2LE8A

The protein complex for dna replication
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication licensing factor MCM6
publication title Structural insights into the Cdt1-mediated MCM2-7 chromatin loading
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 27
structure length 114
sequence length 114
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18263 MCM6_C MCM6 C-terminal winged-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2le8A00
2LE8A 2KLQA
chains in the Genus database with same CATH superfamily
3JADA 3HKBE 2UXNB 1W09A 2BKPA 2CE7A 1SHZC 1ZEEA 4TWDA 4C91A 3OJAA 2E9XB 1W0BA 4DBQA 3AE8A 4BJNA 3H37A 1FEWA 5HXEA 3AE9A 3LDQB 5AQRB 2W2UA 4FJOA 1WR6A 4H9QC 3CPZA 2OV9A 2CRBA 2BS2A 2BG9B 1HR0T 4CXXA 5HXHA 5LJMA 3L3PA 3D0TA 2JQ9A 3K3NA 5HYAA 2XASB 1D0XA 5CGMA 2WSSV 4JI5T 3PUSA 4MFRA 2Z6EA 4L0RA 3UU4A 3MZKB 2NTXA 3ETVA 3MXZA 3RIUA 5F3JA 5J0ZA 3CWZB 3N2KE 2W66A 2V7LA 4LF4T 2C5IT 4UVBB 3NZPA 5L3GB 2XJ7A 3K8PC 3EAMA 1IBMT 2YKSA 3ZCIA 3ONXA 2FJBA 1QLBA 5CA1E 4H9NC 4O2BE 4QXHB 5LCYA 1OEDB 3PUYF 3QB5K 3RI5A 5FL1A 3QNUA 3O9XA 3I1AA 3ANWA 2X0YA 5LG3A 4I4TE 4EEDA 2I59A 5FP3A 4QHOA 4Z91A 1NAFA 4JEHB 4BAYB 5FXZA 2IC6A 4QH5A 4UV8B 4A97A 5AQMB 4H63H 4EEBA 3T1YT 3ZMUB 4Z8XA 3IHRA 1FMVA 4PJNA 4PJLA 4JLEA 2LKGA 5HAXA 4CI1B 3C4ZA 4P0BA 2XSAA 4OFZA 4HFIA 4H9OC 4TN7B 2VASA 2WY2A 2W63A 5LYJE 2CBJA 3RKGA 2Q9QA 5H6QB 2V8SV 4HTEA 5FYMA 4A5XA 5LA6E 3RGLA 3Q9DA 4A56A 2SPCA 4LF6T 4LMKA 3CX6B 4O4JE 2H3RA 4QH1A 1LVKA 3AA6B 4EOZB 1MNDA 3ZC1A 4IE6A 5JR9C 1WFDA 3VRAA 4AISA 4H9SE 3VHLA 3FZFB 1HX1B 4CN1A 3GN5B 4ZZBA 5FVKA 2CXDA 3QOFA 2HPLA 4JV5T 1UK5A 4PK6A 2NR4A 3LG7A 3RPUA 4PJMA 3CQCB 1R8IA 5HXCA 4JYAT 4TX5A 3I0OA 2XAJB 3PTRB 1XMQT 1M62A 2N9DA 3CK6A 4NXMT 4IREA 3RQWA 1VOMA 4YSXA 1M7KA 4LFBT 3Q5XA 4KUMB 3VRBA 3GMIA 1N36T 4LMLA 1KF6A 1MIYA 2E9XA 2YU2A 4CN4A 1WYCA 2QRXA 4DR7T 5LHHB 3HI2A 3BQKA 2ZM8A 2K24A 4X1IE 2I0MA 4LF8T 2V7JA 2YDSA 3P8CD 2BG9A 2WZHA 2V6YA 3IA3A 2WCAA 4CI3B 1HNWT 5DJQC 4PFPA 5LHGB 5J2TE 2M67A 3E0ZA 2K5BB 2BVMA 2Q9QD 2XM1A 3AECA 4C90A 4ZXLA 1HFAA 3VR8A 4PNIA 3KVAA 5ETWA 2XUEA 3UU3A 3HR0A 3RYIE 2AXDS 3DP7A 1HS7A 5ABEA 2WU2A 2UXDT 1UX4A 4ISTA 2A2FX 3N5LA 4YTMA 2ODUA 3MA9A 5BMVE 2RP4A 3L09A 3WAKA 4QWNB 4UELA 1OEDA 2YINA 1UURA 5LMUT 3HA4A 3ZMZB 4MLKA 3AEEA 4IDOA 5L4EA 1D0ZA 4XZCA 4G2AA 2CLYC 3AVRA 2NP9A 2LT3A 4BJMA 2X0HA 5LGTB 2UU9T 3I0QA 4EXTA 2FBWA 2CM0A 4U2ZA 1E2AA 3UULA 1U5PA 5AQGB 3ANWB 3R84B 2V26A 2NW7A 5LMNT 1XZYA 2LSIA 4AQYT 2XAHB 3FBZA 1ZHCA 2C5KT 3LK3B 2E9XD 1HG5A 3C98B 3ZJ2A 1D1CA 4JI4T 1MMAA 4EB6E 2V7IA 3PUAA 2H89A 2YU1A 3ZMTB 3ZYLA 4B3MT 5JREA 2CHNA 1T98A 5LHIB 4HWIB 4ZI7E 4YY3T 4YHJA 2J47A 1Z0PA 2ODVA 2ZLYA 3JCFA 5AQTB 4H9RC 4ZZCA 4B3RT 3JAEA 5F8PA 4HFBA 4DR6T 3EI0A 3AA7B 3W15B 2KINB 5IWAT 2CWYA 5AQQB 4DV6T 4HEAA 2VQET 5KMGP 2W67A 3NVOA 5AQHB 2BBJA 1MNEA 4P1NA 3IBPA 4YSYA 2IAKA 1HG2A 2V1DB 1UGOA 4IE4A 4OYKA 3ZN1B 2CA5A 2EHOD 4YFSA 2KNDA 3FHNA 4HFEA 5AQUB 3FXEB 4X66T 1W9RA 4L9IA 2M6IA 2JQKA 3SFDA 5HXRA 4U72A 3ZT5A 4HFHA 5LBMA 2JIWA 4MHCA 1B7TA 3AAIA 1IZNB 3RIUC 3BQLA 2VL0A 2KLQA 2WB5A 4GKKT 2ACXA 4JI2T 4BA9A 1Y01A 5L3EB 3DTOA 4H63V 2WMOA 4IHJE 2ZM0A 1N32T 1YD8G 3P4QA 2X0LB 3U78A 1T7SA 1LRZA 3UU8A 4U7IA 4DV1T 3SRZA 4FI5A 4ZHQE 4Z90A 2JMHA 1N33T 1T72A 3IF8B 1KK7A 4ZI3D 3N9PA 5L3FB 2XHEB 2XY8B 2A9UA 5FXVA 2V6YB 2PJQA 3GWHA 4HGAA 3P50A 2QYWA 2QVAA 5ADXL 4JUYA 3AB3B 3LBXB 4EZ4A 3MACA 4XAXB 4QX8B 4GIWA 4OX9T 2NOXA 3EHZA 3J9X1 5IHYA 1YQ3A 1NWMX 2CXFA 1KNZA 4AQFC 2LM9A 1YXRA 3RLFF 5JVDE 3RH3A 3FZLB 3ZC0A 1VRBA 2X9HA 3NBXX 1O3XA 3RRWA 3KINB 2WQYA 4YTPA 2K9AA 4PK4A 3ESLA 5HCJA 1T8BA 1HTJF 3Q5WA 3CX8B 3A8YC 4CN6A 4DR4T 2Q9QC 5C8YE 2IIUA 4IDQA 4YSZA 3ETUA 1IAPA 1IBKT 4LF7T 4IDPA 3KBUA 2X51A 3ZT6A 3PU8A 3Q5DA 3F57A 4JEUB 5LNKA 2W62A 4NIQA 3PUVF 4I50E 2IW5B 4DR2T 4DIDB 4IT4A 3HKEE 5AFUL 4ZS2A 3X1DA 4AKHA 4HWDA 4F6RC 2XQ9A 3UUBA 3VKGA 4GOUA 2P9BA 5FVLA 4AKLA 2W0GA 2YOEA 4ERRA 5KDMC 5FXWA 5JDLA 3QB5A 4HFVA 5AQFB 3UFEA 3N9MA 4JI8T 3FXDB 2WU5A 4CXWA 4GKJT 4NUVA 2W61A 4U31A 4X1KE 3L8RA 3CQGB 4QX7B 2JJ9A 5FMNA 1S35A 2CHOA 4AKGA 2ZM6T 4EYUA 2N2NA 4O4IE 3RF1A 3KVBA 3TKLB 2LJLA 4OK0A 3CKDA 2HN2A 5ABGA 3AE4A 2KSRA 4UVAB 5IUXA 2VWAA 4PJJA 4AXPA 5JRCB 2XQAA 1BR2A 2OLTA 3UFGA 