4B3MT

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3mT00
4X64T 4JI4T 1N36T 4DV7T 4X66T 1HNWT 4DR3T 2UXCT 4DV3T 1XNQT 4B3MT 4JI0T 4X62T 4DR6T 4DUZT 4LFAT 2UU9T 3T1HT 5IWAT 4DR4T 4DV2T 4DV0T 4JI3T 1XMOT 4LFBT 4K0KT 2HHHT 5LMNT 4JI1T 1XMQT 2UUBT 5BR8T 1HNZT 4LF6T 1HNXT 4YY3T 2UUAT 2VQET 4DV6T 4DR2T 4LFCT 1IBKT 1HR0T 4LF9T 1IBMT 2VQFT 4JI6T 4KHPT 4JI2T 1FJGT 4JYAT 2F4VT 4JI7T 4DR5T 4DV5T 4JV5T 4LF7T 1N34T 3T1YT 1J5ET 4JI8T 4DR7T 2ZM6T 4YHHT 4B3ST 4JI5T 4LF4T 4DV1T 4DV4T 4GKJT 1IBLT 4DUYT 4OX9T 4LF8T 4DR1T 1XNRT 4B3RT 1N32T 2E5LT 2UUCT 4LF5T 4NXNT 4NXMT 5LMUT 1I94T 2UXBT 4GKKT 1N33T 4X65T 4AQYT 3OTOT 4B3TT 2UXDT
chains in the Genus database with same CATH superfamily
3TLUA 2WWUA 1X79A 3ZPOA 5JDQA 3ZYMA 2V8SV 2CXDA 4TWFA 2WCAA 4TWDA 4CZZB 3RKOA 4IE4A 1IJ6A 5IWAT 2E9XC 5FNVE 4HWDA 3MJXA 4P1NA 3C50A 4LFBT 4K0KT 5GONE 4MHCA 4C90A 4X1IE 2E9XA 2WP9A 2MYSA 2VQET 1US7B 5HXEA 1QUUA 5LA6E 4YSXA 2GK9A 5HXHA 4JYAT 2LSKA 3HI2A 5JVDE 2RP4A 2JQ9A 3AE4A 2WU5A 3NRYA 4YSYA 4GKJT 1HTJF 3N9NA 4LF8T 2X51A 4P0AA 4KX6A 4B3RT 1UGOA 2V26A 5DABA 3KBUA 4JUYA 2NW7A 2QGSA 2VL0A 3CX8B 4PAGA 3PUWF 3ZEFB 5CJ5A 3UULA 3UQ4A 3I9YA 2E9XB 3O1HA 3EVYA 3RIAA 5JDGA 5HXRA 3AE9A 2YU1A 2YDRA 1YKHB 4ZZBA 3Q2MA 3ONXA 2W67A 3IF8B 2V6YA 5L3FB 4AI6A 2NP9A 2X0LB 4AKIA 1KK7A 1S94A 3UQ7A 2LJLA 3Q5WA 4KBMB 1IBMT 3K3NA 1BR1A 5LBMA 3PURA 3E08A 1CUNA 1V9DA 5HEHA 2X9HA 4EGWA 5KXJA 3LK2B 4CN4A 1IAPA 3RC3A 4QWNB 4U2YA 4UF0A 4KMCA 3V5SA 5FXZA 4JI8T 4QX8B 2B1EA 2ZM6T 5JDNA 2G0UA 2D5UA 2K5BB 2KINB 2XTLA 2VKDA 1WLXA 3ZC0A 5H6QB 4E7ZA 5AQVB 2OLTA 3TLVA 5F3JA 2KLQA 2HPLA 3EI0A 3UU6A 1XNRT 3UUXB 2VVNA 3UU4A 3MACA 1MMGA 4NXMT 4DMVA 2BS2A 2V7JA 3K3QC 5FVKA 4IHJE 2KSRA 5JDHA 5AFUL 4ZHQE 2V6YB 2L8KA 4F6RC 2BG9C 1YQ4A 3CK6A 4TNVA 1S35A 2YDQA 2UU9T 4YT0A 3VU7H 4WBNE 1MIWA 4J2CA 5TAOA 4DV2T 3ZKRA 4TV8E 4EYYR 3H3MA 4ASKA 2HHHT 2AE9A 3I1AA 5LCYA 4UF0B 5L3DB 1OEDC 2HN2A 5F8PA 2WS3A 3FXDB 3PTRB 4UV8B 2Y6XA 2VQFT 2V7LA 2YU2A 2UXXB 2VL8A 5HWXA 1G73A 1D0ZA 3T1YT 2X9WA 2J4GA 5LHGB 4JI5T 3BK9A 4H9PC 1KF6A 4Z90A 1LRZA 2VB6A 1U5PA 2W0GA 4WBOA 3AVRA 5J2UE 3R6NA 1OXZA 1KEYA 1B7TA 2C5IT 3PDYA 4CXWA 2UXDT 2ODVA 3U78A 1MIVA 5HXSA 1SUMB 2WY2A 3ETUA 3AE3A 3IA3A 4QKNA 2DLRA 3JC6C 4DR3T 2UXCT 1XNQT 3RH3A 4EOZB 2C5JA 2CRBA 3OVUA 4HWFA 3FZMB 3IHRA 1D0YA 4H63H 4IDOA 2XQ9A 4YTPA 3ZN0B 3ZSSA 3Q5EA 5KDMC 4A56A 1M7KA 1HNZT 1D1AA 4ANJA 4HWIB 4MALA 2HN1A 3HR0A 5JR9C 2BDEA 3JAFA 1IBKT 4HEAA 2VURA 4ZI3C 4UELA 4H9NC 3ZT7A 4KP3C 5JR9A 1XDOA 4DV5T 3QOFA 4IL9A 5AQRB 2EHOA 3ZLIA 3M3ZB 2ES0A 3N9MA 3KDSE 4AKLA 2XSBA 4U7YA 2V6XA 4YJ3E 3LK42 1T98A 3TLTA 3U3IA 4YFSA 2UUCT 2LLYA 2N9DA 4GKKT 2XPKA 3P8CD 3L8RA 1UX4A 4EXTA 4QH5A 3VR9A 1YD8G 2ZM8A 5L47A 4ZS3A 4H9SE 3EUHA 2YKSA 4GK5E 2V5CA 4UVAB 2IAKA 5ABHA 4DIDB 1W09A 4JI3T 5HEUA 2V7IA 4PFPA 3N9OA 4BA9A 2BBHA 5M4YA 4HFCA 2M67A 3PV0F 2W66A 5JR9B 2XAHB 1U4QA 2FBWA 2EHOB 3UUBA 4I4TE 4B6XA 5LOVE 2VKOA 2MAWA 3L09A 4IREA 5CFBA 2WWVA 2E5VA 2BS3A 2HH7A 3RC8A 5IHYA 2BZBA 