3KV9A

Structure of kiaa1718 jumonji domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 116
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv9A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv9A01
2PXJA 5FYBA 5A7OA 5FZCA 4CSWA 5FYVA 5A7WB 4CCJA 5F3IA 5FZDA 4CUGA 4HONA 5KR7A 5FWEA 5FZ4A 5FYTA 5A1FA 5A7PA 4QU1A 5FYYA 5IVYA 2Q8CA 2Q8DA 4XDOA 2OX0A 5FXVA 3UYJA 2WWJA 3DXTA 4LXLA 5FXWA 3N9LA 2XDVA 4XDPA 3NJYA 4QX7A 5F3EA 5LW9A 4CCMA 5FZ6A 4LITA 4LIUA 4HOOA 5FXZA 3AL6A 4IGOA 3K3NA 3KVAA 5FYZA 4IGPA 4Y33A 5IVEA 5F37A 4GAZA 3KV6A 4Y4RA 5FZLA 4URAA 3N9QA 5FPLA 4GJYA 3U78A 5FZOA 5FYCA 5FYMA 5A1LA 3KV9A 2OQ7A 3PUAA 5E6HA 5FJKA 5FZEA 3U4SA 4BU2A 5F3CA 4GJZA 4DO0A 4CCLA 3KV4A 2OS2A 5FP7A 4CCOA 3PUSA 3N9OA 5F32A 4LIVA 3KV5A 5A7NA 4D6SA 5FY4A 5FZFA 5FYUA 3PURA 4UF0A 5FPVA 3ZLIA 3LD8A 4AAPA 5FY7A 5FZGA 3AVSA 5A3PA 5IVCA 2YU2A 4QXCA 5FZHA 2WWUA 2XMLA 4D6RA 3OPTA 4EYUA 3K2OA 4QWNA 2YBKA 5FYIA 5A3TA 5CEHA 3PU3A 3N9NA 4GD4A 2GP5A 4ASKA 5FYHA 4CCKA 5LY1A 4V2VA 5F39A 5IWFA 4NUBA 5FJHA 5FPUA 5F5AA 4QXHA 5F2SA 2XUEA 5FP4A 3AL5A 3K3OA 4BXFA 5FZAA 5FY5A 4C8DA 2OQ6A 5FZIA 5FPAA 5IVBA 5FZKA 5FPBA 5A3WA 5LY2A 5FP8A 5FZ8A 5A7QA 4IGQA 5FZBA 3PTRB 3LDBA 4AI9A 5A7WA 5F5CA 3N9MA 5F2WA 5FBJA 5FXXA 4BISA 5FY0A 4CCNA 4EZHA 5IVFA 5FYSA 5IVVA 5ISLA 3KVBA 5ANQA 5FUPA 4E4HA 4EZ4A 5FP3A 5FZ3A 5FZ7A 4UF0B 5FP9A 2XXZA 2GP3A 5FY9A 3N9PA 3DXUA 5A3NA 5F5IA 2Q8EA 5K4LA 5IW0A 2W2IA 4TN7A 5FZ0A 5FZ9A 5IVJA 4DIQA 5FY1A 2VD7A 4Y3OA 2P5BA 5FZMA 5A80A 3PU8A 4D6QA 5FZOB 3AVRA 1VRBA 3PDQA 5LWBA 4V2WA 4QXBA 5FY8A 5FV3A 2YU1A 3ZPOA 2YBPA 3RVHA 2YBSA 4QX8A 5FZ1A 3OPWA 2OT7A 5F3GA 3PUQA 5A7SA 5FUNA 5FWJA 2YPDA
chains in the Genus database with same CATH superfamily
2BBJA 3NV2A 3NRXA 2W00A 5FZ4A 3JU9A 4NPPA 3FUOA 3VBRB 4E2QA 3QCWA 4EAHA 2MHFA 2WS93 4FPHA 1OA3A 4D8MA 2UY8A 4PF5A 3SKVA 4O8SA 4CXXA 2WR9A 1XMQT 5CADA 1NT0A 4I01A 2PAMA 5CB7A 4ISQA 1WZXA 4IDNA 2V5YA 3MFCA 5FYHA 4FI9A 4HWIB 1O5LA 4GK5E 4U7YA 3K3OA 4QM9A 4YTPA 3NV3A 4MX3A 1VAVA 5H9PA 2XOMA 3AP6A 3VZKA 3AE3A 2VBDA 5FKCA 5F2WA 1IKQA 1PM4A 3OBRA 1CIYA 2A70A 1MNEA 3C7EA 3ZEFB 3I3MA 4K6BA 5CKMA 5CYYA 1GQPA 2ZM6T 5LXTE 4E4DX 4ZXEA 5FZOB 1RUJ3 4Q4X1 2R062 2G9FA 3D82A 1OLQA 3MBWA 2XQ9A 1V9U2 5KR7A 1KRIA 1QOOA 3UYJA 1W9TA 5F3EA 4HE8A 1FMVA 3BQIA 3BQKA 1MPXA 3GN5A 3LK42 1MEC2 3PHMA 5IK5A 3C7GA 3KS7A 2NWBA 4QGNA 2Y0IA 3KV5A 3BALA 3CX8B 5FY4A 5I8TA 5LNKA 3OGJA 2VZUA 3QC9A 2CL2A 4Q8LA 4HVOA 1Z7S3 1YFYA 3AXDA 1PK6C 3H7YA 4WV8A 2VY0A 2X51A 3MFAA 2CU5A 2X0HA 5CB4E 1OOPA 1RL3A 3ZXLA 5ETWA 4KP3C 4QKDA 2J1EA 3T09A 1QMJA 1N1TA 3OYZA 4NHKA 1JZ6A 3JCFA 3THCA 3GM8A 1W0BA 2A73B 3LBXA 3DXUA 2ADDA 5C4WB 4P9GA 2ZAAA 3Q8FA 5IJRA 2IUBA 3SWHA 2BERA 2K48A 2AACA 2IVJA 5EK2A 3WQBA 4QX1A 1BVVA 4Q26A 3O1PA 3MF9A 2WO3A 1AZDA 2R073 3KHCA 5K0UB 2WO1A 1ODMA 2HWE1 4JV5T 1DU3D 1Q43A 1VB2A 3J4UH 4LORA 4FPKA 3GDBA 4LMLA 4X5TA 3I2OA 4FPOB 1Y9QA 4DO0A 3N5LA 4QQLA 4CCOA 3DPRB 1Y4WA 5DMYA 3MZKB 2AUYA 3TLWA 1ZRCA 3S7EA 5LYJE 3NKTA 1YFWA 4AQFC 4AEDA 4ZI2C 2VU9A 2JB4A 4BA9A 3U75A 3AKRA 1PIV2 1D1AA 2VZVA 2XONA 5JZGC 4BLJA 4YZ3A 5LGUB 4Y5TA 1D4M1 1JZ7A 2C5DA 2CDPA 2X8KA 4D69A 2B9VA 4NHLA 5FPZA 1CAUB 3VBFB 4YNIA 1K5JA 1VRH2 2KSRA 2KXLA 2C0SA 1X82A 4YW7A 4PLOA 1GLHA 1WYBA 3NVCA 2H6BA 4UVCB 1R093 3LDKA 1UOJA 1W9FA 2X5IB 4ZS3A 3CKHA 2OKXA 1SPPB 2RDQA 2Y6JA 4XDOA 3A21A 3ONLC 3RGLA 3HR0A 3HWJA 2C5KT 4FTEA 4H9NC 1AR91 4ANJA 1L7QA 3H1YA 3QOPA 4GJYA 2R6QA 1HN1A 5DN2A 1W6MA 2JE9A 1MACA 3I59B 4O2AE 4HFVA 2A75A 5JDFA 3FX3A 1RYYA 1J84A 3O1VA 2V09A 4L0RA 2A71A 2XAFB 3EXUA 5FCCA 4G9SB 4XAEA 4A6SA 4A7KA 3JBG3 3LG7A 1QXPA 3H3AA 1QGLA 3A0KA 1QKQA 2CPTA 4CDWA 4KBZA 3UKNA 2WA4A 4EN6B 2RE9A 1JOPA 4D0QA 1YFUA 2FJAA 3MK7C 3FLTA 1RJ7A 4Q27A 2ARCA 1OEDA 2Z42A 3OYXA 4PQ9A 5HXSA 3MIGA 1PGL1 1W2UA 2VASA 4WW0A 1SCRA 3NV1A 2ADEA 4NHMA 1WCDJ 2I0MA 2V26A 1QHDA 4FP3A 2UXNB 4CRQA 4JQTA 4XIOA 3EVYA 2P3IA 5GJ6A 3M4FA 4ILAA 4K1YA 3ZN0B 2WINB 2UWBA 3WNOA 1LHWA 2LSJA 4AW7A 4GOUA 2WNUA 3P4PA 3QBQA 3V65A 3ENRA 3Q9DA 1WA4A 2DTYA 2F4VT 5D8AB 3S6PA 1XSQA 2Q1FA 3WAKA 2WMOA 1I5ZA 2QDRA 3WW1A 2FD8A 1LJ7A 4PQQA 1Z0PA 1CZSA 3B93A 4OHVA 2HHHT 2QJVA 1LVFA 3U1XA 1H1IA 1DDLA 4GKJT 3ETQA 1WW7A 2BKNA 1AR62 2VUAA 1U4QA 4J2CA 5CFBA 5E89A 1RUG2 4AG4A 4JCKA 1T98A 4RS5C 1XPWA 2AE9A 1JZ2A 2IW5B 2EAAA 3N2KE 4NROA 4XTPA 2K5BB 4DR5T 3P7IA 1LU1A 2UYAA 4FPJA 3WDXA 3MV11 1XNBA 1WW4A 2AREA 4L2NA 2UYBA 2NOXA 1XYPA 2A6WA 1NCQC 1NXD1 3RPUA 5LA9A 1Z8UA 3DXTA 1OT5A 3VZOA 1UQXA 2Y0OA 5JZGA 3AA1B 2VW1A 1SMVA 5GZDA 3ZFEB 5L3GB 3T0BA 1VBB1 1RUD2 4LKEA 3R6NA 5JVDE 4KBBA 3LK3B 3VD5A 3MICA 2WRAA 4ASMB 4BJNA 3VBSB 5HCFA 5A3MA 4CN4A 3RF1A 4XDQA 1RUI3 5AFBA 1CJDA 5JOYA 3VHRA 1DF0A 4CEYA 1UOGA 3AYEA 5EP9A 4WZXA 4ILUA 1R082 3V5SA 2JDPA 4PHZA 1LEDA 5A80A 1X9TA 2RS52 1QH7A 1C57A 2YU1A 2WFF1 4LBNA 4TTGA 1ULEA 1FMD1 3AMPA 2W68A 2WDBA 4ZKTB 3BU7A 3HBZA 2QE3A 3W5MA 1Z78A 2RDRA 2O14A 2WB5A 1IHMA 3SCHA 4LMJA 4GH4A 3ZR6A 4Z92B 4AHYA 3B3QE 2JIJA 4QXBB 2XL7A 2QBXA 1SBDA 3U14A 3J8F2 3O4XE 4IHJE 1AYM2 2VCAA 2RMU2 2IMLA 