3KV9A

Structure of kiaa1718 jumonji domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 116
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv9A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv9A01
5FZ8A 3ZLIA 3KVAA 3N9NA 5FZCA 4CCLA 5FV3A 4Y3OA 2VD7A 3AL6A 5FXVA 2PXJA 5A3NA 2P5BA 5FZ6A 5FZOA 5FYUA 5F3IA 5FPVA 5IW0A 5FPLA 5FUPA 4EZ4A 5FXWA 5FZKA 5ISLA 5FY0A 5FZAA 2WWJA 5FYTA 4GJZA 5FUNA 1VRBA 3PTRB 5FJKA 2OQ7A 2OQ6A 5FJHA 4AAPA 4BISA 4CUGA 5KR7A 5F32A 5CEHA 5FYYA 4UF0A 4Y4RA 4QXBA 4EYUA 4CCMA 2WWUA 3KV6A 3K2OA 5IVBA 5A1LA 3AVRA 4Y33A 5A7WB 3KV5A 5F3GA 5A3TA 5FPUA 3DXTA 4XDPA 3UYJA 4URAA 4BU2A 5FPBA 5IVVA 2OS2A 5A7NA 4HONA 4E4HA 2XMLA 3LDBA 5FZIA 2YBSA 5FYHA 5FYVA 5FY7A 4GJYA 5FZDA 3NJYA 2OX0A 3N9MA 4D6SA 5FY9A 3PURA 4QXCA 4DO0A 3PUQA 4CSWA 5FY4A 4QWNA 3KV9A 3N9PA 3U4SA 4V2WA 5FZ7A 2GP5A 3OPTA 2Q8CA 2YBPA 3N9QA 4BXFA 2YU2A 5A7SA 5IVCA 5LWBA 5A80A 5A3PA 5FZ0A 2XDVA 4LXLA 3K3NA 5A3WA 5K4LA 4XDOA 5LW9A 4D6RA 3KVBA 3AL5A 5F2WA 4CCKA 5FBJA 4QX7A 4CCNA 3PU3A 2YPDA 4V2VA 2XXZA 4IGPA 5FYSA 4GAZA 5FP8A 5F39A 5FY1A 5FZBA 3ZPOA 5FYZA 5A7WA 5FP9A 5FZGA 5FZLA 3DXUA 5FZMA 5IWFA 4QXHA 5FWEA 5A7OA 3AVSA 5FZ9A 4CCJA 5F5CA 5FP4A 5FP3A 5FZEA 5F5AA 5A7QA 5FZOB 3OPWA 5FXXA 5FZFA 3LD8A 3PDQA 5IVEA 5F37A 5FY8A 5IVFA 4DIQA 4LIVA 4D6QA 4UF0B 4C8DA 5FY5A 5LY1A 2XUEA 5FZ4A 3N9LA 5FYCA 4NUBA 4QU1A 5FPAA 5FZ3A 5IVYA 2YU1A 5ANQA 3KV4A 5FXZA 4AI9A 4CCOA 2W2IA 3PUAA 4ASKA 4IGOA 4TN7A 5F3EA 2Q8EA 4LITA 4GD4A 4IGQA 5FYMA 4EZHA 2OT7A 2Q8DA 4QX8A 5FYBA 2YBKA 5F5IA 5A7PA 5F3CA 5LY2A 5FP7A 4LIUA 3K3OA 4HOOA 3U78A 5FYIA 5FWJA 3PU8A 2GP3A 5E6HA 5FZ1A 5IVJA 5F2SA 5FZHA 3RVHA 5A1FA 3N9OA 3PUSA
chains in the Genus database with same CATH superfamily
4NWVA 1AR73 3VBSC 4U2AA 2PELA 1N36T 3MIEA 4AI2A 1OBNA 5FUNA 1JHJA 2UY8A 3ZXGA 4HTEA 2DF7A 2E32A 2IXLA 1E5IA 1HX6A 1IPJA 4YTPA 2XMLA 3GBFA 4JI4T 1NAEA 2VNOA 3RYCE 4D7TA 4OI0A 4XPVA 3AE9A 1FMD2 3ZIXA 2R6QA 4AVVA 1BXHA 4LBJA 3P7IA 2YEVC 2Z69A 4JI6T 4MLOA 5JXGA 1UMZA 3J9SA 1MZEA 2VQ0A 1V9U1 5IHRA 2VGDA 4P00B 4O2AE 2YKSA 1MZFA 4YGDA 2EHOB 2EXKA 2VZPA 4TWDA 5JOXA 2AZ5A 4C1WA 5IVEA 2C5JA 3LFIA 4GXLA 2VZVA 4A6OA 4Q4Y1 3OBZA 3I1AA 3NNMA 2E31A 2D3SA 2W1QA 1VIWB 1UXXX 5AQIB 4Y20A 3RZGA 1DYPA 4ASKA 5F9TA 2KD7A 4GH4C 4MVTA 2YB7A 1U5YA 3JADA 4QQLA 3T4HB 1NQJA 1X8EA 5IK8A 3VKHA 1PO12 3Q5DA 2DCKA 5FVKA 4JDMA 2H0BA 1ZRRA 2RM23 4XYXA 2MAWA 3KHBA 4UF0A 2KA3A 4FOWA 1QLBA 1UXZA 4N7UA 1F4HA 4Q0SA 3HI2A 3DP7A 2HWB2 2K46A 1TVGA 4DR5T 5IVCA 3ETQA 3AEAA 2DCYA 1C1FA 