIWA 2CMRA 4F6RC 4DBRA 2CWOA 4AQFA 1FEWA 3RYCE 1HS7A 2PFVA 2D5UA 4X1YE 5HXSA 3AAAB 2HH7A 3NRYA 3UTKA 4ADZA 3J9X1 1LKXA 2KT9A 3H3AA 4GYRA 3DJBA 3AVRA 4QXCB 3ZMSB 2L8KA 4H9NC 1BR4A 4WW0A 4IDZA 4KMCA 2VB6A 1HTJF 4PK4A 2LE8A 1CUNA 2MOZA 4HEAA 2K5BB 2BDEA 3PU8A 2NW9A 2GK9A 3OBVE 2WM9A 4EZ4A 1X79A 4U74A 5DQVA 2EHOA 5EK2A 3RYHE 2DCFA 3KDSE 3CX6B 2XQYA 4XZCA 1AJ3A 1BR2A 4P09A 5LGNB 4GYSA 3Q5XA 4E7SA 3VHLA 3EDVA 1D1AA 2W00A 1WYBA 3ZN1B 3HA4A 3LJCA 2D0UA 1Y64B 3N5LA 2CA5A 2XHEB 3ZMTB 3I9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0B A;  4OYJ A;  4P09 A;  2D5U A;  4OYK A;  5LJM A;  4JUY A;  2HPJ A;  5LJN A;  2HPL A;  2CM0 A;  4P0A A;  2CCQ A; 
#chains in the Genus database with same CATH topology
 2IHR 1;  5L4H A;  2HPJ A;  3P4R A;  4LMJ A;  5JDF A;  5JDM A;  4QWN B;  5FL0 A;  1WCR A;  4V1A v;  2ZM8 A;  2NWB A;  4QHO A;  1MND A;  3P8C D;  3OKQ A;  3PJA J;  2QVA A;  3UUM A;  4PK5 A;  4EGW A;  3CQX C;  5C8Y E;  2PTF A;  4I55 E;  4EEB A;  4DUY T;  3PUV F;  2LOS A;  3ZLI A;  4LF9 T;  3RYF E;  3RIU C;  2RP4 A;  3ZJ2 A;  2X0H A;  2XAJ B;  5JDL A;  1XMO T;  4IIJ E;  3LK4 2;  2PJQ A;  3ZYL A;  4X64 T;  4QH5 A;  5JVD E;  2BS4 A;  4CN4 A;  2J1D G;  5L4E A;  2MTQ A;  1V9D A;  3PUZ F;  3L3P A;  2MAW A;  2V7J A;  3FXD B;  2LSY A;  3NRX A;  4HFH A;  1XDP A;  4X1K E;  4DV1 T;  4YXD A;  2Z6E A;  1N34 T;  2Y8D A;  3HL6 A;  4TN7 B;  4DMW A;  5LNK A;  1FMV A;  3KBT A;  5J2U E;  2BG9 A;  2QA7 A;  3ZMV B;  5LBM A;  3I0O A;  3L39 A;  1LVK A;  2XQ7 A;  2HN1 A;  3FZM B;  3CKD A;  4ZZC A;  1S94 A;  3HKE E;  2G0U A;  4H63 H;  1UUS A;  5L2L A;  5HWX A;  2VKH A;  4X62 T;  4YSX A;  2X0L B;  2JMH A;  2XSA A;  4HE8 A;  2WWV A;  3RC3 A;  4QKN A;  5ABH A;  5FXZ A;  2IC9 A;  4EYY R;  2RA1 A;  4JI2 T;  4J2C A;  4ZZB A;  3AAE B;  1HFA A;  1QUU A;  3ANW A;  1QSD A;  2BVM A;  4BJM A;  1IAP A;  2M67 A;  4JI5 T;  4IL4 A;  2CE7 A;  3NVO A;  2FJD A;  2XQ5 A;  4L9I A;  3N2G E;  3UU6 A;  4HWD A;  2ZM6 T;  4IGU A;  2HHH T;  1N36 T;  3ONL C;  2CM0 A;  1Y01 A;  2W61 A;  3UUN A;  4X65 T;  4NXN T;  1J1J A;  5LBQ B;  2V6Y A;  2ODU A;  3OJA A;  5HAX A;  3PUQ A;  3T1Y T;  5AQS B;  3UQ4 A;  4KX6 A;  4UEM A;  2VL0 A;  2CXD A;  1YW0 A;  3PUW F;  2LOP A;  3MJX A;  3KBU A;  4IE5 A;  5KX5 E;  5FNV E;  4K0K T;  3C4W A;  2V1D B;  3C64 A;  3PUA A;  4H63 V;  1N32 T;  4CN6 A;  3QUJ A;  4YSZ A;  4QH4 A;  3EI0 A;  5JR9 B;  2LSI A;  1DU2 A;  5KMG P;  2H89 A;  5H6Q B;  2CWY A;  2W63 A;  3O1I A;  5FP3 A;  4IL9 A;  2IML A;  4L5G A;  1BR1 A;  2BKP A;  4PFP A;  3FZH B;  4O4J E;  4OHF A;  3K3O