1V6OA 3UGFA 5C71A 2M6IA 1OHFA 3I8TA 3LDQB 1GZTA 5H6RB 4YW4A 4JUYA 2JDZA 4FCAA 2W47A 2VUCA 4PJLA 2EIEA 2W3JA 5F9TA 5T3NA 2R063 4CZSA 2X9XA 4JEHB 5CJ5A 1LR5A 4P9LA 1VBD2 2WCAA 1CZVA 1N3OA 2Y34A 2VZOA 1UX4A 4BCUA 1RB8G 5APAA 2V7JA 4E8CA 2QQJA 2N7GA 3OCPA 4CDUA 2GC2A 2Q9QB 3OUHA 1POV1 2WNVC 4JHTA 2VKHA 1H6YA 1HRI1 2R1DA 1VMHA 4L9BA 4RYDA 3ZPOA 4ITCA 1ZBE1 2CGNA 3HNBM 4B4PA 4OHWA 3WD5A 3ZT5A 1YI9A 1W2NA 2GU9A 4EEBA 4QU2A 3UULA 2YC2A 4LPLA 1HF8A 4Q4Y1 4YHHT 4EB6E 2XPJA 2DHRA 5JDBA 3Q5EA 1NX9A 3PVOA 2IFRA 2ZS6B 2R0FA 4Q5OA 2ZGRA 5C9AA 3EAMA 2DCYA 4D6RA 5GZEA 1KS5A 1XDPA 2RS32 1YQ8A 4CU8A 1ZNPA 3WW2A 3ZFGA 3L8RA 4XJ8A 3LIGA 2IXKA 1QNWA 5LHHB 3TEXA 3J7NA 5HXVA 2QUOA 4IEXA 2V7LA 4N53B 2D43A 1W8WA 4H9RC 2PQQA 1MIVA 2P3KA 2C0ZA 3C8XA 3IT8A 2VCCA 1D4VB 3J7Yq 1S35A 1VBC2 4Z2WA 2RJ2A 5CGMA 4QX2A 5IHRA 1N1SA 2LHRA 2HLEA 2VECA 2ORZA 1A3KA 5J2UE 2DCZA 2PQSA 3BK9A 1C8M2 3PUAA 3BPSA 2DUOA 4A3ZA 1ZZ6A 3G7DA 3USUA 2C6SA 1VRH3 3TEWA 4EWEA 3CJIC 5IUQA 2X0YA 3PMEA 3TLSA 3RHWA 3AA0B 4YZ2A 2J7MA 2DVBA 1NWMX 4XIKA 3KCCA 5L2LA 2E9XC 1RUE1 4K3UA 3POSA 2OQ6A 1IBKT 2CSGA 1MQTC 5CFDA 1XNDA 4AKHA 2E5LT 4YRDA 2E5VA 4UOJA 2DVDA 3ACGA 3LAGA 5HI0A 4AFBA 3PVNA 3MGUA 4OQ8A 4R8HA 3WP6A 1LOBA 3JAFA 3V0BA 5EK3A 3KDSE 3FZKB 1HB3A 1QJX2 4PIXA 2YDSA 1UYXA 3UT5E 4UFMA 1ULOA 3I2GA 3ZJ1A 5LK5A 3OJAA 3TRSB 3C50A 3WF4A 3A0NA 1BK1A 1ZA4A 4BK5A 3W58A 4CP0A 5IK7A 1OURA 4HK9A 1UXZA 1OFNA 3MLJA 1D1BA 5SV8A 3ZFFC 4Z2AA 1ASJ2 1STMA 2QVSB 4CYDA 2DWRA 4UVBB 4OMDA 1OC1A 4I0BA 5FAXA 2OV9A 1VBE2 3I3EA 3I3BA 3ON7A 3WDVA 2P6HA 3MHZA 3AZYA 3TB0A 5ABJC 2CTVA 1HB4A 3ETPA 2KD7A 5AQLB 4BYYA 3WW3A 3RX6A 2HWB2 2ACXA 1QH6A 4EWAA 5DDJ3 2WJSA 1OEDE 2YN6A 3OPCA 2JDMA 3MA9A 1PZ9A 5A7PA 5ANNA 3WF3A 3T30A 2Y48B 4ZPIA 4B3ST 4TN7B 4MUVA 5JDGA 1W6PA 3AL6A 5A3UA 2DVAA 5GLWA 4AGVA 2VG9A 4YM1A 3TN93 1W8OA 5ERLA 3GCXA 1E5RA 4IDPA 3OF1A 4JX0A 1W0NA 1LU2A 3BVCA 4XC9A 3KINB 4UWDA 2VVNA 1DHKB 1TE1B 1RUF1 1DQ4A 4L9IA 2ZAHA 5LG4A 2V7IA 1UMHA 1EAH3 4Y1VA 3CLPA 5HEHA 4FOWA 4YSYA 3N2OA 5CBLA 3U37A 4HTEA 4UEMA 4B1MA 1VBA2 4MGZE 5DUWA 1WMXA 1IPKA 4PI2A 2BGOA 4CDQA 1AL23 5LHGB 5L73A 1KNRA 2QQUA 2X05A 2BBVA 1ENRA 4CZZB 4M01A 1Q3EA 5FY1A 4EYYR 2R043 1YD8G 2XBO2 1ZRIA 4IV3B 4PAGA 1SFPA 1RINA 3GZUC 4LT5A 4TWHA 3RWKX 1V6JA 2AXDS 4S2HA 3LKJA 2WZR1 4CUGA 1HB2A 3QNUA 4YGDA 5IFPA 3THPA 3H9AA 1WW5A 1GUIA 1UURA 4Z82A 1JUIA 2PG8A 1GOGA 2E9XA 2VKJA 4GAZA 3SLIA 2XM1A 3RKGA 1JYNA 4BK4A 3ANWB 4OYJA 1TMF1 5L9RA 4X1KE 5HEGA 1ST8A 2FDHA 1YHFA 4RR3B 4QXCA 4PLNA 2XWBB 5E88A 4LFCT 2V6YB 3K1SA 4GQ7A 4C0BA 3ES1A 5F1RA 4C1WA 1H8TB 1BZWA 2E33A 2J62A 5KHGA 1AJOA 2WU5A 1LOEA 4O61A 2X9HA 3VBOC 3FFZA 1F4AA 2E9XD 4IE6A 4GMP3 1MZFA 1BEV1 2W08A 4GMP0 2WO2A 1GKBA 4Y3OA 2P5BA 4X64T 4XPVA 3I9YA 5HV0A 2MPKA 3INAA 3L2YA 3BTXA 4BQWA 2RMU3 2LUWA 3QD6A 1REDA 2RR12 4IE5A 1QJY1 3NAPC 4FT8A 5C7GA 3LA3A 5LGNB 2MTQA 4Y1UA 1R1A2 1MR5A 1LHUA 4LIVA 3JXSA 4WVVA 3M2MA 3UUMA 3OGVA 2XWJB 5L47A 1GV9A 1OSGA 2LSYA 3SMHA 5A3TA 2ZX0A 3TYJA 2B46X 4KL1A 4G2AA 1O3QA 5JPMB 4DR2T 5TSWA 1BBT2 3GN5B 3T2PA 2ZGTA 4RGGA 4YG6A 2O1QA 2QZ2A 5JLVA 2ZZJA 3JD72 2L9LA 4OUMA 4XFIA 4NXMT 2WWSA 4AOCA 1SUMB 5FYSA 5JSOA 4ZZBA 1Y7BA 1X36A 2QQWA 2J1DG 1AJ3A 4Q1PA 4B7KA 3T2QA 1E5SA 2JIGA 3ZSTA 2Z4FA 2EHOB 3FHIB 4XXPA 4OLLA 3TNQA 4ILBA 3WZ1A 1PO22 4AQSA 2YPDA 4CU9A 2R6GF 2Z5WA 4XUNA 1K5MA 1N1YA 1UIKA 2VKOA 1E1HB 1WLDA 4ZU7A 4GIWA 5FL1A 4QPGC 2RS33 3EHKA 1F35A 3LBXB 4XDPA 2XB6C 2JKXA 3VDDC 2ODVA 4XTMA 2QNKA 3H8UA 4JVAA 1V9U1 2KZ7B 1PGW2 4WBOA 2KM2A 1DQ6A 3IDCB 5E0OA 5CFCC 1HRV3 3KD4A 3NNFA 3R4SA 4WM8B 3GBFA 1MEC1 4YVSA 2C24A 4RHV2 5F39A 5FJHA 2VL0A 4O4JE 1VPHA 4AYUA 4FBFA 4V1Av 2HWD2 2W0XA 5LBCA 3KZ4C 1HXS2 4Y1YA 4ILCA 4Q4W1 2GNBA 4UAPA 3C7HA 4H7LA 4SBVA 1NG0A 4XJWA 1G6NA 4JC1A 1MS9A 4MGYE 1QWRA 3WLUA 1H6XA 1IKPA 1H1AA 2IXJA 1PMJX 2R7EB 3AB0A 1YIPA 2ZBJA 4CSWA 2ARXA 2E31A 2D6MA 4Y22A 1D0YA 3VBHC 3I3QA 3LK2B 5DABA 4U2ZA 4AVBA 4O4LE 5KX5E 3AKPA 3VKHA 1U5IA 2XVGA 2VNVA 3TBDA 2E53A 2MEV1 3I3DA 5L3BB 2ZX2A 1VMFA 5ACA3 2JJ9A 1UY2A 3GJBA 4KH9A 1LGNA 1W8NA 2ZHKA 3DYPA 4IEZA 2GN7A 1QJX3 2PHFA 3IPVB 1BKZA 3NKGA 4JKMA 1J5WA 1IG0A 3AA7B 5A3WA 2LOPA 1NY72 2LSGA 5LHIB 4N43C 1T8BA 1W6MB 4CCNA 4MFRA 5C3SA 5JDLA 2X29A 4KX6A 4P9WA 4HKLA 1PIV1 1P8JA 4IV1A 3EMRA 4GA9A 2UUCT 1EZ3A 3WQ7A 2BTVC 4HSLA 1G8WA 3P50A 5FDBA 3KCYA 4JRAA 5JRCA 2RP4A 3E08A 3A7QA 4MGSA 4WBNE 1HB1A 1GYKA 4LXLA 3ZT7A 1VBE3 4LIUA 4W6YA 4KNCA 4B7EA 1OEDB 1W9RA 4MXWB 4Y4RA 5FYMA 2Y8DA 3U4SA 4K7JA 3ZXGA 3O0WA 5HXCA 4HN1A 3POFA 3WY6A 1D2SA 4YM2A 4JI4T 2RJLA 2RS12 1XQNA 2L3LA 3E1F1 4LLFA 4Q4X2 3AXJB 1PK6B 1RUH3 2YC4A 3K75B 4BXFA 2DURA 2WWVA 5HCBA 5LY2A 2QGSA 5FZ8A 2VW2A 1MZEA 3ACLA 4S2DA 2EIBA 4KG0A 2ZKNA 1W8TA 2OZJA 4COZA 5KHIA 2RV9A 2VCMA 2CEAA 4OHXA 2NR4A 4IL7A 3VDDA 3KQ4B 5C6CA 1JBCA 5LG3A 4XHXA 2XQ3A 2IAKA 5FR3A 2BDRA 4DUVA 1AYN3 4BQ4A 1RXFA 2P37A 3K51A 2VVEA 3K77A 4BPZA 5CFCA 4V2VA 2VMFA 1L7LA 5CVRA 2JQKA 1US7B 4F7ZA 1HDKA 5DUXA 3LSDA 1QSDA 3T0AA 4COUA 2YC0A 5CIRA 3VKLA 4K8RB 5DG1A 5FZOA 3DF0A 3ABZA 3KFWX 4UBHA 1CESA 2JKBA 