2ETEA 3OF1A 1UX7A 1OLMA 2OIIA 4GYRA 4CA9A 3I4IA 5DDJ3 2EHOC 1ZKEA 3KDSE 1YD8G 2FJAA 5JTGA 3GHNA 4J1WA 1NCRB 4FPHA 5FY8A 2JXAA 4C8DA 3PUWF 1CONA 3H8XA 1VBE1 1AL21 2WABA 2BGOA 2GC3A 2ZGNA 3O1TA 1GWLA 4P9YA 1N3QA 2R063 3FMGA 2E9XB 1WKYA 4FPKA 4NWWA 1D0HA 4ISSA 3ZCJA 4LKFA 2IC6A 2HWF3 3WF4A 3VBHA 1DQ5A 4HWIB 2Q1MA 2Y6JA 4PQ9A 4XMIA 1H7CA 5TSWA 3UL2A 3EBRA 2VVFA 3MF6A 3LDBA 4B4RA 3OTFA 3O9XA 5EWSA 4K20A 2VOTA 5M0TA 3SFEA 4ASLA 4DRRA 1B35C 2VTXJ 4HFEA 3RYFE 2Z79A 3PMEA 3KT4A 1SQ4A 1UZWA 5FYSA 3PHMA 3OEBA 4CN1A 3PUIA 1JZ5A 2ZABA 5HXEA 2B39A 1CVNA 4CDXB 4HPKB 4ILCA 3W15B 1NCRC 1Y43B 3MW2A 3P4SA 5BNOA 4O7XA 1KDMA 3IBMA 3ZYRA 1OXZA 3FUOA 3IIIA 4XW3A 5HV0A 1QNWA 4IE0A 2ZCWA 5T5JA 1NLSA 3AFKA 2GU9A 2HPJA 1REFA 4ZZBA 4LMLA 2VAUA 3BTAA 2E63A 2JX9A 4IV3C 2WDVA 4HWCA 5EQUA 3N35A 3HWJA 1APNA 4LE4A 4ZY9A 4WVZA 3CO2A 3KINB 3WF0A 1YQ4A 5CJ5A 4COFA 4XURA 2J62A 1CJPA 5AQSB 4PF5A 3VKMA 1JMUB 4FTEA 2GNBA 2E5LT 3AX4A 2ZX1A 1ZZ7A 5CBLA 2A3WA 3O0VA 3ZC0A 3TRSB 2ZMNA 3KF3A 5BYNA 2VBBA 4XVHA 4KBZA 5EK4A 3FE5A 2XG3A 2RMU3 4META 4NVPA 5F6KA 4YW3A 3N7KA 2WSSV 4YSFA 1LKNA 1AR82 4OI4A 3ZO0B 1WCKA 2FZ1A 3TN92 2BPA2 3PUZF 2JDNA 1G9DA 2PHLA 5IUXA 2A6XA 1VAVA 4PNIA 2P37A 1JH5A 4XFFA 1NE6A 2WO7A 2NN8A 2ZGMA 5C3PA 3VHRA 2BVVA 4QHBA 4HWFA 1HV1A 1LULA 2LRLA 1HXS3 3PUAA 4TN7A 5F3EA 4QX8A 3POEA 5K0UB 1C8M1 2D7FA 4EROA 3ZMZB 1O8PA 4P09A 4OHXA 1QUUA 3PTRB 4WVWA 3LFMA 2VUDA 5CEHA 2I0MA 5DUVA 3ZYMA 1BJQA 3IB3A 3I8TA 2KXLA 1OVSA 3B57A 4M4RA 2DTYA 3FZFB 1WW6A 3DKWA 3UT0A 4DO0A 5LEKA 4ATFA 5BNNC 2XBO3 1NY72 1YQ8A 4IXLA 1PHMA 2XDVA 4FTBA 4XCBA 2BG9B 3GYDA 5FBZA 5JR9C 5F8PA 2IXKA 4N9HA 2LHRA 5L19A 3HKCE 3THDA 2Y6LA 2EAAA 4DEQA 4RQPA 2JG9A 5KHIA 2X9YA 1AXKA 1NA1A 2HWC3 3JC6C 3FLTA 1VMFA 3ZMOA 1WYBA 2NQYA 5HWYA 4KBBA 5FMOS 3ATGA 2TBVA 2XM2A 5C9AA 3D5OA 2W2IA 4IGOA 3CQXC 2IXJA 4M4PA 3B00A 3OVUA 5K0UC 1GQPA 1BBT2 4FQZA 1HDKA 1S0JA 4RFT0 4CXXA 4EJRA 1JYTA 4X66T 2V7JA 3UGFA 5L3BB 5HCFA 4Z82A 2W1UA 3TLSA 2ZKLA 2GZWA 1RUI2 2VG9A 1UD1A 2ILMA 1OURA 3J7MA 4B3MT 2E51A 3NQHA 2PHFA 2BG9E 4JI0T 4XJWA 5LJNA 1W04A 4NIQA 4Y26A 2C5KT 4I0BA 3C4ZA 2RR13 2VQFT 1MQTA 1BR0A 3MW4A 5FKCA 4HXCA 4BQ2A 1VAMA 4LBQB 1U5PA 5EV7A 5FZEA 4YHJA 5FZOB 2BBVA 1IJ6A 2JENA 2PLV2 3AZWA 1HRV2 3BOWA 5JMCA 3WP4A 3RX6A 3RQ0A 3GDBA 4AHZA 3MZHA 1MIVA 3A23A 4BK4A 3CZUA 3POJA 3DPRB 1M7KA 1W3XA 3ACLA 2C1FA 2PTFA 3PU8A 3AYAA 2DU1A 5HPOA 5JWPA 1RXGA 2HEYF 2FJDA 2EIGA 2XHEB 5HXHA 1GZWA 1BK0A 4X20E 5AQOB 3ZMSB 5E16A 3T1MA 4PJMA 3V64A 2KMFA 4FAGA 4XEZA 4XBNA 3RKGA 