4B3MT

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3mT00
4KHPT 1IBMT 1XNRT 4LF5T 2UXBT 2F4VT 4DV3T 4LF8T 4LF7T 4K0KT 1XNQT 4JI5T 1N34T 1I94T 4X66T 3T1HT 4B3MT 1J5ET 4YY3T 4LFAT 4JI0T 2E5LT 4LF6T 4LFBT 1FJGT 2VQFT 4DV1T 4JI2T 2ZM6T 5LMNT 2UXCT 2UUBT 3OTOT 4OX9T 5BR8T 1N36T 4JI7T 4YHHT 2UU9T 4JI8T 4NXNT 5IWAT 4NXMT 2HHHT 4DR3T 4JV5T 1N32T 4LF4T 2UUCT 1XMOT 4DR5T 4X65T 2UUAT 1N33T 1HR0T 1XMQT 4DR7T 4AQYT 4X62T 4DR4T 4DR6T 4DR2T 1HNWT 1IBKT 4DUYT 4DV4T 4JYAT 4LF9T 4DV5T 4JI4T 4JI6T 3T1YT 4JI3T 5LMUT 4B3RT 4DV2T 2UXDT 4GKJT 4X64T 1HNXT 4DV6T 4GKKT 2VQET 4DUZT 4LFCT 4DR1T 4B3ST 4JI1T 4DV0T 4B3TT 4DV7T 1HNZT 1IBLT
chains in the Genus database with same CATH superfamily
3C4ZA 4JEHB 1HX1B 4CXXA 4DNDA 3SWHA 4GYRA 3AAIA 3PJAA 4ILUA 5LBQB 2WWUA 3KV9A 5KX5E 5HEUA 4MHCA 2X0HA 1HS7A 3RH3A 3AEGA 2AXDS 2VKHA 5F8PA 3DJBA 4ZI3D 4WYVA 4LF8T 3K3QC 5BMVE 4IDZA 2JQHA 3O1HA 3OPCA 3I0OA 5FY1A 2QVAA 3IA3A 3LBXA 1HG2A 2J4GA 5ABGA 3KV4A 4F6RC 5EK3A 4YXDA 1N34T 1IJ6A 3QK6A 4QKNA 4IE0A 2C5JA 1YD8G 4X66T 5L3EB 2CEAA 3LFMA 5FYMA 3KBUA 4JEUB 2LSYA 4EZ4A 5LNKA 4X1YE 2NW9A 4ILAA 2LHRA 2XZEA 2Y48B 2V7IA 3AE4A 3CQCB 4NUVA 5AQOB 1UK5A 3AE7A 4IIJE 5FL1A 2NOXA 3UQ7A 4LFAT 5LBMA 1BR0A 2V7MA 3AE6A 3NBXX 3NKZA 4YSZA 3ONJA 3UU5A 1WR6A 2YK0A 2L9QA 3EABA 1W09A 3PU8A 4O4IE 5AQRB 2FJEA 2VQFT 4IDPA 4DV1T 3FXDB 3FZKB 4KBMB 3CVRA 2IC9A 2J47A 3CKDA 3UUNA 1UCUA 4QH1A 1FMVA 3ZMTB 1WR0A 5HXHA 2AE9A 3KVAA 3NVOA 5AQPB 2E9XB 5LJNA 2BKPA 3CX7B 1ZV4X 1QUUA 3O1JA 2UUBT 4EIWA 1YQ4A 1UGOA 1XWMA 2DWKA 2YN6A 3IBPA 3I1AA 4I0UA 5ABFB 4HWDA 3C64A 2N2NA 1D0ZA 4GK0E 4CQIA 2JMHA 4N78D 1NENA 3ZYKA 2BS2A 2A9UA 2C5IT 2WAUA 4H63H 3I9YA 4TUYE 3ZN1B 4OX9T 3UU6A 3VU7H 3ZT5A 2K3WA 3L3PA 2BG9B 2E5VA 3HKDE 3N9QA 3ANWA 5HXCA 3UU3A 2HPLA 2VK9A 1KNRA 2VWAA 2BZBA 1Z8UA 1OXZA 3HI2A 4LMJA 3J9X1 4JI8T 2MPKA 4NXNT 2XUEA 3EAMA 5L2LA 4EXTA 5ABFA 3C4WA 2LKHA 2LSKA 4Q25A 4PJMA 2E9XA 2LM2A 1N32T 2IUBA 1VCSA 2XY8B 2B1EA 4X20E 3P8CD 3RYHE 2K24A 2WP9A 2BG9A 2D9DA 3QB5A 5JR9A 3L8RA 5IYZE 1H7CA 2J62A 3Q5EA 3JC6C 4V1Av 2YDSA 2MBGA 3QC9A 2DHRA 5LOVE 1N33T 3TLVA 3ZSTA 3ANWB 2BDEA 4YSXA 5AQHB 5AFUL 4DBRA 1XMQT 2H3RA 4DR6T 4B6XA 1HNWT 3LG7A 2YOEA 3RIAA 1IBKT 3M3ZB 2BBHA 3AE5A 4U7YA 4YLHA 3AVSA 2XQ4A 4JYAT 3TLSA 4U2YA 5FY7A 2HN1A 2IW5B 2IAKA 5DABA 5LP6E 2VB6A 1QLBA 2WDRA 3GN5B 4DVDA 1M62A 2XQ8A 2BKOA 2ZM8A 5GONE 4CZZB 2YINA 4ZI3C 4CN1A 4MFRA 2RP4A 2V7JA 3AEEA 3KBTA 3RLFF 2W4XA 4I55E 5J2UE 4UV8B 5AQJB 2MYSA 3RYCE 3RX6A 4AKLA 4TX5A 2PG8A 2BVMA 2WCAA 3PUXF 4QXCB 4GKKT 3PUAA 5JVDE 2WBLA 1QSDA 5A1LA 5FNVE 2JPFA 4JUYA 5H6RB 5J0ZA 4QXHB 4AKGA 1T98A 2IIUA 4LFCT 2JQKA 2W62A 2JMKA 4JI1T 2N9DA 4B3TT 1DU2A 3OVUA 2W66A 2W2UA 1UX4A 4HFCA 3ABVA 4UVCB 4WW0A 5JR9C 1YQ3A 5KMGP 3NWIA 3OYZA 3HKCE 3LDQB 2WZIA 2YDQA 3IF8B 5F5WA 2ZMAA 3UFEA 3UUXB 3ZT6A 2JIWA 4U2ZA 2H7OA 4KHPT 2LJLA 2R6GF 5C2TA 3DTOA 1W0AA 4QH5A 3ZSSA 1IBMT 3ZC1A 2A2FX 1KF6A 5FVKA 5J2TE 2LSJA 3JCFA 3KFWX 2XQ3A 3TLWA 3ZJ1A 2CBIA 3ZYLA 4LF5T 1XNRT 2JQQA 