2LE8A

The protein complex for dna replication
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication licensing factor MCM6
publication title Structural insights into the Cdt1-mediated MCM2-7 chromatin loading
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 27
structure length 114
sequence length 114
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18263 MCM6_C MCM6 C-terminal winged-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2le8A00
2LE8A 2KLQA
chains in the Genus database with same CATH superfamily
2YDRA 4P09A 4NXMT 3LSVA 1T8BA 1QSDA 2EHOB 2KINB 3UQ4A 4CI1B 3CMLA 3FBZA 2X0YA 2ZMAA 4UVCB 4PFPA 3FXEB 2A3DA 4N78D 4KMCA 3P4QA 2LEHA 4CN4A 3Q5XA 3VRAA 4JV5T 2E2AA 1UX4A 2PTFA 4HWDA 4IDPA 4J2CA 4NPPA 1JNZA 2LSJA 4B6XA 4HKAA 3CX8B 2BS3A 3CQGB 3UFGA 3ZCJA 2ODVA 4ZHQE 2XQ9A 1B7TA 3RYIE 3RRCA 2VASA 2CE7A 4ZS2A 4QH5A 3ZT7A 3TLSA 4QH1A 4LFCT 4O4LE 2YKSA 4X62T 2UU9T 2YK0A 2E9XC 5LJNA 3PU8A 2V26A 4DNDA 4PAGA 5L3EB 1BR1A 2XQ5A 1WR6A 2HPJA 4GKKT 4EXTA 1Z0PA 2BS4A 3GA8A 5JVDE 1KEYA 2X0LB 3V5SA 3KBUA 3B13A 3ZKRA 5CA1E 2VL8A 3I9WA 5FXVA 4LFBT 2EHOC 5JQGE 4B3RT 2WMNA 2NWBA 5FVLA 4DR3T 3RC8A 3E22E 2OA5A 2WCAA 3MACA 5LHGB 5J2TE 4HN9A 1FMVA 1YKHB 2N9DA 4YTPA 3W15B 3FXDB 4EZHA 2KXPB 3ABVA 1YQ4A 3S4UA 1WR0A 3O1IA 2P9BA 5HXSA 5LOVE 4X65T 4LMLA 3AEDA 3AEGA 1YQ3A 4X5TA 2BG9E 2KSRA 3PUAA 4DO0A 2V7IA 5HEGA 4I43B 1X9BA 5GONE 3ZMVB 4ANJA 4TX5A 1HTJF 4XAXB 1MIVA 1WFDA 2VB6A 1HFAA 4JI3T 2MBGA 4QXBB 4EEDA 3MKDA 1SUMB 3H3AA 1HR0T 4UV9B 2XZEA 5LXTE 4DV7T 2E9XD 4Z90A 3KVAA 3PURA 1D1BA 4LFAT 4PK5A 1US7B 4O8SA 1HG2A 3RI5A 3HKDE 1HCIA 3C4WA 2RP4A 5LBMA 5L4HA 1U4QA 3RIUC 2QA7A 5JRCA 5FL0A 3PUSA 4HFHA 3N9MA 5F3JA 4CQIA 3X1DA 4DV4T 3GN5B 4X66T 4U33A 2BS2A 2IDOB 3T1YT 4E7SA 2X51A 3CWZB 4PJJA 1KF6A 4O2BE 4YSZA 3AAEB 2XQ4A 2VQFT 5HCJA 5JR9B 3EABA 2R6GF 1S35A 4I0UA 5FVKA 4U7IA 1NAFA 3F2EA 2W63A 5JH7E 3C50A 1OEDE 3I1AA 4AI6A 5JREA 3ANWA 2JIWA 5HXCA 3KFWX 3OPCA 2CM0A 4NUUA 5AQPB 2HH7A 3RC3A 5ABHA 4DV2T 1VCTA 2LT3A 1XWMA 3ZC0A 4MLKA 2YOEA 5L47A 5AQFB 5J0ZA 2CBJA 1G73A 5L3BB 2LSGA 2LHNA 4YFSA 2WWUA 1M62A 2CLYB 3SFDA 2BG9A 2YEVC 4XBFB 3MZKB 4DR5T 3N9PA 4EAHA 4G63A 2BKNA 3C4XA 2V5DA 4ILBA 4ZS3A 2HHHT 2KZ7B 3LBXB 2X68A 1UURA 3RPUA 3T8OA 2NW8A 2X67A 4KI0F 2JMKA 4H9QC 4X64T 2Z6EA 2ZLYA 3DJBA 1UGOA 4ZI7E 1WYCA 3MA9A 4GIWA 4CN6A 3EVYA 2WU5A 4AQFC 1KK7A 1IBKT 5C2TA 3FZLB 3OKQA 2L8KA 3AXJB 4GKJT 3ZSSA 3HKCE 1SHZC 4UF0A 1KNPA 2BBJA 2I0MA 1SA0E 4B3ST 1E2AA 4PJNA 2CLYC 3U3IA 2NP9A 3CVRA 1KFYA 2XASB 3AEFA 1VRBA 2W2UA 4JI0T 4UVAB 2VKDA 4UV8B 4YTMA 1OEDA 2JQQA 3B57A 3N9NA 2PJQA 4H63H 4HTEA 3A8YC 3MXZA 4HWFA 4HGAA 2M67A 4TN7B 2CBIA 5CA0E 3UQ7A 4I4TE 3F57A 1MMDA 4OK0A 1ZEEA 1HS7A 2K3WA 2V1DB 3N9OA 2BVLA 3JAEA 1KNZA 3E0ZA 1BR2A 4ZI2C 4FI5A 4IE7A 4TZ4C 1DU2A 1BR0A 5DABA 2VWAA 2LRLA 3KV5A 4KP3C 4EGWA 3O4XE 4C90A 2XAJB 3P50A 2CHOA 1Y01A 3WAKA 4QWNB 2XAQB 3A7MA 3VRBA 2WDQA 5BR8T 5M4YA 2XQ7A 3JCFA 3AE5A 3LFMA 2IUBA 4DR1T 4DMVA 3CQCB 3ZPOA 5LGUB 4HFVA 4ZXLA 1UUSA 4YT0A 4HEAA 5AQLB 5IUXA 4U31A 5F8PA 3I0QA 3PUYF 4LMJA 2LKHA 4H9RC 4DV0T 5E0OA 3KVBA 4ZOLE 3UU4A 3V5UA 3GMIA 2FUPA 4L9IA 3VHLA 4JUYA 5JDLA 2E9XB 4I50E 5LHIB 5HWYA 3AA1B 2XM1A 3AE2A 2CXFA 3DP7A 1D0YA 2LSYA 3EUHA 1XZYA 4MFRA 2XTLA 3KV4A 1D1CA 3ZYMA 4ZI2D 2IC6A 4UELA 2WDRA 2JQHA 3OYZA 2CHNA 3FBLA 5EK4A 4AKLA 4H9OC 5LNKA 4JLEA 2DWKA 4KUMB 2UXNB 4HFDA 3HA4A 1J1JA 2LSIA 3N2KE 3PU3A 1FIOA 3AVSA 2PFVA 3ZC1A 3QOFA 4O2AE 4TNVA 4HFBA 2X9HA 2V6YB 3TLTA 4QXHB 3MK7C 1N34T 2NTYA 5AQNB 1UX5A 3NRYA 2V7KA 3N9QA 4JI6T 2IW5B 5LG4A 4JYAT 2LM9A 3JADA 5LYJE 2HN1A 2UUBT 2K48A 1ZP0A 4X1IE 2CRBA 1WRDA 3NWIA 3UUNA 2D9DA 1IBLT 2YINA 2X9YA 5JDNA 2XSBA 3U78A 3M3ZB 2DWGA 2N1GA 3I0OA 2UXXB 2V7LA 4K0KT 1HG5A 3H3MA 1S94A 4DR2T 2VK9A 3AE7A 3RH3A 1J5WA 3AE9A 4HE8A 2LE8A 2MYSA 2C0SA 4UR9A 2J1DG 2B1EA 4JBWF 5AQQB 2QVAA 5HAXA 3CQXC 5TAOA 2ZM8A 2IC9A 2FJAA 2A72A 5JDGA 2XAGB 3R84B 5CFBA 4U3CA 3PUXF 2ACZA 2WQYA 1W0BA 4TV9E 3AXJA 3AVRA 2JMHA 4JI4T 5FXWA 3RHWA 3LG7A 2X9XA 4BJNA 1CHUA 2HN2A 5LG3A 3ONJA 3AAAB 3RF1A 4ILCA 2XQYA 3NKZA 3VKGA 2QYWA 2VQET 5HXHA 3CKDA 2UXBT 3UUXB 3LJCA 5AQUB 2XUEA 1T72A 3NVOA 3PTRB 3RLFF 4DR4T 3ZMUB 4NUVA 2VL0A 2BDEA 2LLYA 4P0BA 3LK3B 4FJOA 4KHPT 1WYBA 4IREA 4EYUA 4JEUB 