A;  1NEK A;  4IT4 A;  1G73 A;  3AEA A;  3E08 A;  1W9R A;  4H9O C;  5L3B B;  3C4X A;  1CHU A;  1UK5 A;  2H7O A;  3P7I A;  1OXZ A;  2WU5 A;  4YTM A;  5JR9 C;  2KWI B;  5LXT E;  3ZJ1 A;  2VVN A;  5AQV B;  3N2O A;  3EAB A;  3P50 A;  4EB6 E;  3AE9 A;  1MIY A;  3JCF A;  4JI3 T;  5LCY A;  4JUY A;  3OYX A;  4KHP T;  3GMI A;  4ZXL A;  4GK5 E;  5ABF B;  2EHO D;  2LLY A;  2ZM0 A;  4WNK A;  4PJL A;  3VU7 H;  3HKC E;  5JDG A;  4YT0 A;  1XNQ T;  5LOV E;  2LEH A;  3MKD A;  4UV8 B;  2XQ9 A;  1FIO A;  4EOZ B;  2DL1 A;  4ASK A;  1UUR A;  2X67 A;  5JQG E;  1IBM T;  1QLB A;  5AQT B;  3PJA A;  2X9H A;  4GOU A;  4O2A E;  4TX5 A;  4ZOL E;  3RKO A;  2VK9 A;  4ILB A;  1LRZ A;  4ISS A;  4IDN A;  2KMF A;  4ZI7 E;  2YEV C;  3O4X E;  4B6X A;  2LSG A;  4CN1 A;  4A98 A;  5CFB A;  4H9Q C;  1ZP0 A;  5JRC B;  4HFV A;  2W66 A;  3RRC A;  5JDQ A;  5F3J A;  3BQK A;  3RRW A;  2CCQ A;  5FYM A;  5FY7 A;  4PK6 A;  4OYJ A;  1N33 T;  4Z90 A;  1E7P A;  4X1I E;  1T7S A;  1HF8 A;  3JC6 D;  4Z91 A;  2XQA A;  3RYC E;  1HS7 A;  2PFV A;  2HH7 A;  3G06 A;  2XQ6 A;  2KT9 A;  2L8K A;  4WW0 A;  4KMC A;  2VB6 A;  1YQ3 A;  1CUN A;  2NW9 A;  2WP9 A;  3CX6 B;  2XQY A;  3QB5 K;  3FZF B;  2MPK A;  3FZK B;  1E2A A;  1KFY A;  4AQY T;  3VHL A;  1WYB A;  3ZN1 B;  1XZY A;  3SFE A;  4A56 A;  3Q5E A;  2UUB T;  1FMW A;  4NXM T;  3TLS A;  4KHZ F;  3MAC A;  5FKY A;  2XPK A;  3K3Q C;  2X9Y A;  4U72 A;  1ZKE A;  5LGU B;  2A9U A;  3N9M A;  4CXW A;  2VL8 A;  3N9O A;  4NUV A;  3QC9 A;  2D9D A;  3EVY A;  3GA8 A;  4O4L E;  2BKN A;  5CGM A;  1OED B;  1W0A A;  3LG7 A;  5DAB A;  4TUY E;  3RKG A;  1HNW T;  4ZI3 D;  4JI8 T;  4P0A A;  2EHO B;  3HKB E;  1T72 A;  2V7L A;  1KEY A;  3RYI E;  4I50 E;  3UUB A;  1SHZ C;  4XAX B;  4CI3 B;  4DV7 T;  3FXE B;  3BQL A;  3RQW A;  2VKO A;  4A97 A;  2JQH A;  4ZI2 C;  2X0Y A;  3C4Z A;  2QRX A;  4YLH A;  3RC8 A;  3MXZ A;  3CPZ A;  3NKZ A;  3W15 B;  1OED C;  2LRL A;  1R8I A;  4DND A;  5HCM A;  2JQQ A;  5L47 A;  1ZHC A;  5IWA T;  2LSJ A;  3AB3 B;  4JI1 T;  3HKD E;  4JEU B;  2CXF A;  2XAF B;  5BR8 T;  4JBW F;  5L3F B;  4CXY A;  3NZP A;  5ABE A;  3P4S A;  4QXB B;  4NUU A;  3NZQ A;  2X9W A;  5LB7 B;  4NPP A;  2UUC T;  4WBN E;  3WI3 A;  4PFO A;  3PU3 A;  5JDN A;  5L3G B;  5LMU T;  4EXT A;  3ZT5 A;  3CML A;  4ILC A;  1MMN A;  4IE0 A;  4ZS3 A;  2V8S V;  2LT3 A;  1T8B A;  1M62 A;  1D0X A;  2WSS V;  4Z8X A;  3N9P A;  5H6R B;  4P1N A;  1IJ5 A;  4O8S A;  2V7I A;  2NR4 A;  4OFZ A;  3JAD A;  3UUX B;  5TAO A;  2BG9 B;  5IYZ E;  4QH1 A;  5EZY E;  4U2Y A;  3H37 A;  2YKS A;  2JQK A;  