3HL6A 2KWIB 2DLRA 3AA7B 1ZOYA 2X67A 3AB3B 3K3OA 3BQKA 5AQLB 2UXBT 3N9PA 5M4YA 3O1IA 5LA6E 4IREA 3OJAA 4AQFC 4IDOA 3ZMUB 3IHRA 4ILBA 5F3JA 3FB2A 1HG5A 2BBJA 2LOSA 3JADA 4HWHA 1OWAA 2CBJA 2XAJB 3F57A 1B7TA 3PE0A 5DJQC 1I94T 1MMAA 1WYCA 3WI3A 5JDLA 2LHNA 3RPUA 4O4JE 5J1GA 4YFSA 4B3MT 4PJJA 3P4PA 3EHZA 3HKEE 1D1AA 5CGMA 5JDMA 2WS3A 2NR4A 4NPPA 5AQTB 5L3FB 4YY3T 5JRCA 2V7KA 2XM2A 4TNVA 1V9DA 3UU4A 3AEDA 4L0RA 2X66A 4ZZCA 2XQ6A 3RQWA 2W67A 2LSGA 4WZXA 3QUJA 4PK5A 5FXVA 3ZCJA 2XAQB 4GIWA 5CFBA 5HEJA 2V6XA 1D1BA 2G0UA 4K0UA 4TN7B 2ZM6T 4AQGA 2Y8DA 3QOFA 4QWNB 5AQSB 3RKGA 3KV5A 4CXWA 1MNEA 4CI3B 4TNWA 3TLTA 3WAJA 4UXNB 2KT9A 3PJAJ 4LMLA 3CPZA 1HCIA 2ACZA 4ISTA 4HWIB 3AEBA 4ILCA 4UIGA 2WWVA 3PTRB 4GYSA 5FXZA 3ZMSB 1VOMA 5LGNB 3UUBA 3ZPOA 1YW0A 4ZXLA 1J5ET 3R84B 2Q9QB 1N36T 2JQ9A 4JI7T 1HTJF 2XPKA 4M1PA 4ANJA 3MA9A 3SS1A 3UUMA 4UV9B 2UU9T 1JNRA 2CWOA 1WYBA 1VRBA 3CQXC 3ETUA 3R6NA 3N2KE 1D0YA 2FBWA 3LBXB 3A5XA 3EVYA 4OYJA 4DR3T 2HHHT 2X9XA 4O2BE 5EK4A 4A56A 4UVBB 3AEAA 4EEDA 1NWMX 2WU5A 4Z8XA 2UUCT 2BG9E 5AQGB 3EDVA 1I6ZA 2XAHB 1XMOT 1MNDA 4HFEA 4YHJA 4DR5T 4X65T 1T7SA 2JRKA 2KINB 3C51A 3OKQA 4U31A 5AQQB 2UUAT 2XHEB 2CE7A 5L3DB 4H9OC 2CLYB 2XASB 1UURA 2NW8A 3PUYF 4H9NC 4TWDA 1MMNA 4BJNA 3CQGB 4YJ2E 4ISSA 4DR7T 5FVLA 4DR2T 3FZLB 3X1DA 4BJMA 3ZC0A 5HWXA 4ERRA 2VL0A 4U7IA 2IMLA 2WQYA 3I0QA 4U74A 1UX5A 3ZYMA 2XQ9A 4AISA 2E8IA 4H63V 1Y64B 3DP7A 3T1YT 4EOZB 4WBNE 4KP3C 1KNPA 2VL8A 4E7ZA 2XQ7A 3FZHB 4CXYA 3RYIE 3NZQA 3N9OA 4P1NA 3AE2A 5L4EA 1LVFA 4O4HE 3SOLA 4EEBA 3RI5A 2MOZA 2OA5A 4PK6A 4KUMB 2XAGB 1HNXT 5IUXA 3AA6B 4IDQA 4DV6T 4XBFB 2Q9QC 4IDNA 1S94A 3AEFA 3E0ZA 4PK4A 3U78A 4IL4A 5LGTB 3J7Yq 2M6BA 3ZJ2A 4EV6A 1GQEA 2CCQA 1X9BA 2GK9A 3UFGA 5LCYA 4Z90A 4ZI2D 5LHHB 4DV7T 1HNZT 1YKHB 1M7KA 4ZI7E 2PJQA 4O8SA 1IBLT 3U3IA 2LOPA 3ZMVB 2EHOA 1BR2A 1MMDA 3BQIA 3PU3A 4ZOLE 4ZS2A 3RF1A 1KNZA 2VKOA 3ZN0B 2CXFA 3LK42 3LK2B 4YJ3E 3AE3A 2X0LB 3SFEA 2XM1A 3MJXA 3N9LA 4TV9E 3EUHA 5JRCB 3RGLA 2CLYC 4EYYR 5JQGE 3LJCA 2QYWA 1SA0E 4G63A 5AQMB 2DL1A 2M6IA 3FXEB 4HGAA 2F4VT 1YKEB 4A97A 4DV3T 3SFDA 3N9NA 5HEGA 3KDSE 2XSBA 4QX7B 4PAGA 1U4QA 2NWBA 3M65A 3KINB 1Z0PA 2EHOB 3AVRA 4LMKA 4QHOA 5L47A 4K0KT 3H37A 1CHUA 2V7LA 4KMCA 2D5UA 4Z91A 5HCJA 4JI5T 4C90A 4DBQA 4UELA 1XNQT 3OYXA 3P4QA 2CXLA 2WDVA 3B5MA 4MALA 5ETWA 4EGWA 3GMIA 1WCRA 3NRYA 4YTMA 5LGUB 3T1HT 1JNZA 2WDQA 2NP9A 3KV6A 4O2AE 1XZYA 2PFVA 2K9AA 1E7PA 3EDUA 2A3DA 3Q2MA 2BG9C 3PUQA 3PDYA 3MACA 5C3JA 1FEWA 3GA8A 3AAAB 1L0VA 3AA0B 3K8PC 4AQFA 5JR9B 1EZ3A 2LM9A 3AE9A 4IE6A 4YTNA 4HFVA 5HCMA 2QRXA 5LYJE 2LRLA 4TWFA 4HEAA 4F8HA 2E5LT 1FJGT 4H9SE 3RYFE 2CXDA 4LFBT 5HAXA 4JI2T 2UXNB 4OK0A 4P09A 4AIUA 1T72A 5ADXL 2I6HA 3FHNA 4LF6T 1Y01A 3KVBA 2W0GA 5LMNT 5LB7B 4A98A 4IGUA 2PTFA 3CMLA 5JDQA 2NTYA 4IHJE 2W00A 5DQWA 3T8OA 1SUMB 2KZ7B 1MIYA 5LXTE 4J2CA 4MLKA 1VCTA 3GWHA 2LRKA 2ES0A 4PJNA 4L9IA 1J5WA 4DMWA 2C0SA 5DQVA 1SE7A 3ZEFB 2X68A 4GOUA 4JBWF 3RC3A 3VHLA 3F31A 2CM0A 4X5TA 5BR8T 4AKHA 3PV0F 