4JEHB

Crystal structure of munc18a and syntaxin1 lacking n-peptide complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
221
structure length
221
Chain Sequence
DRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 1
publication title Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 93
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jehB00
4TX5A 4JEUB 2XHEB 5M4YA 1FIOA 1EZ3A 1FEWA 4JEHB 3LG7A 2DNXA 1S94A 5LG4A 1BR0A 1G73A 3C98B 1HS7A
chains in the Genus database with same CATH superfamily
5LHHB 3UU6A 1J5WA 5ABEA 4IDZA 4JI1T 3A8YC 1HR0T 2X9HA 5HEOA 5LP6E 3A7MA 5JVDE 1SHZC 4JI5T 2WMOA 2D0TA 4U2ZA 5FNVE 5JDFA 2RPAA 1KK7A 3C4ZA 3NWIA 3AAIA 5ABHA 1ZOYA 2HPLA 3PUWF 4ZI3D 5IYZE 3HA4A 1WR6A 4IL9A 4P09A 4PJJA 3N5LA 3ZSTA 2IUBA 2VQET 2BBHA 4JI6T 4PJNA 4UR9A 4ZXLA 4EEBA 3GWHA 3UUBA 5FKYA 3L39A 5EK4A 1D1AA 2V6YA 3FZMB 4AI6A 4O2BE 2V5CA 3JC6C 3SWHA 4ILCA 3FXDB 3O1HA 4LFBT 5IHYA 3CQGB 4IE0A 3KV5A 2WCAA 1WFDA 4DBQA 2UXXB 5AQKB 1VCSA 3RQWA 3ONLC 2BS2A 2WDRA 3AEDA 2V7LA 4AXPA 4MLKA 3RPUA 1NAFA 4Z91A 5FP3A 4AKRB 3EUHA 3AEGA 3NRXA 5AQVB 3CQXC 2KSRA 2FJBA 2ACXA 4CN1A 1E1HB 4ZEYA 3K1SA 5J2UE 2ZM6T 5L2LA 2YU1A 4ILAA 2V7MA 2BG9C 4UVCB 3ESLA 4O8SA 3AVSA 1XMOT 2BVLA 4DV4T 1HTJF 1KNRA 4XAXB 1XNQT 5HXCA 2Z6EA 1YW0A 2MOZA 1HS7A 2WWVA 1XWMA 4YJ3E 2A2FX 2XQ4A 3AE5A 3OJAA 1KNZA 4PK6A 2XHEB 1OEDC 3ONXA 1ZHCA 4A56A 5H6QB 5L3GB 2VVNA 2HN1A 4CI1B 2XQ9A 4JV5T 4CZZB 4QKNA 2YDRA 2K9AA 3O4XE 4YT0A 5J0ZA 5AQTB 3C50A 2WM9A 3LDQB 2QGSA 4CN6A 3D0TA 2UU9T 3LK42 2N1GA 1VRBA 5LOVE 2D5UA 2W00A 4B3ST 1XZYA 2WSSV 4H63V 3PE0A 4DV6T 3Q5EA 2NP9A 2JPFA 2CCQA 4YHJA 2Y8DA 4LFCT 5FL1A 4KBMB 4Q25A 1XNRT 5AQNB 2CXDA 3EDUA 2PFVA 1N36T 4LF6T 4DR5T 3UU8A 1L0VA 1FMWA 3PU8A 4JI7T 3ZN1B 4IIJE 5EK2A 3TLUA 4ZOLE 3QNUA 5CB4E 4AKHA 4AISA 3MJXA 4IREA 4JLEA 3CX6B 3W15B 2QA7A 1SA0E 4JYAT 2XASB 2K3WA 1W09A 4YLHA 3EHZA 3AEFA 1FEWA 3NZQA 3CVRA 2C0SA 3PDYA 1UX4A 3H3MA 1I94T 3AEBA 3EABA 5HXEA 5JDMA 2M67A 5JRCB 3RIUC 4ANJA 4G2AA 2LT3A 2LLYA 2J1DG 3RH3A 2BS4A 5HCMA 5F3JA 2XPKA 1WLXA 2JQQA 3C4WA 3C64A 4B3RT 3C98B 3PUYF 3KFWX 3JC6D 4FJOA 3RYHE 1S94A 4EZHA 4HGAA 2CLYC 1S35A 2W63A 1WYCA 1HNWT 3C51A 4KI0F 2QYWA 4X64T 4GKKT 1T8BA 2V6XA 3P4SA 4TNVA 3JAEA 2LJLA 4GYSA 4IDPA 3EI0A 4JI8T 3HI2A 4U33A 4X5TA 4A5XA 2V7JA 5FXVA 4LFAT 3RI5A 3P4QA 2E9XA 3AE9A 4DV1T 4ILBA 2LE8A 3T1HT 2D9DA 1UUSA 1KNPA 3AE7A 5DQVA 3PUQA 2XQ3A 5DQWA 5FXXA 3CK6A 2IC9A 1OEDE 4YTNA 2JRKA 2X9XA 2VB6A 4N78D 5AQIB 1XMQT 4QXCB 4TWFA 3ZMUB 5AQQB 4H63H 3CX8B 5TAOA 3ZN0B 3CMLA 3CKDA 2OA5A 2AXDS 2XAGB 3UUXB 1DU2A 2H88A 1IAPA 4EZ4A 3K3NA 2H7OA 5AQLB 1UURA 2BG9B 4TWHA 2WMNA 3GMIA 2Q9QC 3FBZA 2DHRA 4H9RC 1I6ZA 3ZCJA 4ADZA 5KXJA 1MIVA 2LKGA 2Y48B 2I0MA 2XQ6A 4AKLA 1E2AA 1HNZT 3RF1A 4PAGA 4IE7A 1W0AA 4JI2T 3GN5B 4EXTA 3SOLA 4C91A 2J47A 5GONE 1N34T 4QX7B 4HWFA 2XUEA 5CGMA 2NW8A 2ES0A 4QX8B 4U74A 3CWZB 4X66T 3L3PA 1BR1A 2A9UA 2PG8A 2DL1A 1KF6A 4TZ4C 4ERRA 3N9OA 3GA8A 2L8KA 3OTOT 4FI5A 4C90A 4LF7T 5HXSA 4U3CA 3AE3A 4B6XA 2W61A 3KV4A 4DBRA 4ZZCA 5LG3A 4HKAA 1D0XA 5E0OA 5LB7B 2UUAT 3UQ4A 3ABVA 4EV6A 3BQIA 4OFZA 2PJQA 3ETVA 4DUZT 4WBOA 1J5ET 2KNDA 5HAXA 5JR9A 2IIUA 1MMDA 5JDGA 2CBJA 3VR9A 3E08A 3ONJA 2LOSA 4QH1A 3MACA 4ZI2D 3AAAB 2E5LT 2VVSA 3A5XA 5AQMB 4DNDA 5LHIB 2NWBA 5M4YA 4P0BA 4UIGA 1IZNB 5FVKA 3VR8A 2HHHT 4HN9A 5AQGB 2CPTA 1US7B 2DCFA 2W67A 3PUVF 3ZMSB 3Q5XA 2H7VC 5L4HA 4BJNA 4DV2T 1HG2A 2CLYB 3NBXX 3Q2MA 2XQ8A 2EHOA 2OV9A 3PJAJ 1H7CA 5LYJE 5FY1A 3AXJA 3PUSA 4YSZA 2H3RA 3T1YT 2CHNA 4O4LE 5JREA 1D0YA 2NTYA 2YOEA 5JH7E 4MFRA 2CWOA 1BR0A 3VKHA 2YKSA 1UK5A 2XQ7A 2UUBT 4U2YA 3QC9A 2V8SV 1W0BA 2WU5A 3ANWA 1QLBA 4V1Av 1BR2A 2HN2A 3Q5WA 3RX6A 4Z8XA 5FYMA 3IEEA 1YKEB 4IGUA 4UEMA 2DLRA 3OBVE 4HE8A 1HFAA 3S4UA 4UF0A 4YTPA 4U7IA 5AQJB 2LHRA 3JCFA 3EAMA 2JQ9A 2WZHA 3PV0F 3TLVA 5KDMC 4HWDA 3ZYLA 5BR8T 1YQ3A 3H37A 2VKJA 4I55E 4LF5T 2CHOA 2XAFB 1JNZA 3AE6A 4M1PA 4A97A 5LGTB 5LJMA 4EAHA 3RKOA 2KT9A 3PUAA 3LBXA 2CXFA 3BQLA 4DUYT 1O3XA 3OVUA 5FL0A 5LCYA 2XAHB 1Y01A 1IJ6A 2L9QA 2K5BB 2XQ5A 3UFEA 4P1NA 5ADXL 4G63A 3HKBE 3AVRA 3RC8A 4WZXA 2VKOA 4IHJE 5HYAA 4LF9T 4PNIA 4U7YA 1KEYA 4WW0A 4AQFA 2VWAA 2LKHA 4KP3C 4TN7B 3QB5K 3N2KE 3FZKB 4I4TE 1XDPA 4E7SA 4ZS2A 2VURA 5AQUB 3I9YA 1MNEA 5LA6E 3O1JA 4PJMA 2MTQA 2NTXA 