5HCJA 4X5TA 4CI2B 3X1DA 2CXLA 4BJMA 3PUYF 4XAXB 1QSDA 2LRKA 2RPAA 3VRAA 1N34T 1H7CA 2CPTA 3RLFF 5AQHB 4ISTA 3LFMA 3SWHA 3ZT5A 4UR9A 4PFOA 4OYKA 3KV6A 3HA4A 4ZI2D 1T7SA 2VKHA 3NZPA 3UU8A 1N32T 3ZC1A 4NXNT 3QB5A 1FMVA 1E7PA 3C64A 2V1DB 1M62A 2CWOA 2CWYA 3N2GE 2FJBA 3HKDE 4AKHA 1L0VA 3AEEA 2XQ4A 2VWAA 4DUZT 1VOMA 4JLEA 1Z0PA 4IDQA 4GYSA 4LMJA 4FJOA 4COFA 3ZMVB 4X1YE 5FY7A 2JMHA 2BBJA 4DR2T 1XZYA 2MPKA 1WYCA 4H9RC 1WR6A 4PJNA 4JI7T 4Z8XA 2Q9QD 3P4PA 4HE8A 2XQ5A 1Z8UA 3JADA 3S4UA 2XAFB 2LSYA 2X9YA 2XQ3A 2DL1A 4IDPA 3Q5DA 3H3AA 5LG3A 2RA1A 3VKGA 4EV6A 1AJ3A 4PJMA 4YLHA 4WYVA 2CHNA 5E0OA 5FL0A 2E5LT 3N9PA 1ZHCA 3A5XA 1N33T 3AE6A 5L3EB 4MLKA 2DHRA 2PJQA 5JH7E 3BQIA 5FY0A 4X66T 3SRZA 4AISA 4TV9E 5AQPB 1NWMX 1FMWA 4I0UA 3O1IA 4P09A 4UVBB 5EK2A 5HEGA 4O2BE 3OYZA 5EK3A 4U2ZA 2YK0A 2QRXA 1WRDA 5AQSB 5LP6E 2FUPA 2XZEA 4HWCA 4UV9B 1HR0T 3AA1B 4V1Av 4A97A 3RIUA 4DR5T 3KV4A 1EZ3A 2CE7A 3PUGA 3HKEE 4TUYE 4OYJA 3D0TA 4EAHA 3LG7A 3AVSA 5LHIB 2CHOA 2KNDA 5DQWA 1CHUA 3Q9DA 2LE8A 5AQJB 4DR1T 4O8SA 3OJAA 3ZMZB 3SFDA 4QXCB 4C91A 4AXPA 3JAEA 5A1LA 4U74A 2LSIA 2KWHA 1X9BA 3N2OA 4H63V 3J7Yq 4XZCA 3ESLA 2WBLA 4I43B 3I9WA 2WSSV 4JI0T 4DR6T 4NPPA 4P0BA 3GWHA 3W15B 4HFHA 1NENA 3R84B 3WAJA 3PU8A 3ZCJA 2XASB 5L3BB 4EEBA 3AB3B 2I0MA 2CBIA 4CI1B 5KMGP 3F57A 3O1JA 2LSGA 3FZKB 4PJLA 4ILBA 2BS4A 3LSVA 5AQGB 2X68A 3ZMUB 2C0SA 4AIUA 2M6BA 3PUSA 1Y01A 4OHFA 3CX6B 2WDRA 4HN9A 1LVKA 3E0ZA 2MBGA 2ODUA 5L2LA 4DR7T 4PK6A 3CPZA 3P4WA 3NVOA 2ZLYA 2DI4A 5JDLA 3AA0B 4ZXLA 4AKGA 3AAIA 5LGNB 4EYUA 3I0OA 3F31A 3CIRA 1DU2A 3KFWX 2BVMA 4CQIA 3AAAB 3RRWA 4QX7B 1HS7A 1HNWT 2KT9A 2JPFA 5DQVA 3C51A 4PK4A 1HCIA 1JNZA 5AQLB 4U33A 2W00A 5FMNA 4ZI7E 4DV0T 3CQCB 3VHLA 2M6IA 4OFZA 3AE7A 5HYAA 5LNKA 3FB2A 5L3CB 2CBJA 2YDSA 4EZHA 2JRKA 4ISSA 2NW9A 3ZYKA 3EABA 3FBZA 4DBQA 2XQ6A 4U7IA 4O4HE 5L4HA 4IT4A 2ACZA 5JDMA 2DCFA 5ABGA 4G63A 4B3ST 4LF4T 3FZHB 2EHOC 3A7MA 4ILAA 2LHRA 4PNIA 4ZI2C 3AE5A 2J1DG 4HFDA 2XAJB 2A2FX 2WDQA 4LF5T 3IEEA 5AQFB 4U3CA 3MK7C 3HKCE 1VCTA 2PBIA 4L5GA 2WB5A 4B3TT 4CXYA 5LHHB 3N5LA 1D0XA 4GK0E 4X64T 3WI3A 4I50E 2CMRA 3LDQB 2CLYB 2NWBA 4DV3T 2IC9A 2H88A 4M1PA 2WZHA 4HWHA 2NTXA 4ADZA 3MKDA 3RYCE 1XMOT 5IYZE 3C4XA 2J62A 1KNRA 3UU5A 2UUBT 4YTNA 4AQFA 1ZP0A 3QNUA 1MNDA 2J47A 4JBWF 1UCUA 3L3PA 3CQXC 3OBVE 2R6GF 4CN6A 2XY8B 3SFEA 3B5MA 3L39A 4EIWA 4DO0A 2XHEB 4UIGA 3UT5E 5AQQB 2Q9QA 3RGLA 3HKBE 5ABFA 5C2TA 2LHNA 4XBFB 2JQKA 4DV1T 1T72A 5JREA 3KVBA 4ZZCA 4DV4T 2XAQB 5AQIB 5F5WA 2W2UA 3ZN1B 1HG5A 2IW5B 3JC6D 3RRCA 2QVAA 4DMWA 2K48A 3MA9A 1SE7A 4O4IE 2QA7A 2MTQA 2ACXA 3QC9A 3OTOT 3FBLA 4WZXA 3RPUA 3FZLB 5HWYA 3P7IA 1GQEA 1J1JA 3OKQA 4L0RA 4H9OC 1Y64B 2X9XA 2XQAA 3PJAJ 3RF1A 3CQGB 1T8BA 4IE0A 3HL6A 1LKXA 5LMNT 1MIYA 3KV5A 1ZKEA 4KHZF 3FHNA 1MMNA 4YXDA 4ZEYA 3NZQA 3QK6A 4NUVA 2Q9QB 1HX1B 5ABFB 2JQQA 3NKZA 3PJAA 4LF9T 1FJGT 2WAUA 1KFYA 2AXDS 2F4VT 3CX7B 3BQLA 3O9XA 5AQNB 3DP7A 3B57A 4DBRA 2IDOB 2FJDA 3N9QA 2L3LA 2H3RA 2L9QA 3ZCIA 4UXNB 2LM9A 4TZ4C 4DVDA 