3H3MA 1G8XA 4YHHT 2ZLYA 2KWHA 3FZFB 2D0UA 4NUUA 4BAYB 3P4RA 3N2GE 2D2SA 4X1KE 4CN6A 5KXJA 4FJOA 4U72A 2WZHA 3HKBE 4NXMT 3N2OA 3MK7C 3AE8A 4QX8B 1WRDA 4WBOA 2V6YB 5FMNA 2YDRA 5CB4E 2HN2A 3CX6B 4HWFA 3RIUC 2L8KA 1ZEEA 3ESLA 2XJ7A 3P50A 2YKSA 2WB5A 1MIWA 3HR0A 2FUPA 4WNKA 4EB6E 2FJBA 3P4WA 1KFYA 5FP3A 4ZI2C 1CUNA 1U5PA 2FJDA 3RIFA 1HR0T 4HFIA 3CK6A 2CHNA 3JAEA 4AKRB 4EAHA 3ONLC 3RRCA 4HWCA 3S4UA 5AQIB 2KNDA 3PUWF 3JC6D 2BS4A 4UR9A 5FXXA 2LKGA 3JAFA 5L3CB 5AQUB 4UEMA 1HF8A 1FMWA 2Y6XA 4P0BA 5LG4A 3K1SA 3QNUA 4LF9T 4JI4T 4JI6T 3AAEB 5LJMA 3RC8A 1US7B 4I4TE 2WMNA 4KHZF 3W15B 3C50A 1MMGA 4JI3T 2CPTA 5LMUT 1OEDA 2CHOA 3QB5K 4DV2T 4B3RT 4ZS3A 1AJ3A 5JTGA 2UXDT 1E2AA 2KMFA 1YXRA 2W61A 4TV8E 3I9WA 3VKHA 2EHOC 2Q9QA 4GKJT 1LRZA 2CRBA 5LHGB 2NTXA 2ODVA 3VR8A 3LK3B 4EZHA 5C8YE 4HFBA 2VQET 2V5CA 3NZPA 3B57A 3AE1A 4CN4A 5JDHA 5LHIB 4DR1T 1FIOA 2PBIA 2D0TA 3CIRA 4YSYA 4A5XA 4B3ST 3LSVA 2CMRA 4KI0F 2LSIA 4OHFA 2P9BA 1LKXA 2XQYA 4PNIA 2VKJA 5JH7E 3Q5XA 4H9QC 5FKYA 5HXRA 2BKNA 2Z6EA 2E9XD 2XSAA 2X51A 4TZ4C 3H3AA 2V26A 4IT4A 2V5DA 4HKAA 4YT0A 3E22E 3ZKRA 3OBVE 5HEOA 4QH4A 2MAWA 5AQFB 1WFDA 3UQ4A 1IZNB 2J1DG 4UF0A 3MKDA 4PJLA 4BA9A 3MXZA 4NIQA 2V1DB 2RA1A 2X9HA 3ZT7A 3AXJA 2DNXA 4OFZA 1UUSA 3UTKA 2IDOB 4I43B 3AA1B 5JDNA 2ZM0A 1G73A 4PFOA 4E7SA 5AQKB 3CWZB 3Q9DA 4ZHQE 5CA0E 4C91A 4IL9A 2KXPB 2QGSA 5EZYE 4KX6A 3BQLA 2RPAA 2K48A 3BK9A 4X1IE 2WM9A 4LF7T 3K3NA 3RKOA 2L3LA 3F2EA 2SPCA 2I0MA 4ADZA 2JJ9A 3A8YC 3PUSA 3AXJB 5AQNB 1ZKEA 3ZCIA 4O4LE 3N9MA 1D1CA 3TLUA 4IE5A 5TAOA 3V5UA 1SHZC 1OEDE 2WSSV 4JI0T 3P4SA 2WY2A 3C4XA 3UU8A 4OYKA 5JREA 5HYAA 2V6YA 2VASA 1IJ5A 2B76A 2C5KT 3PUZF 4HFHA 2I59A 2ACXA 2VKDA 2ZM2A 5E0OA 3RHWA 1HX8A 3HA4A 4MBQA 5AQVB 2UXCT 3O4XE 4EYUA 2WU2A 3GN5A 3RQUA 2LLYA 2XQ5A 3VR9A 4HE8A 4UVAB 1ZP0A 3OTOT 2OV9A 3PUVF 4H9RC 4YTPA 5JDGA 3V5SA 2CWYA 2VVSA 2BVLA 3E08A 3UULA 3CX8B 2XAFB 5FXWA 2V8SV 3A7MA 2E2AA 2VVNA 3IEEA 5FY0A 2IC6A 5HXSA 5LG3A 4JLEA 2H89A 2N1GA 1XDPA 1E1HB 4DIDB 4ZZBA 5IWAT 1OEDB 1XDOA 1BR4A 1NAFA 2DI4A 2H7VC 2MTQA 2H88A 2QA7A 3L09A 2K5BB 3RIUA 3ZMZB 3VRBA 4LF4T 2LT3A 4JV5T 3D0TA 2IHR1 3ONXA 3P7IA 3FBLA 2DCFA 3ETVA 5L3BB 3FBZA 2XQAA 3MZKB 5L4HA 3UT5E 2ODUA 2WMOA 3N5LA 3Q5WA 1X79A 4TWHA 4HN9A 2X0YA 4AXPA 3Q5DA 1HFAA 4AQYT 4X62T 4PW8A 5KDMC 4DR4T 2BS3A 2LE8A 4PFPA 4CI2B 1W0BA 2E9XC 4COFA 5HXEA 4DUYT 4DV4T 4ASKA 3L39A 4G2AA 4IE7A 5IHYA 1ZHCA 2YEVC 4CI1B 4IE4A 4H9PC 4DV5T 4GK5E 5L3GB 2M67A 1MIVA 2HPJA 3EI0A 4XAXB 5HEHA 1KK7A 2X9YA 5HWYA 5JDFA 3TKLB 2X9WA 1T8BA 4U33A 5EK2A 1BR1A 2VURA 4I50E 3VKGA 2FJAA 2Q9QD 1IAPA 1NEKA 5FL0A 5H6QB 3C98B 2LEHA 3AECA 4UF0B 2KLQA 5CJ5A 4FI5A 4DO0A 4X64T 3SRZA 1J1JA 2A72A 2YU2A 4QXBB 4HFDA 4ZEYA 3PURA 4AI6A 2HH7A 4L5GA 1O3XA 4DMVA 1D0XA 2EHOD 3B13A 2OLTA 3O9XA 3PUGA 2XTLA 2CA5A 5CA1E 1KEYA 4DUZT 2KSRA 3VRAA 4P0AA 4DV0T 2UXXB 5ABEA 4AKIA 1OEDC 3RRWA 1WLXA 1S35A 4HTEA 3ZLIA 1W9RA 3NRXA 2YU1A 4XZCA 2NW7A 1R8IA 3G06A 5ABHA 3WAKA 2DWGA 4U3CA 3FZMB 2W63A 1LVKA