3C4WA 3CQXC 2H88A 3O1JA 3HL6A 4CZZB 1GQEA 2VVNA 1YKHB 3AEBA 1KNRA 5GONE 1ZKEA 4LMJA 4IIJE 2D2SA 3KBTA 4IDNA 4X20E 4JI3T 2NW8A 5L3BB 5HEOA 2V7MA 4YXDA 5LOVE 1LKXA 3OVUA 4ILAA 3RC3A 4YLHA 5ABHA 4LF5T 1U4QA 1N34T 5E0OA 3QUJA 1CHUA 3ZN0B 2WDRA 5HXSA 2D9DA 3WAJA 1XNQT 4I55E 3K3QC 5LG4A 1SUMB 2KXPB 3K1SA 3V5SA 2CEAA 5FNVE 5EK2A 2BKOA 5JDFA 2EHOC 3PUXF 3HKDE 2CBIA 2VKDA 1IJ6A 4PW8A 3P7IA 1X9BA 2D0UA 3PU3A 4UR9A 4IL4A 3NZQA 2VL8A 1E1HB 4DR1T 3RIFA 4B3TT 2GK9A 4CQIA 1UX5A 3JAFA 4IE0A 4HN9A 2WS3A 2ZM2A 4JI1T 1MMGA 4UIGA 3LBXA 3E08A 3QC9A 3C64A 2ZMAA 3AAAB 3B5MA 2WZIA 4TUYE 3HKCE 4PK5A 1J1JA 4IL9A 2XQ7A 4DV4T 4DV7T 1HCIA 5F5WA 3EVYA 2IUBA 4JI0T 2QA7A 4KBMB 2E5LT 4TWFA 3N9NA 2RPAA 4WBNE 4ZI3C 5LGUB 3G06A 2MOZA 3NRYA 4TZ4C 5HWXA 2LSGA 3JC6D 3AE5A 3ABVA 1HNZT 4KHZF 2JRKA 1OXZA 3RX6A 2KZ7B 1BR4A 2D0TA 1G73A 3NWIA 1HF8A 4KX6A 4QXBB 3CX7B 4H9PC 5LP6E 5HCMA 3KFWX 3E22E 2DWGA 2PFVA 2XTLA 2NW9A 1Z8UA 3O1HA 3TLSA 3EABA 3PDYA 2JQQA 3UQ4A 4UVCB 3AXJB 3KV4A 1L0VA 5EK3A 4KHPT 1D0YA 1MMNA 4U2YA 3TLTA 2UUCT 3N9LA 3LJCA 4ZI2D 2PBIA 1SA0E 2RA1A 4K0UA 4AI6A 2OA5A 3RKOA 4NXNT 2BVLA 2JMKA 3AVSA 3J7Yq 2V7KA 3M3ZB 4AKRB 3RQUA 2LEHA 1BR1A 4TV9E 3ZMVB 4QH4A 3R6NA 4DV0T 1YW0A 2E8IA 3P4RA 4P09A 2VB6A 5EZYE 4IDZA 4DMVA 1XWMA 2X9WA 2WAUA 5JRCA 4F8HA 2XPKA 2X68A 5L47A 4DV5T 2M6BA 4M1PA 3M65A 5AQVB 3AEDA 2V6XA 1H7CA 5FY7A 3FBLA 1SE7A 4OYJA 3ZYKA 2WP9A 3U3IA 2LSYA 2BDEA 3UUMA 2JQHA 4XBFB 2L9QA 4MBQA 3N9OA 5DQWA 1XDPA 3CMLA 3ZCJA 1X79A 1XNRT 3LFMA 3N2GE 5AQLB 4QKNA 4X1YE 4EZHA 2VQFT 5H6RB 1US7B 5HEJA 4HWCA 5ABFB 3BQIA 2ACZA 4X64T 1LVFA 2XQ8A 4JI7T 2V5CA 2Y6XA 3MJXA 3KV6A 4V1Av 1Y64B 4KMCA 3TLWA 5LB7B 2X67A 4JI6T 1W0AA 5HEHA 3I9WA 3AAEB 4GYSA 4I0UA 4HWHA 4CXYA 5AQOB 2F4VT 3ZYMA 3Q2MA 2VK9A 2DWKA 4EAHA 4EGWA 4DVDA 1UUSA 2I6HA 1WRDA 5KX5E 3H3AA 5IYZE 2XQ5A 2PTFA 5C2TA 1QUUA 2J62A 4L5GA 2DCFA 1J5WA 4E7SA 2NTYA 5CA0E 2MYSA 3A7MA 4LFCT 5AQPB 1NENA 1EZ3A 3PUZF 4JBWF 4YHHT 4X5TA 4PFOA 3AEAA 2IHR1 5JR9B 2X66A 2YDRA 3ZSSA 5JDMA 2A72A 1HNXT 3FB2A 3UUXB 5JQGE 4U74A 3ZPOA 4ZEYA 4B6XA 1QSDA 2PG8A 4YJ2E 2XQ6A 1IBLT 2DNXA 3AEGA 3RRCA 2WBLA 5DABA 1WLXA 2A3DA 5L3DB 3OKQA 3F2EA 5M4YA 2KWHA 5JDGA 2ES0A 2XAGB 4DUYT 5LBQB 4CI2B 3PUQA 2C0SA 2WM9A 1CUNA 3MK7C 4DV3T 3AA0B 4HKAA 4E7ZA 5FY0A 2DHRA 2EHOB 2VKHA 4WNKA 3B57A 2IMLA 3PV0F 3AXJA 4MALA 4QXCB 3PURA 2H7OA 3H3MA 3AE7A 2B76A 5DQVA 4IE5A 4WBOA 3OTOT 5AQSB 2B1EA 4UF0B 2WMNA 2YN6A 1E7PA 1UCUA 3C4XA 2VKJA 3JC6C 4J2CA 5FKYA 3BK9A 2XAFB 5LJNA 2CXLA 1D1BA 1JNRA 5AQKB 1MMDA 1J5ET 4P0AA 2WDQA 2YEVC 3ONLC 2UXBT 4GK0E 5JH7E 2MPKA 4ILBA 3RC8A 4AQFA 2FJDA 1S94A 2FUPA 4ZS3A 1ZOYA 2X9YA 3P4PA 3AA1B 3ZEFB 4LFAT 1KNPA 4ASKA 4UV9B 2J1DG 4DO0A 1OWAA 3SOLA 5L4HA 3VKHA 3V5UA 4U3CA 4YJ3E 2X9XA 4ZI2C 2BG9E 4IGUA 3UU6A 5JTGA 2E9XC 3P4WA 2VVSA 4N78D 5J2UE 5LXTE 2FJAA 2BBHA 2XM2A 2BKNA 2LSJA 3DJBA 2N1GA 3F31A 4NPPA 3OYZA 2CLYB 2CWOA 2AE9A 3ZKRA 2E5VA 2K48A 2BG9C 2DL1A 3P4SA 4ANJA 2MTQA 3PJAJ 2E2AA 5ABFA 3WI3A 3TLUA 2D5UA 5AQNB 3T1HT 4A98A 2XZEA 1XDOA 3T8OA 2DLRA 3ONJA 4YT0A 5LGNB 2HPJA 3MKDA 2UXCT 2JPFA 2FJEA 5AQJB 1OEDE 4UXNB 5CB4E 1MIWA 2W4XA 4TNVA 4WW0A 2YDQA 3C51A 3AEFA 4O4HE 4B3ST 3UTKA 4UEMA 3TLVA 1FMWA 5CJ5A 4DR3T 1OEDC 5A1LA 2QGSA 2LOPA 4AQGA 2CCQA 1WCRA 3PUWF 1YQ4A 5FL0A 5FXXA 3CIRA 2L3LA 3KV9A 3VU7H 3KV5A 3C50A 4HE8A 5EK4A 3UU5A 1MIVA 3PJAA 5JR9A 4KI0F 4ISSA 2KWIB 3PUGA 2W00A 5JDNA 4AKIA 5TAOA 2L8KA 3ZMSB 3LK42 2LM2A 3ZSTA 2UXXB 4EV6A 3RYHE 3IEEA 2XQ4A 3FZMB 3RHWA 4KP3C 2LOSA 2CMRA 4ILUA 2V5DA 4TWHA 2YK0A 4WZXA 4TNWA 4ILCA 2Y48B 1ZV4X 2VURA 2MBGA 3S4UA 2WWUA 4ZOLE 3RYCE 3N2OA 3VR9A 2C5JA 5C3JA 3FZKB 1XMOT 3AE2A 3CVRA 4NUUA 3NRXA 3EDVA 4YTNA 3OYXA 2EHOA 3SS1A 3I9YA 3A5XA 1FJGT 3OPCA 4WYVA 2IDOB 5HEUA 4GYRA 4O4LE 2J4GA 2H7VC 1FIOA 3SWHA 2UUBT 2LHNA 4K0KT 4AIUA 4HWFA 2R6GF 4UF0A 5KXJA 1V9DA 4COFA 4OHFA 1VCSA 4TV8E 5AQIB 2K3WA 4DR5T 2KMFA 3UQ7A 2BS3A 3UUNA 3ZJ1A 1BR0A 1WYBA 1JNZA 1ZP0A 1G8XA 1DU2A 4Q25A 3O1IA 4HFDA 5JDQA 3KDSE 2XQ3A 1KEYA 4EIWA 4O2AE 4DBRA 5HWYA 2LLYA 5BR8T 3N9QA 3RIAA 1AJ3A 4IE7A 4DV2T 1KFYA 1VCTA 3B13A 2WDVA 2NWBA 1WR0A 3NKZA 2BZBA 2LRKA 2XSBA 4X62T 3AE1A 3AE6A 1NEKA 2UUAT 2HH7A 3QK6A 3GA8A 3RYFE 4X65T 2Q9QB 2BS4A 2IC9A 4DNDA 3AE3A 1YKEB 1HX8A 2VKOA 3LK2B 5HEGA 2LRLA 3OBVE 4U33A 1I6ZA 4DMWA 1D1AA 3LSVA 4I43B 3EUHA 4HFCA 2MAWA 5JDHA 3EDUA 2LKHA 4O8SA 2WWVA 4EYYR 2Y8DA 3PE0A 3GN5A 4PAGA 2LE8A 3ZT7A 4U7YA 2XQYA 3UT5E 2LHRA 3SFEA 3FZHB 2HHHT 4DUZT 2G0UA 4GK5E 2KT9A 2DI4A 4LF9T 2LSKA 5L3CB 5CFBA 5L2LA 3L39A 2XAQB 3K3OA 4ADZA 2CPTA 5FY1A 4G63A 5J1GA 2HN1A 3Q5EA 1IJ5A 1I94T 3O4XE 3ZLIA
