4B3MT

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3mT00
4DV6T 2UU9T 1XMOT 2UXCT 5IWAT 1HNZT 4JI8T 1N36T 4X64T 4JI2T 4X66T 4AQYT 4DR2T 4X65T 4LF8T 4DV4T 5LMUT 4DR6T 4GKJT 1XMQT 4LFAT 4DR3T 4DR5T 4JI3T 1HNWT 2UUCT 2E5LT 4JI4T 4LF6T 4LF4T 2ZM6T 2UXBT 2UXDT 4JI0T 2F4VT 4KHPT 4B3ST 4LF7T 4DV2T 4DUZT 4DUYT 4YHHT 1J5ET 4X62T 3OTOT 1N34T 4DV1T 3T1YT 1FJGT 4JI5T 4LFBT 4LF9T 1HR0T 4DV0T 4OX9T 4DV3T 4NXMT 1N33T 1N32T 4JV5T 4NXNT 4JI7T 4LFCT 4DV5T 1IBKT 2HHHT 4JYAT 1XNQT 4YY3T 4JI1T 4B3TT 1XNRT 2UUBT 2VQET 2VQFT 1I94T 4GKKT 4DR1T 3T1HT 5BR8T 1IBMT 5LMNT 1IBLT 4DR7T 4K0KT 1HNXT 4B3MT 4LF5T 4JI6T 2UUAT 4DR4T 4B3RT 4DV7T
chains in the Genus database with same CATH superfamily
4XBFB 3AEEA 1IAPA 1HTJF 3AE5A 4PFPA 4ZOLE 3RKGA 3CPZA 3N2KE 1UX4A 1MIYA 2JJ9A 3RHWA 3ZMTB 3TLVA 5LGUB 3AA7B 3H3MA 4CN1A 3F31A 3KBTA 5KX5E 4TUYE 2ZM6T 3UUNA 2UXDT 3I9WA 3LSVA 5FL0A 4EOZB 5LB7B 4ZS3A 5FXWA 4IL4A 3KBUA 3HKDE 3UUMA 2LE8A 1HR0T 2VB6A 3DTOA 3N9OA 5C3JA 5JRCA 2XQAA 5LJMA 4HKAA 2LT3A 3MJXA 2X9WA 2Q9QB 2W4XA 4IDQA 4XAXB 5LHHB 3ANWB 4X5TA 2VURA 3RGLA 3CX7B 1OWAA 4AQFA 4N78D 3D0TA 2JQ9A 4UIGA 2NOXA 2WQYA 4OFZA 2DNXA 3N5LA 4GK0E 3ESLA 4Z91A 2K48A 3C64A 1OEDC 4NUUA 2IMLA 4YT0A 4JI6T 2XASB 1YD8G 4EZ4A 3SS1A 3ZC0A 1SHZC 3RIUA 3RYFE 3AEBA 3NRYA 5HYAA 2Y48B 2BBJA 2PTFA 2CA5A 3PUQA 4IDNA 1W09A 5HWXA 4GIWA 3KV5A 1UUSA 5HEUA 4HTEA 2YU2A 3WI3A 3CX8B 2I59A 5HXCA 3ZSTA 3DJBA 3O1IA 3PUZF 1KFYA 3TKLB 4OHFA 3FBLA 3PUSA 3HI2A 2OLTA 2A2FX 1QUUA 4X62T 5AQQB 3U3IA 2CMRA 4U2ZA 4UV9B 3R6NA 4DV0T 4DBQA 2QYWA 4O2AE 2KSRA 4NXMT 3N2OA 3ONXA 3PUVF 2ODVA 4ZZCA 2YDSA 4H9PC 4PFOA 3SFDA 4Q25A 3L39A 4YY3T 3L09A 2PBIA 4UR9A 5JQGE 3LK42 3JC6D 2YDRA 3E22E 4IE0A 4BJNA 2H3RA 1BR1A 3KVBA 2V1DB 2NWBA 4TV9E 2WU2A 3NWIA 3C4WA 1US7B 5HXHA 5AQMB 3PUWF 5CB4E 3FZFB 3ZSSA 2D0UA 2WY2A 1AJ3A 1OXZA 4LMLA 4YTNA 5FVKA 2J1DG 3O1HA 4YJ3E 1G8XA 1KNZA 4O2BE 2AE9A 3UU3A 2V7JA 1HFAA 4IDPA 3R84B 4EZHA 3ZCIA 3ZKRA 2V7MA 3UU8A 2LRLA 2IW5B 3O4XE 4FI5A 2WZIA 3KV9A 4QH5A 2EHOB 2XAQB 5HWYA 3Q9DA 4O4HE 4NXNT 4H9NC 3P4PA 2KXPB 3LBXA 1HS7A 3ABVA 5LP6E 3DP7A 5LOVE 1E7PA 3RF1A 3TLSA 1U5PA 3B57A 2LHNA 5FXVA 1XNRT 2UUBT 3ZT6A 4A5XA 3UQ7A 3PUGA 4DMWA 1MMDA 3C50A 3T1HT 2R6GF 3UULA 5AQIB 5CFBA 4UF0A 1E2AA 2WAUA 2HPJA 4PJLA 4I4TE 4EEBA 3OYXA 3FZLB 5CGMA 4JI8T 1N36T 3PE0A 4IDZA 1YQ3A 4HWCA 5JR9C 3RC8A 3RYHE 5CJ5A 2HPLA 3QNUA 1HNWT 5HCJA 4EIWA 2HH7A 1X9BA 3EDUA 4DNDA 1MIWA 1HCIA 2DWKA 4CI3B 2UXBT 1FMWA 5LYJE 2X9YA 3NBXX 2E8IA 4GYRA 5ETWA 5AQHB 5CA1E 2N2NA 1FJGT 2XAFB 4M1PA 4ISSA 4IGUA 3JC6C 4H9OC 2FJBA 2L3LA 2KINB 2W00A 4MFRA 2ODUA 4MALA 1UX5A 2QRXA 3ONLC 2LOSA 2YU1A 3NZPA 4AKHA 1ZOYA 4H63V 3P4RA 2BKPA 4NUVA 3W15B 3UTKA 2FJDA 2H7OA 3N9LA 5C8YE 4AKIA 3AA6B 4ILBA 5AQPB 3OBVE 2M6IA 2VK9A 3AVSA 3CQCB 4U3CA 2XTLA 2LSKA 4CXYA 2L9QA 4JI2T 5L2LA 4AQYT 2BVLA 4UVCB 4DV4T 3WAKA 1NENA 5ABHA 2NW9A 2RPAA 2WP9A 2WWUA 2JMKA 5H6QB 4L0RA 3SWHA 5AQFB 2BG9C 3EAMA 5LNKA 5JRCB 2KZ7B 2LM2A 3OTOT 4PJNA 1JNRA 2LEHA 3HKBE 2YOEA 