2VL8A 4DVDA 3DTOA 5LNKA 2YEVC 2KZ7B 4H9SE 2MBGA 4JI3T 4WNKA 3ZCIA 2LEHA 3RIFA 3PTRB 5HXRA 2V5DA 4MALA 4NPPA 3PUXF 2BVMA 2VL0A 5LHGB 3PUGA 2CA5A 3RRCA 4IT4A 3SFDA 5HEUA 4OHFA 1T7SA 5ABGA 2KINB 3L8RA 4JI4T 1U5PA 1HF8A 2IAKA 4HFEA 3P4RA 3NZPA 4H9NC 3RGLA 3K3OA 1UCUA 3LK3B 3UQ7A 3ZPOA 2K48A 4F6RC 4AQGA 1B7TA 2W0GA 5FMNA 2V7KA 4ZS3A 3GN5A 3N9MA 3IF8B 2BKNA 5HWXA 5C3JA 3LFMA 4X62T 3LSVA 3Q9DA 4EEDA 3ZT6A 3OYXA 2RA1A 2XSBA 5F5WA 3UULA 1VOMA 2KMFA 3N9QA 2N9DA 2X9YA 5J1GA 4KMCA 5LBMA 2E9XC 3MK7C 3SRZA 3VU7H 2XM1A 4JEUB 4L9IA 2BS3A 4O4JE 2WDVA 3MKDA 2CRBA 3KBUA 3RIAA 3VRAA 5CA0E 3KV6A 3HKEE 3U3IA 4DR6T 1MNDA 4ISTA 1FIOA 3KDSE 2YU2A 1G8XA 4HTEA 3FBLA 2NW7A 2V7IA 1J1JA 3HKDE 5L4EA 1KFYA 4DV5T 4NUVA 2JQHA 3AECA 2VASA 1LKXA 4CI2B 5AQRB 4JUYA 1UX5A 5LJNA 3N9PA 1QUUA 5L3DB 4LF8T 5ABFB 4OX9T 3M65A 4ZI7E 1EZ3A 3RHWA 3P4PA 3DP7A 4PFPA 4I0UA 3LG7A 3PJAA 1D1CA 3PURA 2BKOA 2I59A 1ZKEA 3RQUA 3RIUA 4CN4A 2OLTA 2IDOB 2LRLA 2DWGA 2BKPA 4EB6E 4EGWA 4OYKA 1MMNA 4ASKA 4L0RA 4CXXA 2XQYA 4AIUA 1Z8UA 4YSXA 3AEAA 4IL4A 4HFDA 1YKHB 2BBJA 3BK9A 5HEHA 3MZKB 2LRKA 4ZI3C 4BJMA 3KVBA 1N33T 1IBKT 1XDOA 4YXDA 2K24A 3UUMA 3WAJA 1R8IA 4PFOA 3VHLA 2UXBT 4TX5A 4EYYR 2CXLA 2CBIA 3L09A 2UXCT 3NVOA 2C5JA 4UV9B 2CE7A 3RRWA 4TV9E 1OEDB 3RYIE 4JI0T 3UU4A 3SS1A 4EYUA 3CX7B 4DO0A 5JR9C 3AE4A 3C4XA 5JDLA 2WB5A 2X0YA 2LSJA 4NXMT 3VKGA 3B13A 1VCTA 4L5GA 2BDEA 4O4IE 2E2AA 1M7KA 1G73A 4HFCA 3P7IA 2W62A 4GK5E 2N2NA 1X9BA 5LG4A 2C5KT 3I9WA 2JMHA 3JADA 3QK6A 3ETUA 3NRYA 4TV8E 3AE8A 5AQSB 4U72A 5KX5E 1LVKA 2P9BA 2I6HA 5FY7A 5JQGE 4KX6A 5JDQA 3M3ZB 2W4XA 4IDQA 3HKCE 3ZT5A 4I43B 4U31A 5A1LA 2EHOC 2LSIA 3E0ZA 1MIYA 4UVAB 2HH7A 5ETWA 2AE9A 1NENA 1ZP0A 5AQPB 4ILUA 1NEKA 2W66A 1MMGA 4DR2T 2WAUA 3MXZA 3MA9A 1ZV4X 3UUNA 4IE5A 5LMUT 1E7PA 4HFVA 4KHZF 1YD8G 2E9XB 3UTKA 5LGUB 4OK0A 4TNWA 2LSYA 5L3EB 2H89A 2VK9A 4PW8A 4YSYA 4HWCA 3CIRA 3F31A 3OKQA 4A98A 3ZJ2A 5DJQC 4IDNA 4QXBB 5L47A 4Z90A 1X79A 2W2UA 4DMWA 2IC6A 2JMKA 5C8YE 2DWKA 3ZMZB 2MYSA 2BZBA 2FJDA 5EK3A 2LSKA 4YTMA 5IUXA 3KBTA 4YFSA 3RLFF 2Y6XA 4B3TT 2ZLYA 5JRCA 3N9LA 3I1AA 4LF4T 3AEEA 2XTLA 4IDOA 4PJLA 3UU5A 2WZIA 2ACZA 4O2AE 2XY8B 2Q9QD 4HFBA 4UELA 4AKGA 1AJ3A 2MPKA 3AA6B 1WR0A 2IMLA 3K3QC 4AQFC 2PTFA 4UVBB 4H9QC 4CQIA 4NUUA 2YDSA 3VRBA 3E22E 2L3LA 1CHUA 4JBWF 2XSAA 4OYJA 2G0UA 1D1BA 4MHCA 2IW5B 2ZM0A 3ZJ1A 3FHNA 5LMNT 4COFA 4K0KT 2WS3A 2WDQA 3B57A 2KLQA 3BQKA 3TLWA 2E5VA 5ABFA 3AA1B 5HXHA 1IBLT 2NR4A 2Q9QB 5BMVE 2D0UA 4BA9A 3KINB 4P0AA 2D2SA 4QWNB 3HL6A 3T8OA 3AB3B 3AAEB 5EZYE 4X20E 1W9RA 3I0OA 4ZZBA 2X51A 2GK9A 4KHPT 2DI4A 2FJEA 4LMJA 2CWYA 1T72A 4J2CA 4AQYT 3FZHB 1HCIA 4CXWA 2X67A 1IBMT 2LM9A 2YN6A 3FZLB 1N32T 3IHRA 5JR9B 4XBFB 1ZEEA 3QB5A 2UXNB 2X66A 2XZEA 4DV3T 1JNRA 1FMVA 2ODVA 5JDHA 2EHOD 5FXZA 2YDQA 5LXTE 3G06A 3N9NA 3IBPA 1CUNA 4BAYB 4NIQA 3UFGA 5DABA 2KWIB 3J9X1 2LSGA 2FUPA 2VQFT 3HR0A 2BG9A 5JDNA 4X1KE 3KVAA 3F57A 3N2OA 4H9PC 4NXNT 3ZKRA 4EIWA 5FXWA 1UGOA 4O4HE 3ZYMA 4UXNB 3PUZF 2HPJA 4HEAA 5IWAT 3LK2B 1LRZA 2UXDT 4B3MT 2A72A 2RP4A 1OEDA 1YQ4A 2XAQB 2YK0A 5J2TE 3QUJA 2XM2A 2EHOB 4TUYE 4GIWA 3ZSSA 3AXJB 3J7Yq 3ZEFB 2KWHA 3AE2A 2FBWA 1WYBA 4X1IE 2UUCT 4DMVA 3ZYKA 3EVYA 5C2TA 4DR7T 4GYRA 1IJ5A 3FXEB 2V6YB 4MBQA 3LJCA 3ANWB 2J4GA 3IA3A 1BR4A 4H9OC 5JTGA 3P4WA 2CMRA 1SE7A 2PBIA 2ZMAA 3QOFA 1NWMX 4QXHB 2CM0A 4UF0B 3OYZA 4JEHB 2X0HA 4HWIB 2WU2A 2LOPA 3O9XA 4IE6A 4X1YE 3UU3A 5HEJA 4WYVA 4IE4A 4UV8B 5HWYA 4ZI2C 4GOUA 2QRXA 4DR1T 3O1IA 2FJAA 3PU3A 1SUMB 4LMKA 2X68A 3LBXB 3ZMTB 2A3DA 3AA0B 3R6NA 2XJ7A 4GKJT 5F8PA 2ODUA 3RYFE 2LM2A 3OPCA 2SPCA 4TWDA 3V5UA 5KMGP 3B5MA 4E7ZA 2BG9E 3Q5DA 1T98A 2ZM2A 3I0QA 2DNXA 4DV7T 3AE1A 5H6RB 1WCRA 2J62A 2JJ9A 1QSDA 4DV0T 3ZMVB 2X0LB 5CJ5A 2IHR1 3R84B 4LMLA 2XQAA 3NKZA 5AQFB 4YY3T 3P8CD 2F4VT 3K8PC 1FJGT 3ZLIA 3ZT7A 4PK4A 3U78A 3FB2A 5AQHB 2VKHA 3TLSA 1LVFA 4DR4T 4YJ2E 5L3FB 4XZCA 2YINA 1YXRA 1U4QA 4YHHT 2LHNA 2X9WA 4QH4A 2WQYA 2ZM8A 4I50E 4DR3T 1Z0PA 3P50A 2E8IA 1MIWA 4KUMB 3CQCB 5AFUL 5L3CB 3V5SA 1Y64B 1HG5A 1WRDA 3WAKA 2M6BA 3JAFA 2KXPB 3SFEA 3FZFB 5LBQB 3KV9A 4WBNE 3UT5E 4PK5A 3X1DA 2M6IA 2JIWA 3F2EA 2CEAA 4HFIA 3WI3A 1MMAA 5CA1E 2C5IT 5FVLA 2NOXA 5HCJA 2WBLA 3TLTA 2Q9QA 2VKDA 4ISSA 2QVAA 4X65T 2V26A 5LGNB 2E9XD 1OXZA 1M62A 2R6GF 2WY2A 3H3AA 2WWUA 2MAWA 5CFBA 2JQKA 4CXYA 3ZC1A 1OWAA 4CI3B 2XAJB 1V9DA 3CPZA 4GK0E 5AQOB 3ZC0A 1HX1B 5L3BB 4QH5A 4HFHA 1D0ZA 4HWHA 1HNXT 4AKIA 3AA7B 2V1DB 4DIDB 5HEGA 2B1EA 3RKGA 3EDVA 3RYCE 5FY0A 2NW9A 3DJBA 4ZHQE 4K0UA 3RC3A 3N2GE 2WP9A 3TKLB 1HX8A 1GQEA 4F8HA 4EOZB 2B76A 4QHOA