5LGTB 5FXZA 2G0UA 3RQUA 2I6HA 4IIJE 4IDQA 4DV5T 2CXLA 5HEOA 5LHHB 4KX6A 5FMNA 3JC6C 5ABFB 2YDQA 4LMKA 2RA1A 4LF9T 3NBXX 3CX7B 4PFOA 3UTKA 3HR0A 3N2GE 5FY0A 5AQKB 3N9LA 5ADXL 3TLUA 2LHRA 1WCRA 2V7JA 1LVKA 2W66A 5L3CB 4QH4A 5FY7A 3SOLA 3E08A 2WU2A 4BJMA 3KDSE 3P4SA 1G8XA 5JTGA 2AE9A 5HWXA 2Y48B 4IDOA 1IJ6A 5LCYA 3C51A 5EK2A 2BVMA 4COFA 3FZHB 2UUAT 4PK4A 4IE6A 3ZMZB 5LGNB 2H7OA 4X20E 1IZNB 2BKPA 3C4ZA 1QUUA 2MAWA 3KBTA 3B5MA 4U7YA 3D0TA 2Q9QC 3GWHA 3MJXA 4U2ZA 3UT5E 3QC9A 1T98A 2C5KT 2B76A 2W67A 5AQSB 3OTOT 5CJ5A 3UFEA 2EHOA 3JC6D 1HNWT 2H88A 1X79A 3NZQA 1UCUA 1IBMT 2ES0A 2KT9A 3AE4A 3H37A 2V5CA 3LK2B 2H3RA 3O1HA 3TLVA 3RYHE 4QHOA 4AQYT 2K9AA 5HCMA 1NENA 4QX7B 4A97A 2QGSA 5AQRB 2V6YA 4QX8B 4DBRA 3UULA 1Y64B 2DI4A 3P4RA 2CA5A 4ISSA 3ZYKA 4JI8T 4AKRB 1LKXA 1FEWA 1VCSA 2KNDA 3CPZA 3EI0A 3R6NA 4TUYE 3LK42 4YJ2E 3AA7B 3QNUA 3ZMTB 2FJEA 5ETWA 2WBLA 4YHHT 4H9NC 2DNXA 4QKNA 2DLRA 5AQJB 2VVSA 2VURA 4JEHB 3J7Yq 4ILUA 2N2NA 2Y6XA 2LSKA 2UUCT 2Q9QD 2JQKA 2CWYA 4ZZCA 2XQAA 4L0RA 2PG8A 2YU1A 3QB5A 5LBQB 3RIUA 4L5GA 4TWDA 2WSSV 3BK9A 4DR6T 3SRZA 1VOMA 4Z91A 3AEAA 2V7MA 4X1YE 3RKGA 2KWIB 3VU7H 4OYKA 2D2SA 1XNRT 5L3GB 4KHZF 3IHRA 4YLHA 5JDMA 3FZFB 1UK5A 2MOZA 2SPCA 1CUNA 2IIUA 3AAIA 4YJ3E 3FZMB 1LVFA 3FB2A 5C8YE 5LMUT 4DVDA 5JDFA 3KINB 3P8CD 4ZEYA 3BQLA 3ZJ1A 3HKBE 2MTQA 1AJ3A 4TNWA 3K3OA 2WAUA 2J47A 5L2LA 1R8IA 1YW0A 5LJMA 2CPTA 1KNRA 2XM2A 5HEUA 2F4VT 3FZKB 5FNVE 5LA6E 4MALA 3VR8A 4UIGA 2XQ6A 2A2FX 3AEEA 5JDHA 3UUMA 1FMWA 4GYRA 2CCQA 4TWHA 3P7IA 4GK0E 5HEJA 3KV9A 5AFUL 3RIAA 1JNRA 2YU2A 1YXRA 3KV6A 2X66A 1IAPA 4DV6T 5LB7B 1XMQT 3IA3A 3OBVE 3ZT5A 4IT4A 2M6IA 4CI3B 2JPFA 3AECA 5KXJA 2ZM2A 3GN5A 3RX6A 3Q9DA 2I59A 2UXDT 3ANWB 4WBNE 3PUQA 2JRKA 1HNXT 3F31A 2VKHA 1NWMX 2D0UA 4XZCA 4AXPA 5JR9A 3ZLIA 5F5WA 2WDVA 2V6XA 1HX8A 3K3QC 3EDVA 2IMLA 3ZYLA 2VKJA 3ZSTA 4ASKA 4DV1T 4H9SE 1FJGT 4NXNT 4A56A 4HFCA 2XHEB 3NRXA 2YDSA 4QXCB 4PNIA 2HPLA 4AQFA 2DHRA 2WMOA 1ZKEA 3EHZA 5HYAA 2X9WA 3RRWA 4DMWA 2KWHA 4LF6T 3K1SA 2YN6A 2J62A 4WBOA 4CZZB 4ILAA 5J2UE 2K24A 2JQ9A 1N36T 3OVUA 2E5VA 2XAFB 4M1PA 4BAYB 3FHNA 2QRXA 4TWFA 4I55E 4OYJA 3CIRA 2FJDA 4U72A 3QK6A 4H63V 5LMNT 1XDOA 2C5JA 3EAMA 3T1HT 4MBQA 4B3TT 4EEBA 3IF8B 2PBIA 1HF8A 3LBXA 2ODUA 5AQOB 1HNZT 3NZPA 4EB6E 4IE4A 4PJLA 5EZYE 3L3PA 2H7VC 5AQTB 1E7PA 5A1LA 3O1JA 4UF0B 5FL1A 4U2YA 3CK6A 5DQVA 3TKLB 3L8RA 2BG9C 2C5IT 4AKGA 2OV9A 1LRZA 5HXEA 4OFZA 5AQVB 5KDMC 2L3LA 1W9RA 3ZN0B 1OEDB 4YXDA 2D5UA 3HI2A 3PV0F 3ONXA 2W4XA 4WZXA 1MIYA 1MMNA 2MPKA 4EYYR 2XAHB 4EV6A 2Y8DA 4TV8E 5AQGB 3UU8A 2FBWA 2LM2A 4P0AA 4AIUA 5L4EA 1Z8UA 4WYVA 2E8IA 4LF5T 1OXZA 4GYSA 1GQEA 4YSYA 4IL4A 5FY1A 3HKEE 1N32T 3C98B 4HFEA 1ZV4X 3ZN1B 3A5XA 4F8HA 5L3FB 5H6RB 2ZM6T 4CN1A 4YSXA 2L9QA 1XNQT 1W09A 4HWIB 3RKOA 3ZMSB 1HX1B 2LOPA 1U5PA 1BR4A 3AE6A 4LF8T 2OLTA 3K8PC 2CWOA 3WAJA 4PJMA 2GK9A 2Q9QB 3LDQB 3HL6A 1N33T 4ADZA 4WNKA 4C91A 1OEDC 2BKOA 4V1Av 1MNEA 2DCFA 2XQ3A 3Q5DA 1WLXA 4ZZBA 3UU6A 5HEHA 5IWAT 2EHOD 2E5LT 1E1HB 2AXDS 5LP6E 2X0HA 2LOSA 4DUZT 4JI1T 3AA6B 4ERRA 3Q5EA 4LF7T 5CB4E 4A5XA 1NEKA 4IE5A 2M6BA 1T7SA 3AE8A 3BQKA 2VKOA 2XY8B 5AQMB 1D0XA 2LKGA 3J9X1 2NR4A 4HFIA 3IEEA 3VR9A 3QB5K 5ABGA 2BBHA 3DTOA 1MMAA 2E9XA 3O9XA 5EK3A 4CI2B 4H9PC 3BQIA 4NIQA 4PW8A 1D1AA 2NW9A 3EDUA 2DL1A 3OYXA 3PJAJ 5JDQA 4IDZA 3I9YA 3PUZF 4Z8XA 3P4PA 2FJBA 2WZHA 1J5ET 5KX5E 4BA9A 3M65A 4HWHA 4IE0A 1W0AA 1ZOYA 4X1KE 5AQHB 3ETUA 2K5BB 3ZT6A 4GOUA 3SS1A 3N2OA 2WP9A 1V9DA 3QUJA 4JI7T 4O4HE 2CMRA 3Q2MA 4ZI3C 2WM9A 4U74A 4DUYT 5DJQC 1SE7A 4YHJA 2H89A 3L39A 3Q5WA 5JR9C 3G06A 4K0UA 5HXRA 2NOXA 2WZIA 3PUGA 4CXXA 2D0TA 3K3NA 3TLWA 1I6ZA 4IHJE 2V8SV 2LRKA 3IBPA 3SFEA 3ZJ2A 4A98A 3AEBA 3P4WA 5J1GA 3RYFE 3AA0B 1H7CA 3UUBA 3ESLA 3AE3A 3UU5A 2W62A 5FKYA 4KBMB 2LJLA 2W0GA 2IHR1 2JJ9A 3ETVA 4DBQA 4AISA 1YD8G 2NW7A 4EZ4A 2BZBA 2RPAA 2WS3A 2W00A 3PUVF 5H6QB 4CXYA 4AQGA 4PK6A 4G2AA 5AQIB 2IAKA 3PE0A 2XQ8A 2CEAA 1I94T 3AE1A 1O3XA 5IHYA 2XPKA 2XSAA 4IDNA 4Q25A 4DV3T 4MHCA 1YKEB 2XJ7A 1IJ5A 4ZI3D 3PUWF 4YY3T 3RIFA 4JI5T 2WY2A 4E7ZA 5FXXA 2CXDA 4ISTA 1M7KA 3C64A 5C3JA 3AB3B 4JI2T 5JRCB 5KMGP 4B3MT 4P1NA 4HWCA 1MIWA 2WWVA 2KLQA 4WW0A 2W61A 5CGMA 4EIWA 3JAFA 5DQWA 4UVBB 5ABEA 2UXCT 2VVNA 4F6RC 1D0ZA 3L09A 3RQWA 4IL9A 1XMOT 4YTNA 4EOZB 3VKHA 5FP3A 2Q9QA 3ZCIA 4OX9T 4UEMA 2NTXA 5ABFA 2ZM0A 4DR7T 1MMGA 3RYCE 4IGUA 3WI3A 4DIDB 5BMVE 3CX6B 3N5LA 4CXWA 4UXNB 3ONLC 3PDYA 1QLBA 1MNDA 4O4JE 2KMFA 4O4IE 3SWHA 3RGLA 3UU3A 3PJAA 1XDPA 2A9UA 5FYMA 4OHFA 1OWAA 1L0VA 2J4GA 5IYZE 5L3DB 4LF4T 4GK5E 4AKHA 2WB5A 3ZEFB 1EZ3A 2ACXA 2BG9B 4AKIA 3OJAA 1ZHCA
