4B3MT

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3mT00
1J5ET 1N32T 2ZM6T 4KHPT 4DV0T 4DR3T 1HR0T 2UUBT 1XNQT 4OX9T 4LFBT 1XMOT 2F4VT 4DV6T 5LMNT 1N33T 4JI7T 4DV4T 3T1HT 2UUCT 4DUZT 4X64T 4GKKT 4LF4T 5LMUT 1HNXT 4NXMT 4DUYT 1XMQT 5IWAT 4YY3T 4B3ST 4LF7T 4B3MT 4NXNT 4LFCT 2UXCT 2UXBT 4K0KT 4X65T 1HNWT 4LF9T 4DV5T 4X62T 4JI1T 4JYAT 5BR8T 4GKJT 2UXDT 2HHHT 4DV2T 4JI0T 4JI3T 1IBLT 4LF6T 4DV7T 4LF5T 4YHHT 4X66T 4LF8T 1FJGT 1IBKT 4DR2T 4DV1T 4JI6T 4B3RT 4DV3T 4B3TT 1N36T 4JI4T 3OTOT 4JI8T 3T1YT 4JI5T 2E5LT 4DR6T 2UUAT 4JI2T 4DR1T 1I94T 1IBMT 4JV5T 4DR4T 2UU9T 4LFAT 4AQYT 2VQET 2VQFT 1HNZT 4DR5T 1XNRT 4DR7T 1N34T
chains in the Genus database with same CATH superfamily
5F5WA 5L4EA 1FEWA 3MACA 1ZOYA 2Y6XA 3FB2A 1YKEB 5J2UE 2XM2A 2QVAA 4YXDA 5KDMC 2M6BA 1E7PA 3HKEE 5CA0E 4GIWA 4L5GA 3ZJ1A 3KVAA 5FL1A 1HG2A 2BKOA 4ZS2A 2A3DA 2X68A 4TWHA 3ZEFB 3AA1B 3QB5A 1OEDE 4B3MT 2JQKA 3A5XA 4ILAA 4QHOA 4CN6A 3AE4A 3QB5K 3ONLC 3RPUA 4LMKA 2MPKA 4TZ4C 4HKAA 1UCUA 4HWCA 4HFEA 1J1JA 2YDSA 3NBXX 2BG9C 4H9QC 5CB4E 3NKZA 4NUUA 4COFA 3SS1A 1US7B 3M65A 5JR9C 4ILUA 4AKRB 3Q2MA 2VKHA 3H3AA 1MNEA 1WR0A 4TX5A 1T8BA 1I94T 2WDQA 2CPTA 4QX8B 1NENA 1O3XA 1ZHCA 3I1AA 5HEOA 4LMLA 2H7OA 2UU9T 2K3WA 3N2OA 2KLQA 4WYVA 5LYJE 3LBXA 4IT4A 2BVMA 2E9XD 4BJMA 2X66A 1SUMB 3M3ZB 5AQTB 5EK4A 2UUBT 3PTRB 2VASA 1T98A 4MALA 2IMLA 2YINA 2BBHA 2B1EA 4O4LE 3LBXB 4GKKT 2XUEA 5JREA 2WZIA 3N9MA 2LHRA 2JIWA 1XMQT 4IE0A 2LOSA 4UF0A 3JAFA 4F8HA 4U74A 2MOZA 3PV0F 4HTEA 2IIUA 2BS4A 3SRZA 2A9UA 3RX6A 3PU8A 2CXDA 3RYHE 2BG9E 4ASKA 1FIOA 1HNWT 4KHZF 4JI1T 4UF0B 2X9YA 1U5PA 2V5CA 2EHOD 2CA5A 3RLFF 1IBKT 3RC3A 4AIUA 2CLYB 1OEDB 2L9QA 3AEFA 1WR6A 5AQMB 3T1YT 4AQGA 4H9SE 4KX6A 3N9LA 4H9RC 3C4ZA 3CX6B 4KMCA 1W9RA 2D0TA 5LCYA 2DHRA 2XTLA 1Y01A 2W67A 5H6QB 2CWOA 3AAEB 1I6ZA 2C5KT 2X0LB 4P0AA 4GYSA 5AFUL 2XQYA 2YK0A 4EZ4A 2K48A 2YN6A 1S94A 3EDUA 3O1HA 1BR0A 3Q5EA 4JEHB 3L39A 5HCJA 2MAWA 2X9WA 4CI1B 4XAXB 1XDOA 3W15B 1AJ3A 3UU4A 5AQSB 3PUYF 2VK9A 3NZQA 4YTPA 2V26A 4MFRA 2NW9A 3P4WA 1KF6A 1NAFA 5FL0A 4DMVA 2VB6A 5AQLB 3AEGA 3ZJ2A 1IZNB 5AQKB 4OHFA 4DR2T 3EHZA 3HKDE 4HFCA 2I59A 5JR9A 1D0ZA 4IDQA 4B3TT 3CIRA 2LSKA 5AQNB 1YXRA 3N9OA 5HXEA 3MXZA 3O4XE 4A98A 3JC6C 2BG9B 5JDGA 3AA0B 3N2KE 5FY1A 4EAHA 5JR9B 1YQ3A 2WMOA 2PTFA 2XY8B 4ILCA 3ZLIA 1N32T 1Z0PA 4PJMA 2D5UA 4DR3T 4TUYE 1HF8A 3B5MA 3VRBA 5LMNT 4DV6T 4DV4T 3GMIA 5L3BB 3ZC1A 4A56A 1UGOA 3AE2A 4AKIA 2N1GA 2KXPB 2K5BB 3ZMTB 3F57A 4LF7T 3CPZA 2MYSA 2YKSA 2UXCT 4IHJE 5CFBA 3G06A 2KWIB 2HPLA 4V1Av 2P9BA 4K0KT 2DLRA 3PDYA 3GN5B 3BQKA 2LE8A 3SOLA 2QGSA 3RIAA 4H63H 4DV7T 2CHNA 2VVNA 4X66T 4PK4A 4YSXA 3FZHB 4ZZCA 2PBIA 1Z8UA 3WAJA 1HX1B 3PUXF 3KV4A 4X1IE 3KINB 2W0GA 3ANWA 2W2UA 4OYKA 2LHNA 1MMGA 3HA4A 1MNDA 5HEGA 2LSGA 4YJ2E 5IUXA 3QNUA 5ABFB 5L3EB 4HFDA 1MIWA 2CWYA 5HCMA 5DQVA 2JMKA 2ODUA 4P09A 2WWVA 4ZI2D 5JRCB 3ANWB 1J5ET 3QUJA 3PUSA 4IDOA 1WRDA 4HWIB 3AE6A 4HFHA 3RKOA 4DIDB 3B57A 5LHGB 4IIJE 4U31A 2ES0A 5FMNA 4YY3T 2FJDA 5LBMA 