chains in the Genus database with same CATH topology
2DHRA 3SRZA 3VU7H 2D2SA 4JEUB 4L9IA 4QWNB 5LHHB 3HL6A 3T8OA 4H9RC 4IDZA 3ZCJA 4O4JE 3MKDA 3KBUA 4ADZA 3AB3B 3AAEB 5EZYE 4X20E 1MIVA 3I0OA 2X51A 2GK9A 2DI4A 5CA0E 2Y48B 3KV6A 2X9HA 2CWYA 4AKLA 4J2CA 5LP6E 5JVDE 3HKEE 3U3IA 1HCIA 1MNDA 4CXWA 4ISTA 2X67A 1SHZC 4IE7A 1FIOA 3KDSE 4PAGA 2YU2A 1G8XA 4HTEA 2LM9A 2NW7A 2D0TA 2WMOA 3FBLA 3IHRA 5JR9B 4XBFB 3GN5B 1ZEEA 2V7IA 2UXNB 5FNVE 5JDFA 3HKDE 1KK7A 2X66A 3C4ZA 1FMVA 3AAIA 4EXTA 4NUVA 3SOLA 2ODVA 4C91A 5JDHA 2EHOD 2HPLA 2VASA 5FXZA 1LKXA 5GONE 4ZI3D 4QX7B 5IYZE 3HA4A 3N9NA 4CI2B 5LXTE 1WR6A 2XUEA 1CUNA 3IBPA 4P09A 2NW8A 4JUYA 4BAYB 4PJJA 2ES0A 1UX5A 5DABA 4QX8B 3N5LA 4U74A 2KWIB 3CWZB 3N9PA 1QUUA 3J9X1 5LJNA 3L3PA 5L3DB 4PJNA 1BR1A 2LSGA 2PG8A 3GWHA 3M65A 4ZI7E 1EZ3A 4TZ4C 4ERRA 5EK4A 3HR0A 4PFPA 1D1AA 3DP7A 3N9OA 5JDNA 3GA8A 4X1KE 3KVAA 3LG7A 3F57A 3PURA 1D1CA 2L8KA 2I59A 3N2OA 4FI5A 4H9PC 4O2BE 4C90A 4AI6A 5HXSA 1ZKEA 4EIWA 3JC6C 4B6XA 3SWHA 2W61A 3KV4A 4DBRA 3FXDB 5FXWA 3O1HA 4O4HE 4HKAA 3ZYMA 5LBMA 1D0XA 2DWGA 5E0OA 4UXNB 5IHYA 3CQGB 4IE0A 2HPJA 4EB6E 3KV5A 4HEAA 4DBQA 2UXXB 3LK2B 1LRZA 4OYKA 1MMNA 3BQIA 2A72A 4OFZA 2PJQA 2RP4A 4ASKA 3ETVA 4L0RA 2XAQB 4CXXA 4WBOA 2YK0A 2XQYA 5J2TE 2KNDA 5HAXA 3QUJA 2V7LA 4AXPA 4MLKA 5JR9A 1NAFA 3RPUA 2EHOB 4TUYE 1YKHB 5FP3A 3BK9A 4AKRB 3MZKB 4GIWA 1MMDA 5JDGA 3EUHA 4ZI3C 3J7Yq 3ZEFB 3NRXA 4BJMA 3KVBA 2KWHA 3E08A 2LOSA 3MACA 4ZI2D 1WYBA 4X1IE 3CQXC 3AAAB 2K24A 3A5XA 2ACXA 3UUMA 4DMVA 3ZYKA 3EVYA 3WAJA 1E1HB 4PFOA 5J2UE 5L2LA 4DNDA 4GYRA 3VHLA 1IJ5A 3FXEB 5LHIB 2YU1A 3LJCA 4MBQA 3ANWB 2V7MA 4TX5A 2NWBA 4UVCB 4EYYR 3ESLA 4H9OC 1BR4A 2CXLA 4O8SA 4P0BA 5M4YA 4UIGA 3AVSA 1IZNB 2BVLA 2CMRA 3L09A 1HTJF 4XAXB 4HN9A 2PBIA 5HXCA 2ZMAA 2Z6EA 2C5JA 1NWMX 4QXHB 4UV9B 1US7B 2DCFA 2CE7A 2CM0A 4UF0B 1YW0A 2MOZA 3OYZA 3Q5XA 3ZMSB 1HS7A 2H7VC 3RRWA 4BJNA 4JEHB 1HG2A 4TV9E 2LOPA 4YJ3E 2A2FX 3O9XA 3OJAA 1KNZA 4PK6A 2XHEB 2CLYB 3NBXX 3Q2MA 3RYIE 2EHOA 4IE6A 4X1YE 3ONXA 3SS1A 1ZHCA 1H7CA 5LYJE 4EYUA 3CX7B 4IE4A 4A56A 5FY1A 4DO0A 5H6QB 5L3GB 5JR9C 4CI1B 3PUSA 4UV8B 2H3RA 3C4XA 5HWYA 5JDLA 4O4LE 2LSJA 5JREA 1D0YA 2NTYA 3VKGA 4CZZB 5JH7E 3B13A 4ZI2C 4GOUA 4QKNA 4MFRA 2K9AA 4L5GA 3O4XE 2BDEA 4O4IE 2CWOA 3C50A 3O1IA 1BR0A 1G73A 2WM9A 3PU3A 3VKHA 3P7IA 2W62A 4GK5E 2N2NA 2QGSA 2X68A 3D0TA 5LG4A 2C5KT 3LBXB 3QC9A 3LK42 3ZMTB 3I9WA 2A3DA 2N1GA 3AA0B 3R6NA 2JMHA 1VRBA 5F8PA 3ANWA 2ODUA 5LOVE 4V1Av 1BR2A 2D5UA 3RYFE 3QK6A 2W00A 3ETUA 2SPCA 2WSSV 4H63V 3Q5WA 3PE0A 3RX6A 3V5UA 4Z8XA 5KMGP 3NRYA 4TV8E 2NP9A 5FYMA 3IEEA 4E7ZA 2JPFA 2CCQA 1YKEB 4IGUA 4YHJA 4UEMA 2DLRA 2Y8DA 3OBVE 4U72A 5KX5E 1LVKA 2P9BA 5FY7A 4HE8A 1HFAA 4KBMB 3S4UA 4UF0A 5JQGE 1T98A 5JDQA 2ZM2A 3I0QA 2CXDA 2LHRA 3HKCE 3EDUA 2PFVA 4I43B 2DNXA 5KDMC 5H6RB 3ZYLA 5A1LA 1FMWA 3PU8A 2EHOC 2LSIA 2VKJA 3H37A 3E0ZA 3ZN1B 4IIJE 1MIYA 4I55E 5EK2A 4UVAB 2HH7A 1QSDA 2JJ9A 4ZOLE 3ZMVB 5ETWA 2X0LB 5CB4E 2XAFB 4AKHA 4M1PA 3R84B 3MJXA 4JLEA 4ILUA 3CX6B 5LGTB 3W15B 5LJMA 4EAHA 2QA7A 3RKOA 1MMGA 1SA0E 2XASB 2KT9A 3PUAA 3P8CD 3LBXA 4YLHA 3K8PC 2WAUA 2CXFA 3ZLIA 3BQLA 1FEWA 1O3XA 3NZQA 4PK4A 3U78A 5LCYA 3CVRA 2C0SA 2XAHB 3FB2A 3MXZA 3MA9A 1UX4A 3PDYA 1ZV4X 2VKHA 1LVFA 3UUNA 4YJ2E 1IJ6A 2L9QA 2K5BB 4IE5A 5L3FB 4XZCA 5HXEA 3UFEA 5JDMA 2M67A 5ADXL 5JRCB 4G63A 4ANJA 4G2AA 3HKBE 3AVRA 2LT3A 2YINA 4HFVA 3RC8A 1YD8G 2E9XB 2J1DG 3RH3A 3UTKA 2VKOA 4OK0A 5LGUB 5F3JA 1U4QA 4IHJE 5HYAA 2LSYA 1WLXA 2LHNA 2JQQA 4PNIA 5L3EB 3C4WA 2X9WA 3C64A 3C98B 2ZM8A 4WW0A 4I50E 3KFWX 3JC6D 4AQFA 4FJOA 3RYHE 1S94A 2VWAA 2VK9A 4PW8A 1Z0PA 4KP3C 4TN7B 4EZHA 3F31A 3OKQA 3N2KE 4HGAA 3ZJ2A 4I4TE 5DJQC 4E7SA 2CLYC 2E8IA 1S35A 4QXBB 4ZS2A 2W63A 1MIWA 1WYCA 4KUMB 3I9YA 3C51A 1MNEA 3CQCB 5LA6E 5AFUL 3O1JA 1X79A 3V5SA 5L3CB 4DMWA 4PJMA 2MTQA 1Y64B 2IC6A 2NTXA 1HG5A 2VL8A 1WRDA 3WAKA 2JMKA 5C8YE 2DWKA 2KXPB 3ZMZB 4DVDA 3DTOA 5LNKA 2MYSA 2BZBA 2YEVC 2KZ7B 4H9SE 5EK3A 5LBQB 3KV9A 4WBNE 2LJLA 3UT5E 2LSKA 4PK5A 4GYSA 2MBGA 