chains in the Genus database with same CATH topology
3D0TA 2E8IA 2Q9QC 4P09A 1OXZA 4I4TE 3F57A 1QSDA 2EHOB 2KINB 3GWHA 3MJXA 4GYSA 1MMDA 4OK0A 1ZEEA 4CI1B 1HS7A 3UT5E 3CMLA 3FBZA 3QC9A 5FY1A 2ZMAA 3HKEE 1T98A 2C5KT 4UVCB 2V1DB 3C98B 3N9OA 2BVLA 4PFPA 1KNZA 1ZV4X 3FXEB 3ZN1B 3A5XA 2A3DA 3E0ZA 4N78D 3UFEA 1BR2A 5L3FB 2EHOA 4KMCA 3JC6D 5H6RB 2LEHA 4ZI2C 4FI5A 4IE7A 3Q5XA 2L9QA 4TZ4C 1UX4A 1X79A 3NZQA 1UCUA 4J2CA 2ES0A 5DABA 1BR0A 3RKOA 3ZMSB 2LSJA 4B6XA 2KT9A 4HKAA 3CX8B 3CQGB 2VWAA 2LOPA 1U5PA 1BR4A 3ZCJA 3KV5A 4KP3C 2ODVA 3H37A 4ZHQE 3LK2B 2H3RA 3O1HA 3K8PC 2CWOA 3WAJA 3RYHE 3O4XE 4PJMA 4QHOA 2GK9A 1B7TA 2Q9QB 2XAJB 4C90A 3RYIE 3WAKA 3RRCA 2VASA 3HL6A 4QWNB 2XAQB 2CE7A 4ZS2A 2K9AA 4ADZA 4WNKA 5M4YA 4C91A 4O4LE 4QX7B 2QGSA 4V1Av 1MNEA 2YK0A 2E9XC 5LJNA 3LFMA 4QX8B 4DMVA 2DCFA 4DBRA 3CQCB 3PU8A 3UULA 2V26A 4DNDA 1Y64B 1WLXA 3ZPOA 5LGUB 2DI4A 4HFVA 4PAGA 5L3EB 2EHOD 1BR1A 2CA5A 4ISSA 3ZYKA 1WR6A 2HPJA 4AKRB 4HEAA 1E1HB 5LP6E 1LKXA 1FEWA 1Z0PA 4EXTA 2KNDA 5F8PA 2LOSA 3I0QA 3CPZA 4H9RC 3R6NA 4TUYE 3LK42 3AA6B 5E0OA 4ERRA 3KVBA 4YJ2E 3GA8A 4ZOLE 3V5UA 5JVDE 3GMIA 2X0LB 3AA7B 3V5SA 3KBUA 5CB4E 4IE5A 3B13A 3ZMTB 5CA1E 4L9IA 2VL8A 3BQKA 5ETWA 2WBLA 2VKOA 3VHLA 3I9WA 5FXVA 2EHOC 5JQGE 4H9NC 1D0XA 4JUYA 5JDLA 2DNXA 4QKNA 3J9X1 2E9XB 2DLRA 2WMNA 4I50E 2NWBA 5LHIB 3RC8A 3E22E 5HWYA 2OA5A 3AA1B 3IEEA 4JEHB 3MACA 3J7Yq 5LHGB 4ILUA 2N2NA 2CXFA 2LSKA 2Y6XA 5J2TE 4HN9A 2Q9QD 3DP7A 2CWYA 1FMVA 1D0YA 1YKHB 2LSYA 2N9DA 3DTOA 4L0RA 2PG8A 1MMAA 2E9XA 2YU1A 5EK3A 3FXDB 5LBQB 3W15B 4EZHA 3O9XA 4CI2B 2KXPB 3EUHA 4L5GA 4H9PC 3S4UA 2WSSV 4MFRA 3BQIA 3O1IA 2P9BA 4PW8A 5HXSA 2XTLA 3KV4A 1D1AA 1D1CA 3BK9A 5LOVE 2NW9A 3ZYMA 3EDUA 3SRZA 4ZI2D 3OYXA 1VOMA 2IC6A 4UELA 5JDQA 4IDZA 3I9YA 3OYZA 4Z8XA 3PUAA 2V7MA 4DO0A 3FBLA 5EK4A 4X1YE 4AKLA 2V7IA 2KWIB 4I43B 3VU7H 4OYKA 2D2SA 5KX5E 5L3GB 4BA9A 3IHRA 4YLHA 3M65A 5GONE 3ZMVB 4ANJA 5JDMA 4TX5A 4H9OC 4IE0A 1HTJF 2MOZA 2SPCA 4XAXB 1MIVA 5LNKA 4JLEA 2DWKA 1CUNA 2VB6A 1HFAA 4KUMB 2UXNB 3AAIA 4X1KE 2MBGA 3ETUA 4YJ3E 2K5BB 4QXBB 1LVFA 3FB2A 3MKDA 3H3AA 4GOUA 3HA4A 3SS1A 5C8YE 4DVDA 3N2OA 5JDFA 3KINB 4UV9B 1V9DA 3QUJA 3P8CD 2LSIA 3BQLA 3ZJ1A 3N2KE 4O4HE 5LXTE 2E9XD 3PU3A 3HKBE 1FIOA 2MTQA 1AJ3A 2CMRA 3AVSA 2PFVA 3K3OA 3ZC1A 4O2AE 2WAUA 3KVAA 2X9HA 3PURA 5L2LA 1D1BA 3Q2MA 4ZI3C 2WM9A 4U74A 4PK5A 4QXHB 1US7B 3MK7C 5DJQC 4O8SA 1YW0A 5LJMA 1HG2A 2NTYA 3HKDE 4YHJA 1HCIA 3C4WA 1UX5A 3NRYA 2RP4A 3Q5WA 2V7KA 3N9QA 5LBMA 5JR9C 4K0UA 5FNVE 2IW5B 5LG4A 5LA6E 5HXRA 4MALA 1U4QA 2NOXA 4UIGA 2LM9A 2QA7A 5LYJE 2A2FX 5JDHA 5JRCA 2K48A 1FMWA 3PUGA 2CCQA 3PUSA 4GYRA 2D0TA 3UUMA 4CXXA 3P7IA 3K3NA 3N9MA 4GK0E 5F3JA 4X1IE 3KV9A 1WRDA 5AFUL 3UUNA 4CQIA 4IHJE 3GN5B 2YU2A 2YINA 2X9YA 3KV6A 2X66A 1IAPA 3IBPA 5JDNA 3U78A 3ZJ2A 2DWGA 2N1GA 3I0OA 3OBVE 2UXXB 2V7LA 4E7SA 2X51A 3CWZB 1HG5A 4PJJA 5J1GA 3RYFE 5CA0E 1S94A 2JPFA 4O2BE 4CI3B 2ZM2A 3AA0B 1H7CA 3AAEB 3GN5A 3RX6A 3Q9DA 2I59A 3ESLA 3ANWB 5JR9B 2VK9A 4WBNE 1S35A 3RH3A 4HE8A 2W62A 2LE8A 3PUQA 2JRKA 2MYSA 2C0SA 4KBMB 1NAFA 2J1DG 2LJLA 2B1EA 3F2EA 2W63A 3F31A 2W0GA 5HAXA 5JH7E 2JJ9A 3CQXC 5TAOA 2ZM8A 3C50A 2VKHA 3ETVA 2IC9A 4DBQA 1NWMX 3I1AA 1YD8G 4AI6A 2NW7A 2D0UA 2A72A 4XZCA 5JDGA 2XAGB 5JREA 3ANWA 3R84B 5JR9A 4AXPA 3ZLIA 4EZ4A 2BZBA 5HXCA 1HX8A 3K3QC 3KFWX 2W00A 3EDVA 5H6QB 2CM0A 4TV9E 4CXYA 3ZYLA 3AVRA 4AQGA 2JMHA 4PK6A 4G2AA 4NUUA 2HH7A 3RC3A 2IAKA 2VKJA 3PE0A 4ASKA 2CEAA 4H9SE 5FXWA 1O3XA 4A56A 3LG7A 2XHEB 3NRXA 5IHYA 2X9XA 4BJNA 4QXCB 4PNIA 2LT3A 2HPLA 4MHCA 4AQFA 3ZC0A 4MLKA 3AAAB 1YKEB 2DHRA 2WMOA 1ZKEA 2XQYA 1IJ5A 4ZI3D 5HYAA 1G73A 5L3BB 2LSGA 2X9WA 2LHNA 3VKGA 3RRWA 4YFSA 4DMWA 2KWHA 2WWUA 4E7ZA 5HXHA 3CKDA 5FXXA 3UUXB 3LJCA 2CLYB 2CXDA 2XUEA 4ISTA 3PTRB 3ZMUB 3C64A 2YEVC 4XBFB 3MZKB 3N9PA 4EAHA 3AB3B 4G63A 4NUVA 4WBOA 4CZZB 5JRCB 3C4XA 2BDEA 5J2UE 2K24A 5KMGP 4P0BA 3LK3B 4FJOA 1WYBA 4ZS3A 4EYUA 4JEUB 5LGTB 1MIWA 5FXZA 2KLQA 