4B3MT

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3mT00
4LF8T 1XNQT 4DUZT 4NXMT 2UUAT 4NXNT 1IBKT 2VQET 4DV3T 5LMUT 4DV0T 4B3TT 4DV4T 2VQFT 2UXDT 1HNXT 1IBLT 3T1YT 5IWAT 1IBMT 5BR8T 4K0KT 2UU9T 2UUCT 4DV1T 3T1HT 4GKKT 4KHPT 4DV7T 4LFBT 4AQYT 4JI1T 4JI0T 1N32T 4JI2T 4DUYT 1N36T 2HHHT 4YY3T 5LMNT 4JI4T 2UXBT 4B3RT 1HR0T 4JI7T 4JV5T 4DR5T 4DR7T 4DR4T 4YHHT 4LF6T 4DV5T 4X62T 4LF4T 4JYAT 4X64T 4DR2T 4LF9T 4JI6T 2E5LT 2F4VT 4X66T 1HNZT 2UXCT 4DR3T 4JI3T 4JI8T 1XMQT 1FJGT 1HNWT 4B3MT 4OX9T 4LFCT 2ZM6T 4GKJT 4LF7T 4JI5T 4LFAT 4B3ST 4DR1T 1XMOT 2UUBT 4X65T 1N34T 1I94T 1J5ET 1XNRT 4DV2T 3OTOT 4LF5T 4DV6T 1N33T 4DR6T
chains in the Genus database with same CATH superfamily
4ZS2A 5JDHA 2X0LB 4IDOA 4K0UA 1XNQT 2ZM2A 3NRXA 3OPCA 3RGLA 2QVAA 2WZIA 1CHUA 2PG8A 2H88A 1MMNA 3IHRA 3RIUC 4CXWA 5CFBA 4YTNA 4IE5A 2OLTA 4C91A 2GK9A 2XUEA 4NUVA 1IBKT 2LHNA 4GK0E 4X1IE 4DNDA 4P0AA 1KK7A 4DV4T 4IGUA 1ZOYA 2E9XA 2LHRA 2WU2A 1YW0A 3VRBA 3WAJA 3T1YT 3RRCA 2DLRA 2H3RA 4UVCB 5IWAT 1OEDB 2H89A 2NWBA 4JEUB 4ZZCA 5LHIB 5BR8T 1LKXA 2IMLA 4A5XA 2LSJA 3KV9A 4AQGA 3C98B 4K0KT 3MZKB 3RPUA 4AIUA 2CXFA 3ZMVB 1LVFA 2E9XD 5JRCA 5H6QB 3F2EA 4PK4A 2WB5A 3LBXA 2MAWA 4QKNA 3E0ZA 5AQIB 3T8OA 3SRZA 3KVBA 2C5IT 3ZPOA 2WU5A 3K3QC 4C90A 1BR4A 3JAEA 3G06A 4L5GA 3M65A 2DNXA 3NZQA 3I0OA 5FL0A 5F5WA 5ABGA 3ZJ2A 2LRKA 4DV1T 2XSBA 3BQIA 1HNWT 2CWOA 3ZEFB 4M1PA 2LE8A 4TNVA 4CXYA 3MXZA 5LHHB 5LCYA 3AE8A 3UUMA 4YJ3E 2JQKA 3RQUA 3PUXF 2OV9A 3ETUA 2SPCA 4IDNA 1MIYA 5AQKB 4JI2T 5AQGB 5EK2A 5LGTB 1UURA 2IHR1 5FY7A 5M4YA 2V7LA 5LGNB 3RRWA 3NWIA 4JI4T 2C5KT 4JI7T 2X0HA 4ZS3A 3CVRA 3AECA 2BZBA 2W2UA 3V5SA 2CEAA 4DR7T 1R8IA 2CXLA 1UUSA 3AE6A 4P1NA 5FP3A 3I1AA 3IA3A 2Q9QB 5L3FB 1FMVA 3TLSA 5HXEA 1WYBA 2VASA 2WDRA 2D0TA 2X9HA 2Y8DA 3KBUA 4FI5A 4KI0F 5GONE 5LBMA 5L3GB 4ILBA 2XY8B 5AQOB 3JC6D 2FUPA 2IAKA 4V1Av 2BBJA 2JPFA 5J1GA 5AQNB 3J7Yq 3QUJA 1ZV4X 1AJ3A 3I9WA 4OFZA 5AQJB 3H37A 1E2AA 1U4QA 3UULA 1HFAA 3JADA 3VHLA 4JI6T 2CLYC 2VVSA 3I9YA 5KDMC 2BS3A 3L39A 1Z8UA 2CM0A 3LJCA 3NZPA 3Q5EA 4QXBB 2VKJA 1WCRA 4WNKA 5LJMA 3S4UA 2UXCT 2XASB 4YXDA 4PFPA 4DO0A 2WWUA 3LDQB 3U3IA 2FJAA 3N2GE 4LMLA 2HH7A 4B6XA 2CBIA 5AQFB 5LYJE 2BDEA 5J0ZA 4IE4A 4IIJE 2VURA 5HEUA 1JNRA 2UXXB 3RQWA 3FZFB 3ZT6A 3C51A 1DU2A 2Q9QA 4HWIB 5L3EB 2D0UA 3RC8A 5KXJA 3C4WA 3AEFA 1FEWA 3W15B 1VRBA 4GYRA 3AEGA 3EAMA 3KV5A 3LFMA 4MLKA 4TWDA 3B57A 2BS4A 4CQIA 2V1DB 2K9AA 3CX7B 3KV4A 4JLEA 3LG7A 3ZCJA 2CLYB 2DWKA 2IUBA 4CXXA 5LP6E 1XMOT 2BS2A 3UTKA 2DL1A 2ZLYA 4X65T 3OVUA 1WR0A 2A3DA 3FXEB 3M3ZB 5LG3A 1US7B 3PU3A 1J5ET 3D0TA 1NAFA 2WZHA 2K48A 2A72A 4IE0A 3NKZA 3OTOT 3QC9A 3HKCE 3AA0B 1N33T 4YSXA 2VL0A 3UU6A 2JQ9A 5JTGA 4UV8B 5L3CB 2IC6A 3PUAA 5EK3A 4IDQA 3UUNA 4YTMA 3HL6A 5LXTE 2ACZA 2PFVA 4WBOA 3KVAA 4WZXA 4X1YE 1EZ3A 5JH7E 2C5JA 4ILCA 3PUZF 4I4TE 5LBQB 3RC3A 3EDUA 3QOFA 4DMWA 3RKGA 3LBXB 2VQET 2E2AA 4U72A 4DV3T 2XQ3A 1XWMA 3AE3A 3MJXA 3TLTA 3VR8A 2XM2A 4TNWA 2NTXA 5EK4A 5AQPB 3UUBA 3P50A 4KMCA 2IIUA 3FZKB 