4WNKA 3ZCIA 3F2EA 2CEAA 2LEHA 3KBTA 4YFSA 3PTRB 5HXRA 3HI2A 4MALA 2Y6XA 2V7JA 5FXVA 3WI3A 1MMAA 5CA1E 2ZLYA 2C5IT 2BVMA 3N9LA 5JRCA 3I1AA 5LHGB 2NOXA 3PUGA 2CA5A 2WBLA 3RRCA 2Q9QA 2VKDA 2E9XA 2XTLA 4ISSA 4OHFA 4PJLA 2KINB 2V26A 1U5PA 1HF8A 2LE8A 4O2AE 2IAKA 5LGNB 2Q9QD 2E9XD 1OXZA 4UELA 4AKGA 1AJ3A 3AA6B 3H3AA 3NZPA 4H9NC 3K3QC 2WWUA 4AQFC 5DQVA 3PUQA 4CXYA 3ZC1A 3K3OA 1OWAA 1UCUA 3LK3B 4UVBB 4CI3B 4H9QC 4CQIA 2XAJB 4NUUA 5DQWA 5FXXA 2IC9A 3ZPOA 3E22E 2K48A 2L3LA 2JRKA 2X9XA 2VB6A 4F6RC 4AQGA 4N78D 4OYJA 1B7TA 1V9DA 3CPZA 2W0GA 4GK0E 5FMNA 2V7KA 4QXCB 2G0UA 4ZS3A 1D1BA 3GN5A 3N9MA 4MHCA 3IF8B 3ZC0A 5HWXA 5L3BB 3LFMA 1D0ZA 3ZMUB 2IW5B 2ZM0A 3ZJ1A 3FHNA 3Q9DA 3CX8B 4H63H 5TAOA 3ZN0B 4AKIA 3AA7B 3CMLA 3CKDA 2OA5A 2V1DB 2XAGB 3UUXB 3OYXA 2RA1A 2B1EA 3B57A 2KLQA 3EDVA 3RYCE 3UULA 1IAPA 3BQKA 5FY0A 2NW9A 4EZ4A 3DJBA 3K3NA 3AA1B 4ZHQE 5HXHA 1VOMA 2KMFA 2H7OA 4K0UA 3N9QA 3RC3A 2N9DA 3N2GE 2X9YA 1HX8A 2Q9QB 3TKLB 5BMVE 2D0UA 2WMNA 4BA9A 3GMIA 4EOZB 5J1GA 3KINB 4KMCA 4QHOA 2Q9QC 4P0AA 2E9XC 3MK7C 3FBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX5 A;  4JEU B;  2XHE B;  5M4Y A;  1FIO A;  1EZ3 A;  1FEW A;  4JEH B;  3LG7 A;  2DNX A;  1S94 A;  5LG4 A;  1BR0 A;  1G73 A;  3C98 B;  1HS7 A; 
#chains in the Genus database with same CATH topology
 5LHH B;  3UU6 A;  1J5W A;  5ABE A;  4IDZ A;  4JI1 T;  3A8Y C;  1HR0 T;  2X9H A;  5HEO A;  5LP6 E;  3A7M A;  5JVD E;  1SHZ C;  4JI5 T;  2WMO A;  2D0T A;  4U2Z A;  5FNV E;  5JDF A;  2RPA A;  1KK7 A;  3C4Z A;  3NWI A;  3AAI A;  5ABH A;  1ZOY A;  2HPL A;  3PUW F;  4ZI3 D;  5IYZ E;  3HA4 A;  1WR6 A;  4IL9 A;  4P09 A;  4PJJ A;  3N5L A;  3ZST A;  2IUB A;  2VQE T;  2BBH A;  4JI6 T;  4PJN A;  4UR9 A;  4ZXL A;  4EEB A;  3GWH A;  3UUB A;  5FKY A;  3L39 A;  5EK4 A;  1D1A A;  2V6Y A;  3FZM B;  4AI6 A;  4O2B E;  2V5C A;  3JC6 C;  3SWH A;  4ILC A;  3FXD B;  3O1H A;  4LFB T;  5IHY A;  3CQG B;  4IE0 A;  3KV5 A;  2WCA A;  1WFD A;  4DBQ A;  2UXX B;  5AQK B;  1VCS A;  3RQW A;  3ONL C;  2BS2 A;  2WDR A;  3AED A;  2V7L A;  4AXP A;  4MLK A;  3RPU A;  1NAF A;  4Z91 A;  5FP3 A;  4AKR B;  3EUH A;  3AEG A;  3NRX A;  5AQV B;  3CQX C;  2KSR A;  2FJB A;  2ACX A;  4CN1 A;  1E1H B;  4ZEY A;  3K1S A;  5J2U E;  2ZM6 T;  5L2L A;  2YU1 A;  4ILA A;  2V7M A;  2BG9 C;  4UVC B;  3ESL A;  4O8S A;  3AVS A;  1XMO T;  2BVL A;  4DV4 T;  1HTJ F;  1KNR A;  4XAX B;  1XNQ T;  5HXC A;  2Z6E A;  1YW0 A;  2MOZ A;  1HS7 A;  2WWV A;  1XWM A;  4YJ3 E;  2A2F X;  2XQ4 A;  3AE5 A;  3OJA A;  1KNZ A;  4PK6 A;  2XHE B;  1OED C;  3ONX A;  1ZHC A;  4A56 A;  5H6Q B;  5L3G B;  2VVN A;  2HN1 A;  4CI1 B;  2XQ9 A;  4JV5 T;  4CZZ B;  4QKN A;  2YDR A;  2K9A A;  3O4X E;  4YT0 A;  5J0Z A;  5AQT B;  3C50 A;  2WM9 A;  3LDQ B;  2QGS A;  4CN6 A;  3D0T A;  2UU9 T;  3LK4 2;  2N1G A;  1VRB A;  5LOV E;  2D5U A;  2W00 A;  4B3S T;  1XZY A;  2WSS V;  4H63 V;  3PE0 A;  4DV6 T;  3Q5E A;  2NP9 A;  2JPF A;  2CCQ A;  4YHJ A;  2Y8D A;  4LFC T;  5FL1 A;  4KBM B;  4Q25 A;  1XNR T;  5AQN B;  2CXD A;  3EDU A;  2PFV A;  1N36 T;  4LF6 T;  4DR5 T;  3UU8 A;  1L0V A;  1FMW A;  3PU8 A;  4JI7 T;  3ZN1 B;  4IIJ E;  5EK2 A;  3TLU A;  4ZOL E;  3QNU A;  5CB4 E;  4AKH A;  4AIS A;  3MJX A;  4IRE A;  4JLE A;  3CX6 B;  3W15 B;  2QA7 A;  1SA0 E;  4JYA T;  2XAS B;  2K3W A;  1W09 A;  4YLH A;  3EHZ A;  3AEF A;  1FEW A;  3NZQ A;  3CVR A;  2C0S A;  3PDY A;  1UX4 A;  3H3M A;  1I94 T;  3AEB A;  3EAB A;  5HXE A;  5JDM A;  2M67 A;  5JRC B;  3RIU C;  4ANJ A;  4G2A A;  2LT3 A;  2LLY A;  2J1D G;  3RH3 A;  2BS4 A;  5HCM A;  5F3J A;  2XPK A;  1WLX A;  2JQQ A;  3C4W A;  3C64 A;  4B3R T;  3C98 B;  3PUY F;  3KFW X;  3JC6 D;  4FJO A;  3RYH E;  1S94 A;  4EZH A;  4HGA A;  2CLY C;  1S35 A;  2W63 A;  1WYC A;  1HNW T;  3C51 A;  4KI0 F;  2QYW A;  4X64 T;  4GKK T;  1T8B A;  2V6X A;  3P4S A;  4TNV A;  3JAE A;  2LJL A;  4GYS A;  4IDP A;  3EI0 A;  4JI8 T;  3HI2 A;  4U33 A;  4X5T A;  4A5X A;  2V7J A;  5FXV A;  4LFA T;  3RI5 A;  3P4Q A;  2E9X A;  3AE9 A;  4DV1 T;  4ILB A;  2LE8 A;  3T1H T;  2D9D A;  1UUS A;  1KNP A;  3AE7 A;  5DQV A;  3PUQ A;  2XQ3 A;  5DQW A;  5FXX A;  3CK6 A;  2IC9 A;  1OED E;  4YTN A;  2JRK A;  2X9X A;  2VB6 A;  4N78 D;  5AQI B;  1XMQ T;  4QXC B;  4TWF A;  3ZMU