chains in the Genus database with same CATH topology
4PW8A 3P7IA 3HKBE 3LK3B 4P0AA 2D0UA 3PU3A 2E9XD 2UXNB 2YEVC 3NZQA 1HG5A 3C98B 3ZJ2A 4GK0E 1D1CA 1SHZC 1ZEEA 2CE7A 1MMAA 3OJAA 2E9XB 2VL8A 4C91A 2V7IA 4EB6E 3PUAA 3RC8A 1E1HB 2YU1A 4DBQA 4AQFA 4BJNA 1S94A 3ZMTB 3H37A 4ZS3A 1FEWA 2GK9A 2X9YA 3ZYLA 5HXEA 4CQIA 5JREA 1UX5A 5LHIB 1T98A 3AA1B 4ZI7E 4IE0A 3ZEFB 4YHJA 4HN9A 2ZM2A 4ASKA 4UV9B 2J1DG 1Z0PA 2ODVA 4DO0A 1MMGA 2ZLYA 1OWAA 4FJOA 3SOLA 4UIGA 1WR6A 4H9QC 3CPZA 3LBXA 3VKHA 3V5UA 4H9RC 4YJ3E 3E08A 2X9XA 3QC9A 4ZI2C 4CXXA 3C64A 4IGUA 5HXHA 2ZMAA 5LJMA 3AAAB 3L3PA 3D0TA 4TUYE 3HKCE 4PK5A 2E9XC 5F8PA 3K3NA 3AA7B 5HYAA 4N78D 2XASB 1D0XA 3W15B 5J2UE 5LXTE 2KINB 1HCIA 2WSSV 3PUSA 4MFRA 2CWYA 3EVYA 2Z6EA 2LSJA 4HEAA 5KMGP 4L0RA 2QA7A 3DJBA 4KBMB 2N1GA 3F31A 3OYZA 1MNEA 2CLYB 3IBPA 3MZKB 3N9NA 2NTXA 3ETVA 3MXZA 4WBNE 5F3JA 2CWOA 2IAKA 1HG2A 2K48A 2V1DB 3CWZB 3N2KE 4ZI3C 5LGUB 2V7LA 4ANJA 2MOZA 3NRYA 4TZ4C 2C5IT 4IE4A 4OYKA 5HWXA 4UVBB 2LSGA 3JC6D 2MTQA 3NZPA 3ZN1B 2CA5A 2EHOD 3WI3A 2D5UA 4YFSA 5L3GB 3K8PC 2KNDA 3ZCIA 2JRKA 3ONXA 3T8OA 3FHNA 1OXZA 3RX6A 2DLRA 2KZ7B 1BR4A 2D0TA 1G73A 5CA1E 4H9NC 4O2BE 5LGNB 1HF8A 3FXEB 2HPJA 3MKDA 4QXBB 4L9IA 3CX7B 4H9PC 4QXHB 5LCYA 5LP6E 3KFWX 2JPFA 5HXRA 3E22E 2DWGA 2PFVA 2XTLA 4U72A 4UXNB 5CB4E 1MIWA 2NW9A 3O1HA 5LBMA 4MHCA 1B7TA 3AAIA 3PDYA 1IZNB 2JQQA 4WW0A 4UVCB 3C51A 3O9XA 3KV4A 4O4HE 5EK3A 3BQLA 2KLQA 3I1AA 1D0YA 1MMNA 3ANWA 2ACXA 5L3EB 4I4TE 4BA9A 3UTKA 3DTOA 4H63V 4UEMA 1FMWA 2WMOA 3N9LA 4IHJE 2ZM0A 3LJCA 4ZI2D 2I59A 5FP3A 4QHOA 2PBIA 1YD8G 1SA0E 1NAFA 2QGSA 2RA1A 4JEHB 5A1LA 4BAYB 5FXZA 2LOPA 2X0LB 3U78A 4K0UA 4AQGA 1LRZA 2CCQA 4AI6A 2OA5A 2IC6A 4UV8B 3RKOA 3SRZA 2BVLA 2JMKA 4FI5A 5FXXA 3AVSA 4H63H 3J7Yq 2V7KA 4ZHQE 4AKRB 2L3LA 3KV9A 3ZMUB 3VU7H 4Z8XA 3IHRA 2JMHA 1FMVA 2LEHA 1BR1A 3IF8B 3KV5A 4PJNA 4TV9E 3C50A 4JLEA 4PJLA 1KK7A 3ZMVB 3R6NA 5HAXA 4HE8A 1YW0A 3C4ZA 5EK4A 4P0BA 4CI1B 1MIVA 4ZI3D 2E8IA 3N9PA 4P09A 2VB6A 4OFZA 5JR9A 5L3FB 2XHEB 5EZYE 4ISSA 5FXVA 4IDZA 4DMVA 2KWIB 4H9OC 4TN7B 2VASA 2PJQA 3GWHA 3PUGA 2W00A 5JDNA 4AKIA 4HGAA 2W63A 5TAOA 2X9WA 2L8KA 2WAUA 5LYJE 5JRCA 3ZMSB 3LK42 2Q9QA 5H6QB 5ADXL 2UXXB 4JUYA 3AB3B 3RYHE 3LBXB 4HTEA 4EZ4A 3MACA 3IEEA 4XAXB 4QX8B 5FYMA 4GIWA 2X68A 5LA6E 4KP3C 2NOXA 2LOSA 3Q9DA 4A56A 3J9X1 2SPCA 2CMRA 4ILUA 4M1PA 5IHYA 3M65A 1NWMX 2CXFA 3CX6B 4O4JE 1KNZA 1H7CA 2H3RA 2YK0A 5FY7A 4AQFC 2LM9A 2Y48B 3FBLA 4OYJA 3ZYKA 1ZV4X 5JVDE 3U3IA 1LVKA 3AA6B 2MBGA 2LSYA 3RH3A 2WWUA 3S4UA 4ZOLE 3RYCE 4EOZB 1VRBA 3N2OA 2X9HA 3ZC0A 1MNDA 2BDEA 3UUMA 3NBXX 1O3XA 2C5JA 4XBFB 2L9QA 3ZC1A 4IE6A 4MBQA 3N9OA 5DQWA 3RRWA 5JR9C 3KINB 3CVRA 4NUUA 3CMLA 2K9AA 4PK4A 3ESLA 3NRXA 3ZCJA 1X79A 3EDVA 3LFMA 4H9SE 3N2GE 3OYXA 2EHOA 3SS1A 4QKNA 3VHLA 3I9YA 3A5XA 3GN5B 1HTJF 3Q5WA 3CX8B 4X1YE 4EZHA 5H6RB 1US7B 4GYRA 4O4LE 3BQIA 2CXDA 2Q9QC 2HPLA 2H7VC 1FIOA 1LVFA 3SWHA 5C8YE 2LHNA 3ETUA 4PK6A 1IAPA 3LG7A 2Y6XA 3MJXA 3KBUA 2X51A 3KV6A 1Y64B 4V1Av 3RPUA 3PU8A 3F57A 4PJMA 4JEUB 4KMCA 5LNKA 2X67A 4UF0A 2W62A 4I50E 2IW5B 3CQCB 5HXCA 1V9DA 4TX5A 3I9WA 3HKEE 3AAEB 3I0OA 4GYSA 4ZS2A 2XAJB 5AFUL 3PTRB 4OHFA 4CXYA 3ZYMA 4AKHA 2N9DA 3Q2MA 4TV8E 2VK9A 4F6RC 2DWKA 4EAHA 3VKGA 4GOUA 2P9BA 1VOMA 2KMFA 4AKLA 2W0GA 4ERRA 4DVDA 3Q5XA 3UUNA 1WRDA 4KUMB 5KX5E 5KDMC 3GMIA 3H3AA 3ZJ1A 1BR0A 1WYBA 1MIYA 2E9XA 2YU2A 5FXWA 5JDLA 1WYCA 4HFVA 3UFEA 1G8XA 5IYZE 3O1IA 3N9MA 5JDQA 5LHHB 1QUUA 3FXDB 4CXWA 4L5GA 3KDSE 2DCFA 4NUVA 3HI2A 3BQKA 2W61A 4X1KE 2ZM8A 2K24A 4E7SA 4EIWA 4X1IE 2NTYA 4O2AE 5HWYA 2MYSA 4DBRA 5CA0E 2V7JA 3CQGB 3N9QA 4QX7B 2JJ9A 1AJ3A 1EZ3A 4IE7A 3P8CD 5FMNA 4PFOA 1S35A 3B13A 2NWBA 4AKGA 4EYUA 2BZBA 2N2NA 4CI3B 4O4IE 3KVBA 3TKLB 5JR9B 2LJLA 2X66A 5JDMA 4OK0A 5DJQC 2A72A 4PFPA 3FB2A 5LHGB 3UUXB 5J2TE 3CKDA 5JQGE 2HH7A 2M67A 3E0ZA 2K5BB 4U74A 2BVMA 3QK6A 3ZPOA 4UVAB 3GA8A 2Q9QD 4B6XA 1QSDA 2VWAA 2PG8A 3RYFE 4PJJA 4AXPA 4YJ2E 5JRCB 1BR2A 2DNXA 