1MMAA 1YYNA 1CWPA 1FOD2 1ND3C 3SFEA 5DG2A 1K45A 5L7OC 3PNAA 2VTFA 5GZCA 4JGZC 4KQ7A 1KD7A 2WDRA 3POWA 1HIXA 2BPA2 4I02A 5FLHA 1PX4A 2WC2A 5JZGB 2YB7A 5BNQA 1ZBA3 1WR6A 2W52A 2OW4A 2HWE2 4EJRA 4NIQA 4E4HA 3EUHA 4IEUA 3RZGA 4A56A 4A3XA 2FJDA 4QX7B 2RJKA 5LA0A 3DN7A 3HKBE 1XXNA 2X66A 2F6BA 3TNPB 1F31A 3GZAA 3Q2MA 1RUG1 1LOFC 3ONJA 3W20A 1JU4A 1DYKA 4EGWA 3S57A 5A33B 5C4WA 1ZRRA 4HETA 2VMEA 2FJEA 2WLPA 1SLAA 5ABHA 1PX3A 2QQVA 1X33A 3ZKYA 4DZGA 1ZRDA 5F6LB 4UFJA 5JI7A 3ZN6A 2GP5A 3O1TA 5CKQA 3VLBB 4KUMB 4TWFA 3CJXA 1RUD1 2G4IA 3ZMOA 1CHUA 3OSDA 3ACHA 3ZN1B 4DINB 5IVBA 3S0MA 5CA1E 1AXZA 3PUXF 3LDBA 4Q4V2 4BISA 4AVCA 3DPRA 1AR92 3IHRA 2P6CA 4WVWA 1E7PA 5BNOA 4JKKA 4YGCA 3HIFA 2K2SA 2WQZC 4YSZA 3B5MA 5LP6E 3CHXA 4TXWA 1QDOA 1VRBA 4R9BA 4BOWA 2Y38A 3UFEA 2OT7A 3HR9A 3ZOIA 1R081 3QK6A 3OKQA 4CEWC 4IGUA 1NKGA 2GK9A 4JBWF 1W04A 1DZQA 1CAUA 5FXWA 3A23A 3VBFA 2RS51 2YINA 1LKXA 4JI7T 1JN2P 5H6QB 1BBT3 2JX9A 3N7JA 3NBXX 2XAJB 2QQPA 4JDNA 4XUPA 3UETA 3MV01 4OVEA 1RXGA 1SFYA 4ZU4A 4UF0A 2WP9A 1CAWA 3AVSA 3V5UA 1PGL2 1ND2A 1SPPA 4CUCA 4AEKA 2WAAA 4AXPA 1SDWA 1IQDC 5IHYA 1KS4A 5DQWA 3FC0A 3J8F1 2GNMA 2W62A 1UPSA 3C4ZA 2CV6A 1AYM1 4PBOA 4HLTA 3RIUC 3KSCA 3BTZA 2ZGKA 1W39A 5JI9A 3KM5A 4CXYA 3CQCB 4Y5SA 3H1WA 4X66T 2C5IT 1HFAA 2NW9A 4O9EA 4IERA 2HWC1 4RS5B 4NIAA 5JIUA 2AENA 2NM1A 3KLSA 2XSAA 1VBD1 1JYWA 1V6KA 2XY8B 5DZFA 2PLV3 3ZKUA 4BA6A 3O12A 1GR3A 4UXNB 4CTEA 4XQ4A 2EA7A 4FFFA 5FWJA 4LF9T 4OI4A 2O8OA 4YZ5A 5FWEA 5AQNB 5A1FA 1VE0A 3MO4A 1Q8OA 1NCQB 3OGSA 4B3MT 2YROA 1RHI2 4IE4A 5JDQA 3HQRA 1A6CA 5EJ1B 4NIGA 1F2NA 2P3YA 2QQMA 2VOKA 1VLNA 5C8WA 5LWBA 3P8CD 1HXS3 4M4RA 2JG8A 1QIQA 2YY1A 5FPXA 3MZHA 2XSBA 1RIRA 4JI8T 3OPTA 2PMWB 2Y6XA 5BUVA 5LBEA 4W4ZA 4CCEA 5A6XA 2LEHA 4AHXA 3CMGA 3PUGA 1M06G 3PL0A 1D0GA 2ZJCA 4YG0A 4YWAA 2VPVA 1CX4A 1JZ4A 3CVRA 1H2KA 3VD4A 1NCRC 3HMYA 4HK8A 1OPMA 2VB6A 5D8AA 4ZZ8A 1X9PA 4YVWC 4YFZA 4Z91A 2QTWB 3LEIA 3F31A 4PNIA 2OYZA 5JDHA 1IJ6A 1G7YA 5C5TA 1DLCA 1O4ZA 1OLRA 1LENA 3ACFA 2G9ZA 2JDHA 2X10A 5F3GA 1RVF2 3I2KA 4YM0A 3FLRA 4DEQA 5LOVE 1LTEA 1VBC1 2LW8A 1OA2A 1T6GC 3PIGA 3H50A 5FZLA 4URAA 1UD1A 3MJXA 1VOMA 2NN8A 4E9KA 4CCLA 5KXEA 2HEVF 1PZ7A 4XAXB 1DZRA 2WFF2 4LEJA 4NUBA 2LHNA 2BW8A 5LBQB 1FYUA 4IEOA 4FQZA 2NW8A 4QQOA 1WCUA 4H63V 1KDMA 3QH6A 4CEWA 1H2MA 2V7KA 3ZXKA 3EO6A 1AUYA 3VHNA 1SDDB 5IWAT 5F5IA 3PV0F 4RQPC 2WNVB 4NVPA 5EIYB 3VBSA 3V64A 4A97A 3ILFA 5LA6E 5FOBB 4HGAA 2BG9C 3B7MA 2Q0AA 5J36A 2Y6HA 4U2YA 4XVHA 3D5OA 2PXJA 1I9RA 1QJU1 2XPKA 2JPFA 3N2GE 2ZHMA 2PJQA 1DGRN 1YQCA 5LJNA 3ZCJA 1X8MA 4XJUA 4GZ9A 3TKLB 1CQ9A 2XZEA 3A5XA 4TNWA 3WQ1A 1UOFA 5EYYA 3ZYPA 5J1GA 4KHPT 1HRI2 2JQHA 3M70A 1GBGA 2WWUA 5JH7E 3K2OA 2DL1A 4BIOA 5G04L 4FPGA 4CCCA 1D0XA 3KHBA 2D0UA 1F5JA 3Q8BA 4FPYA 1PVC2 1W6PB 3M3ZB 1ASJ1 2D5HA 4HL0A 3AEEA 1FEWA 1BR1A 3WEZA 5IVVA 4DS0A 1NA1A 3ETUA 2XVLA 4FP2A 2BS2A 5FK7A 3CQXC 5K9YA 4NIDA 3N7KA 1K42A 1QOTA 2Y6LA 3ZSJA 2IWGB 3MW3A 1SCSA 3F2ZA 3MIEA 3CU7A 2CBJA 4YW3A 1SHWB 4MG2A 5T50A 5IVYA 4CDQB 2JIWA 3GJAA 2HWB1 2Y8KA 4RFRB 2Q9QA 1FT9A 1ENXA 4WM7C 3IF8B 4DV6T 1UUSA 1O91A 3K4AA 3SCGA 1GICA 3H8RA 4OHFA 2HWE3 2J4GA 5A7NA 2LTNA 5EWSA 5J98B 3CJIB 2WQYA 4A98A 3LFIA 3LFMA 2VNRA 1GMMA 2BNNA 2B76A 1AR82 3WNLA 4NXNT 1IBMT 4AHZA 2E9XB 4DEVA 4M3CF 3EDUA 3VKFC 1O8SA 2YPJA 4TYSA 4O9GA 3I0QA 4XF4A 2Q4SA 5C3QA 4NE9A 4XOGA 4QXCB 1D4M3 2OPKA 2YG0A 1VBA1 4LMFA 5EJZB 4BZ4A 2CA5A 5AQKB 2Q1ZB 1Y9GA 2DI4A 3RJRA 2IC9A 1W6QA 3UU6A 1PZ8A 2FDJA 2BKOA 2ZTNA 3VBUC 2CHOA 5I0UA 5DPNA 5TAOA 1AX1A 2UURA 1RUE2 2XBO1 4R9DA 1J5ET 1R8IA 1HNXT 2BYVE 3FMGA 2W1QA 2H0VA 1AR72 4MHCA 1NOVA 2VZPA 2UU8A 3N4MA 2WNEA 1VALA 2ZGPA 4EWDA 4IE0A 3AZVA 1AR93 3RYIE 4XETA 2GSYA 2QQNA 1B35C 1QXRA 3VBRC 2X68A 2XQYA 1OQ1A 2CE7A 2P3JA 4QX5A 4BQXA 1WMDA 2YFZA 1OA4A 3ALQA 2VUJA 4CCDA 3CIHA 5FZAA 3FXDB 3AMNA 3PIJA 4LO6B 5ABJB 1QQP1 2EICA 2ID4A 1ENQA 4MHUA 3RNSA 5DUUA 2VXJA 4LBOA 2IHR1 1J3QA 1YKHB 4RD7A 5KXJA 4TLFA 4DIQA 3C4XA 1H4GA 1W06A 3PU8A 3ECQA 1ENSA 2BFUS 5JR9A 2JDAA 3VDAA 2TUNA 4O65A 1JOBA 2GC0A 3E5UA 3AEDA 4A2UA 3O1UA 3SRZA 4ARXA 3VR9A 1T6BX 4CU7A 4AI6A 2ES0A 1CAVA 5D21A 1Y64B 3K3NA 3KVAA 1R1ZA 4HFSA 2NPIA 1UCUA 3OTOT 5BYNA 4AKRB 5GZGA 3HAGA 1K5MB 3LD8A 3AAEB 3O1HA 3IZOA 3CPZA 4QKNA 3LA7A 1D0ZA 2BOIA 4TZ4C 4Q25A 4QGLA 1R1A1 2ERFA 4LJHA 1M7KA 4MGTA 3M3CA 2ZGNA 3RSJA 5C8YE 5FO7B 4HWDA 1U5YA 5HYAA 3D0JA 2OIIA 2DUPA 4U31A 2ZEXA 2H89A 2GALA 1WD3A 1KGYA 2D5UA 3UQ4A 2H7OA 2QQOA 3MLKA 4YVSB 5IW0A 4XZUG 4EEDA 2DCJA 4NHYA 3KGLA 3MEPA 4P9IA 2V8SV 4JGYC 5HXRA 3NJZA 4YLZA 3ZC0A 5AQSB 2VM9A 4ERRA 1W8FA 3ZSSA 4EZHA 3AE2A 4Z90A 4Q8KA 1X50A 4TUYE 4W8JA 2HBTA 1L3JA 4NIHA 5J0ZA 4AE2A 3T08A 4UELA 4PDWC 3CZJA 1UX6A 5HCJA 1XNTA 1IPSA 2O8QA 4OUSA 4XJ9A 1PO21 3GNEA 4XUTA 3WI3A 4FPCA 1BCXA 4N7IA 3HT2A 3DKQA 3VDBA 5IT6A 1U0AA 3N9OA 3KMHA 3E22E 5K0UC 2WT1A 3IIIA 3WG3A 4LMKA 2E26A 5CAZA 1VBB3 1PGW1 4Y22B 3PMSA 4JKLA 4DXTA 2WZR2 2OZ6A 1W6NB 5JOZA 5I8SA 2F17A 2OUHA 3FLPA 3W15B 1SLBA 2ORXA 1OH4A 3MLLA 3FJSA 3MYXA 1AX2A 4NPLA 4RHV1 1WYCA 1OD5A 2ARAA 1TZOA 