4WW0A 2KZ7B 2W61A 2XAFB 2G0UA 3LBXB 3FHNA 4M1PA 4BAYB 2X68A 4EIWA 4I55E 4OYJA 4IIJE 3RPUA 3T8OA 5DQWA 2CXLA 2NW8A 4U72A 2X67A 3QK6A 4H63V 4UVBB 2JMKA 4H9QC 5LHHB 4F6RC 1D0ZA 5FMNA 3JC6C 2C5JA 2Z6EA 2ZLYA 3DJBA 4MBQA 2RA1A 3IF8B 2PBIA 1HF8A 3LBXA 3L09A 4ZI7E 1WYCA 3NBXX 3CX7B 3MA9A 2ODUA 4GIWA 4PFOA 3UTKA 3NZPA 4EB6E 3EVYA 3HR0A 4IE4A 4EOZB 3N2GE 3VKHA 4PJLA 5EZYE 5FP3A 5FY0A 2Q9QA 3ZCIA 3L3PA 3N9LA 4AQFC 5ADXL 2H7VC 2LHRA 1KK7A 4UEMA 2NTXA 5A1LA 2V7JA 1LVKA 2ZM0A 3O1JA 1MMGA 4UF0B 3OKQA 5L3CB 3RYCE 5FY7A 3SOLA 3E08A 4IGUA 5DQVA 3WI3A 2L8KA 3TKLB 5BMVE 4BJMA 3KDSE 3CX6B 3HKCE 1SHZC 2C5IT 3N5LA 4AKGA 4CXWA 1LRZA 1G8XA 4UF0A 4UXNB 3PDYA 5HXEA 4OFZA 2Y48B 5HWXA 1SA0E 5KDMC 2L3LA 1MNDA 1IJ6A 3ZN0B 4O4JE 3C51A 5LCYA 2KMFA 4PJNA 4O4IE 5EK2A 2BVMA 3SWHA 2D5UA 2CLYC 3HI2A 3U3IA 2NP9A 3CVRA 3ONXA 4PK4A 5FYMA 2XASB 1MIYA 1MMNA 4IE6A 1VRBA 4OHFA 3ZMZB 4EYYR 2XAHB 1OWAA 2Y8DA 4TV8E 4UVAB 2VKDA 4UV8B 5LGNB 2JQQA 5IYZE 3B57A 3N9NA 5L3DB 2H7OA 4GK5E 4X20E 4AKHA 1IZNB 3C4ZA 2PJQA 4H63H 3ZEFB 1EZ3A 1QUUA 4HTEA 3MXZA 2ACXA 3KBTA 4HGAA 2M67A 4AKIA 4TN7B 4P0AA 3OJAA 1ZHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE8 A;  2KLQ A; 
#chains in the Genus database with same CATH topology
 2YDR A;  4P09 A;  4NXM T;  3LSV A;  1T8B A;  1QSD A;  2EHO B;  2KIN B;  3UQ4 A;  4CI1 B;  3CML A;  3FBZ A;  2X0Y A;  2ZMA A;  4UVC B;  4PFP A;  3FXE B;  2A3D A;  4N78 D;  4KMC A;  3P4Q A;  2LEH A;  4CN4 A;  3Q5X A;  3VRA A;  4JV5 T;  2E2A A;  1UX4 A;  2PTF A;  4HWD A;  4IDP A;  4J2C A;  4NPP A;  1JNZ A;  2LSJ A;  4B6X A;  4HKA A;  3CX8 B;  2BS3 A;  3CQG B;  3UFG A;  3ZCJ A;  2ODV A;  4ZHQ E;  2XQ9 A;  1B7T A;  3RYI E;  3RRC A;  2VAS A;  2CE7 A;  4ZS2 A;  4QH5 A;  3ZT7 A;  3TLS A;  4QH1 A;  4LFC T;  4O4L E;  2YKS A;  4X62 T;  2UU9 T;  2YK0 A;  2E9X C;  5LJN A;  3PU8 A;  2V26 A;  4DND A;  4PAG A;  5L3E B;  1BR1 A;  2XQ5 A;  1WR6 A;  2HPJ A;  4GKK T;  4EXT A;  1Z0P A;  2BS4 A;  3GA8 A;  5JVD E;  1KEY A;  2X0L B;  3V5S A;  3KBU A;  3B13 A;  3ZKR A;  5CA1 E;  2VL8 A;  3I9W A;  5FXV A;  4LFB T;  2EHO C;  5JQG E;  4B3R T;  2WMN A;  2NWB A;  5FVL A;  4DR3 T;  3RC8 A;  3E22 E;  2OA5 A;  2WCA A;  3MAC A;  5LHG B;  5J2T E;  4HN9 A;  1FMV A;  1YKH B;  2N9D A;  4YTP A;  3W15 B;  3FXD B;  4EZH A;  2KXP B;  3ABV A;  1YQ4 A;  3S4U A;  1WR0 A;  3O1I A;  2P9B A;  5HXS A;  5LOV E;  4X65 T;  4LML A;  3AED A;  3AEG A;  1YQ3 A;  4X5T A;  2BG9 E;  2KSR A;  3PUA A;  4DO0 A;  2V7I A;  5HEG A;  4I43 B;  1X9B A;  5GON E;  3ZMV B;  4ANJ A;  4TX5 A;  1HTJ F;  4XAX B;  1MIV A;  1WFD A;  2VB6 A;  1HFA A;  4JI3 T;  2MBG A;  4QXB B;  4EED A;  3MKD A;  1SUM B;  3H3A A;  1HR0 T;  4UV9 B;  2XZE A;  5LXT E;  4DV7 T;  2E9X D;  4Z90 A;  3KVA A;  3PUR A;  1D1B A;  4LFA T;  4PK5 A;  1US7 B;  4O8S A;  1HG2 A;  3RI5 A;  3HKD E;  1HCI A;  3C4W A;  2RP4 A;  5LBM A;  5L4H A;  1U4Q A;  3RIU C;  2QA7 A;  5JRC A;  5FL0 A;  3PUS A;  4HFH A;  3N9M A;  5F3J A;  4CQI A;  3X1D A;  4DV4 T;  3GN5 B;  4X66 T;  4U33 A;  2BS2 A;  2IDO B;  3T1Y T;  4E7S A;  2X51 A;  3CWZ B;  4PJJ A;  1KF6 A;  4O2B E;  4YSZ A;  3AAE B;  2XQ4 A;  2VQF T;  5HCJ A;  5JR9 B;  3EAB A;  2R6G F;  1S35 A;  4I0U A;  5FVK A;  4U7I A;  1NAF A;  3F2E A;  2W63 A;  5JH7 E;  3C50 A;  1OED E;  3I1A A;  4AI6 A;  5JRE A;  3ANW A;  2JIW A;  5HXC A;  3KFW X;  3OPC A;  2CM0 A;  4NUU A;  5AQP B;  2HH7 A;  3RC3 A;  5ABH A;  4DV2 T;  1VCT A;  2LT3 A;  1XWM A;  3ZC0 A;  4MLK A;  2YOE A;  5L47 A;  5AQF B;  5J0Z A;  2CBJ A;  1G73 A;  5L3B B;  2LSG A;  2LHN A;  4YFS A;  2WWU A;  1M62 A;  2CLY B;  3SFD A;  2BG9 A;  2YEV C;  4XBF B;  3MZK B;  4DR5 T;  3N9P A;  4EAH A;  4G63 A;  2BKN A;  3C4X A;  2V5D A;  4ILB A;  4ZS3 A;  2HHH T;  2KZ7 B;  3LBX B;  2X68 A;  1UUR A;  3RPU A;  3T8O A;  2NW8 A;  2X67 A;  4KI0 F;  2JMK A;  4H9Q C;  4X64 T;  2Z6E A;  2ZLY A;  3DJB A;  1UGO A;  4ZI7 E;  1WYC A;  3MA9 A;  4GIW A;  4CN6 A;  3EVY A;  2WU5 A;  4AQF C;  1KK7 A;  1IBK T;  5C2T A;  3FZL B;  3OKQ A;  2L8K A;  3AXJ B;  4GKJ T;  3ZSS A;  3HKC E;  1SHZ C;  4UF0 A;  1KNP A;  2BBJ A;  2I0M A;  1SA0 E;  4B3S T;  1E2A A;  4PJN A;  2CLY C;  3U3I A;  2NP9 A;  3CVR A;  1KFY A;  2XAS B;  3AEF A;  1VRB A;  2W2U A;  4JI0 T;  4UVA