2WQYA 4KP3C 4U74A 4H9OC 4IL4A 5DQVA 2E8IA 3JCFA 3X1DA 5HXHA 1IBLT 1OEDA 2ZM0A 2EHOD 2WBLA 3AA1B 4O8SA 3RI5A 3A7MA 5JDMA 1IBMT 1KNZA 3B5MA 2ODVA 3K3OA 4IE7A 4QHOA 3Q9DA 2WCAA 2QA7A 3FZMB 1MMGA 1SA0E 2UU9T 2NW7A 3CMLA 3AE5A 3CQCB 1IJ6A 5HEOA 1M62A 2LOSA 4E7SA 2CPTA 3EABA 4QXCB 3K1SA 2W61A 2QYWA 5AQLB 1UX5A 5AQSB 5C8YE 4AKRB 4PJLA 1X9BA 3RLFF 4H63H 3V5UA 4GKKT 4UELA 2XAHB 1MNEA 2XAJB 2CE7A 2V7JA 3HKEE 4QH5A 2K24A 4TV9E 1HTJF 2Y48B 3B13A 4DV7T 2M67A 4AQFC 1V9DA 5DQWA 4YJ2E 5JREA 4B3MT 2XSAA 4IL9A 4XAXB 4CI1B 1N32T 2X67A 2YINA 2ZMAA 2E5VA 3EHZA 4DUYT 4HKAA 2AXDS 4NUUA 3ZSSA 2Z6EA 2HHHT 5L4HA 3RYIE 5L3DB 4YY3T 3P4RA 2OA5A 1VOMA 4PFOA 2Q9QC 5LMNT 2UXBT 5HXSA 3FXDB 4UF0A 2WWVA 3RYFE 3SWHA 4IREA 4N78D 4DR5T 4X20E 1UK5A 2EHOB 4HGAA 2IW5B 2KWIB 3CPZA 4AKLA 1YXRA 3ZSTA 2JMKA 4LF6T 3AVSA 3O4XE 4YSZA 1BR0A 3ONLC 5C2TA 3L8RA 5IYZE 4X62T 4DV5T 4NPPA 1YQ4A 2K3WA 2YDSA 4AXPA 5AFUL 5CGMA 3PU8A 1W9RA 5JR9C 4U7YA 1T98A 2KLQA 3Q5DA 4GIWA 4QX8B 2PBIA 1S94A 4XZCA 2W62A 2M6BA 4LMJA 3O1IA 4JYAT 4X64T 3FHNA 4I55E 5JVDE 3ONXA 4HFDA 3C4XA 3IEEA 3RX6A 4LF9T 2BKNA 2N2NA 4U3CA 2M6IA 1VCTA 4LMKA 2YU1A 3A8YC 4EGWA 4ZZBA 1G8XA 3P8CD 5LHGB 5JDLA 5FYMA 3O1JA 2F4VT 2XJ7A 1FMWA 5FKYA 4P0BA 4ZI7E 2PJQA 5H6RB 1WLXA 4JI3T 2WS3A 3CX6B 5JRCB 3FBLA 3BQKA 5KX5E 3PJAJ 3PURA 3E08A 2KMFA 5JR9A 3PTRB 4O2AE 3ZMSB 3ANWA 4YTPA 2RA1A 4HFIA 3NVOA 4TV8E 2FJEA 3ZMUB 2LKHA 2R6GF 2JQQA 3VKGA 3KDSE 2CWYA 5IHYA 4OHFA 4PNIA 5AQQB 2XAFB 5FXZA 4LFCT 3AE9A 2ZM6T 1OEDC 2V7IA 1UCUA 2XZEA 3DJBA 4LF7T 2LSGA 1WYCA 2XQAA 5HEHA 1MNDA 3AE2A 3C64A 4NIQA 2V26A 4U7IA 2DI4A 1XDOA 4B3ST 3KFWX 1LRZA 2X51A 3GA8A 5LGUB 5FXVA 5FY0A 3SOLA 5CA1E 3H3AA 2WMOA 5J2TE 1KNRA 1D1AA 2V8SV 1YQ3A 3L09A 3TLVA 2FJDA 3GWHA 1G73A 4IDPA 2YOEA 2E9XC 2I59A 4OYJA 4DV2T 2W67A 5ABFA 4G63A 4O4LE 4Z90A 2XQYA 2HN2A 3AE4A 4LF5T 2XM1A 1JNZA 1YKEB 3Q2MA 4DV6T 3ZMTB 1QSDA 4GK5E 4PAGA 1T8BA 1D0XA 1MIWA 1T7SA 2NW8A 2HPLA 1W0AA 2DWGA 2KXPB 3KV6A 4TUYE 4DUZT 3F57A 3RYHE 5LNKA 2I6HA 4O4HE 4NXMT 2XQ6A 1KFYA 2FJBA 4WYVA 2N1GA 4JUYA 2W00A 4CI3B 4I50E 4UV9B 3A5XA 3GN5A 3ZYKA 4U33A 5BMVE 2Y6XA 1BR1A 4MFRA 1NWMX 5LMUT 4DV0T 3BQLA 3VRAA 2DHRA 2VVNA 3AXJA 4OK0A 4COFA 4ZI2D 3K3NA 2VQFT 4PJJA 1HNXT 4IDZA 4ANJA 2UXDT 3N9QA 3J9X1 2V6YB 3RIFA 4CN4A 4ZOLE 2BBHA 3JC6C 2KT9A 3KINB 4HN9A 1OXZA 2LEHA 4HTEA 3UQ4A 3UU3A 4PK6A 1HF8A 3ZC0A 3AEEA 1W0BA 4HWCA 2J4GA 4HFEA 1KEYA 3ESLA 5DABA 1FIOA 1D1CA 3AA6B 2HN1A 3GN5B 3N9OA 5AQHB 4EAHA 5L4EA 2VKDA 3GMIA 4H9NC 2UUCT 3ANWB 2V6XA 1ZKEA 4I0UA 4MHCA 4QXHB 3FZHB 3VU7H 1S35A 1HX1B 3NRYA 4PW8A 5ABHA 3LK3B 1KNPA 5JDQA 2W66A 2XPKA 4KHPT 3K8PC 3EVYA 4LFBT 4KUMB 1LVKA 2KINB 4H9PC 4ZI3C 1Z0PA 4AQYT 3NBXX 1UGOA 4JI1T 1U5PA 4JBWF 2FBWA 5J2UE 1WR6A 3UFGA 2VKOA 2BG9A 3AAEB 1N36T 1H7CA 1NEKA 5AQMB 4O4IE 1HX8A 2LKGA 1IZNB 2CRBA 4JEHB 3RHWA 5AQVB 3OJAA 5FNVE 4ADZA 1HR0T 2V7MA 4Q25A 2WSSV 4JV5T 5ABFB 1IJ5A 5FY1A 5HEGA 4ZEYA 3ABVA 1CUNA 3P4PA 4Z91A 4DR4T 4TN7B 5HAXA 3RYCE 2B1EA 1MMAA 1MIVA 4HWFA 3H3MA 