B;  5AQQ B;  4H63 H;  3CX8 B;  5TAO A;  3ZN0 B;  3CML A;  3CKD A;  2OA5 A;  2AXD S;  2XAG B;  3UUX B;  1DU2 A;  2H88 A;  1IAP A;  4EZ4 A;  3K3N A;  2H7O A;  5AQL B;  1UUR A;  2BG9 B;  4TWH A;  2WMN A;  3GMI A;  2Q9Q C;  3FBZ A;  2DHR A;  4H9R C;  1I6Z A;  3ZCJ A;  4ADZ A;  5KXJ A;  1MIV A;  2LKG A;  2Y48 B;  2I0M A;  2XQ6 A;  4AKL A;  1E2A A;  1HNZ T;  3RF1 A;  4PAG A;  4IE7 A;  1W0A A;  4JI2 T;  3GN5 B;  4EXT A;  3SOL A;  4C91 A;  2J47 A;  5GON E;  1N34 T;  4QX7 B;  4HWF A;  2XUE A;  5CGM A;  2NW8 A;  2ES0 A;  4QX8 B;  4U74 A;  3CWZ B;  4X66 T;  3L3P A;  1BR1 A;  2A9U A;  2PG8 A;  2DL1 A;  1KF6 A;  4TZ4 C;  4ERR A;  3N9O A;  3GA8 A;  2L8K A;  3OTO T;  4FI5 A;  4C90 A;  4LF7 T;  5HXS A;  4U3C A;  3AE3 A;  4B6X A;  2W61 A;  3KV4 A;  4DBR A;  4ZZC A;  5LG3 A;  4HKA A;  1D0X A;  5E0O A;  5LB7 B;  2UUA T;  3UQ4 A;  3ABV A;  4EV6 A;  3BQI A;  4OFZ A;  2PJQ A;  3ETV A;  4DUZ T;  4WBO A;  1J5E T;  2KND A;  5HAX A;  5JR9 A;  2IIU A;  1MMD A;  5JDG A;  2CBJ A;  3VR9 A;  3E08 A;  3ONJ A;  2LOS A;  4QH1 A;  3MAC A;  4ZI2 D;  3AAA B;  2E5L T;  2VVS A;  3A5X A;  5AQM B;  4DND A;  5LHI B;  2NWB A;  5M4Y A;  4P0B A;  4UIG A;  1IZN B;  5FVK A;  3VR8 A;  2HHH T;  4HN9 A;  5AQG B;  2CPT A;  1US7 B;  2DCF A;  2W67 A;  3PUV F;  3ZMS B;  3Q5X A;  2H7V C;  5L4H A;  4BJN A;  4DV2 T;  1HG2 A;  2CLY B;  3NBX X;  3Q2M A;  2XQ8 A;  2EHO A;  2OV9 A;  3PJA J;  1H7C A;  5LYJ E;  5FY1 A;  3AXJ A;  3PUS A;  4YSZ A;  2H3R A;  3T1Y T;  2CHN A;  4O4L E;  5JRE A;  1D0Y A;  2NTY A;  2YOE A;  5JH7 E;  4MFR A;  2CWO A;  1BR0 A;  3VKH A;  2YKS A;  1UK5 A;  2XQ7 A;  2UUB T;  4U2Y A;  3QC9 A;  2V8S V;  1W0B A;  2WU5 A;  3ANW A;  1QLB A;  4V1A v;  1BR2 A;  2HN2 A;  3Q5W A;  3RX6 A;  4Z8X A;  5FYM A;  3IEE A;  1YKE B;  4IGU A;  4UEM A;  2DLR A;  3OBV E;  4HE8 A;  1HFA A;  3S4U A;  4UF0 A;  4YTP A;  4U7I A;  5AQJ B;  2LHR A;  3JCF A;  3EAM A;  2JQ9 A;  2WZH A;  3PV0 F;  3TLV A;  5KDM C;  4HWD A;  3ZYL A;  5BR8 T;  1YQ3 A;  3H37 A;  2VKJ A;  4I55 E;  4LF5 T;  2CHO A;  2XAF B;  1JNZ A;  3AE6 A;  4M1P A;  4A97 A;  5LGT B;  5LJM A;  4EAH A;  3RKO A;  2KT9 A;  3PUA A;  3LBX A;  2CXF A;  3BQL A;  4DUY T;  1O3X A;  3OVU A;  5FL0 A;  5LCY A;  2XAH B;  1Y01 A;  1IJ6 A;  2L9Q A;  2K5B B;  2XQ5 A;  3UFE A;  4P1N A;  5ADX L;  4G63 A;  3HKB E;  3AVR A;  3RC8 A;  4WZX A;  2VKO A;  4IHJ E;  5HYA A;  4LF9 T;  4PNI A;  4U7Y A;  1KEY A;  4WW0 A;  4AQF A;  2VWA A;  2LKH A;  4KP3 C;  4TN7 B;  3QB5 K;  3N2K E;  3FZK B;  4I4T E;  1XDP A;  4E7S A;  4ZS2 A;  2VUR A;  5AQU B;  3I9Y A;  1MNE A;  5LA6 E;  3O1J A;  4PJM A;  2MTQ A;  2NTX A;  2VL8 A;  4DVD A;  3DTO A;  5LNK A;  2YEV C;  2KZ7 B;  4H9S E;  2MBG A;  4JI3 T;  4WNK A;  3ZCI A;  2LEH A;  3RIF A;  3PTR B;  5HXR A;  2V5D A;  4MAL A;  4NPP A;  3PUX F;  2BVM A;  2VL0 A;  5LHG B;  3PUG A;  2CA5 A;  3RRC A;  4IT4 A;  3SFD A;  5HEU A;  4OHF A;  1T7S A;  5ABG A;  2KIN B;  3L8R A;  4JI4 T;  1U5P A;  1HF8 A;  2IAK A;  4HFE A;  3P4R A;  3NZP A;  4H9N C;  3RGL A;  3K3O A;  1UCU A;  3LK3 B;  3UQ7 A;  3ZPO A;  2K48 A;  4F6R C;  4AQG A;  1B7T A;  2W0G A;  5FMN A;  2V7K A;  4ZS3 A;  3GN5 A;  3N9M A;  3IF8 B;  2BKN A;  5HWX A;  5C3J A;  3LFM A;  4X62 T;  3LSV A;  3Q9D A;  4EED A;  3ZT6 A;  3OYX A;  2RA1 A;  2XSB A;  5F5W A;  3UUL A;  1VOM A;  2KMF A;  3N9Q A;  2N9D A;  2X9Y A;  5J1G A;  4KMC A;  5LBM A;  2E9X C;  3MK7 C;  3SRZ A;  3VU7 H;  2XM1 A;  4JEU B;  4L9I A;  2BS3 A;  4O4J E;  2WDV A;  3MKD A;  2CRB A;  3KBU A;  3RIA A;  3VRA A;  5CA0 E;  3KV6 A;  3HKE E;  3U3I A;  4DR6 T;  1MND A;  4IST A;  1FIO A;  3KDS E;  2YU2 A;  1G8X A;  4HTE A;  3FBL A;  2NW7 A;  2V7I A;  1J1J A;  3HKD E;  5L4E A;  1KFY A;  4DV5 T;  4NUV A;  2JQH A;  3AEC A;  2VAS A;  1LKX A;  4CI2 B;  5AQR B;  4JUY A;  1UX5 A;  5LJN A;  3N9P A;  1QUU A;  5L3D B;  4LF8 T;  5ABF B;  4OX9 T;  3M65 A;  4ZI7 E;  1EZ3 A;  3RHW A;  3P4P A;  3DP7 A;  4PFP A;  4I0U A;  3LG7 A;  3PJA A;  1D1C A;  3PUR A;  2BKO A;  2I59 A;  1ZKE A;  3RQU A;  3RIU A;  4CN4 A;  2OLT A;  2IDO B;  2LRL A;  2DWG A;  2BKP A;  4EB6 E;  4EGW A;  4OYK A;  1MMN A;  4ASK A;  4L0R A;  4CXX A;  2XQY A;  4AIU A;  1Z8U A;  4YSX A;  3AEA A;  4IL4 A;  4HFD A;  1YKH B;  2BBJ A;  3BK9 