2Z6EA 4LFBT 4LF9T 2X51A 5IHYA 2V7KA 4KP3C 2CWYA 2KNDA 4TNVA 3OVUA 4LMKA 4IDOA 1J1JA 4YHJA 3WAJA 2E9XA 4X1KE 3NRXA 2P9BA 5HXRA 2ZM2A 3VR8A 3VKGA 2FJAA 1SE7A 1DU2A 1IJ5A 5AQNB 4ASKA 4QKNA 4JBWF 2V6YB 2XQ3A 4YXDA 1WR6A 5FY7A 1XMOT 2GK9A 2DL1A 5GONE 2LHRA 2V5DA 1HNZT 2NR4A 4IREA 5LHIB 2WBLA 3CWZB 4O4JE 5JDQA 2CLYC 4IIJE 4DR2T 5AQTB 1YKHB 5EK3A 1YKEB 2Q9QD 2XAHB 1HG5A 3EHZA 2WU5A 1XDPA 5JTGA 3L3PA 4IE4A 3E08A 3TLWA 2ZLYA 4F6RC 5L4HA 1CHUA 5ABGA 1NAFA 2ES0A 4U72A 4ANJA 2CHNA 4YSYA 4A56A 3PU3A 3VU7H 1VCSA 4DV3T 1D1CA 2ACXA 2BKOA 4KMCA 4DV5T 4H9SE 2XQ7A 2DCFA 3V5SA 2NTXA 4QH1A 4G2AA 3RI5A 5F3JA 2AXDS 3EVYA 2XSBA 1HF8A 3IF8B 4AQGA 4I43B 3KVAA 1D1AA 3Q5WA 4E7ZA 4U7YA 4YJ2E 2UUAT 4NIQA 2XAJB 2BG9E 2L8KA 4WZXA 2IIUA 1ZHCA 2MTQA 3FHNA 2KT9A 2UXCT 2G0UA 4CI1B 1S35A 1KNRA 3LK2B 4ZI3C 5C2TA 4X65T 2IUBA 2LSJA 2XQ9A 4LFAT 2W0GA 2XSAA 4HFVA 3UU5A 2WB5A 5L4EA 5LG3A 3QB5K 4LF6T 4QXCB 2D5UA 1ZP0A 4UVBB 3RLFF 5EK4A 2V6YA 2OA5A 3FB2A 1J5WA 1V9DA 5AQKB 2N9DA 3LBXB 5J0ZA 3EUHA 3KFWX 4KBMB 1OEDA 4UF0B 1U4QA 2C5IT 4AKRB 1HX1B 4WYVA 2X0HA 2WSSV 3ZC1A 2CWOA 2D9DA 4GKKT 3MKDA 4DR1T 1W9RA 3ONJA 1KNPA 1VRBA 2JMHA 2XY8B 4WW0A 4PAGA 3EI0A 3BQLA 4AISA 3PV0F 3FXDB 4EYYR 4EXTA 3K3QC 2Q9QC 3OKQA 5IWAT 2VWAA 1WRDA 3AEFA 3K1SA 2KMFA 3K3NA 3B13A 2LSYA 4WNKA 1WYCA 3BK9A 4HWDA 3OYZA 4I0UA 4KI0F 3P8CD 3ZYLA 2EHOD 1GQEA 4HGAA 2W63A 4ISTA 3VHLA 3N2GE 4H63H 2BDEA 4IL9A 3ZT7A 3HKEE 4O4LE 3T8OA 3M3ZB 5FYMA 4P0AA 2W62A 1Z0PA 2FBWA 4JI0T 4H9QC 3Q5EA 4PW8A 3AXJB 3RH3A 3EDVA 4P1NA 3CVRA 1J5ET 3AE9A 1T8BA 3QOFA 2V6XA 4ZS2A 3ZYKA 3RRCA 2A72A 4EEDA 2LSGA 4HE8A 1KF6A 4OYJA 2X68A 3ZYMA 5AQSB 1MNEA 4EV6A 4PK4A 1FMVA 4DMVA 1HX8A 4U7IA 4EGWA 5EZYE 3U78A 3M65A 1BR2A 3S4UA 1IBMT 3CMLA 5DQVA 2A3DA 4HWHA 5ABEA 1NEKA 2MBGA 3A7MA 4AIUA 2X9HA 2LJLA 3I1AA 4QWNB 5LXTE 3P50A 3O9XA 1VOMA 4UXNB 4HEAA 1W0AA 3BQKA 2JRKA 3FZMB 1MIVA 1S94A 5LBMA 2CXDA 3AE2A 3IEEA 3RYIE 5LGNB 1UCUA 5HEJA 3B5MA 5JDHA 4EB6E 4JLEA 4PNIA 4ILCA 2VL8A 4DUZT 3ZMZB 4ZHQE 3QB5A 3PTRB 3ZCJA 3OJAA 3AECA 5LJNA 1BR4A 2E9XB 3UU4A 3MACA 2HN1A 1G73A 2BS3A 5AQRB 4I50E 5FY1A 4IHJE 4K0UA 4JV5T 4A97A 4LFCT 2DLRA 2BVMA 2CPTA 2IAKA 4L9IA 3FBZA 3AE1A 3VRBA 5ADXL 3P4QA 4MLKA 3AXJA 2Y6XA 5BR8T 3NKZA 2RP4A 4YSZA 5JR9A 5JH7E 5M4YA 2EHOC 4C90A 4DR4T 2WMNA 4DV6T 2K24A 3FZHB 4BAYB 5FMNA 3AA0B 4YFSA 3PU8A 4X64T 4J2CA 1H7CA 4X66T 2B1EA 1XDOA 5CA0E 1W0BA 3SRZA 1MNDA 3PJAA 4FJOA 3AEGA 3GA8A 2UUCT 5JREA 2WMOA 2QVAA 1T7SA 4Z90A 2XQ6A 5FVLA 3UQ4A 2JQKA 4E7SA 5AQUB 3VR9A 2CCQA 2I0MA 2BKNA 2BZBA 4WBOA 1N34T 3Q5DA 3RPUA 3H3AA 2WDQA 4JI5T 3C4ZA 2NP9A 2DI4A 1CUNA 3ZMSB 3KV6A 4ZI3D 4AKLA 4HFIA 3N9PA 3ZJ1A 4MBQA 2WCAA 3G06A 1XNQT 3LFMA 3PDYA 1M7KA 2ACZA 5FP3A 3UT5E 3TLUA 3PUYF 2XM2A 1UURA 4B6XA 4LF5T 2XM1A 4CXWA 1Y64B 3FZKB 3AA1B 2MOZA 2MAWA 2XJ7A 4DV7T 1M62A 3UU6A 2UU9T 4C91A 2CE7A 4GK5E 2N1GA 4A98A 3NVOA 3E0ZA 1KK7A 4BJMA 2X66A 5HCMA 3AE8A 3BQIA 4JUYA 4LMJA 5LMUT 2V26A 4QXHB 5JDNA 3GWHA 3N9NA 5JDLA 2XQ4A 4CXXA 4JI4T 2J47A 3GN5A 