3P4WA 2LLYA 4EEDA 5E0OA 4DBRA 5L47A 2J62A 3PE0A 2VB6A 4GOUA 4AQFA 4BJMA 5ADXL 3PUGA 2WP9A 2BVLA 2VL8A 4TZ4C 3ZCIA 4AKIA 4H63V 1J1JA 2XQ9A 5HXRA 1SE7A 3PDYA 2NTYA 3CKDA 4ISTA 4TWFA 4F8HA 5A1LA 3EI0A 4F6RC 3AE1A 1FJGT 4H9SE 2H7OA 3N2OA 3HR0A 4EOZB 5JQGE 2BG9B 5FXXA 4PJNA 1VCSA 2BG9E 3EUHA 3CWZB 4X1KE 2V7KA 3ZN1B 3AEAA 5LG4A 2QRXA 1YKHB 1W09A 4GYSA 4IE6A 3RKOA 1HNZT 4HFCA 1WRDA 1I6ZA 2LSKA 3N9NA 3O1HA 4KHZF 4O4JE 5JDFA 1HCIA 5TAOA 4A97A 2BKOA 4L9IA 3HKBE 4ASKA 2JMHA 1XMQT 2XQ8A 1GQEA 4JI8T 2G0UA 2JRKA 4UVBB 4UEMA 3QB5K 2NP9A 4EEBA 2LJLA 3UFEA 4EB6E 2V6YA 2XQ5A 5EZYE 4X5TA 4BAYB 3VKHA 5FL1A 1X79A 2ES0A 4EXTA 3ZJ1A 3LK42 3MA9A 3OYXA 2VK9A 2LSIA 3O9XA 4GKJT 3JAFA 4DBQA 4JI5T 3P4SA 4LFAT 3BK9A 5AQRB 4ZI3D 3PUWF 2WDVA 3CQGB 5F8PA 5HWYA 4WBNE 4AKHA 3ONJA 2RPAA 5FXWA 4ILAA 3U78A 4YFSA 1N34T 4MALA 2VKHA 1HG2A 2UXNB 4EZ4A 3PUYF 3C4ZA 3E22E 1XNRT 3AE7A 4QH1A 2KNDA 2K5BB 2KWHA 2MTQA 2D9DA 3RIAA 2PTFA 1HS7A 5LB7B 3TLWA 2X0YA 3LSVA 4MBQA 1E7PA 2X9YA 2WY2A 3LK2B 1IAPA 4ILUA 3UT5E 2KZ7B 4DR6T 2MYSA 2D2SA 3QNUA 4LF8T 3PUQA 3ZC1A 5CB4E 3N2KE 2LM9A 2JQHA 2WAUA 2YDQA 4H9RC 5CJ5A 4PK5A 3QK6A 4IHJE 2L3LA 2UUAT 2NOXA 3DP7A 3CQXC 4UVAB 2MPKA 4NXNT 4HEAA 2MBGA 4ZI2C 5DJQC 3PV0F 5L3BB 3VR9A 2BKPA 4B3TT 1D0YA 1ZP0A 2YN6A 3MK7C 3TLUA 1SHZC 3P7IA 3DTOA 4O2BE 4EV6A 1OEDE 2WDQA 4YHJA 4HFVA 1XZYA 4EIWA 4ISSA 3AA7B 4UR9A 2BVMA 2VWAA 3N5LA 4HFHA 4U31A 3UU4A 5IUXA 3AXJB 4HE8A 5JR9B 1ZEEA 2X9XA 5HCJA 4ZHQE 2LM2A 2CMRA 2DCFA 2XAQB 3OKQA 3R6NA 1QUUA 3RIUA 4EYUA 3TKLB 2CCQA 2LT3A 2WM9A 4IT4A 2C0SA 3AAAB 3FB2A 2LSYA 3UU5A 2ZM8A 4TX5A 1UX4A 2WMNA 1KF6A 2P9BA 1L0VA 4ERRA 1Y01A 3SFDA 2XQ4A 3C50A 3AVRA 4HWHA 4PJMA 3SS1A 4DMVA 3T1HT 2J47A 1WFDA 4H9QC 2YDRA 2V5DA 3ZYMA 2A9UA 4EYYR 1M7KA 2CHOA 2ODUA 4QX7B 5HCMA 3SFEA 2J1DG 2YU2A 4JI0T 3CX8B 2CA5A 3KBTA 4YT0A 5JDNA 4G2AA 5KMGP 5CA0E 3FZLB 1B7TA 5ABEA 1HG5A 2AE9A 2ACXA 2RP4A 2W4XA 4U2YA 2I0MA 3OBVE 4B3RT 4P09A 4HFBA 3FBZA 2L9QA 5F3JA 2CXDA 2JIWA 2LRLA 4CI2B 4YSYA 5LJNA 5FMNA 4DVDA 3QB5A 4UF0B 3ETVA 2X66A 4YHHT 4KBMB 2NW9A 4AISA 3WI3A 4E7ZA 4AI6A 4BA9A 1BR2A 2EHOA 1SUMB 1YD8G 2X9WA 4UXNB 4LF4T 3ZMZB 2HPJA 2L8KA 2XTLA 1J5WA 2EHOC 1ZHCA 3HKDE 5AQTB 5LOVE 4FJOA 4CZZB 3IBPA 5HXCA 5C3JA 2JJ9A 3RF1A 3N9MA 3PJAA 4U2ZA 4A56A 4DR2T 3N9PA 3ZKRA 4I43B 4DIDB 2CHNA 3R84B 2N9DA 3RH3A 2W63A 4OYKA 3UU8A 5HWXA 3HI2A 3AAIA 1XDPA 2XQ7A 3P4QA 1O3XA 2XAGB 2E5LT 4J2CA 5L2LA 3AEBA 1NENA 3MACA 3UUXB 3OYZA 4CN6A 4X66T 3ZYLA 4DR3T 3AEDA 2V5CA 4QWNB 3WAKA 3Q5XA 3MKDA 2MOZA 2LOPA 4HWDA 4TWHA 2W0GA 3EDVA 2IDOB 3PUSA 3CIRA 4ZXLA 4CN1A 4WW0A 3ZT7A 4OX9T 3Q5WA 4A98A 2KSRA 4QH4A 1D1BA 1QLBA 5ETWA 3N9LA 5FVLA 2H7VC 2X68A 5FVKA 3ZLIA 1D0ZA 2XHEB 3F31A 2QGSA 1Y64B 4L0RA 4YLHA 2Q9QD 3ZT5A 5HYAA 3L3PA 1T72A 2CBJA 2YK0A 5HEJA 4DR1T 2UUBT 1OWAA 2IC9A 5LA6E 1MMDA 3HA4A 2YEVC 2E9XB 4EZHA 4Z8XA 3PUVF 2D5UA 5AQUB 1I94T 4XBFB 3IF8B 4KX6A 2YKSA 3UQ7A 4AKGA 3ZN0B 1E1HB 3CK6A 2A2FX 5JDGA 3AB3B 2BG9C 4BJNA 4UIGA 3I0QA 2B76A 2NR4A