A;  5HEH A;  3MZK B;  2LRK A;  4ZI3 C;  4BJM A;  3KVB A;  1N33 T;  1IBK T;  1XDO A;  4YXD A;  2K24 A;  3UUM A;  3WAJ A;  1R8I A;  4PFO A;  3VHL A;  2UXB T;  4TX5 A;  4EYY R;  2CXL A;  2CBI A;  3L09 A;  2UXC T;  3NVO A;  2C5J A;  4UV9 B;  2CE7 A;  3RRW A;  4TV9 E;  1OED B;  3RYI E;  4JI0 T;  3UU4 A;  3SS1 A;  4EYU A;  3CX7 B;  4DO0 A;  5JR9 C;  3AE4 A;  3C4X A;  5JDL A;  2WB5 A;  2X0Y A;  2LSJ A;  4NXM T;  3VKG A;  3B13 A;  1VCT A;  4L5G A;  2BDE A;  4O4I E;  2E2A A;  1M7K A;  1G73 A;  4HFC A;  3P7I A;  2W62 A;  4GK5 E;  2N2N A;  1X9B A;  5LG4 A;  2C5K T;  3I9W A;  2JMH A;  3JAD A;  3QK6 A;  3ETU A;  3NRY A;  4TV8 E;  3AE8 A;  5AQS B;  4U72 A;  5KX5 E;  1LVK A;  2P9B A;  2I6H A;  5FY7 A;  5JQG E;  4KX6 A;  5JDQ A;  3M3Z B;  2W4X A;  4IDQ A;  3HKC E;  3ZT5 A;  4I43 B;  4U31 A;  5A1L A;  2EHO C;  2LSI A;  3E0Z A;  1MIY A;  4UVA B;  2HH7 A;  5ETW A;  2AE9 A;  1NEN A;  1ZP0 A;  5AQP B;  4ILU A;  1NEK A;  2W66 A;  1MMG A;  4DR2 T;  2WAU A;  3MXZ A;  3MA9 A;  1ZV4 X;  3UUN A;  4IE5 A;  5LMU T;  1E7P A;  4HFV A;  4KHZ F;  1YD8 G;  2E9X B;  3UTK A;  5LGU B;  4OK0 A;  4TNW A;  2LSY A;  5L3E B;  2H89 A;  2VK9 A;  4PW8 A;  4YSY A;  4HWC A;  3CIR A;  3F31 A;  3OKQ A;  4A98 A;  3ZJ2 A;  5DJQ C;  4IDN A;  4QXB B;  5L47 A;  4Z90 A;  1X79 A;  2W2U A;  4DMW A;  2IC6 A;  2JMK A;  5C8Y E;  2DWK A;  3ZMZ B;  2MYS A;  2BZB A;  2FJD A;  5EK3 A;  2LSK A;  4YTM A;  5IUX A;  3KBT A;  4YFS A;  3RLF F;  2Y6X A;  4B3T T;  2ZLY A;  5JRC A;  3N9L A;  3I1A A;  4LF4 T;  3AEE A;  2XTL A;  4IDO A;  4PJL A;  3UU5 A;  2WZI A;  2ACZ A;  4O2A E;  2XY8 B;  2Q9Q D;  4HFB A;  4UEL A;  4AKG A;  1AJ3 A;  2MPK A;  3AA6 B;  1WR0 A;  2IML A;  3K3Q C;  4AQF C;  2PTF A;  4UVB B;  4H9Q C;  4CQI A;  4NUU A;  2YDS A;  3VRB A;  3E22 E;  2L3L A;  1CHU A;  4JBW F;  2XSA A;  4OYJ A;  2G0U A;  1D1B A;  4MHC A;  2IW5 B;  2ZM0 A;  3ZJ1 A;  3FHN A;  5LMN T;  4COF A;  4K0K T;  2WS3 A;  2WDQ A;  3B57 A;  2KLQ A;  3BQK A;  3TLW A;  2E5V A;  5ABF A;  3AA1 B;  5HXH A;  1IBL T;  2NR4 A;  2Q9Q B;  5BMV E;  2D0U A;  4BA9 A;  3KIN B;  4P0A A;  2D2S A;  4QWN B;  3HL6 A;  3T8O A;  3AB3 B;  3AAE B;  5EZY E;  4X20 E;  1W9R A;  3I0O A;  4ZZB A;  2X51 A;  2GK9 A;  4KHP T;  2DI4 A;  2FJE A;  4LMJ A;  2CWY A;  1T72 A;  4J2C A;  4AQY T;  3FZH B;  1HCI A;  4CXW A;  2X67 A;  1IBM T;  2LM9 A;  2YN6 A;  3FZL B;  1N32 T;  3IHR A;  5JR9 B;  4XBF B;  1ZEE A;  3QB5 A;  2UXN B;  2X66 A;  2XZE A;  4DV3 T;  1JNR A;  1FMV A;  2ODV A;  5JDH A;  2EHO D;  5FXZ A;  2YDQ A;  5LXT E;  3G06 A;  3N9N A;  3IBP A;  1CUN A;  4BAY B;  4NIQ A;  3UFG A;  5DAB A;  2KWI B;  3J9X 1;  2LSG A;  2FUP A;  2VQF T;  3HR0 A;  2BG9 A;  5JDN A;  4X1K E;  3KVA A;  3F57 A;  3N2O A;  4H9P C;  4NXN T;  3ZKR A;  4EIW A;  5FXW A;  1UGO A;  4O4H E;  3ZYM A;  4UXN B;  3PUZ F;  2HPJ A;  4HEA A;  5IWA T;  3LK2 B;  1LRZ A;  2UXD T;  4B3M T;  2A72 A;  2RP4 A;  1OED A;  1YQ4 A;  2XAQ B;  2YK0 A;  5J2T E;  3QUJ A;  2XM2 A;  2EHO B;  4TUY E;  4GIW A;  3ZSS A;  3AXJ B;  3J7Y q;  3ZEF B;  2KWH A;  3AE2 A;  2FBW A;  1WYB A;  4X1I E;  2UUC T;  4DMV A;  3ZYK A;  3EVY A;  5C2T A;  4DR7 T;  4GYR A;  1IJ5 A;  3FXE B;  2V6Y B;  4MBQ A;  3LJC A;  3ANW B;  2J4G A;  3IA3 A;  1BR4 A;  4H9O C;  5JTG A;  3P4W A;  2CMR A;  1SE7 A;  2PBI A;  2ZMA A;  3QOF A;  1NWM X;  4QXH B;  2CM0 A;  4UF0 B;  3OYZ A;  4JEH B;  2X0H A;  4HWI B;  2WU2 A;  2LOP A;  3O9X A;  4IE6 A;  4X1Y E;  3UU3 A;  5HEJ A;  4WYV A;  4IE4 A;  4UV8 B;  5HWY A;  4ZI2 C;  4GOU A;  2QRX A;  4DR1 T;  3O1I A;  2FJA A;  3PU3 A;  1SUM B;  4LMK A;  2X68 A;  3LBX B;  3ZMT B;  2A3D A;  3AA0 B;  3R6N A;  2XJ7 A;  4GKJ T;  5F8P A;  2ODU A;  3RYF E;  2LM2 A;  3OPC A;  2SPC A;  4TWD A;  3V5U A;  5KMG P;  3B5M A;  4E7Z A;  2BG9 E;  3Q5D A;  1T98 A;  2ZM2 A;  3I0Q A;  2DNX A;  4DV7 T;  3AE1 A;  5H6R B;  1WCR A;  2J62 A;  2JJ9 A;  1QSD A;  4DV0 T;  3ZMV B;  2X0L B;  5CJ5 A;  2IHR 1;  3R84 B;  4LML A;  2XQA A;  3NKZ A;  5AQF B;  4YY3 T;  3P8C D;  2F4V T;  3K8P C;  1FJG T;  3ZLI A;  3ZT7 A;  4PK4 A;  3U78 A;  3FB2 A;  5AQH B;  2VKH A;  3TLS A;  1LVF A;  4DR4 T;  4YJ2 E;  5L3F B;  4XZC A;  2YIN A;  1YXR A;  1U4Q A;  4YHH T;  2LHN A;  2X9W A;  4QH4 A;  2WQY A;  2ZM8 A;  4I50 