2LE8A

The protein complex for dna replication
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords DNA replication licensing factor MCM6
publication title Structural insights into the Cdt1-mediated MCM2-7 chromatin loading
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 114
sequence length 114
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18263 MCM6_C MCM6 C-terminal winged-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2le8A00
2LE8A 2KLQA
chains in the Genus database with same CATH superfamily
5JDQA 4DR5T 2JQKA 3I9YA 3ABVA 5HYAA 2F4VT 5AQLB 4O8SA 1OEDB 2A72A 3EAMA 2LEHA 2C5IT 5JVDE 1HG5A 1BR1A 4H63H 3ZMZB 4YTPA 3ESLA 3V5UA 5CFBA 1MNEA 5LXTE 3UUMA 2HPLA 4OHFA 3UU4A 4DIDB 4ILCA 3F2EA 4EAHA 2LHRA 3A7MA 1J5WA 2Q9QA 4CI2B 4JV5T 4LMJA 1FJGT 4LMLA 2EHOD 3RKGA 3ZEFB 5IHYA 1UX5A 4K0KT 4ZI3C 4QXBB 2CLYC 4QX8B 2JIWA 1YQ3A 4G63A 3RIUA 4DV7T 5DABA 3K3NA 5ABEA 1WCRA 5DJQC 4YFSA 5HEUA 4H9PC 2YU1A 1G8XA 1XMOT 3P4WA 3ONLC 3JC6C 1XWMA 2ZM2A 4QXCB 2UUCT 3PDYA 2NR4A 5IUXA 3RIAA 3O1IA 4HTEA 2X9XA 4YTMA 2XQAA 2C0SA 5A1LA 1OEDA 2VKDA 4MHCA 2CM0A 4LMKA 4ZI7E 4AI6A 5HWYA 2CXLA 4UR9A 1WRDA 3SFDA 4IREA 2WZIA 3LFMA 5L4EA 4U33A 2VB6A 2E9XB 3RI5A 3H3MA 4IE4A 4I50E 3Q5WA 3B13A 3C4ZA 5HEJA 5HXCA 4AKRB 4YSZA 1D0YA 1HG2A 5FMNA 2XQ4A 3OKQA 1HNZT 3RQUA 2YINA 5L2LA 3AE5A 5HCMA 3KVAA 3A5XA 2NTXA 4I0UA 4OX9T 4QX7B 2J62A 3OTOT 4ZS3A 3FBZA 5LGNB 2WP9A 5LOVE 2XHEB 4HWFA 5LJMA 3Q5DA 4PJNA 4U2YA 2CPTA 2ZM8A 4C91A 4PJJA 3Q5XA 4HWDA 4A5XA 1U4QA 4XZCA 4EIWA 2VKOA 1Z8UA 3AE7A 2ODVA 3C51A 4ADZA 5AQTB 3TLTA 1W09A 4J2CA 5LG4A 5FY7A 2OLTA 5J1GA 5JRCB 2BBJA 4PK6A 4ZI2C 2E9XA 3FZMB 3HA4A 2JQHA 4DR2T 2ODUA 5ABFB 2JMKA 4UVCB 4XAXB 2PJQA 4JEUB 3AA6B 2BDEA 4JI3T 2IC6A 2V5DA 3J7Yq 1ZEEA 4U2ZA 4ZZBA 2LJLA 3NZQA 3EDVA 2KSRA 3RQWA 5FXZA 4AKIA 2VL0A 3L8RA 3ZT7A 2W0GA 1IBKT 3AB3B 1WR0A 3UULA 2NP9A 3P7IA 4IDQA 2VURA 2WY2A 2XQ9A 3ZPOA 4ERRA 5FKYA 1MMGA 1JNRA 3MACA 4ZZCA 1R8IA 4OFZA 3KV4A 4IL4A 3CVRA 3J9X1 3MXZA 5L4HA 5LHIB 2HPJA 2I59A 3K3OA 4YY3T 2DWGA 4KI0F 2XSAA 4JI5T 4HKAA 3HKBE 4GK0E 3ZSTA 5ABFA 2K48A 2WU5A 1W9RA 4QH1A 2D0UA 3IF8B 5L3GB 5JREA 4LF9T 4AQFC 1D1AA 4LF6T 3D0TA 3MK7C 3K8PC 3CQCB 2NW8A 3N9MA 3BK9A 3ZT6A 1N33T 4CN6A 5M4YA 2FUPA 2VVSA 3GMIA 5FNVE 4IDZA 5AQQB 4N78D 1S94A 1SUMB 4CXWA 3FXDB 3N9QA 2E5LT 4YHJA 4JUYA 3NRYA 2I6HA 3FZLB 2WDQA 3OPCA 3UUXB 4HGAA 4NXMT 4H9SE 4JI8T 5DQWA 5EK4A 4DR1T 2UUAT 3VKGA 4BA9A 3OBVE 4ZHQE 2XY8B 2W63A 3Q2MA 4F6RC 3NRXA 4QH4A 4U31A 3IBPA 2LSJA 4LF5T 3IHRA 5LJNA 1HNWT 3W15B 2B76A 2AE9A 4IDPA 4U7IA 2CXDA 3I0QA 2PBIA 3RX6A 5JDMA 3FXEB 3UFGA 4Q25A 2E5VA 3P4RA 2XSBA 2CA5A 4YJ3E 5LB7B 1YKHB 5HXSA 5JDFA 4LF7T 4HFEA 5ABGA 5LA6E 3RLFF 2H7OA 1FIOA 2BG9B 2JJ9A 5AFUL 2XAGB 4PNIA 4UF0B 3AA0B 3EHZA 4WYVA 4GOUA 3T8OA 3PJAJ 3ZYLA 3NKZA 4F8HA 1VOMA 2XQYA 3AE3A 3AE1A 1US7B 4IE7A 4L0RA 3X1DA 3C4WA 1NWMX 5AQRB 4GKKT 4X62T 5L3BB 2WSSV 3N5LA 2V6YB 3VRAA 2GK9A 4IL9A 5ETWA 3CIRA 2IAKA 3RRCA 5FP3A 3U3IA 3KFWX 4DO0A 3ZN1B 5L3EB 2RPAA 3K3QC 2UUBT 3H37A 5BR8T 1N34T 2XJ7A 5E0OA 4AQYT 4HFDA 1S35A 3LJCA 1D1BA 1I6ZA 3ZYKA 5AQGB 3KV5A 5CB4E 5LCYA 4JEHB 2WS3A 2LSKA 4HFCA 1VCSA 4EZHA 2VASA 2Y48B 4O2BE 4U74A 3P50A 1LRZA 3EDUA 4EXTA 2Q9QC 4B6XA 4DV0T 2EHOB 2VL8A 2W61A 2ACXA 2BS4A 3KBUA 4ANJA 4JYAT 2CCQA 2BG9A 4DV6T 4TWDA 2CWOA 4UF0A 4TUYE 2XZEA 2LKGA 5H6RB 3H3AA 2Z6EA 3O4XE 5HEOA 2XUEA 2ZMAA 2WBLA 2XM1A 4B3TT 5KX5E 1YW0A 3O9XA 2WU2A 5TAOA 2BKOA 2V6YA 5HXHA 3PUQA 4BJMA 1G73A 3BQIA 1O3XA 5JR9B 2BVLA 2WDVA 4WNKA 1WFDA 1KF6A 3UU8A 4A56A 4Z91A 5HXRA 1DU2A 1OEDC 3SS1A 2PFVA 4C90A 3UU3A 3AE8A 3M65A 4MALA 4DMVA 5HAXA 5KXJA 5JDNA 3F31A 4O4IE 4TZ4C 4BJNA 4TV9E 4O2AE 2CLYB 1E1HB 3ZN0B 2E2AA 2EHOA 4EOZB 4CN1A 2ZLYA 4I4TE 2XAFB 2R6GF 2VWAA 4ILAA 3WAJA 1CUNA 3RRWA 4GK5E 1MNDA 4UVAB 5HCJA 5LBMA 3NVOA 5LMNT 2KT9A 3E08A 4AKLA 3N9LA 2YDQA 3HKCE 3JADA 1GQEA 1WLXA 4X1KE 5JR9A 2KWHA 2KLQA 3V5SA 1FEWA 3LG7A 4WBNE 4HFVA 3T1YT 4DV4T 1NEKA 4H9QC 2LM9A 2X0HA 4H9NC 5IYZE 4IE6A 5HEGA 2JQQA 3KINB 2YK0A 1H7CA 2LRLA 3CKDA 4EGWA 4H63V 5HWXA 2WCAA 3L3PA 5JDGA 4ZOLE 2LSGA 5AQSB 2E9XC 1Z0PA 5FXXA 3TLUA 2M67A 4YJ2E 2X0LB 4PAGA 5ABHA 3C98B 3EVYA 1FMVA 2WMNA 4COFA 4L9IA 4NUUA 3JC6D 1WYBA 3AEDA 2V8SV 1YD8G 3KV6A 4L5GA 4ZEYA 3ZC0A 5FY1A 