B;  2VKD A;  4UV8 B;  4YTM A;  1OED A;  2JQQ A;  3B57 A;  3N9N A;  2PJQ A;  4H63 H;  4HTE A;  3A8Y C;  3MXZ A;  4HWF A;  4HGA A;  2M67 A;  4TN7 B;  2CBI A;  5CA0 E;  3UQ7 A;  4I4T E;  3F57 A;  1MMD A;  4OK0 A;  1ZEE A;  1HS7 A;  2K3W A;  2V1D B;  3N9O A;  2BVL A;  3JAE A;  1KNZ A;  3E0Z A;  1BR2 A;  4ZI2 C;  4FI5 A;  4IE7 A;  4TZ4 C;  1DU2 A;  1BR0 A;  5DAB A;  2VWA A;  2LRL A;  3KV5 A;  4KP3 C;  4EGW A;  3O4X E;  4C90 A;  2XAJ B;  3P50 A;  2CHO A;  1Y01 A;  3WAK A;  4QWN B;  2XAQ B;  3A7M A;  3VRB A;  2WDQ A;  5BR8 T;  5M4Y A;  2XQ7 A;  3JCF A;  3AE5 A;  3LFM A;  2IUB A;  4DR1 T;  4DMV A;  3CQC B;  3ZPO A;  5LGU B;  4HFV A;  4ZXL A;  1UUS A;  4YT0 A;  4HEA A;  5AQL B;  5IUX A;  4U31 A;  5F8P A;  3I0Q A;  3PUY F;  4LMJ A;  2LKH A;  4H9R C;  4DV0 T;  5E0O A;  3KVB A;  4ZOL E;  3UU4 A;  3V5U A;  3GMI A;  2FUP A;  4L9I A;  3VHL A;  4JUY A;  5JDL A;  2E9X B;  4I50 E;  5LHI B;  5HWY A;  3AA1 B;  2XM1 A;  3AE2 A;  2CXF A;  3DP7 A;  1D0Y A;  2LSY A;  3EUH A;  1XZY A;  4MFR A;  2XTL A;  3KV4 A;  1D1C A;  3ZYM A;  4ZI2 D;  2IC6 A;  4UEL A;  2WDR A;  2JQH A;  3OYZ A;  2CHN A;  3FBL A;  5EK4 A;  4AKL A;  4H9O C;  5LNK A;  4JLE A;  2DWK A;  4KUM B;  2UXN B;  4HFD A;  3HA4 A;  1J1J A;  2LSI A;  3N2K E;  3PU3 A;  1FIO A;  3AVS A;  2PFV A;  3ZC1 A;  3QOF A;  4O2A E;  4TNV A;  4HFB A;  2X9H A;  2V6Y B;  3TLT A;  4QXH B;  3MK7 C;  1N34 T;  2NTY A;  5AQN B;  1UX5 A;  3NRY A;  2V7K A;  3N9Q A;  4JI6 T;  2IW5 B;  5LG4 A;  4JYA T;  2LM9 A;  3JAD A;  5LYJ E;  2HN1 A;  2UUB T;  2K48 A;  1ZP0 A;  4X1I E;  2CRB A;  1WRD A;  3NWI A;  3UUN A;  2D9D A;  1IBL T;  2YIN A;  2X9Y A;  5JDN A;  2XSB A;  3U78 A;  3M3Z B;  2DWG A;  2N1G A;  3I0O A;  2UXX B;  2V7L A;  4K0K T;  1HG5 A;  3H3M A;  1S94 A;  4DR2 T;  2VK9 A;  3AE7 A;  3RH3 A;  1J5W A;  3AE9 A;  4HE8 A;  2LE8 A;  2MYS A;  2C0S A;  4UR9 A;  2J1D G;  2B1E A;  4JBW F;  5AQQ B;  2QVA A;  5HAX A;  3CQX C;  5TAO A;  2ZM8 A;  2IC9 A;  2FJA A;  2A72 A;  5JDG A;  2XAG B;  3R84 B;  5CFB A;  4U3C A;  3PUX F;  2ACZ A;  2WQY A;  1W0B A;  4TV9 E;  3AXJ A;  3AVR A;  2JMH A;  4JI4 T;  5FXW A;  3RHW A;  3LG7 A;  2X9X A;  4BJN A;  1CHU A;  2HN2 A;  5LG3 A;  3ONJ A;  3AAA B;  3RF1 A;  4ILC A;  2XQY A;  3NKZ A;  3VKG A;  2QYW A;  2VQE T;  5HXH A;  3CKD A;  2UXB T;  3UUX B;  3LJC A;  5AQU B;  2XUE A;  1T72 A;  3NVO A;  3PTR B;  3RLF F;  4DR4 T;  3ZMU B;  4NUV A;  2VL0 A;  2BDE A;  2LLY A;  4P0B A;  3LK3 B;  4FJO A;  4KHP T;  1WYB A;  4IRE A;  4EYU A;  4JEU B;  5LGT B;  5FXZ A;  2G0U A;  3RQU A;  2I6H A;  4IIJ E;  4IDQ A;  4DV5 T;  2CXL A;  5HEO A;  5LHH B;  4KX6 A;  5FMN A;  3JC6 C;  5ABF B;  2YDQ A;  4LMK A;  2RA1 A;  4LF9 T;  3NBX X;  3CX7 B;  4PFO A;  3UTK A;  3HR0 A;  3N2G E;  5FY0 A;  5AQK B;  3N9L A;  5ADX L;  3TLU A;  2LHR A;  1WCR A;  2V7J A;  1LVK A;  2W66 A;  5L3C B;  4QH4 A;  5FY7 A;  3SOL A;  3E08 A;  2WU2 A;  4BJM A;  3KDS E;  3P4S A;  1G8X A;  5JTG A;  2AE9 A;  5HWX A;  2Y48 B;  4IDO A;  1IJ6 A;  5LCY A;  3C51 A;  5EK2 A;  2BVM A;  4COF A;  3FZH B;  2UUA T;  4PK4 A;  4IE6 A;  3ZMZ B;  5LGN B;  2H7O A;  4X20 E;  1IZN B;  2BKP A;  3C4Z A;  1QUU A;  2MAW A;  3KBT A;  3B5M A;  4U7Y A;  3D0T A;  2Q9Q C;  3GWH A;  3MJX A;  4U2Z A;  3UT5 E;  3QC9 A;  1T98 A;  2C5K T;  2B76 A;  2W67 A;  5AQS B;  3OTO T;  5CJ5 A;  3UFE A;  2EHO A;  3JC6 D;  1HNW T;  2H88 A;  1X79 A;  3NZQ A;  1UCU A;  1IBM T;  2ES0 A;  2KT9 A;  3AE4 A;  3H37 A;  2V5C A;  3LK2 B;  2H3R A;  3O1H A;  3TLV A;  3RYH E;  4QHO A;  4AQY T;  2K9A A;  5HCM A;  1NEN A;  4QX7 B;  4A97 A;  2QGS A;  5AQR B;  2V6Y A;  4QX8 B;  4DBR A;  3UUL A;  1Y64 B;  2DI4 A;  3P4R A;  2CA5 A;  4ISS A;  3ZYK A;  4JI8 T;  4AKR B;  1LKX A;  1FEW A;  1VCS A;  2KND A;  3CPZ A;  3EI0 A;  3R6N A;  4TUY E;  3LK4 2;  4YJ2 E;  3AA7 B;  3QNU A;  3ZMT B;  2FJE A;  5ETW A;  2WBL A;  4YHH T;  4H9N C;  2DNX A;  4QKN A;  2DLR A;  5AQJ B;  2VVS A;  2VUR A;  4JEH B;  3J7Y q;  4ILU A;  2N2N A;  2Y6X A;  2LSK A;  2UUC T;  2Q9Q D;  2JQK A;  2CWY A;  4ZZC A;  2XQA A;  4L0R A;  2PG8 A;  2YU1 A;  3QB5 A;  5LBQ B;  3RIU A;  4L5G A;  4TWD A;  2WSS V;  3BK9 A;  4DR6 T;  3SRZ A;  1VOM A;  4Z91 A;  3AEA A;  2V7M A;  4X1Y E;  3RKG A;  2KWI B;  