chains in the Genus database with same CATH topology
4LF8T 1XNQT 4DUZT 4NXMT 2UUAT 4NXNT 1IBKT 2VQET 4DV3T 5LMUT 4DV0T 4B3TT 4DV4T 2VQFT 2UXDT 1HNXT 1IBLT 3T1YT 5IWAT 1IBMT 5BR8T 4K0KT 2UU9T 2UUCT 4DV1T 3T1HT 4GKKT 4KHPT 4DV7T 4LFBT 4AQYT 4JI1T 4JI0T 1N32T 4JI2T 4DUYT 1N36T 2HHHT 4YY3T 5LMNT 4JI4T 2UXBT 4B3RT 1HR0T 4JI7T 4JV5T 4DR5T 4DR7T 4DR4T 4YHHT 4LF6T 4DV5T 4X62T 4LF4T 4JYAT 4X64T 4DR2T 4LF9T 4JI6T 2E5LT 2F4VT 4X66T 1HNZT 2UXCT 4DR3T 4JI3T 4JI8T 1XMQT 1FJGT 1HNWT 4B3MT 4OX9T 4LFCT 2ZM6T 4GKJT 4LF7T 4JI5T 4LFAT 4B3ST 4DR1T 1XMOT 2UUBT 4X65T 1N34T 1I94T 1J5ET 1XNRT 4DV2T 3OTOT 4LF5T 4DV6T 1N33T 4DR6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 T;  1XNQ T;  4DUZ T;  4NXM T;  2UUA T;  4NXN T;  1IBK T;  2VQE T;  4DV3 T;  5LMU T;  4DV0 T;  4B3T T;  4DV4 T;  2VQF T;  2UXD T;  1HNX T;  1IBL T;  3T1Y T;  5IWA T;  1IBM T;  5BR8 T;  4K0K T;  2UU9 T;  2UUC T;  4DV1 T;  3T1H T;  4GKK T;  4KHP T;  4DV7 T;  4LFB T;  4AQY T;  4JI1 T;  4JI0 T;  1N32 T;  4JI2 T;  4DUY T;  1N36 T;  2HHH T;  4YY3 T;  5LMN T;  4JI4 T;  2UXB T;  4B3R T;  1HR0 T;  4JI7 T;  4JV5 T;  4DR5 T;  4DR7 T;  4DR4 T;  4YHH T;  4LF6 T;  4DV5 T;  4X62 T;  4LF4 T;  4JYA T;  4X64 T;  4DR2 T;  4LF9 T;  4JI6 T;  2E5L T;  2F4V T;  4X66 T;  1HNZ T;  2UXC T;  4DR3 T;  4JI3 T;  4JI8 T;  1XMQ T;  1FJG T;  1HNW T;  4B3M T;  4OX9 T;  4LFC T;  2ZM6 T;  4GKJ T;  4LF7 T;  4JI5 T;  4LFA T;  4B3S T;  4DR1 T;  1XMO T;  2UUB T;  4X65 T;  1N34 T;  1I94 T;  1J5E T;  1XNR T;  4DV2 T;  3OTO T;  4LF5 T;  4DV6 T;  1N33 T;  4DR6 T; 
#chains in the Genus database with same CATH topology
 4ZS2 A;  5JDH A;  2X0L B;  4IDO A;  4K0U A;  1XNQ T;  2ZM2 A;  3NRX A;  3OPC A;  3RGL A;  2QVA A;  2WZI A;  1CHU A;  2PG8 A;  2H88 A;  1MMN A;  3IHR A;  3RIU C;  4CXW A;  5CFB A;  4YTN A;  4IE5 A;  2OLT A;  4C91 A;  2GK9 A;  2XUE A;  4NUV A;  1IBK T;  2LHN A;  4GK0 E;  4X1I E;  4DND A;  4P0A A;  1KK7 A;  4DV4 T;  4IGU A;  1ZOY A;  2E9X A;  2LHR A;  2WU2 A;  1YW0 A;  3VRB A;  3WAJ A;  3T1Y T;  3RRC A;  2DLR A;  2H3R A;  4UVC B;  5IWA T;  1OED B;  2H89 A;  2NWB A;  4JEU B;  4ZZC A;  5LHI B;  5BR8 T;  1LKX A;  2IML A;  4A5X A;  2LSJ A;  3KV9 A;  4AQG A;  3C98 B;  4K0K T;  3MZK B;  3RPU A;  4AIU A;  2CXF A;  3ZMV B;  1LVF A;  2E9X D;  5JRC A;  5H6Q B;  3F2E A;  4PK4 A;  2WB5 A;  3LBX A;  2MAW A;  4QKN A;  3E0Z A;  5AQI B;  3T8O A;  3SRZ A;  3KVB A;  2C5I T;  3ZPO A;  2WU5 A;  3K3Q C;  4C90 A;  1BR4 A;  3JAE A;  3G06 A;  4L5G A;  3M65 A;  2DNX A;  3NZQ A;  3I0O A;  5FL0 A;  5F5W A;  5ABG A;  3ZJ2 A;  2LRK A;  4DV1 T;  2XSB A;  3BQI A;  1HNW T;  2CWO A;  3ZEF B;  4M1P A;  2LE8 A;  4TNV A;  4CXY A;  3MXZ A;  5LHH B;  5LCY A;  3AE8 A;  3UUM A;  4YJ3 E;  2JQK A;  3RQU A;  3PUX F;  2OV9 A;  3ETU A;  2SPC A;  4IDN A;  1MIY A;  5AQK B;  4JI2 T;  5AQG B;  5EK2 A;  5LGT B;  1UUR A;  2IHR 1;  5FY7 A;  5M4Y A;  2V7L A;  5LGN B;  3RRW A;  3NWI A;  4JI4 T;  2C5K T;  4JI7 T;  2X0H A;  4ZS3 A;  3CVR A;  3AEC A;  2BZB