1NEN A;  4O2B E;  5ADX L;  1UX4 A;  2AE9 A;  2FJB A;  5J1G A;  4IRE A;  1NAF A;  3IF8 B;  4LFB T;  2IW5 B;  1SE7 A;  3ZPO A;  5HXE A;  4AI6 A;  3LK2 B;  4M1P A;  2KLQ A;  5HEH A;  2UXX B;  4TV9 E;  4HN9 A;  3ZC1 A;  4AQF C;  2BG9 C;  2VAS A;  2C5J A;  1MIW A;  2WBL A;  2V6X A;  2XY8 B;  5HEG A;  2MYS A;  3FHN A;  3ANW B;  2XSB A;  1XDO A;  4UVA B;  3M65 A;  3ZCJ A;  2V5C A;  2Q9Q D;  4YHJ A;  3RF1 A;  2HPL A;  2WQY A;  2VUR A;  4U7Y A;  4YHH T;  4YJ2 E;  2C5I T;  2LHR A;  2ACX A;  2X51 A;  3A5X A;  5LG4 A;  4MAL A;  4TV8 E;  3VKH A;  3GN5 A;  3O9X A;  4I43 B;  1D0Z A;  4DUZ T;  2Y6X A;  4IE7 A;  2V6Y B;  2VQF T;  5CB4 E;  3FB2 A;  1HR0 T;  3KV6 A;  2WZH A;  2YK0 A;  1NWM X;  2E9X D;  3KVB A;  4FJO A;  5ETW A;  3EDU A;  3UFE A;  4BA9 A;  2NOX A;  4HWF A;  4TWD A;  2K9A A;  1HX1 B;  5AQR B;  3PDY A;  2UXB T;  3S4U A;  2XUE A;  3AXJ A;  2LRK A;  2XAS B;  5FVL A;  4TWH A;  5HXC A;  4UVC B;  5E0O A;  4JI7 T;  2PG8 A;  2WZI A;  3J7Y q;  2IDO B;  5KDM C;  2CRB A;  3AE2 A;  2IC6 A;  3ZYM A;  1VRB A;  4IDO A;  2XQ8 A;  3PUG A;  3OVU A;  4MFR A;  1U4Q A;  2VKJ A;  1Z8U A;  3CVR A;  5JTG A;  2CHN A;  2R6G F;  2WAU A;  2FJE A;  3DTO A;  4PW8 A;  2J4G A;  2N9D A;  3AA6 B;  4DO0 A;  1D1B A;  3R6N A;  4ZHQ E;  5EK4 A;  3UU4 A;  1BR0 A;  4ILA A;  3E22 E;  4EED A;  2NP9 A;  2W4X A;  5L3E B;  2JPF A;  3AE8 A;  3QNU A;  3KFW X;  3PV0 F;  1WR6 A;  3TLW A;  2V26 A;  2HN2 A;  4UV9 B;  4B3M T;  1S35 A;  1L0V A;  1I6Z A;  4GIW A;  3MK7 C;  4F6R C;  3LDQ B;  1ZOY A;  2CWO A;  3RQU A;  4X1Y E;  4IDP A;  4GYR A;  3ZMS B;  3AVR A;  4IDZ A;  3JAE A;  2OV9 A;  2BBH A;  2BS3 A;  4PK4 A;  2MOZ A;  4EZ4 A;  2DCF A;  2XJ7 A;  3ABV A;  4XZC A;  1AJ3 A;  4KI0 F;  4E7S A;  2FBW A;  2FJA A;  3EDV A;  3HA4 A;  2D0U A;  1Y64 B;  5J0Z A;  1KF6 A;  2VWA A;  3I0Q A;  2CBJ A;  4U2Z A;  3CK6 A;  3RI5 A;  3B13 A;  3H3M A;  5FXX A;  4EAH A;  5LHH B;  4AXP A;  2E5V A;  2RPA A;  4FI5 A;  3JAF A;  3PUY F;  4X5T A;  4LF8 T;  4HTE A;  5DJQ C;  1IJ6 A;  2LKH A;  2K24 A;  5AQJ B;  2BS2 A;  2Q9Q A;  5LHG B;  2DNX A;  3IA3 A;  1HG5 A;  3TLU A;  4PJN A;  3U3I A;  4EIW A;  1VOM A;  1SA0 E;  4N78 D;  2M6I A;  2LHN A;  2VKD A;  4TNV A;  4EV6 A;  1YXR A;  5LGT B;  4U3C A;  3TLT A;  2NTY A;  2QGS A;  2N2N A;  1KNZ A;  4H9S E;  2KXP B;  4WBO A;  3UU5 A;  3ETU A;  4UF0 A;  3RGL A;  1XNR T;  4ERR A;  5FY1 A;  4EZH A;  4CI2 B;  4HWC A;  5C3J A;  3MA9 A;  2F4V T;  2YDR A;  5FVK A;  4AIS A;  5FXV A;  3AE4 A;  1XWM A;  2E9X A;  4YFS A;  2V5D A;  4OYK A;  3AA1 B;  5HEU A;  1MMG A;  1IZN