3VU7 H;  4OYK A;  2D2S A;  1XNR T;  5L3G B;  4KHZ F;  3IHR A;  4YLH A;  5JDM A;  3FZF B;  1UK5 A;  2MOZ A;  2SPC A;  1CUN A;  2IIU A;  3AAI A;  4YJ3 E;  3FZM B;  1LVF A;  3FB2 A;  5C8Y E;  5LMU T;  4DVD A;  5JDF A;  3KIN B;  3P8C D;  4ZEY A;  3BQL A;  3ZJ1 A;  3HKB E;  2MTQ A;  1AJ3 A;  4TNW A;  3K3O A;  2WAU A;  2J47 A;  5L2L A;  1R8I A;  1YW0 A;  5LJM A;  2CPT A;  1KNR A;  2XM2 A;  5HEU A;  2F4V T;  3FZK B;  5FNV E;  5LA6 E;  4MAL A;  3VR8 A;  4UIG A;  2XQ6 A;  2A2F X;  3AEE A;  5JDH A;  3UUM A;  1FMW A;  4GYR A;  2CCQ A;  4TWH A;  3P7I A;  4GK0 E;  5HEJ A;  3KV9 A;  5AFU L;  3RIA A;  1JNR A;  2YU2 A;  1YXR A;  3KV6 A;  2X66 A;  1IAP A;  4DV6 T;  5LB7 B;  1XMQ T;  3IA3 A;  3OBV E;  3ZT5 A;  4IT4 A;  2M6I A;  4CI3 B;  2JPF A;  3AEC A;  5KXJ A;  2ZM2 A;  3GN5 A;  3RX6 A;  3Q9D A;  2I59 A;  2UXD T;  3ANW B;  4WBN E;  3PUQ A;  2JRK A;  1HNX T;  3F31 A;  2VKH A;  1NWM X;  2D0U A;  4XZC A;  4AXP A;  5JR9 A;  3ZLI A;  5F5W A;  2WDV A;  2V6X A;  1HX8 A;  3K3Q C;  3EDV A;  2IML A;  3ZYL A;  2VKJ A;  3ZST A;  4ASK A;  4DV1 T;  4H9S E;  1FJG T;  4NXN T;  4A56 A;  4HFC A;  2XHE B;  3NRX A;  2YDS A;  4QXC B;  4PNI A;  2HPL A;  4AQF A;  2DHR A;  2WMO A;  1ZKE A;  3EHZ A;  5HYA A;  2X9W A;  3RRW A;  4DMW A;  2KWH A;  4LF6 T;  3K1S A;  2YN6 A;  2J62 A;  4WBO A;  4CZZ B;  4ILA A;  5J2U E;  2K24 A;  2JQ9 A;  1N36 T;  3OVU A;  2E5V A;  2XAF B;  4M1P A;  4BAY B;  3FHN A;  2QRX A;  4TWF A;  4I55 E;  4OYJ A;  3CIR A;  2FJD A;  4U72 A;  3QK6 A;  4H63 V;  5LMN T;  1XDO A;  2C5J A;  3EAM A;  3T1H T;  4MBQ A;  4B3T T;  4EEB A;  3IF8 B;  2PBI A;  1HF8 A;  3LBX A;  2ODU A;  5AQO B;  1HNZ T;  3NZP A;  4EB6 E;  4IE4 A;  4PJL A;  5EZY E;  3L3P A;  2H7V C;  5AQT B;  1E7P A;  5A1L A;  3O1J A;  4UF0 B;  5FL1 A;  4U2Y A;  3CK6 A;  5DQV A;  3TKL B;  3L8R A;  2BG9 C;  2C5I T;  4AKG A;  2OV9 A;  1LRZ A;  5HXE A;  4OFZ A;  5AQV B;  5KDM C;  2L3L A;  1W9R A;  3ZN0 B;  1OED B;  4YXD A;  2D5U A;  3HI2 A;  3PV0 F;  3ONX A;  2W4X A;  4WZX A;  1MIY A;  1MMN A;  2MPK A;  4EYY R;  2XAH B;  4EV6 A;  2Y8D A;  4TV8 E;  5AQG B;  3UU8 A;  2FBW A;  2LM2 A;  4P0A A;  4AIU A;  5L4E A;  1Z8U A;  4WYV A;  2E8I A;  4LF5 T;  1OXZ A;  4GYS A;  1GQE A;  4YSY A;  4IL4 A;  5FY1 A;  3HKE E;  1N32 T;  3C98 B;  4HFE A;  1ZV4 X;  3ZN1 B;  3A5X A;  4F8H A;  5L3F B;  5H6R B;  2ZM6 T;  4CN1 A;  4YSX A;  2L9Q A;  1XNQ T;  1W09 A;  4HWI B;  3RKO A;  3ZMS B;  1HX1 B;  2LOP A;  1U5P A;  1BR4 A;  3AE6 A;  4LF8 T;  2OLT A;  3K8P C;  2CWO A;  3WAJ A;  4PJM A;  2GK9 A;  2Q9Q B;  3LDQ B;  3HL6 A;  1N33 T;  4ADZ A;  4WNK A;  4C91 A;  1OED C;  2BKO A;  4V1A v;  1MNE A;  2DCF A;  2XQ3 A;  3Q5D A;  1WLX A;  4ZZB A;  3UU6 A;  5HEH A;  5IWA T;  2EHO D;  2E5L T;  1E1H B;  2AXD S;  5LP6 E;  2X0H A;  2LOS A;  4DUZ T;  4JI1 T;  3AA6 B;  4ERR A;  3Q5E A;  4LF7 T;  5CB4 E;  4A5X A;  1NEK A;  4IE5 A;  2M6B A;  1T7S A;  3AE8 A;  3BQK A;  2VKO A;  2XY8 B;  5AQM B;  1D0X A;  2LKG A;  3J9X 1;  2NR4 A;  4HFI A;  3IEE A;  3VR9 A;  3QB5 K;  5ABG A;  2BBH A;  3DTO A;  1MMA A;  2E9X A;  3O9X A;  5EK3 A;  4CI2 B;  4H9P C;  3BQI A;  4NIQ A;  4PW8 A;  1D1A A;  2NW9 A;  3EDU A;  2DL1 A;  3OYX A;  3PJA J;  5JDQ A;  4IDZ A;  3I9Y A;  3PUZ F;  4Z8X A;  3P4P A;  2FJB A;  2WZH A;  1J5E T;  5KX5 E;  4BA9 A;  3M65 A;  4HWH A;  4IE0 A;  1W0A A;  1ZOY A;  4X1K E;  5AQH B;  3ETU A;  2K5B B;  3ZT6 A;  4GOU A;  3SS1 A;  3N2O A;  2WP9 A;  1V9D A;  3QUJ A;  4JI7 T;  4O4H E;  2CMR A;  3Q2M A;  4ZI3 C;  2WM9 A;  4U74 A;  4DUY T;  5DJQ C;  1SE7 A;  4YHJ A;  2H89 A;  3L39 A;  3Q5W A;  5JR9 C;  3G06 A;  4K0U A;  5HXR A;  2NOX A;  2WZI A;  3PUG A;  4CXX A;  2D0T A;  3K3N A;  3TLW A;  1I6Z A;  4IHJ E;  2V8S V;  2LRK A;  3IBP A;  3SFE A;  3ZJ2 A;  4A98 A;  3AEB A;  3P4W A;  5J1G A;  3RYF E;  3AA0 B;  1H7C A;  3UUB A;  3ESL A;  3AE3 A;  3UU5 A;  2W62 A;  5FKY A;  4KBM B;  2LJL A;  2W0G A;  2IHR 1;  2JJ9 A;  3ETV A;  4DBQ A;  4AIS A;  1YD8 G;  2NW7 A;  4EZ4 A;  2BZB A;  2RPA A;  2WS3 A;  2W00 A;  3PUV F;  5H6Q B;  4CXY A;  4AQG A;  4PK6 A;  4G2A A;  5AQI B;  2IAK A;  3PE0 A;  2XQ8 A;  2CEA A;  1I94 T;  3AE1 A;  1O3X A;  5IHY A;  2XPK A;  2XSA A;  4IDN A;  4Q25 A;  4DV3 T;  4MHC A;  1YKE