2CXFA 3DL3A 4KWKA 3OGRA 2HWD1 3UJOA 4LUMA 3AB3B 4LBQB 3BI3A 2ARBA 3WP4A 4DNDA 4QD2A 1TMF2 2DBNA 1PNGA 4XF3A 1OVSA 1FXZA 4W65A 5GLUA 4K0KT 4FXKB 1W9YA 5LZ6A 2WYFA 4GB33 2W63A 4ASLA 1B35A 3WG4A 5AC92 1RUC2 1OUXA 1UZ0A 2DYCA 4JQRA 1XYOA 4DV5T 5LB6A 3PJQA 1FMD3 4I30A 2HWF2 3AP5A 2VZ1A 3CKDA 3CO2A 3E97A 1BEV2 5JRCB 4LHSA 4XJAA 3CQOA 1O4TA 3RRWA 5IUXA 4UFHA 3WNXA 2CWYA 2H6CA 4AFMA 3LPFA 1JHJA 2XJPA 2DDUA 2FJBA 1LGBA 2HH7A 5HXEA 3ZXAC 3ZYBA 1PGSA 3AECA 3QUJA 4M00A 1XNAA 1C5HA 3S5AA 3NNMA 1E5IA 2D5FA 3APBA 3F2EA 2YXSA 1QJY2 3BB6A 4P9YA 1S0IA 1MMNA 3S4UA 2W1SA 3ZDVA 4RR3A 2VXRA 3VV1A 2V6YA 2G0UA 1NY71 4PI0A 3HN1A 1NYWA 2ZM2A 3MXZA 4AWDA 1H8TA 4FVVA 1POV3 1POV0 2B42B 3AYCA 2BKPA 1HV1A 1HRI3 2CLYB 4DV7T 4M0NA 1FPN2 1W09A 1F8VA 3S7IA 1ZBE3 2KA3A 4Q1RA 2TEPA 3W9AA 3RGBA 1H30A 3VDDB 3P6BA 2X53S 3GBGA 1UW8A 4AVSA 4Y1XA 4R9CA 3FB2A 4AVTA 1JTZX 1ZP0A 2ZMAA 5EYXA 3B94A 4HANA 1ZA7A 1OI6A 4GWNA 5CFCB 3AAAB 1RMU1 3FXEB 3C7OA 4Q4Y3 2LT3A 3NWIA 3Q5XA 3KB5A 2A7AA 2CNAA 5K7PA 3N35A 1GQGA 1LVKA 4JLEA 4GALA 2RS11 2XQXA 2DWKA 3A4UA 1OVPA 4CE8A 4GWJA 4R52A 4QPIA 1FIOA 1PO11 2LJLA 5HCHA 1RC6A 3WINE 1UXXX 5FNVE 1ZM1A 1IAPA 4ZONA 2VZQA 5I93A 5LEKA 3UQ7A 1WCKA 3MDPA 3UU5A 1EUUA 3LEGA 4ZY9A 3J9X1 4I09A 2CM0A 4DV1T 4BMBA 1W8ZA 4FTSA 3ZKRA 4B1LA 4LOTA 3VBHB 1Q5OA 5FXZA 4Y33A 3ZMZB 2RG4A 5L9BA 1KJLA 4Q4W2 1H8VA 2HH9A 5LA1A 2EHOA 4IEVA 2W66A 2QA7A 4R9AA 3FE5A 2XHKA 3VUOA 3I2IA 3P3PA 3WHTA 3TLTA 2ZM0A 4SLIA 4BQ1A 5JXIA 3LE0A 4YGEA 5AQMB 3IAQA 3W21A 4LF8T 4KU8A 2Y6GA 1S55A 4M0HA 3ZFEC 2XJUA 2ZA9A 1FOD1 2Y6FA 2D44A 2K24A 1OQEA 2ZACA 4QX0A 2VR4A 1AF9A 3IAPA 3RYFE 2CCQA 4V1PA 1G9AA 3KVBA 4Y24A 1CUNA 1HX6A 3WCSA 2MEV2 4WM8A 3ZN6B 3VD3A 2RM22 3ZYGA 2EHOD 4AI8A 3GBWA 2IIUA 1YW0A 3DGTA 4FPEA 2VMCA 4META 1JNRA 3ZN4A 4K0UA 3PJYA 2PTFA 2PFVA 4CPBA 3FZFB 1LECA 2VZTA 4AFCA 2AR6A 3SKJE 4H14A 1YO8A 3KWVA 5BNOB 2JG9C 3ABVA 3PE0A 1FNZA 5L3DB 4OI2A 1OFSA 4LLOA 4QH5A 5JCTA 4TX5A 3WV6A 4OI1A 1AXKA 1TME2 3JAEA 5FPVA 1WCRA 1VIWB 1C8NA 2B9UA 4DBRA 5ABEA 2D97A 4ZEYA 4H3WA 3RYRA 4TZDA 5LMUT 2XUEA 1H0BA 1DYPA 1WD4A 4CPBD 4H9PC 1YQ5A 4UV8B 4JTOA 5AVPA 4AHWA 2NW7A 4WYVA 4UF0B 3SOLA 5EPAA 1CAWB 2G9GA 1ND2B 4DY5A 3RJ2X 1YQ4A 2GMMA 4Q4V1 5DAQA 2XJTA 1SHZC 3IPVA 3WT3A 4K1ZA 2XJSA 1UK5A 4NO4A 3PVEA 1NZCA 4WBBA 1WR0A 4A7ZA 3HNMA 2ATFA 3DYOA 1F5FA 1OKOA 5FKYA 1O5UA 3GF6A 3Q5DA 4ZXKA 2W39A 4XW3A 3EQEA 3AZWA 3H7JA 4DMIA 5ABFB 3H3ZA 3T1LA 4FTBA 4AAXA 5JXJA 1CONA 2CDOA 3J7LA 3VD9A 1KQRA 1BMV2 2FDGA 1RJ8A 4PCRA 1ND3B 3K4DA 3IN9A 5L7OB 3POGA 2KXPB 4JGZB 1HRV1 4OX9T 3AAIA 4AI3A 4OFGA 1RUF3 1W9WA 4ZU5A 1ODNA 2XVKA 4MXWA 5FPAA 3HL6A 4KU7A 2CHNA 3NRUA 2M6BA 3WDYA 5LMNT 1I94T 3NJVA 2JG8B 5FZ7A 3FZLB 3RZMA 3K4ZA 2I07B 3MI8A 2KR2A 3AXJA 1PK6A 2XM2A 3WDUA 2ZXQA 3AEFA 4N53C 3ST7A 4Y4YA 3WF2A 4BAYB 1KFYA 4CI2B 4FAGA 5E1RA 3M8LA 1H7CA 4NRQA 3PVBB 3RPQA 3WP3A 4JI0T 2XQ6A 2WZR3 2ZPXA 2YYOA 3IA3A 4DV0T 2BVMA 5DQ0A 4LR4A 5GM0A 3UV9A 3AKSA 2OQ7A 5DZGA 2XLAA 5FL0A 1RUNA 2ES3A 3PUYF 2CRBA 3LOBA 2NZ9A 1RHI1 2VOVA 4Y26A 1ZOYA 4QGMA 4AAPA 1EYBA 4ZZCA 2YU2A 3I49A 3AM2A 2PHUA 2HKXA 2DV9A 1W6OA 5KXBA 2Z69A 3TWIA 2YEVC 3KF5A 5BNPC 1EPWA 4XBFB 4AKLA 3SH5A 1BLZA 2VKDA 1L0VA 4QQ2A 1YCIA 2ET1A 3I7DA 1ONAA 1XNCA 5JREA 2YGLA 3UESA 2VOTA 5BPXA 4AQFA 2D6PA 4D3WA 4UVAB 2WS92 3SEEA 2BS4A 5IYZE 5FV3A 1BEV3 4GWIA 1QUUA 4HFBA 3ZXEA 5ABGA 3KCXA 4CEWB 1BVP1 4QWNB 2OX0A 2PBIA 4XF1A 2UUAT 1J83A 4QX7A 3TLUA 4MSVA 4NHXA 2JDNA 2B39A 1RVF1 2XASB 2UXDT 1UYYA 1I5PA 4AFDA 1MZ5A 1QJY3 4W6WA 1UAIA 5JIAA 4AI1A 5GALA 1JH5A 2AGSA 2IUWA 4QPYA 2Z6EA 3WF0A 2IXHA 4ZI2D 5K8SA 2D3RA 4LKFA 1O6UA 4TSVA 2OVUA 4XFCA 3D4KA 4NN0A 1S0DA 5A33A 1H4HA 1RUJ2 1JYXA 2IXIA 2EXIA 4XEZA 2V4AA 5F7UA 4QX3A 2ODUA 3PTRB 3SH4A 5F3JA 5ANQA 5LATA 3WCRA 2YDQA 5K4LA 1Q8QA 5FBZA 4ZI3C 3P4RA 2ZMKA 5AQIB 5EZYE 4EV0A 2D0TA 4DR7T 5GLTA 3IDAA 3OJBA 3RI9A 5J09A 3GZTB 4LBLA 3AC0A 5L4HA 1XOYA 1AYN1 4WNKA 3POBA 4IDZA 1UKRA 4H2AA 3OUJA 4IW3A 4MYEA 1Z7S2 3QB5A 1NA1B 4AI2A 2BGCA 4COVA 1W3XA 4DR1T 4TWDA 3T2OA 2FHRA 3LJCA 4PK5A 4EE2A 3P1IA 2QKDA 3O9XA 2PHWA 4GWMA 1NXMA 2HWC2 3DCQA 5AQOB 1E2AA 2DVFA 1V9U3 2Z79A 5FY7A 4XE9A 2GZWA 1UKGA 2ZGOA 1XRUA 2LM9A 2YBKA 2FDKA 1YWKA 3Q8EA 1BXHA 4QXHA 3I9WA 4J25A 2VBPA 3RIFA 1MEC3 4NRMA 2QCSB 4S2FA 3ESLA 4FPFA 2VZSA 2HBUA 3LPGA 4HFIA 2C1FA 3UJQA 1KEXA 1URXA 3OTFA 1PVC1 2D6OX 3HNYM 2BQPA 1GQHA 1HG2A 5FZ0A 3ZYMA 2Z2SB 4JRLA 1OMIA 4Q4W3 1XBFA 2JD4A 4LF6T 1EUTA 4JZRA 4QH1A 5LA2A 5AFEA 4YFSA 2VTXA 5FMDA 5KHHA 5FZCA 1XU1A 4NAOA 2GMEA 3K48A 4PT6A 1DQ2A 3T2TA 1MS1A 5C33A 3TEZA 4EOZB 2D6LX 4IV3C 4RS5A 1GWKA 2PTMA 5BNPA 4KI5M 4A4AA 5JSPA 1WRDA 4HFHA 1SEFA 3ZMUB 3VZMA 1W6QB 5HV4A 2A72A 4IL9A 4CP9A 2BNMA 2MEV3 2Y26A 4UW3A 5CISA 1NCQA 4GKYA 1QF3A 5C8CC 3DECA 3ZYIB 2V73A 2P17A 4K8FA 4BM8A 1R092 4BJ0A 5A6YA 4AQYT 1DG6A 4AGRA 5CA0E 2JDKA 4X1IE 2LKGA 4YHJA 5CG9A 1T7SA 3O1IA 3CEWA 1AR81 4ET7A 5L19A 1PMIA 3POEA 3PUIA 2NLRA 2KINB 4KWJA 4AQGA 4LF7T 2E63A 4RQPB 1K3IA 2VURA 3W5NA 1UYPA 3EABA 3VZLA 3VB9A 4O7XA 3AEBA 2WU2A 1PIV3 2GH8A 3GHMA 4HXCA 2ACZA 