B;  2NTX A;  2YU1 A;  5HXH A;  4MLK A;  3X1D A;  2IAK A;  4X20 E;  4LF6 T;  4IE4 A;  2X66 A;  1MMD A;  5HEO A;  5DQW A;  1YKE B;  5AQU B;  4COF A;  3BQI A;  4GKK T;  4JEH B;  4OK0 A;  3ZSS A;  3ZST A;  4CI1 B;  3F57 A;  1WR0 A;  3VKG A;  1HG2 A;  3ZMU B;  2IIU A;  3N9Q A;  2W0G A;  3AVS A;  4DV0 T;  2I0M A;  2WDQ A;  3ZYK A;  4CXX A;  4TNW A;  5J2T E;  2WWU A;  2W2U A;  3R84 B;  3NBX X;  2E8I A;  3NWI A;  1J5W A;  4JI0 T;  4DR6 T;  2WMO A;  5FXW A;  4X66 T;  2YDQ A;  5AQK B;  3N9N A;  4AQG A;  1HNX T;  2AXD S;  3V5U A;  4UEL A;  2V7K A;  3K8P C;  3EUH A;  1W0B A;  3AEB A;  2M6B A;  5HEJ A;  4HKA A;  5AQL B;  5F5W A;  3ETV A;  4DR7 T;  3BK9 A;  4LF5 T;  4G63 A;  3U78 A;  4DMV A;  2DHR A;  2I6H A;  2E5L T;  3UFG A;  3LBX A;  3B5M A;  4O4H E;  4YY3 T;  4HWI B;  2KZ7 B;  2UXN B;  5BMV E;  4HGA A;  2VQE T;  5HCJ A;  4P0B A;  3Q9D A;  2JQ9 A;  2EHO C;  3PUR A;  2YIN A;  4DBQ A;  1KK7 A;  5HWY A;  3ZMZ B;  4YSY A;  2WDR A;  3RX6 A;  2N1G A;  1VCS A;  2W62 A;  2CPT A;  2D0T A;  1G8X A;  4DR2 T;  2LJL A;  3HI2 A;  2L3L A;  4GKJ T;  3LK3 B;  3AEC A;  3OPC A;  1WRD A;  5CA0 E;  4PJM A;  4DV3 T;  4QXH B;  4DR5 T;  2BVL A;  3QOF A;  4A5X A;  2ZLY A;  3EHZ A;  4TWF A;  2JIW A;  5CJ5 A;  4UIG A;  3L8R A;  1FJG T;  3PUX F;  3PTR B;  2D2S A;  1US7 B;  4JI6 T;  2C5K T;  3DP7 A;  3VR9 A;  3IEE A;  2H3R A;  5LHI B;  4OX9 T;  4AKL A;  3O1H A;  3I1A A;  2ODV A;  1M7K A;  3JC6 C;  4QX8 B;  5LA6 E;  3SS1 A;  3AEE A;  3GN5 B;  1MMA A;  3UQ7 A;  5HXR A;  2LM9 A;  3RIU A;  4UXN B;  3PUS A;  1UCU A;  4K0U A;  4DVD A;  2L9Q A;  1OED E;  2JRK A;  5JDH A;  5M4Y A;  3GWH A;  3AE7 A;  4DR4 T;  3K1S A;  3ESL A;  1HCI A;  3CQG B;  4Q25 A;  1HX8 A;  3WAK A;  5AQQ B;  3AA0 B;  3V5S A;  2UXD T;  2XAG B;  4DV5 T;  3VRB A;  2KIN B;  2X9X A;  3IBP A;  3HR0 A;  4LFA T;  3AXJ B;  4BJN A;  3I9W A;  4B3S T;  2JJ9 A;  2SPC A;  2YU2 A;  3ZC0 A;  2OA5 A;  4G2A A;  5AQF B;  2CMR A;  2E2A A;  4DBR A;  4AQF A;  2D5U A;  2YN6 A;  4ADZ A;  3J9X 1;  3AED A;  4LF7 T;  3DJB A;  4QXC B;  4H9N C;  1IBK T;  3M3Z B;  4HEA A;  2K5B B;  2BDE A;  3P4Q A;  2GK9 A;  3RHW A;  1X79 A;  5DQV A;  4WZX A;  2VVS A;  3AE5 A;  3KDS E;  3ZT6 A;  3SFD A;  2LM2 A;  1BR2 A;  5LGN B;  2IUB A;  1YQ4 A;  4GYS A;  3ZT7 A;  3Q5X A;  3RLF F;  2CBI A;  1D1A A;  4LF4 T;  3ZMT B;  4ZI3 C;  5LP6 E;  4I4T E;  4NIQ A;  4IDQ A;  2A72 A;  1WYC A;  3ZEF B;  2X68 A;  4C91 A;  4ILU A;  2WS3 A;  5EK3 A;  4KBM B;  2KND A;  2XM1 A;  3AAI A;  4DID B;  4E7Z A;  5LG3 A;  4ZEY A;  2ZMA A;  2I59 A;  5F8P A;  2MBG A;  