4Q4V1 2R1BA 5L36A 3QK6A 4N9IA 5ABGA 5LCWL 4V2WA 5LMUT 2K3WA 5EJ1B 2VOVA 2CWMA 2GMEA 3AA7B 4V2VA 3J8F2 2ES0A 2CAUA 5L3FB 1LGNA 4F8HA 1KEYA 3U07A 5FZGA 1D0GA 4LBMA 1JOJA 4A2UA 4EN0A 4B3NA 5CYYA 2VMFA 1CX4A 4HK9A 3AC0A 4XETA 3VBUA 2VCMA 5DPNA 2JKXA 1PGSA 5KC5A 2W3JA 3ZC1A 4GKJT 2J1VA 1N33T 2QQKA 5DQVA 1FNYA 2JE8A 3AEDA 5HCAA 3RKOA 3UGGA 3GZEA 5HXMA 2KWIB 2BDEA 1GQHA 1QIQA 4JEHB 5GZGA 2IFRA 1CAUA 4B6XA 3AKRA 3FHIB 2WS93 3K2OA 3CPZA 1KNRA 1YCIA 5FYHA 3QC9A 1XE0A 3RHWA 3L9JT 4TUYE 2JEMA 4AQ6A 1Q56A 1W09A 3A8YC 4AYUA 1VBD2 4UW3A 5C5UA 3I3EA 3E6BA 2YPDA 3H50A 1YKEB 4AQGA 2DNXA 3TLUA 5LBMA 5JDMA 2WIIB 1ZEEA 2JIJA 2DWGA 4RFRB 2HN1A 1J3QA 4TWTA 2IXHA 2BNOA 2LTNA 5FR3A 2JD4A 4CN4A 5ABJA 1G9BA 1W2OA 3KS7A 1L0VA 1JUIA 1XDOA 5HI0A 4AKIA 4OUSA 4AVBA 4I55E 4B3TT 3LCPA 4IUGA 2MTQA 3FBMA 2OT7A 2IC1A 2P34A 5ERLA 3GN5B 2QVSB 4CZSA 4EXTA 2E26A 2O8OA 1DYKA 2LSGA 2CTVA 5FYUA 1Q8PA 5BMVE 1N1YA 3UV9A 1RUF2 2VL0A 1SLCA 2LROA 3GALA 3RF1A 5C5TA 1YXRA 4RD7A 2PBIA 2VCCA 1ENSA 2P1BA 2DBIA 2HHHT 3JCFA 3PL0A 2VVNA 4E4SA 5HXSA 2JQKA 4CSWA 4WYVA 3IIAA 4IEOA 4DZGA 2AEYA 3VBHC 5H9RA 5DZGA 3F57A 1D1CA 3JD71 5ANNA 3WNNA 2WNOA 1PMJX 1SZBA 3AZVA 2RR11 1AJOA 2GC1A 5IWAT 2W1SA 2Q4SA 3LSDA 2ZGQA 2Y60A 4GB33 4QHOA 1ASJ3 2XJVA 1XSQA 4YFSA 1KRIA 4EB6E 3ABVA 3ST7A 1XZYA 5HXCA 3QOFA 1EV12 1PO22 2BFUS 1XNTA 2ZMLA 3M3EA 1PK6C 4TSVA 3DCQA 4DUWA 3K46A 4LUKA 1G9CA 3L3PA 3KVAA 5J09A 4JLEA 5A3NA 5IK5A 3R4DB 1CAVA 3JQWA 3QNUA 4Q0PA 3VD9A 1NEKA 3EYPA 1HTJF 3I9YA 4B1MA 4UXNB 4A97A 1XMQT 2ZHMA 4BE3A 1CUNA 3C7FA 2FDIA 4PLNA 3SHRA 3CQOA 4ZI3C 5LXTE 3UQ7A 3I7DA 2IVJA 2Y8DA 1WWYA 2XJPA 3U0ZA 3HA4A 1RUE1 4MOAA 5KMGP 4FSJA 5FP3A 1OOPB 2WL1A 2ZHNA 2IZWA 1WLCA 2QQPA 4YYOA 3ZN1B 1GZTA 4RL7A 1ZZ9A 3ZFFA 2YG0A 2Y8KA 1FPN3 5JDHA 3N2KE 2BS3A 3WXPA 4AGRA 1OI6A 3VBFB 1PMIA 5JSOA 4HOOA 1C8NA 4LO6B 2J1AA 3VHOA 1PGL2 2ZGUA 2DHRA 4JI3T 5KXBA 2YOEA 3H8OA 4QGNA 3ZFEA 4KX6A 2X51A 2LUWA 1IS3A 3GHMA 4G2AA 3DYOA 2CXLA 2XQ3A 1PO13 4IEVA 2BS2A 2YK0A 4FPLA 4XE9A 2A6WA 4D0QA 5JPMB 2XLAA 4E4HA 3HBZA 1QOSA 4CDUB 1ZBE2 4KHZF 2W62A 1L7RA 3RG0A 4JI2T 3P3PA 4IERA 2WZHA 3FN9A 5FZ7A 3AK0A 4LKDA 4UBHA 4BJMA 1PZ9A 3WDVA 1N1TA 1HRI2 2HWB3 5F39A 4RS5A 3RRCA 4FP3A 4D8MA 2YY1A 3GBWA 4ARXA 2R072 5AC93 3ACHA 4CDQA 1OOPC 3DYMA 1MMDA 1BR2A 2Y6XA 1U4QA 2IXIA 2R041 1HJFA 2CAVA 1K12A 4XDQA 3M8LA 3VU7H 4R9AA 4BXSV 2ZM0A 1PNGA 1LVFA 3BODA 3C4XA 3LF7A 3UK9A 3ZSKA 3VBFC 4CU7A 3WDYA 5GONE 5C8YE 4ET7A 4IQPA 2KINB 1G73A 4RQPC 4Y3OA 4DXSA 2XGXA 1UW8A 1VBB3 1UOGA 1H2NA 3LEKA 