2RVAA 5CNAA 1F15A 3H3UA 5JOWA 5FYYA 4AEJA 2XQ8A 1S2EA 4QKFA 4Y1ZA 1COV1 2JRKA 1FI2A 4IGPA 4HFDA 3JBG2 1UZYA 4WVMA 1SZBA 5FRAA 3KV6A 2XR4A 3V0AA 1KDKA 1BJQA 4XUQA 5JR9B 2CWMA 4O2BE 3H3LA 1IG3A 3E6DA 1NQJA 3VGIA 5FZHA 4AI0A 1AR71 2VOXA 4AQ6A 3MW4A 1VCTA 3KBTA 2BJSA 1DQ5A 4IREA 1CAVB 1FATA 4URTA 2GAUA 1QJU2 5EK4A 5IAXA 3ILNA 5A7QA 1VR3A 5L36A 1O3XA 3E6BA 4XUOA 1J3PA 4DRRA 3VRAA 2KT9A 1LRZA 5AQHB 2BUKA 4DUXA 1S0CA 4FAHA 2GC3A 3VU7H 3H37A 3UGHA 3BTAA 2CAVA 5FO8B 1REFA 2P4EA 5L3CB 4LO8A 3VKGA 2BVLA 4INDA 4D7SA 4LTAA 5HBAA 4YSXA 3ZYKA 1H2NA 5L4EA 2SBAA 2VWAA 2XDVA 4IIJE 3KQRA 1OOPC 2WNVA 1YC61 2N9DA 1JZ5A 1XB9A 2PHTA 1SBEA 3HD8B 4C90A 4OI0A 3MIFA 3HN3A 4XAAA 5B4NA 1GP6A 4CI3B 2WBKA 4LF5T 3RZLA 1PMHX 2B8MA 5D2AA 4QHBA 4UFLA 3IDEA 5JSRA 1WA6X 4BJMA 1FAYA 1IJ5A 1VB4A 1GP4A 3ME2A 4BDVB 3UFGA 3A8YC 3VHPA 3VHOA 1QY4A 2XKOA 5FREA 2GP3A 1OF4A 4NUUA 4ZS2A 2OA2A 2WT0A 1XE0A 3AEAA 1X7NA 1O3RA 3POYA 2YMZA 3UKTA 1AR63 1LOGA 1FMWA 1W8UA 3VBUB 1LESA 4YZ4A 1O3TA 2Q8CA 3I2DA 3UUXB 1Q8SA 4AEDC 3PDYA 1RUG3 4FJOA 3WNKA 4AVVA 4LQRA 4YW2A 4LO5B 3I0OA 4DIDB 1NLSA 3EJKA 3UT0A 3ZVXA 4P1NA 3RYHE 5IAVA 3ZO0B 4C1XA 2VAUA 5FMOS 4MGQA 3GHNA 1CAXA 3IMNA 5DJQC 1LGCA 4WVZA 1JS9A 3MIHA 2XJQA 4A41A 5DUVA 5HPOA 1B35B 2UXXB 1UO9A 2RHPA 4D7TA 3JC6C 2W4XA 3MACA 2MAWA 1REEA 2IFWA 3ZMVB 4ZHNA 2WN2A 4A6OA 1TVGA 3RMYA 5FZBA 3MKDA 4WZFA 5FBJA 3P4SA 1RUD3 1EPZA 1MVQA 4DOUA 4FFIA 4DXSA 4XQDA 4N9IA 5IYYA 1SLLA 3O0VA 3JUUA 3CJIA 4E2GA 3BIWE 1YI7A 3V56A 4ARYA 5J7MA 3LIHA 2DVGA 4BHPA 3U07A 1VJ2A 3D8CA 3CWZB 3IMMA 1JW6A 2VJXA 3HQXA 2J22A 1R64A 2PFWA 3UKVA 2HJIA 5FYBA 1MQTA 4ISTA 3AE4A 2CYFA 5EFUA 1KFUL 3AZZA 3CZUA 4TLGA 2WAOA 1R083 2DFBA 3VL9A 1KF6A 1QQP2 4BQ5A 1XU2A 1LNSA 3H0OA 2EALA 2RS53 1O4YA 2VMDA 5AC91 1RUC1 4CDWC 1EV11 1QJZA 2EF6A 4FXGB 2XAQB 2D3PA 3R0RA 3O1JA 5F5WA 1SLCA 2HWF1 1HG5A 1Q8VA 3BKZA 3N36A 1OEDC 5EV7A 4MO3M 2WM9A 5IWFA 1GQEA 4IDQA 4CU6A 3CK6A 5FTTC 2YDEA 1VAKA 4H7MA 4L92A 2XQ5A 5CU1A 2AYHA 4YTNA 2X9WA 4UXAA 1S4CA 5FY0A 3ZFFA 3J8F3 1XWMA 5FP3A 2VH9A 1AYM3 1CPNA 1OQDA 3SISA 2YK0A 4ES8A 2ZX1A 2VD7A 2VQAA 4CDXC 1UOBA 4JGYB 2WNUC 3AE5A 2VMHA 4N90A 1X79A 3U3IA 1RUOA 2HWC3 3R4UA 3FWEA 5LRSA 1V00A 4YARA 3Q8CA 1VBD3 5FZ6A 1NEKA 5GONE 1LHVA 5ABJA 3FBZA 2W2UA 3VZNA 4PIZA 4AIUA 2W1WA 5FYTA 4QPIB 5LBFA 3K8PC 5CG8A 4E7SA 4PDWB 4LKDA 2HEWF 3C3VA 5HCAA 3UNPA 3FZ3A 4LK6A 3ROUA 1W0AA 1FPN1 3O5SA 2V5DA 2ZZQA 5FP7A 2W67A 1XJAA 4XMAA 4U2AA 4BLIA 5FYUA 5C3PA 2P2KA 5T54A 3LF7A 2ZOEB 2VL4A 5LY1A 4CCKA 2VQUA 3RYCE 5IFTA 1GNHA 1OLMA 5FO9B 1UY4A 3AJZA 4GKXA 5T5OA 3FZHB 4L0PA 3FHNA 4L5GA 3IBMA 4NPRA 2NTXA 3IB3A 3VZJA 5LCWL 2DU0A 3CX6B 2V6XA 1GZCA 3MIBA 3QH7A 4G4FA 3PUZF 5FQ0B 1SQ4A 3AVRA 1MS3A 2D2SA 3O7OA 3EB7A 2YBPA 2BWCA 5L9VA 4Z07A 5KMGP 3NNJA 2BRTA 5FUNA 5FYZA 3NZQA 2LSKA 1HS7A 4XYXA 3PTYA 2P34A 4N7UA 4MALA 4QU1A 5LCYA 1FV3A 2Q8DA 2BZBA 4I0WB 1SACA 1GNYA 2Q1MA 1WMFA 2JE7A 3M7AA 5FVLA 2V1DB 1Y43B 4BQ3A 1YRZA 4NAMA 2A3XA 2W91A 3KF3A 5FJKA 3DJBA 4CEYC 1VBC3 2A6ZA 2EXHA 2PELA 2UWCA 5JAXA 4O4IE 4DUZT 4QQPA 2IXCA 3EYPA 2EXJA 4A5XA 2PN5A 1NQDA 3I2JA 3H8XA 2C5JA 4IESA 3B5LB 2JWPA 2RDNA 4ZZ5A 4J6GA 2ZHLA 1C8M3 3JC6D 2I45A 2OLTA 2P1BA 4UW6A 1UYZA 4MH0E 4HSJA 2QQIA 4OMCA 5FZ3A 4P5YA 4U7IA 2XXZA 4U72A 4Y20A 1W05A 4PFPA 4GH4C 4N8MA 2BP6A 4I43B 3PUWF 1W6NA 1GWMA 4CVUA 3X29B 2RM21 4HMZA 3VBOA 2DU1A 5JQGE 2J1TA 4N9HA 4CI1B 2WWJA 2MYSA 2ZX3A 4CUBA 1UWWA 2N1GA 4LBQA 1QJU3 1XSRA 2K0GA 3VHLA 3OD4A 2FZ1A 1GNZA 3DEMA 4ZHQE 3EDVA 4M3CA 4CDUC 5DAVA 3BUCA 4COYA 1NENA 4NJ4A 4AL9A 2R49A 2CWOA 4B3RT 3PUVF 3LQCA 1WLXA 4KMQA 1VP6A 4CDXA 4L8QA 2BNOA 3AK0A 3O1RA 5JTGA 1W2TA 3NAPA 1TME1 5FVKA 4TWTA 4BMEA 4XACA 5DDJ2 4LF4T 4HVRA 1JNZA 3RWNA 1UZWA 3K3QC 5FXXA 3T1MA 1ASJ3 5FUPA 4EZ4A 4LBQD 5EQUA 2PHLA 5A32B 4ORFA 3H42B 3ZT6A 1G9BA 1RMU2 4YYOA 2A3WA 3TN92 1BYHA 2CMRA 4K40A 2XQ7A 2X67A 1N36T 5C9AC 1KJRA 4P00B 4EIWA 3NJXA 3RYPA 3ZJ2A 1EAH2 3ZFGC 2C9KA 4U36A 1JMUB 2JE8A 4YW5A 2VQTA 3DKWA 3ZYHA 3CX7B 4K9SA 3CBNA 5FIXA 5AQVB 2HWB3 1PO12 2GMPA 2NYYA 4E7ZA 3ONXA 3KV4A 3C98B 3OYWB 3RS6A 1NLRA 1ULFA 1AL22 3ZCIA 1I6XA 2JB8A 3NO8A 5LEJA 2V72A 4C91A 2YZ4A 2ZGUA 2IXLA 4JTNA 3VN4A 1KK7A 4QPGA 5KHKA 1JHNA 2R042 5LBBA 1IOAA 4AK3A 1BMV1 1GU3A 3B01A 2Q30A 2W92A 3C2UA 2LM2A 1UU6A 2BBHA 4HBNA 5FUIA 4LHNA 1IS6A 1CN1A 4TV9E 4I4TE 3CQGB 3DP7A 4NWWA 3GGLA 5AQRB 5HWXA 4LA3A 1W6OB 3WDWA 4LUKA 3I2HA 3UUNA 1PHMA 3ZYRA 1C4RA 1VBA3 3MUY1 1MVEA 1YXRA 1N3QA 2CXLA 4B8EA 2ZHNA 3OY8B 4JEUB 3RRCA 3WX5A 2TBVA 4GB31 3NNLA 1W3VA 2JG9B 2JQ9A 2EIGA 1OF3A 2XBO3 3IDBB 5FYCA 3KV9A 2DLRA 5CFDC 1YQ2A 4RGAA 4XFAA 2DFCA 2BOJA 5FZFA 3WXPA 5IVCA 4I55E 1V6IA 3N9NA 2KWHA 3AKQA 2CXDA 5LASA 1S0EA 4X62T 1UZZA 3VBHA 1XMOT 1WLTA 4Q0QA 4HT1T 3B9IA 4Q29A 4QX8B 5E8AA 4FOQA 2VUDA 2H7VC 3ZSEA 2WQ8A 2N2NA 3EHZA 1J58A 3P5BA 3L9JT 3R05A 3HKCE 1QQP3 3T0DA 2GDFA 3L09A 1TG7A 2WZEA 1J1JA 1Y01A 1MMGA 2W5FA 2J1AA 3DTOA 3HEIA 2JECA 4N43A 3CDZB 1DGRA 2R1BA 2WS91 3KBUA 4Z8XA 3BGAA 3ZYJB 1VAMA 4MADA 1AJKA 4UW5A 2SLIA 4KGGA 4ATFA 4DRVA 4G3YC 1ULDA 1D2QA 3NSTA 2FBWA 