chains in the Genus database with same CATH topology
4KHPT 1IBMT 1XNRT 4LF5T 2UXBT 2F4VT 4DV3T 4LF8T 4LF7T 4K0KT 1XNQT 4JI5T 1N34T 1I94T 4X66T 3T1HT 4B3MT 1J5ET 4YY3T 4LFAT 4JI0T 2E5LT 4LF6T 4LFBT 1FJGT 2VQFT 4DV1T 4JI2T 2ZM6T 5LMNT 2UXCT 2UUBT 3OTOT 4OX9T 5BR8T 1N36T 4JI7T 4YHHT 2UU9T 4JI8T 4NXNT 5IWAT 4NXMT 2HHHT 4DR3T 4JV5T 1N32T 4LF4T 2UUCT 1XMOT 4DR5T 4X65T 2UUAT 1N33T 1HR0T 1XMQT 4DR7T 4AQYT 4X62T 4DR4T 4DR6T 4DR2T 1HNWT 1IBKT 4DUYT 4DV4T 4JYAT 4LF9T 4DV5T 4JI4T 4JI6T 3T1YT 4JI3T 5LMUT 4B3RT 4DV2T 2UXDT 4GKJT 4X64T 1HNXT 4DV6T 4GKKT 2VQET 4DUZT 4LFCT 4DR1T 4B3ST 4JI1T 4DV0T 4B3TT 4DV7T 1HNZT 1IBLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP T;  1IBM T;  1XNR T;  4LF5 T;  2UXB T;  2F4V T;  4DV3 T;  4LF8 T;  4LF7 T;  4K0K T;  1XNQ T;  4JI5 T;  1N34 T;  1I94 T;  4X66 T;  3T1H T;  4B3M T;  1J5E T;  4YY3 T;  4LFA T;  4JI0 T;  2E5L T;  4LF6 T;  4LFB T;  1FJG T;  2VQF T;  4DV1 T;  4JI2 T;  2ZM6 T;  5LMN T;  2UXC T;  2UUB T;  3OTO T;  4OX9 T;  5BR8 T;  1N36 T;  4JI7 T;  4YHH T;  2UU9 T;  4JI8 T;  4NXN T;  5IWA T;  4NXM T;  2HHH T;  4DR3 T;  4JV5 T;  1N32 T;  4LF4 T;  2UUC T;  1XMO T;  4DR5 T;  4X65 T;  2UUA T;  1N33 T;  1HR0 T;  1XMQ T;  4DR7 T;  4AQY T;  4X62 T;  4DR4 T;  4DR6 T;  4DR2 T;  1HNW T;  1IBK T;  4DUY T;  4DV4 T;  4JYA T;  4LF9 T;  4DV5 T;  4JI4 T;  4JI6 T;  3T1Y T;  4JI3 T;  5LMU T;  4B3R T;  4DV2 T;  2UXD T;  4GKJ T;  4X64 T;  1HNX T;  4DV6 T;  4GKK T;  2VQE T;  4DUZ T;  4LFC T;  4DR1 T;  4B3S T;  4JI1 T;  4DV0 T;  4B3T T;  4DV7 T;  1HNZ T;  1IBL T; 
#chains in the Genus database with same CATH topology
 3C4Z A;  4JEH B;  1HX1 B;  4CXX A;  4DND A;  3SWH A;  4GYR A;  3AAI A;  3PJA A;  4ILU A;  5LBQ B;  2WWU A;  3KV9 A;  5KX5 E;  5HEU A;  4MHC A;  2X0H A;  1HS7 A;  3RH3 A;  3AEG A;  2AXD S;  2VKH A;  5F8P A;  3DJB A;  4ZI3 D;  4WYV A;  4LF8 T;  3K3Q C;  5BMV E;  4IDZ A;  2JQH A;  3O1H A;  3OPC A;  3I0O A;  5FY1 A;  2QVA A;  3IA3 A;  3LBX A;  1HG2 A;  2J4G A;  5ABG A;  3KV4 A;  4F6R C;  5EK3 A;  4YXD A;  1N34 T;  1IJ6 A;  3QK6 A;  4QKN A;  4IE0 A;  2C5J A;  1YD8 G;  4X66 T;  5L3E B;  2CEA A;  3LFM A;  5FYM A;  3KBU A;  4JEU B;  2LSY A;  4EZ4 A;  5LNK A;  4X1Y E;  2NW9 A;  4ILA A;  2LHR A;  2XZE A;  2Y48 B;  2V7I A;  3AE4 A;  3CQC B;  4NUV A;  5AQO B;  1UK5 A;  3AE7 A;  4IIJ E;  5FL1 A;  2NOX A;  3UQ7 A;  4LFA T;  5LBM A;  1BR0 A;  2V7M A;  3AE6 A;  3NBX X;  3NKZ A;  4YSZ A;  3ONJ A;  3UU5 A;  1WR6 A;  2YK0 A;  2L9Q A;  3EAB A;  1W09 A;  3PU8 A;  4O4I E;  5AQR B;  2FJE A;  2VQF T;  4IDP A;  4DV1 T;  3FXD B;  3FZK B;  4KBM B;  3CVR A;  2IC9 A;  2J47 A;  3CKD A;  3UUN A;  1UCU A;  4QH1 A;  1FMV A;  3ZMT B;  1WR0 A;  5HXH A;  2AE9 A;  3KVA A;  3NVO A;  5AQP B;  2E9X B;  5LJN A;  2BKP A;  3CX7 B;  1ZV4 X;  1QUU A;  3O1J A;  2UUB T;  4EIW A;  1YQ4 A;  1UGO A;  1XWM A;  2DWK A;  2YN6 A;  3IBP A;  3I1A A;  4I0U A;  5ABF B;  4HWD A;  3C64 A;  2N2N A;  1D0Z A;  4GK0 E;  4CQI A;  2JMH A;  4N78 D;  1NEN A;  3ZYK