4C90A 3RRCA 2WBLA 5DABA 2Q9QB 2IC9A 4DNDA 3C4WA 1HFAA 4PNIA 3KVAA 3CQXC 1YKEB 3O1JA 1HX8A 2VKOA 1WLXA 3LK2B 5ETWA 2XUEA 3HL6A 4CZZB 3HR0A 3RYIE 3OBVE 2A3DA 3DP7A 5L3DB 1HS7A 3OKQA 4DMWA 3F2EA 5M4YA 1YKHB 2KWHA 1UX4A 1D1AA 4ISTA 5JDGA 2ES0A 1ZKEA 4I43B 2A2FX 5GONE 3N5LA 5JH7E 4IIJE 2D2SA 2XAGB 3KBTA 4X20E 3EUHA 2NW8A 5L3BB 5LBQB 2ODUA 2V7MA 5JDHA 3MA9A 5LOVE 1LKXA 3EDUA 4CI2B 3PUQA 5BMVE 4O8SA 4EYYR 2RP4A 2Y8DA 3PE0A 3GN5A 3RC3A 4PAGA 4YLHA 2C0SA 2LE8A 2WM9A 1CUNA 3L09A 3MK7C 3AA0B 3WAKA 4QWNB 4UELA 4HKAA 4E7ZA 1U4QA 2YINA 2XQYA 3HA4A 5FY0A 3UT5E 3ZMZB 2DHRA 4MLKA 2EHOB 2LHRA 2VKHA 4WNKA 3B57A 1D0ZA 5E0OA 3QUJA 4XZCA 3ZN0B 2G0UA 4G2AA 2CLYC 3AVRA 5HXSA 4GK5E 4MALA 2KT9A 4QXCB 3WAJA 3PURA 2DI4A 4I55E 2H7OA 2NP9A 3K3QC 5LG4A 2LT3A 2LSKA 5L3CB 4BJMA 5DQVA 5LGTB 5L2LA 4IE5A 2KXPB 3I0QA 4WBOA 4EXTA 3V5SA 2CM0A 2B1EA 2CEAA 2XAQB 2WMNA 4UF0B 5FNVE 5EK2A 3UULA 5JDFA 1UCUA 3K3OA 1U5PA 4ADZA 3C4XA 3ANWB 2VKJA 3JC6C 5FY1A 4G63A 3R84B 4J2CA 2EHOC 3HKDE 2V26A 3BK9A 2NW7A 5J1GA 2VKDA 2XAFB 5LJNA 2LSIA 2CXLA 1D1BA 1IJ6A 2XAHB 3FBZA 1IJ5A 3O4XE 1ZHCA 1MMDA 3ZLIA 2C5KT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE8 A;  2KLQ A; 
#chains in the Genus database with same CATH topology
 3JAD A;  3HKB E;  2UXN B;  1W09 A;  2BKP A;  2CE7 A;  1SHZ C;  1ZEE A;  4TWD A;  4C91 A;  3OJA A;  2E9X B;  1W0B A;  4DBQ A;  3AE8 A;  4BJN A;  3H37 A;  1FEW A;  5HXE A;  3AE9 A;  3LDQ B;  5AQR B;  2W2U A;  4FJO A;  1WR6 A;  4H9Q C;  3CPZ A;  2OV9 A;  2CRB A;  2BS2 A;  2BG9 B;  1HR0 T;  4CXX A;  5HXH A;  5LJM A;  3L3P A;  3D0T A;  2JQ9 A;  3K3N A;  5HYA A;  2XAS B;  1D0X A;  5CGM A;  2WSS V;  4JI5 T;  3PUS A;  4MFR A;  2Z6E A;  4L0R A;  3UU4 A;  3MZK B;  2NTX A;  3ETV A;  3MXZ A;  3RIU A;  5F3J A;  5J0Z A;  3CWZ B;  3N2K E;  2W66 A;  2V7L A;  4LF4 T;  2C5I T;  4UVB B;  3NZP A;  5L3G B;  2XJ7 A;  3K8P C;  3EAM A;  1IBM T;  2YKS A;  3ZCI A;  3ONX A;  2FJB A;  1QLB A;  5CA1 E;  4H9N C;  4O2B E;  4QXH B;  5LCY A;  1OED B;  3PUY F;  3QB5 K;  3RI5 A;  5FL1 A;  3QNU A;  3O9X A;  3I1A A;  3ANW A;  2X0Y A;  5LG3 A;  4I4T E;  4EED A;  2I59 A;  5FP3 A;  4QHO A;  4Z91 A;  1NAF A;  4JEH B;  4BAY B;  5FXZ A;  2IC6 A;  4QH5 A;  4UV8 B;  4A97 A;  5AQM B;  4H63 H;  4EEB A;  3T1Y T;  3ZMU B;  4Z8X A;  3IHR A;  1FMV A;  4PJN A;  4PJL A;  4JLE A;  2LKG A;  5HAX A;  4CI1 B;  3C4Z A;  4P0B A;  2XSA A;  4OFZ A;  4HFI A;  4H9O C;  4TN7 B;  2VAS A;  2WY2 A;  2W63 A;  5LYJ E;  2CBJ A;  3RKG A;  2Q9Q A;  5H6Q B;  2V8S V;  4HTE A;  5FYM A;  4A5X A;  5LA6 E;  3RGL A;  3Q9D A;  4A56 A;  2SPC A;  4LF6 T;  4LMK A;  3CX6 B;  4O4J E;  2H3R A;  4QH1 A;  1LVK A;  3AA6 B;  4EOZ B;  1MND A;  3ZC1 A;  4IE6 A;  5JR9 C;  1WFD A;  3VRA A;  4AIS A;  4H9S E;  3VHL A;  3FZF B;  1HX1 B;  4CN1 A;  3GN5 B;  4ZZB A;  5FVK A;  2CXD A;  3QOF A;  2HPL A;  4JV5 T;  1UK5 A;  4PK6 A;  2NR4 A;  3LG7 A;  3RPU A;  4PJM A;  3CQC B;  1R8I A;  5HXC A;  4JYA T;  4TX5 A;  3I0O A;  2XAJ B;  3PTR B;  1XMQ T;  1M62 A;  2N9D A;  3CK6 A;  4NXM T;  4IRE A;  3RQW A;  1VOM A;  4YSX A;  1M7K A;  4LFB T;  3Q5X A;  4KUM B;  3VRB A;  3GMI A;  1N36 T;  4LML A;  1KF6 A;  1MIY A;  2E9X A;  2YU2 A;  4CN4 A;  1WYC A;  2QRX A;  4DR7 T;  5LHH B;  3HI2 A;  3BQK A;  2ZM8 A;  2K24 A;  4X1I E;  2I0M A;  4LF8 T;  2V7J A;  2YDS A;  3P8C D;  2BG9 A;  2WZH A;  2V6Y A;  3IA3 A;  2WCA A;  4CI3 B;  1HNW T;  5DJQ C;  4PFP A;  5LHG B;  5J2T E;  2M67 A;  3E0Z A;  2K5B B;  2BVM A;  2Q9Q D;  2XM1 A;  3AEC A;  4C90 A;  4ZXL A;  1HFA A;  3VR8 A;  4PNI A;  3KVA A;  5ETW A;  2XUE A;  3UU3 A;  3HR0 A;  3RYI E;  2AXD S;  3DP7 A;  1HS7 A;  5ABE A;  2WU2 A;  2UXD T;  1UX4 A;  4IST A;  2A2F X;  3N5L A;  4YTM A;  2ODU A;  3MA9 A;  5BMV E;  2RP4 A;  3L09 A;  3WAK A;  4QWN B;  4UEL A;  1OED A;  2YIN A;  1UUR A;  5LMU T;  3HA4 A;  3ZMZ B;  4MLK A;  3AEE A;  4IDO A;  5L4E A;  1D0Z A;  4XZC A;  4G2A A;  2CLY C;  3AVR A;  2NP9 A;  2LT3 A;  4BJM A;  2X0H A;  5LGT B;  2UU9 T;  3I0Q A;  4EXT A;  2FBW A;  2CM0 A;  4U2Z A;  1E2A A;  3UUL A;  1U5P A;  5AQG B;  3ANW B;  3R84 B;  2V26 A;  2NW7 A;  5LMN T;  1XZY A;  2LSI A;  4AQY T;  2XAH B;  3FBZ A;  1ZHC A;  2C5K T;  3LK3 B;  2E9X D;  1HG5 A;  3C98 B;  3ZJ2 A;  1D1C