2CM0A

The pub domain functions as a p97 binding module in human peptide n-glycanase.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
GSASPAVAELCQNTPETFLEASKLLLTYADAILRNPNDEAARSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Pub Domain Functions as a P97 Binding Module in Human Peptide N-Glycanase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PEPTIDE N-GLYCANASE HOMOLOG
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cm0A00
5LJMA 2CM0A 4OYKA 4P0BA 4P0AA 4P09A 4JUYA 2HPJA 2D5UA 2CCQA 5LJNA 4OYJA 2HPLA
chains in the Genus database with same CATH superfamily
1B7TA 3AE3A 2E2AA 4B3ST 1N32T 1VCSA 2KINB 4O4LE 2Q9QB 1ZHCA 4HGAA 2VVNA 3LK42 3M65A 4O8SA 1M7KA 2ZMAA 4Z90A 3NZQA 3SFEA 1J1JA 5FL1A 4L0RA 4LMKA 4DR1T 2XAFB 4HFBA 2CBJA 5JQGE 4CI2B 1QUUA 2LSIA 1HCIA 4H9OC 1FEWA 2IAKA 1EZ3A 1E7PA 2X68A 3CX8B 3Q2MA 4YFSA 5EZYE 2ZM6T 2XAJB 5JDGA 3MACA 2RPAA 3H3AA 2R6GF 1IAPA 4Q25A 1HF8A 2XQ5A 3AE5A 3JAEA 2IW5B 4CXWA 4DV5T 4LF7T 2V26A 1BR0A 2K5BB 2XAQB 3E22E 3AA0B 3SFDA 1NENA 2DLRA 2DL1A 3EVYA 4HWIB 4X1IE 3CQGB 1VCTA 1UK5A 1SHZC 1Z0PA 4WW0A 4H9PC 2M6IA 1OEDC 2Y48B 3O9XA 4Z8XA 1X79A 3NWIA 3OPCA 2CA5A 4E7SA 2BKNA 2MAWA 3UTKA 2PG8A 3G06A 1D0XA 2BG9A 2YDRA 4I4TE 3VR8A 3ZMVB 4EIWA 2B76A 3ZCIA 5M4YA 3TKLB 2XASB 4EZHA 5ABGA 4YT0A 4AKIA 2LKHA 3ONLC 4IDZA 4KUMB 5DJQC 2YU1A 3B57A 3TLWA 5L47A 2FJDA 2E9XA 4EGWA 1XNRT 2WDQA 4B3RT 2J4GA 1WLXA 1MIYA 3UQ7A 3MXZA 4OX9T 3DP7A 4LF6T 4UVAB 3R6NA 1S94A 3ZT6A 2V5CA 3MKDA 3AE2A 4QXCB 3LBXA 2Y8DA 1NEKA 2W67A 3AEEA 1H7CA 3HKBE 3Q5EA 2X66A 3UU8A 5JDHA 1JNRA 2ODUA 2Z6EA 2ZLYA 3AAAB 3J7Yq 2UUCT 4DV4T 5JRCB 2RA1A 4PNIA 5CFBA 1SE7A 2XUEA 3CWZB 4L9IA 4UR9A 4AKGA 2OV9A 1N34T 4QH5A 4OFZA 5L2LA 1KNPA 4F8HA 3P50A 3SRZA 5HXRA 5HXEA 2NW7A 3PUXF 2N9DA 1WRDA 3AEBA 5BMVE 4DR4T 3KDSE 1MMAA 3NRXA 1UURA 4NUVA 3N9MA 3U78A 2FJAA 2PBIA 2H88A 2H7OA 5HCJA 5AQTB 3ZYLA 4EEDA 2XQ8A 5C8YE 4K0UA 3BQLA 2E9XC 4GIWA 3P4RA 5HEGA 3UU3A 4YY3T 2UUAT 2C0SA 2CXLA 2XTLA 3EDVA 3PUVF 2IUBA 4ZZBA 1R8IA 5AQHB 4CQIA 4NXNT 2XM2A 5JTGA 2V6YA 3F57A 3AEAA 2BKOA 2LM2A 5IHYA 4HE8A 1HNZT 2XQ6A 3LDQB 2NWBA 3AE8A 3P4QA 3PUSA 3FBZA 2X0LB 4DVDA 1OXZA 3ZKRA 1OEDA 2CBIA 3NRYA 3ONXA 2V6XA 1YQ3A 1V9DA 1YW0A 4HFHA 5J2TE 3EI0A 2WWUA 1T8BA 4WBNE 2A2FX 2HH7A 4JYAT 4FI5A 2C5KT 3AEGA 3RKOA 1ZP0A 2QA7A 5LGTB 3EABA 2CLYC 3JADA 1LVKA 4U31A 2NW8A 5FMNA 2VURA 4XZCA 2DNXA 2UXBT 2X9HA 3GA8A 3E08A 5KMGP 2H7VC 3PU8A 2YEVC 3M3ZB 2KT9A 3GN5B 2IMLA 3CMLA 4PK5A 3SOLA 4LFCT 3KVAA 4CN6A 3VRBA 1U4QA 5DABA 1XDOA 2K9AA 3WAJA 4UF0A 2JQ9A 1MMNA 1VRBA 2BZBA 2DWGA 4EYYR 4X1KE 5FXVA 3EHZA 4KP3C 4GK0E 2VK9A 4QHOA 3O1IA 2D0TA 4UV8B 4DV1T 4NIQA 4IDQA 4CN1A 2DI4A 1IJ5A 2CLYB 4AQFA 3QC9A 2V7LA 3N9OA 3NBXX 4O4JE 5EK3A 4CXYA 2LRLA 2DHRA 3K8PC 4DV3T 1YQ4A 5LG4A 3Q5WA 3UT5E 2Q9QC 2CEAA 3IF8B 2VVSA 3AE9A 4ZI3D 4B3TT 3HL6A 5HWYA 1D0ZA 3ZN1B 2L9QA 3CVRA 4BA9A 2X67A 4DO0A 4X65T 5FYMA 4X66T 2WMOA 2WB5A 3RPUA 1HNWT 3KINB 2HPJA 1QSDA 2IIUA 2LLYA 3AAIA 3ETUA 3HR0A 5A1LA 2WM9A 3QB5A 4KHZF 3FZHB 5ABEA 4JV5T 2FBWA 4U2ZA 5LA6E 5LHHB 4TUYE 3PJAA 4EZ4A 4C91A 3GMIA 3LBXB 3NZPA 4AQFC 2UXDT 4YSXA 3KBUA 2MOZA 5JR9C 3ZSTA 4IE6A 3C4XA 3AA7B 1O3XA 4IE0A 4YJ2E 5AQFB 2FJBA 5FY0A 1IZNB 4IE5A 4LF8T 2B1EA 2UUBT 2E9XB 4QWNB 3P4WA 4YTMA 1SA0E 2V8SV 4JI0T 1KF6A 3RIUA 1XZYA 4G2AA 5HCMA 2VWAA 3T1YT 1I6ZA 2X0HA 4GOUA 5CJ5A 5JREA 2N2NA 3ABVA 3P7IA 3UU6A 4ZI7E 1IBLT 4U72A 2WQYA 2LRKA 5AQIB 5L3FB 4TV8E 4PJNA 2ODVA 2XHEB 2QGSA 4HFEA 3AAEB 2BBHA 4YXDA 2KXPB 2VKOA 2D2SA 1LVFA 2CE7A 4CI3B 1LKXA 2H3RA 2Y6XA 3L09A 2IC9A 4NUUA 2V5DA 5TAOA 4HWCA 1CUNA 3N9PA 1HX1B 4ZZCA 1WYCA 1FMVA 2N1GA 4WBOA 4MHCA 4DV7T 3PUWF 2W4XA 4ZHQE 2WU5A 3PU3A 4ZI2D 4LF9T 5FKYA 2EHOA 5ADXL 4U2YA 4GK5E 2D0UA 1OEDE 2H89A 4AKLA 4Z91A 4O2AE 2CCQA 2X9XA 3Q9DA 4JBWF 1LRZA 4LF5T 4IL4A 4HFIA 1UUSA 1E2AA 2LOSA 3BQIA 1U5PA 3PURA 3PV0F 4HKAA 2M6BA 1XDPA 3C4WA 3EDUA 4GYSA 3IA3A 3RC8A 3P4SA 3A5XA 4YTNA 1HFAA 5L3CB 3CQCB 4QXBB 2XZEA 3HKEE 4DUYT 4JLEA 5JDNA 1WR0A 2ZM8A 4KBMB 4DBQA 1WR6A 3RH3A 1Y01A 3AE1A 2NP9A 4HFDA 2JIWA 4YHJA 2JQHA 2VASA 3RIFA 3V5UA 4U7IA 4YHHT 5JDFA 3FXEB 4E7ZA 4HEAA 1IBKT 2JQQA 3T8OA 3ZMSB 4QH4A 1MIVA 3L8RA 4LF4T 1KNRA 3RGLA 3K3NA 4ZOLE 2F4VT 2D9DA 5C3JA 3K3OA 3CX6B 4PJMA 2P9BA 5LMNT 3FB2A 3MZKB 2I6HA 4DV6T 2MYSA 