5IUXA 1UK5A 2XSAA 4YHHT 1NAFA 3JCFA 4X20E 2LEHA 4IL4A 3O4XE 2KXPB 5HEOA 5ETWA 3PU3A 5FY1A 3RQUA 5LYJE 1G8XA 4N78D 1HF8A 4ERRA 3WAKA 1I94T 3KVAA 3RYIE 3ZMSB 5EK4A 3AEBA 4IE6A 2VASA 2D0TA 4IE7A 1KNZA 2BKPA 2IIUA 4AKRB 4X62T 3AE8A 1MMDA 3P50A 3T1HT 3UFEA 2WDVA 5AQUB 3RX6A 3MZKB 3ZYLA 2X67A 1ZV4X 4EB6E 3PUVF 3ETVA 4KI0F 4TNWA 5LJNA 4LF6T 2PG8A 5LBQB 4YY3T 3MXZA 2VKJA 3NWIA 2XAGB 1W0AA 2HPJA 4JEUB 4LFCT 2CM0A 5LG4A 4L9IA 4U31A 3RI5A 4KHPT 4JI2T 3V5UA 1SHZC 2YN6A 2SPCA 5C8YE 1WCRA 3ONLC 5CA1E 3UFGA 4JV5T 1OWAA 2A3DA 3RHWA 2BKOA 2QYWA 1ZEEA 3CKDA 2YEVC 3RIUC 3I0QA 5JTGA 2UXNB 5AQOB 4KUMB 2ZM2A 3K8PC 3K1SA 3F2EA 5H6RB 2CEAA 4OX9T 2DNXA 2CXFA 2D2SA 1FEWA 2DWKA 2D9DA 1W9RA 5FL1A 3DTOA 5AQKB 3VR8A 2WZIA 2P9BA 5LMUT 1BR4A 2WM9A 2A9UA 2CCQA 2OA5A 5HCMA 5FVLA 5FYMA 5C3JA 3AECA 3G06A 1UURA 2E9XD 5KX5E 5LGTB 2FJEA 2XJ7A 2MOZA 1WR0A 3QB5K 5FP3A 4JI1T 3AEFA 1NEKA 5AQMB 5EZYE 3AE2A 3EDVA 5FKYA 2UUAT 2B76A 2LOPA 4ZOLE 4DV6T 2W4XA 3Q5XA 2N2NA 1SA0E 4Z91A 4JI6T 3UTKA 4O2AE 2JJ9A 1BR0A 1HFAA 2ZM0A 3PUQA 3VKHA 2WMNA 4BJNA 5HAXA 1E1HB 2H89A 2VK9A 2X0HA 2K3WA 1IBLT 3C98B 5JRCA 2Y8DA 3C4WA 2LT3A 4CN1A 1E2AA 3OPCA 2BG9A 5J0ZA 2UXBT 3PUZF 5FXVA 4QXHB 5LGUB 1VRBA 3LK3B 2Z6EA 4JEHB 2W62A 4B3MT 1HX8A 3RIFA 3EHZA 2C5KT 3LBXA 1D1CA 4LFAT 3A8YC 3N9LA 4I55E 3TLSA 2K24A 4X1KE 3AXJA 1YQ3A 2Y48B 4HFBA 2DWGA 1IJ5A 1OEDA 2XM1A 5CB4E 2KWIB 1QLBA 2XM2A 3ZJ2A 5HEJA 5AQTB 2K9AA 5L3GB 3FXEB 3SOLA 2BVLA 3AEGA 4GYRA 2WQYA 2CLYC 5CGMA 4HTEA 4ZS2A 5LB7B 4TX5A 3UUMA 2IC6A 3DJBA 3TLWA 2W63A 5JRCB 3UU3A 4U72A 5J1GA 5JQGE 2OV9A 1YXRA 4OK0A 2BG9B 1D1BA 4NUUA 3N2KE 2BG9E 3B13A 5CA0E 5LXTE 1O3XA 2IUBA 2H7OA 4ILUA 3AE1A 2JIWA 3PE0A 1VCSA 4E7SA 2E2AA 3LBXB 4IGUA 3TKLB 3RYFE 2X0YA 3P4RA 2XQ8A 4IDZA 4HFIA 3AXJB 2NOXA 3PUXF 1WYBA 1OEDB 1OEDE 2W61A 4JI4T 1N36T 4YJ2E 4H9QC 4IDNA 1R8IA 2ZMAA 3EDUA 3AA6B 2LOSA 4O4JE 4A98A 2A72A 4DR4T 1XDPA 4YTMA 4CI3B 5DJQC 2IHR1 4O4LE 3AEAA 4PK5A 2NR4A 1UX5A 3OYXA 3IBPA 1XMQT 4TWHA 5BR8T 1HNXT 2FJAA 4EEDA 3CMLA 3ZMTB 5L4EA 3SS1A 3RKGA 1UUSA 3AEDA 4TN7B 4GOUA 2WMOA 3C4ZA 3H37A 4AQFC 2JQHA 2KMFA 2LKGA 3VRBA 3GMIA 4G2AA 3T8OA 4QH4A 3UUNA 4IE5A 3LJCA 4LF7T 4YSZA 4AQGA 4HKAA 5BMVE 4QH1A 3ANWA 4LMKA 4UVCB 3RYHE 3J9X1 2YOEA 3CVRA 1WFDA 2D0UA 2Q9QC 5LJMA 4DUYT 3ABVA 5FXXA 2NTYA 2H7VC 4CXXA 3ONJA 3M65A 2I59A 3ZSTA 2V5DA 4MFRA 1HG2A 1KNPA 4Q25A 2PTFA 4HGAA 3K3OA 4WW0A 3FZFB 3CWZB 5ABEA 2XUEA 3GN5A 4PJJA 4DV7T 4QHOA 5FXWA 3P4QA 4UEMA 3ZJ1A 4DNDA 4GIWA 4PW8A 3BQKA 3P4SA 3NRXA 2XQ7A 1J5WA 4HFEA 2JMKA 3GA8A 2KZ7B 1YW0A 3KBTA 3AAEB 2X66A 4K0UA 4A5XA 2YINA 2WU2A 4WNKA 2LRLA 1FIOA 4MBQA 3EAMA 2CA5A 3QUJA 4YHJA 4IIJE 5J2TE 3ANWB 1YKEB 2V7MA 3PUAA 4ZI3D 2EHOD 3KV9A 3KINB 4LMLA 5JDFA 4HFVA 2VVSA 1IZNB 2N1GA 4NIQA 1MMAA 3RQWA 3E22E 2V7KA 4ILCA 1J5ET 2PFVA 5HXCA 1MNEA 1XWMA 2LM2A 3NBXX 1ZOYA 2LSJA 3AA7B 2E8IA 3GN5B 4QXBB 4EZ4A 1BR2A 2NW8A 5ADXL 1LVFA 4FI5A 1I6ZA 2LKHA 3ZT6A 1JNRA 2BKNA 2XQYA 4BAYB 4X65T 4AQYT 4F8HA 2I6HA 1W0BA 2IMLA