2WCAA 1PIV2 5G04L 2WNUA 4YW2A 2UU9T 5C9AC 3ZYFA 4CDUC 2LKHA 1YFYA 4ILAA 3ZFGB 2WWVA 1H6XA 4O4HE 1FJGT 4MXVA 2D3PA 2XJRA 5FKYA 3D0TA 3FHNA 1W39A 2JECA 1LRZA 5CA6A 3AL5A 4G3YC 4R4XA 3AA0B 3O1SA 1AYN1 2RV9A 1WCQA 3RWKX 5EHDA 3OKQA 3RFRA 3LSEA 2IIUA 3RRDA 3C2UA 1JN2P 2BOJA 3ZT6A 2H6CA 2P3YA 4IV1A 1RUJ2 4DV5T 2WA3A 4BH9A 2V6XA 3I2IA 5HXRA 4Y5Z0 1NT0A 4DY5A 2XTLA 2JDHA 3SLIA 2VVEA 3RYRA 3H42B 4MHRA 4KUMB 2PXJA 2YC4A 2WN3A 5FYTA 5E8AA 5FJHA 1LKXA 2CE7A 1ZRDA 3WCRA 2ZM2A 5A7WB 3KV5A 1PNFA 4NUUA 2P6CA 4QX2A 3X29B 4PDWA 4L9IA 1O4ZA 5EFUA 3B7MA 3AB0A 1J1LA 2C0ZA 3DUIA 2NZ9A 1ZM1A 1TME2 3KWVA 3FZ3A 4ISRA 3LE0A 3ZT7A 1GBGA 5GKAC 4DXRA 1GYKA 1LHVA 4N90A 5LBFA 3MIDA 3GNEA 3T2QA 1OD5A 1HV0A 5IWFA 3KD4A 3OG2A 4QT6A 4Z92B 4GULA 1X36A 2D6MA 3JU9A 3VBRA 5DN2A 1NKGA 3JUUA 3T2PA 2JG8C 4CUBA 2YU1A 1LJ7A 5LYJE 1WMFA 3LEMA 5D8AA 4LITA 3UKNA 5IT6A 1DQ4A 5FWJA 4ZZCA 4MGKE 4XQ4A 4LHKA 2PQSA 3AMHA 1H8TA 4PJNA 3O4XE 3PMSA 2AGSA 5L3DB 4H9PC 1S0DA 4BISA 4O61A 4BQWA 2D43A 3UQ4A 4JGYA 4CEWB 3U10A 4URAA 4Y1UA 3USUB 3O14A 3ZKUA 2ZHKA 2LRPA 1W6QA 2RS12 2EIEA 2ZAHA 2YDRA 2RS52 1RMU3 1JZ7A 2J1TA 4LJHA 5JSRA 1YQ3A 3R6SA 3NRYA 1T6GC 2DVFA 3UU4A 3IWZA 1X79A 3D6EA 3VUOA 1GP6A 2WNEA 3R05A 3AE8A 2QQLA 1QJFA 5FOJB 2YFUA 3BTXA 2ARCA 4GIQA 1ZP0A 4YARA 1I94T 1H8VA 2RP4A 1IS5A 5B4NA 4IEWA 5A3MA 2R1DA 3R84B 4Q25A 3LSVA 4O4IE 5F3CA 1IS4A 2KNDA 1V0AA 3WP3A 1XXNA 4QPYA 1XJAA 5FXVA 4XJ9A 4OUEA 5CA0E 1QJU3 1ENRA 5F3IA 1QJEA 2A6YA 5A32A 3SXWA 4MG2A 3MLKA 5GLUA 4Y5SA 2Q9QA 1VBB1 5SV8A 3GM8A 2XJUA 4CEWC 1CGPA 5KHKA 4TWHA 4O2BE 3V65A 1R1A1 3UKTA 3WAJA 3PUGA 1KS5A 1O91A 5L4HA 4MH0E 4I43B 4O65A 1UGOA 1RHI1 2E7AA 3HN1A 2A71A 3EUHA 1OEDB 4RHV3 3OBAA 4GK0E 2P3JA 2WT2A 3SMHA 4JC1A 1GNZA 5AQKB 4LOTA 4O4JE 3WCSA 3H3UA 5JDFA 1RUC2 3A7QA 1W8ZA 1W6NB 1HRV3 3MV01 3LA7A 3CF6E 5C3OA 2NP0A 3MUY1 5H9SA 4LIUA 2Z2SB 1UOBA 4BQYA 1V9U2 5FPXA 4KI5M 1J5ET 4YZ4A 3DTOA 1IG3A 3U75A 3ZM8A 3AAEB 4YHHT 3T4VA 3AJZA 4NR1A 1HS7A 2MBGA 4Q4Y2 1NCQC 2DWKA 3WQ7A 5L7OA 1UY1A 3AXJA 4LOSA 4OQ9A 2MEV1 4GKXA 1O4YA 2WYSA 3N9QA 2J1UA 3UNPA 2KZ7B 2YYOA 3SISA 3H7YA 1UYXA 3LPFA 4QAWA 4P9XA 3PJAA 3PU3A 1VB4A 4NE9A 3UU8A 2VOKA 4YG0A 3Q8FA 4AI1A 2BEOA 5EJZB 1KFYA 3ZYPA 1FIOA 3RLFF 4PLMA 3LA3A 2A75A 3TEYA 5IAVA 2YDQA 1GV9A 3ZOIA 5DG1A 1VALA 1SBEA 3PVBB 2UUBT 4JDOA 4JKMA 4AI3A 1O3XA 1KFUL 1WA6X 5H9QA 1VMJA 3HR0A 3AKPA 1LENA 4LLFA 5L4EA 4QB2A 1S1AA 2N9DA 3H37A 3VN4A 4OHVA 1AJ3A 5LNKA 4DV1T 5LEJA 1JI6A 1H0BA 4YVSB 5A33A 2CHHA 4ES9A 2OPWA 4CUGA 4I50E 4KGQA 3AP6A 2BZBA 