A;  4JI4 T;  1MMA A;  4EB6 E;  2V7I A;  3PUA A;  2H89 A;  2YU1 A;  3ZMT B;  3ZYL A;  4B3M T;  5JRE A;  2CHN A;  1T98 A;  5LHI B;  4HWI B;  4ZI7 E;  4YY3 T;  4YHJ A;  2J47 A;  1Z0P A;  2ODV A;  2ZLY A;  3JCF A;  5AQT B;  4H9R C;  4ZZC A;  4B3R T;  3JAE A;  5F8P A;  4HFB A;  4DR6 T;  3EI0 A;  3AA7 B;  3W15 B;  2KIN B;  5IWA T;  2CWY A;  5AQQ B;  4DV6 T;  4HEA A;  2VQE T;  5KMG P;  2W67 A;  3NVO A;  5AQH B;  2BBJ A;  1MNE A;  4P1N A;  3IBP A;  4YSY A;  2IAK A;  1HG2 A;  2V1D B;  1UGO A;  4IE4 A;  4OYK A;  3ZN1 B;  2CA5 A;  2EHO D;  4YFS A;  2KND A;  3FHN A;  4HFE A;  5AQU B;  3FXE B;  4X66 T;  1W9R A;  4L9I A;  2M6I A;  2JQK A;  3SFD A;  5HXR A;  4U72 A;  3ZT5 A;  4HFH A;  5LBM A;  2JIW A;  4MHC A;  1B7T A;  3AAI A;  1IZN B;  3RIU C;  3BQL A;  2VL0 A;  2KLQ A;  2WB5 A;  4GKK T;  2ACX A;  4JI2 T;  4BA9 A;  1Y01 A;  5L3E B;  3DTO A;  4H63 V;  2WMO A;  4IHJ E;  2ZM0 A;  1N32 T;  1YD8 G;  3P4Q A;  2X0L B;  3U78 A;  1T7S A;  1LRZ A;  3UU8 A;  4U7I A;  4DV1 T;  3SRZ A;  4FI5 A;  4ZHQ E;  4Z90 A;  2JMH A;  1N33 T;  1T72 A;  3IF8 B;  1KK7 A;  4ZI3 D;  3N9P A;  5L3F B;  2XHE B;  2XY8 B;  2A9U A;  5FXV A;  2V6Y B;  2PJQ A;  3GWH A;  4HGA A;  3P50 A;  2QYW A;  2QVA A;  5ADX L;  4JUY A;  3AB3 B;  3LBX B;  4EZ4 A;  3MAC A;  4XAX B;  4QX8 B;  4GIW A;  4OX9 T;  2NOX A;  3EHZ A;  3J9X 1;  5IHY A;  1YQ3 A;  1NWM X;  2CXF A;  1KNZ A;  4AQF C;  2LM9 A;  1YXR A;  3RLF F;  5JVD E;  3RH3 A;  3FZL B;  3ZC0 A;  1VRB A;  2X9H A;  3NBX X;  1O3X A;  3RRW A;  3KIN B;  2WQY A;  4YTP A;  2K9A A;  4PK4 A;  3ESL A;  5HCJ A;  1T8B A;  1HTJ F;  3Q5W A;  3CX8 B;  3A8Y C;  4CN6 A;  4DR4 T;  2Q9Q C;  5C8Y E;  2IIU A;  4IDQ A;  4YSZ A;  3ETU A;  1IAP A;  1IBK T;  4LF7 T;  4IDP A;  3KBU A;  2X51 A;  3ZT6 A;  3PU8 A;  3Q5D A;  3F57 A;  4JEU B;  5LNK A;  2W62 A;  4NIQ A;  3PUV F;  4I50 E;  2IW5 B;  4DR2 T;  4DID B;  4IT4 A;  3HKE E;  5AFU L;  4ZS2 A;  3X1D A;  4AKH A;  4HWD A;  4F6R C;  2XQ9 A;  3UUB A;  3VKG A;  4GOU A;  2P9B A;  5FVL A;  4AKL A;  2W0G A;  2YOE A;  4ERR A;  5KDM C;  5FXW A;  5JDL A;  3QB5 A;  4HFV A;  5AQF B;  3UFE A;  3N9M A;  4JI8 T;  3FXD B;  2WU5 A;  4CXW A;  4GKJ T;  4NUV A;  2W61 A;  4U31 A;  4X1K E;  3L8R A;  3CQG B;  4QX7 B;  2JJ9 A;  5FMN A;  1S35 A;  2CHO A;  4AKG A;  2ZM6 T;  4EYU A;  2N2N A;  4O4I E;  3RF1 A;  3KVB A;  3TKL B;  2LJL A;  4OK0 A;  3CKD A;  2HN2 A;  5ABG A;  3AE4 A;  2KSR A;  4UVA B;  5IUX A;  2VWA A;  4PJJ A;  4AXP A;  5JRC B;  2XQA A;  1BR2 A;  2OLT A;  3UFG A;  3C4W A;  3CQX C;  2H88 A;  3O1J A;  3HL6 A;  4CZZ B;  1GQE A;  2VVN A;  1YKH B;  3AEB A;  1KNR A;  5GON E;  1ZKE A;  4LMJ A;  4IIJ E;  2D2S A;  3KBT A;  4IDN A;  4X20 E;  4JI3 T;  2NW8 A;  5L3B B;  5HEO A;  2V7M A;  4YXD A;  5LOV E;  1LKX A;  3OVU A;  4ILA A;  3RC3 A;  4YLH A;  5ABH A;  4LF5 T;  1U4Q A;  1N34 T;  5E0O A;  3QUJ A;  1CHU A;  3ZN0 B;  2WDR A;  5HXS A;  2D9D A;  3WAJ A;  1XNQ T;  4I55 E;  3K3Q C;  5LG4 A;  1SUM B;  2KXP B;  3K1S A;  3V5S A;  2CEA A;  5FNV E;  5EK2 A;  2BKO A;  5JDF A;  2EHO C;  3PUX F;  3HKD E;  2CBI A;  2VKD A;  1IJ6 A;  4PW8 A;  3P7I A;  1X9B A;  2D0U A;  3PU3 A;  4UR9 A;  4IL4 A;  3NZQ A;  2VL8 A;  1E1H B;  4DR1 T;  3RIF A;  4B3T T;  2GK9 A;  4CQI A;  1UX5 A;  3JAF A;  4IE0 A;  4HN9 A;  2WS3 A;  2ZM2 A;  4JI1 T;  1MMG A;  4UIG A;  3LBX A;  3E08 A;  3QC9 A;  3C64 A;  2ZMA A;  3AAA B;  3B5M A;  2WZI A;  4TUY E;  3HKC E;  4PK5 A;  1J1J A;  4IL9 A;  2XQ7 A;  4DV4 T;  4DV7 T;  1HCI A;  5F5W A;  3EVY A;  2IUB A;  4JI0 T;  2QA7 A;  4KBM B;  2E5L T;  4TWF A;  3N9N A;  2RPA A;  4WBN E;  4ZI3 C;  5LGU B;  3G06 A;  2MOZ A;  3NRY A;  4TZ4 C;  5HWX A;  2LSG A;  3JC6 D;  3AE5 A;  3ABV A;  1HNZ T;  4KHZ F;  2JRK A;  1OXZ A;  3RX6 A;  2KZ7 B;  1BR4 A;  2D0T A;  1G73 A;  3NWI A;  1HF8 A;  4KX6 A;  4QXB B;  3CX7 B;  4H9P C;  5LP6 E;  5HCM A;  3KFW X;  3E22 E;  2DWG A;  2PFV A;  2XTL A;  2NW9 A;  1Z8U A;  3O1H A;  3TLS A;  3EAB A;  3PDY A;  2JQQ A;  3UQ4 A;  4UVC B;  3AXJ B;  3KV4 A;  1L0V A;  5EK3 A;  4KHP T;  1D0Y A;  1MMN A;  4U2Y A;  3TLT A;  2UUC T;  3N9L A;  3LJC A;  4ZI2 D;  2PBI A;  1SA0 E;  2RA1 A;  4K0U A;  4AI6 A;  2OA5 A;  3RKO A;  4NXN T;  2BVL A;  2JMK A;  3AVS A;  3J7Y q;  