chains in the Genus database with same CATH topology
4X64T 4JI4T 1N36T 4DV7T 4X66T 1HNWT 4DR3T 2UXCT 4DV3T 1XNQT 4B3MT 4JI0T 4X62T 4DR6T 4DUZT 4LFAT 2UU9T 3T1HT 5IWAT 4DR4T 4DV2T 4DV0T 4JI3T 1XMOT 4LFBT 4K0KT 2HHHT 5LMNT 4JI1T 1XMQT 2UUBT 5BR8T 1HNZT 4LF6T 1HNXT 4YY3T 2UUAT 2VQET 4DV6T 4DR2T 4LFCT 1IBKT 1HR0T 4LF9T 1IBMT 2VQFT 4JI6T 4KHPT 4JI2T 1FJGT 4JYAT 2F4VT 4JI7T 4DR5T 4DV5T 4JV5T 4LF7T 1N34T 3T1YT 1J5ET 4JI8T 4DR7T 2ZM6T 4YHHT 4B3ST 4JI5T 4LF4T 4DV1T 4DV4T 4GKJT 1IBLT 4DUYT 4OX9T 4LF8T 4DR1T 1XNRT 4B3RT 1N32T 2E5LT 2UUCT 4LF5T 4NXNT 4NXMT 5LMUT 1I94T 2UXBT 4GKKT 1N33T 4X65T 4AQYT 3OTOT 4B3TT 2UXDT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 T;  4JI4 T;  1N36 T;  4DV7 T;  4X66 T;  1HNW T;  4DR3 T;  2UXC T;  4DV3 T;  1XNQ T;  4B3M T;  4JI0 T;  4X62 T;  4DR6 T;  4DUZ T;  4LFA T;  2UU9 T;  3T1H T;  5IWA T;  4DR4 T;  4DV2 T;  4DV0 T;  4JI3 T;  1XMO T;  4LFB T;  4K0K T;  2HHH T;  5LMN T;  4JI1 T;  1XMQ T;  2UUB T;  5BR8 T;  1HNZ T;  4LF6 T;  1HNX T;  4YY3 T;  2UUA T;  2VQE T;  4DV6 T;  4DR2 T;  4LFC T;  1IBK T;  1HR0 T;  4LF9 T;  1IBM T;  2VQF T;  4JI6 T;  4KHP T;  4JI2 T;  1FJG T;  4JYA T;  2F4V T;  4JI7 T;  4DR5 T;  4DV5 T;  4JV5 T;  4LF7 T;  1N34 T;  3T1Y T;  1J5E T;  4JI8 T;  4DR7 T;  2ZM6 T;  4YHH T;  4B3S T;  4JI5 T;  4LF4 T;  4DV1 T;  4DV4 T;  4GKJ T;  1IBL T;  4DUY T;  4OX9 T;  4LF8 T;  4DR1 T;  1XNR T;  4B3R T;  1N32 T;  2E5L T;  2UUC T;  4LF5 T;  4NXN T;  4NXM T;  5LMU T;  1I94 T;  2UXB T;  4GKK T;  1N33 T;  4X65 T;  4AQY T;  3OTO T;  4B3T T;  2UXD T; 
#chains in the Genus database with same CATH topology
 3TLU A;  2WWU A;  1X79 A;  3ZPO A;  5JDQ A;  3ZYM A;  2V8S V;  2CXD A;  4TWF A;  2WCA A;  4TWD A;  4CZZ B;  3RKO A;  4IE4 A;  1IJ6 A;  5IWA T;  2E9X C;  5FNV E;  4HWD A;  3MJX A;  4P1N A;  3C50 A;  4LFB T;  4K0K T;  5GON E;  4MHC A;  4C90 A;  4X1I E;  2E9X A;  2WP9 A;  2MYS A;  2VQE T;  1US7 B;  5HXE A;  1QUU A;  5LA6 E;  4YSX A;  2GK9 A;  5HXH A;  4JYA T;  2LSK A;  3HI2 A;  5JVD E;  2RP4 A;  2JQ9 A;  3AE4 A;  2WU5 A;  3NRY A;  4YSY A;  4GKJ T;  1HTJ F;  3N9N A;  4LF8 T;  2X51 A;  4P0A A;  4KX6 A;  4B3R T;  1UGO A;  2V26 A;  5DAB A;  3KBU A;  4JUY A;  2NW7 A;  2QGS A;  2VL0 A;  3CX8 B;  4PAG A;  3PUW F;  3ZEF B;  5CJ5 A;  3UUL A;  3UQ4 A;  3I9Y A;  2E9X B;  3O1H A;  3EVY A;  3RIA A;  5JDG A;  5HXR A;  3AE9 A;  2YU1 A;  2YDR A;  1YKH B;  4ZZB A;  3Q2M A;  3ONX A;  2W67 A;  3IF8 B;  2V6Y A;  5L3F B;  4AI6 A;  2NP9 A;  2X0L B;  4AKI A;  1KK7 A;  1S94 A;  3UQ7 A;  2LJL A;  3Q5W A;  4KBM B;  1IBM T;  3K3N A;  1BR1 A;  5LBM A;  3PUR A;  3E08 A;  1CUN A;  1V9D A;  5HEH A;  2X9H A;  4EGW A;  5KXJ A;  3LK2 B;  4CN4 A;  1IAP A;  3RC3 A;  4QWN B;  4U2Y A;  4UF0 A;  4KMC A;  3V5S A;  5FXZ A;  4JI8 T;  4QX8 B;  2B1E A;  2ZM6 T;  5JDN A;  2G0U A;  2D5U A;  2K5B B;  2KIN B;  2XTL A;  2VKD A;  1WLX A;  3ZC0 A;  5H6Q B;  4E7Z A;  5AQV B;  2OLT A;  3TLV A;  5F3J A;  2KLQ A;  2HPL A;  3EI0 A;  3UU6 A;  1XNR T;  3UUX