A;  2W2U A;  3V5S A;  2CEA A;  4DR7 T;  1R8I A;  2CXL A;  1UUS A;  3AE6 A;  4P1N A;  5FP3 A;  3I1A A;  3IA3 A;  2Q9Q B;  5L3F B;  1FMV A;  3TLS A;  5HXE A;  1WYB A;  2VAS A;  2WDR A;  2D0T A;  2X9H A;  2Y8D A;  3KBU A;  4FI5 A;  4KI0 F;  5GON E;  5LBM A;  5L3G B;  4ILB A;  2XY8 B;  5AQO B;  3JC6 D;  2FUP A;  2IAK A;  4V1A v;  2BBJ A;  2JPF A;  5J1G A;  5AQN B;  3J7Y q;  3QUJ A;  1ZV4 X;  1AJ3 A;  3I9W A;  4OFZ A;  5AQJ B;  3H37 A;  1E2A A;  1U4Q A;  3UUL A;  1HFA A;  3JAD A;  3VHL A;  4JI6 T;  2CLY C;  2VVS A;  3I9Y A;  5KDM C;  2BS3 A;  3L39 A;  1Z8U A;  2CM0 A;  3LJC A;  3NZP A;  3Q5E A;  4QXB B;  2VKJ A;  1WCR A;  4WNK A;  5LJM A;  3S4U A;  2UXC T;  2XAS B;  4YXD A;  4PFP A;  4DO0 A;  2WWU A;  3LDQ B;  3U3I A;  2FJA A;  3N2G E;  4LML A;  2HH7 A;  4B6X A;  2CBI A;  5AQF B;  5LYJ E;  2BDE A;  5J0Z A;  4IE4 A;  4IIJ E;  2VUR A;  5HEU A;  1JNR A;  2UXX B;  3RQW A;  3FZF B;  3ZT6 A;  3C51 A;  1DU2 A;  2Q9Q A;  4HWI B;  5L3E B;  2D0U A;  3RC8 A;  5KXJ A;  3C4W A;  3AEF A;  1FEW A;  3W15 B;  1VRB A;  4GYR A;  3AEG A;  3EAM A;  3KV5 A;  3LFM A;  4MLK A;  4TWD A;  3B57 A;  2BS4 A;  4CQI A;  2V1D B;  2K9A A;  3CX7 B;  3KV4 A;  4JLE A;  3LG7 A;  3ZCJ A;  2CLY B;  2DWK A;  2IUB A;  4CXX A;  5LP6 E;  1XMO T;  2BS2 A;  3UTK A;  2DL1 A;  2ZLY A;  4X65 T;  3OVU A;  1WR0 A;  2A3D A;  3FXE B;  3M3Z B;  5LG3 A;  1US7 B;  3PU3 A;  1J5E T;  3D0T A;  1NAF A;  2WZH A;  2K48 A;  2A72 A;  4IE0 A;  3NKZ A;  3OTO T;  3QC9 A;  3HKC E;  3AA0 B;  1N33 T;  4YSX A;  2VL0 A;  3UU6 A;  2JQ9 A;  5JTG A;  4UV8 B;  5L3C B;  2IC6 A;  3PUA A;  5EK3 A;  4IDQ A;  3UUN A;  4YTM A;  3HL6 A;  5LXT E;  2ACZ A;  2PFV A;  4WBO A;  3KVA A;  4WZX A;  4X1Y E;  1EZ3 A;  5JH7 E;  2C5J A;  4ILC A;  3PUZ F;  4I4T E;  5LBQ B;  3RC3 A;  3EDU A;  3QOF A;  4DMW A;  3RKG A;  3LBX B;  2VQE T;  2E2A A;  4U72 A;  4DV3 T;  2XQ3 A;  1XWM A;  3AE3 A;  3MJX A;  3TLT A;  3VR8 A;  2XM2 A;  4TNW A;  2NTX A;  5EK4 A;  5AQP B;  3UUB A;  3P50 A;  4KMC A;  2IIU A;  3FZK B;  2WQY A;  4KP3 C;  4U74 A;  4H9O C;  4IL4 A;  5DQV A;  2E8I A;  3JCF A;  3X1D A;  5HXH A;  1IBL T;  1OED A;  2ZM0 A;  2EHO D;  2WBL A;  3AA1 B;  4O8S A;  3RI5 A;  3A7M A;  5JDM A;  1IBM T;  1KNZ A;  3B5M A;  2ODV A;  3K3O A;  4IE7 A;  4QHO A;  3Q9D A;  2WCA A;  2QA7 A;  3FZM B;  1MMG A;  1SA0 E;  2UU9 T;  2NW7 A;  3CML A;  3AE5 A;  3CQC B;  1IJ6 A;  5HEO A;  1M62 A;  2LOS A;  4E7S A;  2CPT A;  3EAB A;  4QXC B;  3K1S A;  2W61 A;  2QYW A;  5AQL B;  1UX5 A;  5AQS B;  5C8Y E;  4AKR B;  4PJL A;  1X9B A;  3RLF F;  4H63 H;  3V5U A;  4GKK T;  4UEL A;  2XAH B;  1MNE A;  2XAJ B;  2CE7 A;  2V7J A;  3HKE E;  4QH5 A;  2K24 A;  4TV9 E;  1HTJ F;  2Y48 B;  3B13 A;  4DV7 T;  2M67 A;  4AQF C;  1V9D A;  5DQW A;  4YJ2 E;  5JRE A;  4B3M T;  2XSA A;  4IL9 A;  4XAX B;  4CI1 B;  1N32 T;  2X67 A;  2YIN A;  2ZMA A;  2E5V A;  3EHZ A;  4DUY T;  4HKA A;  2AXD S;  4NUU A;  3ZSS A;  2Z6E A;  2HHH T;  5L4H A;  3RYI E;  5L3D B;  