2V7K A;  3M3Z B;  4AKR B;  3RQU A;  2LEH A;  1BR1 A;  4TV9 E;  3ZMV B;  4QH4 A;  3R6N A;  4DV0 T;  1YW0 A;  2E8I A;  3P4R A;  4P09 A;  2VB6 A;  5EZY E;  4IDZ A;  4DMV A;  1XWM A;  2X9W A;  2WAU A;  5JRC A;  4F8H A;  2XPK A;  2X68 A;  5L47 A;  4DV5 T;  2M6B A;  4M1P A;  3M65 A;  5AQV B;  3AED A;  2V6X A;  1H7C A;  5FY7 A;  3FBL A;  1SE7 A;  4OYJ A;  3ZYK A;  2WP9 A;  3U3I A;  2LSY A;  2BDE A;  3UUM A;  2JQH A;  4XBF B;  2L9Q A;  4MBQ A;  3N9O A;  5DQW A;  1XDP A;  3CML A;  3ZCJ A;  1X79 A;  1XNR T;  3LFM A;  3N2G E;  5AQL B;  4QKN A;  4X1Y E;  4EZH A;  2VQF T;  5H6R B;  1US7 B;  5HEJ A;  4HWC A;  5ABF B;  3BQI A;  2ACZ A;  4X64 T;  1LVF A;  2XQ8 A;  4JI7 T;  2V5C A;  2Y6X A;  3MJX A;  3KV6 A;  4V1A v;  1Y64 B;  4KMC A;  3TLW A;  5LB7 B;  2X67 A;  4JI6 T;  1W0A A;  5HEH A;  3I9W A;  3AAE B;  4GYS A;  4I0U A;  4HWH A;  4CXY A;  5AQO B;  2F4V T;  3ZYM A;  3Q2M A;  2VK9 A;  2DWK A;  4EAH A;  4EGW A;  4DVD A;  1UUS A;  2I6H A;  1WRD A;  5KX5 E;  3H3A A;  5IYZ E;  2XQ5 A;  2PTF A;  5C2T A;  1QUU A;  2J62 A;  4L5G A;  2DCF A;  1J5W A;  4E7S A;  2NTY A;  5CA0 E;  2MYS A;  3A7M A;  4LFC T;  5AQP B;  1NEN A;  1EZ3 A;  3PUZ F;  4JBW F;  4YHH T;  4X5T A;  4PFO A;  3AEA A;  2IHR 1;  5JR9 B;  2X66 A;  2YDR A;  3ZSS A;  5JDM A;  2A72 A;  1HNX T;  3FB2 A;  3UUX B;  5JQG E;  4U74 A;  3ZPO A;  4ZEY A;  4B6X A;  1QSD A;  2PG8 A;  4YJ2 E;  2XQ6 A;  1IBL T;  2DNX A;  3AEG A;  3RRC A;  2WBL A;  5DAB A;  1WLX A;  2A3D A;  5L3D B;  3OKQ A;  3F2E A;  5M4Y A;  2KWH A;  5JDG A;  2ES0 A;  2XAG B;  4DUY T;  5LBQ B;  4CI2 B;  3PUQ A;  2C0S A;  2WM9 A;  1CUN A;  3MK7 C;  4DV3 T;  3AA0 B;  4HKA A;  4E7Z A;  5FY0 A;  2DHR A;  2EHO B;  2VKH A;  4WNK A;  3B57 A;  2IML A;  3PV0 F;  3AXJ A;  4MAL A;  4QXC B;  3PUR A;  2H7O A;  3H3M A;  3AE7 A;  2B76 A;  5DQV A;  4IE5 A;  4WBO A;  3OTO T;  5AQS B;  2B1E A;  4UF0 B;  2WMN A;  2YN6 A;  1E7P A;  1UCU A;  3C4X A;  2VKJ A;  3JC6 C;  4J2C A;  5FKY A;  3BK9 A;  2XAF B;  5LJN A;  2CXL A;  1D1B A;  1JNR A;  5AQK B;  1MMD A;  1J5E T;  4P0A A;  2WDQ A;  2YEV C;  3ONL C;  2UXB T;  4GK0 E;  5JH7 E;  2MPK A;  4ILB A;  3RC8 A;  4AQF A;  2FJD A;  1S94 A;  2FUP A;  4ZS3 A;  1ZOY A;  2X9Y A;  3P4P A;  3AA1 B;  3ZEF B;  4LFA T;  1KNP A;  4ASK A;  4UV9 B;  2J1D G;  4DO0 A;  1OWA A;  3SOL A;  5L4H A;  3VKH A;  3V5U A;  4U3C A;  4YJ3 E;  2X9X A;  4ZI2 C;  2BG9 E;  4IGU A;  3UU6 A;  5JTG A;  2E9X C;  3P4W A;  2VVS A;  4N78 D;  5J2U E;  5LXT E;  2FJA A;  2BBH A;  2XM2 A;  2BKN A;  2LSJ A;  3DJB A;  2N1G A;  3F31 A;  4NPP A;  3OYZ A;  2CLY B;  2CWO A;  2AE9 A;  3ZKR A;  2E5V A;  2K48 A;  2BG9 C;  2DL1 A;  3P4S A;  4ANJ A;  2MTQ A;  3PJA J;  2E2A A;  5ABF A;  3WI3 A;  3TLU A;  2D5U A;  5AQN B;  3T1H T;  4A98 A;  2XZE A;  1XDO A;  3T8O A;  2DLR A;  3ONJ A;  4YT0 A;  5LGN B;  2HPJ A;  3MKD A;  2UXC T;  2JPF A;  2FJE A;  5AQJ B;  1OED E;  4UXN B;  5CB4 E;  1MIW A;  2W4X A;  4TNV A;  4WW0 A;  2YDQ A;  3C51 A;  3AEF A;  4O4H E;  4B3S T;  3UTK A;  4UEM A;  3TLV A;  1FMW A;  5CJ5 A;  4DR3 T;  1OED C;  5A1L A;  2QGS A;  2LOP A;  4AQG A;  2CCQ A;  1WCR A;  3PUW F;  1YQ4 A;  5FL0 A;  5FXX A;  3CIR A;  2L3L A;  3KV9 A;  3VU7 H;  3KV5 A;  3C50 A;  4HE8 A;  5EK4 A;  3UU5 A;  1MIV A;  3PJA A;  5JR9 A;  4KI0 F;  4ISS A;  2KWI B;  3PUG A;  2W00 A;  5JDN A;  4AKI A;  5TAO A;  2L8K A;  3ZMS B;  3LK4 2;  2LM2 A;  3ZST A;  2UXX B;  4EV6 A;  3RYH E;  3IEE A;  2XQ4 A;  3FZM B;  3RHW A;  4KP3 C;  2LOS A;  2CMR A;  4ILU A;  2V5D A;  4TWH A;  2YK0 A;  4WZX A;  4TNW A;  4ILC A;  2Y48 B;  1ZV4 X;  2VUR A;  2MBG A;  3S4U A;  2WWU A;  4ZOL E;  3RYC E;  3N2O A;  3VR9 A;  2C5J A;  5C3J A;  3FZK B;  1XMO T;  3AE2 A;  3CVR A;  4NUU A;  3NRX A;  3EDV A;  4YTN A;  3OYX A;  2EHO A;  3SS1 A;  3I9Y A;  3A5X A;  1FJG T;  3OPC A;  4WYV A;  2IDO B;  5HEU A;  4GYR A;  4O4L E;  2J4G A;  2H7V C;  1FIO A;  3SWH A;  2UUB T;  2LHN A;  4K0K T;  4AIU A;  4HWF A;  2R6G F;  4UF0 A;  5KXJ A;  1V9D A;  4COF A;  4OHF A;  1VCS A;  4TV8 E;  5AQI B;  2K3W A;  4DR5 T;  2KMF A;  3UQ7 A;  2BS3 A;  3UUN A;  3ZJ1 A;  1BR0 A;  1WYB A;  1JNZ A;  1ZP0 A;  1G8X A;  1DU2 A;  4Q25 A;  3O1I A;  4HFD A;  5JDQ A;  3KDS E;  2XQ3 A;  1KEY A;  4EIW