2XQ8A 3N9MA 3JCFA 4PK6A 5KDMC 4B3ST 2QGSA 2XUEA 2YK0A 3UUXB 4YHHT 3AB3B 5FKYA 3UFGA 5DJQC 2CRBA 2KLQA 2J4GA 2XQ5A 1OEDB 1LVKA 4HWFA 4HFHA 2WWVA 4O4IE 1N32T 2CHOA 2H7VC 4L5GA 5LG4A 5FY0A 1YXRA 2VVSA 3JAFA 2PG8A 4QHOA 1ZV4X 3HL6A 5HAXA 5L3CB 3LDQB 2WS3A 4U31A 4DIDB 2VQFT 1R8IA 2W61A 4IE5A 5AQVB 2CBIA 5FXZA 4B3RT 4AQFC 5ABFA 2XAGB 4QH4A 2IDOB 4U33A 4CQIA 3ZEFB 1MMGA 2CBJA 3PUXF 4DR3T 5JDFA 5A1LA 1E1HB 2VKJA 3RIUC 2XPKA 2BS2A 3QUJA 4U2YA 2C5JA 4KUMB 2KWHA 3VKHA 2Y8DA 1WLXA 3C98B 4IT4A 2J62A 4DUYT 4QXBB 3AE6A 4Z8XA 5AQOB 4HFEA 3X1DA 3T1YT 2K5BB 5IYZE 2CXLA 1XWMA 4UVAB 5FNVE 3VRAA 3MA9A 4QX8B 3V5UA 1N33T 4O8SA 2V7IA 5F5WA 3RIFA 5HEGA 4JI7T 4TWFA 1WYBA 4WBNE 2ZMAA 3Q2MA 1LVFA 2ZM0A 5JVDE 5AFUL 5JDGA 3PURA 4ADZA 4HFDA 4UEMA 3IBPA 1I94T 2ZM8A 5L3DB 4YTMA 1HNXT 3AAEB 4YTPA 5EK2A 5L3GB 2SPCA 2XQYA 2K9AA 4QX7B 4NPPA 4U74A 2NTYA 3PUAA 3P4SA 4TWDA 2WDVA 2JQQA 4I55E 4ZZBA 5L3FB 4PJJA 2DHRA 3CK6A 3KDSE 4V1Av 4AXPA 5LBQB 4DR5T 3J7Yq 4G63A 1SUMB 2NW8A 2C5KT 4JEUB 3A5XA 2W66A 4TX5A 2LKHA 1B7TA 4LF4T 5L3BB 4ILAA 4MHCA 1VCTA 1IZNB 4H9RC 2YN6A 1Z8UA 3CQXC 4IE6A 1O3XA 2H89A 2W67A 4AKGA 3GMIA 4DBRA 2X67A 2VVNA 2V5CA 1SA0E 1WR0A 5HEHA 2FUPA 4PJMA 1YQ4A 2CEAA 1D0XA 2MYSA 3A8YC 4HWIB 3RQWA 3MXZA 3AEAA 2VKOA 3ZPOA 5J2UE 3RYCE 4COFA 3EABA 3KINB 4CN4A 4ZI2D 5JR9B 4JI1T 2M6BA 2Q9QA 3KV4A 2PJQA 4TNWA 3I0QA 4P09A 3ANWA 3ETUA 3UFEA 5LMNT 3CQGB 2JPFA 5DABA 2BS4A 3PJAJ 4X20E 2M67A 2B76A 5AQGB 1BR0A 1X79A 5LCYA 5BMVE 2I6HA 2WM9A 4P0BA 1ZKEA 4AI6A 2D2SA 2YEVC 2E9XD 2VASA 3AE4A 2K3WA 1NWMX 3IA3A 1D1BA 4DR6T 1LRZA 4DO0A 1MMNA 4UV8B 4TZ4C 5IUXA 2QA7A 2VL0A 3I9YA 1OEDE 1UK5A 3TLTA 1LKXA 2D0TA 1T98A 5JDMA 5FXXA 3CKDA 5HEOA 4X1IE 3AAAB 3N9QA 2LRKA 1FEWA 3O1JA 4TWHA 4JEHB 4GOUA 3AAIA 2H88A 3LJCA 3ZN0B 3MK7C 2MPKA 1XZYA 4OYKA 2E2AA 3LK3B 2LOPA 3RKOA 3RX6A 3ZMVB 1L0VA 3AVRA 4DVDA 5LA6E 4JYAT 3H37A 2YINA 2KWIB 2A9UA 2X0YA 3ZJ2A 2W2UA 3RQUA 4B3MT 5L47A 2HN2A 1HG2A 4CZZB 2BG9B 2UXXB 5L3EB 4ZI7E 3RIAA 2LSIA 4BA9A 3ZT5A 2X9XA 5HXSA 5LGTB 4EYUA 2JQHA 4LF8T 3GN5B 1WCRA 2JIWA 4EAHA 3L8RA 4GKJT 2C0SA 1XMQT 1Y01A 1ZEEA 4JI3T 4UELA 3FXEB 1JNZA 1IJ6A 2E5LT 3F2EA 3AE3A 2YDQA 3LG7A 4HFCA 3CIRA 3MZKB 2DWGA 3C4XA 2BBHA 2F4VT 4KHPT 4LF7T 4DV2T 4ILUA 3ZLIA 5TAOA 2WZHA 3QC9A 4DV1T 4PK5A 3AE7A 1I6ZA 4ZI2C 3RC3A 3P7IA 5HXEA 4X1YE 2CXFA 4YSXA 1KEYA 1IBKT 2VKDA 4KHZF 2HHHT 2X0LB 1QSDA 2EHOA 2CLYB 4CN6A 3SOLA 3RRWA 4B3TT 5AQJB 1D0ZA 2IC6A 4OK0A 3JADA 2IHR1 2OV9A 1UGOA 3K8PC 1D0YA 1IBLT 1FIOA 5ABFB 4DR7T 3F57A 3ZN1B 4ERRA 3NZQA 2E9XC 3QK6A 1WFDA 5FL1A 5KXJA 2LLYA 2V7LA 4YLHA 2E5VA 1QLBA 5E0OA 3Q5XA 4KX6A 1EZ3A 4HN9A 3HR0A 3AEDA 3OPCA 5DQWA 3SFEA 4ZEYA 3IHRA 2RA1A 4TV8E 3HA4A 1YW0A 5F8PA 3JAEA 2WDRA 5AQLB 5LHGB 4IE7A 2XZEA 2YKSA 2CM0A 4F8HA 1T72A 2PFVA 3CX6B 2BG9A 4CI2B 3ETVA 4TN7B 2XHEB 3C51A 2VKHA 5J2TE 4OX9T 4GYSA 4HFBA 1MMAA 4XZCA 3I0OA 2NW7A 3UUBA 3HKCE 2V8SV 3P4WA 2UXNB 2VQET 3ZMUB 2IC9A 2FJEA 2LKGA 2LM9A 4K0KT 3K3OA 4ZXLA 3J9X1 5KMGP 5J1GA 5H6RB