2V7JA 2BS3A 2DCFA 3CX6B 3PUYF 4X1YE 3ZYMA 2XQ5A 2B1EA 2PG8A 1KFYA 3ZMUB 4EB6E 5LHGB 1OXZA 1Y01A 2HN1A 3PTRB 4LFAT 4GYSA 4NIQA 4HN9A 1UK5A 1SHZC 4UXNB 2XPKA 3O1HA 4DVDA 5EK3A 2W66A 2V1DB 4P09A 3AAIA 3FZHB 1YXRA 1HCIA 1BR4A 4YLHA 3G06A 3QNUA 4U72A 4CN4A 3JAEA 3KVBA 3QB5A 1U5PA 4DBQA 5AQOB 5F5WA 3C50A 4P1NA 4B3RT 3GN5B 3O1JA 2QGSA 1N32T 1MMAA 3OVUA 2DL1A 2KXPB 3CX7B 4Z90A 3R84B 3OJAA 4PJLA 4FJOA 2N2NA 1ZOYA 1HTJF 3UT5E 2DLRA 1UURA 2MBGA 3R6NA 1T98A 4U3CA 1XNRT 4X66T 3LK42 2FJBA 4I43B 4YSYA 3ZJ2A 4E7SA 5FL1A 4DMWA 2XQ8A 4TWFA 1VCTA 1MIYA 2BVMA 5FVKA 3RGLA 2LLYA 4QXHB 4ZI2D 3PUAA 2XAJB 2CRBA 1KNZA 2X68A 4KP3C 2WZHA 4UV8B 2D0TA 2QA7A 2J4GA 2JMHA 3UUNA 3RC8A 5FXWA 4UIGA 1MIWA 1EZ3A 3NZPA 3SFEA 4DR7T 2LSIA 3AEAA 2VKHA 3PUSA 5FY0A 2CWYA 3GN5A 4MLKA 2RP4A 4CXXA 3VHLA 4WW0A 4PK5A 3ANWB 4QHOA 2NWBA 4NPPA 2WWVA 3CPZA 1MIVA 3OYZA 3RHWA 3N9OA 3PUXF 5FVLA 5LGUB 2QYWA 1KNRA 1X9BA 2VK9A 4PFOA 2WAUA 1OEDE 3CX8B 3KBTA 5AQJB 3RYFE 4HWHA 4EEBA 3FB2A 4KUMB 2CMRA 3RKOA 3VR9A 3CMLA 2LKHA 2XQ7A 2G0UA 3SRZA 2X9WA 3RPUA 2LE8A 5AQNB 1IZNB 3ZCIA 4DUZT 1XZYA 2WB5A 4TN7B 5AQKB 4O4HE 3PJAA 4OYJA 3ZSSA 2IW5B 4ILUA 3UU6A 2D2SA 4WZXA 4LFBT 4NUVA 4DBRA 4AKGA 4QKNA 5L47A 1QUUA 2V7LA 2KINB 2CBJA 2P9BA 3P4PA 1ZHCA 4YTNA 2BKPA 3CQXC 3PUGA 1BR0A 1LVKA 4QH5A 4OYKA 3PURA 2JRKA 4O4JE 4MFRA 3ANWA 1KK7A 2H88A 4IDOA 3I9WA 4X5TA 5AQIB 5AQHB 3UQ7A 4IHJE 3B5MA 2UXDT 2N9DA 2AXDS 2SPCA 4JI1T 3ONJA 4ISTA 1UX4A 5LGTB 4AIUA 4EYYR 2BG9C 1WR6A 3LSVA 2YDSA 1MMDA 1XDPA 2K3WA 2FBWA 2HH7A 4UELA 1OWAA 3RIFA 1QLBA 1Y64B 2CHOA 2CBIA 2OV9A 3SOLA 2YEVC 2W67A 3PUVF 4KBMB 3EABA 2HHHT 3ZMVB 4JI6T 3HKDE 4YXDA 2ZM6T 2CE7A 3DTOA 2QRXA 3E22E 4IIJE 4X64T 2ZM0A 5AQFB 4ZXLA 5L3CB 2NOXA 3LK3B 2LRKA 4JI2T 2Y6XA 2JPFA 2V6XA 2M6IA 5EK2A 4BAYB 2ES0A 3KDSE 4UV9B 5J2UE 4HWCA 5JH7E 2NW9A 3PU3A 5AQMB 4HE8A 1XMQT 3ZKRA 4LFCT 5CA0E 3TLVA 5DQVA 1NENA 2JQ9A 2H7VC 1SA0E 3HI2A 2WDRA 2FJAA 4EZ4A 4ISSA 4TNWA 1UUSA 4CQIA 3A8YC 2EHOC 3TLSA 2VVNA 3AAAB 2MTQA 4U7YA 3RIUC 2ACZA 1LVFA 4KX6A 4CXYA 1E2AA 5JDHA 2PTFA 2M6BA 2BBHA 3ZT5A 3PE0A 1X79A 3BQLA 2H3RA 2LM2A 2X9HA 3PUWF 1W0AA 4TV8E 2LSYA 4A98A 1T8BA 3I0OA 2DHRA 2DWKA 5JR9C 4X20E 2MAWA 3PV0F 2UXNB 1J1JA 2V7MA 3TKLB 2A9UA 3UTKA 4P0BA 2J47A 2YKSA 3DJBA 2Q9QD 3JAFA 5KDMC 3PUZF 4HWIB 1BR2A 3AAEB 1M7KA 3UUBA 2L8KA 4AXPA 2L3LA 4PFPA 2K9AA 2L9QA 1UCUA 1LKXA 5CA1E 4PJMA 4X65T 3OYXA 4LF4T 4ILBA 4TNVA 3PU8A 3Q9DA 4EYUA 2XAQB 5L3DB 1XDOA 5HXEA 3MJXA 4AKHA 3I1AA 4JLEA 2LOSA 3FZFB 3ZMSB 3P8CD 2X66A 3EI0A 4CI3B 4KMCA 2J1DG 2D5UA 4IE0A 1MMNA 1IBMT 4CZZB 2LOPA 4B3MT 3JCFA 2A3DA 3AEGA 5C8YE 1L0VA 2W62A 4JBWF 4PK4A 2UXXB 5HEHA 2CEAA 2KWIB 4ZI3D 1KEYA 3QB5K 5LYJE 2Y8DA 3AECA 3VU7H 4DV5T 2UXBT 2MOZA 2WQYA 3AA7B 5JDLA 2CHNA 1V9DA 3CK6A 3M3ZB 1ZP0A 4PW8A 3T1HT 3EUHA 5ADXL 2C5KT 4OK0A 4DNDA 3AE6A 4MBQA 3AEFA 5LBQB 3N2GE 1T72A 2IHR1 4KHZF 3K1SA 5KMGP 5L3FB 3N9NA 4Z8XA 3AVRA 4TWHA 3C64A 3AEEA 4O4LE 3RF1A 5C3JA 2VKJA 5AQPB 3E0ZA 4I55E 4IE5A 4WBOA 3QK6A 2XQ6A 3U78A 3LBXB 1IAPA 4IGUA 1N36T 1HX1B 1UGOA 4KHPT 3AE4A 3DP7A 1J5ET 4TX5A 4YSXA 4ASKA 2NW7A 1SE7A 3ZC1A 1IBLT 2V7IA 3WAKA 3N2KE 3CWZB 2CXFA 2E9XD 4IDNA 2K24A 3HKEE 3S4UA 3P4SA 4JI7T 1FMWA 2BG9E 2V7KA 2YDRA 1YKEB 3UQ4A 2X67A 3FBLA 1B7TA 4YT0A 5GONE 3MA9A 3UFEA 1M62A 5LP6E 3F57A 5F8PA 3LK2B 3HL6A 3RH3A 1YQ4A 4JI4T 2K5BB 5BMVE 5CJ5A 2A2FX 2V26A 4UEMA 2WM9A 3NBXX 3WI3A 2YOEA 3LBXA 4K0UA 3N9PA 5AQVB 4G2AA 1ZKEA 5C2TA 4E7ZA 2KZ7B 5FL0A 2X0YA 4AQGA 2N1GA 2BKNA 4JI0T 2XM2A 3RYCE 4DV2T 1WYCA 4HFBA 3GWHA 3LDQB 3ONXA 2BZBA 4EV6A 3AE2A 4ZS2A 4NXNT 5JRCA 1W0BA 4LF8T 3MKDA 4H9RC 1D1CA 4GIWA 4V1Av 3SWHA 5FYMA 3HR0A 2V5CA 5H6QB 4HEAA 3RYHE 4DR6T 2E8IA 4GYRA 2OA5A 3RC3A 5LHHB 2QVAA 3TLWA 2RA1A 1IJ5A 3IEEA 4DR3T 2IIUA 1D0ZA 1HNXT 3L09A 2IMLA 3FHNA 3QUJA 4DV3T 2XASB 2X9YA 4YHHT 2D9DA 4H9OC 3AXJB 3L39A 3ETVA 2HN2A 1HS7A 1KNPA 2IUBA 2UU9T 2IC9A 4DR4T 3P4QA 4DV1T 4UVBB 3ETUA 4P0AA 3AEBA 4AQFA 3UU5A 2BS2A 3QC9A 3CQGB 2DI4A 5LMUT 1JNZA 1D0XA 3IA3A 1I94T 3RYIE 4GKJT 2XQ3A 1IJ6A 3VR8A 3B57A 3C4XA 5CGMA 3ZJ1A 5LNKA 5FXVA 2LHNA 3NWIA 2KNDA 2KMFA 3FZKB 3ZCJA 3AVSA 4DUYT 1XNQT 4HFIA 5AQUB 5JQGE 2IDOB 4AISA 1AJ3A 4QWNB 2FJEA 2NTYA 4FI5A 2XAHB 5EZYE 2XTLA 1VRBA 2MYSA 3AE9A 5LG3A 5JTGA 2VQFT 3AXJA 2UXCT 3ZLIA 2YU2A 1NAFA 4EEDA 1E7PA 3VKHA 3MZKB 4A97A 4X1IE 4CI1B 3Q5EA 1CHUA 2WWUA 2I0MA 1ZV4X 2H89A 2YN6A 4IT4A 4M1PA 3KV9A 1HR0T 2W2UA 2Q9QB 2DNXA 3BQKA 2X51A 4B3ST 2C5JA 2W00A 3N2OA 2VQET 3VRBA 1QSDA 4XBFB 1HF8A 2W4XA 2WMOA 4HFHA 5IWAT 2FJDA 1T7SA 1HX8A 5F3JA 5J2TE 1HFAA 3ZMTB 3QOFA 2MPKA 2LT3A 3GA8A 5J0ZA 3AA1B