2WDVA 3FZKB 1G8XA 2W2UA 2KNDA 3QK6A 1WFDA 2JMHA 4MLKA 4HFVA 4QH1A 3ONJA 4O4HE 4TWDA 5FY7A 3AVSA 2YDQA 4PAGA 3DJBA 2W62A 2UXNB 4TV9E 2W66A 3AECA 3OJAA 3C50A 5AQNB 2HN2A 4ILCA 1E1HB 2EHOD 3X1DA 4U3CA 1HR0T 2W61A 2CHNA 1W9RA 4OYJA 3PUZF 2HHHT 3AEFA 3K3QC 3OVUA 2OLTA 4AQYT 5GONE 3MJXA 3OKQA 2LSJA 2ES0A 2PJQA 2X9YA 4U33A 3FZFB 2J62A 2NOXA 1S35A 4WNKA 2YDSA 2JRKA 3D0TA 3QNUA 3I9YA 3UUNA 4I55E 3KV6A 5J2UE 5HEOA 5LGNB 1FIOA 2V7JA 2AE9A 2W63A 5L3BB 1FMWA 2WZHA 3VRAA 2XM1A 5KDMC 2LE8A 3WAKA 4ERRA 4DR5T 4H63V 3JC6C 4IE4A 2C5JA 4ASKA 3JAFA 3ZMTB 4EXTA 3UU4A 5LXTE 5LYJE 1N33T 2BBJA 2VL8A 2LM9A 2WZIA 3SS1A 2J47A 3BK9A 3I0OA 2DCFA 2G0UA 3UULA 4AISA 4AQGA 5LMUT 3ZT7A 5JH7E 4ANJA 3Q5DA 5LHIB 3IHRA 1HG5A 5AQUB 3UFEA 4MFRA 2JMKA 4UV9B 5L3EB 4IREA 2WY2A 3TLTA 1XWMA 1MMDA 4YTPA 1D0YA 1XMQT 3UFGA 3C64A 2YN6A 4DR6T 2EHOB 1M62A 2XSAA 5FXXA 1YD8G 4HWFA 1IBMT 3N2GE 2BS4A 3UUXB 3UU5A 4HN9A 2WSSV 4OK0A 5JDQA 2CWYA 3IBPA 3CQXC 5DQVA 2KMFA 3RC3A 5LBQB 2LHRA 3RX6A 3K1SA 4EOZB 3AB3B 5L3GB 1NWMX 5E0OA 3RRWA 1UX5A 3ZLIA 2XQ3A 1AJ3A 2ACXA 3QUJA 3J9X1 4ZEYA 4AXPA 3LSVA 3NKZA 4TWFA 2JPFA 3KV4A 5L3DB 2K24A 5FY1A 2LT3A 1ZEEA 5J0ZA 1W09A 5BR8T 2RP4A 3LJCA 1XMOT 2LOPA 3ZPOA 5LGUB 4LFBT 3ANWA 2WP9A 4CN4A 5ETWA 1ZOYA 2QYWA 2XQ7A 4QX7B 5AQGB 1WCRA 2NR4A 4BJMA 1I94T 4C90A 4B3MT 2ACZA 3FZLB 5IYZE 3PUGA 3W15B 2BS3A 2WBLA 2KLQA 3VU7H 5HXHA 2KWHA 5LG3A 4PK4A 2IDOB 4DIDB 2UU9T 2LEHA 3RKGA 2CMRA 3S4UA 3PJAJ 2C5IT 2VKDA 1W0BA 3PDYA 4I43B 4JI5T 5LJNA 4JI1T 3N2KE 3RRCA 4DR2T 4YLHA 4DMVA 2BVLA 3ZC0A 2BKPA 2LSGA 4XAXB 2I0MA 1UCUA 4X5TA 4JI3T 2WDRA 3ZC1A 4JI4T 2KSRA 3N9LA 1BR1A 1D1AA 2X51A 4ZXLA 3N2OA 4P1NA 1T7SA 3PUAA 4ISTA 3AEDA 2L3LA 2CM0A 3KV5A 3ZJ1A 5AFUL 3OYZA 4TZ4C 5FP3A 3KFWX 1J5WA 1UGOA 3LG7A 3RQWA 2D5UA 4H9RC 4PW8A 3RLFF 1L0VA 4B6XA 3A7MA 1YKEB 1G73A 2KZ7B 2NTYA 2YINA 5H6RB 4GYRA 5HYAA 2VQFT 1FJGT 3AA1B 2WCAA 2HN1A 3N9NA 5HWXA 1ZV4X 4AKRB 4EB6E 1IJ6A 4YSZA 2LJLA 3JCFA 2MBGA 3I0QA 4TNVA 4U74A 5AQMB 3UQ4A 5IUXA 4LFAT 2YKSA 3CK6A 4UF0B 2VB6A 3UUMA 2XAHB 4EAHA 5EK2A 5AQJB 4QX8B 4I0UA 3GN5A 2WAUA 2BDEA 3HA4A 2BG9C 2PFVA 3B13A 4G63A 2PTFA 2XQ4A 2MTQA 2YU2A 3RYCE 5HXSA 2FJEA 3E0ZA 4X20E 3HKCE 5AQPB 4ILAA 5F5WA 2XAGB 4PJJA 3ZJ2A 4NXMT 3ZN0B 1CHUA 1HX8A 4IDPA 4NPPA 3HKDE 4YSYA 3PE0A 3CX7B 4H63H 4P0BA 3Q5XA 5AQSB 3RI5A 2GK9A 2AXDS 3DTOA 1Z8UA 2L8KA 2WMNA 3QB5K 3EAMA 4EYUA 5FNVE 5KXJA 5LOVE 3B5MA 3RIAA 1OEDB 1T98A 1NAFA 3N5LA 1XNQT 1HS7A 3PTRB 3TLUA 3F31A 4ISSA 4DUZT 4DBRA 2XJ7A 5FXWA 2CWOA 4JEUB 1MIWA 3C98B 4ZS3A 1KEYA 2V6YB 1W0AA 2SPCA 2V7KA 4J2CA 4PJLA 1X9BA 4UEMA 4K0KT 2KWIB 3ZYKA 3OTOT 2BS2A 2ZM2A 3RIUC 3TLVA 4KMCA 4DR3T 4DV2T 2E9XD 3L39A 5LP6E 3FHNA 5IWAT 4PK6A 3I9WA 1UX4A 5HAXA 4ZI2C 4ZI3C 2XPKA 4WYVA 4TWHA 2W0GA 4CI1B 3VHLA 5JDLA 2CXFA 2IHR1 3LFMA 4X62T 1N36T 1DU2A 2NW9A 2A72A 3V5SA 3RF1A 4EEBA 5LBMA 4IL9A 5KX5E 3CKDA 3C4ZA 2XQAA 4A97A 5FVLA 2CPTA 2WS3A 4H9QC 2E5LT 4JI6T 2IC6A 2V7IA 4MALA 2MPKA 4UELA 5AQVB 3RYIE 4V1Av 3RQUA 4COFA 1D1BA 4JI8T 3IEEA 5F8PA 3R84B 5JRCA 3FXDB 4IT4A 2EHOC 3BQKA 2M67A 2XQYA 3H3MA 3GWHA 4JUYA 3ZEFB 2V1DB 3I1AA 3PUYF 5LJMA 4KHPT 5AQQB 3AA6B 4DR7T 1MNEA 1JNZA 3O1JA 4M1PA 5HEUA 3RHWA 3ZSSA 4DNDA 4IDOA 4AI6A 2YK0A 1SUMB 3ETVA 3AE4A 4MBQA 3ANWB 3O4XE 3UUBA 5JDMA 2JQKA 3CIRA 2X9WA 3C51A 1OWAA 2UXCT 2CHOA 3F2EA 1D1CA 2BG9B 3AE7A 2CRBA 4H9NC 4UVCB 4QKNA 3OBVE 4YJ3E 1T72A 4X1YE 2LSKA 5AQOB 4JEHB 3O1HA 4P09A 5AQKB 5LHGB 4O4IE 1QLBA 2WU2A 4JI2T 3P4PA 4ADZA 5FL0A 2A9UA 2LSYA 4TNWA 3FBLA 3CPZA 3LK2B 1US7B 3EUHA 4IE7A 5HXCA 2FUPA 5CB4E 3VR9A 5ABHA 2BVMA 4HFCA 3ZCJA 1KFYA 2I59A 4I50E 1Y64B 5AQLB 3RYHE 3ZMUB 4JI7T 3ESLA 4QXHB 2BG9E 4X64T 2UXXB 2NTXA 1HNXT 1ZKEA 5LNKA 1BR2A 4L5GA 4A56A 2XSBA 4OYKA 3ZT5A 3AVRA 3KV9A 1MNDA 4A98A 2VKHA 4ILBA 2X0YA 4WZXA 1YXRA 2V7MA 2A3DA 2QRXA 2XY8B 3MA9A 4FJOA 5LB7B 4DMWA 3JC6D 4UXNB 4EV6A 4XBFB 2Q9QA 2OA5A 4A5XA 3VKGA 2JJ9A 1MMGA 3N9QA 3ZYMA 5HEJA 4TX5A 2VKJA 2J1DG 2XQ9A 5J1GA 3P8CD 1GQEA 3U3IA 5H6QB 3KVBA 5JVDE 2Q9QD 5DQWA 5HEHA 3ZMZB 2DWKA 4H9SE 2W00A 5L4HA 2ZM0A 4UVBB 4KI0F 5FVKA 4AIUA 4ZS2A 4DV0T 5JR9A 3H37A 3KBTA 1KNZA 4IGUA 3NVOA 3SWHA 4ILUA 4AKHA 4BAYB 1VOMA 4KX6A 4CXXA 1J5ET 4HWHA 4LMJA 2LHNA 2K3WA 3QOFA 4HWDA 5ABFB 2HPLA 1HTJF 3AXJB 3MK7C 3TLSA 5LCYA 2QVAA 2E5VA 4P0AA 3VKHA 1BR4A 3OYXA 3LK3B 3RYFE 4N78D 3AXJA 3FZMB 5ABFA 1WYBA 2CXDA 3A8YC 3HI2A 4O2BE 4TN7B 5AQRB 5F3JA 2VQET 4PFOA 5EK4A 4GKJT 5CGMA 3T1HT 1HG2A 2E8IA 4IHJE 4IIJE 4U7YA 5FXZA 2WWVA 3PUQA 4HTEA 3WI3A 4CZZB 1YKHB 5CA0E 5CA1E 5JR9B 1KK7A 5C2TA 3L3PA 4BJNA 4OHFA 4F6RC 2K48A 2YOEA 2LKGA 2VL0A 3AE6A 4IDNA 4GKKT 4LMLA 4PFPA 4UIGA 5L4EA