B;  2XJ7 A;  1IJ5 A;  4ZI3 D;  3PUW F;  4YY3 T;  3RIF A;  4JI5 T;  2WY2 A;  4E7Z A;  5FXX A;  2CXD A;  4IST A;  1M7K A;  3C64 A;  5C3J A;  3AB3 B;  4JI2 T;  5JRC B;  5KMG P;  4B3M T;  4P1N A;  4HWC A;  1MIW A;  2WWV A;  2KLQ A;  4WW0 A;  2W61 A;  5CGM A;  4EIW A;  3JAF A;  5DQW A;  4UVB B;  5ABE A;  2UXC T;  2VVN A;  4F6R C;  1D0Z A;  3L09 A;  3RQW A;  4IL9 A;  1XMO T;  4YTN A;  4EOZ B;  3VKH A;  5FP3 A;  2Q9Q A;  3ZCI A;  4OX9 T;  4UEM A;  2NTX A;  5ABF A;  2ZM0 A;  4DR7 T;  1MMG A;  3RYC E;  4IGU A;  3WI3 A;  4DID B;  5BMV E;  3CX6 B;  3N5L A;  4CXW A;  4UXN B;  3ONL C;  3PDY A;  1QLB A;  1MND A;  4O4J E;  2KMF A;  4O4I E;  3SWH A;  3RGL A;  3UU3 A;  3PJA A;  1XDP A;  2A9U A;  5FYM A;  4OHF A;  1OWA A;  1L0V A;  2J4G A;  5IYZ E;  5L3D B;  4LF4 T;  4GK5 E;  4AKH A;  2WB5 A;  3ZEF B;  1EZ3 A;  2ACX A;  2BG9 B;  4AKI A;  3OJA A;  1ZHC A; 
#chains in the Genus database with same CATH homology
 3D0T A;  2E8I A;  2Q9Q C;  4P09 A;  1OXZ A;  4I4T E;  3F57 A;  1QSD A;  2EHO B;  2KIN B;  3GWH A;  3MJX A;  4GYS A;  1MMD A;  4OK0 A;  1ZEE A;  4CI1 B;  1HS7 A;  3UT5 E;  3CML A;  3FBZ A;  3QC9 A;  5FY1 A;  2ZMA A;  3HKE E;  1T98 A;  2C5K T;  4UVC B;  2V1D B;  3C98 B;  3N9O A;  2BVL A;  4PFP A;  1KNZ A;  1ZV4 X;  3FXE B;  3ZN1 B;  3A5X A;  2A3D A;  3E0Z A;  4N78 D;  3UFE A;  1BR2 A;  5L3F B;  2EHO A;  4KMC A;  3JC6 D;  5H6R B;  2LEH A;  4ZI2 C;  4FI5 A;  4IE7 A;  3Q5X A;  2L9Q A;  4TZ4 C;  1UX4 A;  1X79 A;  3NZQ A;  1UCU A;  4J2C A;  2ES0 A;  5DAB A;  1BR0 A;  3RKO A;  3ZMS B;  2LSJ A;  4B6X A;  2KT9 A;  4HKA A;  3CX8 B;  3CQG B;  2VWA A;  2LOP A;  1U5P A;  1BR4 A;  3ZCJ A;  3KV5 A;  4KP3 C;  2ODV A;  3H37 A;  4ZHQ E;  3LK2 B;  2H3R A;  3O1H A;  3K8P C;  2CWO A;  3WAJ A;  3RYH E;  3O4X E;  4PJM A;  4QHO A;  2GK9 A;  1B7T A;  2Q9Q B;  2XAJ B;  4C90 A;  3RYI E;  3WAK A;  3RRC A;  2VAS A;  3HL6 A;  4QWN B;  2XAQ B;  2CE7 A;  4ZS2 A;  2K9A A;  4ADZ A;  4WNK A;  5M4Y A;  4C91 A;  4O4L E;  4QX7 B;  2QGS A;  4V1A v;  1MNE A;  2YK0 A;  2E9X C;  5LJN A;  3LFM A;  4QX8 B;  4DMV A;  2DCF A;  4DBR A;  3CQC B;  3PU8 A;  3UUL A;  2V26 A;  4DND A;  1Y64 B;  1WLX A;  3ZPO A;  5LGU B;  2DI4 A;  4HFV A;  4PAG A;  5L3E B;  2EHO D;  1BR1 A;  2CA5 A;  4ISS A;  3ZYK A;  1WR6 A;  2HPJ A;  4AKR B;  4HEA A;  1E1H B;  5LP6 E;  1LKX A;  1FEW A;  1Z0P A;  4EXT A;  2KND A;  5F8P A;  2LOS A;  3I0Q A;  3CPZ A;  4H9R C;  3R6N A;  4TUY E;  3LK4 2;  3AA6 B;  5E0O A;  4ERR A;  3KVB A;  4YJ2 E;  3GA8 A;  4ZOL E;  3V5U A;  5JVD E;  3GMI A;  2X0L B;  3AA7 B;  3V5S A;  3KBU A;  5CB4 E;  4IE5 A;  3B13 A;  3ZMT B;  5CA1 E;  4L9I A;  2VL8 A;  3BQK A;  5ETW A;  2WBL A;  2VKO A;  3VHL A;  3I9W A;  5FXV A;  2EHO C;  5JQG E;  4H9N C;  1D0X A;  4JUY A;  5JDL A;  2DNX A;  4QKN A;  3J9X 1;  2E9X B;  2DLR A;  2WMN A;  4I50 E;  2NWB A;  5LHI B;  3RC8 A;  3E22 E;  5HWY A;  2OA5 A;  3AA1 B;  3IEE A;  4JEH B;  3MAC A;  3J7Y q;  5LHG B;  4ILU A;  2N2N A;  2CXF A;  2LSK A;  2Y6X A;  5J2T E;  4HN9 A;  2Q9Q D;  3DP7 A;  2CWY A;  1FMV A;  1D0Y A;  1YKH B;  2LSY A;  2N9D A;  3DTO A;  4L0R A;  2PG8 A;  1MMA A;  2E9X A;  2YU1 A;  5EK3 A;  3FXD B;  5LBQ B;  3W15 B;  4EZH A;  3O9X A;  4CI2 B;  2KXP B;  3EUH A;  4L5G A;  4H9P C;  3S4U A;  2WSS V;  4MFR A;  3BQI A;  3O1I A;  2P9B A;  4PW8 A;  5HXS A;  2XTL A;  3KV4 A;  1D1A A;  1D1C A;  3BK9 A;  5LOV E;  2NW9 A;  3ZYM A;  3EDU A;  3SRZ A;  4ZI2 D;  3OYX A;  1VOM A;  2IC6 A;  4UEL A;  5JDQ A;  4IDZ A;  3I9Y A;  3OYZ A;  4Z8X A;  3PUA A;  2V7M A;  4DO0 A;  3FBL A;  5EK4 A;  4X1Y E;  4AKL A;  2V7I A;  2KWI B;  4I43 B;  3VU7 H;  4OYK A;  2D2S A;  5KX5 E;  5L3G B;  4BA9 A;  3IHR A;  4YLH A;  3M65 A;  5GON E;  3ZMV B;  4ANJ A;  5JDM A;  4TX5 A;  4H9O C;  4IE0 A;  1HTJ F;  2MOZ A;  2SPC A;  4XAX B;  1MIV A;  5LNK A;  4JLE A;  2DWK A;  1CUN A;  2VB6 A;  1HFA A;  4KUM B;  2UXN B;  3AAI A;  4X1K E;  2MBG A;  3ETU A;  4YJ3 E;  2K5B B;  4QXB B;  1LVF A;  3FB2 A;  3MKD A;  3H3A A;  4GOU A;  3HA4 A;  3SS1 A;  5C8Y E;  4DVD A;  3N2O A;  5JDF A;  3KIN B;  4UV9 B;  1V9D A;  3QUJ A;  3P8C D;  2LSI A;  3BQL A;  3ZJ1 A;  3N2K E;  4O4H E;  5LXT E;  2E9X D;  3PU3 A;  3HKB E;  1FIO A;  2MTQ A;  1AJ3 A;  2CMR A;  