B;  2VVN A;  3UU4 A;  3MAC A;  1MMG A;  4NXM T;  4DMV A;  2BS2 A;  2V7J A;  3K3Q C;  5FVK A;  4IHJ E;  2KSR A;  5JDH A;  5AFU L;  4ZHQ E;  2V6Y B;  2L8K A;  4F6R C;  2BG9 C;  1YQ4 A;  3CK6 A;  4TNV A;  1S35 A;  2YDQ A;  2UU9 T;  4YT0 A;  3VU7 H;  4WBN E;  1MIW A;  4J2C A;  5TAO A;  4DV2 T;  3ZKR A;  4TV8 E;  4EYY R;  3H3M A;  4ASK A;  2HHH T;  2AE9 A;  3I1A A;  5LCY A;  4UF0 B;  5L3D B;  1OED C;  2HN2 A;  5F8P A;  2WS3 A;  3FXD B;  3PTR B;  4UV8 B;  2Y6X A;  2VQF T;  2V7L A;  2YU2 A;  2UXX B;  2VL8 A;  5HWX A;  1G73 A;  1D0Z A;  3T1Y T;  2X9W A;  2J4G A;  5LHG B;  4JI5 T;  3BK9 A;  4H9P C;  1KF6 A;  4Z90 A;  1LRZ A;  2VB6 A;  1U5P A;  2W0G A;  4WBO A;  3AVR A;  5J2U E;  3R6N A;  1OXZ A;  1KEY A;  1B7T A;  2C5I T;  3PDY A;  4CXW A;  2UXD T;  2ODV A;  3U78 A;  1MIV A;  5HXS A;  1SUM B;  2WY2 A;  3ETU A;  3AE3 A;  3IA3 A;  4QKN A;  2DLR A;  3JC6 C;  4DR3 T;  2UXC T;  1XNQ T;  3RH3 A;  4EOZ B;  2C5J A;  2CRB A;  3OVU A;  4HWF A;  3FZM B;  3IHR A;  1D0Y A;  4H63 H;  4IDO A;  2XQ9 A;  4YTP A;  3ZN0 B;  3ZSS A;  3Q5E A;  5KDM C;  4A56 A;  1M7K A;  1HNZ T;  1D1A A;  4ANJ A;  4HWI B;  4MAL A;  2HN1 A;  3HR0 A;  5JR9 C;  2BDE A;  3JAF A;  1IBK T;  4HEA A;  2VUR A;  4ZI3 C;  4UEL A;  4H9N C;  3ZT7 A;  4KP3 C;  5JR9 A;  1XDO A;  4DV5 T;  3QOF A;  4IL9 A;  5AQR B;  2EHO A;  3ZLI A;  3M3Z B;  2ES0 A;  3N9M A;  3KDS E;  4AKL A;  2XSB A;  4U7Y A;  2V6X A;  4YJ3 E;  3LK4 2;  1T98 A;  3TLT A;  3U3I A;  4YFS A;  2UUC T;  2LLY A;  2N9D A;  4GKK T;  2XPK A;  3P8C D;  3L8R A;  1UX4 A;  4EXT A;  4QH5 A;  3VR9 A;  1YD8 G;  2ZM8 A;  5L47 A;  4ZS3 A;  4H9S E;  3EUH A;  2YKS A;  4GK5 E;  2V5C A;  4UVA B;  2IAK A;  5ABH A;  4DID B;  1W09 A;  4JI3 T;  5HEU A;  2V7I A;  4PFP A;  3N9O A;  4BA9 A;  2BBH A;  5M4Y A;  4HFC A;  2M67 A;  3PV0 F;  2W66 A;  5JR9 B;  2XAH B;  1U4Q A;  2FBW A;  2EHO B;  3UUB A;  4I4T E;  4B6X A;  5LOV E;  2VKO A;  2MAW A;  3L09 A;  4IRE A;  5CFB A;  2WWV A;  2E5V A;  2BS3 A;  2HH7 A;  3RC8 A;  5IHY A;  2BZB A;  5HCJ A;  4X5T A;  4CI2 B;  3X1D A;  2CXL A;  4BJM A;  3PUY F;  4XAX B;  1QSD A;  2LRK A;  2RPA A;  3VRA A;  1N34 T;  1H7C A;  2CPT A;  3RLF F;  5AQH B;  4IST A;  3LFM A;  3SWH A;  3ZT5 A;  4UR9 A;  4PFO A;  4OYK A;  3KV6 A;  3HA4 A;  4ZI2 D;  1T7S A;  2VKH A;  3NZP A;  3UU8 A;  1N32 T;  3ZC1 A;  4NXN T;  3QB5 A;  1FMV A;  1E7P A;  3C64 A;  2V1D B;  1M62 A;  2CWO A;  2CWY A;  3N2G E;  2FJB A;  3HKD E;  4AKH A;  1L0V A;  3AEE A;  2XQ4 A;  2VWA A;  4DUZ T;  1VOM A;  4JLE A;  1Z0P A;  4IDQ A;  4GYS A;  4LMJ A;  4FJO A;  4COF A;  3ZMV B;  4X1Y E;  5FY7 A;  2JMH A;  2BBJ A;  4DR2 T;  1XZY A;  2MPK A;  1WYC A;  4H9R C;  1WR6 A;  4PJN A;  4JI7 T;  4Z8X A;  2Q9Q D;  3P4P A;  4HE8 A;  2XQ5 A;  1Z8U A;  3JAD A;  3S4U A;  2XAF B;  2LSY A;  2X9Y A;  2XQ3 A;  2DL1 A;  4IDP A;  3Q5D A;  3H3A A;  5LG3 A;  2RA1 A;  3VKG A;  4EV6 A;  1AJ3 A;  4PJM A;  4YLH A;  4WYV A;  2CHN A;  5E0O A;  5FL0 A;  2E5L T;  3N9P A;  