3VRBA 2EAKA 3GWHA 2W87A 3LSVA 1M4WA 2RR13 2QVAA 4FO9A 2BEOA 2F4LA 3KT1A 4L99A 5HEJA 3ZIXA 3U10A 4COFA 4OFZA 1WFDA 1JI6A 1WW6A 1R1A3 5A7WA 4RL7A 3WW4A 4KG8A 2YKSA 1RUJ1 1QXJA 2ZEYA 3AMMA 1XC6A 2QRXA 4PK4A 4LO7A 3RFRA 1WLWA 2B5HA 4YJ2E 5BV6A 2L9QA 3LEKA 4QMAA 4QXHB 2W95A 2LRKA 1ZZCA 3HOBA 5FY8A 2YHJA 5A1AA 3PLQA 4P09A 2VQ0A 3OPWA 2JMKA 4LFBT 3JD73 1HRV2 1YLLA 3JB8A 2XLGA 3IEEA 4LO4B 2SPCA 3EI0A 4F3JA 5F3IA 5BR8T 4FOVA 5T52A 3AE9A 1G9DA 1UX7A 3ZMTB 2J47A 1JYCA 1WKYA 4HG6B 4Q0VA 4CUAA 4CP2A 4ADZA 4FOYA 5LBMA 4OZXA 5F3CA 1Z7S1 4GK0E 5H9SA 4E2SA 1PO23 5FLJA 4CDQC 2LE8A 5FMBA 5AQTB 1UZVA 5FZGA 1WLCA 2EIDA 4DR4T 4EXTA 4IEWA 4GULA 3GYDA 2LRLA 2R16A 1KNZA 3FFQA 5BNPB 5ABFA 3RQUA 1N47A 2YDRA 3I97A 2XJRA 1DIWA 4QPWA 3IWZA 4OULA 3E0ZA 1OLME 2FMYA 1ND3A 4QT6A 3VKNA 5KDMC 2VOWA 4CP9B 3J9SA 5A3NA 5L7OA 3HT1A 4JGZA 5F8PA 4RHV3 1ZZ9A 1RGSA 3RQ0A 3H3MA 4JDOA 1C1LA 1I6ZA 1C3HA 3FBMA 2HWD3 3SITA 2VGDA 4HPKA 4FFGA 5ACA2 2R071 5A7SA 3RLFF 2VL8A 2HYXA 1LKNA 3M3IA 1UF2C 5GLZA 2WYSA 4QAWA 4X6RB 4B3TT 2E6VA 1LEMA 4UI9L 4IGOA 4OQ9A 2A1XA 4DUWA 4UR9A 1J1TA 3N9QA 1JU3A 4XBLA 3A7MA 2JMHA 1A8DA 1LOFA 2HN2A 3RKOA 2B7YA 1S0FA 3CMLA 1GZWB 4GD4A 3SEPA 4OZOA 3URFA 5KBFA 3J26N 2ILMA 1VMJA 1APNA 4WVMB 3FBLA 1W03A 3V0AB 4X8PA 3SCFA 2VVSA 4ZI7E 1HCIA 4YW6A 4BE3A 4MHRA 1MMDA 2DCKA 1MIWA 1J59A 2VZRA 2WAUA 5DAWA 2JENA 1D1CA 2LKHA 1R091 3B00A 2JXAA 4NR1A 4GYRA 2HPJA 3UU8A 1CJPA 5FZ1A 5M4YA 1T72A 2W1UA 1ALYA 2B1EA 2QQLA 2ZLYA 1RUH2 1QJEA 4LITA 1B09A 3K46A 4CN1A 4DXZA 2UXCT 5BNNC 2BBAA 4FPLA 1UPIA 5FPLA 5FZEA 4CN6A 3OVUA 3WG2A 5EHDA 1D7PM 1OUSA 1OPOA 4MZUA 4QHZA 4HFCA 3ZSLA 1YIFA 3M65A 4UIGA 3JBG1 2VC9A 3OD0A 4QWNA 2I59A 1HLCA 4X6QB 1US2A 4M3CE 4RA0A 1RMU3 2XHEB 2BVBA 2I2SA 4F8AA 1AYN2 2UU9T 3WOGA 5J2TE 2IVIB 4G63A 2YGMA 5FZKA 4M1PA 1X9BA 3RC3A 1K5MC 5LJMA 5J1XA 4QH4A 3T1YT 2FMDA 2UXBT 2RS13 3RC8A 4Q4X3 4ZXLA 1G73A 2FUPA 2E2AA 1PO13 1W2AX 5FLIA 1GP5A 3BU0A 3VDCA 5DQVA 2KNDA 4ZOLE 4X65T 5A7OA 3RIUA 5H9RA 1DQ1A 1IS4A 1DLLA 4YVSC 1O7FA 1ZYBA 2OPWA 3AZXA 2XTLA 3T1HT 4HOOA 1QLBA 5L3FB 1BR2A 2D40A 3NL1A 4LE4A 2W0GA 1ZBA2 1ACCA 4XF9A 4EN0A 1IQAA 3M3QA 3OUIA 1UGOA 3CIRA 1J1LA 2GH2A 3WAJA 2UY9A 2VVFA 2A5ZA 1LB2A 3PU3A 4O4HE 3AMHA 1WBLA 5C8CB 3AP9A 4MLOA 1YXWA 1DP0A 3N7LA 3WHUA 4GYSA 1JOJA 3N9MA 1HV0A 1CAXB 4E27A 5HEOA 2DF7A 4OHYA 1W99A 4H9SE 1FOD3 1JZ3A 3CNAA 4U74A 2A3DA 2XH6A 5J3UA 4PK6A 4P9XA 3RI8A 1L7RA 4BQ2A 2WZ8A 3R84B 4V2WA 1JZ8A 2NP0A 3NKZA 1UCXA 2GNDA 1NCRA 2XKPA 2PAKA 3LB9A 2QQKA 5I0SA 1TQ5A 3AX4A 4LKSA 4CCMA 3N3HA 4YVWA 4JI1T 3X1DA 3DYMA 5IATA 4UT5A 1KFXL 1UIJA 4AXOA 1HKDA 3ZXFA 5LK7B 5JXHA 3POJA 2VVDA 2VE1A 4H9OC 1CZTA 2J1RA 1NE4A 2QYWA 4D6SA 3W59A 4XCAA 1MQTB 2H88A 5FK8A 4YLHA 4IV1C 2D3SA 2B45X 4HEAA 2WT2A 1RUI1 1V6NA 2MBGA 2XQRA 1KEYA 4EQVA 2WMNA 2ZM8A 1U5XA 3LA2A 4A45A 2E9QA 3M1HA 1SLTA 2OA5A 2LROA 1CR7A 4AKGA 1COV2 2ZKLA 3BODA 1S2BA 1XE7A 1I1EA 3KT7A 2W61A 2VQFT 1D0HA 3NVOA 1WBFA 4BQYA 2WDVA 1V6LA 3ZYFA 3BCWA 5BNNA 1NLQA 3HKEE 4KI0F 2J1UA 1MS5A 4ATEA 4Q0UA 5JMCA 2IZWA 3BYWA 4PJJA 4Q4V3 4DV3T 3ZFFB 3ZM8A 3JZVA 4Y5Z0 1KITA 2OXBA 4XABA 5KXDA 1GZ9A 4XCBA 1OOPB 2O0OA 4RQPA 5F37A 4MGIE 3DUIA 2WL1A 5J37A 2VW0A 4UBGA 2CLYC 4HZFA 2Y6KA 2BG9A 1G9FA 3VL8A 2J42A 3PURA 5J48A 4Q2FA 4P0AA 3AP7A 2ZCWA 2R061 2A6XA 2K46A 3OBZA 4UYBA 4KWLA 2L8KA 2PLV2 1S0BA 5FMOL 4RN5A 4D94A 2MOZA 5ADXL 4PF1A 4A7YA 2WO7A 4L11A 3THDA 2LM3A 3TLVA 1XNKA 5ISLA 3RZKA 4AQ2A 4IUGA 4AF9A 4NMIA 5BXXA 4XJZA 1ULCA 2WN3A 3OPZA 5J96B 5SV5A 3T4HB 2W94A 1O8PA 1A34A 4NRPA 4P0BA 3ELNA 1UY0A 2CWSA 4EV6A 3THTA 2NTYA 2WQ4A 5T5LA 2D6KA 3CL1A 3SFDA 2Q5TA 4JV4A 4YM3A 2JICA 3AMQA 1MS0A 3AE1A 4AEDB 2RPAA 2ZGMA 1UU4A 1HNZT 4LOSA 1UNBA 2BZDA 1WWYA 1NZIA 1W9SA 4HWHA 3ASIA 2K9AA 2YUEA 3ZX7A 5FFOC 4TV8E 1ZRFA 1BHGA 3JB4C 3HQUA 3LOIA 3IM0A 4HWFA 2WY2A 2X0LB 4CP1A 5A3PA 2XQAA 2CHHA 4YXDA 2YV8A 3AA6B 2I6HA 2RDSA 2KLQA 1POQA 3WNMA 1RHI3 4K20A 4WM7A 5AQUB 3PJAA 2WZPP 4IGQA 2WZHA 4UFIA 5HXHA 1W8HA 1DFQA 2MPFA 1N32T 5FP9A 4HN0A 4KBMB 5C4WC 1GANA 1Q8PA 5FZMA 4H9QC 3GXUA 1IS5A 4JI5T 3RQWA 2AEZA 1N3PA 3LEMA 4QKBA 5JPNB 1LODA 2JQQA 3WUDA 3AYDA 5AQPB 2TNFA 2Q8OA 1AXYA 3RDIA 1DBNA 4AQTA 1UMZA 4XQWA 1OXZA 4DMWA 3N9LA 2FCVA 5LB7B 4Y20B 3QACA 1VRH1 4QDQA 4HFEA 3C4WA 4DXRA 5L3EB 4CDWB 4IETA 3PUSA 3DPRC 4QQHA 1RVF3 3ILRA 1KNPA 3VBUA 5BNOC 4QB2A 3VBOB 3FHQA 1ULPA 1H2LA 2G1MA 5FPUA 3FUQA 5JR2A 4YW1A 2VK9A 1XZYA 4J1XA 4U33A 3RZZA 4M3CB 2MNGA 4JHZA 1MIYA 3VBFC 4R4XA 3VBRA 3IBPA 2XL9A 5FOJB 1QOSA 1EV12 2WFF3 4CDXB 2WNUB 3VKOA 4EN7B 3LZZA 3NAPB 1LOAA 1G86A 1ZZBA 4AI9A 1BK0A 3RZHA 2X5IC 2WSSV 4XILA 3BTYA 1ND2C 3GMIA 2WFPA 3U4XA 2WLQA 1UN1A 5JXGA 1H9WA 3ZDSA 1HX8A 1CIWA 1OWAA 4N78D 3AXEA 3B13A 1HQWA 5I0DA 1SG3A 3B9CA 2WZIA 3RMXA 3B69A 3ZLIA 3NNGA 4PFOA 2VCBA 2IC6A 4DUYT 3PJAJ 3I54A 2BS3A 4XFHA 3PUHA 1UU5A 2A9UA 3HJRA 3VR8A 4P5HA 3ZXDA 2HPLA 5F5CA 5JR7B 5H9QA 3RZJA 3I1AA 5EXOA 4QM8A 4JI2T 3RG0A 2DNXA 5DDJ1 5AQFB 4QPGB 1XNRT 2WBLA 4D6QA 1C1FA 1CX1A 3LSEA 1PVC3 1LHOA 4JAAA 3SC7X 2JG8C 4R4ZA 5KXCA 4XZCA 2XHNA 3AFKA 3Q8AA 