chains in the Genus database with same CATH topology
3VU7H 5JDQA 3LK42 2MOZA 4I43B 5LJNA 2CXDA 3ZJ2A 3AA7B 3I0QA 2PBIA 4E7SA 3RX6A 5JDMA 3FXEB 4DMWA 5JDLA 3I9YA 1V9DA 5HYAA 4PW8A 2CA5A 1MIYA 4YJ3E 2BVMA 3EUHA 5ADXL 2C5KT 4O8SA 1YKHB 4OK0A 4DNDA 5JDFA 5HXSA 4MBQA 4QXHB 5LBQB 4ZI2D 2A72A 3PUAA 2XAJB 3N2GE 2LEHA 5LA6E 1KNZA 2H7OA 2X68A 2C5IT 4KP3C 5JVDE 1FIOA 5KMGP 2JJ9A 1HG5A 5AFUL 1BR1A 2XAGB 4H63H 4PNIA 3ZMZB 4UV8B 4UF0B 5L3FB 2D0TA 3AA0B 2QA7A 3N9NA 2JMHA 3UUNA 3RC8A 4GOUA 5FXWA 3T8OA 4UIGA 1MIWA 4Z8XA 1EZ3A 3AVRA 3ESLA 3V5UA 1MNEA 3ZYLA 5LXTE 3NZPA 3C64A 3UUMA 2HPLA 4OHFA 2LSIA 1VOMA 2XQYA 2VKHA 4O4LE 3PUSA 1US7B 4IE7A 4L0RA 2VKJA 3C4WA 1NWMX 3F2EA 4EAHA 2LHRA 5FY0A 5L3BB 2CWYA 3E0ZA 2Q9QA 4I55E 4CI2B 4IE5A 4WBOA 2WSSV 3QK6A 3GN5A 3U78A 3N5LA 3LBXB 1IAPA 4IGUA 2RP4A 2EHOD 4MLKA 4WW0A 3VHLA 3DP7A 4CXXA 4PK5A 4TX5A 3ANWB 4QHOA 2GK9A 3ZEFB 5ETWA 2NWBA 3CPZA 5IHYA 1MIVA 1UX5A 2IAKA 3RRCA 4ASKA 3OYZA 2NW7A 4ZI3C 4QXBB 2CLYC 3N9OA 5FP3A 4QX8B 3U3IA 3KFWX 4DO0A 3ZN1B 5L3EB 5LGUB 3ZC1A 3K3QC 2VK9A 2V7IA 3WAKA 3H37A 3N2KE 4G63A 3CWZB 5E0OA 2CXFA 4PFOA 2E9XD 2WAUA 5DABA 1S35A 3K3NA 3LJCA 2K24A 1D1BA 3HKEE 3S4UA 3ZYKA 5DJQC 3KV5A 5CB4E 3CX8B 4YFSA 1FMWA 2V7KA 3KBTA 5LCYA 4JEHB 1YKEB 4H9PC 2YU1A 2X67A 2LSKA 1G8XA 3RYFE 3FB2A 3FBLA 3JC6C 2CMRA 4KUMB 4EZHA 3RKOA 2VASA 2Y48B 3CMLA 4O2BE 1B7TA 2ZM2A 2G0UA 4QXCB 3SRZA 2X9WA 3PDYA 3RPUA 5GONE 4U74A 3MA9A 1LRZA 3EDUA 3O1IA 4HTEA 3UFEA 4EXTA 2X9XA 2Q9QC 2LE8A 2C0SA 5A1LA 5LP6E 1IZNB 3ZCIA 4B6XA 2EHOB 3F57A 2VKDA 2VL8A 2W61A 4TN7B 5F8PA 4O4HE 2ACXA 3LK2B 4MHCA 3HL6A 3KBUA 2CM0A 4OYJA 4ANJA 2IW5B 4ZI7E 3RH3A 2CCQA 4AI6A 5HWYA 4ILUA 2K5BB 2CXLA 5BMVE 2CWOA 2D2SA 4UF0A 1WRDA 4TUYE 5H6RB 3H3AA 2Z6EA 3O4XE 4NUVA 3LFMA 2A2FX 4DBRA 4AKGA 4QKNA 2V26A 1QUUA 2XUEA 2ZMAA 2VB6A 2V7LA 2KINB 2E9XB 2WBLA 4UEMA 4IE4A 2WM9A 4I50E 2P9BA 1ZHCA 3Q5WA 5KX5E 1YW0A 3B13A 3NBXX 3O9XA 3WI3A 3CQXC 5TAOA 3PUGA 1BR0A 1LVKA 3LBXA 4K0UA 3C4ZA 3N9PA 4OYKA 5HXHA 3PURA 2JRKA 4O4JE 3PUQA 4MFRA 3ANWA 4BJMA 1G73A 1KK7A 3BQIA 3I9WA 1O3XA 4G2AA 5HXCA 1ZKEA 4AKRB 5JR9B 1D0YA 1HG2A 5FMNA 4E7ZA 2KZ7B 2BVLA 3OKQA 4WNKA 4IHJE 4AQGA 2YINA 5L2LA 2N1GA 4A56A 2N9DA 3KVAA 3A5XA 2NTXA 2SPCA 5HXRA 4QX7B 3RYCE 3SS1A 4ISTA 1UX4A 5LGTB 4EYYR 1WYCA 4ZS3A 3FBZA 1WR6A 3GWHA 2PFVA 4C90A 5LGNB 3ONXA 2BZBA 4ZS2A 5LOVE 2XHEB 1MMDA 3M65A 4MALA 4DMVA 5JRCA 2HH7A 4UELA 1OWAA 5HAXA 3MKDA 5JDNA 1Y64B 5LJMA 3F31A 3SOLA 4PJNA 4H9RC 2YEVC 4O4IE 4KBMB 1D1CA 2ZM8A 4TZ4C 4GIWA 4V1Av 3SWHA 4BJNA 3ZMVB 4C91A 4TV9E 3HKDE 4O2AE 2CLYB 1E1HB 4PJJA 3Q5XA 5FYMA 3ZN0B 3HR0A 1U4QA 5H6QB 4XZCA 2EHOA 4EOZB 2ZLYA 4I4TE 2XAFB 4HEAA 4EIWA 2CE7A 2VWAA 3DTOA 2VKOA 3RYHE 2ODVA 3C51A 3WAJA 1CUNA 4ADZA 2E8IA 3E22E 3RRWA 4GYRA 4GK5E 2OA5A 4IIJE 2ZM0A 4J2CA 5LG4A 1MNDA 2NOXA 3LK3B 5FY7A 5J1GA 5L3CB 3RC3A 4UVAB 2Y6XA 5LHHB 5JRCB 2JPFA 4PK6A 5EK2A 4ZI2C 2RA1A 1IJ5A 2E9XA 3HA4A 3IEEA 5LBMA 2ES0A 4BAYB 2ODUA 2KT9A 3E08A 3KDSE 4UV9B 2JMKA 4AKLA 4UVCB 5J2UE 4XAXB 2PJQA 2Y8DA 5JH7E 1D0ZA 2NW9A 3PU3A 4JEUB 3AA6B 2BDEA 3L09A 3N9LA 3FHNA 3QUJA 4HE8A 5CA0E 2XASB 5DQVA 2X9YA 3HKCE 2IC6A 1WLXA 4H9OC 4X1KE 5JR9A 2KWHA 3J7Yq 2H7VC 2KLQA 3V5SA 1SA0E 3HI2A 1ZEEA 3ETVA 1FEWA 4EZ4A 4ISSA 3LG7A 4WBNE 1HS7A 4HFVA 2LJLA 4CQIA 2IC9A 3NZQA 2EHOC 3EDVA 4H9QC 2LM9A 4UVBB 3AAAB 2MTQA 4H9NC 3ETUA 5FXZA 5IYZE 4AKIA 1LVFA 4IE6A 4P0AA 2JQQA 4CXYA 2W0GA 3KINB 2YK0A 5JDHA 1H7CA 3AB3B 3CKDA 4AQFA 4H63V 5HWXA 3UULA 2NP9A 3L3PA 5JDGA 4ZOLE 3PE0A 2LSGA 3P7IA 2E9XC 3QC9A 3CQGB 1X79A 2DI4A 3BQLA 3ZPOA 2H3RA 4ERRA 1Z0PA 2X9HA 5FXXA 1D0XA 1MMGA 3RYIE 2M67A 1IJ6A 2LSYA 4TV8E 3MACA 3B57A 2X0LB 4YJ2E 3C4XA 3I0OA 4OFZA 3KV4A 4PAGA 3C98B 3CVRA 3ZJ1A 3EVYA 3J9X1 5LNKA 1FMVA 2WMNA 5FXVA 2LHNA 4L9IA 2DHRA 2DWKA 5JR9C 4NUUA 3MXZA 3JC6D 4X20E 5LHIB 2UXNB 1WYBA 2KNDA 2HPJA 2KMFA 2V7MA 3TKLB 1YD8G 2I59A 3K3OA 3ZCJA 3KV6A 3AVSA 4L5GA 3UTKA 2DWGA 4P0BA 3ZC0A 3DJBA 2Q9QD 4HKAA 3HKBE 