A;  2BS2 A;  2A9U A;  2C5I T;  2WAU A;  4H63 H;  3I9Y A;  4TUY E;  3ZN1 B;  4OX9 T;  3UU6 A;  3VU7 H;  3ZT5 A;  2K3W A;  3L3P A;  2BG9 B;  2E5V A;  3HKD E;  3N9Q A;  3ANW A;  5HXC A;  3UU3 A;  2HPL A;  2VK9 A;  1KNR A;  2VWA A;  2BZB A;  1Z8U A;  1OXZ A;  3HI2 A;  4LMJ A;  3J9X 1;  4JI8 T;  2MPK A;  4NXN T;  2XUE A;  3EAM A;  5L2L A;  4EXT A;  5ABF A;  3C4W A;  2LKH A;  2LSK A;  4Q25 A;  4PJM A;  2E9X A;  2LM2 A;  1N32 T;  2IUB A;  1VCS A;  2XY8 B;  2B1E A;  4X20 E;  3P8C D;  3RYH E;  2K24 A;  2WP9 A;  2BG9 A;  2D9D A;  3QB5 A;  5JR9 A;  3L8R A;  5IYZ E;  1H7C A;  2J62 A;  3Q5E A;  3JC6 C;  4V1A v;  2YDS A;  2MBG A;  3QC9 A;  2DHR A;  5LOV E;  1N33 T;  3TLV A;  3ZST A;  3ANW B;  2BDE A;  4YSX A;  5AQH B;  5AFU L;  4DBR A;  1XMQ T;  2H3R A;  4DR6 T;  4B6X A;  1HNW T;  3LG7 A;  2YOE A;  3RIA A;  1IBK T;  3M3Z B;  2BBH A;  3AE5 A;  4U7Y A;  4YLH A;  3AVS A;  2XQ4 A;  4JYA T;  3TLS A;  4U2Y A;  5FY7 A;  2HN1 A;  2IW5 B;  2IAK A;  5DAB A;  5LP6 E;  2VB6 A;  1QLB A;  2WDR A;  3GN5 B;  4DVD A;  1M62 A;  2XQ8 A;  2BKO A;  2ZM8 A;  5GON E;  4CZZ B;  2YIN A;  4ZI3 C;  4CN1 A;  4MFR A;  2RP4 A;  2V7J A;  3AEE A;  3KBT A;  3RLF F;  2W4X A;  4I55 E;  5J2U E;  4UV8 B;  5AQJ B;  2MYS A;  3RYC E;  3RX6 A;  4AKL A;  4TX5 A;  2PG8 A;  2BVM A;  2WCA A;  3PUX F;  4QXC B;  4GKK T;  3PUA A;  5JVD E;  2WBL A;  1QSD A;  5A1L A;  5FNV E;  2JPF A;  4JUY A;  5H6R B;  5J0Z A;  4QXH B;  4AKG A;  1T98 A;  2IIU A;  4LFC T;  2JQK A;  2W62 A;  2JMK A;  4JI1 T;  2N9D A;  4B3T T;  1DU2 A;  3OVU A;  2W66 A;  2W2U A;  1UX4 A;  4HFC A;  3ABV A;  4UVC B;  4WW0 A;  5JR9 C;  1YQ3 A;  5KMG P;  3NWI A;  3OYZ A;  3HKC E;  3LDQ B;  2WZI A;  2YDQ A;  3IF8 B;  5F5W A;  2ZMA A;  3UFE A;  3UUX B;  3ZT6 A;  2JIW A;  4U2Z A;  2H7O A;  4KHP T;  2LJL A;  2R6G F;  5C2T A;  3DTO A;  1W0A A;  4QH5 A;  3ZSS A;  1IBM T;  3ZC1 A;  2A2F X;  1KF6 A;  5FVK A;  5J2T E;  2LSJ A;  3JCF A;  3KFW X;  2XQ3 A;  3TLW A;  3ZJ1 A;  2CBI A;  3ZYL A;  4LF5 T;  1XNR T;  2JQQ A;  3HL6 A;  2KWI B;  2DLR A;  3AA7 B;  1ZOY A;  2X67 A;  3AB3 B;  3K3O A;  3BQK A;  5AQL B;  2UXB T;  3N9P A;  5M4Y A;  3O1I A;  5LA6 E;  4IRE A;  3OJA A;  4AQF C;  4IDO A;  3ZMU B;  3IHR A;  4ILB A;  5F3J A;  3FB2 A;  1HG5 A;  2BBJ A;  2LOS A;  3JAD A;  4HWH A;  1OWA A;  2CBJ A;  2XAJ B;  3F57 A;  1B7T A;  3PE0 A;  5DJQ C;  1I94 T;  1MMA A;  1WYC A;  3WI3 A;  5JDL A;  2LHN A;  3RPU A;  4O4J E;  5J1G A;  4YFS A;  4B3M T;  4PJJ A;  3P4P A;  3EHZ A;  3HKE E;  1D1A A;  5CGM A;  5JDM A;  2WS3 A;  2NR4 A;  4NPP A;  5AQT B;  5L3F B;  4YY3 T;  5JRC A;  2V7K A;  2XM2 A;  4TNV A;  1V9D A;  3UU4 A;  3AED A;  4L0R A;  2X66 A;  4ZZC A;  2XQ6 A;  3RQW A;  2W67 A;  2LSG A;  4WZX A;  3QUJ A;  4PK5 A;  5FXV A;  3ZCJ A;  2XAQ B;  4GIW A;  5CFB A;  5HEJ A;  2V6X A;  1D1B A;  2G0U A;  4K0U A;  4TN7 B;  2ZM6 T;  4AQG A;  2Y8D A;  3QOF A;  4QWN B;  5AQS B;  3RKG A;  3KV5 A;  4CXW A;  1MNE A;  4CI3 B;  4TNW A;  3TLT A;  