4YPJA 3UK9A 4H63H 1EY2A 1BQPA 2DBIA 2BV4A 3TN91 3JQWA 1AR61 4NIIA 4AKIA 4XHBA 5T5PA 1NAEA 2X09A 2ZEZA 1IBLT 1JXNA 4JGYA 5B2GB 1ZKEA 4GIQA 4EN8B 4DBQA 4CEYB 4YJ3E 3H8OA 1XYNA 4B4RA 2D98A 1EAH1 5D8AC 1MZ6A 5M0TA 5B4XA 3OB8A 4XZPA 1D4M2 2M67A 4QDSA 3TAYA 1TNFA 4PDWA 1G8XA 1RITA 5F5AA 3AL5A 1O59A 2HEYF 1AL21 4DFSA 5FZIA 1W90A 1DGWX 3GALA 4COWA 3ZMSB 1N33T 1NE6A 5HXMA 2FCUA 1RTVA 3SH3A 2FDFA 5DAPA 3WSOA 2WA3A 2R041 1W0PA 4LFAT 5K0UA 1OH3A 1N1VA 1ZREA 4J1WA 4PJNA 2V7MA 4GH4B 1AR83 3MPBA 1JUHA 1IGOA 5F6KA 4LBMA 3SHRA 2IDOB 1BR4A 2XGXA 1V0AA 2ZX4A 2BU9A 2ETEA 1F4HA 1ZZ7A 3AFGA 3ATGA 4Z8BA 2LALA 2FCTA 4B3NA 4DR3T 1HN0A 3O14A 1GFF2 2BVVA 5JOXA 2E7AA 1ZHCA 3WP5A 1ZV4X 2ENRA 5FQ0A 2X9YA 3AJYA 3JADA 1COV3 1AVBA 1GWLA 4P9JA 4OK0A 3J7MA 1IPJA 3ES4A 4CDUB 1MS4A 1YQ6A 3D3AA 1US3A 4LHLA 4N43B 4HN9A 4B4QA 3JQXA 1RUE3 3VBSC 4L97A 3DV8A 2C9AA 4YSFA 1U5PA 2V4VA 4QDRA 4I0UA 1AR73 1WCQA 2E8IA 3BIEA 3GZEA 1GOHA 1H9PA 4LA2A 4GMP1 2X5IA 4Z1VA 3T3YA 3BOPA 5GKAC 4XBQA 3WF1A 2FZ2A 5HEUA 2NMNA 2ET7A 2ZGLA 5IVJA 3UUBA 1G9CA 3QLQA 4KWUA 4AFAA 2DWGA 2WDQA 2RMU1 5EZWA 4IT4A 2ZGQA 1U12A 3I59A 4XBNA 1DU2A 1LAJA 5I8YA 3F57A 1QDCA 5IK8A 1YQ3A 5C9AB 2QFEA 5A7WB 1O3SA 2A2FX 3OEBA 2KMFA 2Y60A 4Q0PA 1JYTA 5HWYA 5LRRA 2LSIA 3KT4A 3ZFGB 2DUQA 4BIFA 4E4SA 1UX5A 3OGGA 1C5IA 4EROA 5E6HA 4GXLA 1S0GA 3RYKA 2OS2A 2XLFA 4I50E 1NA1C 2GN3A 3S5QA 3D0TA 5KC5A 4PJMA 3ZSKA 1HQLA 1QU0A 2BG9E 1CD3G 1LRHA 3ZPYA 2IC1A 1BR0A 4LBKA 2LLYA 2PAEA 3TEYA 3WUCA 5JWPA 1W2OA 1YFXA 5FY5A 1NUKA 3UU3A 5C3OA 2PHXA 2R0HA 3BN6A 1IS3A 4X20E 1YUDA 2DCTA 4UW4A 5IVFA 3UL2A 1VCSA 1YJKA 4MBQA 1ZVFA 2Q9QC 2LS6A 3AE6A 4NWVA 4I3GA 3C7FA 4XURA 1YKEB 3NZPA 1UMIA 1MNDA 4QXKA 2D93A 3H1MA 2QDNA 4DQAA 3USUB 3MIDA 4IE7A 2RS31 3WQ0A 1HW5A 4MV2A 2LOSA 3M3EA 4ISSA 1J3RA 4W6XA 3TOJA 1VBB2 1HNWT 2A3YA 5A32A 3NJYA 3C51A 4RSUA 2VNOA 3UGGA 1A8MA 2Y64A 5KC6A 3RI5A 3ZR5A 2VBBA 1IZNB 1SE7A 5CFDB 4DB5A 4HPKB 3EBRA 5C2TA 2D7FA 4BH9A 2PA7A 1QJFA 3VD7A 1EP0A 1QNYA 4BB3A 1V6MA 1CVNA 3V0BB 1AX0A 3WR0A 2UWAA 1DQ0A 2F4PA 2G19A 2CBIA 1FX5A 4I2OA 2W46A 4GB32 1DGLA 3RH3A 2R32A 3ETVA 3OYWA 2QZ3A 1WMEA 1C8M1 2XUMA 1FMD2 4HWCA 2W2IA 5GZFA 2WSUA 3HKDE 4YG3A 4Q0SA 4DV4T 4CA9A 1JYIA 3IIAA 4S2GA 4I3PA 3ZIWA 2HYKA 2C4XA 3ZFEA 2RA1A 1C28A 1OKQA 3FHAA 2I74A 2XJ7A 5FYVA 2WNOA 3LWCA 4CCJA 4KMCA 5DAXA 4DNYA 3ZYLA 2J1SA 3BQLA 2E7QA 2VMIA 3P3NA 5JVVA 3WNPA 5ACA1 2XG3A 3OBAA 1TMF3 3JCIA 3U78A 3NW4A 1XE8A 5FMCA 3AE8A 4HKWA 1UY1A 5AQQB 4JI6T 1W28A 2VZ3A 5KWRA 2HN1A 3Q9OA 4NOTA 1M62A 1QJX1 4JI3T 1XNQT 3B57A 5AC93 1RUC3 4ES9A 2XMLA 2UUBT 1EV13 4KHZF 4ASKA 3OY8A 5AQGB 4EN9B 3L39A 2HWF3 3NRYA 2AC1A 5JR9C 2JG9A 1UY3A 4OHZA 4QB1A 1Z0HA 3ZN5A 3AEGA 5FPBA 2NQYA 3G6JB 3ZC1A 2NP9A 3AKTA 5A70A 1ZBE2 3OG2A 2JEMA 3Q5WA 5AFUL 5FY9A 3N9PA 1SFNA 2CY6A 3POIA 3R6SA 3ZSMA 1QEXA 5C3JA 1PVXA 2CGOA 3AE7A 4QXBA 1W0OA 3O1OA 4OYKA 1WUVA 4QX8A 2DCFA 3I4IA 3PUQA 4LBJA 4Q4Y2 1VBE1 2WUHA 5BY5A 5A3OA 3P4QA 5CKNA 3RIAA 5HAXA 1Y3TA 4P02B 1E5HA 5I0TA 2FQPA 2VO5A 2BGPA 5JUVA 3C64A 5IVEA 2XJVA 1S0JA 1ZZ8A 1RUH1 2WS3A 1FPN3 3ACIA 5EJ3A 3LGRA 5F5QA 5CEHA 3LCPA 4E8DA 3S30A 2A6YA 1FJGT 4IEQA 5FP8A 3ZXJA 3HI2A 5BMVE 4PW8A 2FBEA 4TNVA 2K9ZA 4F6RC 1T2XA 2Y33A 2PHRA 4IEPA 3J7HA 2XAGB 3MF6A 4CXWA 2GNTA 4DPNA 2B4KA 3E5XA 1SBFA 1LOCA 1WGPA 3MUZ1 4B29A 2Q9QD 4DVDA 2VQET 2V5CA 4IXLA 1CPMA 3T4VA 3UTKA 3AP4A 4HONA 1OD3A 4C0HA 4QHOA 3OEAA 2XQ4A 3WDTA 4JDMA 5FXVA 1AL0G 1S94A 2JDUA 4FQ4A 2NMOA 4E4ZA 3GCWA 1XDOA 4B6XA 3BPZA 1HR0T 4N53A 4K21A 4RFT0 2ZABA 3U0ZA 1LULA 1NCRB 4AVAA 4DR6T 1YNAA 2BWAA 1ZBA1 1FV2A 2R072 1KXGA 4YVWB 4DMVA 5CA6A 1S1AA 1JYVA 4PIYA 4A44A 4YT0A 4AR2A 3SNMA 2EVXA 2C26A 4RGKA 4AEMA 5T55A 3L3PA 3G06A 5A6QA 1PNFA 2JDYA 3NMBA 3D6EA 3SS1A 3NQHA 1CGPA 1V9DA 4XFBA 5I0RA 4IDOA 2JD9A 2D9DA 3ZMNA 4OYUA 4AGGA 4DY3A 4YY3T 1GSLA 4MOAA 3QB5K 4HKOA 3O1MA 1B7TA 1HQNA 1ULGA 2RM23 2ZMNA 5BNNB 3OBTA 4ONUA 4BXSV 1N34T 5JDMA 4BU2A 4GKKT 1WCSA 4WZCA 1MS8A 1IZ3A 1DZTA 1ZEEA 4RR3C 1FNYA 5KHJA 4F8HA 4U3CA 1OBNA 3IKWA 2EXKA 5FYIA 5GLVA 5A6ZA 2PYTA 4OCTA 4NUVA 4AZZA 2YOEA 4ISRA 2VULA 2R30A 5C3RA 3VKMA 4KGQA 5F2SA 5FP4A 4UFKA 1AHSA 1H8TC 4LE3A 3WG1A 1GOFA 4CQIA 4PBPA 2RR11 4LK7A 2WABA 2BG9B 1TME3 2H0BA 3ITQA 5D1IA 3FL7A 3M3OA 5G05L 3FN9A 4F83A 2ZGSA 4DV2T 2GC1A 5IK4A 2W9XA 5CZKA 1GZWA 1PM7A 3F95A 1I3HA 2LRPA 1X8EA 3A22A 3P4WA 4YFWA 5JMOA 2VNGA 1SLIA 3AYAA 5A3LA 3RRDA 5I91A 4XXAA 5FZDA 1BBT1 1NAFA 5FMNA 3JD71 1DYOA 4FSJA 3NV4A 2K3WA 1DCSA 1U5ZA 1TNRA 5AVAA 1HTJF 2PHDA 1RUF2 5T5JA 3MW2A 4XMIA 4XFFA 1TEIA 4GJZA 3ORJA 1OXCA 4P08A 2A6VA 2JJ6A 3NWKA 4D7YA 5F32A 2CGPA 3HBKA 4XF0A 2YFUA 4QPIC 1YJLA 1LHNA 4MXVA 4LHKA 3I2FA 3HVDA 5AQJB 1K12A 2E51A 1V70A 3KGZA 1SA0E 1LCLA 3QOFA 1H1MA 1YEWA 3SXWA 1ZX5A 2VTXJ 4M4PA 1F9KA 3E5QA 2AZ5A 4BWOA 3USSA 3B02A 2PLV1 1E57A 2XAHB 4LNVA 1HX1B 4FFHA 5C5UA 2WSVA 5FZ9A 4ZI3D 4TN7A 4OUEA 2J1VA 3HPNA 1A78A 2WKKA 2EHOC 4IQPA 5LGTB 4PJYA 3PDQA 4WM7B 3OBVE 2DTWA 3O0XA 3SQOA 4I0AA 4PLMA 2AH2A 5FKBA 2CAUA 2BDEA 4MLKA 3FBYA 2E32A 1JODA 3N7MA 3BOWA 5LW9A 5DXDA 4AISA 1HXS1 3LDRA 2KWIB 4YZ1A 4LULA 2FDIA 3UU4A 4A42A 3T8OA 5A1LA 4IEYA 1DGWA 4NPMA 5DZEA 3WVJA 2D6NA 5C70A 2AEYA 4UV9B 4HKAA 5HCMA 1HJGA 4WM8C 3O1SA 4EYUA 4IV1B 5JDNA 4XFGA 4IL4A 2ZMLA 2H3RA 4FI5A 5E16A 4IV3A 4X8NA 3WNNA 4HVQA 3CF6E 2P9BA 1HJFA 2VMGA 1Y9MA 3L2HA 4C8DA 3MPPG 3FZMB 1Q56A 3OOXA 4X1YE 4H55A 4MVTA 3GA8A 4W50A 1UL9A 2ZEWA 3R4DB 2Q8EA 3E6CC 4P14A 2E7TA 4QB6A 3U11A 5C8CA 1S2KA 4MGKE 3RVHA 2YBSA 3HA4A 2BFUL 2WIIB 4YGBA 2OUJA 3ANWA 4JYAT 3D0SA 1RUI2 4YTMA