1GOGA 3R4UA 4Q4X3 4W50A 1QH7A 2W5FA 4QQ2A 3TEWA 1AL22 3UJQA 3UT5E 3ABZA 3M4FA 4UELA 1JOPA 1W05A 4ISTA 3LZZA 5DG2A 2ARXA 5CFCA 1RMU1 2HBTA 3J7NA 4N43B 4D6RA 3ME2A 4Z91A 4PW8A 3O1UA 2ZEXA 3V0BA 3EB7A 2VULA 5JZGA 1V6OA 4CU9A 3AVSA 1VBC1 4P5HA 5CKMA 4BJ0A 4AFDA 4EWAA 3UUMA 3ILFA 3L2YA 1QJX3 3ELNA 1HNXT 5HEJA 2V7KA 2YROA 3VZLA 2DCFA 1RUG3 3C7HA 1KNZA 5KC6A 1XNBA 4EEDA 2BVMA 4JV5T 2H7VC 5FLIA 2IXCA 2RS33 3POYA 2RDRA 4P9GA 1WLXA 2ORXA 4QPGB 2KLQA 5LZ6A 2CLYB 3U4XA 5AFUL 1YFWA 4HN9A 2DBNA 1QJU1 2DUQA 3QH6A 2YV8A 3C50A 3SKJE 1IOAA 4K6BA 3EMRA 4UAPA 4TLGA 3A7MA 4NXMT 2LM3A 1UX4A 2C24A 4BXFA 1W0NA 3BU7A 1E5HA 1N3OA 4BA9A 4N43C 5HXVA 4NHLA 1Q8VA 1AF9A 4OYJA 3ZKRA 4LMFA 2WNUC 2KXPB 4DOUA 4WM7A 1FV2A 3AE7A 3TYJA 1AR72 4JYAT 3LD8A 2DI4A 4TXWA 2DCJA 4QQOA 3VR8A 2RHPA 4MO3M 4XBQA 1OQDA 1L3JA 5AQFB 2XJ7A 1LGBA 3LIHA 3DN7A 4QWNB 4XABA 4UFIA 4YVWA 4LMKA 4QPGC 3ZYLA 5FMCA 4UT5A 5FPVA 3MACA 2CLYC 4XUOA 1HG5A 3GBGA 3HEIA 4QX7B 3OD4A 4JGZA 1JZ6A 2QFEA 5GJ6A 2CXFA 3OYWB 3N4MA 4LF9T 5FY7A 1FOD1 2YGLA 5JH7E 3MUZ1 4DVDA 1NXD1 4CPBA 3NNJA 4XQWA 1UYYA 1CAWA 3SNMA 3RRWA 4LE3A 3ZSMA 4KL1A 3T2OA 1ZRCA 1ZNPA 5FPZA 3NJVA 1O8SA 1LR5A 2FHRA 3JB8A 2XZEA 4K3UA 1NXMA 3IZOA 3HNMA 3IDBB 4FPFA 2J42A 5LBEA 3BGAA 2Q1ZB 4NRQA 2RM22 2CMRA 4ITCA 5I0RA 2N2NA 2YN6A 1W03A 5FIXA 2JPFA 3J7Yq 5JXHA 1GU3A 3N5LA 4IW3A 5FYBA 2YBKA 3PJQA 1IG0A 1R64A 2VQAA 4MBQA 4CCLA 1Q8OA 2E2AA 2BKPA 2HWE3 3M3CA 3W58A 5ABHA 3WNKA 4Q5OA 5EJ3A 2ZXQA 2Q30A 4FBFA 4DV6T 1R093 5F3GA 5CFBA 1S0GA 3UYJA 1BHGA 4CEYC 4N53B 4GIWA 1XYOA 2WZR1 4NN0A 3NJYA 5ABFB 2E9QA 2XL7A 3TLVA 4CU6A 3M7AA 2JQQA 1ZBE3 4LKEA 1OHFA 2D6OX 4QPWA 1NUKA 1OFSA 2R062 2WUHA 4JGYC 3I2FA 2FCVA 2RG4A 1UKGA 1FEWA 3RC3A 2HWD3 4XUTA 1UK5A 5FZFA 4R4ZA 3POBA 2E9XD 4EWDA 4KH9A 5IJRA 3ZMUB 4CUCA 4TN7B 4BPZA 3OSDA 1QJX1 1AR61 3AE1A 5CGMA 3NVCA 3TKLB 3WZ1A 1LOFA 4W4ZA 3AKSA 1RUG1 1ZBA1 1S4CA 3OUIA 4JVAA 5A7PA 5LY2A 2BS4A 1Y01A 1K42A 4ZI7E 1IZNB 4HVRA 4YRDA 5LB7B 1VRH1 1W6OB 4UVAB 1D7PM 3BTYA 4M0NA 3AEFA 4Y5TA 2PJQA 5K7PA 2WO2A 2JDYA 3EDVA 4N53C 2EXIA 2XOMA 4AQSA 3LPGA 5LBBA 2LM2A 4ADZA 4NRPA 4UFKA 4HK8A 3J7HA 4HL0A 3OBRA 1LGCA 3N7JA 4NXNT 2ORZA 5A7SA 5CB7A 1W9YA 3VBSA 5CAZA 4E7SA 3CQGB 2R0FA 4AI6A 4IEZA 3E1F1 3NNGA 2UU8A 4YGCA 1UKRA 1NA1B 2XY8B 3NKZA 2GNTA 1SPPA 5JIAA 1SUMB 3VV1A 1H6YA 5A7QA 3VKLA 3H3MA 2UXBT 5LMNT 1QJY1 1W9TA 3ECQA 4C90A 4QXBB 4R8HA 5LRRA 3VBOC 4XJUA 3O0WA 4Q4V2 1Z7S3 4IDZA 3ANWB 3WDUA 5KBFA 2YUEA 4YTNA 1KJLA 1QJZA 1RUJ3 1SLLA 5F2SA 1A3KA 1UPIA 3EAMA 1ND3B 2JMKA 