3WAJ A;  4UXN B;  2KT9 A;  3PJA J;  4LML A;  3CPZ A;  1HCI A;  2ACZ A;  4IST A;  4HWI B;  3AEB A;  4ILC A;  4UIG A;  2WWV A;  3PTR B;  4GYS A;  5FXZ A;  3ZMS B;  1VOM A;  5LGN B;  3UUB A;  3ZPO A;  1YW0 A;  4ZXL A;  1J5E T;  3R84 B;  2Q9Q B;  1N36 T;  2JQ9 A;  4JI7 T;  1HTJ F;  2XPK A;  4M1P A;  4ANJ A;  3MA9 A;  3SS1 A;  3UUM A;  4UV9 B;  2UU9 T;  1JNR A;  2CWO A;  1WYB A;  1VRB A;  3CQX C;  3ETU A;  3R6N A;  3N2K E;  1D0Y A;  2FBW A;  3LBX B;  3A5X A;  3EVY A;  4OYJ A;  4DR3 T;  2HHH T;  2X9X A;  4O2B E;  5EK4 A;  4A56 A;  4UVB B;  3AEA A;  4EED A;  1NWM X;  2WU5 A;  4Z8X A;  2UUC T;  2BG9 E;  5AQG B;  3EDV A;  1I6Z A;  2XAH B;  1XMO T;  1MND A;  4HFE A;  4YHJ A;  4DR5 T;  4X65 T;  1T7S A;  2JRK A;  2KIN B;  3C51 A;  3OKQ A;  4U31 A;  5AQQ B;  2UUA T;  2XHE B;  2CE7 A;  5L3D B;  4H9O C;  2CLY B;  2XAS B;  1UUR A;  2NW8 A;  3PUY F;  4H9N C;  4TWD A;  1MMN A;  4BJN A;  3CQG B;  4YJ2 E;  4ISS A;  4DR7 T;  5FVL A;  4DR2 T;  3FZL B;  3X1D A;  4BJM A;  3ZC0 A;  5HWX A;  4ERR A;  2VL0 A;  4U7I A;  2IML A;  2WQY A;  3I0Q A;  4U74 A;  1UX5 A;  3ZYM A;  2XQ9 A;  4AIS A;  2E8I A;  4H63 V;  1Y64 B;  3DP7 A;  3T1Y T;  4EOZ B;  4WBN E;  4KP3 C;  1KNP A;  2VL8 A;  4E7Z A;  2XQ7 A;  3FZH B;  4CXY A;  3RYI E;  3NZQ A;  3N9O A;  4P1N A;  3AE2 A;  5L4E A;  1LVF A;  4O4H E;  3SOL A;  4EEB A;  3RI5 A;  2MOZ A;  2OA5 A;  4PK6 A;  4KUM B;  2XAG B;  1HNX T;  5IUX A;  3AA6 B;  4IDQ A;  4DV6 T;  4XBF B;  2Q9Q C;  4IDN A;  1S94 A;  3AEF A;  3E0Z A;  4PK4 A;  3U78 A;  4IL4 A;  5LGT B;  3J7Y q;  2M6B A;  3ZJ2 A;  4EV6 A;  1GQE A;  2CCQ A;  1X9B A;  2GK9 A;  3UFG A;  5LCY A;  4Z90 A;  4ZI2 D;  5LHH B;  4DV7 T;  1HNZ T;  1YKH B;  1M7K A;  4ZI7 E;  2PJQ A;  4O8S A;  1IBL T;  3U3I A;  2LOP A;  3ZMV B;  2EHO A;  1BR2 A;  1MMD A;  3BQI A;  3PU3 A;  4ZOL E;  4ZS2 A;  3RF1 A;  1KNZ A;  2VKO A;  3ZN0 B;  2CXF A;  3LK4 2;  3LK2 B;  4YJ3 E;  3AE3 A;  2X0L B;  3SFE A;  2XM1 A;  3MJX A;  3N9L A;  4TV9 E;  3EUH A;  5JRC B;  3RGL A;  2CLY C;  4EYY R;  5JQG E;  3LJC A;  2QYW A;  1SA0 E;  4G63 A;  5AQM B;  2DL1 A;  2M6I A;  3FXE B;  4HGA A;  2F4V T;  1YKE B;  4A97 A;  4DV3 T;  3SFD A;  3N9N A;  5HEG A;  3KDS E;  2XSB A;  4QX7 B;  4PAG A;  1U4Q A;  2NWB A;  3M65 A;  3KIN B;  1Z0P A;  2EHO B;  3AVR A;  4LMK A;  4QHO A;  5L47 A;  4K0K T;  3H37 A;  1CHU A;  2V7L A;  4KMC A;  2D5U A;  4Z91 A;  5HCJ A;  4JI5 T;  4C90 A;  4DBQ A;  4UEL A;  1XNQ T;  3OYX A;  3P4Q A;  2CXL A;  2WDV A;  3B5M A;  4MAL A;  5ETW A;  4EGW A;  3GMI A;  1WCR A;  3NRY A;  4YTM A;  5LGU B;  3T1H T;  1JNZ A;  2WDQ A;  2NP9 A;  3KV6 A;  4O2A E;  1XZY A;  2PFV A;  2K9A A;  1E7P A;  3EDU A;  2A3D A;  3Q2M A;  2BG9 C;  3PUQ A;  3PDY A;  3MAC A;  5C3J A;  1FEW A;  3GA8 A;  3AAA B;  1L0V A;  3AA0 B;  3K8P C;  4AQF A;  5JR9 B;  1EZ3 A;  2LM9 A;  3AE9 A;  4IE6 A;  4YTN A;  4HFV A;  5HCM A;  2QRX A;  5LYJ E;  2LRL A;  4TWF A;  4HEA A;  4F8H A;  2E5L T;  1FJG T;  4H9S E;  3RYF E;  2CXD