4YY3 T;  3P4R A;  2OA5 A;  1VOM A;  4PFO A;  2Q9Q C;  5LMN T;  2UXB T;  5HXS A;  3FXD B;  4UF0 A;  2WWV A;  3RYF E;  3SWH A;  4IRE A;  4N78 D;  4DR5 T;  4X20 E;  1UK5 A;  2EHO B;  4HGA A;  2IW5 B;  2KWI B;  3CPZ A;  4AKL A;  1YXR A;  3ZST A;  2JMK A;  4LF6 T;  3AVS A;  3O4X E;  4YSZ A;  1BR0 A;  3ONL C;  5C2T A;  3L8R A;  5IYZ E;  4X62 T;  4DV5 T;  4NPP A;  1YQ4 A;  2K3W A;  2YDS A;  4AXP A;  5AFU L;  5CGM A;  3PU8 A;  1W9R A;  5JR9 C;  4U7Y A;  1T98 A;  2KLQ A;  3Q5D A;  4GIW A;  4QX8 B;  2PBI A;  1S94 A;  4XZC A;  2W62 A;  2M6B A;  4LMJ A;  3O1I A;  4JYA T;  4X64 T;  3FHN A;  4I55 E;  5JVD E;  3ONX A;  4HFD A;  3C4X A;  3IEE A;  3RX6 A;  4LF9 T;  2BKN A;  2N2N A;  4U3C A;  2M6I A;  1VCT A;  4LMK A;  2YU1 A;  3A8Y C;  4EGW A;  4ZZB A;  1G8X A;  3P8C D;  5LHG B;  5JDL A;  5FYM A;  3O1J A;  2F4V T;  2XJ7 A;  1FMW A;  5FKY A;  4P0B A;  4ZI7 E;  2PJQ A;  5H6R B;  1WLX A;  4JI3 T;  2WS3 A;  3CX6 B;  5JRC B;  3FBL A;  3BQK A;  5KX5 E;  3PJA J;  3PUR A;  3E08 A;  2KMF A;  5JR9 A;  3PTR B;  4O2A E;  3ZMS B;  3ANW A;  4YTP A;  2RA1 A;  4HFI A;  3NVO A;  4TV8 E;  2FJE A;  3ZMU B;  2LKH A;  2R6G F;  2JQQ A;  3VKG A;  3KDS E;  2CWY A;  5IHY A;  4OHF A;  4PNI A;  5AQQ B;  2XAF B;  5FXZ A;  4LFC T;  3AE9 A;  2ZM6 T;  1OED C;  2V7I A;  1UCU A;  2XZE A;  3DJB A;  4LF7 T;  2LSG A;  1WYC A;  2XQA A;  5HEH A;  1MND A;  3AE2 A;  3C64 A;  4NIQ A;  2V26 A;  4U7I A;  2DI4 A;  1XDO A;  4B3S T;  3KFW X;  1LRZ A;  2X51 A;  3GA8 A;  5LGU B;  5FXV A;  5FY0 A;  3SOL A;  5CA1 E;  3H3A A;  2WMO A;  5J2T E;  1KNR A;  1D1A A;  2V8S V;  1YQ3 A;  3L09 A;  3TLV A;  2FJD A;  3GWH A;  1G73 A;  4IDP A;  2YOE A;  2E9X C;  2I59 A;  4OYJ A;  4DV2 T;  2W67 A;  5ABF A;  4G63 A;  4O4L E;  4Z90 A;  2XQY A;  2HN2 A;  3AE4 A;  4LF5 T;  2XM1 A;  1JNZ A;  1YKE B;  3Q2M A;  4DV6 T;  3ZMT B;  1QSD A;  4GK5 E;  4PAG A;  1T8B A;  1D0X A;  1MIW A;  1T7S A;  2NW8 A;  2HPL A;  1W0A A;  2DWG A;  2KXP B;  3KV6 A;  4TUY E;  4DUZ T;  3F57 A;  3RYH E;  5LNK A;  2I6H A;  4O4H E;  4NXM T;  2XQ6 A;  1KFY A;  2FJB A;  4WYV A;  2N1G A;  4JUY A;  2W00 A;  4CI3 B;  4I50 E;  4UV9 B;  3A5X A;  3GN5 A;  3ZYK A;  4U33 A;  5BMV E;  2Y6X A;  1BR1 A;  4MFR A;  1NWM X;  5LMU T;  4DV0 T;  3BQL A;  3VRA A;  2DHR A;  2VVN A;  3AXJ A;  4OK0 A;  4COF A;  4ZI2 D;  3K3N A;  2VQF T;  4PJJ A;  1HNX T;  4IDZ A;  4ANJ A;  2UXD T;  3N9Q A;  3J9X 1;  2V6Y B;  3RIF A;  4CN4 A;  4ZOL E;  2BBH A;  3JC6 C;  2KT9 A;  3KIN B;  4HN9 A;  1OXZ A;  2LEH A;  4HTE A;  3UQ4 A;  3UU3 A;  4PK6 A;  1HF8 A;  3ZC0 A;  3AEE A;  1W0B A;  4HWC A;  2J4G A;  4HFE A;  1KEY A;  3ESL A;  5DAB A;  1FIO A;  1D1C A;  3AA6 B;  2HN1 A;  3GN5 B;  3N9O A;  5AQH B;  4EAH A;  5L4E A;  2VKD A;  3GMI A;  4H9N C;  2UUC T;  3ANW B;  2V6X A;  1ZKE A;  4I0U A;  4MHC A;  4QXH B;  3FZH B;  3VU7 H;  1S35 A;  1HX1 B;  3NRY A;  4PW8 A;  5ABH A;  3LK3 B;  1KNP A;  5JDQ A;  2W66 A;  2XPK A;  4KHP T;  3K8P C;  3EVY A;  4LFB T;  4KUM