chains in the Genus database with same CATH topology
1B7TA 4O4LE 2KINB 2Q9QB 1ZHCA 4HGAA 4O8SA 3LK42 3M65A 3ZYLA 2ZMAA 3NZQA 4L0RA 2XAFB 5JQGE 4CI2B 1QUUA 2LSIA 1HCIA 4H9OC 1FEWA 2IAKA 1EZ3A 2X68A 3Q2MA 3CX8B 4YFSA 5EZYE 2XAJB 5JDGA 3MACA 3H3AA 1IAPA 1HF8A 2IW5B 4CXWA 2V26A 1BR0A 2K5BB 2XAQB 3E22E 3AA0B 3EVYA 2DLRA 4X1IE 3CQGB 1SHZC 1Z0PA 4WW0A 4H9PC 2Y48B 3O9XA 4Z8XA 1X79A 2CA5A 4E7SA 3UTKA 2PG8A 1D0XA 4I4TE 4EIWA 3ZMVB 3ZCIA 5M4YA 3TKLB 2XASB 4EZHA 4AKIA 4IDZA 4KUMB 5DJQC 2YU1A 3B57A 2E9XA 1WLXA 1MIYA 3MXZA 3DP7A 4UVAB 3R6NA 1S94A 3MKDA 4QXCB 3LBXA 2Y8DA 1H7CA 3HKBE 2X66A 5JDHA 3J7Yq 2ODUA 3AAAB 2Z6EA 2ZLYA 4AKHA 5JRCB 2RA1A 4PNIA 2XUEA 3CWZB 4L9IA 4OFZA 5L2LA 3SRZA 5HXRA 5HXEA 2NW7A 2N9DA 1WRDA 5BMVE 3KDSE 1MMAA 3NRXA 4NUVA 3U78A 3N9MA 4AKGA 2PBIA 2H7OA 5C8YE 4K0UA 3BQLA 2E9XC 4GIWA 2C0SA 2CXLA 2XTLA 3EDVA 4CQIA 3F57A 5IHYA 4HE8A 2NWBA 3PUSA 3FBZA 2X0LB 4DVDA 1OXZA 3NRYA 3ONXA 1V9DA 1YW0A 5J2TE 2WWUA 4WBNE 2A2FX 2HH7A 4FI5A 2C5KT 3RKOA 2QA7A 5LGTB 2CLYC 1LVKA 5FMNA 2NW8A 4XZCA 2DNXA 2X9HA 3GA8A 3E08A 5KMGP 2H7VC 3PU8A 2YEVC 2KT9A 3GN5B 3CMLA 4PK5A 3SOLA 3KVAA 1U4QA 5DABA 2K9AA 3WAJA 4UF0A 1MMNA 1VRBA 2BZBA 2DWGA 4EYYR 4X1KE 5FXVA 4KP3C 4GK0E 2VK9A 4QHOA 3O1IA 2D0TA 4UV8B 2DI4A 1IJ5A 2CLYB 4AQFA 3QC9A 2V7LA 3N9OA 3NBXX 4O4JE 5EK3A 4CXYA 2DHRA 3K8PC 5LG4A 3Q5WA 3UT5E 2Q9QC 2CEAA 3IF8B 4ZI3D 3HL6A 5HWYA 1D0ZA 3ZN1B 2L9QA 3CVRA 4BA9A 2X67A 4DO0A 5FYMA 2WMOA 3RPUA 3KINB 2HPJA 1QSDA 3ETUA 3AAIA 3HR0A 5A1LA 2WM9A 5LA6E 5LHHB 4TUYE 4EZ4A 4C91A 3GMIA 3LBXB 3NZPA 4AQFC 3KBUA 2MOZA 5JR9C 4IE6A 3C4XA 3AA7B 1O3XA 4IE0A 4YJ2E 5FY0A 1IZNB 4IE5A 2B1EA 2E9XB 4QWNB 1SA0E 4G2AA 2VWAA 4GOUA 5JREA 2N2NA 3P7IA 4ZI7E 4U72A 5L3FB 4TV8E 4PJNA 2ODVA 2XHEB 2QGSA 3AAEB 2KXPB 2VKOA 2D2SA 1LVFA 2CE7A 4CI3B 1LKXA 2H3RA 2Y6XA 3L09A 2IC9A 4NUUA 5TAOA 1CUNA 3N9PA 1WYCA 1FMVA 2N1GA 4WBOA 4MHCA 4ZHQE 3PU3A 4ZI2D 2EHOA 4GK5E 2D0UA 4AKLA 4O2AE 2CCQA 2X9XA 3Q9DA 1LRZA 2LOSA 3PURA 3BQIA 1U5PA 4HKAA 3C4WA 3EDUA 4GYSA 3RC8A 3A5XA 1HFAA 5L3CB 3CQCB 4QXBB 3HKEE 4JLEA 2ZM8A 4KBMB 4DBQA 1WR6A 3RH3A 2NP9A 4YHJA 2VASA 3V5UA 5JDFA 3FXEB 4HEAA 2JQQA 3T8OA 3ZMSB 1MIVA 3K3NA 4ZOLE 3K3OA 3CX6B 4PJMA 2P9BA 3FB2A 3MZKB 2MYSA 1G8XA 2KNDA 3QK6A 2JMHA 4MLKA 4HFVA 3ZJ1A 5FY7A 4O4HE 5LP6E 3AVSA 4TV9E 4PAGA 3DJBA 2W62A 2UXNB 4E7ZA 3OJAA 3C50A 1E1HB 2EHOD 2W61A 4OYJA 3K3QC 5GONE 3MJXA 3OKQA 2LSJA 2ES0A 2PJQA 2X9YA 2NOXA 1S35A 4WNKA 2JRKA 3D0TA 3I9YA 3UUNA 4I55E 3KV6A 5J2UE 5LGNB 1FIOA 2V7JA 2W63A 5L3BB 1FMWA 5KDMC 2LE8A 3WAKA 4ERRA 4H63V 3JC6C 4IE4A 2C5JA 4ASKA 4EXTA 3ZMTB 5LXTE 5LYJE 2VL8A 2LM9A 3SS1A 5LHIB 3BK9A 3I0OA 3UULA 2DCFA 2G0UA 4AQGA 5JH7E 4ANJA 3IHRA 1HG5A 3UFEA 4MFRA 2JMKA 4UV9B 5L3EB 1MMDA 1D0YA 3C64A 2EHOB 5FXXA 1YD8G 3N2GE 3UUXB 4HN9A 2WSSV 4OK0A 5JDQA 2CWYA 3IBPA 3CQXC 5DQVA 2KMFA 3RC3A 5LBQB 2LHRA 3RX6A 4EOZB 5L3GB 3AB3B 1NWMX 5E0OA 3RRWA 1UX5A 3ZLIA 1AJ3A 2ACXA 3QUJA 3J9X1 4AXPA 2JPFA 3KV4A 5L3DB 2K24A 5FY1A 2LT3A 1ZEEA 2RP4A 3LJCA 2LOPA 3ZPOA 5LGUB 3ANWA 5ETWA 4QX7B 4BJMA 4C90A 5IYZE 3PUGA 3W15B 2WBLA 2KLQA 3VU7H 5HXHA 2KWHA 4PK4A 2LEHA 2CMRA 3S4UA 2C5IT 2VKDA 5LJNA 3PDYA 4I43B 3N2KE 3RRCA 4YLHA 4DMVA 2BVLA 3ZC0A 2LSGA 4XAXB 1UCUA 3ZC1A 3N9LA 1BR1A 1D1AA 2X51A 3N2OA 3PUAA 4ISTA 2L3LA 2CM0A 3KV5A 5AFUL 3OYZA 4TZ4C 5FP3A 3KFWX 3LG7A 2D5UA 4H9RC 4PW8A 4B6XA 1YKEB 1G73A 2KZ7B 2NTYA 2YINA 5H6RB 4GYRA 5HYAA 3AA1B 3N9NA 5HWXA 1ZV4X 4AKRB 4EB6E 1IJ6A 2LJLA 2MBGA 3I0QA 4U74A 4UF0B 2VB6A 3UUMA 2XAHB 4EAHA 5EK2A 4QX8B 3GN5A 3HA4A 2BDEA 2WAUA 5HXSA 2PFVA 3B13A 4G63A 3RYCE 2MTQA 2YU2A 3E0ZA 4X20E 3HKCE 2XAGB 4PJJA 3ZJ2A 3ZN0B 1HX8A 3HKDE 3PE0A 3CX7B 4H63H 4P0BA 3Q5XA 2GK9A 3DTOA 2L8KA 2WMNA 4EYUA 5FNVE 5LOVE 1T98A 1NAFA 3N5LA 1HS7A 3PTRB 3F31A 4ISSA 4DBRA 5FXWA 2CWOA 4JEUB 1MIWA 3C98B 4ZS3A 2SPCA 2V7KA 4J2CA 4PJLA 4UEMA 2KWIB 3ZYKA 2ZM2A 4KMCA 2E9XD 3FHNA 4PK6A 3I9WA 1UX4A 5HAXA 4ZI2C 4ZI3C 5JDLA 4CI1B 2W0GA 3VHLA 2CXFA 