chains in the Genus database with same CATH topology
4DV6T 2UU9T 1XMOT 2UXCT 5IWAT 1HNZT 4JI8T 1N36T 4X64T 4JI2T 4X66T 4AQYT 4DR2T 4X65T 4LF8T 4DV4T 5LMUT 4DR6T 4GKJT 1XMQT 4LFAT 4DR3T 4DR5T 4JI3T 1HNWT 2UUCT 2E5LT 4JI4T 4LF6T 4LF4T 2ZM6T 2UXBT 2UXDT 4JI0T 2F4VT 4KHPT 4B3ST 4LF7T 4DV2T 4DUZT 4DUYT 4YHHT 1J5ET 4X62T 3OTOT 1N34T 4DV1T 3T1YT 1FJGT 4JI5T 4LFBT 4LF9T 1HR0T 4DV0T 4OX9T 4DV3T 4NXMT 1N33T 1N32T 4JV5T 4NXNT 4JI7T 4LFCT 4DV5T 1IBKT 2HHHT 4JYAT 1XNQT 4YY3T 4JI1T 4B3TT 1XNRT 2UUBT 2VQET 2VQFT 1I94T 4GKKT 4DR1T 3T1HT 5BR8T 1IBMT 5LMNT 1IBLT 4DR7T 4K0KT 1HNXT 4B3MT 4LF5T 4JI6T 2UUAT 4DR4T 4B3RT 4DV7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 T;  2UU9 T;  1XMO T;  2UXC T;  5IWA T;  1HNZ T;  4JI8 T;  1N36 T;  4X64 T;  4JI2 T;  4X66 T;  4AQY T;  4DR2 T;  4X65 T;  4LF8 T;  4DV4 T;  5LMU T;  4DR6 T;  4GKJ T;  1XMQ T;  4LFA T;  4DR3 T;  4DR5 T;  4JI3 T;  1HNW T;  2UUC T;  2E5L T;  4JI4 T;  4LF6 T;  4LF4 T;  2ZM6 T;  2UXB T;  2UXD T;  4JI0 T;  2F4V T;  4KHP T;  4B3S T;  4LF7 T;  4DV2 T;  4DUZ T;  4DUY T;  4YHH T;  1J5E T;  4X62 T;  3OTO T;  1N34 T;  4DV1 T;  3T1Y T;  1FJG T;  4JI5 T;  4LFB T;  4LF9 T;  1HR0 T;  4DV0 T;  4OX9 T;  4DV3 T;  4NXM T;  1N33 T;  1N32 T;  4JV5 T;  4NXN T;  4JI7 T;  4LFC T;  4DV5 T;  1IBK T;  2HHH T;  4JYA T;  1XNQ T;  4YY3 T;  4JI1 T;  4B3T T;  1XNR T;  2UUB T;  2VQE T;  2VQF T;  1I94 T;  4GKK T;  4DR1 T;  3T1H T;  5BR8 T;  1IBM T;  5LMN T;  1IBL T;  4DR7 T;  4K0K T;  1HNX T;  4B3M T;  4LF5 T;  4JI6 T;  2UUA T;  4DR4 T;  4B3R T;  4DV7 T; 
#chains in the Genus database with same CATH topology
 4XBF B;  3AEE A;  1IAP A;  1HTJ F;  3AE5 A;  4PFP A;  4ZOL E;  3RKG A;  3CPZ A;  3N2K E;  1UX4 A;  1MIY A;  2JJ9 A;  3RHW A;  3ZMT B;  3TLV A;  5LGU B;  3AA7 B;  3H3M A;  4CN1 A;  3F31 A;  3KBT A;  5KX5 E;  4TUY E;  2ZM6 T;  3UUN A;  2UXD T;  3I9W A;  3LSV A;  5FL0 A;  4EOZ B;  5LB7 B;  4ZS3 A;  5FXW A;  4IL4 A;  3KBU A;  3HKD E;  3UUM A;  2LE8 A;  1HR0 T;  2VB6 A;  3DTO A;  3N9O A;  5C3J A;  5JRC A;  2XQA A;  5LJM A;  4HKA A;  2LT3 A;  3MJX A;  2X9W A;  2Q9Q B;  2W4X A;  4IDQ A;  4XAX B;  5LHH B;  3ANW B;  4X5T A;  2VUR A;  3RGL A;  3CX7 B;  1OWA A;  4AQF A;  4N78 D;  3D0T A;  2JQ9 A;  4UIG A;  2NOX A;  2WQY A;  4OFZ A;  2DNX A;  3N5L A;  4GK0 E;  3ESL A;  4Z91 A;  2K48 A;  3C64 A;  1OED C;  4NUU A;  2IML A;  4YT0 A;  4JI6 T;  2XAS B;  1YD8 G;  4EZ4 A;  3SS1 A;  3ZC0 A;  1SHZ C;  3RIU A;  3RYF E;  3AEB A;  3NRY A;  5HYA A;  2Y48 B;  2BBJ A;  2PTF A;  2CA5 A;  3PUQ A;  4IDN A;  1W09 A;  5HWX A;  4GIW A;  3KV5 A;  1UUS A;  5HEU A;  4HTE A;  2YU2 A;  3WI3 A;  3CX8 B;  2I59 A;  5HXC A;  3ZST A;  3DJB A;  3O1I A;  3PUZ F;  1KFY A;  3TKL B;  4OHF A;  3FBL A;  3PUS A;  3HI2 A;  2OLT A;  2A2F X;  1QUU A;  4X62 T;  5AQQ B;  3U3I A;  2CMR A;  4U2Z A;  4UV9 B;  3R6N A;  4DV0 T;  4DBQ A;  2QYW A;  4O2A E;  2KSR A;  4NXM T;  3N2O A;  3ONX A;  3PUV F;  2ODV A;  4ZZC A;  2YDS A;  4H9P C;  4PFO A;  3SFD A;  4Q25 