A;  4LFB T;  5HAX A;  4JI2 T;  2UXN B;  4OK0 A;  4P09 A;  4AIU A;  1T72 A;  5ADX L;  2I6H A;  3FHN A;  4LF6 T;  1Y01 A;  3KVB A;  2W0G A;  5LMN T;  5LB7 B;  4A98 A;  4IGU A;  2PTF A;  3CML A;  5JDQ A;  2NTY A;  4IHJ E;  2W00 A;  5DQW A;  3T8O A;  1SUM B;  2KZ7 B;  1MIY A;  5LXT E;  4J2C A;  4MLK A;  1VCT A;  3GWH A;  2LRK A;  2ES0 A;  4PJN A;  4L9I A;  1J5W A;  4DMW A;  2C0S A;  5DQV A;  1SE7 A;  3ZEF B;  2X68 A;  4GOU A;  4JBW F;  3RC3 A;  3VHL A;  3F31 A;  2CM0 A;  4X5T A;  5BR8 T;  4AKH A;  3PV0 F;  3H3M A;  1G8X A;  4YHH T;  2ZLY A;  2KWH A;  3FZF B;  2D0U A;  4NUU A;  4BAY B;  3P4R A;  3N2G E;  2D2S A;  4X1K E;  4CN6 A;  5KXJ A;  4FJO A;  4U72 A;  2WZH A;  3HKB E;  4NXM T;  3N2O A;  3MK7 C;  3AE8 A;  4QX8 B;  1WRD A;  4WBO A;  2V6Y B;  5FMN A;  2YDR A;  5CB4 E;  2HN2 A;  3CX6 B;  4HWF A;  3RIU C;  2L8K A;  1ZEE A;  3ESL A;  2XJ7 A;  3P50 A;  2YKS A;  2WB5 A;  1MIW A;  3HR0 A;  2FUP A;  4WNK A;  4EB6 E;  2FJB A;  3P4W A;  1KFY A;  5FP3 A;  4ZI2 C;  1CUN A;  1U5P A;  2FJD A;  3RIF A;  1HR0 T;  4HFI A;  3CK6 A;  2CHN A;  3JAE A;  4AKR B;  4EAH A;  3ONL C;  3RRC A;  4HWC A;  3S4U A;  5AQI B;  2KND A;  3PUW F;  3JC6 D;  2BS4 A;  4UR9 A;  5FXX A;  2LKG A;  3JAF A;  5L3C B;  5AQU B;  4UEM A;  1HF8 A;  1FMW A;  2Y6X A;  4P0B A;  5LG4 A;  3K1S A;  3QNU A;  4LF9 T;  4JI4 T;  4JI6 T;  3AAE B;  5LJM A;  3RC8 A;  1US7 B;  4I4T E;  2WMN A;  4KHZ F;  3W15 B;  3C50 A;  1MMG A;  4JI3 T;  2CPT A;  5LMU T;  1OED A;  2CHO A;  3QB5 K;  4DV2 T;  4B3R T;  4ZS3 A;  1AJ3 A;  5JTG A;  2UXD T;  1E2A A;  2KMF A;  1YXR A;  2W61 A;  4TV8 E;  3I9W A;  3VKH A;  2EHO C;  2Q9Q A;  4GKJ T;  1LRZ A;  2CRB A;  5LHG B;  2NTX A;  2ODV A;  3VR8 A;  3LK3 B;  4EZH A;  5C8Y E;  4HFB A;  2VQE T;  2V5C A;  3NZP A;  3B57 A;  3AE1 A;  4CN4 A;  5JDH A;  5LHI B;  4DR1 T;  1FIO A;  2PBI A;  2D0T A;  3CIR A;  4YSY A;  4A5X A;  4B3S T;  3LSV A;  2CMR A;  4KI0 F;  2LSI A;  4OHF A;  2P9B A;  1LKX A;  2XQY A;  4PNI A;  2VKJ A;  5JH7 E;  3Q5X A;  4H9Q C;  5FKY A;  5HXR A;  2BKN A;  2Z6E A;  2E9X D;  2XSA A;  2X51 A;  4TZ4 C;  3H3A A;  2V26 A;  4IT4 A;  2V5D A;  4HKA A;  4YT0 A;  3E22 E;  3ZKR A;  3OBV E;  5HEO A;  4QH4 A;  2MAW A;  5AQF B;  1WFD A;  3UQ4 A;  1IZN B;  2J1D G;  4UF0 A;  3MKD A;  4PJL A;  4BA9 A;  3MXZ A;  4NIQ A;  2V1D B;  2RA1 A;  2X9H A;  3ZT7 A;  3AXJ A;  2DNX A;  4OFZ A;  1UUS A;  3UTK A;  2IDO B;  4I43 B;  3AA1 B;  5JDN A;  2ZM0 A;  1G73 A;  4PFO A;  4E7S A;  5AQK B;  3CWZ B;  3Q9D A;  4ZHQ E;  5CA0 E;  4C91 A;  4IL9 A;  2KXP B;  2QGS A;  5EZY E;  4KX6 A;  3BQL A;  2RPA A;  2K48 A;  3BK9 A;  4X1I E;  2WM9 A;  4LF7 T;  3K3N A;  3RKO A;  2L3L A;  3F2E A;  2SPC A;  2I0M A;  4ADZ A;  2JJ9 A;  3A8Y C;  3PUS A;  3AXJ B;  5AQN B;  1ZKE A;  3ZCI A;  4O4L E;  3N9M A;  1D1C A;  3TLU A;  4IE5 A;  5TAO A;  3V5U A;  1SHZ C;  1OED E;  2WSS V;  4JI0 T;  3P4S A;  2WY2 A;  3C4X A;  3UU8 A;  4OYK A;  5JRE A;  5HYA A;  2V6Y A;  2VAS A;  1IJ5 A;  