3LFMA 2NW9A 2A72A 3V5SA 5LBMA 5KX5E 3CKDA 3C4ZA 4H9QC 2IC6A 2V7IA 4MALA 4UELA 3RYIE 4V1Av 5JRCA 1D1BA 3IEEA 5F8PA 3R84B 3FXDB 2EHOC 3BQKA 2M67A 2XQYA 4JUYA 3GWHA 3ZEFB 2V1DB 3I1AA 5LJMA 3AA6B 1MNEA 3O1JA 4AI6A 4M1PA 4DNDA 2YK0A 3ETVA 4MBQA 3ANWB 3O4XE 5JDMA 2X9WA 3C51A 1OWAA 3F2EA 1D1CA 4H9NC 4UVCB 4QKNA 3OBVE 4YJ3E 4X1YE 2LSKA 4JEHB 3O1HA 4P09A 5LHGB 4O4IE 4ADZA 2LSYA 3FBLA 3CPZA 3LK2B 1US7B 3EUHA 4IE7A 5HXCA 5CB4E 2BVMA 3ZCJA 2I59A 4I50E 3RYHE 1Y64B 3ZMUB 3ESLA 4QXHB 2UXXB 2NTXA 1ZKEA 5LNKA 1BR2A 4L5GA 4A56A 4OYKA 3AVRA 3KV9A 1MNDA 2VKHA 2V7MA 2A3DA 3MA9A 4FJOA 4DMWA 3JC6D 4UXNB 4XBFB 2OA5A 2Q9QA 3VKGA 2JJ9A 1MMGA 3N9QA 3ZYMA 4TX5A 2VKJA 2J1DG 5J1GA 3P8CD 3U3IA 5H6QB 3KVBA 5JVDE 2Q9QD 5DQWA 3ZMZB 2DWKA 4H9SE 2W00A 2ZM0A 4UVBB 4ZS2A 5JR9A 3H37A 3KBTA 1KNZA 4IGUA 3SWHA 4ILUA 4BAYB 1VOMA 4CXXA 2LHNA 2HPLA 1HTJF 3MK7C 5LCYA 4P0AA 3VKHA 1BR4A 3OYXA 3LK3B 3RYFE 4N78D 1WYBA 2CXDA 3HI2A 4O2BE 4TN7B 5F3JA 4PFOA 5EK4A 1HG2A 2E8IA 4IHJE 4IIJE 5FXZA 5ADXL 5JDNA 3PUQA 4HTEA 3WI3A 4CZZB 1YKHB 5CA0E 5CA1E 5JR9B 1KK7A 3L3PA 4BJNA 4OHFA 4F6RC 2K48A 4PFPA 4UIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJM A;  2CM0 A;  4OYK A;  4P0B A;  4P0A A;  4P09 A;  4JUY A;  2HPJ A;  2D5U A;  2CCQ A;  5LJN A;  4OYJ A;  2HPL A; 
#chains in the Genus database with same CATH topology
 1B7T A;  3AE3 A;  2E2A A;  4B3S T;  1N32 T;  1VCS A;  2KIN B;  4O4L E;  2Q9Q B;  1ZHC A;  4HGA A;  2VVN A;  3LK4 2;  3M65 A;  4O8S A;  1M7K A;  2ZMA A;  4Z90 A;  3NZQ A;  3SFE A;  1J1J A;  5FL1 A;  4L0R A;  4LMK A;  4DR1 T;  2XAF B;  4HFB A;  2CBJ A;  5JQG E;  4CI2 B;  1QUU A;  2LSI A;  1HCI A;  4H9O C;  1FEW A;  2IAK A;  1EZ3 A;  1E7P A;  2X68 A;  3CX8 B;  3Q2M A;  4YFS A;  5EZY E;  2ZM6 T;  2XAJ B;  5JDG A;  3MAC A;  2RPA A;  3H3A A;  2R6G F;  1IAP A;  4Q25 A;  1HF8 A;  2XQ5 A;  3AE5 A;  3JAE A;  2IW5 B;  4CXW A;  4DV5 T;  4LF7 T;  2V26 A;  1BR0 A;  2K5B B;  2XAQ B;  3E22 E;  3AA0 B;  3SFD A;  1NEN A;  2DLR A;  2DL1 A;  3EVY A;  4HWI B;  4X1I E;  3CQG B;  1VCT A;  1UK5 A;  1SHZ C;  1Z0P A;  4WW0 A;  4H9P C;  2M6I A;  1OED C;  2Y48 B;  3O9X A;  4Z8X A;  1X79 A;  3NWI A;  3OPC A;  2CA5 A;  4E7S A;  2BKN A;  2MAW A;  3UTK A;  2PG8 A;  3G06 A;  1D0X A;  2BG9 A;  2YDR A;  4I4T E;  3VR8 A;  3ZMV B;  4EIW A;  2B76 A;  3ZCI A;  5M4Y A;  3TKL B;  2XAS B;  4EZH A;  5ABG A;  4YT0 A;  4AKI A;  2LKH A;  3ONL C;  4IDZ A;  4KUM B;  5DJQ C;  2YU1 A;  3B57 A;  3TLW A;  5L47 A;  2FJD A;  2E9X A;  4EGW A;  1XNR T;  2WDQ A;  4B3R T;  2J4G A;  1WLX A;  1MIY A;  3UQ7 A;  3MXZ A;  4OX9 T;  3DP7 A;  4LF6 T;  4UVA B;  3R6N A;  1S94 A;  3ZT6 A;  2V5C A;  3MKD A;  3AE2 A;  4QXC B;  3LBX A;  2Y8D A;  1NEK A;  2W67 A;  3AEE A;  1H7C A;  3HKB E;  3Q5E A;  2X66 A;  3UU8 A;  5JDH A;  1JNR A;  2ODU A;  2Z6E A;  2ZLY A;  3AAA B;  3J7Y q;  2UUC T;  4DV4 T;  5JRC B;  2RA1 A;  4PNI A;  5CFB A;  1SE7 A;  2XUE A;  3CWZ B;  4L9I A;  4UR9 A;  4AKG A;  2OV9 A;  1N34 T;  4QH5 A;  4OFZ A;  5L2L A;  1KNP A;  4F8H A;  3P50 A;  3SRZ A;  5HXR A;  5HXE A;  2NW7 A;  3PUX F;  2N9D A;  1WRD A;  3AEB A;  5BMV E;  4DR4 T;  3KDS E;  1MMA A;  3NRX A;  1UUR A;  4NUV A;  3N9M A;  3U78 A;  2FJA A;  2PBI A;  2H88 A;  2H7O A;  5HCJ A;  5AQT B;  3ZYL A;  4EED A;  2XQ8 A;  5C8Y E;  4K0U A;  3BQL A;  2E9X C;  4GIW A;  3P4R A;  5HEG A;  3UU3 A;  4YY3 T;  2UUA T;  2C0S A;  2CXL A;  2XTL A;  3EDV A;  3PUV F;  2IUB A;  4ZZB A;  1R8I A;  5AQH B;  4CQI A;  4NXN T;  2XM2 A;  5JTG A;  2V6Y A;  3F57 A;  3AEA A;  2BKO A;  2LM2 A;  5IHY A;  4HE8 A;  1HNZ T;  2XQ6 A;  3LDQ B;  2NWB A;  3AE8 A;  3P4Q A;  3PUS A;  3FBZ A;  2X0L B;  4DVD A;  1OXZ A;  3ZKR A;  1OED A;  2CBI A;  3NRY A;  3ONX A;  2V6X A;  1YQ3 A;  1V9D A;  1YW0 A;  4HFH A;  5J2T E;  3EI0 A;  2WWU A;  1T8B A;  4WBN E;  2A2F X;  2HH7 A;  4JYA T;  4FI5 A;  2C5K T;  3AEG A;  3RKO A;  1ZP0 A;  2QA7 A;  5LGT B;  3EAB A;  2CLY C;  3JAD A;  1LVK A;  4U31 A;  2NW8 A;  5FMN A;  2VUR A;  4XZC A;  2DNX A;  2UXB T;  2X9H A;  3GA8 A;  3E08 A;  5KMG P;  2H7V C;  3PU8 A;  2YEV C;  3M3Z B;  2KT9 A;  3GN5 B;  2IML A;  3CML A;  4PK5 A;  3SOL A;  4LFC T;  3KVA A;  4CN6 A;  3VRB A;  1U4Q A;  5DAB A;  1XDO A;  2K9A A;  3WAJ A;  4UF0 A;  2JQ9 A;  1MMN A;  