A;  4O2A E;  4DBR A;  5HWY A;  2LLY A;  5BR8 T;  3N9Q A;  3RIA A;  1AJ3 A;  4IE7 A;  4DV2 T;  1KFY A;  1VCT A;  3B13 A;  2WDV A;  2NWB A;  1WR0 A;  3NKZ A;  2BZB A;  2LRK A;  2XSB A;  4X62 T;  3AE1 A;  3AE6 A;  1NEK A;  2UUA T;  2HH7 A;  3QK6 A;  3GA8 A;  3RYF E;  4X65 T;  2Q9Q B;  2BS4 A;  2IC9 A;  4DND A;  3AE3 A;  1YKE B;  1HX8 A;  2VKO A;  3LK2 B;  5HEG A;  2LRL A;  3OBV E;  4U33 A;  1I6Z A;  4DMW A;  1D1A A;  3LSV A;  4I43 B;  3EUH A;  4HFC A;  2MAW A;  5JDH A;  3EDU A;  2LKH A;  4O8S A;  2WWV A;  4EYY R;  2Y8D A;  3PE0 A;  3GN5 A;  4PAG A;  2LE8 A;  3ZT7 A;  4U7Y A;  2XQY A;  3UT5 E;  2LHR A;  3SFE A;  3FZH B;  2HHH T;  4DUZ T;  2G0U A;  4GK5 E;  2KT9 A;  2DI4 A;  4LF9 T;  2LSK A;  5L3C B;  5CFB A;  5L2L A;  3L39 A;  2XAQ B;  3K3O A;  4ADZ A;  2CPT A;  5FY1 A;  4G63 A;  5J1G A;  2HN1 A;  3Q5E A;  1IJ5 A;  1I94 T;  3O4X E;  3ZLI A; 
#chains in the Genus database with same CATH homology
 4PW8 A;  3P7I A;  3HKB E;  3LK3 B;  4P0A A;  2D0U A;  3PU3 A;  2E9X D;  2UXN B;  2YEV C;  3NZQ A;  1HG5 A;  3C98 B;  3ZJ2 A;  4GK0 E;  1D1C A;  1SHZ C;  1ZEE A;  2CE7 A;  1MMA A;  3OJA A;  2E9X B;  2VL8 A;  4C91 A;  2V7I A;  4EB6 E;  3PUA A;  3RC8 A;  1E1H B;  2YU1 A;  4DBQ A;  4AQF A;  4BJN A;  1S94 A;  3ZMT B;  3H37 A;  4ZS3 A;  1FEW A;  2GK9 A;  2X9Y A;  3ZYL A;  5HXE A;  4CQI A;  5JRE A;  1UX5 A;  5LHI B;  1T98 A;  3AA1 B;  4ZI7 E;  4IE0 A;  3ZEF B;  4YHJ A;  4HN9 A;  2ZM2 A;  4ASK A;  4UV9 B;  2J1D G;  1Z0P A;  2ODV A;  4DO0 A;  1MMG A;  2ZLY A;  1OWA A;  4FJO A;  3SOL A;  4UIG A;  1WR6 A;  4H9Q C;  3CPZ A;  3LBX A;  3VKH A;  3V5U A;  4H9R C;  4YJ3 E;  3E08 A;  2X9X A;  3QC9 A;  4ZI2 C;  4CXX A;  3C64 A;  4IGU A;  5HXH A;  2ZMA A;  5LJM A;  3AAA B;  3L3P A;  3D0T A;  4TUY E;  3HKC E;  4PK5 A;  2E9X C;  5F8P A;  3K3N A;  3AA7 B;  5HYA A;  4N78 D;  2XAS B;  1D0X A;  3W15 B;  5J2U E;  5LXT E;  2KIN B;  1HCI A;  2WSS V;  3PUS A;  4MFR A;  2CWY A;  3EVY A;  2Z6E A;  2LSJ A;  4HEA A;  5KMG P;  4L0R A;  2QA7 A;  3DJB A;  4KBM B;  2N1G A;  3F31 A;  3OYZ A;  1MNE A;  2CLY B;  3IBP A;  3MZK B;  3N9N A;  2NTX A;  3ETV A;  3MXZ A;  4WBN E;  5F3J A;  2CWO A;  2IAK A;  1HG2 A;  2K48 A;  2V1D B;  3CWZ B;  3N2K E;  4ZI3 C;  5LGU B;  2V7L A;  4ANJ A;  2MOZ A;  3NRY A;  4TZ4 C;  2C5I T;  4IE4 A;  4OYK A;  5HWX A;  4UVB B;  2LSG A;  3JC6 D;  2MTQ A;  3NZP A;  3ZN1 B;  2CA5 A;  2EHO D;  3WI3 A;  2D5U A;  4YFS A;  5L3G B;  3K8P C;  2KND A;  3ZCI A;  2JRK A;  3ONX A;  3T8O A;  3FHN A;  1OXZ A;  3RX6 A;  2DLR A;  2KZ7 B;  1BR4 A;  2D0T A;  1G73 A;  5CA1 E;  4H9N C;  4O2B E;  5LGN B;  1HF8 A;  3FXE B;  2HPJ A;  3MKD A;  4QXB B;  4L9I A;  3CX7 B;  4H9P C;  4QXH B;  5LCY A;  5LP6 E;  3KFW X;  2JPF A;  5HXR A;  3E22 E;  2DWG A;  2PFV A;  2XTL A;  4U72 A;  4UXN B;  5CB4 E;  1MIW A;  2NW9 A;  3O1H A;  5LBM A;  4MHC A;  1B7T A;  3AAI A;  3PDY A;  1IZN B;  2JQQ A;  4WW0 A;  4UVC B;  3C51 A;  3O9X A;  3KV4 A;  4O4H E;  5EK3 A;  3BQL A;  2KLQ A;  3I1A A;  1D0Y A;  1MMN A;  3ANW A;  2ACX A;  5L3E B;  4I4T E;  4BA9 A;  3UTK A;  3DTO A;  4H63 V;  4UEM A;  1FMW A;  2WMO A;  3N9L A;  4IHJ E;  2ZM0 A;  3LJC A;  4ZI2 D;  2I59 A;  5FP3 A;  4QHO A;  2PBI A;  1YD8 G;  1SA0 E;  1NAF A;  2QGS A;  2RA1 A;  4JEH B;  5A1L A;  4BAY B;  5FXZ A;  2LOP A;  2X0L B;  3U78 A;  4K0U A;  4AQG A;  1LRZ A;  2CCQ A;  4AI6 A;  2OA5 A;  2IC6 A;  4UV8 B;  3RKO A;  3SRZ A;  2BVL A;  2JMK A;  4FI5 A;  5FXX A;  3AVS A;  4H63 H;  3J7Y q;  2V7K A;  4ZHQ E;  4AKR B;  2L3L A;  3KV9 A;  3ZMU B;  3VU7 H;  4Z8X A;  3IHR A;  2JMH A;  1FMV A;  2LEH A;  1BR1 A;  3IF8 B;  3KV5 A;  4PJN A;  4TV9 E;  3C50 A;  4JLE A;  4PJL A;  1KK7 A;  3ZMV B;  3R6N A;  5HAX A;  4HE8 A;  1YW0 A;  3C4Z A;  5EK4 A;  4P0B A;  4CI1 B;  1MIV A;  4ZI3 D;  2E8I A;  3N9P A;  4P09 A;  2VB6 A;  4OFZ A;  5JR9 A;  5L3F B;  2XHE B;  5EZY E;  4ISS A;  5FXV A;  4IDZ A;  4DMV A;  2KWI B;  4H9O C;  4TN7 B;  2VAS A;  2PJQ A;  3GWH A;  3PUG A;  2W00 A;  5JDN A;  4AKI A;  4HGA A;  2W63 A;  5TAO A;  2X9W A;  2L8K A;  2WAU A;  5LYJ E;  5JRC A;  3ZMS B;  3LK4 2;  2Q9Q A;  5H6Q B;  5ADX L;  2UXX B;  4JUY A;  3AB3 B;  3RYH E;  3LBX B;  4HTE A;  4EZ4 A;  3MAC A;  3IEE A;  4XAX B;  4QX8 B;  