E;  4DR3 T;  1Z0P A;  3P50 A;  2E8I A;  1MIW A;  4KUM B;  3CQC B;  5AFU L;  5L3C B;  3V5S A;  1Y64 B;  1HG5 A;  1WRD A;  3WAK A;  2M6B A;  3JAF A;  2KXP B;  3SFE A;  3FZF B;  5LBQ B;  3KV9 A;  4WBN E;  3UT5 E;  4PK5 A;  3X1D A;  2M6I A;  2JIW A;  3F2E A;  2CEA A;  4HFI A;  3WI3 A;  1MMA A;  5CA1 E;  2C5I T;  5FVL A;  2NOX A;  5HCJ A;  2WBL A;  3TLT A;  2Q9Q A;  2VKD A;  4ISS A;  2QVA A;  4X65 T;  2V26 A;  5LGN B;  2E9X D;  1OXZ A;  1M62 A;  2R6G F;  2WY2 A;  3H3A A;  2WWU A;  2MAW A;  5CFB A;  2JQK A;  4CXY A;  3ZC1 A;  1OWA A;  4CI3 B;  2XAJ B;  1V9D A;  3CPZ A;  4GK0 E;  5AQO B;  3ZC0 A;  1HX1 B;  5L3B B;  4QH5 A;  4HFH A;  1D0Z A;  4HWH A;  1HNX T;  4AKI A;  3AA7 B;  2V1D B;  4DID B;  5HEG A;  2B1E A;  3RKG A;  3EDV A;  3RYC E;  5FY0 A;  2NW9 A;  3DJB A;  4ZHQ E;  4K0U A;  3RC3 A;  3N2G E;  2WP9 A;  3TKL B;  1HX8 A;  1GQE A;  4F8H A;  4EOZ B;  2B76 A;  4QHO A; 
#chains in the Genus database with same CATH homology
 2DHR A;  3SRZ A;  3VU7 H;  2D2S A;  4JEU B;  4L9I A;  4QWN B;  5LHH B;  3HL6 A;  3T8O A;  4H9R C;  4IDZ A;  3ZCJ A;  4O4J E;  3MKD A;  3KBU A;  4ADZ A;  3AB3 B;  3AAE B;  5EZY E;  4X20 E;  1MIV A;  3I0O A;  2X51 A;  2GK9 A;  2DI4 A;  5CA0 E;  2Y48 B;  3KV6 A;  2X9H A;  2CWY A;  4AKL A;  4J2C A;  5LP6 E;  5JVD E;  3HKE E;  3U3I A;  1HCI A;  1MND A;  4CXW A;  4IST A;  2X67 A;  1SHZ C;  4IE7 A;  1FIO A;  3KDS E;  4PAG A;  2YU2 A;  1G8X A;  4HTE A;  2LM9 A;  2NW7 A;  2D0T A;  2WMO A;  3FBL A;  3IHR A;  5JR9 B;  4XBF B;  3GN5 B;  1ZEE A;  2V7I A;  2UXN B;  5FNV E;  5JDF A;  3HKD E;  1KK7 A;  2X66 A;  3C4Z A;  1FMV A;  3AAI A;  4EXT A;  4NUV A;  3SOL A;  2ODV A;  4C91 A;  5JDH A;  2EHO D;  2HPL A;  2VAS A;  5FXZ A;  1LKX A;  5GON E;  4ZI3 D;  4QX7 B;  5IYZ E;  3HA4 A;  3N9N A;  4CI2 B;  5LXT E;  1WR6 A;  2XUE A;  1CUN A;  3IBP A;  4P09 A;  2NW8 A;  4JUY A;  4BAY B;  4PJJ A;  2ES0 A;  1UX5 A;  5DAB A;  4QX8 B;  3N5L A;  4U74 A;  2KWI B;  3CWZ B;  3N9P A;  1QUU A;  3J9X 1;  5LJN A;  3L3P A;  5L3D B;  4PJN A;  1BR1 A;  2LSG A;  2PG8 A;  3GWH A;  3M65 A;  4ZI7 E;  1EZ3 A;  4TZ4 C;  4ERR A;  5EK4 A;  3HR0 A;  4PFP A;  1D1A A;  3DP7 A;  3N9O A;  5JDN A;  3GA8 A;  4X1K E;  3KVA A;  3LG7 A;  3F57 A;  3PUR A;  1D1C A;  2L8K A;  2I59 A;  3N2O A;  4FI5 A;  4H9P C;  4O2B E;  4C90 A;  4AI6 A;  5HXS A;  1ZKE A;  4EIW A;  3JC6 C;  4B6X A;  3SWH A;  2W61 A;  3KV4 A;  4DBR A;  3FXD B;  5FXW A;  3O1H A;  4O4H E;  4HKA A;  3ZYM A;  5LBM A;  1D0X A;  2DWG A;  5E0O A;  4UXN B;  5IHY A;  3CQG B;  4IE0 A;  2HPJ A;  4EB6 E;  3KV5 A;  4HEA A;  4DBQ A;  2UXX B;  3LK2 B;  1LRZ A;  4OYK A;  1MMN A;  3BQI A;  2A72 A;  4OFZ A;  2PJQ A;  2RP4 A;  4ASK A;  3ETV A;  4L0R A;  2XAQ B;  4CXX A;  4WBO A;  2YK0 A;  2XQY A;  5J2T E;  2KND A;  5HAX A;  3QUJ A;  2V7L A;  4AXP A;  4MLK A;  5JR9 A;  1NAF A;  3RPU A;  2EHO B;  4TUY E;  1YKH B;  5FP3 A;  3BK9 A;  4AKR B;  3MZK B;  4GIW A;  1MMD A;  5JDG A;  3EUH A;  4ZI3 C;  3J7Y q;  3ZEF B;  3NRX A;  4BJM A;  3KVB A;  2KWH A;  3E08 A;  2LOS A;  3MAC A;  4ZI2 D;  1WYB A;  4X1I E;  3CQX C;  3AAA B;  2K24 A;  3A5X A;  2ACX A;  3UUM A;  4DMV A;  3ZYK A;  3EVY A;  3WAJ A;  1E1H B;  4PFO A;  5J2U E;  5L2L A;  4DND A;  4GYR A;  3VHL A;  1IJ5 A;  3FXE B;  5LHI B;  2YU1 A;  3LJC A;  4MBQ A;  3ANW B;  2V7M A;  4TX5 A;  2NWB A;  4UVC B;  4EYY R;  3ESL A;  4H9O C;  1BR4 A;  2CXL A;  4O8S A;  4P0B A;  5M4Y A;  4UIG A;  3AVS A;  1IZN B;  2BVL A;  2CMR A;  3L09 A;  1HTJ F;  4XAX B;  4HN9 A;  2PBI A;  5HXC A;  2ZMA A;  2Z6E A;  2C5J A;  1NWM X;  4QXH B;  4UV9 B;  1US7 B;  2DCF A;  2CE7 A;  2CM0 A;  4UF0 B;  1YW0 A;  2MOZ A;  3OYZ A;  3Q5X A;  3ZMS B;  1HS7 A;  2H7V C;  3RRW A;  4BJN A;  4JEH B;  1HG2 A;  4TV9 E;  2LOP A;  4YJ3 E;  2A2F X;  3O9X A;  3OJA A;  1KNZ A;  4PK6 A;  2XHE B;  2CLY B;  3NBX X;  3Q2M A;  3RYI E;  2EHO A;  4IE6 A;  4X1Y E;  3ONX A;  3SS1 A;  1ZHC A;  1H7C A;  5LYJ E;  4EYU A;  3CX7 B;  4IE4 A;  4A56 A;  5FY1 A;  4DO0 A;  5H6Q B;  5L3G B;  5JR9 C;  4CI1 B;  3PUS A;  4UV8 B;  2H3R A;  3C4X A;  5HWY A;  5JDL A;  4O4L E;  2LSJ A;  5JRE A;  1D0Y A;  2NTY A;  3VKG A;  4CZZ B;  5JH7 E;  3B13 A;  4ZI2 C;  4GOU A;  4QKN A;  4MFR A;  2K9A A;  4L5G A;  3O4X E;  2BDE