1VRB A;  2BZB A;  2DWG A;  4EYY R;  4X1K E;  5FXV A;  3EHZ A;  4KP3 C;  4GK0 E;  2VK9 A;  4QHO A;  3O1I A;  2D0T A;  4UV8 B;  4DV1 T;  4NIQ A;  4IDQ A;  4CN1 A;  2DI4 A;  1IJ5 A;  2CLY B;  4AQF A;  3QC9 A;  2V7L A;  3N9O A;  3NBX X;  4O4J E;  5EK3 A;  4CXY A;  2LRL A;  2DHR A;  3K8P C;  4DV3 T;  1YQ4 A;  5LG4 A;  3Q5W A;  3UT5 E;  2Q9Q C;  2CEA A;  3IF8 B;  2VVS A;  3AE9 A;  4ZI3 D;  4B3T T;  3HL6 A;  5HWY A;  1D0Z A;  3ZN1 B;  2L9Q A;  3CVR A;  4BA9 A;  2X67 A;  4DO0 A;  4X65 T;  5FYM A;  4X66 T;  2WMO A;  2WB5 A;  3RPU A;  1HNW T;  3KIN B;  2HPJ A;  1QSD A;  2IIU A;  2LLY A;  3AAI A;  3ETU A;  3HR0 A;  5A1L A;  2WM9 A;  3QB5 A;  4KHZ F;  3FZH B;  5ABE A;  4JV5 T;  2FBW A;  4U2Z A;  5LA6 E;  5LHH B;  4TUY E;  3PJA A;  4EZ4 A;  4C91 A;  3GMI A;  3LBX B;  3NZP A;  4AQF C;  2UXD T;  4YSX A;  3KBU A;  2MOZ A;  5JR9 C;  3ZST A;  4IE6 A;  3C4X A;  3AA7 B;  1O3X A;  4IE0 A;  4YJ2 E;  5AQF B;  2FJB A;  5FY0 A;  1IZN B;  4IE5 A;  4LF8 T;  2B1E A;  2UUB T;  2E9X B;  4QWN B;  3P4W A;  4YTM A;  1SA0 E;  2V8S V;  4JI0 T;  1KF6 A;  3RIU A;  1XZY A;  4G2A A;  5HCM A;  2VWA A;  3T1Y T;  1I6Z A;  2X0H A;  4GOU A;  5CJ5 A;  5JRE A;  2N2N A;  3ABV A;  3P7I A;  3UU6 A;  4ZI7 E;  1IBL T;  4U72 A;  2WQY A;  2LRK A;  5AQI B;  5L3F B;  4TV8 E;  4PJN A;  2ODV A;  2XHE B;  2QGS A;  4HFE A;  3AAE B;  2BBH A;  4YXD A;  2KXP B;  2VKO A;  2D2S A;  1LVF A;  2CE7 A;  4CI3 B;  1LKX A;  2H3R A;  2Y6X A;  3L09 A;  2IC9 A;  4NUU A;  2V5D A;  5TAO A;  4HWC A;  1CUN A;  3N9P A;  1HX1 B;  4ZZC A;  1WYC A;  1FMV A;  2N1G A;  4WBO A;  4MHC A;  4DV7 T;  3PUW F;  2W4X A;  4ZHQ E;  2WU5 A;  3PU3 A;  4ZI2 D;  4LF9 T;  5FKY A;  2EHO A;  5ADX L;  4U2Y A;  4GK5 E;  2D0U A;  1OED E;  2H89 A;  4AKL A;  4Z91 A;  4O2A E;  2CCQ A;  2X9X A;  3Q9D A;  4JBW F;  1LRZ A;  4LF5 T;  4IL4 A;  4HFI A;  1UUS A;  1E2A A;  2LOS A;  3BQI A;  1U5P A;  3PUR A;  3PV0 F;  4HKA A;  2M6B A;  1XDP A;  3C4W A;  3EDU A;  4GYS A;  3IA3 A;  3RC8 A;  3P4S A;  3A5X A;  4YTN A;  1HFA A;  5L3C B;  3CQC B;  4QXB B;  2XZE A;  3HKE E;  4DUY T;  4JLE A;  5JDN A;  1WR0 A;  2ZM8 A;  4KBM B;  4DBQ A;  1WR6 A;  3RH3 A;  1Y01 A;  3AE1 A;  2NP9 A;  4HFD A;  2JIW A;  4YHJ A;  2JQH A;  2VAS A;  3RIF A;  3V5U A;  4U7I A;  4YHH T;  5JDF A;  3FXE B;  4E7Z A;  4HEA A;  1IBK T;  2JQQ A;  3T8O A;  3ZMS B;  4QH4 A;  1MIV A;  3L8R A;  4LF4 T;  1KNR A;  3RGL A;  3K3N A;  4ZOL E;  2F4V T;  2D9D A;  5C3J A;  3K3O A;  3CX6 B;  4PJM A;  2P9B A;  5LMN T;  3FB2 A;  3MZK B;  2I6H A;  4DV6 T;  2MYS A;  2WDV A;  3FZK B;  1G8X A;  2W2U A;  2KND A;  3QK6 A;  1WFD A;  2JMH A;  4MLK A;  4HFV A;  4QH1 A;  3ONJ A;  4O4H E;  4TWD A;  5FY7 A;  3AVS A;  2YDQ A;  4PAG A;  3DJB A;  2W62 A;  2UXN B;  4TV9 E;  2W66 A;  3AEC A;  3OJA A;  3C50 A;  5AQN B;  2HN2 A;  4ILC A;  1E1H B;  2EHO D;  3X1D A;  4U3C A;  1HR0 T;  2W61 A;  2CHN A;  1W9R A;  4OYJ A;  3PUZ F;  2HHH T;  3AEF A;  3K3Q C;  3OVU A;  2OLT A;  4AQY T;  5GON E;  3MJX A;  3OKQ A;  2LSJ A;  2ES0 A;  2PJQ A;  2X9Y A;  4U33 A;  3FZF B;  2J62 A;  2NOX A;  1S35 A;  4WNK A;  2YDS A;  2JRK A;  3D0T A;  3QNU A;  3I9Y A;  3UUN A;  4I55 E;  3KV6 A;  5J2U E;  5HEO A;  5LGN B;  1FIO A;  2V7J A;  2AE9 A;  2W63 A;  5L3B B;  1FMW A;  2WZH A;  3VRA A;  2XM1 A;  5KDM C;  2LE8 A;  3WAK A;  4ERR A;  4DR5 T;  4H63 V;  3JC6 C;  4IE4 A;  2C5J A;  4ASK A;  3JAF A;  3ZMT B;  4EXT A;  3UU4 A;  5LXT E;  5LYJ E;  1N33 T;  2BBJ A;  2VL8 A;  2LM9 A;  2WZI A;  3SS1 A;  2J47 A;  3BK9 A;  3I0O A;  2DCF A;  2G0U A;  3UUL A;  4AIS A;  4AQG A;  5LMU T;  3ZT7 A;  5JH7 E;  4ANJ A;  3Q5D A;  5LHI B;  3IHR A;  1HG5 A;  5AQU B;  3UFE A;  4MFR A;  2JMK A;  4UV9 B;  5L3E B;  4IRE A;  2WY2 A;  3TLT A;  1XWM A;  1MMD A;  4YTP A;  1D0Y A;  1XMQ T;  3UFG A;  3C64 A;  2YN6 A;  4DR6 T;  2EHO B;  1M62 A;  2XSA A;  5FXX A;  1YD8 G;  4HWF A;  1IBM T;  3N2G E;  2BS4 A;  3UUX B;  3UU5 A;  4HN9 A;  2WSS V;  4OK0 A;  5JDQ A;  2CWY A;  3IBP A;  3CQX C;  5DQV A;  2KMF A;  3RC3 A;  5LBQ B;  2LHR A;  3RX6 A;  3K1S A;  4EOZ B;  3AB3 B;  5L3G B;  1NWM X;  5E0O A;  3RRW A;  1UX5 A;  3ZLI A;  2XQ3 A;  1AJ3 A;  2ACX A;  3QUJ A;  3J9X 1;  4ZEY A;  4AXP A;  3LSV A;  3NKZ A;  4TWF A;  2JPF A;  3KV4 A;  5L3D