3SWH A;  4WYV A;  4CQI A;  4PAG A;  3C50 A;  4JV5 T;  5LMN T;  4O4I E;  4JI4 T;  2DWK A;  3ONX A;  2CLY B;  4U31 A;  2ZM2 A;  5KXJ A;  2BG9 E;  4JLE A;  1KNP A;  5L3C B;  3OYZ A;  4C90 A;  4AKR B;  1KNR A;  5LJM A;  1YKH B;  2WMN A;  2J47 A;  3C51 A;  4YTP A;  3Q5W A;  4B3T T;  3IHR A;  5FY0 A;  4ANJ A;  4UVB B;  3UU3 A;  3UT5 E;  3T8O A;  3ZCI A;  4KP3 C;  3OTO T;  2W67 A;  5CA1 E;  3UUL A;  2V7M A;  4PJJ A;  2CA5 A;  4ZS2 A;  2CLY C;  3KIN B;  2DLR A;  4HFE A;  4LML A;  2WDV A;  1JNR A;  4I0U A;  1ZEE A;  2J62 A;  3RH3 A;  2B76 A;  3EAM A;  4YJ3 E;  4HFD A;  3F31 A;  4XBF B;  5AQM B;  4LFC T;  2H7V C;  1LVF A;  1WLX A;  2Q9Q B;  3P4P A;  2XAH B;  1GQE A;  4ZI2 D;  2XM2 A;  2FUP A;  2B1E A;  5IUX A;  4H9P C;  3QB5 A;  1ZV4 X;  4DR3 T;  2WY2 A;  3FBZ A;  5JR9 A;  4MBQ A;  2K48 A;  3P4W A;  4IST A;  3N9L A;  2PBI A;  2DWG A;  4AKG A;  2XQ4 A;  4KUM B;  3LSV A;  4UF0 B;  1O3X A;  1EZ3 A;  5GON E;  1W09 A;  2QYW A;  3AA7 B;  1HNZ T;  2XTL A;  1H7C A;  5AFU L;  4UR9 A;  4QX7 B;  4IHJ E;  3A7M A;  2Q9Q C;  5AQI B;  2E9X B;  1MNE A;  1UX5 A;  1B7T A;  2C0S A;  5HYA A;  3SOL A;  3Q2M A;  4U33 A;  3D0T A;  2WU2 A;  5C2T A;  4AKH A;  4HFI A;  5AQG B;  2UXC T;  2CEA A;  4JYA T;  4DR1 T;  2JMK A;  2XAQ B;  2A3D A;  3AE3 A;  2BZB A;  4DV2 T;  4HFB A;  3KV5 A;  2XZE A;  5ABF A;  3A8Y C;  4B3R T;  1X9B A;  5L3D B;  2E9X C;  5AQO B;  3L09 A;  3ONJ A;  2CHO A;  1T98 A;  3CIR A;  3N2K E;  4IE6 A;  3WAJ A;  2K3W A;  1D1C A;  2XQ3 A;  1OWA A;  3CX8 B;  2WB5 A;  3TKL B;  4AIU A;  5FMN A;  2UUA T;  4MHC A;  3I9Y A;  3C98 B;  3E0Z A;  3O1J A;  3RIF A;  3KVA A;  3RIA A;  3LFM A;  3MZK B;  5FL1 A;  4EYU A;  1J5E T;  2ES0 A;  4U7I A;  4LMK A;  5LJN A;  1IBL T;  2OLT A;  3B57 A;  5JRC A;  4AKI A;  2NW7 A;  1D0Y A;  4PNI A;  4YTN A;  3K3N A;  3PE0 A;  5AQN B;  3CQC B;  4F8H A;  3AEF A;  4HFC A;  3T1H T;  1Z0P A;  3AE1 A;  5LYJ E;  4TZ4 C;  3LBX B;  2YDS A;  2P9B A;  3SRZ A;  3QK6 A;  2LKG A;  3FZL B;  3VR8 A;  4CZZ B;  2A2F X;  3KV9 A;  1YD8 G;  2KSR A;  2NW8 A;  4L0R A;  4BAY B;  2CXL A;  3RPU A;  2ACZ A;  5JRE A;  5JH7 E;  1U5P A;  3VRA A;  1VCT A;  2LSK A;  3TLV A;  4GK0 E;  3FBL A;  4H9R C;  3CWZ B;  1MIV A;  3CX7 B;  5IHY A;  2UU9 T;  2H88 A;  5A1L A;  1UGO A;  3AE6 A;  1SUM B;  2KWH A;  2BBJ A;  1JNZ A;  3F2E A;  3Q5D A;  1I94 T;  3ZN0 B;  4DV4 T;  2WCA A;  2DI4 A;  2Y48 B;  3UU8 A;  1E1H B;  2BKO A;  5AQH B;  1WFD A;  1FEW A;  5HXS A;  3AAA B;  3NRY A;  3UTK A;  1LKX A;  3H3A A;  4HWH A;  1BR4 A;  1OED A;  2YOE A;  1HTJ F;  2LE8 A;  3PU8 A;  3OBV E;  5ABG A;  4DV6 T;  2WM9 A;  4U74 A;  2EHO A;  5EK2 A;  3RYH E;  1XMQ T;  3AEG A;  4P09 A;  5AQP B;  2W00 A;  3LJC A;  3N5L A;  3ZKR A;  2XHE B;  3KV4 A; 