3LK42 2RMU2 2XONA 2VU9A 1SLTA 4ZS3A 2UUAT 4EYUA 5BNPA 3KV6A 1HQWA 3N36A 2RE9A 3BPSA 2W39A 5DABA 2VQET 5AQHB 4AQYT 1W2TA 4OK0A 5JREA 4LBLA 1H9PA 3DV8A 4J1XA 4GH4A 1BYHA 4A41A 5JDNA 1WCUA 4XFAA 4XUNA 2N7GA 5T50A 2BTVC 4YW6A 4YWAA 2DTWA 2UYBA 2VO5A 5FBJA 3M2MA 3GCWA 1KITA 4J25A 1VCSA 3UFGA 3C3VA 1JYCA 4FTSA 1XNDA 3B01A 1AVBA 4F83A 3WI3A 2ZMAA 4O9EA 1AL0G 1PX4A 3UESA 3HN3A 2RJLA 5T55A 3C64A 3LK3B 4GWJA 2Y6HA 1H2LA 3FHQA 5AQRB 4XFIA 4BLJA 3AZYA 4I0WB 4YLHA 2FZ2A 1N1SA 1S0FA 2XJQA 2HEVF 1D2SA 2JWPA 1SCSA 2XLGA 2EHOA 1A8MA 1XE7A 1QF3A 3D0SA 2VK9A 2ZZQA 4CP1A 1F4AA 1R083 2A6ZA 3OGVA 4G63A 1J3RA 2LLYA 1DCSA 2W46A 1COV1 3BQIA 1PM7A 3RS6A 2V7LA 3ACGA 4QH5A 4S2DA 4INDA 3AZZA 1W6MB 2HWC2 1J84A 4WBOA 2JICA 3FUQA 2YBPA 1K3IA 4NIGA 2RS13 2HJIA 3GJBA 2RS53 4ZXEA 2G9GA 2Z5WA 1J59A 1MMNA 1BR1A 1D0ZA 1MS3A 5JOZA 2HWD1 2D0UA 3C7EA 5CFCC 1B35A 3ETVA 1W8NA 5A1AA 1DZQA 5I8SA 3J4UH 4LFCT 4EZHA 2BKOA 2UXCT 3MIFA 4CYDA 5LP6E 3K3OA 2FDKA 2GP3A 5A70A 1CAUB 4JEUB 4P14A 4AOCA 4F7ZA 2RR12 3HL6A 5EPAA 3S5QA 2XQRA 3WLUA 2AEZA 1NCRA 3MK7C 1SLAA 2ZLYA 3RGBA 5J96B 1MS4A 4FPEA 2GMMA 2VZ1A 4QB1A 5C4WB 4OLLA 2IDOB 2PHRA 4UYBA 2XQAA 4U7YA 3GCXA 3LEIA 3NSTA 4U72A 4ERRA 4AVCA 1SBDA 1LODA 4NPLA 4IV3A 2Y6FA 2D6LX 1E2AA 1OPOA 3T0AA 1GICA 3QUJA 3SH5A 1E5SA 5LW9A 3SKVA 1X9BA 5L2LA 1VBA3 2OA2A 4IE5A 5JI7A 3RZZA 4GOUA 2E8IA 1XPWA 5ABJB 2V26A 3PVNA 1W06A 5F5CA 2X53S 4NPPA 2W92A 3EQEA 1T98A 4I09A 1AHSA 2H3RA 2JE7A 2YC0A 1TG7A 2DDUA 1E7PA 1XQNA 4CXYA 2ZOEB 2G0UA 1KS4A 4PI2A 1KDKA 4AI9A 1Z7S1 4AWDA 4B29A 3ZDSA 2Q0AA 4LNVA 3BALA 3ZLIA 2DWRA 2NOXA 2BW8A 4JCKA 4IDPA 2QYWA 4CDXA 4HPKA 4L8QA 1CIWA 4QX5A 4P9JA 2MNGA 5FCCA 5C70A 3KCCA 5T5PA 2OPKA 5C4WC 1RITA 4OYUA 3I2GA 2XSAA 4ASMB 3LBXB 1AYM3 3IMMA 4QHZA 4TTGA 4JQTA 4Q4Y3 2O1QA 3OD0A 4AVSA 3M65A 2VKJA 4JHZA 2VMCA 4Q26A 5C3QA 1H2KA 4WZCA 1R8IA 5AFBA 1NZCA 2I2SA 4JAAA 4HKWA 4G4FA 3MDPA 4M3CA 4LHLA 4OCTA 2B1EA 2XPKA 1XNRT 3ZYJB 2QZ3A 5GM0A 3Q8CA 3AA1B 5FAXA 4HMZA 5BNNA 2WS92 3WV6A 3RI8A 4F3JA 2WA4A 2VUCA 3A0KA 2XQ5A 1PZ8A 3ZR5A 4XBFB 5JR9A 2DVBA 1BCXA 1K45A 2J4GA 3ZSLA 2E7TA 4X1IE 2L9LA 3CX6B 2AR6A 3Q5XA 3PVOA 1QDOA 3OJAA 4XUQA 3MZKB 1R081 3UGHA 2BGPA 3NV3A 5DUWA 2SLIA 2OS2A 2VE1A 5C3RA 5T52A 3S30A 5L9BA 4LK7A 1XC6A 2XSBA 2DCTA 3ZDVA 5HYAA 3WP5A 5K0UA 1IAPA 2Y0OA 1NLRA 3HT2A 3H1YA 2Q1FA 5FMDA 1VBE3 1AL23 3SWHA 4JBWF 2ES3A 2RJ2A 1XNKA 4AQFC 1LEDA 2QKDA 4JQRA 2WBKA 2JQ9A 2LJLA 2GC0A 1YEWA 1XYNA 5HEUA 2CA5A 4FQ4A 2UWAA 2UUCT 2C0SA 4PK6A 3RJRA 1RUH1 1U5IA 2EALA 1UNBA 1CIYA 