5FY1A 4GK0E 2V7JA 5JQGE 2K48A 2DCFA 5KDMC 3CX6B 1AJ3A 4QWNB 4X1YE 2NTYA 3ZYMA 2B1EA 2PG8A 4FI5A 2D0UA 3ZMUB 3IF8B 4EB6E 1BR2A 5L3GB 3AAEB 2XAHB 5EZYE 5LHGB 1OXZA 4AQFC 5JREA 2XTLA 1D1AA 3PTRB 1VRBA 2L8KA 3D0TA 3MK7C 2MYSA 3K8PC 3CQCB 4GYSA 2NW8A 4HN9A 3N9MA 4AXPA 3BK9A 2L3LA 4PFPA 2K9AA 1SHZC 2L9QA 3ZLIA 1UCUA 1LKXA 3O1HA 4UXNB 5CA1E 5M4YA 4PJMA 4DVDA 5EK3A 3GMIA 3OYXA 5FNVE 4IDZA 2YU2A 1NAFA 2V1DB 3PU8A 4N78D 1S94A 4CXWA 4P09A 3AAIA 3Q9DA 3FXDB 3N9QA 4EYUA 2XAQB 5L3DB 4YHJA 3VKHA 4JUYA 1HCIA 3MZKB 1BR4A 4YLHA 4X1IE 3NRYA 4U72A 4CI1B 2WWUA 5HXEA 3MJXA 4AKHA 3KVBA 1ZV4X 4DBQA 1U5PA 4M1PA 3I1AA 3KV9A 4JLEA 2LOSA 2Q9QB 3C50A 2DNXA 3BQKA 4HGAA 3UUXB 3ZMSB 3GN5B 2X66A 3P8CD 2X51A 3O1JA 2QGSA 4CI3B 4KMCA 1MMAA 2J1DG 2D5UA 2C5JA 4IE0A 1MMNA 2W00A 4H9SE 4CZZB 2LOPA 5DQWA 2KXPB 5EK4A 3CX7B 3N2OA 2A3DA 1QSDA 3VKGA 4BA9A 3R84B 4XBFB 1HF8A 3OBVE 3OJAA 4PJLA 5C8YE 4ZHQE 4FJOA 2WMOA 2W62A 4PK4A 2N2NA 2UXXB 1HTJF 3UT5E 1HX8A 2W63A 5F3JA 2DLRA 5J2TE 3Q2MA 1HFAA 2CEAA 2KWIB 2MBGA 3NRXA 3ZMTB 4F6RC 2LT3A 4ZI3D 3R6NA 3GA8A 3IBPA 2LSJA 5LYJE 1T98A 3IHRA 3AA1B 3W15B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE8 A;  2KLQ A; 
#chains in the Genus database with same CATH topology
 5JDQ A;  4DR5 T;  2JQK A;  3I9Y A;  3ABV A;  5HYA A;  2F4V T;  5AQL B;  4O8S A;  1OED B;  2A72 A;  3EAM A;  2LEH A;  2C5I T;  5JVD E;  1HG5 A;  1BR1 A;  4H63 H;  3ZMZ B;  4YTP A;  3ESL A;  3V5U A;  5CFB A;  1MNE A;  5LXT E;  3UUM A;  2HPL A;  4OHF A;  3UU4 A;  4DID B;  4ILC A;  3F2E A;  4EAH A;  2LHR A;  3A7M A;  1J5W A;  2Q9Q A;  4CI2 B;  4JV5 T;  4LMJ A;  1FJG T;  4LML A;  2EHO D;  3RKG A;  3ZEF B;  5IHY A;  1UX5 A;  4K0K T;  4ZI3 C;  4QXB B;  2CLY C;  4QX8 B;  2JIW A;  1YQ3 A;  4G63 A;  3RIU A;  4DV7 T;  5DAB A;  3K3N A;  5ABE A;  1WCR A;  5DJQ C;  4YFS A;  5HEU A;  4H9P C;  2YU1 A;  1G8X A;  1XMO T;  3P4W A;  3ONL C;  3JC6 C;  1XWM A;  2ZM2 A;  4QXC B;  2UUC T;  3PDY A;  2NR4 A;  5IUX A;  3RIA A;  3O1I A;  4HTE A;  2X9X A;  4YTM A;  2XQA A;  2C0S A;  5A1L A;  1OED A;  2VKD A;  4MHC A;  2CM0 A;  4LMK A;  4ZI7 E;  4AI6 A;  5HWY A;  2CXL A;  4UR9 A;  1WRD A;  3SFD A;  4IRE A;  2WZI A;  3LFM A;  5L4E A;  4U33 A;  2VB6 A;  2E9X B;  3RI5 A;  3H3M A;  4IE4 A;  4I50 E;  3Q5W A;  3B13 A;  3C4Z A;  5HEJ A;  5HXC A;  4AKR B;  4YSZ A;  1D0Y A;  1HG2 A;  5FMN A;  2XQ4 A;  3OKQ A;  1HNZ T;  3RQU A;  2YIN A;  5L2L A;  3AE5 A;  5HCM A;  3KVA A;  3A5X A;  2NTX A;  4I0U A;  4OX9 T;  4QX7 B;  2J62 A;  3OTO T;  4ZS3 A;  3FBZ A;  5LGN B;  2WP9 A;  5LOV E;  2XHE B;  4HWF A;  5LJM A;  3Q5D A;  4PJN A;  4U2Y A;  2CPT A;  2ZM8 A;  4C91 A;  4PJJ A;  3Q5X A;  4HWD A;  4A5X A;  1U4Q A;  4XZC A;  4EIW A;  2VKO A;  1Z8U A;  3AE7 A;  2ODV A;  3C51 A;  4ADZ A;  5AQT B;  3TLT A;  1W09 A;  4J2C A;  5LG4 A;  5FY7 A;  2OLT A;  5J1G A;  5JRC B;  2BBJ A;  4PK6 A;  4ZI2 C;  2E9X A;  3FZM B;  3HA4 A;  2JQH A;  4DR2 T;  2ODU A;  5ABF B;  2JMK A;  4UVC B;  4XAX B;  2PJQ A;  4JEU B;  3AA6 B;  2BDE A;  4JI3 T;  2IC6 A;  2V5D A;  3J7Y q;  1ZEE A;  4U2Z A;  4ZZB A;  2LJL A;  3NZQ A;  3EDV A;  2KSR A;  3RQW A;  5FXZ A;  4AKI A;  2VL0 A;  3L8R A;  3ZT7 A;  2W0G A;  1IBK T;  3AB3 B;  1WR0 A;  3UUL A;  2NP9 A;  3P7I A;  4IDQ A;  2VUR A;  2WY2 A;  2XQ9 A;  3ZPO A;  4ERR A;  5FKY A;  1MMG A;  1JNR A;  3MAC A;  4ZZC A;  1R8I A;  4OFZ A;  3KV4 A;  4IL4 A;  3CVR A;  3J9X 1;  3MXZ A;  5L4H A;  5LHI B;  2HPJ A;  2I59 A;  3K3O A;  4YY3 T;  2DWG A;  4KI0 F;  2XSA A;  4JI5 T;  4HKA A;  3HKB E;  4GK0 E;  3ZST A;  5ABF A;  2K48 A;  2WU5 A;  1W9R A;  4QH1 A;  2D0U A;  3IF8 B;  5L3G B;  5JRE A;  4LF9 T;  4AQF C;  1D1A A;  4LF6 T;  3D0T A;  3MK7 C;  3K8P C;  3CQC B;  2NW8 A;  3N9M A;  3BK9 A;  3ZT6 A;  1N33 T;  4CN6 A;  5M4Y A;  2FUP A;  2VVS A;  3GMI A;  5FNV E;  4IDZ A;  5AQQ B;  4N78 D;  1S94 A;  1SUM B;  4CXW A;  3FXD B;  3N9Q A;  2E5L T;  4YHJ A;  4JUY A;  3NRY A;  2I6H A;  3FZL B;  2WDQ A;  3OPC A;  3UUX B;  4HGA A;  4NXM T;  4H9S E;  4JI8 T;  5DQW A;  5EK4 A;  4DR1 T;  2UUA T;  3VKG A;  4BA9 A;  3OBV E;  4ZHQ E;  2XY8 B;  2W63 A;  3Q2M A;  4F6R C;  3NRX A;  4QH4 A;  4U31 A;  3IBP A;  2LSJ A;  4LF5 T;  3IHR A;  5LJN A;  1HNW T;  3W15 B;  2B76 A;  2AE9 A;  