2ACXA 4ZI3D 5AQJB 4ERRA 3AE3A 3FBLA 4L0RA 5LHIB 3IF8B 3QC9A 4CI2B 4X65T 4O2AE 3ONJA 4AKGA 5EZYE 3PUQA 1IJ6A 4EYUA 3KV6A 3QK6A 2L3LA 4YHHT 1ZV4X 1W09A 4H9PC 4PK6A 4IE6A 3UFEA 4DV1T 3BK9A 3EUHA 2H88A 2V1DB 3RF1A 5LGUB 4YTMA 3K1SA 4YLHA 5HXHA 5HWXA 5HAXA 2IUBA 1VCTA 4TWFA 3OBVE 1GQEA 3AEDA 4DR5T 2WMNA 4WW0A 3O1JA 3ZYKA 3NRYA 3HL6A 1KEYA 5LXTE 4H63V 4DV0T 5ABEA 5JDLA 3LSVA 4OX9T 5JDMA 1FMWA 1XMOT 1OXZA 4WZXA 4YT0A 4UIGA 2D2SA 3K3NA 5FXZA 4PJJA 1HTJF 4U7IA 2K9AA 2WS3A 4QH5A 1HFAA 4QXCB 2NTXA 2QA7A 1LVKA 1W0BA 4JEUB 1T72A 5FXWA 4IDPA 2E8IA 4KI0F 3BQIA 2BS3A 2DNXA 3H3MA 3UTKA 4N78D 2X67A 3V5UA 3E0ZA 4CZZB 3P50A 3RHWA 3ZYMA 2WB5A 3FBZA 5TAOA 1MMNA 4YHJA 4JI6T 4B3RT 3UQ7A 3PUZF 3RQUA 2LOPA 3AE8A 2VKOA 4B6XA 3ZMUB 3AVRA 4QH1A 3OVUA 2XQ9A 3UUXB 2JPFA 3Q5XA 2H3RA 1XWMA 1IJ5A 1QUUA 3ZMVB 2VQFT 1E1HB 4YSZA 5C2TA 2I0MA 4A97A 2GK9A 2CBJA 2YDQA 4TV9E 3OPCA 4XBFB 4CI3B 4YSYA 4ANJA 3GWHA 3UQ4A 3F2EA 4EOZB 4UVCB 3S4UA 2YOEA 4YJ3E 5AQPB 5CJ5A 4LF4T 5FYMA 3ZKRA 2JQ9A 3OYXA 5CA1E 3C4XA 3ZN1B 3AAAB 2H89A 3B13A 3P4RA 5C3JA 3IBPA 2ZLYA 4O4IE 4ZXLA 2A2FX 4LF9T 3L3PA 4JI3T 2J1DG 2BKNA 2W63A 5EK3A 5LHHB 2IDOB 1U4QA 4YFSA 3LDQB 5L4HA 3I9WA 2WDVA 4J2CA 3JADA 2X9XA 3CVRA 5FNVE 3LK2B 5LBQB 4F6RC 4DR4T 2NR4A 5AQFB 3UT5E 2E9XA 3CQXC 5AQHB 3AEAA 2VQET 4GK5E 4DR7T 5FP3A 2AE9A 4JBWF 5L3GB 3ZT7A 1XZYA 4HFIA 1IAPA 4QXBB 2XM1A 4UVBB 4U2YA 4YTNA 2KZ7B 2M67A 2Q9QC 3NVOA 3RGLA 3FXDB 4DUYT 5KMGP 3R84B 2HH7A 3C98B 5AQQB 1ZEEA 4NPPA 5JVDE 1D0XA 3K3OA 3AA6B 4IDNA 4O4HE 2EHOA 3UULA 4X62T 4FI5A 3SFEA 2HHHT 5AQOB 3AE9A 4OYJA 3A8YC 4L9IA 2JMHA 3P4SA 4HWHA 3MJXA 2C0SA 4DV3T 2OA5A 4UELA 2W61A 4MBQA 2BS2A 3HI2A 2LKGA 2CM0A 4QX7B 3OTOT 4P0BA 4PK5A 4BAYB 1SE7A 4JI5T 4DR1T 2X9HA 2IAKA 4TV8E 3FZMB 1HX8A 4CXWA 2RP4A 4ADZA 2VWAA 1M7KA 1MMAA 2BBJA 3IHRA 4KBMB 3PUAA 4CQIA 2FBWA 3VU7H 2NWBA 1N33T 4JUYA 4GOUA 2XAGB 2C5JA 2IW5B 1VOMA 4HE8A 5F3JA 5LG3A 5AQVB 4AXPA 2PG8A 5J0ZA 4AISA 3SWHA 3C51A 1X9BA 2QRXA 2W00A 3SFDA 2Z6EA 3R6NA 2DCFA 5LB7B 5GONE 1YD8G 3CQCB 3N2GE 3ZYLA 5HYAA 1D1BA 4JI4T 2WZHA 5J1GA 3L09A 2E5LT 4OFZA 3PURA 4DBRA 2CCQA 3T8OA 4EV6A 3TLTA 2JQQA 4HGAA 4WBNE 3LK42 2HN1A 3RI5A 3DP7A 2SPCA 5ADXL 4HEAA 4FJOA 2VL8A 2KMFA 1HR0T 2XAHB 3WAKA 1UUSA 2XSBA 4CXYA 2VVSA 2J4GA 2Q9QA 2X0YA 1G73A 3KDSE 3E22E 2CRBA 3IEEA 3V5SA 4IE4A 1HNXT 4NXMT 4EXTA 3UUMA 2IC6A 3RIUC 3RYIE 2KNDA 4U7YA 2XAFB 1BR1A 3OJAA 3FZLB 2XQ6A 2Q9QB 3Q9DA 4PAGA 4EEBA 1JNRA 3UUBA 4Z90A 2PFVA 4JYAT 1SHZC 2IC9A 3I9YA 3KV5A 2CXLA 4LMJA 1EZ3A 2K24A 4K0UA 4LF8T 5HWYA 3KV9A 4P1NA 3PUGA 3AA7B 4O8SA 3ZPOA 3JC6D 4E7ZA 2WCAA 4DMWA 1NWMX 2DWGA 2XPKA 3JAEA 4ZOLE 2VURA 3AE1A 2LSIA 5L3DB 4DR6T 5L47A 2UUAT 5FY0A 2CEAA 2FJBA 3J7Yq 1JNZA 3CKDA 2X0HA 2FUPA 2ZM2A 3VHLA 5JH7E 3AXJA 3LK3B 5ETWA 3KVBA 3ZMSB 3RRWA 5CGMA 2JQHA 2BKPA 4WNKA 4CXXA 1LRZA 3O9XA 4ISTA 2N2NA 4E7SA 3VKGA 2BZBA 3AXJB 2UXXB 4KP3C 2WU5A 4IE7A 4Z91A 2E9XC 4I55E 2H7VC 4DVDA 3TKLB 1KNZA 4X64T 5KX5E 2LLYA 2YU1A 1SA0E 2PJQA 2C5IT 3PE0A 2FJEA 2CHOA 