#chains in the Genus database with same CATH homology
 2VWA A;  3I0Q A;  2HPJ A;  4A56 A;  5LP6 E;  4I4T E;  5JDF A;  5JDM A;  3B13 A;  1FMW A;  2A72 A;  5FXX A;  1WYC A;  3ZEF B;  2X68 A;  4C91 A;  4ILU A;  3MAC A;  4QWN B;  5EK3 A;  4KBM B;  3K3Q C;  2KND A;  3AAI A;  4V1A v;  4E7Z A;  2ZM8 A;  4EAH A;  2NWB A;  4QHO A;  1MND A;  5LHH B;  2X9Y A;  4U72 A;  1ZKE A;  2ZMA A;  5LGU B;  3P8C D;  4AXP A;  2I59 A;  3OKQ A;  5F8P A;  2MBG A;  3N9M A;  4FI5 A;  3UUM A;  4CXW A;  3SWH A;  2VL8 A;  3N9O A;  4PK5 A;  4NUV A;  3C50 A;  4PAG A;  3QC9 A;  3CQX C;  3EVY A;  3GA8 A;  4I55 E;  4O4I E;  5C8Y E;  4O4L E;  2LOS A;  3ZLI A;  2DWK A;  3RYF E;  4HTE A;  5DJQ C;  2RP4 A;  3ZJ2 A;  1IJ6 A;  2XAJ B;  3LG7 A;  5DAB A;  2K24 A;  4TUY E;  5JDL A;  4IIJ E;  3LK4 2;  2PJQ A;  3ONX A;  3ZYL A;  2CLY B;  4ZI3 D;  2ZM2 A;  2Q9Q A;  4P0A A;  5JVD E;  5LHG B;  4JLE A;  2DNX A;  2J1D G;  5L3C B;  2EHO B;  2MTQ A;  3OYZ A;  1HG5 A;  3HKB E;  1V9D A;  4C90 A;  4AKR B;  4PJN A;  3L3P A;  3U3I A;  2V7L A;  4EIW A;  1VOM A;  5LJM A;  1SA0 E;  3RYI E;  1YKH B;  2V7J A;  4I50 E;  4N78 D;  2LHN A;  1SHZ C;  2VKD A;  2WMN A;  3FXD B;  4XAX B;  2LSY A;  3FXE B;  4CI3 B;  3NRX A;  5LGT B;  3BQL A;  3C51 A;  4X1K E;  2VKO A;  2NTY A;  3Q5W A;  2QGS A;  2N2N A;  1KNZ A;  4H9S E;  2KXP B;  3IHR A;  4WBO A;  5FY0 A;  2Z6E A;  4ZI2 C;  2Y8D A;  4ANJ A;  4UVB B;  3ETU A;  3C4Z A;  3UT5 E;  3HL6 A;  4TN7 B;  4UF0 A;  4YLH A;  1FMV A;  3T8O A;  4DMW A;  5LNK A;  3RC8 A;  3ZCI A;  3KBT A;  3MXZ A;  4ERR A;  5FY1 A;  4EZH A;  4CI2 B;  4KP3 C;  3CPZ A;  3W15 B;  5J2U E;  3MA9 A;  2QA7 A;  3ZMV B;  4DND A;  5LBM A;  3I0O A;  5CA1 E;  3UUL A;  5FXV A;  2JQQ A;  2V7M A;  4PJJ A;  1ZHC A;  2LSJ A;  4ZS2 A;  2CLY C;  1LVK A;  3KIN B;  2E9X A;  4YFS A;  2DLR A;  4OYK A;  3AB3 B;  3AA1 B;  3HKD E;  1MMG A;  1IZN B;  2NTX A;  2YU1 A;  4JEU B;  5HXH A;  4MLK A;  2CXF A;  2XAF B;  3CKD A;  1S94 A;  2IAK A;  4X20 E;  1ZEE A;  3HKE E;  2G0U A;  4H63 H;  3RH3 A;  4IE4 A;  2X66 A;  1MMD A;  5L2L A;  5L3F B;  4CXY A;  3NZP A;  5HWX A;  5DQW A;  2VKH A;  4YJ3 E;  1YKE B;  3BQI A;  2X0L B;  2JMH A;  3F31 A;  4QXB B;  4NUU A;  4JEH B;  4XBF B;  3NZQ A;  4HE8 A;  2X9W A;  2H7V C;  3RC3 A;  4OK0 A;  1LVF A;  1WLX A;  2Q9Q B;  4QKN A;  4WBN E;  3WI3 A;  4CI1 B;  2XAH B;  4PFO A;  3PU3 A;  5JDN A;  5L3G B;  3F57 A;  4ZI2 