A;  4O4I E;  2CWO A;  3C50 A;  3O1I A;  1BR0 A;  1G73 A;  2WM9 A;  3PU3 A;  3VKH A;  3P7I A;  2W62 A;  4GK5 E;  2N2N A;  2QGS A;  2X68 A;  3D0T A;  5LG4 A;  2C5K T;  3LBX B;  3QC9 A;  3LK4 2;  3ZMT B;  3I9W A;  2A3D A;  2N1G A;  3AA0 B;  3R6N A;  2JMH A;  1VRB A;  5F8P A;  3ANW A;  2ODU A;  5LOV E;  4V1A v;  1BR2 A;  2D5U A;  3RYF E;  3QK6 A;  2W00 A;  3ETU A;  2SPC A;  2WSS V;  4H63 V;  3Q5W A;  3PE0 A;  3RX6 A;  3V5U A;  4Z8X A;  5KMG P;  3NRY A;  4TV8 E;  2NP9 A;  5FYM A;  3IEE A;  4E7Z A;  2JPF A;  2CCQ A;  1YKE B;  4IGU A;  4YHJ A;  4UEM A;  2DLR A;  2Y8D A;  3OBV E;  4U72 A;  5KX5 E;  1LVK A;  2P9B A;  5FY7 A;  4HE8 A;  1HFA A;  4KBM B;  3S4U A;  4UF0 A;  5JQG E;  1T98 A;  5JDQ A;  2ZM2 A;  3I0Q A;  2CXD A;  2LHR A;  3HKC E;  3EDU A;  2PFV A;  4I43 B;  2DNX A;  5KDM C;  5H6R B;  3ZYL A;  5A1L A;  1FMW A;  3PU8 A;  2EHO C;  2LSI A;  2VKJ A;  3H37 A;  3E0Z A;  3ZN1 B;  4IIJ E;  1MIY A;  4I55 E;  5EK2 A;  4UVA B;  2HH7 A;  1QSD A;  2JJ9 A;  4ZOL E;  3ZMV B;  5ETW A;  2X0L B;  5CB4 E;  2XAF B;  4AKH A;  4M1P A;  3R84 B;  3MJX A;  4JLE A;  4ILU A;  3CX6 B;  5LGT B;  3W15 B;  5LJM A;  4EAH A;  2QA7 A;  3RKO A;  1MMG A;  1SA0 E;  2XAS B;  2KT9 A;  3PUA A;  3P8C D;  3LBX A;  4YLH A;  3K8P C;  2WAU A;  2CXF A;  3ZLI A;  3BQL A;  1FEW A;  1O3X A;  3NZQ A;  4PK4 A;  3U78 A;  5LCY A;  3CVR A;  2C0S A;  2XAH B;  3FB2 A;  3MXZ A;  3MA9 A;  1UX4 A;  3PDY A;  1ZV4 X;  2VKH A;  1LVF A;  3UUN A;  4YJ2 E;  1IJ6 A;  2L9Q A;  2K5B B;  4IE5 A;  5L3F B;  4XZC A;  5HXE A;  3UFE A;  5JDM A;  2M67 A;  5ADX L;  5JRC B;  4G63 A;  4ANJ A;  4G2A A;  3HKB E;  3AVR A;  2LT3 A;  2YIN A;  4HFV A;  3RC8 A;  1YD8 G;  2E9X B;  2J1D G;  3RH3 A;  3UTK A;  2VKO A;  4OK0 A;  5LGU B;  5F3J A;  1U4Q A;  4IHJ E;  5HYA A;  2LSY A;  1WLX A;  2LHN A;  2JQQ A;  4PNI A;  5L3E B;  3C4W A;  2X9W A;  3C64 A;  3C98 B;  2ZM8 A;  4WW0 A;  4I50 E;  3KFW X;  3JC6 D;  4AQF A;  4FJO A;  3RYH E;  1S94 A;  2VWA A;  2VK9 A;  4PW8 A;  1Z0P A;  4KP3 C;  4TN7 B;  4EZH A;  3F31 A;  3OKQ A;  3N2K E;  4HGA A;  3ZJ2 A;  4I4T E;  5DJQ C;  4E7S A;  2CLY C;  2E8I A;  1S35 A;  4QXB B;  4ZS2 A;  2W63 A;  1MIW A;  1WYC A;  4KUM B;  3I9Y A;  3C51 A;  1MNE A;  3CQC B;  5LA6 E;  5AFU L;  3O1J A;  1X79 A;  3V5S A;  5L3C B;  4DMW A;  4PJM A;  2MTQ A;  1Y64 B;  2IC6 A;  2NTX A;  1HG5 A;  2VL8 A;  1WRD A;  3WAK A;  2JMK A;  5C8Y E;  2DWK A;  2KXP B;  3ZMZ B;  4DVD A;  3DTO A;  5LNK A;  2MYS A;  2BZB A;  2YEV C;  2KZ7 B;  4H9S E;  5EK3 A;  5LBQ B;  3KV9 A;  4WBN E;  2LJL A;  3UT5 E;  2LSK A;  4PK5 A;  4GYS A;  2MBG A;  4WNK A;  3ZCI A;  3F2E A;  2CEA A;  2LEH A;  3KBT A;  4YFS A;  3PTR B;  5HXR A;  3HI2 A;  4MAL A;  2Y6X A;  2V7J A;  5FXV A;  3WI3 A;  1MMA A;  5CA1 E;  2ZLY A;  2C5I T;  2BVM A;  3N9L A;  5JRC A;  3I1A A;  5LHG B;  2NOX A;  3PUG A;  2CA5 A;  2WBL A;  3RRC A;  2Q9Q A;  2VKD A;  2E9X A;  2XTL A;  4ISS A;  4OHF A;  4PJL A;  2KIN B;  2V26 A;  1U5P A;  1HF8 A;  2LE8 A;  4O2A E;  2IAK A;  5LGN B;  2Q9Q D;  2E9X D;  1OXZ A;  4UEL A;  4AKG A;  1AJ3 A;  3AA6 B;  3H3A A;  3NZP A;  4H9N C;  3K3Q C;  2WWU A;  4AQF C;  5DQV A;  3PUQ A;  4CXY A;  3ZC1 A;  3K3O A;  1OWA A;  1UCU A;  3LK3 B;  4UVB B;  4CI3 B;  4H9Q C;  4CQI A;  2XAJ B;  4NUU A;  5DQW A;  5FXX A;  2IC9 A;  3ZPO A;  3E22 E;  2K48 A;  2L3L A;  2JRK A;  2X9X A;  2VB6 A;  4F6R C;  4AQG A;  4N78 D;  4OYJ A;  1B7T A;  1V9D A;  3CPZ A;  2W0G A;  4GK0 E;  5FMN A;  2V7K A;  4QXC B;  2G0U A;  4ZS3 A;  1D1B A;  3GN5 A;  3N9M A;  4MHC A;  3IF8 B;  3ZC0 A;  5HWX A;  5L3B B;  3LFM A;  1D0Z A;  3ZMU B;  2IW5 B;  2ZM0 A;  3ZJ1 A;  3FHN A;  3Q9D A;  3CX8 B;  4H63 H;  5TAO A;  3ZN0 B;  4AKI A;  3AA7 B;  3CML A;  3CKD A;  2OA5 A;  2V1D B;  2XAG B;  3UUX B;  3OYX A;  2RA1 A;  2B1E A;  3B57 A;  2KLQ A;  3EDV A;  3RYC E;  3UUL A;  1IAP A;  3BQK A;  5FY0 A;  2NW9 A;  4EZ4 A;  3DJB A;  3K3N A;  3AA1 B;  4ZHQ E;  5HXH A;  1VOM A;  2KMF A;  2H7O A;  4K0U A;  3N9Q A;  3RC3 A;  2N9D A;  3N2G E;  2X9Y A;  1HX8 A;  2Q9Q B;  3TKL B;  5BMV E;  2D0U A;  2WMN A;  4BA9 A;  3GMI A;  4EOZ B;  5J1G A;  3KIN B;  4KMC A;  4QHO A;  2Q9Q C;  4P0A A;  2E9X C;  3MK7 C;  3FBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...