A;  3L39 A;  4YY3 T;  3L09 A;  2PBI A;  4UR9 A;  5JQG E;  3LK4 2;  3JC6 D;  2YDR A;  3E22 E;  4IE0 A;  4BJN A;  2H3R A;  1BR1 A;  3KVB A;  2V1D B;  2NWB A;  4TV9 E;  2WU2 A;  3NWI A;  3C4W A;  1US7 B;  5HXH A;  5AQM B;  3PUW F;  5CB4 E;  3FZF B;  3ZSS A;  2D0U A;  2WY2 A;  1AJ3 A;  1OXZ A;  4LML A;  4YTN A;  5FVK A;  2J1D G;  3O1H A;  4YJ3 E;  1G8X A;  1KNZ A;  4O2B E;  2AE9 A;  3UU3 A;  2V7J A;  1HFA A;  4IDP A;  3R84 B;  4EZH A;  3ZCI A;  3ZKR A;  2V7M A;  3UU8 A;  2LRL A;  2IW5 B;  3O4X E;  4FI5 A;  2WZI A;  3KV9 A;  4QH5 A;  2EHO B;  2XAQ B;  5HWY A;  3Q9D A;  4O4H E;  4NXN T;  4H9N C;  3P4P A;  2KXP B;  3LBX A;  1HS7 A;  3ABV A;  5LP6 E;  3DP7 A;  5LOV E;  1E7P A;  3RF1 A;  3TLS A;  1U5P A;  3B57 A;  2LHN A;  5FXV A;  1XNR T;  2UUB T;  3ZT6 A;  4A5X A;  3UQ7 A;  3PUG A;  4DMW A;  1MMD A;  3C50 A;  3T1H T;  2R6G F;  3UUL A;  5AQI B;  5CFB A;  4UF0 A;  1E2A A;  2WAU A;  2HPJ A;  4PJL A;  4I4T E;  4EEB A;  3OYX A;  3FZL B;  5CGM A;  4JI8 T;  1N36 T;  3PE0 A;  4IDZ A;  1YQ3 A;  4HWC A;  5JR9 C;  3RC8 A;  3RYH E;  5CJ5 A;  2HPL A;  3QNU A;  1HNW T;  5HCJ A;  4EIW A;  2HH7 A;  1X9B A;  3EDU A;  4DND A;  1MIW A;  1HCI A;  2DWK A;  4CI3 B;  2UXB T;  1FMW A;  5LYJ E;  2X9Y A;  3NBX X;  2E8I A;  4GYR A;  5ETW A;  5AQH B;  5CA1 E;  2N2N A;  1FJG T;  2XAF B;  4M1P A;  4ISS A;  4IGU A;  3JC6 C;  4H9O C;  2FJB A;  2L3L A;  2KIN B;  2W00 A;  4MFR A;  2ODU A;  4MAL A;  1UX5 A;  2QRX A;  3ONL C;  2LOS A;  2YU1 A;  3NZP A;  4AKH A;  1ZOY A;  4H63 V;  3P4R A;  2BKP A;  4NUV A;  3W15 B;  3UTK A;  2FJD A;  2H7O A;  3N9L A;  5C8Y E;  4AKI A;  3AA6 B;  4ILB A;  5AQP B;  3OBV E;  2M6I A;  2VK9 A;  3AVS A;  3CQC B;  4U3C A;  2XTL A;  2LSK A;  4CXY A;  2L9Q A;  4JI2 T;  5L2L A;  4AQY T;  2BVL A;  4UVC B;  4DV4 T;  3WAK A;  1NEN A;  5ABH A;  2NW9 A;  2RPA A;  2WP9 A;  2WWU A;  2JMK A;  5H6Q B;  4L0R A;  3SWH A;  5AQF B;  2BG9 C;  3EAM A;  5LNK A;  5JRC B;  2KZ7 B;  2LM2 A;  3OTO T;  4PJN A;  1JNR A;  2LEH A;  3HKB E;  2YOE A;  2Z6E A;  4LFB T;  4LF9 T;  2X51 A;  5IHY A;  2V7K A;  4KP3 C;  2CWY A;  2KND A;  4TNV A;  3OVU A;  4LMK A;  4IDO A;  1J1J A;  4YHJ A;  3WAJ A;  2E9X A;  4X1K E;  3NRX A;  2P9B A;  5HXR A;  2ZM2 A;  3VR8 A;  3VKG A;  2FJA A;  1SE7 A;  1DU2 A;  1IJ5 A;  5AQN B;  4ASK A;  4QKN A;  4JBW F;  2V6Y B;  2XQ3 A;  4YXD A;  1WR6 A;  5FY7 A;  1XMO T;  2GK9 A;  2DL1 A;  5GON E;  2LHR A;  2V5D A;  1HNZ T;  2NR4 A;  4IRE A;  5LHI B;  2WBL A;  3CWZ B;  4O4J E;  5JDQ A;  2CLY C;  4IIJ E;  4DR2 T;  5AQT B;  1YKH B;  5EK3 A;  1YKE B;  2Q9Q D;  2XAH B;  1HG5 A;  3EHZ A;  2WU5 A;  1XDP A;  5JTG A;  3L3P A;  4IE4 A;  3E08 A;  3TLW A;  2ZLY A;  4F6R C;  5L4H A;  1CHU A;  5ABG A;  1NAF A;  2ES0 A;  4U72 A;  4ANJ A;  2CHN A;  4YSY A;  4A56 A;  3PU3 A;  3VU7 H;  1VCS A;  4DV3 T;  1D1C A;  2ACX A;  2BKO A;  4KMC A;  4DV5 T;  4H9S E;  2XQ7 A;  2DCF A;  3V5S A;  2NTX A;  4QH1 A;  4G2A A;  3RI5 A;  5F3J A;  2AXD S;  3EVY A;  