D;  4EXT A;  3CML A;  5FXZ A;  2B1E A;  3VKG A;  2IC9 A;  1HG2 A;  4EYY R;  3ZMU B;  2RA1 A;  3N9Q A;  4J2C A;  1MMN A;  4H9P C;  2W0G A;  1ZV4 X;  3AAE B;  1HFA A;  4IE0 A;  4ZS3 A;  3AVS A;  2LT3 A;  3FBZ A;  1QUU A;  5JR9 A;  4MBQ A;  2K48 A;  3ZYK A;  1D0X A;  2WSS V;  3ANW A;  4IST A;  3N9P A;  1QSD A;  3N9L A;  4Z8X A;  2BVM A;  4BJM A;  4CXX A;  2PBI A;  5H6R B;  5J2T E;  1IAP A;  2DWG A;  2M67 A;  2WWU A;  1IJ5 A;  4AKG A;  3R84 B;  4KUM B;  4O8S A;  3NBX X;  2V7I A;  4UF0 B;  1O3X A;  1EZ3 A;  4OFZ A;  5GON E;  2CE7 A;  2E8I A;  3AA7 B;  3UUX B;  2XTL A;  5TAO A;  4CQI A;  1H7C A;  5AFU L;  4QX7 B;  4L9I A;  5IYZ E;  4IHJ E;  2WMO A;  5FXW A;  3N2G E;  5EZY E;  3N9N A;  4AQG A;  4IGU A;  2Q9Q C;  3H37 A;  2E9X B;  3V5U A;  2CM0 A;  4UEL A;  2V7K A;  3K8P C;  2W61 A;  3UUN A;  4O2B E;  1MNE A;  1UX5 A;  5ADX L;  1B7T A;  1UX4 A;  2C0S A;  3EUH A;  5LBQ B;  2ODU A;  3OJA A;  5HAX A;  3PUQ A;  5J1G A;  5HYA A;  4HKA A;  3SOL A;  3Q2M A;  3D0T A;  1NAF A;  3IF8 B;  4UEM A;  3ETV A;  4AKH A;  3BK9 A;  2CXD A;  4G63 A;  2IW5 B;  3U78 A;  1YW0 A;  2CEA A;  4DMV A;  2LOP A;  3ZPO A;  2DHR A;  5HXE A;  4AI6 A;  2JMK A;  3LK2 B;  4M1P A;  2KLQ A;  3MJX A;  3KBU A;  4IE5 A;  2UXX B;  2XAQ B;  2A3D A;  5KX5 E;  2BZB A;  5FNV E;  4TV9 E;  3KV4 A;  4HN9 A;  3ZC1 A;  4AQF C;  3C4W A;  2V1D B;  3C64 A;  2VAS A;  3KV5 A;  2C5J A;  3PUA A;  4H63 V;  3QUJ A;  3LBX A;  1MIW A;  2WBL A;  4O4H E;  5L3D B;  5JR9 B;  2LSI A;  2KZ7 B;  5KMG P;  5H6Q B;  2CWY A;  2E9X C;  2MYS A;  3FHN A;  3ANW B;  3L09 A;  2W63 A;  4UVA B;  3M65 A;  3O1I A;  5FP3 A;  3ZCJ A;  2Q9Q D;  4YHJ A;  2UXN B;  5BMV E;  1T98 A;  4HGA A;  3N2K E;  4IE6 A;  3WAJ A;  2HPL A;  1D1C A;  4L5G A;  1BR1 A;  4PFP A;  4P0B A;  3Q9D A;  4O4J E;  4OHF A;  3K3O A;  2EHO C;  1OWA A;  3CX8 B;  3TKL B;  4YJ2 E;  2C5I T;  5FMN A;  3PUR A;  2LHR A;  2ACX A;  2X51 A;  4MHC A;  1G73 A;  2YIN A;  3E08 A;  4DBQ A;  3A5X A;  1KK7 A;  3I9Y A;  3C98 B;  4H9O C;  5LG4 A;  4MAL A;  5L3B B;  5HWY A;  3ZMZ B;  3C4X A;  4TV8 E;  3VKH A;  3GN5 A;  3O9X A;  3E0Z A;  3O1J A;  4I43 B;  3KVA A;  3RX6 A;  1D0Z A;  2H7O A;  2Y6X A;  3P7I A;  2N1G A;  2W62 A;  3LFM A;  1OXZ A;  4IE7 A;  3MZK B;  2D0T A;  4EYU A;  1G8X A;  2ES0 A;  5CB4 E;  5JR9 C;  3FB2 A;  2KWI B;  2LJL A;  3HI2 A;  3KV6 A;  2L3L A;  3ZJ1 A;  5LJN A;  5LXT E;  2YK0 A;  3B57 A;  1NWM X;  3N2O A;  5JRC A;  4AKI A;  4EB6 E;  2NW7 A;  2E9X D;  1D0Y A;  3KVB A;  3LK3 B;  4PNI A;  4FJO A;  1WRD A;  3K3N A;  3PE0 A;  3CQC B;  5CA0 E;  