1ZHC A;  3A5X A;  1N33 T;  3AE6 A;  5L3E B;  4MLK A;  2DHR A;  2PJQ A;  5JH7 E;  3BQI A;  5FY0 A;  4X66 T;  3SRZ A;  4AIS A;  4TV9 E;  5AQP B;  1NWM X;  1FMW A;  4I0U A;  3O1I A;  4P09 A;  4UVB B;  5EK2 A;  5HEG A;  4O2B E;  3OYZ A;  5EK3 A;  4U2Z A;  2YK0 A;  2QRX A;  1WRD A;  5AQS B;  5LP6 E;  2FUP A;  2XZE A;  4HWC A;  4UV9 B;  1HR0 T;  3AA1 B;  4V1A v;  4A97 A;  3RIU A;  4DR5 T;  3KV4 A;  1EZ3 A;  2CE7 A;  3PUG A;  3HKE E;  4TUY E;  4OYJ A;  3D0T A;  4EAH A;  3LG7 A;  3AVS A;  5LHI B;  2CHO A;  2KND A;  5DQW A;  1CHU A;  3Q9D A;  2LE8 A;  5AQJ B;  4DR1 T;  4O8S A;  3OJA A;  3ZMZ B;  3SFD A;  4QXC B;  4C91 A;  4AXP A;  3JAE A;  5A1L A;  4U74 A;  2LSI A;  2KWH A;  1X9B A;  3N2O A;  4H63 V;  3J7Y q;  4XZC A;  3ESL A;  2WBL A;  4I43 B;  3I9W A;  2WSS V;  4JI0 T;  4DR6 T;  4NPP A;  4P0B A;  3GWH A;  3W15 B;  4HFH A;  1NEN A;  3R84 B;  3WAJ A;  3PU8 A;  3ZCJ A;  2XAS B;  5L3B B;  4EEB A;  3AB3 B;  2I0M A;  2CBI A;  4CI1 B;  5KMG P;  3F57 A;  3O1J A;  2LSG A;  3FZK B;  4PJL A;  4ILB A;  2BS4 A;  3LSV A;  5AQG B;  2X68 A;  3ZMU B;  2C0S A;  4AIU A;  2M6B A;  3PUS A;  1Y01 A;  4OHF A;  3CX6 B;  2WDR A;  4HN9 A;  1LVK A;  3E0Z A;  2MBG A;  2ODU A;  5L2L A;  4DR7 T;  4PK6 A;  3CPZ A;  3P4W A;  3NVO A;  2ZLY A;  2DI4 A;  5JDL A;  3AA0 B;  4ZXL A;  4AKG A;  3AAI A;  5LGN B;  4EYU A;  3I0O A;  3F31 A;  3CIR A;  1DU2 A;  3KFW X;  2BVM A;  4CQI A;  3AAA B;  3RRW A;  4QX7 B;  1HS7 A;  1HNW T;  2KT9 A;  2JPF A;  5DQV A;  3C51 A;  4PK4 A;  1HCI A;  1JNZ A;  5AQL B;  4U33 A;  2W00 A;  5FMN A;  4ZI7 E;  4DV0 T;  3CQC B;  3VHL A;  2M6I A;  4OFZ A;  3AE7 A;  5HYA A;  5LNK A;  3FB2 A;  5L3C B;  2CBJ A;  2YDS A;  4EZH A;  2JRK A;  4ISS A;  2NW9 A;  3ZYK A;  3EAB A;  3FBZ A;  4DBQ A;  2XQ6 A;  4U7I A;  4O4H E;  5L4H A;  4IT4 A;  2ACZ A;  5JDM A;  2DCF A;  5ABG A;  4G63 A;  4B3S T;  4LF4 T;  3FZH B;  2EHO C;  3A7M A;  4ILA A;  2LHR A;  4PNI A;  4ZI2 C;  3AE5 A;  2J1D G;  4HFD A;  2XAJ B;  2A2F X;  2WDQ A;  4LF5 T;  3IEE A;  5AQF B;  4U3C A;  3MK7 C;  3HKC E;  1VCT A;  2PBI A;  4L5G A;  2WB5 A;  4B3T T;  4CXY A;  5LHH B;  3N5L A;  1D0X A;  4GK0 E;  4X64 T;  3WI3 A;  4I50 E;  2CMR A;  3LDQ B;  2CLY B;  2NWB A;  4DV3 T;  2IC9 A;  2H88 A;  4M1P A;  2WZH A;  4HWH A;  2NTX A;  4ADZ A;  3MKD A;  3RYC E;  1XMO T;  5IYZ E;  3C4X A;  2J62 A;  1KNR A;  3UU5 A;  2UUB T;  4YTN A;  4AQF A;  1ZP0 A;  3QNU A;  1MND A;  2J47 A;  4JBW F;  1UCU A;  3L3P A;  3CQX C;  3OBV E;  2R6G F;  4CN6 A;  2XY8 B;  3SFE A;  3B5M A;  3L39 A;  4EIW A;  4DO0 A;  2XHE B;  4UIG A;  3UT5 E;  5AQQ B;  2Q9Q A;  3RGL A;  3HKB E;  5ABF A;  5C2T A;  2LHN A;  4XBF B;  2JQK A;  4DV1 T;  1T72 A;  5JRE A;  3KVB A;  4ZZC A;  4DV4 T;  2XAQ B;  5AQI B;  5F5W A;  2W2U A;  3ZN1 B;  1HG5 A;  2IW5 B;  3JC6 D;  3RRC A;  2QVA A;  4DMW A;  2K48 A;  3MA9 A;  1SE7 A;  4O4I E;  2QA7 A;  2MTQ A;  2ACX A;  3QC9 A;  3OTO T;  3FBL A;  4WZX A;  3RPU A;  3FZL B;  5HWY A;  3P7I A;  1GQE