B;  2K24 A;  5FY1 A;  2LT3 A;  1ZEE A;  5J0Z A;  1W09 A;  5BR8 T;  2RP4 A;  3LJC A;  1XMO T;  2LOP A;  3ZPO A;  5LGU B;  4LFB T;  3ANW A;  2WP9 A;  4CN4 A;  5ETW A;  1ZOY A;  2QYW A;  2XQ7 A;  4QX7 B;  5AQG B;  1WCR A;  2NR4 A;  4BJM A;  1I94 T;  4C90 A;  4B3M T;  2ACZ A;  3FZL B;  5IYZ E;  3PUG A;  3W15 B;  2BS3 A;  2WBL A;  2KLQ A;  3VU7 H;  5HXH A;  2KWH A;  5LG3 A;  4PK4 A;  2IDO B;  4DID B;  2UU9 T;  2LEH A;  3RKG A;  2CMR A;  3S4U A;  3PJA J;  2C5I T;  2VKD A;  1W0B A;  3PDY A;  4I43 B;  4JI5 T;  5LJN A;  4JI1 T;  3N2K E;  3RRC A;  4DR2 T;  4YLH A;  4DMV A;  2BVL A;  3ZC0 A;  2BKP A;  2LSG A;  4XAX B;  2I0M A;  1UCU A;  4X5T A;  4JI3 T;  2WDR A;  3ZC1 A;  4JI4 T;  2KSR A;  3N9L A;  1BR1 A;  1D1A A;  2X51 A;  4ZXL A;  3N2O A;  4P1N A;  1T7S A;  3PUA A;  4IST A;  3AED A;  2L3L A;  2CM0 A;  3KV5 A;  3ZJ1 A;  5AFU L;  3OYZ A;  4TZ4 C;  5FP3 A;  3KFW X;  1J5W A;  1UGO A;  3LG7 A;  3RQW A;  2D5U A;  4H9R C;  4PW8 A;  3RLF F;  1L0V A;  4B6X A;  3A7M A;  1YKE B;  1G73 A;  2KZ7 B;  2NTY A;  2YIN A;  5H6R B;  4GYR A;  5HYA A;  2VQF T;  1FJG T;  3AA1 B;  2WCA A;  2HN1 A;  3N9N A;  5HWX A;  1ZV4 X;  4AKR B;  4EB6 E;  1IJ6 A;  4YSZ A;  2LJL A;  3JCF A;  2MBG A;  3I0Q A;  4TNV A;  4U74 A;  5AQM B;  3UQ4 A;  5IUX A;  4LFA T;  2YKS A;  3CK6 A;  4UF0 B;  2VB6 A;  3UUM A;  2XAH B;  4EAH A;  5EK2 A;  5AQJ B;  4QX8 B;  4I0U A;  3GN5 A;  2WAU A;  2BDE A;  3HA4 A;  2BG9 C;  2PFV A;  3B13 A;  4G63 A;  2PTF A;  2XQ4 A;  2MTQ A;  2YU2 A;  3RYC E;  5HXS A;  2FJE A;  3E0Z A;  4X20 E;  3HKC E;  5AQP B;  4ILA A;  5F5W A;  2XAG B;  4PJJ A;  3ZJ2 A;  4NXM T;  3ZN0 B;  1CHU A;  1HX8 A;  4IDP A;  4NPP A;  3HKD E;  4YSY A;  3PE0 A;  3CX7 B;  4H63 H;  4P0B A;  3Q5X A;  5AQS B;  3RI5 A;  2GK9 A;  2AXD S;  3DTO A;  1Z8U A;  2L8K A;  2WMN A;  3QB5 K;  3EAM A;  4EYU A;  5FNV E;  5KXJ A;  5LOV E;  3B5M A;  3RIA A;  1OED B;  1T98 A;  1NAF A;  3N5L A;  1XNQ T;  1HS7 A;  3PTR B;  3TLU A;  3F31 A;  4ISS A;  4DUZ T;  4DBR A;  2XJ7 A;  5FXW A;  2CWO A;  4JEU B;  1MIW A;  3C98 B;  4ZS3 A;  1KEY A;  2V6Y B;  1W0A A;  2SPC A;  2V7K A;  4J2C A;  4PJL A;  1X9B A;  4UEM A;  4K0K T;  2KWI B;  3ZYK A;  3OTO T;  2BS2 A;  2ZM2 A;  3RIU C;  3TLV A;  4KMC A;  4DR3 T;  4DV2 T;  2E9X D;  3L39 A;  5LP6 E;  3FHN A;  5IWA T;  4PK6 A;  3I9W A;  1UX4 A;  5HAX A;  4ZI2 C;  4ZI3 C;  2XPK A;  4WYV A;  4TWH A;  2W0G A;  4CI1 B;  3VHL A;  5JDL A;  2CXF A;  2IHR 1;  3LFM A;  4X62 T;  1N36 T;  1DU2 A;  2NW9 A;  2A72 A;  3V5S A;  3RF1 A;  4EEB A;  5LBM A;  4IL9 A;  5KX5 E;  3CKD A;  3C4Z A;  2XQA A;  4A97 A;  5FVL A;  2CPT A;  2WS3 A;  4H9Q C;  2E5L T;  4JI6 T;  2IC6 A;  2V7I A;  4MAL A;  2MPK A;  4UEL A;  5AQV B;  3RYI E;  4V1A v;  3RQU A;  4COF A;  1D1B A;  4JI8 T;  3IEE A;  5F8P A;  3R84 B;  5JRC A;  3FXD B;  4IT4 A;  2EHO C;  3BQK A;  2M67 A;  2XQY A;  3H3M A;  3GWH A;  4JUY A;  3ZEF B;  2V1D B;  3I1A A;  3PUY F;  5LJM A;  4KHP T;  5AQQ B;  3AA6 B;  4DR7 T;  1MNE A;  1JNZ A;  3O1J A;  4M1P A;  5HEU A;  3RHW A;  3ZSS A;  4DND A;  4IDO A;  4AI6 A;  2YK0 A;  1SUM B;  3ETV A;  3AE4 A;  4MBQ A;  3ANW B;  3O4X E;  3UUB A;  5JDM A;  2JQK A;  3CIR A;  2X9W A;  3C51 A;  1OWA A;  2UXC T;  2CHO A;  3F2E A;  1D1C A;  2BG9 B;  3AE7 A;  2CRB A;  4H9N C;  4UVC B;  4QKN A;  3OBV E;  4YJ3 E;  1T72 A;  4X1Y E;  2LSK A;  5AQO B;  4JEH B;  3O1H A;  4P09 A;  5AQK B;  5LHG B;  4O4I E;  1QLB A;  2WU2 A;  4JI2 T;  3P4P A;  4ADZ A;  5FL0 A;  2A9U A;  2LSY A;  4TNW A;  3FBL A;  3CPZ A;  3LK2 B;  1US7 B;  3EUH A;  4IE7 A;  5HXC A;  2FUP A;  5CB4 E;  3VR9 A;  5ABH A;  2BVM A;  4HFC A;  3ZCJ A;  1KFY A;  2I59 A;  4I50 E;  1Y64 B;  5AQL B;  3RYH E;  3ZMU B;  4JI7 T;  3ESL A;  4QXH B;  2BG9 E;  4X64 T;  2UXX B;  2NTX A;  1HNX T;  1ZKE A;  5LNK A;  1BR2 A;  4L5G A;  4A56 A;  2XSB A;  4OYK A;  3ZT5 A;  3AVR A;  3KV9 A;  1MND A;  4A98 A;  2VKH A;  4ILB A;  2X0Y A;  4WZX A;  1YXR A;  2V7M A;  2A3D A;  2QRX A;  2XY8 B;  3MA9 A;  4FJO A;  5LB7 B;  4DMW A;  3JC6 D;  4UXN B;  4EV6 A;  4XBF B;  2Q9Q A;  2OA5 A;  4A5X A;  3VKG A;  2JJ9 A;  1MMG A;  3N9Q A;  3ZYM A;  5HEJ A;  4TX5 A;  2VKJ A;  2J1D G;  2XQ9 A;  5J1G A;  3P8C D;  1GQE A;  3U3I A;  5H6Q B;  3KVB A;  5JVD E;  2Q9Q D;  5DQW