2B76 A;  2C5K T;  3PUZ F;  4HFH A;  2I59 A;  2ACX A;  2VKD A;  2ZM2 A;  5E0O A;  3RHW A;  1HX8 A;  3HA4 A;  4MBQ A;  5AQV B;  2UXC T;  3O4X E;  4EYU A;  2WU2 A;  3GN5 A;  3RQU A;  2LLY A;  2XQ5 A;  3VR9 A;  4HE8 A;  4UVA B;  1ZP0 A;  3OTO T;  2OV9 A;  3PUV F;  4H9R C;  4YTP A;  5JDG A;  3V5S A;  2CWY A;  2VVS A;  2BVL A;  3E08 A;  3UUL A;  3CX8 B;  2XAF B;  5FXW A;  2V8S V;  3A7M A;  2E2A A;  2VVN A;  3IEE A;  5FY0 A;  2IC6 A;  5HXS A;  5LG3 A;  4JLE A;  2H89 A;  2N1G A;  1XDP A;  1E1H B;  4DID B;  4ZZB A;  5IWA T;  1OED B;  1XDO A;  1BR4 A;  1NAF A;  2DI4 A;  2H7V C;  2MTQ A;  2H88 A;  2QA7 A;  3L09 A;  2K5B B;  3RIU A;  3ZMZ B;  3VRB A;  4LF4 T;  2LT3 A;  4JV5 T;  3D0T A;  2IHR 1;  3ONX A;  3P7I A;  3FBL A;  2DCF A;  3ETV A;  5L3B B;  3FBZ A;  2XQA A;  3MZK B;  5L4H A;  3UT5 E;  2ODU A;  2WMO A;  3N5L A;  3Q5W A;  1X79 A;  4TWH A;  4HN9 A;  2X0Y A;  4AXP A;  3Q5D A;  1HFA A;  4AQY T;  4X62 T;  4PW8 A;  5KDM C;  4DR4 T;  2BS3 A;  2LE8 A;  4PFP A;  4CI2 B;  1W0B A;  2E9X C;  4COF A;  5HXE A;  4DUY T;  4DV4 T;  4ASK A;  3L39 A;  4G2A A;  4IE7 A;  5IHY A;  1ZHC A;  2YEV C;  4CI1 B;  4IE4 A;  4H9P C;  4DV5 T;  4GK5 E;  5L3G B;  2M67 A;  1MIV A;  2HPJ A;  3EI0 A;  4XAX B;  5HEH A;  1KK7 A;  2X9Y A;  5HWY A;  5JDF A;  3TKL B;  2X9W A;  1T8B A;  4U33 A;  5EK2 A;  1BR1 A;  2VUR A;  4I50 E;  3VKG A;  2FJA A;  2Q9Q D;  1IAP A;  1NEK A;  5FL0 A;  5H6Q B;  3C98 B;  2LEH A;  3AEC A;  4UF0 B;  2KLQ A;  5CJ5 A;  4FI5 A;  4DO0 A;  4X64 T;  3SRZ A;  1J1J A;  2A72 A;  2YU2 A;  4QXB B;  4HFD A;  4ZEY A;  3PUR A;  4AI6 A;  2HH7 A;  4L5G A;  1O3X A;  4DMV A;  1D0X A;  2EHO D;  3B13 A;  2OLT A;  3O9X A;  3PUG A;  2XTL A;  2CA5 A;  5CA1 E;  1KEY A;  4DUZ T;  2KSR A;  3VRA A;  4P0A A;  4DV0 T;  2UXX B;  5ABE A;  4AKI A;  1OED C;  3RRW A;  1WLX A;  1S35 A;  4HTE A;  3ZLI A;  1W9R A;  3NRX A;  2YU1 A;  4XZC A;  2NW7 A;  1R8I A;  3G06 A;  5ABH A;  3WAK A;  2DWG A;  4U3C A;  3FZM B;  2W63 A;  1LVK A; 
#chains in the Genus database with same CATH homology
 4KHP T;  1IBM T;  1XNR T;  4LF5 T;  2UXB T;  2F4V T;  4DV3 T;  4LF8 T;  4LF7 T;  4K0K T;  1XNQ T;  4JI5 T;  1N34 T;  1I94 T;  4X66 T;  3T1H T;  4B3M T;  1J5E T;  4YY3 T;  4LFA T;  4JI0 T;  2E5L T;  4LF6 T;  4LFB T;  1FJG T;  2VQF T;  4DV1 T;  4JI2 T;  2ZM6 T;  5LMN T;  2UXC T;  2UUB T;  3OTO T;  4OX9 T;  5BR8 T;  1N36 T;  4JI7 T;  4YHH T;  2UU9 T;  4JI8 T;  4NXN T;  5IWA T;  4NXM T;  2HHH T;  4DR3 T;  4JV5 T;  1N32 T;  4LF4 T;  2UUC T;  1XMO T;  4DR5 T;  4X65 T;  2UUA T;  1N33 T;  1HR0 T;  1XMQ T;  4DR7 T;  4AQY T;  4X62 T;  4DR4 T;  4DR6 T;  4DR2 T;  1HNW T;  1IBK T;  4DUY T;  4DV4 T;  4JYA T;  4LF9 T;  4DV5 T;  4JI4 T;  4JI6 T;  3T1Y T;  4JI3 T;  5LMU T;  4B3R T;  4DV2 T;  2UXD T;  4GKJ T;  4X64 T;  1HNX T;  4DV6 T;  4GKK T;  2VQE T;  4DUZ T;  4LFC T;  4DR1 T;  4B3S T;  4JI1 T;  4DV0 T;  4B3T T;  4DV7 T;  1HNZ T;  1IBL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...