5HWXA 5AQVB 3FL7A 4COZA 2V73A 3IAPA 1N3PA 5B4XA 5J36A 2HH7A 2NMNA 4URTA 1AYN2 4X1YE 2AE9A 1CZSA 3WF1A 2VL8A 4K8RB 3THPA 5LBCA 4MGYE 4NAMA 2PMWB 4HN1A 5FREA 1H30A 4IDOA 1K5MB 4IETA 4NRMA 4GB32 1ASJ2 1LOFC 2OZJA 3RI5A 3RGLA 4UVBB 3AAAB 2V6YB 1OA3A 1AR81 3PUQA 2IWGB 1GQEA 5AQJB 1X9PA 3TN91 4H55A 1YW0A 4A5XA 2VL4A 2ZPXA 3RYKA 2ADEA 2ADDA 4HWHA 2K48A 5DAPA 4JI7T 3MO4A 1POQA 3V0AB 1FYUA 1DHKB 5H6QB 2EAKA 1DQ2A 2QDRA 4N7IA 4CI3B 2V4VA 2XUMA 5BV6A 1RJ8A 2NMOA 2VB6A 5CZKA 4I30A 1RYYA 2WT0A 2ARBA 1K5JA 4B4QA 5CVRA 2H6BA 2PFVA 1ND2B 2Z42A 4XCAA 4C1XA 4P9IA 2VOXA 4AXOA 4D3WA 4GMP1 1D4M3 3IPVB 5ACA3 4AFMA 4LBQA 4AKLA 1YWKA 4H9OC 3I49A 2CBIA 1NX9A 5FZOA 3OGSA 4V1Av 1I3HA 2XL9A 3JCIA 2HKXA 2FQPA 3H3ZA 3RIUA 4E2SA 2CV6A 2A9UA 1K5MC 2FMDA 5DAXA 3OUHA 2WC2A 5GZFA 3VRBA 4UV9B 3LAGA 1BZWA 4RN5A 4YM1A 3CKDA 5C7GA 5JDGA 5FMBA 2ODUA 3DPRA 3AXEA 1HR0T 1Q3EA 2AYHA 2VOWA 2A5ZA 3VD4A 4PIXA 1FPN2 1QU0A 2VASA 2CWSA 5A3WA 3BOPA 2FBWA 1AYM1 4FXGB 5DQ0A 5BNPC 3NJXA 3JBG1 3CVRA 1YIFA 5IK4A 1CZVA 3ZXLA 3O12A 3WAKA 5C71A 1YQ6A 2JDAA 2OZ6A 1C8M3 1C1LA 3WW4A 1V6IA 3BIWE 2F4PA 3HIFA 3FBLA 4W65A 3WDWA 3TLTA 3MI8A 2WAAA 2X67A 5L73A 4GWMA 4YZ5A 3P1IA 4EQVA 3ZN4A 4H7MA 2F4VT 4RGKA 5CKNA 2UXDT 2WQ4A 1CJDA 4EN6B 2WFF1 1O3SA 3UTKA 2LRKA 1KEXA 2VTXA 1KD7A 4CN6A 3W5NA 3B93A 2BBAA 4BIFA 1OVPA 3O1IA 4A7YA 4I01A 5FYYA 5F5WA 5JVDE 4PDWB 3KB5A 4DINB 3R4SA 5AC92 4AGVA 2K0GA 5FZIA 3TNQA 1Y3TA 4H14A 3RZKA 1JS9A 1MPXA 1UYPA 5IHYA 2WYFA 5JXJA 2ZGOA 2J1EA 5LWBA 5AVPA 5A80A 2C5DA 4JZRA 4UI9L 1YJKA 2LOPA 5L9RA 3DYPA 2D5HA 1ULOA 4YW5A 1OLQA 4FO9A 5FYZA 4IIJE 1C57A 3USSA 5FP4A 1VBB2 4OMDA 3CNAA 3GGLA 2YINA 2J7MA 3VHPA 2E7QA 1KNPA 5FY5A 1XU1A 4BLIA 3SOLA 2ZGTA 1XB9A 4IT4A 1CR7A 1G86A 1QKQA 3K8PC 1H8TB 2WM9A 4RGAA 5FYMA 4YM0A 4MYEA 4XBLA 5JAXA 1TMF1 2R7EB 1V6MA 4XFGA 5J3UA 3RWNA 2IMLA 1KXGA 2FBEA 2KWHA 1XNCA 4AF9A 4EEBA 3AMMA 4K7JA 4MHUA 3ZXJA 4XFHA 3U11A 4YJ2E 2JE9A 3SCFA 4X8PA 3VDDB 3F2EA 1P8JA 3BQKA 4AKRB 2B8MA 3QOPA 2I6HA 1PK6A 3WDXA 3WQ0A 3NWIA 3J8F1 3P8CD 3ZT5A 5GALA 1GSLA 1WBFA 2DURA 2Q8CA 3GMIA 1AXYA 2JIGA 4AQ2A 4LXLA 4HGAA 3FFZA 2YDEA 1TNRA 5LHGB 2XXZA 4I0UA 2W61A 4YNIA 1YJLA 2ZX2A 2E9XC 1F9KA 5JR2A 1ZOYA 1ENXA 1XOYA 4D69A 4S2GA 3POWA 1OD3A 4L11A 4DS0A 5FZ3A 3GXUA 3ALQA 4M1PA 3TEXA 2MEV2 4AEDB 3SH3A 2VQUA 3P3NA 2VZUA 5KX5E 4Q4V3 1D4M1 3FZMB 1E5RA 5ACA1 3KF5A 1D1BA 1HQLA 2Y33A 5ISLA 4EZ4A 4H63H 3TEZA 3EDUA 1X9TA 2WWUA 3VDDC 1VBD1 2LALA 3ZX7A 4QDQA 1AX1A 1D2QA 4EGWA 3CK6A 2WT1A 4L99A 1CESA 3NNLA 2WNVB 4ISQA 2V8SV 