A;  1J1J A;  3OKQ A;  4L0R A;  4H9O C;  1Y64 B;  2X9X A;  2XQA A;  3PJA J;  3RF1 A;  3CQG B;  1T8B A;  4IE0 A;  3HL6 A;  1LKX A;  5LMN T;  1MIY A;  3KV5 A;  1ZKE A;  4KHZ F;  3FHN A;  1MMN A;  4YXD A;  4ZEY A;  3NZQ A;  3QK6 A;  4NUV A;  2Q9Q B;  1HX1 B;  5ABF B;  2JQQ A;  3NKZ A;  3PJA A;  4LF9 T;  1FJG T;  2WAU A;  1KFY A;  2AXD S;  2F4V T;  3CX7 B;  3BQL A;  3O9X A;  5AQN B;  3DP7 A;  3B57 A;  4DBR A;  2IDO B;  2FJD A;  3N9Q A;  2L3L A;  2H3R A;  2L9Q A;  3ZCI A;  4UXN B;  2LM9 A;  4TZ4 C;  4DVD A;  5IUX A;  1UK5 A;  2XSA A;  4YHH T;  1NAF A;  3JCF A;  4X20 E;  2LEH A;  4IL4 A;  3O4X E;  2KXP B;  5HEO A;  5ETW A;  3PU3 A;  5FY1 A;  3RQU A;  5LYJ E;  1G8X A;  4N78 D;  1HF8 A;  4ERR A;  3WAK A;  1I94 T;  3KVA A;  3RYI E;  3ZMS B;  5EK4 A;  3AEB A;  4IE6 A;  2VAS A;  2D0T A;  4IE7 A;  1KNZ A;  2BKP A;  2IIU A;  4AKR B;  4X62 T;  3AE8 A;  1MMD A;  3P50 A;  3T1H T;  3UFE A;  2WDV A;  5AQU B;  3RX6 A;  3MZK B;  3ZYL A;  2X67 A;  1ZV4 X;  4EB6 E;  3PUV F;  3ETV A;  4KI0 F;  4TNW A;  5LJN A;  4LF6 T;  2PG8 A;  5LBQ B;  4YY3 T;  3MXZ A;  2VKJ A;  3NWI A;  2XAG B;  1W0A A;  2HPJ A;  4JEU B;  4LFC T;  2CM0 A;  5LG4 A;  4L9I A;  4U31 A;  3RI5 A;  4KHP T;  4JI2 T;  3V5U A;  1SHZ C;  2YN6 A;  2SPC A;  5C8Y E;  1WCR A;  3ONL C;  5CA1 E;  3UFG A;  4JV5 T;  1OWA A;  2A3D A;  3RHW A;  2BKO A;  2QYW A;  1ZEE A;  3CKD A;  2YEV C;  3RIU C;  3I0Q A;  5JTG A;  2UXN B;  5AQO B;  4KUM B;  2ZM2 A;  3K8P C;  3K1S A;  3F2E A;  5H6R B;  2CEA A;  4OX9 T;  2DNX A;  2CXF A;  2D2S A;  1FEW A;  2DWK A;  2D9D A;  1W9R A;  5FL1 A;  3DTO A;  5AQK B;  3VR8 A;  2WZI A;  2P9B A;  5LMU T;  1BR4 A;  2WM9 A;  2A9U A;  2CCQ A;  2OA5 A;  5HCM A;  5FVL A;  5FYM A;  5C3J A;  3AEC A;  3G06 A;  1UUR A;  2E9X D;  5KX5 E;  5LGT B;  2FJE A;  2XJ7 A;  2MOZ A;  1WR0 A;  3QB5 K;  5FP3 A;  4JI1 T;  3AEF A;  1NEK A;  5AQM B;  5EZY E;  3AE2 A;  3EDV A;  5FKY A;  2UUA T;  2B76 A;  2LOP A;  4ZOL E;  4DV6 T;  2W4X A;  3Q5X A;  2N2N A;  1SA0 E;  4Z91 A;  4JI6 T;  3UTK A;  4O2A E;  2JJ9 A;  1BR0 A;  1HFA A;  2ZM0 A;  3PUQ A;  3VKH A;  2WMN A;  4BJN A;  5HAX A;  1E1H B;  2H89 A;  2VK9 A;  2X0H A;  2K3W A;  1IBL T;  3C98 B;  5JRC A;  2Y8D A;  3C4W A;  2LT3 A;  4CN1 A;  1E2A A;  3OPC A;  2BG9 A;  5J0Z A;  2UXB T;  3PUZ F;  5FXV A;  4QXH B;  5LGU B;  1VRB A;  3LK3 B;  2Z6E A;  4JEH B;  2W62 A;  4B3M T;  1HX8 A;  3RIF A;  3EHZ A;  2C5K T;  3LBX A;  1D1C A;  4LFA T;  3A8Y C;  3N9L A;  4I55 E;  3TLS A;  2K24 A;  4X1K E;  3AXJ A;  1YQ3 A;  2Y48 B;  4HFB A;  2DWG A;  1IJ5 A;  1OED A;  2XM1 A;  5CB4 E;  2KWI B;  1QLB A;  2XM2 A;  3ZJ2 A;  5HEJ A;  5AQT B;  2K9A A;  5L3G B;  3FXE B;  3SOL A;  2BVL A;  3AEG A;  4GYR A;  2WQY A;  2CLY C;  5CGM A;  4HTE A;  4ZS2 A;  5LB7 B;  4TX5 A;  3UUM A;  2IC6 A;  3DJB A;  3TLW A;  2W63 A;  5JRC B;  3UU3 A;  4U72 A;  5J1G A;  5JQG E;  2OV9 A;  1YXR A;  4OK0 A;  2BG9 B;  1D1B A;  4NUU A;  3N2K E;  2BG9 E;  3B13 A;  5CA0 E;  5LXT E;  1O3X