3AVS A;  2PFV A;  3K3O A;  3ZC1 A;  4O2A E;  2WAU A;  3KVA A;  2X9H A;  3PUR A;  5L2L A;  1D1B A;  3Q2M A;  4ZI3 C;  2WM9 A;  4U74 A;  4PK5 A;  4QXH B;  1US7 B;  3MK7 C;  5DJQ C;  4O8S A;  1YW0 A;  5LJM A;  1HG2 A;  2NTY A;  3HKD E;  4YHJ A;  1HCI A;  3C4W A;  1UX5 A;  3NRY A;  2RP4 A;  3Q5W A;  2V7K A;  3N9Q A;  5LBM A;  5JR9 C;  4K0U A;  5FNV E;  2IW5 B;  5LG4 A;  5LA6 E;  5HXR A;  4MAL A;  1U4Q A;  2NOX A;  4UIG A;  2LM9 A;  2QA7 A;  5LYJ E;  2A2F X;  5JDH A;  5JRC A;  2K48 A;  1FMW A;  3PUG A;  2CCQ A;  3PUS A;  4GYR A;  2D0T A;  3UUM A;  4CXX A;  3P7I A;  3K3N A;  3N9M A;  4GK0 E;  5F3J A;  4X1I E;  3KV9 A;  1WRD A;  5AFU L;  3UUN A;  4CQI A;  4IHJ E;  3GN5 B;  2YU2 A;  2YIN A;  2X9Y A;  3KV6 A;  2X66 A;  1IAP A;  3IBP A;  5JDN A;  3U78 A;  3ZJ2 A;  2DWG A;  2N1G A;  3I0O A;  3OBV E;  2UXX B;  2V7L A;  4E7S A;  2X51 A;  3CWZ B;  1HG5 A;  4PJJ A;  5J1G A;  3RYF E;  5CA0 E;  1S94 A;  2JPF A;  4O2B E;  4CI3 B;  2ZM2 A;  3AA0 B;  1H7C A;  3AAE B;  3GN5 A;  3RX6 A;  3Q9D A;  2I59 A;  3ESL A;  3ANW B;  5JR9 B;  2VK9 A;  4WBN E;  1S35 A;  3RH3 A;  4HE8 A;  2W62 A;  2LE8 A;  3PUQ A;  2JRK A;  2MYS A;  2C0S A;  4KBM B;  1NAF A;  2J1D G;  2LJL A;  2B1E A;  3F2E A;  2W63 A;  3F31 A;  2W0G A;  5HAX A;  5JH7 E;  2JJ9 A;  3CQX C;  5TAO A;  2ZM8 A;  3C50 A;  2VKH A;  3ETV A;  2IC9 A;  4DBQ A;  1NWM X;  3I1A A;  1YD8 G;  4AI6 A;  2NW7 A;  2D0U A;  2A72 A;  4XZC A;  5JDG A;  2XAG B;  5JRE A;  3ANW A;  3R84 B;  5JR9 A;  4AXP A;  3ZLI A;  4EZ4 A;  2BZB A;  5HXC A;  1HX8 A;  3K3Q C;  3KFW X;  2W00 A;  3EDV A;  5H6Q B;  2CM0 A;  4TV9 E;  4CXY A;  3ZYL A;  3AVR A;  4AQG A;  2JMH A;  4PK6 A;  4G2A A;  4NUU A;  2HH7 A;  3RC3 A;  2IAK A;  2VKJ A;  3PE0 A;  4ASK A;  2CEA A;  4H9S E;  5FXW A;  1O3X A;  4A56 A;  3LG7 A;  2XHE B;  3NRX A;  5IHY A;  2X9X A;  4BJN A;  4QXC B;  4PNI A;  2LT3 A;  2HPL A;  4MHC A;  4AQF A;  3ZC0 A;  4MLK A;  3AAA B;  1YKE B;  2DHR A;  2WMO A;  1ZKE A;  2XQY A;  1IJ5 A;  4ZI3 D;  5HYA A;  1G73 A;  5L3B B;  2LSG A;  2X9W A;  2LHN A;  3VKG A;  3RRW A;  4YFS A;  4DMW A;  2KWH A;  2WWU A;  4E7Z A;  5HXH A;  3CKD A;  5FXX A;  3UUX B;  3LJC A;  2CLY B;  2CXD A;  2XUE A;  4IST A;  3PTR B;  3ZMU B;  3C64 A;  2YEV C;  4XBF B;  3MZK B;  3N9P A;  4EAH A;  3AB3 B;  4G63 A;  4NUV A;  4WBO A;  4CZZ B;  5JRC B;  3C4X A;  2BDE A;  5J2U E;  2K24 A;  5KMG P;  4P0B A;  3LK3 B;  4FJO A;  1WYB A;  4ZS3 A;  4EYU A;  4JEU B;  5LGT B;  1MIW A;  5FXZ A;  2KLQ A;  4WW0 A;  2KZ7 B;  2W61 A;  2XAF B;  2G0U A;  3LBX B;  3FHN A;  4M1P A;  4BAY B;  2X68 A;  4EIW A;  4I55 E;  4OYJ A;  4IIJ E;  3RPU A;  3T8O A;  5DQW A;  2CXL A;  2NW8 A;  4U72 A;  2X67 A;  3QK6 A;  4H63 V;  4UVB B;  2JMK A;  4H9Q C;  5LHH B;  4F6R C;  1D0Z A;  5FMN A;  3JC6 C;  2C5J A;  2Z6E A;  2ZLY A;  3DJB A;  4MBQ A;  2RA1 A;  3IF8 B;  2PBI A;  1HF8 A;  3LBX A;  3L09 A;  4ZI7 E;  1WYC A;  3NBX X;  3CX7 B;  3MA9 A;  2ODU A;  4GIW A;  4PFO A;  3UTK A;  3NZP A;  4EB6 E;  3EVY A;  3HR0 A;  4IE4 A;  4EOZ B;  3N2G E;  3VKH A;  4PJL A;  5EZY E;  5FP3 A;  5FY0 A;  2Q9Q A;  3ZCI A;  3L3P A;  3N9L A;  4AQF C;  5ADX L;  2H7V C;  2LHR A;  1KK7 A;  4UEM A;  2NTX A;  5A1L A;  2V7J A;  1LVK A;  2ZM0 A;  3O1J A;  1MMG A;  4UF0 B;  3OKQ A;  5L3C B;  3RYC E;  5FY7 A;  3SOL A;  3E08 A;  4IGU A;  5DQV A;  3WI3 A;  2L8K A;  3TKL B;  5BMV E;  4BJM A;  3KDS E;  3CX6 B;  3HKC E;  1SHZ C;  2C5I T;  3N5L A;  4AKG A;  4CXW A;  1LRZ A;  1G8X A;  4UF0 A;  4UXN B;  3PDY A;  5HXE A;  4OFZ A;  2Y48 B;  5HWX A;  1SA0 E;  5KDM C;  2L3L A;  1MND A;  1IJ6 A;  3ZN0 B;  4O4J E;  3C51 A;  5LCY A;  2KMF A;  4PJN A;  4O4I E;  5EK2 A;  2BVM A;  3SWH A;  2D5U A;  2CLY C;  3HI2 A;  3U3I A;  2NP9 A;  3CVR A;  3ONX A;  4PK4 A;  5FYM A;  2XAS B;  1MIY A;  1MMN A;  4IE6 A;  1VRB A;  4OHF A;  3ZMZ B;  4EYY R;  2XAH B;  1OWA A;  2Y8D A;  4TV8 E;  4UVA B;  2VKD A;  4UV8 B;  5LGN B;  2JQQ A;  5IYZ E;  3B57 A;  3N9N A;  5L3D B;  2H7O A;  4GK5 E;  4X20 E;  4AKH A;  1IZN B;  3C4Z A;  2PJQ A;  4H63 H;  3ZEF B;  1EZ3 A;  1QUU A;  4HTE A;  3MXZ A;  2ACX A;  3KBT A;  4HGA A;  2M67 A;  4AKI A;  4TN7 B;  4P0A A;  3OJA A;  1ZHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...