A;  5HEH A;  3ZMZ B;  2DWK A;  4H9S E;  2W00 A;  5L4H A;  2ZM0 A;  4UVB B;  4KI0 F;  5FVK A;  4AIU A;  4ZS2 A;  4DV0 T;  5JR9 A;  3H37 A;  3KBT A;  1KNZ A;  4IGU A;  3NVO A;  3SWH A;  4ILU A;  4AKH A;  4BAY B;  1VOM A;  4KX6 A;  4CXX A;  1J5E T;  4HWH A;  4LMJ A;  2LHN A;  2K3W A;  3QOF A;  4HWD A;  5ABF B;  2HPL A;  1HTJ F;  3AXJ B;  3MK7 C;  3TLS A;  5LCY A;  2QVA A;  2E5V A;  4P0A A;  3VKH A;  1BR4 A;  3OYX A;  3LK3 B;  3RYF E;  4N78 D;  3AXJ A;  3FZM B;  5ABF A;  1WYB A;  2CXD A;  3A8Y C;  3HI2 A;  4O2B E;  4TN7 B;  5AQR B;  5F3J A;  2VQE T;  4PFO A;  5EK4 A;  4GKJ T;  5CGM A;  3T1H T;  1HG2 A;  2E8I A;  4IHJ E;  4IIJ E;  4U7Y A;  5FXZ A;  2WWV A;  3PUQ A;  4HTE A;  3WI3 A;  4CZZ B;  1YKH B;  5CA0 E;  5CA1 E;  5JR9 B;  1KK7 A;  5C2T A;  3L3P A;  4BJN A;  4OHF A;  4F6R C;  2K48 A;  2YOE A;  2LKG A;  2VL0 A;  3AE6 A;  4IDN A;  4GKK T;  4LML A;  4PFP A;  4UIG A;  5L4E A; 
#chains in the Genus database with same CATH homology
 1B7T A;  4O4L E;  2KIN B;  2Q9Q B;  1ZHC A;  4HGA A;  4O8S A;  3LK4 2;  3M65 A;  3ZYL A;  2ZMA A;  3NZQ A;  4L0R A;  2XAF B;  5JQG E;  4CI2 B;  1QUU A;  2LSI A;  1HCI A;  4H9O C;  1FEW A;  2IAK A;  1EZ3 A;  2X68 A;  3Q2M A;  3CX8 B;  4YFS A;  5EZY E;  2XAJ B;  5JDG A;  3MAC A;  3H3A A;  1IAP A;  1HF8 A;  2IW5 B;  4CXW A;  2V26 A;  1BR0 A;  2K5B B;  2XAQ B;  3E22 E;  3AA0 B;  3EVY A;  2DLR A;  4X1I E;  3CQG B;  1SHZ C;  1Z0P A;  4WW0 A;  4H9P C;  2Y48 B;  3O9X A;  4Z8X A;  1X79 A;  2CA5 A;  4E7S A;  3UTK A;  2PG8 A;  1D0X A;  4I4T E;  4EIW A;  3ZMV B;  3ZCI A;  5M4Y A;  3TKL B;  2XAS B;  4EZH A;  4AKI A;  4IDZ A;  4KUM B;  5DJQ C;  2YU1 A;  3B57 A;  2E9X A;  1WLX A;  1MIY A;  3MXZ A;  3DP7 A;  4UVA B;  3R6N A;  1S94 A;  3MKD A;  4QXC B;  3LBX A;  2Y8D A;  1H7C A;  3HKB E;  2X66 A;  5JDH A;  3J7Y q;  2ODU A;  3AAA B;  2Z6E A;  2ZLY A;  4AKH A;  5JRC B;  2RA1 A;  4PNI A;  2XUE A;  3CWZ B;  4L9I A;  4OFZ A;  5L2L A;  3SRZ A;  5HXR A;  5HXE A;  2NW7 A;  2N9D A;  1WRD A;  5BMV E;  3KDS E;  1MMA A;  3NRX A;  4NUV A;  3U78 A;  3N9M A;  4AKG A;  2PBI A;  2H7O A;  5C8Y E;  4K0U A;  3BQL A;  2E9X C;  4GIW A;  2C0S A;  2CXL A;  2XTL A;  3EDV A;  4CQI A;  3F57 A;  5IHY A;  4HE8 A;  2NWB A;  3PUS A;  3FBZ A;  2X0L B;  4DVD A;  1OXZ A;  3NRY A;  3ONX A;  1V9D A;  1YW0 A;  5J2T E;  2WWU A;  4WBN E;  2A2F X;  2HH7 A;  4FI5 A;  2C5K T;  3RKO A;  2QA7 A;  5LGT B;  2CLY C;  1LVK A;  5FMN A;  2NW8 A;  4XZC A;  2DNX A;  2X9H A;  3GA8 A;  3E08 A;  5KMG P;  2H7V C;  3PU8 A;  2YEV C;  2KT9 A;  3GN5 B;  3CML A;  4PK5 A;  3SOL A;  3KVA A;  1U4Q A;  5DAB A;  2K9A A;  3WAJ A;  4UF0 A;  1MMN A;  1VRB A;  2BZB A;  2DWG A;  4EYY R;  4X1K E;  5FXV A;  4KP3 C;  4GK0 E;  2VK9 A;  4QHO A;  3O1I A;  2D0T A;  4UV8 B;  2DI4 A;  1IJ5 A;  2CLY B;  4AQF A;  3QC9 A;  2V7L A;  3N9O A;  3NBX X;  4O4J E;  5EK3 A;  4CXY A;  2DHR A;  3K8P C;  5LG4 A;  3Q5W A;  3UT5 E;  2Q9Q C;  2CEA A;  3IF8 B;  4ZI3 D;  3HL6 A;  5HWY A;  1D0Z A;  3ZN1 B;  2L9Q A;  3CVR A;  4BA9 A;  2X67 A;  4DO0 A;  5FYM A;  2WMO A;  3RPU A;  3KIN B;  2HPJ A;  1QSD A;  3ETU A;  3AAI A;  3HR0 A;  5A1L A;  2WM9 A;  5LA6 E;  5LHH B;  4TUY E;  4EZ4 A;  4C91 A;  3GMI A;  3LBX B;  3NZP A;  4AQF C;  3KBU A;  2MOZ A;  5JR9 C;  4IE6 A;  3C4X A;  3AA7 B;  1O3X A;  4IE0 A;  4YJ2 E;  5FY0 A;  1IZN B;  4IE5 A;  2B1E A;  2E9X B;  4QWN B;  1SA0 E;  4G2A A;  2VWA A;  4GOU A;  5JRE A;  2N2N A;  3P7I A;  4ZI7 E;  4U72 A;  5L3F B;  4TV8 E;  4PJN A;  2ODV A;  2XHE B;  2QGS A;  3AAE B;  2KXP B;  2VKO A;  2D2S A;  1LVF A;  2CE7 A;  4CI3 B;  1LKX A;  2H3R A;  2Y6X A;  3L09 A;  2IC9 A;  4NUU A;  5TAO A;  1CUN A;  3N9P A;  1WYC A;  1FMV A;  2N1G A;  4WBO A;  4MHC A;  4ZHQ E;  3PU3 A;  4ZI2 D;  2EHO A;  4GK5 E;  2D0U A;  4AKL A;  4O2A E;  2CCQ A;  2X9X A;  3Q9D A;  1LRZ A;  2LOS A;  3PUR A;  3BQI A;  1U5P A;  4HKA A;  3C4W A;  3EDU A;  4GYS A;  3RC8 A;  3A5X A;  1HFA A;  5L3C B;  3CQC B;  4QXB B;  3HKE E;  4JLE A;  2ZM8 A;  4KBM B;  4DBQ A;  1WR6 A;  3RH3 A;  2NP9 A;  4YHJ A;  2VAS A;  3V5U A;  5JDF A;  3FXE B;  4HEA A;  2JQQ A;  3T8O A;  3ZMS B;  1MIV A;  3K3N A;  4ZOL E;  3K3O A;  3CX6 B;  4PJM A;  2P9B A;  3FB2 A;  3MZK B;  2MYS A;  1G8X A;  2KND A;  3QK6 A;  