A;  2IUB A;  2H7O A;  4ILU A;  3AE1 A;  2JIW A;  3PE0 A;  1VCS A;  4E7S A;  2E2A A;  3LBX B;  4IGU A;  3TKL B;  3RYF E;  2X0Y A;  3P4R A;  2XQ8 A;  4IDZ A;  4HFI A;  3AXJ B;  2NOX A;  3PUX F;  1WYB A;  1OED B;  1OED E;  2W61 A;  4JI4 T;  1N36 T;  4YJ2 E;  4H9Q C;  4IDN A;  1R8I A;  2ZMA A;  3EDU A;  3AA6 B;  2LOS A;  4O4J E;  4A98 A;  2A72 A;  4DR4 T;  1XDP A;  4YTM A;  4CI3 B;  5DJQ C;  2IHR 1;  4O4L E;  3AEA A;  4PK5 A;  2NR4 A;  1UX5 A;  3OYX A;  3IBP A;  1XMQ T;  4TWH A;  5BR8 T;  1HNX T;  2FJA A;  4EED A;  3CML A;  3ZMT B;  5L4E A;  3SS1 A;  3RKG A;  1UUS A;  3AED A;  4TN7 B;  4GOU A;  2WMO A;  3C4Z A;  3H37 A;  4AQF C;  2JQH A;  2KMF A;  2LKG A;  3VRB A;  3GMI A;  4G2A A;  3T8O A;  4QH4 A;  3UUN A;  4IE5 A;  3LJC A;  4LF7 T;  4YSZ A;  4AQG A;  4HKA A;  5BMV E;  4QH1 A;  3ANW A;  4LMK A;  4UVC B;  3RYH E;  3J9X 1;  2YOE A;  3CVR A;  1WFD A;  2D0U A;  2Q9Q C;  5LJM A;  4DUY T;  3ABV A;  5FXX A;  2NTY A;  2H7V C;  4CXX A;  3ONJ A;  3M65 A;  2I59 A;  3ZST A;  2V5D A;  4MFR A;  1HG2 A;  1KNP A;  4Q25 A;  2PTF A;  4HGA A;  3K3O A;  4WW0 A;  3FZF B;  3CWZ B;  5ABE A;  2XUE A;  3GN5 A;  4PJJ A;  4DV7 T;  4QHO A;  5FXW A;  3P4Q A;  4UEM A;  3ZJ1 A;  4DND A;  4GIW A;  4PW8 A;  3BQK A;  3P4S A;  3NRX A;  2XQ7 A;  1J5W A;  4HFE A;  2JMK A;  3GA8 A;  2KZ7 B;  1YW0 A;  3KBT A;  3AAE B;  2X66 A;  4K0U A;  4A5X A;  2YIN A;  2WU2 A;  4WNK A;  2LRL A;  1FIO A;  4MBQ A;  3EAM A;  2CA5 A;  3QUJ A;  4YHJ A;  4IIJ E;  5J2T E;  3ANW B;  1YKE B;  2V7M A;  3PUA A;  4ZI3 D;  2EHO D;  3KV9 A;  3KIN B;  4LML A;  5JDF A;  4HFV A;  2VVS A;  1IZN B;  2N1G A;  4NIQ A;  1MMA A;  3RQW A;  3E22 E;  2V7K A;  4ILC A;  1J5E T;  2PFV A;  5HXC A;  1MNE A;  1XWM A;  2LM2 A;  3NBX X;  1ZOY A;  2LSJ A;  3AA7 B;  2E8I A;  3GN5 B;  4QXB B;  4EZ4 A;  1BR2 A;  2NW8 A;  5ADX L;  1LVF A;  4FI5 A;  1I6Z A;  2LKH A;  3ZT6 A;  1JNR A;  2BKN A;  2XQY A;  4BAY B;  4X65 T;  4AQY T;  4F8H A;  2I6H A;  1W0B A;  2IML A; 
#chains in the Genus database with same CATH homology
 4X64 T;  4JI4 T;  1N36 T;  4DV7 T;  4X66 T;  1HNW T;  4DR3 T;  2UXC T;  4DV3 T;  1XNQ T;  4B3M T;  4JI0 T;  4X62 T;  4DR6 T;  4DUZ T;  4LFA T;  2UU9 T;  3T1H T;  5IWA T;  4DR4 T;  4DV2 T;  4DV0 T;  4JI3 T;  1XMO T;  4LFB T;  4K0K T;  2HHH T;  5LMN T;  4JI1 T;  1XMQ T;  2UUB T;  5BR8 T;  1HNZ T;  4LF6 T;  1HNX T;  4YY3 T;  2UUA T;  2VQE T;  4DV6 T;  4DR2 T;  4LFC T;  1IBK T;  1HR0 T;  4LF9 T;  1IBM T;  2VQF T;  4JI6 T;  4KHP T;  4JI2 T;  1FJG T;  4JYA T;  2F4V T;  4JI7 T;  4DR5 T;  4DV5 T;  4JV5 T;  4LF7 T;  1N34 T;  3T1Y T;  1J5E T;  4JI8 T;  4DR7 T;  2ZM6 T;  4YHH T;  4B3S T;  4JI5 T;  4LF4 T;  4DV1 T;  4DV4 T;  4GKJ T;  1IBL T;  4DUY T;  4OX9 T;  4LF8 T;  4DR1 T;  1XNR T;  4B3R T;  1N32 T;  2E5L T;  2UUC T;  4LF5 T;  4NXN T;  4NXM T;  5LMU T;  1I94 T;  2UXB T;  4GKK T;  1N33 T;  4X65 T;  4AQY T;  3OTO T;  4B3T T;  2UXD T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...