3C64A 5LG4A 2LT3A 3IA3A 5DJQC 2VL0A 4NUVA 1UX5A 5LJNA 3E08A 4LFCT 3C50A 3UU6A 2NOXA 2M6IA 5LOVE 5E0OA 3KBTA 2BVLA 3CMLA 2Y48B 4DBQA 3AEEA 5JDFA 4ZHQE 1IBLT 2CBIA 2XQ4A 4LF5T 3A7MA 2A72A 2XQ3A 3OKQA 3I0OA 4TNVA 3VR8A 2WAUA 4CN4A 1B7TA 2EHOC 3N9QA 4UV8B 5AQGB 3RKGA 3WI3A 3AAIA 3RRCA 4GYRA 3CK6A 2I6HA 2VKDA 5AQRB 3TLWA 4M1PA 3AE5A 3ABVA 2V7IA 2WU2A 3LFMA 5BMVE 3RYCE 2WBLA 4ILBA 2XASB 3QOFA 4EEDA 3H37A 4ZEYA 4EB6E 5HXRA 3RIUA 4AQFA 4B3ST 2V6XA 2V7JA 4GK0E 3LJCA 4UV9B 2NW8A 4AKHA 3RH3A 2YDRA 2LM9A 2CXFA 1G8XA 4DV5T 4BJNA 2LM2A 4JI0T 1H7CA 2MBGA 2KINB 4QXHB 5M4YA 4EZHA 3P7IA 3MK7C 5JDNA 2E2AA 5KXJA 3EVYA 3PUVF 1N36T 2X51A 3UU8A 2LSJA 3K8PC 3FXEB 1VRBA 3DTOA 3C4WA 4JV5T 2W4XA 4X1KE 1BR4A 4ZI7E 4EYYR 2Y8DA 4AQYT 3UUNA 3ZMZB 4IE5A 4HN9A 1T7SA 5LGNB 2DI4A 3OYZA 4U3CA 4H9NC 3NZPA 2LJLA 1NEKA 1MIYA 4TWDA 3GA8A 3HR0A 5FVLA 1XNQT 2XAQB 3L8RA 4I50E 2IHR1 3T1HT 1KNPA 2V7MA 1OEDA 4HWFA 3VRAA 4Q25A 1L0VA 3FZKB 1S35A 1M62A 2LEHA 3VKHA 2V7LA 2WQYA 4QH4A 4NXNT 2E9XB 3MKDA 5H6RB 3ETUA 4UEMA 3EAMA 3ESLA 2YU2A 5LNKA 2NP9A 5HEJA 4QWNB 4PW8A 1KFYA 5LP6E 2J47A 4IREA 4GKJT 5FKYA 1DU2A 2G0UA 4DV2T 2XJ7A 1WYBA 1VCSA 3PJAA 3HKCE 1WYCA 2RPAA 2ZM0A 5JDHA 2XHEB 2V5DA 3RIFA 1ZKEA 1R8IA 4ZS3A 4EGWA 4H9OC 4MHCA 3N9PA 1UURA 1HCIA 1IBMT 3CWZB 4TNWA 3U3IA 4X20E 4I4TE 2LSYA 2W62A 4DO0A 3AB3B 3P8CD 2EHOB 2WWUA 2D0UA 2V6YA 2QYWA 3CX8B 4X1YE 1XNRT 5DABA 2CE7A 2ZM6T 4XZCA 1QLBA 4ZI2C 2V6YB 2J62A 4PJNA 2HPJA 5C8YE 1Y64B 5FVKA 2UUCT 5LJMA 3AE7A 2DL1A 3BQLA 5LMUT 2JJ9A 2OV9A 2ZMAA 2NW7A 3AEBA 5IWAT 2WDRA 2BG9A 1WFDA 4U72A 4EIWA 3NRXA 2L8KA 3O1IA 4ISSA 3N9NA 4C91A 2UXBT 5IYZE 2KSRA 4Z8XA 4ZI3C 3UU5A 3K3QC 4CN1A 4LF6T 4IL9A 2DWKA 5L2LA 4G63A 4A5XA 5AQIB 3Q5WA 4O2BE 2WY2A 2XSAA 3X1DA 5JTGA 1D1CA 2XAJB 2CMRA 3ETVA 3VR9A 3AVSA 5FXVA 1KK7A 5IHYA 5L3FB 2ODVA 3DJBA 2XQ5A 1FMVA 4IGUA 2LKHA 3P4PA 4UVAB 3N5LA 5FXXA 1N34T 3PJAJ 3GN5A 1HS7A 3ZSTA 4PFOA 1W0AA 5HEUA 5JQGE 1ZP0A 2Q9QD 2KWHA 5L3CB 4WBOA 4IDZA 4PFPA 1KNRA 2XZEA 4JI7T 2V7KA 2XQ8A 3EDVA 2MTQA 1YQ4A 4DUZT 4IL4A 5DQWA 4PJLA 3CX7B 2V8SV 4G2AA 5FY7A 2R6GF 4QKNA 4UXNB 1D0YA 2RA1A 3KFWX 3LG7A 5JDQA 4OK0A 5HEHA 5J2TE 1UX4A 2D9DA 2WP9A 5ABFA 3ZC0A 3PU3A 3HKBE 4O4JE 1E2AA 3EI0A 2AXDS 2UXDT 5JRCA 5AQUB 4AQFC 1FJGT 4KUMB 3UU3A 3ZCIA 3I0QA 3ZT5A 2HN2A 4HFVA 4I43B 3PUWF 4ZZBA 4I0UA 4JI8T 2KT9A 2W66A 4JI2T 4X5TA 4BA9A 2XQ7A 3MZKB 1OWAA 2WSSV 1WLXA 4PNIA 2E5VA 3TLVA 5EK2A 1UK5A 1WCRA 3AECA 4KHPT 3UFGA 4AKLA 1MIVA 2ZM8A 3ONXA 5F8PA 4LFBT 2F4VT 3ZSSA 2LRKA 5ABGA 3J9X1 2JRKA 3ZT6A 1BR2A 1YW0A 4NIQA 3ZN0B 1CUNA 2FJAA 3U78A 2UXNB 3TLUA 1LVFA 2BDEA 1YKHB 4C90A 5HXSA 3FHNA 2VKJA 1MMDA 3RQWA 1HG5A 2N9DA 3EABA 3F31A 2LRLA 5ABHA 3RYFE 3MA9A 3ZCJA 2NTYA 1CHUA 3P4QA 4U33A 3FZFB 2CLYC 5BR8T 2ACZA 1OEDC 5A1LA 4HWDA 5LA6E 1D1AA 3TLSA 2OLTA 3NWIA 4JLEA 5HXCA 1J5WA 4AI6A 4DNDA 4TN7B 4MLKA 1X79A 2XQAA 3D0TA 2B76A 2YEVC 5LGTB 3KBUA 3RC8A 4U2ZA 3CQGB 3Q5DA 1V9DA 1XDPA 3JCFA 1LKXA 2WM9A 4HFBA 4LFAT 1QSDA 1HNZT 4UR9A