4IDP A;  4U7I A;  2CXD A;  3I0Q A;  2PBI A;  3RX6 A;  5JDM A;  3FXE B;  3UFG A;  4Q25 A;  2E5V A;  3P4R A;  2XSB A;  2CA5 A;  4YJ3 E;  5LB7 B;  1YKH B;  5HXS A;  5JDF A;  4LF7 T;  4HFE A;  5ABG A;  5LA6 E;  3RLF F;  2H7O A;  1FIO A;  2BG9 B;  2JJ9 A;  5AFU L;  2XAG B;  4PNI A;  4UF0 B;  3AA0 B;  3EHZ A;  4WYV A;  4GOU A;  3T8O A;  3PJA J;  3ZYL A;  3NKZ A;  4F8H A;  1VOM A;  2XQY A;  3AE3 A;  3AE1 A;  1US7 B;  4IE7 A;  4L0R A;  3X1D A;  3C4W A;  1NWM X;  5AQR B;  4GKK T;  4X62 T;  5L3B B;  2WSS V;  3N5L A;  2V6Y B;  3VRA A;  2GK9 A;  4IL9 A;  5ETW A;  3CIR A;  2IAK A;  3RRC A;  5FP3 A;  3U3I A;  3KFW X;  4DO0 A;  3ZN1 B;  5L3E B;  2RPA A;  3K3Q C;  2UUB T;  3H37 A;  5BR8 T;  1N34 T;  2XJ7 A;  5E0O A;  4AQY T;  4HFD A;  1S35 A;  3LJC A;  1D1B A;  1I6Z A;  3ZYK A;  5AQG B;  3KV5 A;  5CB4 E;  5LCY A;  4JEH B;  2WS3 A;  2LSK A;  4HFC A;  1VCS A;  4EZH A;  2VAS A;  2Y48 B;  4O2B E;  4U74 A;  3P50 A;  1LRZ A;  3EDU A;  4EXT A;  2Q9Q C;  4B6X A;  4DV0 T;  2EHO B;  2VL8 A;  2W61 A;  2ACX A;  2BS4 A;  3KBU A;  4ANJ A;  4JYA T;  2CCQ A;  2BG9 A;  4DV6 T;  4TWD A;  2CWO A;  4UF0 A;  4TUY E;  2XZE A;  2LKG A;  5H6R B;  3H3A A;  2Z6E A;  3O4X E;  5HEO A;  2XUE A;  2ZMA A;  2WBL A;  2XM1 A;  4B3T T;  5KX5 E;  1YW0 A;  3O9X A;  2WU2 A;  5TAO A;  2BKO A;  2V6Y A;  5HXH A;  3PUQ A;  4BJM A;  1G73 A;  3BQI A;  1O3X A;  5JR9 B;  2BVL A;  2WDV A;  4WNK A;  1WFD A;  1KF6 A;  3UU8 A;  4A56 A;  4Z91 A;  5HXR A;  1DU2 A;  1OED C;  3SS1 A;  2PFV A;  4C90 A;  3UU3 A;  3AE8 A;  3M65 A;  4MAL A;  4DMV A;  5HAX A;  5KXJ A;  5JDN A;  3F31 A;  4O4I E;  4TZ4 C;  4BJN A;  4TV9 E;  4O2A E;  2CLY B;  1E1H B;  3ZN0 B;  2E2A A;  2EHO A;  4EOZ B;  4CN1 A;  2ZLY A;  4I4T E;  2XAF B;  2R6G F;  2VWA A;  4ILA A;  3WAJ A;  1CUN A;  3RRW A;  4GK5 E;  1MND A;  4UVA B;  5HCJ A;  5LBM A;  3NVO A;  5LMN T;  2KT9 A;  3E08 A;  4AKL A;  3N9L A;  2YDQ A;  3HKC E;  3JAD A;  1GQE A;  1WLX A;  4X1K E;  5JR9 A;  2KWH A;  2KLQ A;  3V5S A;  1FEW A;  3LG7 A;  4WBN E;  4HFV A;  3T1Y T;  4DV4 T;  1NEK A;  4H9Q C;  2LM9 A;  2X0H A;  4H9N C;  5IYZ E;  4IE6 A;  5HEG A;  2JQQ A;  3KIN B;  2YK0 A;  1H7C A;  2LRL A;  3CKD A;  4EGW A;  4H63 V;  5HWX A;  2WCA A;  3L3P A;  5JDG A;  4ZOL E;  2LSG A;  5AQS B;  2E9X C;  1Z0P A;  5FXX A;  3TLU A;  2M67 A;  4YJ2 E;  2X0L B;  4PAG A;  5ABH A;  3C98 B;  3EVY A;  1FMV A;  2WMN A;  4COF A;  4L9I A;  4NUU A;  3JC6 D;  1WYB A;  3AED A;  2V8S V;  1YD8 G;  3KV6 A;  4L5G A;  4ZEY A;  3ZC0 A;  5FY1 A;  2V7J A;  2BS3 A;  2DCF A;  3CX6 B;  3PUY F;  4X1Y E;  3ZYM A;  2XQ5 A;  2B1E A;  2PG8 A;  1KFY A;  3ZMU B;  4EB6 E;  5LHG B;  1OXZ A;  1Y01 A;  2HN1 A;  3PTR B;  4LFA T;  4GYS A;  4NIQ A;  4HN9 A;  1UK5 A;  1SHZ C;  4UXN B;  2XPK A;  3O1H A;  4DVD A;  5EK3 A;  2W66 A;  2V1D B;  4P09 A;  3AAI A;  3FZH B;  1YXR A;  1HCI A;  1BR4 A;  4YLH A;  3G06 A;  3QNU A;  4U72 A;  4CN4 A;  3JAE A;  3KVB A;  3QB5 A;  1U5P A;  4DBQ A;  5AQO B;  5F5W A;  3C50 A;  4P1N A;  4B3R T;  3GN5 B;  3O1J A;  2QGS A;  1N32 T;  1MMA A;  3OVU A;  2DL1 A;  2KXP B;  3CX7 B;  4Z90 A;  3R84 B;  3OJA A;  4PJL A;  4FJO A;  2N2N A;  1ZOY A;  1HTJ F;  3UT5 E;  2DLR A;  1UUR A;  2MBG A;  3R6N A;  1T98 A;  4U3C A;  1XNR T;  4X66 T;  3LK4 2;  2FJB A;  4I43 B;  4YSY A;  3ZJ2 A;  4E7S A;  5FL1 A;  4DMW A;  2XQ8 A;  4TWF A;  1VCT A;  1MIY A;  2BVM A;  5FVK A;  3RGL A;  2LLY A;  4QXH B;  4ZI2 D;  3PUA A;  2XAJ B;  2CRB A;  1KNZ A;  2X68 A;  4KP3 C;  2WZH A;  4UV8 B;  2D0T A;  2QA7 A;  2J4G A;  2JMH A;  3UUN A;  3RC8 A;  5FXW A;  4UIG A;  1MIW A;  1EZ3 A;  3NZP A;  3SFE A;  4DR7 T;  2LSI A;  3AEA A;  2VKH A;  3PUS A;  5FY0 A;  2CWY A;  3GN5 A;  4MLK A;  2RP4 A;  4CXX A;  3VHL A;  4WW0 A;  4PK5 A;  3ANW B;  4QHO A;  2NWB A;  4NPP A;  2WWV A;  3CPZ A;  1MIV A;  3OYZ A;  3RHW A;  3N9O A;  3PUX F;  5FVL A;  5LGU B;  2QYW A;  1KNR A;  1X9B A;  2VK9 A;  4PFO A;  2WAU A;  1OED E;  3CX8 B;  3KBT A;  5AQJ B;  3RYF E;  4HWH A;  4EEB A;  3FB2 A;  4KUM B;  2CMR A;  3RKO A;  3VR9 A;  3CML A;  2LKH A;  2XQ7 A;  2G0U A;  3SRZ A;  2X9W A;  3RPU A;  2LE8 A;  5AQN B;  1IZN B;  3ZCI A;  4DUZ T;  1XZY A;  2WB5 A;  4TN7 B;  5AQK B;  4O4H E;  3PJA A;  4OYJ A;  3ZSS