2XSB A;  1HF8 A;  3IF8 B;  4AQG A;  4I43 B;  3KVA A;  1D1A A;  3Q5W A;  4E7Z A;  4U7Y A;  4YJ2 E;  2UUA T;  4NIQ A;  2XAJ B;  2BG9 E;  2L8K A;  4WZX A;  2IIU A;  1ZHC A;  2MTQ A;  3FHN A;  2KT9 A;  2UXC T;  2G0U A;  4CI1 B;  1S35 A;  1KNR A;  3LK2 B;  4ZI3 C;  5C2T A;  4X65 T;  2IUB A;  2LSJ A;  2XQ9 A;  4LFA T;  2W0G A;  2XSA A;  4HFV A;  3UU5 A;  2WB5 A;  5L4E A;  5LG3 A;  3QB5 K;  4LF6 T;  4QXC B;  2D5U A;  1ZP0 A;  4UVB B;  3RLF F;  5EK4 A;  2V6Y A;  2OA5 A;  3FB2 A;  1J5W A;  1V9D A;  5AQK B;  2N9D A;  3LBX B;  5J0Z A;  3EUH A;  3KFW X;  4KBM B;  1OED A;  4UF0 B;  1U4Q A;  2C5I T;  4AKR B;  1HX1 B;  4WYV A;  2X0H A;  2WSS V;  3ZC1 A;  2CWO A;  2D9D A;  4GKK T;  3MKD A;  4DR1 T;  1W9R A;  3ONJ A;  1KNP A;  1VRB A;  2JMH A;  2XY8 B;  4WW0 A;  4PAG A;  3EI0 A;  3BQL A;  4AIS A;  3PV0 F;  3FXD B;  4EYY R;  4EXT A;  3K3Q C;  2Q9Q C;  3OKQ A;  5IWA T;  2VWA A;  1WRD A;  3AEF A;  3K1S A;  2KMF A;  3K3N A;  3B13 A;  2LSY A;  4WNK A;  1WYC A;  3BK9 A;  4HWD A;  3OYZ A;  4I0U A;  4KI0 F;  3P8C D;  3ZYL A;  2EHO D;  1GQE A;  4HGA A;  2W63 A;  4IST A;  3VHL A;  3N2G E;  4H63 H;  2BDE A;  4IL9 A;  3ZT7 A;  3HKE E;  4O4L E;  3T8O A;  3M3Z B;  5FYM A;  4P0A A;  2W62 A;  1Z0P A;  2FBW A;  4JI0 T;  4H9Q C;  3Q5E A;  4PW8 A;  3AXJ B;  3RH3 A;  3EDV A;  4P1N A;  3CVR A;  1J5E T;  3AE9 A;  1T8B A;  3QOF A;  2V6X A;  4ZS2 A;  3ZYK A;  3RRC A;  2A72 A;  4EED A;  2LSG A;  4HE8 A;  1KF6 A;  4OYJ A;  2X68 A;  3ZYM A;  5AQS B;  1MNE A;  4EV6 A;  4PK4 A;  1FMV A;  4DMV A;  1HX8 A;  4U7I A;  4EGW A;  5EZY E;  3U78 A;  3M65 A;  1BR2 A;  3S4U A;  1IBM T;  3CML A;  5DQV A;  2A3D A;  4HWH A;  5ABE A;  1NEK A;  2MBG A;  3A7M A;  4AIU A;  2X9H A;  2LJL A;  3I1A A;  4QWN B;  5LXT E;  3P50 A;  3O9X A;  1VOM A;  4UXN B;  4HEA A;  1W0A A;  3BQK A;  2JRK A;  3FZM B;  1MIV A;  1S94 A;  5LBM A;  2CXD A;  3AE2 A;  3IEE A;  3RYI E;  5LGN B;  1UCU A;  5HEJ A;  3B5M A;  5JDH A;  4EB6 E;  4JLE A;  4PNI A;  4ILC A;  2VL8 A;  4DUZ T;  3ZMZ B;  4ZHQ E;  3QB5 A;  3PTR B;  3ZCJ A;  3OJA A;  3AEC A;  5LJN A;  1BR4 A;  2E9X B;  3UU4 A;  3MAC A;  2HN1 A;  1G73 A;  2BS3 A;  5AQR B;  4I50 E;  5FY1 A;  4IHJ E;  4K0U A;  4JV5 T;  4A97 A;  4LFC T;  2DLR A;  2BVM A;  2CPT A;  2IAK A;  4L9I A;  3FBZ A;  3AE1 A;  3VRB A;  5ADX L;  3P4Q A;  4MLK A;  3AXJ A;  2Y6X A;  5BR8 T;  3NKZ A;  2RP4 A;  4YSZ A;  5JR9 A;  5JH7 E;  5M4Y A;  2EHO C;  4C90 A;  4DR4 T;  2WMN A;  4DV6 T;  2K24 A;  3FZH B;  4BAY B;  5FMN A;  3AA0 B;  4YFS A;  3PU8 A;  4X64 T;  4J2C A;  1H7C A;  4X66 T;  2B1E A;  1XDO A;  5CA0 E;  1W0B A;  3SRZ A;  1MND A;  3PJA A;  4FJO A;  3AEG A;  3GA8 A;  2UUC T;  5JRE A;  2WMO A;  2QVA A;  1T7S A;  4Z90 A;  2XQ6 A;  5FVL A;  3UQ4 A;  2JQK A;  4E7S A;  5AQU B;  3VR9 A;  2CCQ A;  2I0M A;  2BKN A;  2BZB A;  4WBO A;  1N34 T;  3Q5D A;  3RPU A;  3H3A A;  2WDQ A;  4JI5 T;  3C4Z A;  2NP9 A;  2DI4 A;  1CUN A;  3ZMS B;  3KV6 A;  4ZI3 D;  4AKL A;  4HFI A;  3N9P