chains in the Genus database with same CATH topology
1J5ET 1N32T 2ZM6T 4KHPT 4DV0T 4DR3T 1HR0T 2UUBT 1XNQT 4OX9T 4LFBT 1XMOT 2F4VT 4DV6T 5LMNT 1N33T 4JI7T 4DV4T 3T1HT 2UUCT 4DUZT 4X64T 4GKKT 4LF4T 5LMUT 1HNXT 4NXMT 4DUYT 1XMQT 5IWAT 4YY3T 4B3ST 4LF7T 4B3MT 4NXNT 4LFCT 2UXCT 2UXBT 4K0KT 4X65T 1HNWT 4LF9T 4DV5T 4X62T 4JI1T 4JYAT 5BR8T 4GKJT 2UXDT 2HHHT 4DV2T 4JI0T 4JI3T 1IBLT 4LF6T 4DV7T 4LF5T 4YHHT 4X66T 4LF8T 1FJGT 1IBKT 4DR2T 4DV1T 4JI6T 4B3RT 4DV3T 4B3TT 1N36T 4JI4T 3OTOT 4JI8T 3T1YT 4JI5T 2E5LT 4DR6T 2UUAT 4JI2T 4DR1T 1I94T 1IBMT 4JV5T 4DR4T 2UU9T 4LFAT 4AQYT 2VQET 2VQFT 1HNZT 4DR5T 1XNRT 4DR7T 1N34T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E T;  1N32 T;  2ZM6 T;  4KHP T;  4DV0 T;  4DR3 T;  1HR0 T;  2UUB T;  1XNQ T;  4OX9 T;  4LFB T;  1XMO T;  2F4V T;  4DV6 T;  5LMN T;  1N33 T;  4JI7 T;  4DV4 T;  3T1H T;  2UUC T;  4DUZ T;  4X64 T;  4GKK T;  4LF4 T;  5LMU T;  1HNX T;  4NXM T;  4DUY T;  1XMQ T;  5IWA T;  4YY3 T;  4B3S T;  4LF7 T;  4B3M T;  4NXN T;  4LFC T;  2UXC T;  2UXB T;  4K0K T;  4X65 T;  1HNW T;  4LF9 T;  4DV5 T;  4X62 T;  4JI1 T;  4JYA T;  5BR8 T;  4GKJ T;  2UXD T;  2HHH T;  4DV2 T;  4JI0 T;  4JI3 T;  1IBL T;  4LF6 T;  4DV7 T;  4LF5 T;  4YHH T;  4X66 T;  4LF8 T;  1FJG T;  1IBK T;  4DR2 T;  4DV1 T;  4JI6 T;  4B3R T;  4DV3 T;  4B3T T;  1N36 T;  4JI4 T;  3OTO T;  4JI8 T;  3T1Y T;  4JI5 T;  2E5L T;  4DR6 T;  2UUA T;  4JI2 T;  4DR1 T;  1I94 T;  1IBM T;  4JV5 T;  4DR4 T;  2UU9 T;  4LFA T;  4AQY T;  2VQE T;  2VQF T;  1HNZ T;  4DR5 T;  1XNR T;  4DR7 T;  1N34 T; 
#chains in the Genus database with same CATH topology
 5F5W A;  5L4E A;  1FEW A;  3MAC A;  1ZOY A;  2Y6X A;  3FB2 A;  1YKE B;  5J2U E;  2XM2 A;  2QVA A;  4YXD A;  5KDM C;  2M6B A;  1E7P A;  3HKE E;  5CA0 E;  4GIW A;  4L5G A;  3ZJ1 A;  3KVA A;  5FL1 A;  1HG2 A;  2BKO A;  4ZS2 A;  2A3D A;  2X68 A;  4TWH A;  3ZEF B;  3AA1 B;  3QB5 A;  1OED E;  4B3M T;  2JQK A;  3A5X A;  4ILA A;  4QHO A;  4CN6 A;  3AE4 A;  3QB5 K;  3ONL C;  3RPU A;  4LMK A;  2MPK A;  4TZ4 C;  4HKA A;  1UCU A;  4HWC A;  4HFE A;  1J1J A;  2YDS A;  3NBX X;  2BG9 C;  4H9Q C;  5CB4 E;  3NKZ A;  4NUU A;  4COF A;  3SS1 A;  1US7 B;  3M65 A;  5JR9 C;  4ILU A;  4AKR B;  3Q2M A;  2VKH A;  3H3A A;  1MNE A;  1WR0 A;  4TX5 A;  1T8B A;  1I94 T;  2WDQ A;  2CPT A;  4QX8 B;  1NEN A;  1O3X A;  1ZHC A;  3I1A A;  5HEO A;  4LML A;  2H7O A;  2UU9 T;  2K3W A;  3N2O A;  2KLQ A;  4WYV A;  5LYJ E;  3LBX A;  4IT4 A;  2BVM A;  2E9X D;  4BJM A;  2X66 A;  1SUM B;  3M3Z B;  5AQT B;  5EK4 A;  2UUB T;  3PTR B;  2VAS A;  1T98 A;  4MAL A;  2IML A;  2YIN A;  2BBH A;  2B1E A;  4O4L E;  3LBX B;  4GKK T;  2XUE A;  5JRE A;  2WZI A;  3N9M A;  2LHR A;  2JIW A;  1XMQ T;  4IE0 A;  2LOS A;  4UF0 A;  3JAF A;  4F8H A;  4U74 A;  2MOZ A;  3PV0 F;  4HTE A;  2IIU A;  2BS4 A;  3SRZ A;  2A9U A;  3RX6 A;  3PU8 A;  2CXD A;  3RYH E;  2BG9 E;  4ASK A;  1FIO A;  1HNW T;  4KHZ F;  4JI1 T;  4UF0 B;  2X9Y A;  1U5P A;  2V5C A;  2EHO D;  2CA5 A;  3RLF