A;  2IW5 B;  4ILU A;  3UU6 A;  2D2S A;  4WZX A;  4LFB T;  4NUV A;  4DBR A;  4AKG A;  4QKN A;  5L47 A;  1QUU A;  2V7L A;  2KIN B;  2CBJ A;  2P9B A;  3P4P A;  1ZHC A;  4YTN A;  2BKP A;  3CQX C;  3PUG A;  1BR0 A;  1LVK A;  4QH5 A;  4OYK A;  3PUR A;  2JRK A;  4O4J E;  4MFR A;  3ANW A;  1KK7 A;  2H88 A;  4IDO A;  3I9W A;  4X5T A;  5AQI B;  5AQH B;  3UQ7 A;  4IHJ E;  3B5M A;  2UXD T;  2N9D A;  2AXD S;  2SPC A;  4JI1 T;  3ONJ A;  4IST A;  1UX4 A;  5LGT B;  4AIU A;  4EYY R;  2BG9 C;  1WR6 A;  3LSV A;  2YDS A;  1MMD A;  1XDP A;  2K3W A;  2FBW A;  2HH7 A;  4UEL A;  1OWA A;  3RIF A;  1QLB A;  1Y64 B;  2CHO A;  2CBI A;  2OV9 A;  3SOL A;  2YEV C;  2W67 A;  3PUV F;  4KBM B;  3EAB A;  2HHH T;  3ZMV B;  4JI6 T;  3HKD E;  4YXD A;  2ZM6 T;  2CE7 A;  3DTO A;  2QRX A;  3E22 E;  4IIJ E;  4X64 T;  2ZM0 A;  5AQF B;  4ZXL A;  5L3C B;  2NOX A;  3LK3 B;  2LRK A;  4JI2 T;  2Y6X A;  2JPF A;  2V6X A;  2M6I A;  5EK2 A;  4BAY B;  2ES0 A;  3KDS E;  4UV9 B;  5J2U E;  4HWC A;  5JH7 E;  2NW9 A;  3PU3 A;  5AQM B;  4HE8 A;  1XMQ T;  3ZKR A;  4LFC T;  5CA0 E;  3TLV A;  5DQV A;  1NEN A;  2JQ9 A;  2H7V C;  1SA0 E;  3HI2 A;  2WDR A;  2FJA A;  4EZ4 A;  4ISS A;  4TNW A;  1UUS A;  4CQI A;  3A8Y C;  2EHO C;  3TLS A;  2VVN A;  3AAA B;  2MTQ A;  4U7Y A;  3RIU C;  2ACZ A;  1LVF A;  4KX6 A;  4CXY A;  1E2A A;  5JDH A;  2PTF A;  2M6B A;  2BBH A;  3ZT5 A;  3PE0 A;  1X79 A;  3BQL A;  2H3R A;  2LM2 A;  2X9H A;  3PUW F;  1W0A A;  4TV8 E;  2LSY A;  4A98 A;  1T8B A;  3I0O A;  2DHR A;  2DWK A;  5JR9 C;  4X20 E;  2MAW A;  3PV0 F;  2UXN B;  1J1J A;  2V7M A;  3TKL B;  2A9U A;  3UTK A;  4P0B A;  2J47 A;  2YKS A;  3DJB A;  2Q9Q D;  3JAF A;  5KDM C;  3PUZ F;  4HWI B;  1BR2 A;  3AAE B;  1M7K A;  3UUB A;  2L8K A;  4AXP A;  2L3L A;  4PFP A;  2K9A A;  2L9Q A;  1UCU A;  1LKX A;  5CA1 E;  4PJM A;  4X65 T;  3OYX A;  4LF4 T;  4ILB A;  4TNV A;  3PU8 A;  3Q9D A;  4EYU A;  2XAQ B;  5L3D B;  1XDO A;  5HXE A;  3MJX A;  4AKH A;  3I1A A;  4JLE A;  2LOS A;  3FZF B;  3ZMS B;  3P8C D;  2X66 A;  3EI0 A;  4CI3 B;  4KMC A;  2J1D G;  2D5U A;  4IE0 A;  1MMN A;  1IBM T;  4CZZ B;  2LOP A;  4B3M T;  3JCF A;  2A3D A;  3AEG A;  5C8Y E;  1L0V A;  2W62 A;  4JBW F;  4PK4 A;  2UXX B;  5HEH A;  2CEA A;  2KWI B;  4ZI3 D;  1KEY A;  3QB5 K;  5LYJ E;  2Y8D A;  3AEC A;  3VU7 H;  4DV5 T;  2UXB T;  2MOZ A;  2WQY A;  3AA7 B;  5JDL A;  2CHN A;  1V9D A;  3CK6 A;  3M3Z B;  1ZP0 A;  4PW8 A;  3T1H T;  3EUH A;  5ADX L;  2C5K T;  4OK0 A;  4DND A;  3AE6 A;  4MBQ A;  3AEF A;  5LBQ B;  3N2G E;  1T72 A;  2IHR 1;  4KHZ F;  3K1S A;  5KMG P;  5L3F B;  3N9N A;  4Z8X A;  3AVR A;  4TWH A;  3C64 A;  3AEE A;  4O4L E;  3RF1 A;  5C3J A;  2VKJ A;  5AQP B;  3E0Z A;  4I55 E;  4IE5 A;  4WBO A;  3QK6 A;  2XQ6 A;  3U78 A;  3LBX B;  1IAP A;  4IGU A;  1N36 T;  1HX1 B;  1UGO A;  4KHP T;  3AE4 A;  3DP7 A;  1J5E T;  4TX5 A;  4YSX A;  4ASK A;  2NW7 A;  1SE7 A;  3ZC1 A;  1IBL T;  2V7I A;  3WAK A;  3N2K E;  3CWZ B;  2CXF A;  2E9X D;  4IDN A;  2K24 A;  3HKE E;  3S4U A;  3P4S A;  4JI7 T;  1FMW A;  2BG9 E;  2V7K A;  2YDR A;  1YKE B;  3UQ4 A;  2X67 A;  3FBL A;  1B7T A;  4YT0 A;  5GON E;  3MA9 A;  3UFE A;  1M62 A;  5LP6 E;  3F57 A;  5F8P A;  3LK2 B;  3HL6 A;  3RH3 A;  1YQ4 A;  4JI4 T;  2K5B B;  5BMV E;  5CJ5 A;  2A2F X;  2V26 A;  4UEM A;  2WM9 A;  3NBX X;  3WI3 A;  2YOE A;  3LBX A;  4K0U A;  3N9P A;  5AQV B;  4G2A A;  1ZKE A;  5C2T A;  4E7Z A;  2KZ7 B;  5FL0 A;  2X0Y A;  4AQG A;  2N1G A;  2BKN A;  4JI0 T;  2XM2 A;  3RYC E;  4DV2 T;  1WYC A;  4HFB A;  3GWH A;  3LDQ B;  3ONX A;  2BZB A;  4EV6 A;  3AE2 A;  4ZS2 A;  4NXN T;  5JRC A;  1W0B A;  4LF8 T;  3MKD A;  4H9R C;  1D1C A;  4GIW A;  4V1A v;  3SWH A;  5FYM A;  3HR0 A;  2V5C A;  5H6Q B;  4HEA A;  3RYH E;  4DR6 T;  2E8I A;  4GYR A;  2OA5 A;  3RC3 A;  5LHH B;  2QVA A;  3TLW A;  2RA1 A;  1IJ5 A;  3IEE A;  4DR3 T;  2IIU A;  1D0Z A;  1HNX T;  3L09 A;  2IML A;  3FHN A;  3QUJ A;  4DV3 T;  2XAS B;  2X9Y A;  4YHH T;  2D9D A;  4H9O C;  3AXJ B;  3L39 A;  3ETV A;  2HN2 A;  1HS7 A;  1KNP A;  2IUB A;  2UU9 T;  2IC9 A;  4DR4 T;  3P4Q A;  4DV1 T;  4UVB B;  3ETU A;  4P0A A;  3AEB A;  4AQF A;  3UU5 A;  2BS2 A;  3QC9 A;  3CQG B;  2DI4 A;  5LMU T;  1JNZ A;  1D0X A;  3IA3 A;  