5FYM A;  4GIW A;  2X68 A;  5LA6 E;  4KP3 C;  2NOX A;  2LOS A;  3Q9D A;  4A56 A;  3J9X 1;  2SPC A;  2CMR A;  4ILU A;  4M1P A;  5IHY A;  3M65 A;  1NWM X;  2CXF A;  3CX6 B;  4O4J E;  1KNZ A;  1H7C A;  2H3R A;  2YK0 A;  5FY7 A;  4AQF C;  2LM9 A;  2Y48 B;  3FBL A;  4OYJ A;  3ZYK A;  1ZV4 X;  5JVD E;  3U3I A;  1LVK A;  3AA6 B;  2MBG A;  2LSY A;  3RH3 A;  2WWU A;  3S4U A;  4ZOL E;  3RYC E;  4EOZ B;  1VRB A;  3N2O A;  2X9H A;  3ZC0 A;  1MND A;  2BDE A;  3UUM A;  3NBX X;  1O3X A;  2C5J A;  4XBF B;  2L9Q A;  3ZC1 A;  4IE6 A;  4MBQ A;  3N9O A;  5DQW A;  3RRW A;  5JR9 C;  3KIN B;  3CVR A;  4NUU A;  3CML A;  2K9A A;  4PK4 A;  3ESL A;  3NRX A;  3ZCJ A;  1X79 A;  3EDV A;  3LFM A;  4H9S E;  3N2G E;  3OYX A;  2EHO A;  3SS1 A;  4QKN A;  3VHL A;  3I9Y A;  3A5X A;  3GN5 B;  1HTJ F;  3Q5W A;  3CX8 B;  4X1Y E;  4EZH A;  5H6R B;  1US7 B;  4GYR A;  4O4L E;  3BQI A;  2CXD A;  2Q9Q C;  2HPL A;  2H7V C;  1FIO A;  1LVF A;  3SWH A;  5C8Y E;  2LHN A;  3ETU A;  4PK6 A;  1IAP A;  3LG7 A;  2Y6X A;  3MJX A;  3KBU A;  2X51 A;  3KV6 A;  1Y64 B;  4V1A v;  3RPU A;  3PU8 A;  3F57 A;  4PJM A;  4JEU B;  4KMC A;  5LNK A;  2X67 A;  4UF0 A;  2W62 A;  4I50 E;  2IW5 B;  3CQC B;  5HXC A;  1V9D A;  4TX5 A;  3I9W A;  3HKE E;  3AAE B;  3I0O A;  4GYS A;  4ZS2 A;  2XAJ B;  5AFU L;  3PTR B;  4OHF A;  4CXY A;  3ZYM A;  4AKH A;  2N9D A;  3Q2M A;  4TV8 E;  2VK9 A;  4F6R C;  2DWK A;  4EAH A;  3VKG A;  4GOU A;  2P9B A;  1VOM A;  2KMF A;  4AKL A;  2W0G A;  4ERR A;  4DVD A;  3Q5X A;  3UUN A;  1WRD A;  4KUM B;  5KX5 E;  5KDM C;  3GMI A;  3H3A A;  3ZJ1 A;  1BR0 A;  1WYB A;  1MIY A;  2E9X A;  2YU2 A;  5FXW A;  5JDL A;  1WYC A;  4HFV A;  3UFE A;  1G8X A;  5IYZ E;  3O1I A;  3N9M A;  5JDQ A;  5LHH B;  1QUU A;  3FXD B;  4CXW A;  4L5G A;  3KDS E;  2DCF A;  4NUV A;  3HI2 A;  3BQK A;  2W61 A;  4X1K E;  2ZM8 A;  2K24 A;  4E7S A;  4EIW A;  4X1I E;  2NTY A;  4O2A E;  5HWY A;  2MYS A;  4DBR A;  5CA0 E;  2V7J A;  3CQG B;  3N9Q A;  4QX7 B;  2JJ9 A;  1AJ3 A;  1EZ3 A;  4IE7 A;  3P8C D;  5FMN A;  4PFO A;  1S35 A;  3B13 A;  2NWB A;  4AKG A;  4EYU A;  2BZB A;  2N2N A;  4CI3 B;  4O4I E;  3KVB A;  3TKL B;  5JR9 B;  2LJL A;  2X66 A;  5JDM A;  4OK0 A;  5DJQ C;  2A72 A;  4PFP A;  3FB2 A;  5LHG B;  3UUX B;  5J2T E;  3CKD A;  5JQG E;  2HH7 A;  2M67 A;  3E0Z A;  2K5B B;  4U74 A;  2BVM A;  3QK6 A;  3ZPO A;  4UVA B;  3GA8 A;  2Q9Q D;  4B6X A;  1QSD A;  2VWA A;  2PG8 A;  3RYF E;  4PJJ A;  4AXP A;  4YJ2 E;  5JRC B;  1BR2 A;  2DNX A;  4C90 A;  3RRC A;  2WBL A;  5DAB A;  2Q9Q B;  2IC9 A;  4DND A;  3C4W A;  1HFA A;  4PNI A;  3KVA A;  3CQX C;  1YKE B;  3O1J A;  1HX8 A;  2VKO A;  1WLX A;  3LK2 B;  5ETW A;  2XUE A;  3HL6 A;  4CZZ B;  3HR0 A;  3RYI E;  3OBV E;  2A3D A;  3DP7 A;  5L3D B;  1HS7 A;  3OKQ A;  4DMW A;  3F2E A;  5M4Y A;  1YKH B;  2KWH A;  1UX4 A;  1D1A A;  4IST A;  5JDG A;  2ES0 A;  1ZKE A;  4I43 B;  2A2F X;  5GON E;  3N5L A;  5JH7 E;  4IIJ E;  2D2S A;  2XAG B;  3KBT A;  4X20 E;  3EUH A;  2NW8 A;  5L3B B;  5LBQ B;  2ODU A;  2V7M A;  5JDH A;  3MA9 A;  5LOV E;  1LKX A;  3EDU A;  4CI2 B;  3PUQ A;  5BMV E;  4O8S A;  4EYY R;  2RP4 A;  2Y8D A;  3PE0 A;  3GN5 A;  3RC3 A;  4PAG A;  4YLH A;  2C0S A;  2LE8 A;  2WM9 A;  1CUN A;  3L09 A;  3MK7 C;  3AA0 B;  3WAK A;  4QWN B;  4UEL A;  4HKA A;  4E7Z A;  1U4Q A;  2YIN A;  2XQY A;  3HA4 A;  5FY0 A;  3UT5 E;  3ZMZ B;  2DHR A;  4MLK A;  2EHO B;  2LHR A;  2VKH A;  4WNK A;  3B57 A;  1D0Z A;  5E0O A;  3QUJ A;  4XZC A;  3ZN0 B;  2G0U A;  4G2A A;  2CLY C;  3AVR A;  5HXS A;  4GK5 E;  4MAL A;  2KT9 A;  4QXC B;  3WAJ A;  3PUR A;  2DI4 A;  4I55 E;  2H7O A;  2NP9 A;  3K3Q C;  5LG4 A;  2LT3 A;  2LSK A;  5L3C B;  4BJM A;  5DQV A;  5LGT B;  5L2L A;  4IE5 A;  2KXP B;  3I0Q A;  4WBO A;  4EXT A;  3V5S A;  2CM0 A;  2B1E A;  2CEA A;  2XAQ B;  2WMN A;  4UF0 B;  5FNV E;  5EK2 A;  3UUL A;  5JDF A;  1UCU A;  3K3O A;  1U5P A;  4ADZ A;  3C4X A;  3ANW B;  2VKJ A;  3JC6 C;  5FY1 A;  4G63 A;  3R84 B;  4J2C A;  2EHO C;  3HKD E;  2V26 A;  3BK9 A;  2NW7 A;  5J1G A;  2VKD A;  2XAF B;  5LJN A;  2LSI A;  2CXL A;  1D1B A;  1IJ6 A;  2XAH B;  3FBZ A;  1IJ5 A;  3O4X E;  1ZHC A;  1MMD A;  3ZLI A;  2C5K T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...