F;  1IBK T;  3RC3 A;  4AIU A;  2CLY B;  1OED B;  2L9Q A;  3AEF A;  1WR6 A;  5AQM B;  3T1Y T;  4AQG A;  4H9S E;  4KX6 A;  3N9L A;  4H9R C;  3C4Z A;  3CX6 B;  4KMC A;  1W9R A;  2D0T A;  5LCY A;  2DHR A;  2XTL A;  1Y01 A;  2W67 A;  5H6Q B;  2CWO A;  3AAE B;  1I6Z A;  2C5K T;  2X0L B;  4P0A A;  4GYS A;  5AFU L;  2XQY A;  2YK0 A;  4EZ4 A;  2K48 A;  2YN6 A;  1S94 A;  3EDU A;  3O1H A;  1BR0 A;  3Q5E A;  4JEH B;  3L39 A;  5HCJ A;  2MAW A;  2X9W A;  4CI1 B;  4XAX B;  1XDO A;  3W15 B;  1AJ3 A;  3UU4 A;  5AQS B;  3PUY F;  2VK9 A;  3NZQ A;  4YTP A;  2V26 A;  4MFR A;  2NW9 A;  3P4W A;  1KF6 A;  1NAF A;  5FL0 A;  4DMV A;  2VB6 A;  5AQL B;  3AEG A;  3ZJ2 A;  1IZN B;  5AQK B;  4OHF A;  4DR2 T;  3EHZ A;  3HKD E;  4HFC A;  2I59 A;  5JR9 A;  1D0Z A;  4IDQ A;  4B3T T;  3CIR A;  2LSK A;  5AQN B;  1YXR A;  3N9O A;  5HXE A;  3MXZ A;  3O4X E;  4A98 A;  3JC6 C;  2BG9 B;  5JDG A;  3AA0 B;  3N2K E;  5FY1 A;  4EAH A;  5JR9 B;  1YQ3 A;  2WMO A;  2PTF A;  2XY8 B;  4ILC A;  3ZLI A;  1N32 T;  1Z0P A;  4PJM A;  2D5U A;  4DR3 T;  4TUY E;  1HF8 A;  3B5M A;  3VRB A;  5LMN T;  4DV6 T;  4DV4 T;  3GMI A;  5L3B B;  3ZC1 A;  4A56 A;  1UGO A;  3AE2 A;  4AKI A;  2N1G A;  2KXP B;  2K5B B;  3ZMT B;  3F57 A;  4LF7 T;  3CPZ A;  2MYS A;  2YKS A;  2UXC T;  4IHJ E;  5CFB A;  3G06 A;  2KWI B;  2HPL A;  4V1A v;  2P9B A;  4K0K T;  2DLR A;  3PDY A;  3GN5 B;  3BQK A;  2LE8 A;  3SOL A;  2QGS A;  3RIA A;  4H63 H;  4DV7 T;  2CHN A;  2VVN A;  4X66 T;  4PK4 A;  4YSX A;  3FZH B;  4ZZC A;  2PBI A;  1Z8U A;  3WAJ A;  1HX1 B;  3PUX F;  3KV4 A;  4X1I E;  3KIN B;  2W0G A;  3ANW A;  2W2U A;  4OYK A;  2LHN A;  1MMG A;  3HA4 A;  1MND A;  5HEG A;  2LSG A;  4YJ2 E;  5IUX A;  3QNU A;  5ABF B;  5L3E B;  4HFD A;  1MIW A;  2CWY A;  5HCM A;  5DQV A;  2JMK A;  2ODU A;  4P09 A;  2WWV A;  4ZI2 D;  5JRC B;  3ANW B;  1J5E T;  3QUJ A;  3PUS A;  4IDO A;  1WRD A;  4HWI B;  3AE6 A;  4HFH A;  3RKO A;  4DID B;  3B57 A;  5LHG B;  4IIJ E;  4U31 A;  2ES0 A;  5FMN A;  4YY3 T;  2FJD A;  5LBM A;  2ACX A;  4ZI3 D;  5AQJ B;  4ERR A;  3AE3 A;  3FBL A;  4L0R A;  5LHI B;  3IF8 B;  3QC9 A;  4CI2 B;  4X65 T;  4O2A E;  3ONJ A;  4AKG A;  5EZY E;  3PUQ A;  1IJ6 A;  4EYU A;  3KV6 A;  3QK6 A;  2L3L A;  4YHH T;  1ZV4 X;  1W09 A;  4H9P C;  4PK6 A;  4IE6 A;  3UFE A;  4DV1 T;  3BK9 A;  3EUH A;  2H88 A;  2V1D B;  3RF1 A;  5LGU B;  4YTM A;  3K1S A;  4YLH A;  5HXH A;  5HWX A;  5HAX A;  2IUB A;  1VCT A;  4TWF A;  3OBV E;  1GQE A;  3AED A;  4DR5 T;  2WMN A;  4WW0 A;  3O1J A;  3ZYK A;  3NRY A;  3HL6 A;  1KEY A;  5LXT E;  4H63 V;  4DV0 T;  5ABE A;  5JDL A;  3LSV A;  4OX9 T;  5JDM A;  1FMW A;  1XMO T;  1OXZ A;  4WZX A;  4YT0 A;  4UIG A;  2D2S A;  3K3N A;  5FXZ A;  4PJJ A;  1HTJ F;  4U7I A;  2K9A A;  2WS3 A;  4QH5 A;  1HFA A;  4QXC B;  2NTX A;  2QA7 A;  1LVK A;  1W0B A;  4JEU B;  1T72 A;  5FXW A;  4IDP A;  2E8I A;  4KI0 F;  3BQI A;  2BS3 A;  2DNX A;  3H3M A;  3UTK A;  4N78 D;  2X67 A;  3V5U A;  3E0Z A;  4CZZ B;  