chains in the Genus database with same CATH topology
3DTOA 2LSKA 1HS7A 5A7OA 5A7WB 3UTKA 3NRXA 2UXNB 2W00A 4HONA 4MALA 5FZ4A 2A2FX 3J9X1 3ZYKA 4QHOA 4QWNB 4QU1A 2KMFA 5LCYA 2Q8DA 2CM0A 5FXVA 3SRZA 2OX0A 1US7B 2PBIA 5HWYA 2BZBA 1OXZA 2LHRA 2LSIA 3KBUA 2VWAA 5LOVE 3EVYA 4Z8XA 3N9LA 4DMWA 2XDVA 4IIJE 4QX7A 1QSDA 4IE5A 4EAHA 2XTLA 1S94A 4AI6A 2ES0A 4HOOA 2V1DB 5FXZA 5LGNB 1Y64B 1UX5A 3K3NA 3KVAA 5L3FB 2MTQA 2N9DA 5J2UE 4Y33A 3ZN0B 3ZMZB 1BR2A 2XASB 2LSJA 4B6XA 3BK9A 5FZLA 4URAA 4GOUA 2W0GA 3C4WA 5FZOA 3MJXA 1VOMA 5E6HA 5FJKA 3DJBA 3PUAA 3KFWX 2EHOA 5L3EB 2QA7A 3Q9DA 4CCLA 2OS2A 4C90A 3PUSA 4O8SA 1UCUA 1MMAA 4LIVA 4CXXA 4I50E 4O4IE 4AKRB 3UUMA 3WAJA 4XAXB 3D0TA 3LD8A 2ZM0A 3AAEB 2LSYA 2Z6EA 4PJMA 4CI3B 3O1HA 5A3TA 4ZI2D 3WAKA 3CPZA 2WMOA 3PU3A 3GWHA 4QKNA 1D0ZA 3AA0B 4G2AA 5FYHA 4O4HE 2C5JA 4TZ4C 1NWMX 1Z0PA 1BR0A 4NUBA 5FPUA 2LHNA 4DMVA 5LBQB 4BJMA 4GK5E 1LVFA 3K3OA 5C8YE 3GN5B 5L2LA 2E9XC 1IJ5A 4OFZA 5FY5A 2VK9A 2OQ6A 2NW8A 2K24A 3L3PA 5HYAA 4GYSA 5A3PA 2ODUA 3JC6D 3PTRB 1WR6A 1U4QA 4H63V 5A7WA 3N9MA 5F2WA 4J2CA 3RYFE 5F3JA 4AKHA 4X20E 2CCQA 3SS1A 5IVFA 2V7KA 5FYSA 3KVBA 1MIYA 3EUHA 4H9SE 5ANQA 4E4HA 4MBQA 4A56A 5FZ3A 1MNEA 2Q9QC 1CUNA 3ZEFB 4QX7B 4U74A 2XXZA 2GP3A 2D5UA 3IBPA 4U72A 2J1DG 2H7OA 4NUUA 1AJ3A 5F5IA 1T98A 2A3DA 5K4LA 5IW0A 4PK6A 1V9DA 1YKEB 4PFPA 4PK4A 4ZS2A 3HKBE 3NZPA 2IW5B 2X66A 5LXTE 2EHOD 4YJ2E 5EK3A 5HXRA 4ZI3C 2L9QA 1MNDA 3N2KE 3KDSE 1YW0A 5FZOB 5EZYE 4QXHB 2EHOB 3R84B 2K5BB 4I43B 5LA6E 2D0TA 3P7IA 4HGAA 3ZC0A 4V2WA 5FY8A 4P09A 4K0UA 3Q2MA 3OPWA 2JMKA 3UT5E 4ERRA 4IE7A 4EZHA 2PFVA 2YPDA 4AI9A 1FMWA 3IEEA 2PXJA 4TUYE 2SPCA 3ZJ1A 2LOSA 5F3IA 4WNKA 2WSSV 5KR7A 4IDZA 2VKOA 3OJAA 1E1HB 3C50A 3GMIA 4ISSA 2NOXA 4GIWA 2Q8CA 4UELA 2JPFA 3UUXB 3N2GE 5JQGE 3PDYA 3UYJA 4FJOA 4CI1B 3RPUA 2WWJA 2MYSA 2PJQA 3DXTA 3LBXB 4XDPA 3NJYA 3I0OA 5LJNA 5F3EA 4HE8A 1FMVA 3BQIA 3ZCJA 4CCMA 1B7TA 2N1GA 1HX8A 2ODVA 3BQKA 3RYHE 3C51A 3ZMTB 5FYZA 3GN5A 3PE0A 3WI3A 3LK42 3TKLB 3LJCA 1OWAA 4N78D 3AA1B 4PK5A 4ADZA 1IZNB 5LBMA 2KZ7B 5L3DB 3A5XA 3VHLA 4WBOA 3B13A 2NWBA 5JDMA 3O9XA 4BU2A 5F3CA 4TX5A 4H9OC 4ZHQE 3EDVA 1D1BA 5L3GB 4GK0E 3N9OA 5DJQC 3KV5A 5E0OA 4D6SA 3CX8B 1ZEEA 5FY4A 2LE8A 3E22E 5J1GA 5FPVA 3ZLIA 5LNKA 2UXXB 3R6NA 5FY7A 5JVDE 3QC9A 5FZGA 2CWOA 4PFOA 4UVBB 4YLHA 2WWUA 2LM9A 5JH7E 2IC6A 3JC6C 3K2OA 2YBKA 5FYIA 3LK3B 4EXTA 1WLXA 2GP5A 4NUVA 3MACA 4HEAA 4DBRA 4BJNA 2X51A 1D0XA 4KUMB 3ZMVB 5F39A 2MBGA 5FJHA 5CB4E 2D0UA 4O4JE 2WMNA 4QXHA 3I9WA 4V1Av 5ETWA 2XUEA 5F2SA 1KNZA 5FP4A 2ZM8A 5LWBA 4H9PC 4UV8B 4CQIA 3ZN1B 5IVBA 1FEWA 5CA1E 1BR1A 4KP3C 3W15B 2OA5A 5FZBA 3ESLA 3LDBA 2HPLA 3RH3A 4AKGA 3K3QC 3MKDA 5F5CA 5FXXA 4BISA 5FBJA 3OYZA 3ETVA 5IVVA 2NW7A 5FUPA 1WYCA 3E0ZA 4EZ4A 3I1AA 2W61A 3IHRA 4ILUA 4UF0B 2CXFA 3ETUA 3SOLA 5KDMC 3LBXA 3DXUA 5A3NA 3V5SA 3CQXC 3AB3B 1HG2A 2W2IA 5FZ0A 3ZYMA 2DNXA 4DNDA 5F8PA 3HKDE 5LP6E 5A80A 2WBLA 3RX6A 4D6QA 1SHZC 3HKEE 1VRBA 3CWZB 2ACXA 3SWHA 2YU1A 2K48A 3UFEA 2CMRA 2OT7A 2RA1A 5A7SA 4YFSA 5EK2A 2VL8A 2X67A 4XZCA 3QK6A 4PJJA 3OKQA 5FYBA 4IGUA 5FYVA 5FZCA 2W63A 4CCJA 4CSWA 5FZDA 4KMCA 4EIWA 3MA9A 4H63H 3ZYLA 4ISTA 5A7PA 1NAFA 5IVYA 3BQLA 5FMNA 2GK9A 3ZJ2A 5FXWA 2Q9QA 2YINA 4EOZB 1LKXA 1D0YA 2Y48B 4AKIA 5H6QB 3LK2B 5DABA 4TN7B 3IF8B 1HTJF 5JDGA 3AL6A 4IGOA 5F37A 3NBXX 4O4LE 3CX7B 5KX5E 2XAJB 1ZKEA 3CKDA 3N9QA 3VKHA 3U78A 1WRDA 2CLYC 4DBQA 4QXBB 3ONXA 4DO0A 4OHFA 4E7ZA 5L3BB 4GJZA 3N5LA 3KV4A 3C98B 4YJ3E 3ZMUB 4CCOA 5JRCB 5F32A 2JMHA 2XAQB 5A7NA 3KINB 3O4XE 3O1JA 4IHJE 5IVCA 2JJ9A 2A72A 3MZKB 3ZCIA 3PURA 4UF0A 3RKOA 3AVSA 3V5UA 4P0AA 3B57A 3RRWA 1HG5A 4C91A 2XMLA 3CMLA 5LYJE 2M67A 2CWYA 2KXPB 4GD4A 4L9IA 4ASKA 4AQFC 3LFMA 5LG4A 4AXPA 3AAIA 1KK7A 4ZI2C 2V7IA 2WM9A 4V2VA 5IWFA 2HH7A 2L8KA 5HXEA 5IHYA 4BA9A 1G8XA 1SA0E 4JUYA 5H6RB 5F5AA 5DQWA 3NRYA 5JR9C 4PJLA 3QUJA 3AL5A 3N2OA 1D1AA 2E9XB 2MOZA 5ADXL 3FBLA 3EDUA 2X9XA 2W62A 4HTEA 4JEHB 5FPAA 3C4ZA 3HL6A 5FZIA 3F2EA 3AA7B 4UEMA 5FPBA 5A3WA 2LOPA 3ZMSB 5LGUB 5CA0E 2LSGA 5LHIB 2X9WA 4X1IE 1UX4A 3ZC1A 5FY0A 4YHJA 4CCNA 2NP9A 2V7JA 4ZI7E 3O1IA 4CXYA 4MFRA 3CQCB 5ISLA 1HCIA 1MMNA 3S4UA 5JDLA 5FP3A 3I0QA 5FZ7A 2C5IT 1MMDA 2Q9QB 1HFAA 5LHGB 2NW9A 2XAHB 5FY9A 3Q5WA 1MIWA 4TV9E 5AFUL 3N9PA 4QXCB 2KINB 4I4TE 4AQGA 3CQGB 2WAUA 2C0SA 3DP7A 4CZZB 4ZI3D 4PJNA 4TN7A 5FZ9A 2YK0A 1D1CA 2V7MA 5FY1A 5HWXA 2VD7A 1EZ3A 4EYYR 2VKHA 2CA5A 2G0UA 1YD8G 4P0BA 2EHOC 5LGTB 2ZM2A 3PDQA 3MXZA 1BR4A 1X79A 3OBVE 3U3IA 4QXBA 1WYBA 4OYKA 4PAGA 2DI4A 2NTYA 4GYRA 2HPJA 3ZPOA 4QX8A 5JRCA 5FZ1A 4UXNB 3UUNA 2DCFA