A;  3ZJ1 A;  4MBQ A;  2WCA A;  3G06 A;  1XNQ T;  3LFM A;  3PDY A;  1M7K A;  2ACZ A;  5FP3 A;  3UT5 E;  3TLU A;  3PUY F;  2XM2 A;  1UUR A;  4B6X A;  4LF5 T;  2XM1 A;  4CXW A;  1Y64 B;  3FZK B;  3AA1 B;  2MOZ A;  2MAW A;  2XJ7 A;  4DV7 T;  1M62 A;  3UU6 A;  2UU9 T;  4C91 A;  2CE7 A;  4GK5 E;  2N1G A;  4A98 A;  3NVO A;  3E0Z A;  1KK7 A;  4BJM A;  2X66 A;  5HCM A;  3AE8 A;  3BQI A;  4JUY A;  4LMJ A;  5LMU T;  2V26 A;  4QXH B;  5JDN A;  3GWH A;  3N9N A;  5JDL A;  2XQ4 A;  4CXX A;  4JI4 T;  2J47 A;  3GN5 A;  2XQ8 A;  3N9M A;  3JCF A;  4PK6 A;  5KDM C;  4B3S T;  2QGS A;  2XUE A;  2YK0 A;  3UUX B;  4YHH T;  3AB3 B;  5FKY A;  3UFG A;  5DJQ C;  2CRB A;  2KLQ A;  2J4G A;  2XQ5 A;  1OED B;  1LVK A;  4HWF A;  4HFH A;  2WWV A;  4O4I E;  1N32 T;  2CHO A;  2H7V C;  4L5G A;  5LG4 A;  5FY0 A;  1YXR A;  2VVS A;  3JAF A;  2PG8 A;  4QHO A;  1ZV4 X;  3HL6 A;  5HAX A;  5L3C B;  3LDQ B;  2WS3 A;  4U31 A;  4DID B;  2VQF T;  1R8I A;  2W61 A;  4IE5 A;  5AQV B;  2CBI A;  5FXZ A;  4B3R T;  4AQF C;  5ABF A;  2XAG B;  4QH4 A;  2IDO B;  4U33 A;  4CQI A;  3ZEF B;  1MMG A;  2CBJ A;  3PUX F;  4DR3 T;  5JDF A;  5A1L A;  1E1H B;  2VKJ A;  3RIU C;  2XPK A;  2BS2 A;  3QUJ A;  4U2Y A;  2C5J A;  4KUM B;  2KWH A;  3VKH A;  2Y8D A;  1WLX A;  3C98 B;  4IT4 A;  2J62 A;  4DUY T;  4QXB B;  3AE6 A;  4Z8X A;  5AQO B;  4HFE A;  3X1D A;  3T1Y T;  2K5B B;  5IYZ E;  2CXL A;  1XWM A;  4UVA B;  5FNV E;  3VRA A;  3MA9 A;  4QX8 B;  3V5U A;  1N33 T;  4O8S A;  2V7I A;  5F5W A;  3RIF A;  5HEG A;  4JI7 T;  4TWF A;  1WYB A;  4WBN E;  2ZMA A;  3Q2M A;  1LVF A;  2ZM0 A;  5JVD E;  5AFU L;  5JDG A;  3PUR A;  4ADZ A;  4HFD A;  4UEM A;  3IBP A;  1I94 T;  2ZM8 A;  5L3D B;  4YTM A;  1HNX T;  3AAE B;  4YTP A;  5EK2 A;  5L3G B;  2SPC A;  2XQY A;  2K9A A;  4QX7 B;  4NPP A;  4U74 A;  2NTY A;  3PUA A;  3P4S A;  4TWD A;  2WDV A;  2JQQ A;  4I55 E;  4ZZB A;  5L3F B;  4PJJ A;  2DHR A;  3CK6 A;  3KDS E;  4V1A v;  4AXP A;  5LBQ B;  4DR5 T;  3J7Y q;  4G63 A;  1SUM B;  2NW8 A;  2C5K T;  4JEU B;  3A5X A;  2W66 A;  4TX5 A;  2LKH A;  1B7T A;  4LF4 T;  5L3B B;  4ILA A;  4MHC A;  1VCT A;  1IZN B;  4H9R C;  2YN6 A;  1Z8U A;  3CQX C;  4IE6 A;  1O3X A;  2H89 A;  2W67 A;  4AKG A;  3GMI A;  4DBR A;  2X67 A;  2VVN A;  2V5C A;  1SA0 E;  1WR0 A;  5HEH A;  2FUP A;  4PJM A;  1YQ4 A;  2CEA A;  1D0X A;  2MYS A;  3A8Y C;  4HWI B;  3RQW A;  3MXZ A;  3AEA A;  2VKO A;  3ZPO A;  5J2U E;  3RYC E;  4COF A;  3EAB A;  3KIN B;  4CN4 A;  4ZI2 D;  5JR9 B;  4JI1 T;  2M6B A;  2Q9Q A;  3KV4 A;  2PJQ A;  4TNW A;  3I0Q A;  4P09 A;  3ANW A;  3ETU A;  3UFE A;  5LMN T;  3CQG B;  2JPF A;  5DAB A;  2BS4 A;  3PJA J;  4X20 E;  2M67 A;  2B76 A;  5AQG B;  1BR0 A;  1X79 A;  5LCY A;  5BMV E;  2I6H A;  2WM9 A;  4P0B A;  1ZKE A;  4AI6 A;  2D2S A;  2YEV C;  2E9X D;  2VAS A;  3AE4 A;  2K3W A;  1NWM X;  3IA3 A;  1D1B A;  4DR6 T;  1LRZ A;  4DO0 A;  1MMN A;  4UV8 B;  4TZ4 C;  5IUX A;  2QA7 A;  2VL0 A;  3I9Y A;  1OED E;  1UK5 A;  