3P50 A;  3RHW A;  3ZYM A;  2WB5 A;  3FBZ A;  5TAO A;  1MMN A;  4YHJ A;  4JI6 T;  4B3R T;  3UQ7 A;  3PUZ F;  3RQU A;  2LOP A;  3AE8 A;  2VKO A;  4B6X A;  3ZMU B;  3AVR A;  4QH1 A;  3OVU A;  2XQ9 A;  3UUX B;  2JPF A;  3Q5X A;  2H3R A;  1XWM A;  1IJ5 A;  1QUU A;  3ZMV B;  2VQF T;  1E1H B;  4YSZ A;  5C2T A;  2I0M A;  4A97 A;  2GK9 A;  2CBJ A;  2YDQ A;  4TV9 E;  3OPC A;  4XBF B;  4CI3 B;  4YSY A;  4ANJ A;  3GWH A;  3UQ4 A;  3F2E A;  4EOZ B;  4UVC B;  3S4U A;  2YOE A;  4YJ3 E;  5AQP B;  5CJ5 A;  4LF4 T;  5FYM A;  3ZKR A;  2JQ9 A;  3OYX A;  5CA1 E;  3C4X A;  3ZN1 B;  3AAA B;  2H89 A;  3B13 A;  3P4R A;  5C3J A;  3IBP A;  2ZLY A;  4O4I E;  4ZXL A;  2A2F X;  4LF9 T;  3L3P A;  4JI3 T;  2J1D G;  2BKN A;  2W63 A;  5EK3 A;  5LHH B;  2IDO B;  1U4Q A;  4YFS A;  3LDQ B;  5L4H A;  3I9W A;  2WDV A;  4J2C A;  3JAD A;  2X9X A;  3CVR A;  5FNV E;  3LK2 B;  5LBQ B;  4F6R C;  4DR4 T;  2NR4 A;  5AQF B;  3UT5 E;  2E9X A;  3CQX C;  5AQH B;  3AEA A;  2VQE T;  4GK5 E;  4DR7 T;  5FP3 A;  2AE9 A;  4JBW F;  5L3G B;  3ZT7 A;  1XZY A;  4HFI A;  1IAP A;  4QXB B;  2XM1 A;  4UVB B;  4U2Y A;  4YTN A;  2KZ7 B;  2M67 A;  2Q9Q C;  3NVO A;  3RGL A;  3FXD B;  4DUY T;  5KMG P;  3R84 B;  2HH7 A;  3C98 B;  5AQQ B;  1ZEE A;  4NPP A;  5JVD E;  1D0X A;  3K3O A;  3AA6 B;  4IDN A;  4O4H E;  2EHO A;  3UUL A;  4X62 T;  4FI5 A;  3SFE A;  2HHH T;  5AQO B;  3AE9 A;  4OYJ A;  3A8Y C;  4L9I A;  2JMH A;  3P4S A;  4HWH A;  3MJX A;  2C0S A;  4DV3 T;  2OA5 A;  4UEL A;  2W61 A;  4MBQ A;  2BS2 A;  3HI2 A;  2LKG A;  2CM0 A;  4QX7 B;  3OTO T;  4P0B A;  4PK5 A;  4BAY B;  1SE7 A;  4JI5 T;  4DR1 T;  2X9H A;  2IAK A;  4TV8 E;  3FZM B;  1HX8 A;  4CXW A;  2RP4 A;  4ADZ A;  2VWA A;  1M7K A;  1MMA A;  2BBJ A;  3IHR A;  4KBM B;  3PUA A;  4CQI A;  2FBW A;  3VU7 H;  2NWB A;  1N33 T;  4JUY A;  4GOU A;  2XAG B;  2C5J A;  2IW5 B;  1VOM A;  4HE8 A;  5F3J A;  5LG3 A;  5AQV B;  4AXP A;  2PG8 A;  5J0Z A;  4AIS A;  3SWH A;  3C51 A;  1X9B A;  2QRX A;  2W00 A;  3SFD A;  2Z6E A;  3R6N A;  2DCF A;  5LB7 B;  5GON E;  1YD8 G;  3CQC B;  3N2G E;  3ZYL A;  5HYA A;  1D1B A;  4JI4 T;  2WZH A;  5J1G A;  3L09 A;  2E5L T;  4OFZ A;  3PUR A;  4DBR A;  2CCQ A;  3T8O A;  4EV6 A;  3TLT A;  2JQQ A;  4HGA A;  4WBN E;  3LK4 2;  2HN1 A;  3RI5 A;  3DP7 A;  2SPC A;  5ADX L;  4HEA A;  4FJO A;  2VL8 A;  2KMF A;  1HR0 T;  2XAH B;  3WAK A;  1UUS A;  2XSB A;  4CXY A;  2VVS A;  2J4G A;  2Q9Q A;  2X0Y A;  1G73 A;  3KDS E;  3E22 E;  2CRB A;  3IEE A;  3V5S A;  4IE4 A;  1HNX T;  4NXM T;  4EXT A;  3UUM A;  2IC6 A;  3RIU C;  3RYI E;  2KND A;  4U7Y A;  2XAF B;  1BR1 A;  3OJA A;  3FZL B;  2XQ6 A;  2Q9Q B;  3Q9D A;  4PAG A;  4EEB A;  1JNR A;  3UUB A;  4Z90 A;  2PFV A;  4JYA T;  1SHZ C;  2IC9 A;  3I9Y A;  3KV5 A;  2CXL A;  4LMJ A;  1EZ3 A;  2K24 A;  4K0U A;  4LF8 T;  5HWY A;  3KV9 A;  4P1N A;  3PUG A;  3AA7 B;  4O8S A;  3ZPO A;  3JC6 D;  4E7Z A;  2WCA A;  4DMW A;  1NWM X;  2DWG A;  2XPK A;  3JAE A;  4ZOL E;  2VUR A;  3AE1 