B;  1LVK A;  2KIN B;  4H9P C;  4ZI3 C;  1Z0P A;  4AQY T;  3NBX X;  1UGO A;  4JI1 T;  1U5P A;  4JBW F;  2FBW A;  5J2U E;  1WR6 A;  3UFG A;  2VKO A;  2BG9 A;  3AAE B;  1N36 T;  1H7C A;  1NEK A;  5AQM B;  4O4I E;  1HX8 A;  2LKG A;  1IZN B;  2CRB A;  4JEH B;  3RHW A;  5AQV B;  3OJA A;  5FNV E;  4ADZ A;  1HR0 T;  2V7M A;  4Q25 A;  2WSS V;  4JV5 T;  5ABF B;  1IJ5 A;  5FY1 A;  5HEG A;  4ZEY A;  3ABV A;  1CUN A;  3P4P A;  4Z91 A;  4DR4 T;  4TN7 B;  5HAX A;  3RYC E;  2B1E A;  1MMA A;  1MIV A;  4HWF A;  3H3M A;  3P4W A;  2LLY A;  4EED A;  5E0O A;  4DBR A;  5L47 A;  2J62 A;  3PE0 A;  2VB6 A;  4GOU A;  4AQF A;  4BJM A;  5ADX L;  3PUG A;  2WP9 A;  2BVL A;  2VL8 A;  4TZ4 C;  3ZCI A;  4AKI A;  4H63 V;  1J1J A;  2XQ9 A;  5HXR A;  1SE7 A;  3PDY A;  2NTY A;  3CKD A;  4IST A;  4TWF A;  4F8H A;  5A1L A;  3EI0 A;  4F6R C;  3AE1 A;  1FJG T;  4H9S E;  2H7O A;  3N2O A;  3HR0 A;  4EOZ B;  5JQG E;  2BG9 B;  5FXX A;  4PJN A;  1VCS A;  2BG9 E;  3EUH A;  3CWZ B;  4X1K E;  2V7K A;  3ZN1 B;  3AEA A;  5LG4 A;  2QRX A;  1YKH B;  1W09 A;  4GYS A;  4IE6 A;  3RKO A;  1HNZ T;  4HFC A;  1WRD A;  1I6Z A;  2LSK A;  3N9N A;  3O1H A;  4KHZ F;  4O4J E;  5JDF A;  1HCI A;  5TAO A;  4A97 A;  2BKO A;  4L9I A;  3HKB E;  4ASK A;  2JMH A;  1XMQ T;  2XQ8 A;  1GQE A;  4JI8 T;  2G0U A;  2JRK A;  4UVB B;  4UEM A;  3QB5 K;  2NP9 A;  4EEB A;  2LJL A;  3UFE A;  4EB6 E;  2V6Y A;  2XQ5 A;  5EZY E;  4X5T A;  4BAY B;  3VKH A;  5FL1 A;  1X79 A;  2ES0 A;  4EXT A;  3ZJ1 A;  3LK4 2;  3MA9 A;  3OYX A;  2VK9 A;  2LSI A;  3O9X A;  4GKJ T;  3JAF A;  4DBQ A;  4JI5 T;  3P4S A;  4LFA T;  3BK9 A;  5AQR B;  4ZI3 D;  3PUW F;  2WDV A;  3CQG B;  5F8P A;  5HWY A;  4WBN E;  4AKH A;  3ONJ A;  2RPA A;  5FXW A;  4ILA A;  3U78 A;  4YFS A;  1N34 T;  4MAL A;  2VKH A;  1HG2 A;  2UXN B;  4EZ4 A;  3PUY F;  3C4Z A;  3E22 E;  1XNR T;  3AE7 A;  4QH1 A;  2KND A;  2K5B B;  2KWH A;  2MTQ A;  2D9D A;  3RIA A;  2PTF A;  1HS7 A;  5LB7 B;  3TLW A;  2X0Y A;  3LSV A;  4MBQ A;  1E7P A;  2X9Y A;  2WY2 A;  3LK2 B;  1IAP A;  4ILU A;  3UT5 E;  2KZ7 B;  4DR6 T;  2MYS A;  2D2S A;  3QNU A;  4LF8 T;  3PUQ A;  3ZC1 A;  5CB4 E;  3N2K E;  2LM9 A;  2JQH A;  2WAU A;  2YDQ A;  4H9R C;  5CJ5 A;  4PK5 A;  3QK6 A;  4IHJ E;  2L3L A;  2UUA T;  2NOX A;  3DP7 A;  3CQX C;  4UVA B;  2MPK A;  4NXN T;  4HEA A;  2MBG A;  4ZI2 C;  5DJQ C;  3PV0 F;  5L3B B;  3VR9 A;  2BKP A;  4B3T T;  1D0Y A;  1ZP0 A;  2YN6 A;  3MK7 C;  3TLU A;  1SHZ C;  3P7I A;  3DTO A;  4O2B E;  4EV6 A;  1OED E;  2WDQ A;  4YHJ A;  4HFV A;  1XZY A;  4EIW A;  4ISS A;  3AA7 B;  4UR9 A;  2BVM A;  2VWA A;  3N5L A;  4HFH A;  4U31 A;  3UU4 A;  5IUX A;  3AXJ B;  4HE8 A;  5JR9 B;  1ZEE A;  2X9X A;  5HCJ A;  4ZHQ E;  2LM2 A;  2CMR A;  2DCF A;  2XAQ B;  3OKQ A;  3R6N A;  1QUU A;  3RIU A;  4EYU A;  3TKL B;  2CCQ A;  2LT3 A;  2WM9 A;  4IT4 A;  2C0S A;  3AAA B;  3FB2 A;  2LSY A;  3UU5 A;  2ZM8 A;  4TX5 A;  1UX4 A;  2WMN A;  1KF6 A;  2P9B A;  1L0V A;  4ERR A;  1Y01 A;  