1I94 T;  3RYI E;  4GKJ T;  2XQ3 A;  1IJ6 A;  3VR8 A;  3B57 A;  3C4X A;  5CGM A;  3ZJ1 A;  5LNK A;  5FXV A;  2LHN A;  3NWI A;  2KND A;  2KMF A;  3FZK B;  3ZCJ A;  3AVS A;  4DUY T;  1XNQ T;  4HFI A;  5AQU B;  5JQG E;  2IDO B;  4AIS A;  1AJ3 A;  4QWN B;  2FJE A;  2NTY A;  4FI5 A;  2XAH B;  5EZY E;  2XTL A;  1VRB A;  2MYS A;  3AE9 A;  5LG3 A;  5JTG A;  2VQF T;  3AXJ A;  2UXC T;  3ZLI A;  2YU2 A;  1NAF A;  4EED A;  1E7P A;  3VKH A;  3MZK B;  4A97 A;  4X1I E;  4CI1 B;  3Q5E A;  1CHU A;  2WWU A;  2I0M A;  1ZV4 X;  2H89 A;  2YN6 A;  4IT4 A;  4M1P A;  3KV9 A;  1HR0 T;  2W2U A;  2Q9Q B;  2DNX A;  3BQK A;  2X51 A;  4B3S T;  2C5J A;  2W00 A;  3N2O A;  2VQE T;  3VRB A;  1QSD A;  4XBF B;  1HF8 A;  2W4X A;  2WMO A;  4HFH A;  5IWA T;  2FJD A;  1T7S A;  1HX8 A;  5F3J A;  5J2T E;  1HFA A;  3ZMT B;  3QOF A;  2MPK A;  2LT3 A;  3GA8 A;  5J0Z A;  3AA1 B; 
#chains in the Genus database with same CATH homology
 3VU7 H;  5JDQ A;  3LK4 2;  2MOZ A;  4I43 B;  5LJN A;  2CXD A;  3ZJ2 A;  3AA7 B;  3I0Q A;  2PBI A;  4E7S A;  3RX6 A;  5JDM A;  3FXE B;  4DMW A;  5JDL A;  3I9Y A;  1V9D A;  5HYA A;  4PW8 A;  2CA5 A;  1MIY A;  4YJ3 E;  2BVM A;  3EUH A;  5ADX L;  2C5K T;  4O8S A;  1YKH B;  4OK0 A;  4DND A;  5JDF A;  5HXS A;  4MBQ A;  4QXH B;  5LBQ B;  4ZI2 D;  2A72 A;  3PUA A;  2XAJ B;  3N2G E;  2LEH A;  5LA6 E;  1KNZ A;  2H7O A;  2X68 A;  2C5I T;  4KP3 C;  5JVD E;  1FIO A;  5KMG P;  2JJ9 A;  1HG5 A;  5AFU L;  1BR1 A;  2XAG B;  4H63 H;  4PNI A;  3ZMZ B;  4UV8 B;  4UF0 B;  5L3F B;  2D0T A;  3AA0 B;  2QA7 A;  3N9N A;  2JMH A;  3UUN A;  3RC8 A;  4GOU A;  5FXW A;  3T8O A;  4UIG A;  1MIW A;  4Z8X A;  1EZ3 A;  3AVR A;  3ESL A;  3V5U A;  1MNE A;  3ZYL A;  5LXT E;  3NZP A;  3C64 A;  3UUM A;  2HPL A;  4OHF A;  2LSI A;  1VOM A;  2XQY A;  2VKH A;  4O4L E;  3PUS A;  1US7 B;  4IE7 A;  4L0R A;  2VKJ A;  3C4W A;  1NWM X;  3F2E A;  4EAH A;  2LHR A;  5FY0 A;  5L3B B;  2CWY A;  3E0Z A;  2Q9Q A;  4I55 E;  4CI2 B;  4IE5 A;  4WBO A;  2WSS V;  3QK6 A;  3GN5 A;  3U78 A;  3N5L A;  3LBX B;  1IAP A;  4IGU A;  2RP4 A;  2EHO D;  4MLK A;  4WW0 A;  3VHL A;  3DP7 A;  4CXX A;  4PK5 A;  4TX5 A;  3ANW B;  4QHO A;  2GK9 A;  3ZEF B;  5ETW A;  2NWB A;  3CPZ A;  5IHY A;  1MIV A;  1UX5 A;  2IAK A;  3RRC A;  4ASK A;  3OYZ A;  2NW7 A;  4ZI3 C;  4QXB B;  2CLY C;  3N9O A;  5FP3 A;  4QX8 B;  3U3I A;  3KFW X;  4DO0 A;  3ZN1 B;  5L3E B;  5LGU B;  3ZC1 A;  3K3Q C;  2VK9 A;  2V7I A;  3WAK A;  3H37 A;  3N2K E;  4G63 A;  3CWZ B;  5E0O A;  2CXF A;  4PFO A;  2E9X D;  2WAU A;  5DAB A;  1S35 A;  3K3N A;  3LJC A;  2K24 A;  1D1B A;  3HKE E;  3S4U A;  3ZYK A;  5DJQ C;  3KV5 A;  5CB4 E;  3CX8 B;  4YFS A;  1FMW A;  2V7K A;  3KBT A;  5LCY A;  4JEH B;  1YKE B;  4H9P C;  2YU1 A;  2X67 A;  2LSK A;  1G8X A;  3RYF E;  3FB2 A;  3FBL A;  3JC6 C;  2CMR A;  4KUM B;  4EZH A;  3RKO A;  2VAS A;  2Y48 B;  3CML A;  4O2B E;  1B7T A;  2ZM2 A;  2G0U A;  4QXC B;  3SRZ A;  2X9W A;  3PDY A;  3RPU A;  5GON E;  4U74 A;  3MA9 A;  1LRZ A;  3EDU A;  3O1I A;  4HTE A;  3UFE A;  4EXT A;  2X9X A;  2Q9Q C;  2LE8 A;  2C0S A;  5A1L A;  5LP6 E;  1IZN B;  3ZCI A;  4B6X A;  2EHO B;  3F57 A;  2VKD A;  2VL8 A;  2W61 A;  4TN7 B;  5F8P A;  4O4H E;  2ACX A;  3LK2 B;  4MHC A;  3HL6 A;  3KBU A;  2CM0 A;  4OYJ A;  4ANJ A;  2IW5 B;  4ZI7 E;  3RH3 A;  2CCQ A;  4AI6 A;  5HWY A;  4ILU A;  2K5B B;  2CXL A;  5BMV E;  2CWO A;  2D2S A;  4UF0 A;  1WRD A;  4TUY E;  5H6R B;  3H3A A;  2Z6E A;  3O4X E;  4NUV A;  3LFM A;  2A2F X;  4DBR A;  4AKG A;  4QKN A;  2V26 A;  1QUU A;  2XUE A;  2ZMA A;  2VB6 A;  2V7L A;  2KIN B;  2E9X B;  2WBL A;  4UEM A;  4IE4 A;  2WM9 A;  4I50 E;  2P9B A;  1ZHC A;  3Q5W A;  5KX5 E;  1YW0 A;  3B13 A;  3NBX X;  3O9X A;  3WI3 A;  3CQX C;  5TAO A;  3PUG A;  1BR0 A;  1LVK A;  3LBX A;  4K0U A;  3C4Z A;  3N9P A;  4OYK A;  5HXH A;  3PUR A;  2JRK A;  4O4J E;  3PUQ A;  4MFR A;  3ANW A;  4BJM A;  1G73 A;  1KK7 A;  3BQI A;  3I9W A;  1O3X A;  4G2A A;  5HXC A;  1ZKE A;  4AKR B;  5JR9 B;  1D0Y A;  1HG2 A;  5FMN A;  4E7Z A;  2KZ7 B;  2BVL A;  3OKQ A;  4WNK A;  4IHJ E;  4AQG A;  2YIN A;  5L2L A;  2N1G A;  4A56 A;  2N9D A;  3KVA A;  3A5X A;  2NTX A;  2SPC A;  5HXR A;  4QX7 B;  3RYC E;  3SS1 A;  4IST A;  