A;  2LSI A;  5L3D B;  4DR6 T;  5L47 A;  2UUA T;  5FY0 A;  2CEA A;  2FJB A;  3J7Y q;  1JNZ A;  3CKD A;  2X0H A;  2FUP A;  2ZM2 A;  3VHL A;  5JH7 E;  3AXJ A;  3LK3 B;  5ETW A;  3KVB A;  3ZMS B;  3RRW A;  5CGM A;  2JQH A;  2BKP A;  4WNK A;  4CXX A;  1LRZ A;  3O9X A;  4IST A;  2N2N A;  4E7S A;  3VKG A;  2BZB A;  3AXJ B;  2UXX B;  4KP3 C;  2WU5 A;  4IE7 A;  4Z91 A;  2E9X C;  4I55 E;  2H7V C;  4DVD A;  3TKL B;  1KNZ A;  4X64 T;  5KX5 E;  2LLY A;  2YU1 A;  1SA0 E;  2PJQ A;  2C5I T;  3PE0 A;  2FJE A;  2CHO A;  3C64 A;  5LG4 A;  2LT3 A;  3IA3 A;  5DJQ C;  2VL0 A;  4NUV A;  1UX5 A;  5LJN A;  3E08 A;  4LFC T;  3C50 A;  3UU6 A;  2NOX A;  2M6I A;  5LOV E;  5E0O A;  3KBT A;  2BVL A;  3CML A;  2Y48 B;  4DBQ A;  3AEE A;  5JDF A;  4ZHQ E;  1IBL T;  2CBI A;  2XQ4 A;  4LF5 T;  3A7M A;  2A72 A;  2XQ3 A;  3OKQ A;  3I0O A;  4TNV A;  3VR8 A;  2WAU A;  4CN4 A;  1B7T A;  2EHO C;  3N9Q A;  4UV8 B;  5AQG B;  3RKG A;  3WI3 A;  3AAI A;  3RRC A;  4GYR A;  3CK6 A;  2I6H A;  2VKD A;  5AQR B;  3TLW A;  4M1P A;  3AE5 A;  3ABV A;  2V7I A;  2WU2 A;  3LFM A;  5BMV E;  3RYC E;  2WBL A;  4ILB A;  2XAS B;  3QOF A;  4EED A;  3H37 A;  4ZEY A;  4EB6 E;  5HXR A;  3RIU A;  4AQF A;  4B3S T;  2V6X A;  2V7J A;  4GK0 E;  3LJC A;  4UV9 B;  2NW8 A;  4AKH A;  3RH3 A;  2YDR A;  2LM9 A;  2CXF A;  1G8X A;  4DV5 T;  4BJN A;  2LM2 A;  4JI0 T;  1H7C A;  2MBG A;  2KIN B;  4QXH B;  5M4Y A;  4EZH A;  3P7I A;  3MK7 C;  5JDN A;  2E2A A;  5KXJ A;  3EVY A;  3PUV F;  1N36 T;  2X51 A;  3UU8 A;  2LSJ A;  3K8P C;  3FXE B;  1VRB A;  3DTO A;  3C4W A;  4JV5 T;  2W4X A;  4X1K E;  1BR4 A;  4ZI7 E;  4EYY R;  2Y8D A;  4AQY T;  3UUN A;  3ZMZ B;  4IE5 A;  4HN9 A;  1T7S A;  5LGN B;  2DI4 A;  3OYZ A;  4U3C A;  4H9N C;  3NZP A;  2LJL A;  1NEK A;  1MIY A;  4TWD A;  3GA8 A;  3HR0 A;  5FVL A;  1XNQ T;  2XAQ B;  3L8R A;  4I50 E;  2IHR 1;  3T1H T;  1KNP A;  2V7M A;  1OED A;  4HWF A;  3VRA A;  4Q25 A;  1L0V A;  3FZK B;  1S35 A;  1M62 A;  2LEH A;  3VKH A;  2V7L A;  2WQY A;  4QH4 A;  4NXN T;  2E9X B;  3MKD A;  5H6R B;  3ETU A;  4UEM A;  3EAM A;  3ESL A;  2YU2 A;  5LNK A;  2NP9 A;  5HEJ A;  4QWN B;  4PW8 A;  1KFY A;  5LP6 E;  2J47 A;  4IRE A;  4GKJ T;  5FKY A;  1DU2 A;  2G0U A;  4DV2 T;  2XJ7 A;  1WYB A;  1VCS A;  3PJA A;  3HKC E;  1WYC A;  2RPA A;  2ZM0 A;  5JDH A;  2XHE B;  2V5D A;  3RIF A;  1ZKE A;  1R8I A;  4ZS3 A;  4EGW A;  4H9O C;  4MHC A;  3N9P A;  1UUR A;  1HCI A;  1IBM T;  3CWZ B;  4TNW A;  3U3I A;  4X20 E;  4I4T E;  2LSY A;  2W62 A;  4DO0 A;  3AB3 B;  3P8C D;  2EHO B;  2WWU A;  2D0U A;  2V6Y A;  2QYW A;  3CX8 B;  4X1Y E;  1XNR T;  5DAB A;  2CE7 A;  2ZM6 T;  4XZC A;  1QLB A;  4ZI2 C;  2V6Y B;  2J62 A;  4PJN A;  2HPJ A;  5C8Y E;  1Y64 B;  5FVK A;  2UUC T;  5LJM A;  3AE7 A;  2DL1 A;  3BQL A;  5LMU T;  2JJ9 A;  2OV9 A;  2ZMA A;  2NW7 A;  3AEB A;  5IWA T;  2WDR A;  2BG9 A;  1WFD A;  4U72 A;  4EIW A;  3NRX A;  2L8K A;  3O1I A;  4ISS A;  3N9N A;  4C91 A;  2UXB T;  5IYZ E;  2KSR A;  