4PJM A;  1MIY A;  4QXH B;  5ETW A;  3EDU A;  3UFE A;  5LCY A;  2BVL A;  4JUY A;  3OYX A;  4BA9 A;  2NOX A;  3GMI A;  2K9A A;  2ZLY A;  3PDY A;  1Z0P A;  4UIG A;  4GK5 E;  5LYJ E;  2EHO D;  3S4U A;  4TZ4 C;  3LBX B;  2XUE A;  2ZM0 A;  4WNK A;  4PJL A;  2XAS B;  3VU7 H;  4ZI3 C;  3HKC E;  2P9B A;  3PTR B;  5JDG A;  2D2S A;  1US7 B;  3SRZ A;  5HXC A;  5LOV E;  3QK6 A;  2LEH A;  4UVC B;  5E0O A;  3MKD A;  2C5K T;  4UV8 B;  2PG8 A;  3DP7 A;  3J7Y q;  1FIO A;  4EOZ B;  4CZZ B;  3IEE A;  2A2F X;  2H3R A;  4ASK A;  5KDM C;  5LHI B;  3KV9 A;  1YD8 G;  2X67 A;  4AKL A;  2NW8 A;  5JQG E;  3O1H A;  4L0R A;  4BAY B;  3I1A A;  2ODV A;  2IC6 A;  2CXL A;  2X9H A;  3RPU A;  4GOU A;  3ZYM A;  1VRB A;  3JC6 C;  4QX8 B;  4O2A E;  4TX5 A;  4ZOL E;  3RKO A;  2VK9 A;  5LA6 E;  3PUG A;  3SS1 A;  1LRZ A;  5JRE A;  4ISS A;  5JH7 E;  1U5P A;  3GN5 B;  4MFR A;  1U4Q A;  2VKJ A;  2KMF A;  2LSK A;  4ZI7 E;  3CVR A;  4GK0 E;  3FBL A;  1MMA A;  2YEV C;  3CWZ B;  4H9R C;  1MIV A;  3CX7 B;  2WAU A;  5HXR A;  2LM9 A;  3DTO A;  5IHY A;  4PW8 A;  2N9D A;  3O4X E;  3AA6 B;  4B6X A;  4UXN B;  2LSG A;  4H9Q C;  5A1L A;  3PUS A;  4DO0 A;  4HFV A;  5JRC B;  1D1B A;  1UCU A;  3R6N A;  2KWH A;  4ZHQ E;  5EK4 A;  4K0U A;  4DVD A;  2L9Q A;  3RRC A;  5JDH A;  2JRK A;  5JDQ A;  5M4Y A;  3GWH A;  5F3J A;  3BQK A;  3F2E A;  3RRW A;  1BR0 A;  3ESL A;  2CCQ A;  3E22 E;  2NP9 A;  1HCI A;  3CQG B;  5FYM A;  5FY7 A;  1HX8 A;  4PK6 A;  3WAK A;  3ZN0 B;  3AA0 B;  3V5S A;  5L3E B;  2JPF A;  2XAG B;  4OYJ A;  2KIN B;  2X9X A;  3IBP A;  3HR0 A;  2DI4 A;  4BJN A;  2Y48 B;  2JJ9 A;  3KFW X;  2SPC A;  1WR6 A;  2YU2 A;  1E1H B;  2V26 A;  3ZC0 A;  4X1I E;  4UV9 B;  1S35 A;  1HF8 A;  2OA5 A;  3JC6 D;  4G2A A;  3MK7 C;  4GIW A;  2CMR A;  4F6R C;  4DBR A;  2CWO A;  4AQF A;  1FEW A;  3RYC E;  1HS7 A;  2PFV A;  2D5U A;  4X1Y E;  5HXS A;  3AAA B;  2HH7 A;  3NRY A;  3UTK A;  4ADZ A;  3J9X 1;  1LKX A;  2KT9 A;  3H3A A;  4GYR A;  3DJB A;  3AVR A;  4QXC B;  3ZMS B;  2L8K A;  4H9N C;  1BR4 A;  4WW0 A;  4IDZ A;  4KMC A;  2VB6 A;  1HTJ F;  4PK4 A;  2LE8 A;  1CUN A;  2MOZ A;  4HEA A;  2K5B B;  2BDE A;  3PU8 A;  2NW9 A;  2GK9 A;  3OBV E;  2WM9 A;  4EZ4 A;  1X79 A;  4U74 A;  5DQV A;  2EHO A;  5EK2 A;  3RYH E;  2DCF A;  3KDS E;  3CX6 B;  2XQY A;  4XZC A;  1AJ3 A;  1BR2 A;  4P09 A;  5LGN B;  4GYS A;  3Q5X A;  4E7S A;  3VHL A;  3EDV A;  1D1A A;  2W00 A;  1WYB A;  3ZN1 B;  3HA4 A;  3LJC A;  2D0U A;  1Y64 B;  3N5L A;  2CA5 A;  2XHE B;  3ZMT B;  3I9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...