1UX4 A;  5LGT B;  4EYY R;  1WYC A;  4ZS3 A;  3FBZ A;  1WR6 A;  3GWH A;  2PFV A;  4C90 A;  5LGN B;  3ONX A;  2BZB A;  4ZS2 A;  5LOV E;  2XHE B;  1MMD A;  3M65 A;  4MAL A;  4DMV A;  5JRC A;  2HH7 A;  4UEL A;  1OWA A;  5HAX A;  3MKD A;  5JDN A;  1Y64 B;  5LJM A;  3F31 A;  3SOL A;  4PJN A;  4H9R C;  2YEV C;  4O4I E;  4KBM B;  1D1C A;  2ZM8 A;  4TZ4 C;  4GIW A;  4V1A v;  3SWH A;  4BJN A;  3ZMV B;  4C91 A;  4TV9 E;  3HKD E;  4O2A E;  2CLY B;  1E1H B;  4PJJ A;  3Q5X A;  5FYM A;  3ZN0 B;  3HR0 A;  1U4Q A;  5H6Q B;  4XZC A;  2EHO A;  4EOZ B;  2ZLY A;  4I4T E;  2XAF B;  4HEA A;  4EIW A;  2CE7 A;  2VWA A;  3DTO A;  2VKO A;  3RYH E;  2ODV A;  3C51 A;  3WAJ A;  1CUN A;  4ADZ A;  2E8I A;  3E22 E;  3RRW A;  4GYR A;  4GK5 E;  2OA5 A;  4IIJ E;  2ZM0 A;  4J2C A;  5LG4 A;  1MND A;  2NOX A;  3LK3 B;  5FY7 A;  5J1G A;  5L3C B;  3RC3 A;  4UVA B;  2Y6X A;  5LHH B;  5JRC B;  2JPF A;  4PK6 A;  5EK2 A;  4ZI2 C;  2RA1 A;  1IJ5 A;  2E9X A;  3HA4 A;  3IEE A;  5LBM A;  2ES0 A;  4BAY B;  2ODU A;  2KT9 A;  3E08 A;  3KDS E;  4UV9 B;  2JMK A;  4AKL A;  4UVC B;  5J2U E;  4XAX B;  2PJQ A;  2Y8D A;  5JH7 E;  1D0Z A;  2NW9 A;  3PU3 A;  4JEU B;  3AA6 B;  2BDE A;  3L09 A;  3N9L A;  3FHN A;  3QUJ A;  4HE8 A;  5CA0 E;  2XAS B;  5DQV A;  2X9Y A;  3HKC E;  2IC6 A;  1WLX A;  4H9O C;  4X1K E;  5JR9 A;  2KWH A;  3J7Y q;  2H7V C;  2KLQ A;  3V5S A;  1SA0 E;  3HI2 A;  1ZEE A;  3ETV A;  1FEW A;  4EZ4 A;  4ISS A;  3LG7 A;  4WBN E;  1HS7 A;  4HFV A;  2LJL A;  4CQI A;  2IC9 A;  3NZQ A;  2EHO C;  3EDV A;  4H9Q C;  2LM9 A;  4UVB B;  3AAA B;  2MTQ A;  4H9N C;  3ETU A;  5FXZ A;  5IYZ E;  4AKI A;  1LVF A;  4IE6 A;  4P0A A;  2JQQ A;  4CXY A;  2W0G A;  3KIN B;  2YK0 A;  5JDH A;  1H7C A;  3AB3 B;  3CKD A;  4AQF A;  4H63 V;  5HWX A;  3UUL A;  2NP9 A;  3L3P A;  5JDG A;  4ZOL E;  3PE0 A;  2LSG A;  3P7I A;  2E9X C;  3QC9 A;  3CQG B;  1X79 A;  2DI4 A;  3BQL A;  3ZPO A;  2H3R A;  4ERR A;  1Z0P A;  2X9H A;  5FXX A;  1D0X A;  1MMG A;  3RYI E;  2M67 A;  1IJ6 A;  2LSY A;  4TV8 E;  3MAC A;  3B57 A;  2X0L B;  4YJ2 E;  3C4X A;  3I0O A;  4OFZ A;  3KV4 A;  4PAG A;  3C98 B;  3CVR A;  3ZJ1 A;  3EVY A;  3J9X 1;  5LNK A;  1FMV A;  2WMN A;  5FXV A;  2LHN A;  4L9I A;  2DHR A;  2DWK A;  5JR9 C;  4NUU A;  3MXZ A;  3JC6 D;  4X20 E;  5LHI B;  2UXN B;  1WYB A;  2KND A;  2HPJ A;  2KMF A;  2V7M A;  3TKL B;  1YD8 G;  2I59 A;  3K3O A;  3ZCJ A;  3KV6 A;  3AVS A;  4L5G A;  3UTK A;  2DWG A;  4P0B A;  3ZC0 A;  3DJB A;  2Q9Q D;  4HKA A;  3HKB E;  5FY1 A;  4GK0 E;  2V7J A;  5JQG E;  2K48 A;  2DCF A;  5KDM C;  3CX6 B;  1AJ3 A;  4QWN B;  4X1Y E;  2NTY A;  3ZYM A;  2B1E A;  2PG8 A;  4FI5 A;  2D0U A;  3ZMU B;  3IF8 B;  4EB6 E;  1BR2 A;  5L3G B;  3AAE B;  2XAH B;  5EZY E;  5LHG B;  1OXZ A;  4AQF C;  5JRE A;  2XTL A;  1D1A A;  3PTR B;  1VRB A;  2L8K A;  3D0T A;  3MK7 C;  2MYS A;  3K8P C;  3CQC B;  4GYS A;  2NW8 A;  4HN9 A;  3N9M A;  4AXP A;  3BK9 A;  2L3L A;  4PFP A;  2K9A A;  1SHZ C;  2L9Q A;  3ZLI A;  1UCU A;  1LKX A;  3O1H A;  4UXN B;  5CA1 E;  5M4Y A;  4PJM A;  4DVD A;  5EK3 A;  3GMI A;  3OYX A;  5FNV E;  4IDZ A;  2YU2 A;  1NAF A;  2V1D B;  3PU8 A;  4N78 D;  1S94 A;  4CXW A;  4P09 A;  3AAI A;  3Q9D A;  3FXD B;  3N9Q A;  4EYU A;  2XAQ B;  5L3D B;  4YHJ A;  3VKH A;  4JUY A;  1HCI A;  3MZK B;  1BR4 A;  4YLH A;  4X1I E;  3NRY A;  4U72 A;  4CI1 B;  2WWU A;  5HXE A;  3MJX A;  4AKH A;  3KVB A;  1ZV4 X;  4DBQ A;  1U5P A;  4M1P A;  3I1A A;  3KV9 A;  4JLE A;  2LOS A;  2Q9Q B;  3C50 A;  2DNX A;  3BQK A;  4HGA A;  3UUX B;  3ZMS B;  3GN5 B;  2X66 A;  3P8C D;  2X51 A;  3O1J A;  2QGS A;  4CI3 B;  4KMC A;  1MMA A;  2J1D G;  2D5U A;  2C5J A;  4IE0 A;  1MMN A;  2W00 A;  4H9S E;  4CZZ B;  2LOP A;  5DQW A;  2KXP B;  5EK4 A;  3CX7 B;  3N2O A;  2A3D A;  1QSD A;  3VKG A;  4BA9 A;  3R84 B;  4XBF B;  1HF8 A;  3OBV E;  3OJA A;  4PJL A;  5C8Y E;  4ZHQ E;  4FJO A;  2WMO A;  2W62 A;  4PK4 A;  2N2N A;  2UXX B;  1HTJ F;  3UT5 E;  1HX8 A;  2W63 A;  5F3J A;  2DLR A;  5J2T E;  3Q2M A;  1HFA A;  2CEA A;  2KWI B;  2MBG A;  3NRX A;  3ZMT B;  4F6R C;  2LT3 A;  4ZI3 D;  3R6N A;  3GA8 A;  3IBP A;  2LSJ A;  5LYJ E;  1T98 A;  3IHR A;  3AA1 B;  3W15 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...