4Z8X A;  4ZI3 C;  3UU5 A;  3K3Q C;  4CN1 A;  4LF6 T;  4IL9 A;  2DWK A;  5L2L A;  4G63 A;  4A5X A;  5AQI B;  3Q5W A;  4O2B E;  2WY2 A;  2XSA A;  3X1D A;  5JTG A;  1D1C A;  2XAJ B;  2CMR A;  3ETV A;  3VR9 A;  3AVS A;  5FXV A;  1KK7 A;  5IHY A;  5L3F B;  2ODV A;  3DJB A;  2XQ5 A;  1FMV A;  4IGU A;  2LKH A;  3P4P A;  4UVA B;  3N5L A;  5FXX A;  1N34 T;  3PJA J;  3GN5 A;  1HS7 A;  3ZST A;  4PFO A;  1W0A A;  5HEU A;  5JQG E;  1ZP0 A;  2Q9Q D;  2KWH A;  5L3C B;  4WBO A;  4IDZ A;  4PFP A;  1KNR A;  2XZE A;  4JI7 T;  2V7K A;  2XQ8 A;  3EDV A;  2MTQ A;  1YQ4 A;  4DUZ T;  4IL4 A;  5DQW A;  4PJL A;  3CX7 B;  2V8S V;  4G2A A;  5FY7 A;  2R6G F;  4QKN A;  4UXN B;  1D0Y A;  2RA1 A;  3KFW X;  3LG7 A;  5JDQ A;  4OK0 A;  5HEH A;  5J2T E;  1UX4 A;  2D9D A;  2WP9 A;  5ABF A;  3ZC0 A;  3PU3 A;  3HKB E;  4O4J E;  1E2A A;  3EI0 A;  2AXD S;  2UXD T;  5JRC A;  5AQU B;  4AQF C;  1FJG T;  4KUM B;  3UU3 A;  3ZCI A;  3I0Q A;  3ZT5 A;  2HN2 A;  4HFV A;  4I43 B;  3PUW F;  4ZZB A;  4I0U A;  4JI8 T;  2KT9 A;  2W66 A;  4JI2 T;  4X5T A;  4BA9 A;  2XQ7 A;  3MZK B;  1OWA A;  2WSS V;  1WLX A;  4PNI A;  2E5V A;  3TLV A;  5EK2 A;  1UK5 A;  1WCR A;  3AEC A;  4KHP T;  3UFG A;  4AKL A;  1MIV A;  2ZM8 A;  3ONX A;  5F8P A;  4LFB T;  2F4V T;  3ZSS A;  2LRK A;  5ABG A;  3J9X 1;  2JRK A;  3ZT6 A;  1BR2 A;  1YW0 A;  4NIQ A;  3ZN0 B;  1CUN A;  2FJA A;  3U78 A;  2UXN B;  3TLU A;  1LVF A;  2BDE A;  1YKH B;  4C90 A;  5HXS A;  3FHN A;  2VKJ A;  1MMD A;  3RQW A;  1HG5 A;  2N9D A;  3EAB A;  3F31 A;  2LRL A;  5ABH A;  3RYF E;  3MA9 A;  3ZCJ A;  2NTY A;  1CHU A;  3P4Q A;  4U33 A;  3FZF B;  2CLY C;  5BR8 T;  2ACZ A;  1OED C;  5A1L A;  4HWD A;  5LA6 E;  1D1A A;  3TLS A;  2OLT A;  3NWI A;  4JLE A;  5HXC A;  1J5W A;  4AI6 A;  4DND A;  4TN7 B;  4MLK A;  1X79 A;  2XQA A;  3D0T A;  2B76 A;  2YEV C;  5LGT B;  3KBU A;  3RC8 A;  4U2Z A;  3CQG B;  3Q5D A;  1V9D A;  1XDP A;  3JCF A;  1LKX A;  2WM9 A;  4HFB A;  4LFA T;  1QSD A;  1HNZ T;  4UR9 A; 
#chains in the Genus database with same CATH homology
 1J5E T;  1N32 T;  2ZM6 T;  4KHP T;  4DV0 T;  4DR3 T;  1HR0 T;  2UUB T;  1XNQ T;  4OX9 T;  4LFB T;  1XMO T;  2F4V T;  4DV6 T;  5LMN T;  1N33 T;  4JI7 T;  4DV4 T;  3T1H T;  2UUC T;  4DUZ T;  4X64 T;  4GKK T;  4LF4 T;  5LMU T;  1HNX T;  4NXM T;  4DUY T;  1XMQ T;  5IWA T;  4YY3 T;  4B3S T;  4LF7 T;  4B3M T;  4NXN T;  4LFC T;  2UXC T;  2UXB T;  4K0K T;  4X65 T;  1HNW T;  4LF9 T;  4DV5 T;  4X62 T;  4JI1 T;  4JYA T;  5BR8 T;  4GKJ T;  2UXD T;  2HHH T;  4DV2 T;  4JI0 T;  4JI3 T;  1IBL T;  4LF6 T;  4DV7 T;  4LF5 T;  4YHH T;  4X66 T;  4LF8 T;  1FJG T;  1IBK T;  4DR2 T;  4DV1 T;  4JI6 T;  4B3R T;  4DV3 T;  4B3T T;  1N36 T;  4JI4 T;  3OTO T;  4JI8 T;  3T1Y T;  4JI5 T;  2E5L T;  4DR6 T;  2UUA T;  4JI2 T;  4DR1 T;  1I94 T;  1IBM T;  4JV5 T;  4DR4 T;  2UU9 T;  4LFA T;  4AQY T;  2VQE T;  2VQF T;  1HNZ T;  4DR5 T;  1XNR T;  4DR7 T;  1N34 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...