3SFD A;  2XQ4 A;  3C50 A;  3AVR A;  4HWH A;  4PJM A;  3SS1 A;  4DMV A;  3T1H T;  2J47 A;  1WFD A;  4H9Q C;  2YDR A;  2V5D A;  3ZYM A;  2A9U A;  4EYY R;  1M7K A;  2CHO A;  2ODU A;  4QX7 B;  5HCM A;  3SFE A;  2J1D G;  2YU2 A;  4JI0 T;  3CX8 B;  2CA5 A;  3KBT A;  4YT0 A;  5JDN A;  4G2A A;  5KMG P;  5CA0 E;  3FZL B;  1B7T A;  5ABE A;  1HG5 A;  2AE9 A;  2ACX A;  2RP4 A;  2W4X A;  4U2Y A;  2I0M A;  3OBV E;  4B3R T;  4P09 A;  4HFB A;  3FBZ A;  2L9Q A;  5F3J A;  2CXD A;  2JIW A;  2LRL A;  4CI2 B;  4YSY A;  5LJN A;  5FMN A;  4DVD A;  3QB5 A;  4UF0 B;  3ETV A;  2X66 A;  4YHH T;  4KBM B;  2NW9 A;  4AIS A;  3WI3 A;  4E7Z A;  4AI6 A;  4BA9 A;  1BR2 A;  2EHO A;  1SUM B;  1YD8 G;  2X9W A;  4UXN B;  4LF4 T;  3ZMZ B;  2HPJ A;  2L8K A;  2XTL A;  1J5W A;  2EHO C;  1ZHC A;  3HKD E;  5AQT B;  5LOV E;  4FJO A;  4CZZ B;  3IBP A;  5HXC A;  5C3J A;  2JJ9 A;  3RF1 A;  3N9M A;  3PJA A;  4U2Z A;  4A56 A;  4DR2 T;  3N9P A;  3ZKR A;  4I43 B;  4DID B;  2CHN A;  3R84 B;  2N9D A;  3RH3 A;  2W63 A;  4OYK A;  3UU8 A;  5HWX A;  3HI2 A;  3AAI A;  1XDP A;  2XQ7 A;  3P4Q A;  1O3X A;  2XAG B;  2E5L T;  4J2C A;  5L2L A;  3AEB A;  1NEN A;  3MAC A;  3UUX B;  3OYZ A;  4CN6 A;  4X66 T;  3ZYL A;  4DR3 T;  3AED A;  2V5C A;  4QWN B;  3WAK A;  3Q5X A;  3MKD A;  2MOZ A;  2LOP A;  4HWD A;  4TWH A;  2W0G A;  3EDV A;  2IDO B;  3PUS A;  3CIR A;  4ZXL A;  4CN1 A;  4WW0 A;  3ZT7 A;  4OX9 T;  3Q5W A;  4A98 A;  2KSR A;  4QH4 A;  1D1B A;  1QLB A;  5ETW A;  3N9L A;  5FVL A;  2H7V C;  2X68 A;  5FVK A;  3ZLI A;  1D0Z A;  2XHE B;  3F31 A;  2QGS A;  1Y64 B;  4L0R A;  4YLH A;  2Q9Q D;  3ZT5 A;  5HYA A;  3L3P A;  1T72 A;  2CBJ A;  2YK0 A;  5HEJ A;  4DR1 T;  2UUB T;  1OWA A;  2IC9 A;  5LA6 E;  1MMD A;  3HA4 A;  2YEV C;  2E9X B;  4EZH A;  4Z8X A;  3PUV F;  2D5U A;  5AQU B;  1I94 T;  4XBF B;  3IF8 B;  4KX6 A;  2YKS A;  3UQ7 A;  4AKG A;  3ZN0 B;  1E1H B;  3CK6 A;  2A2F X;  5JDG A;  3AB3 B;  2BG9 C;  4BJN A;  4UIG A;  3I0Q A;  2B76 A;  2NR4 A; 
#chains in the Genus database with same CATH homology
 4LF8 T;  1XNQ T;  4DUZ T;  4NXM T;  2UUA T;  4NXN T;  1IBK T;  2VQE T;  4DV3 T;  5LMU T;  4DV0 T;  4B3T T;  4DV4 T;  2VQF T;  2UXD T;  1HNX T;  1IBL T;  3T1Y T;  5IWA T;  1IBM T;  5BR8 T;  4K0K T;  2UU9 T;  2UUC T;  4DV1 T;  3T1H T;  4GKK T;  4KHP T;  4DV7 T;  4LFB T;  4AQY T;  4JI1 T;  4JI0 T;  1N32 T;  4JI2 T;  4DUY T;  1N36 T;  2HHH T;  4YY3 T;  5LMN T;  4JI4 T;  2UXB T;  4B3R T;  1HR0 T;  4JI7 T;  4JV5 T;  4DR5 T;  4DR7 T;  4DR4 T;  4YHH T;  4LF6 T;  4DV5 T;  4X62 T;  4LF4 T;  4JYA T;  4X64 T;  4DR2 T;  4LF9 T;  4JI6 T;  2E5L T;  2F4V T;  4X66 T;  1HNZ T;  2UXC T;  4DR3 T;  4JI3 T;  4JI8 T;  1XMQ T;  1FJG T;  1HNW T;  4B3M T;  4OX9 T;  4LFC T;  2ZM6 T;  4GKJ T;  4LF7 T;  4JI5 T;  4LFA T;  4B3S T;  4DR1 T;  1XMO T;  2UUB T;  4X65 T;  1N34 T;  1I94 T;  1J5E T;  1XNR T;  4DV2 T;  3OTO T;  4LF5 T;  4DV6 T;  1N33 T;  4DR6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...