3TLT A;  1LKX A;  2D0T A;  1T98 A;  5JDM A;  5FXX A;  3CKD A;  5HEO A;  4X1I E;  3AAA B;  3N9Q A;  2LRK A;  1FEW A;  3O1J A;  4TWH A;  4JEH B;  4GOU A;  3AAI A;  2H88 A;  3LJC A;  3ZN0 B;  3MK7 C;  2MPK A;  1XZY A;  4OYK A;  2E2A A;  3LK3 B;  2LOP A;  3RKO A;  3RX6 A;  3ZMV B;  1L0V A;  3AVR A;  4DVD A;  5LA6 E;  4JYA T;  3H37 A;  2YIN A;  2KWI B;  2A9U A;  2X0Y A;  3ZJ2 A;  2W2U A;  3RQU A;  4B3M T;  5L47 A;  2HN2 A;  1HG2 A;  4CZZ B;  2BG9 B;  2UXX B;  5L3E B;  4ZI7 E;  3RIA A;  2LSI A;  4BA9 A;  3ZT5 A;  2X9X A;  5HXS A;  5LGT B;  4EYU A;  2JQH A;  4LF8 T;  3GN5 B;  1WCR A;  2JIW A;  4EAH A;  3L8R A;  4GKJ T;  2C0S A;  1XMQ T;  1Y01 A;  1ZEE A;  4JI3 T;  4UEL A;  3FXE B;  1JNZ A;  1IJ6 A;  2E5L T;  3F2E A;  3AE3 A;  2YDQ A;  3LG7 A;  4HFC A;  3CIR A;  3MZK B;  2DWG A;  3C4X A;  2BBH A;  2F4V T;  4KHP T;  4LF7 T;  4DV2 T;  4ILU A;  3ZLI A;  5TAO A;  2WZH A;  3QC9 A;  4DV1 T;  4PK5 A;  3AE7 A;  1I6Z A;  4ZI2 C;  3RC3 A;  3P7I A;  5HXE A;  4X1Y E;  2CXF A;  4YSX A;  1KEY A;  1IBK T;  2VKD A;  4KHZ F;  2HHH T;  2X0L B;  1QSD A;  2EHO A;  2CLY B;  4CN6 A;  3SOL A;  3RRW A;  4B3T T;  5AQJ B;  1D0Z A;  2IC6 A;  4OK0 A;  3JAD A;  2IHR 1;  2OV9 A;  1UGO A;  3K8P C;  1D0Y A;  1IBL T;  1FIO A;  5ABF B;  4DR7 T;  3F57 A;  3ZN1 B;  4ERR A;  3NZQ A;  2E9X C;  3QK6 A;  1WFD A;  5FL1 A;  5KXJ A;  2LLY A;  2V7L A;  4YLH A;  2E5V A;  1QLB A;  5E0O A;  3Q5X A;  4KX6 A;  1EZ3 A;  4HN9 A;  3HR0 A;  3AED A;  3OPC A;  5DQW A;  3SFE A;  4ZEY A;  3IHR A;  2RA1 A;  4TV8 E;  3HA4 A;  1YW0 A;  5F8P A;  3JAE A;  2WDR A;  5AQL B;  5LHG B;  4IE7 A;  2XZE A;  2YKS A;  2CM0 A;  4F8H A;  1T72 A;  2PFV A;  3CX6 B;  2BG9 A;  4CI2 B;  3ETV A;  4TN7 B;  2XHE B;  3C51 A;  2VKH A;  5J2T E;  4OX9 T;  4GYS A;  4HFB A;  1MMA A;  4XZC A;  3I0O A;  2NW7 A;  3UUB A;  3HKC E;  2V8S V;  3P4W A;  2UXN B;  2VQE T;  3ZMU B;  2IC9 A;  2FJE A;  2LKG A;  2LM9 A;  4K0K T;  3K3O A;  4ZXL A;  3J9X 1;  5KMG P;  5J1G A;  5H6R B; 
#chains in the Genus database with same CATH homology
 4DV6 T;  2UU9 T;  1XMO T;  2UXC T;  5IWA T;  1HNZ T;  4JI8 T;  1N36 T;  4X64 T;  4JI2 T;  4X66 T;  4AQY T;  4DR2 T;  4X65 T;  4LF8 T;  4DV4 T;  5LMU T;  4DR6 T;  4GKJ T;  1XMQ T;  4LFA T;  4DR3 T;  4DR5 T;  4JI3 T;  1HNW T;  2UUC T;  2E5L T;  4JI4 T;  4LF6 T;  4LF4 T;  2ZM6 T;  2UXB T;  2UXD T;  4JI0 T;  2F4V T;  4KHP T;  4B3S T;  4LF7 T;  4DV2 T;  4DUZ T;  4DUY T;  4YHH T;  1J5E T;  4X62 T;  3OTO T;  1N34 T;  4DV1 T;  3T1Y T;  1FJG T;  4JI5 T;  4LFB T;  4LF9 T;  1HR0 T;  4DV0 T;  4OX9 T;  4DV3 T;  4NXM T;  1N33 T;  1N32 T;  4JV5 T;  4NXN T;  4JI7 T;  4LFC T;  4DV5 T;  1IBK T;  2HHH T;  4JYA T;  1XNQ T;  4YY3 T;  4JI1 T;  4B3T T;  1XNR T;  2UUB T;  2VQE T;  2VQF T;  1I94 T;  4GKK T;  4DR1 T;  3T1H T;  5BR8 T;  1IBM T;  5LMN T;  1IBL T;  4DR7 T;  4K0K T;  1HNX T;  4B3M T;  4LF5 T;  4JI6 T;  2UUA T;  4DR4 T;  4B3R T;  4DV7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...