2JMH A;  4MLK A;  4HFV A;  3ZJ1 A;  5FY7 A;  4O4H E;  5LP6 E;  3AVS A;  4TV9 E;  4PAG A;  3DJB A;  2W62 A;  2UXN B;  4E7Z A;  3OJA A;  3C50 A;  1E1H B;  2EHO D;  2W61 A;  4OYJ A;  3K3Q C;  5GON E;  3MJX A;  3OKQ A;  2LSJ A;  2ES0 A;  2PJQ A;  2X9Y A;  2NOX A;  1S35 A;  4WNK A;  2JRK A;  3D0T A;  3I9Y A;  3UUN A;  4I55 E;  3KV6 A;  5J2U E;  5LGN B;  1FIO A;  2V7J A;  2W63 A;  5L3B B;  1FMW A;  5KDM C;  2LE8 A;  3WAK A;  4ERR A;  4H63 V;  3JC6 C;  4IE4 A;  2C5J A;  4ASK A;  4EXT A;  3ZMT B;  5LXT E;  5LYJ E;  2VL8 A;  2LM9 A;  3SS1 A;  5LHI B;  3BK9 A;  3I0O A;  3UUL A;  2DCF A;  2G0U A;  4AQG A;  5JH7 E;  4ANJ A;  3IHR A;  1HG5 A;  3UFE A;  4MFR A;  2JMK A;  4UV9 B;  5L3E B;  1MMD A;  1D0Y A;  3C64 A;  2EHO B;  5FXX A;  1YD8 G;  3N2G E;  3UUX B;  4HN9 A;  2WSS V;  4OK0 A;  5JDQ A;  2CWY A;  3IBP A;  3CQX C;  5DQV A;  2KMF A;  3RC3 A;  5LBQ B;  2LHR A;  3RX6 A;  4EOZ B;  5L3G B;  3AB3 B;  1NWM X;  5E0O A;  3RRW A;  1UX5 A;  3ZLI A;  1AJ3 A;  2ACX A;  3QUJ A;  3J9X 1;  4AXP A;  2JPF A;  3KV4 A;  5L3D B;  2K24 A;  5FY1 A;  2LT3 A;  1ZEE A;  2RP4 A;  3LJC A;  2LOP A;  3ZPO A;  5LGU B;  3ANW A;  5ETW A;  4QX7 B;  4BJM A;  4C90 A;  5IYZ E;  3PUG A;  3W15 B;  2WBL A;  2KLQ A;  3VU7 H;  5HXH A;  2KWH A;  4PK4 A;  2LEH A;  2CMR A;  3S4U A;  2C5I T;  2VKD A;  5LJN A;  3PDY A;  4I43 B;  3N2K E;  3RRC A;  4YLH A;  4DMV A;  2BVL A;  3ZC0 A;  2LSG A;  4XAX B;  1UCU A;  3ZC1 A;  3N9L A;  1BR1 A;  1D1A A;  2X51 A;  3N2O A;  3PUA A;  4IST A;  2L3L A;  2CM0 A;  3KV5 A;  5AFU L;  3OYZ A;  4TZ4 C;  5FP3 A;  3KFW X;  3LG7 A;  2D5U A;  4H9R C;  4PW8 A;  4B6X A;  1YKE B;  1G73 A;  2KZ7 B;  2NTY A;  2YIN A;  5H6R B;  4GYR A;  5HYA A;  3AA1 B;  3N9N A;  5HWX A;  1ZV4 X;  4AKR B;  4EB6 E;  1IJ6 A;  2LJL A;  2MBG A;  3I0Q A;  4U74 A;  4UF0 B;  2VB6 A;  3UUM A;  2XAH B;  4EAH A;  5EK2 A;  4QX8 B;  3GN5 A;  3HA4 A;  2BDE A;  2WAU A;  5HXS A;  2PFV A;  3B13 A;  4G63 A;  3RYC E;  2MTQ A;  2YU2 A;  3E0Z A;  4X20 E;  3HKC E;  2XAG B;  4PJJ A;  3ZJ2 A;  3ZN0 B;  1HX8 A;  3HKD E;  3PE0 A;  3CX7 B;  4H63 H;  4P0B A;  3Q5X A;  2GK9 A;  3DTO A;  2L8K A;  2WMN A;  4EYU A;  5FNV E;  5LOV E;  1T98 A;  1NAF A;  3N5L A;  1HS7 A;  3PTR B;  3F31 A;  4ISS A;  4DBR A;  5FXW A;  2CWO A;  4JEU B;  1MIW A;  3C98 B;  4ZS3 A;  2SPC A;  2V7K A;  4J2C A;  4PJL A;  4UEM A;  2KWI B;  3ZYK A;  2ZM2 A;  4KMC A;  2E9X D;  3FHN A;  4PK6 A;  3I9W A;  1UX4 A;  5HAX A;  4ZI2 C;  4ZI3 C;  5JDL A;  4CI1 B;  2W0G A;  3VHL A;  2CXF A;  3LFM A;  2NW9 A;  2A72 A;  3V5S A;  5LBM A;  5KX5 E;  3CKD A;  3C4Z A;  4H9Q C;  2IC6 A;  2V7I A;  4MAL A;  4UEL A;  3RYI E;  4V1A v;  5JRC A;  1D1B A;  3IEE A;  5F8P A;  3R84 B;  3FXD B;  2EHO C;  3BQK A;  2M67 A;  2XQY A;  4JUY A;  3GWH A;  3ZEF B;  2V1D B;  3I1A A;  5LJM A;  3AA6 B;  1MNE A;  3O1J A;  4AI6 A;  4M1P A;  4DND A;  2YK0 A;  3ETV A;  4MBQ A;  3ANW B;  3O4X E;  5JDM A;  2X9W A;  3C51 A;  1OWA A;  3F2E A;  1D1C A;  4H9N C;  4UVC B;  4QKN A;  3OBV E;  4YJ3 E;  4X1Y E;  2LSK A;  4JEH B;  3O1H A;  4P09 A;  5LHG B;  4O4I E;  4ADZ A;  2LSY A;  3FBL A;  3CPZ A;  3LK2 B;  1US7 B;  3EUH A;  4IE7 A;  5HXC A;  5CB4 E;  2BVM A;  3ZCJ A;  2I59 A;  4I50 E;  3RYH E;  1Y64 B;  3ZMU B;  3ESL A;  4QXH B;  2UXX B;  2NTX A;  1ZKE A;  5LNK A;  1BR2 A;  4L5G A;  4A56 A;  4OYK A;  3AVR A;  3KV9 A;  1MND A;  2VKH A;  2V7M A;  2A3D A;  3MA9 A;  4FJO A;  4DMW A;  3JC6 D;  4UXN B;  4XBF B;  2OA5 A;  2Q9Q A;  3VKG A;  2JJ9 A;  1MMG A;  3N9Q A;  3ZYM A;  4TX5 A;  2VKJ A;  2J1D G;  5J1G A;  3P8C D;  3U3I A;  5H6Q B;  3KVB A;  5JVD E;  2Q9Q D;  5DQW A;  3ZMZ B;  2DWK A;  4H9S E;  2W00 A;  2ZM0 A;  4UVB B;  4ZS2 A;  5JR9 A;  3H37 A;  3KBT A;  1KNZ A;  4IGU A;  3SWH A;  4ILU A;  4BAY B;  1VOM A;  4CXX A;  2LHN A;  2HPL A;  1HTJ F;  3MK7 C;  5LCY A;  4P0A A;  3VKH A;  1BR4 A;  3OYX A;  3LK3 B;  3RYF E;  4N78 D;  1WYB A;  2CXD A;  3HI2 A;  4O2B E;  4TN7 B;  5F3J A;  4PFO A;  5EK4 A;  1HG2 A;  2E8I A;  4IHJ E;  4IIJ E;  5FXZ A;  5ADX L;  5JDN A;  3PUQ A;  4HTE A;  3WI3 A;  4CZZ B;  1YKH B;  5CA0 E;  5CA1 E;  5JR9 B;  1KK7 A;  3L3P A;  4BJN A;  4OHF A;  4F6R C;  2K48 A;  4PFP A;  4UIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...