1OKOA 2EXJA 4QXKA 4CDXC 1UU6A 1UMIA 3IDCB 3Q5WA 1BMV1 1QMJA 2GNMA 3LIGA 4MGQA 1ZA7A 3VKOA 3PLQA 4QQPA 3WW2A 3KGZA 5F6LB 3DL3A 3ESLA 1WLTA 3AE3A 3ZXAC 1D0XA 3AECA 4WVMB 3NRXA 3OPCA 2WR9A 2NW7A 5CG9A 5JRCB 1UY4A 5IVFA 1BEV3 4NIIA 1ODNA 4JX0A 4GA9A 1YXWA 3PUHA 1Y4WA 5FYCA 4XQDA 4C0HA 4AEDC 2CPTA 2C6SA 1RMU2 1BQPA 4YSXA 1A8DA 2BV4A 1W0PA 1O5UA 2FCUA 2VNVA 4LF8T 1OOPA 4UFLA 2ZKNA 3Q8BA 2FDFA 1VBC2 2W63A 5LA6E 1U0AA 2VTFA 4XACA 3OY8A 5L7OB 1QXPA 3D3AA 3EABA 2ZMKA 1PMHX 1J58A 5G05L 2YXSA 2BNNA 2WNVC 1JBCA 3VBFA 3W20A 1HCIA 4KU8A 4WBBA 3C4WA 4UFMA 4K40A 4YW4A 3UU5A 1MNDA 2OYZA 3WW3A 1BLZA 5EZYE 2Y0IA 2UXNB 4BIOA 1EV11 1LVKA 1PO21 3FXEB 2YZ4A 4LTAA 3H7JA 4Q27A 3BU0A 2Y6GA 4AE2A 5J7MA 1QJU2 4CDUA 5IAXA 4QH1A 2A3XA 1WFDA 2DFCA 5J1XA 3H8RA 3E5XA 4MXWB 2WZEA 2XJSA 3ZXKA 2ZEZA 4YZ1A 1LOAA 4D94A 3ROUA 4AHXA 4I02A 2MOZA 4YW1A 4AEJA 4DR4T 1H2MA 1OFNA 4CDWB 3K3QC 3CJXA 5D21A 5F3JA 1RUD1 4Z07A 3FBYA 1F2NA 3BK9A 1UL9A 3JD73 1C5IA 3SC7X 2OQ6A 2WBLA 2WO1A 2EXHA 3E0ZA 2V09A 4RHV2 2IVIB 3WR0A 4XUPA 2VVSA 3UUNA 2WLPA 2BG9C 5BR8T 2D2SA 2BZDA 3WNPA 4QGMA 4HKAA 3SEEA 1Q8SA 2BERA 3B9CA 2CL2A 1PGW1 2PHTA 1CX1A 3LDKA 5DZEA 4ZXLA 4IGUA 1N47A 3I9WA 3RH3A 1JW6A 3K77A 3WVJA 3K3NA 2ZGPA 2B7YA 3T1YT 2HYKA 2K5BB 5L3GB 2V5CA 3BQLA 2A2FX 5LASA 4BQ3A 2NR4A 4DR3T 3SRZA 4UOJA 5FWEA 4AHYA 4LO5B 5EXOA 5F5AA 2I45A 1HB4A 2WAOA 1DLCA 4EOZB 3RMXA 5LG4A 3NV4A 1UPSA 3I2DA 4X5TA 1FATA 2D3RA 3H1MA 3KV4A 4YGBA 4XAEA 2GMPA 2Q8DA 2P4EA 3ZYKA 5AQNB 2G9ZA 2J1SA 4Q1RA 2XVLA 4NHMA 3FZHB 3NWKA 1YYNA 4QKFA 1VE0A 3IF8B 4CDWC 2J47A 4A56A 5FPLA 4AL9A 5FXWA 1EPWA 1AXZA 3G6JB 1NENA 1ONAA 2JG8A 1GQGA 4DIDB 1UF2C 5DQWA 4HKOA 5CFDB 1V9DA 3AZXA 4QU2A 4ZHQE 2GH8A 1UZYA 1RUE3 1HRI1 1W6PB 5FZDA 4SLIA 2HYXA 1F15A 4CCEA 4S2HA 3AYCA 3IN9A 2R071 3RI9A 2ZHLA 4WM7B 4HT1T 1X8MA 3RIUC 2X05A 5CADA 4AFCA 3TOJA 4GKYA 2I74A 5A7WA 4TNWA 4DR7T 4HFSA 4A7ZA 4HG6B 2KM2A 3DPRC 2Y38A 4IE4A 3MFCA 3B3QE 2Z4FA 1HG2A 1G8XA 2D93A 4RA0A 2WZR2 4Q4X2 3AMPA 3WOGA 1MR5A 1BEV1 4FPJA 1QY4A 1ULDA 3KCXA 1V70A 2AXDS 4BA6A 3VL8A 1HQNA 3ZSJA 1CAXB 3Q5EA 1HLCA 1GNHA 3O5SA 1QH6A 2QDNA 4GQ7A 3E6DA 3DJBA 4B7EA 1BKZA 2JDKA 4O9GA 5FZ8A 2VMEA 4NROA 1QQP1 4XAAA 3ZN6A 3LDRA 3Q8AA 4XZCA 3E22E 3TB0A 5ETWA 1ZRIA 5A1LA 1VJ2A 3HQXA 4MADA 1ULCA 3LQCA 2WMNA 3I3BA 3MEPA 1QJX2 4LBNA 1AR62 1S35A 1CAWB 2XAGB 3CJIB 2BYVE 3CMGA 4IEQA 2ZX4A 4ZS2A 2R043 3HR9A 1RUG2 1ZBA2 2ATFA 3VLBB 1MEC3 5EYYA 2WDRA 2RS32 2DV9A 4EIWA 4HFIA 4XHXA 1POV3 2F4LA 3OUJA 2HEWF 1F5JA 1ZZ8A 4CEWA 1YRZA 1VRH2 4L0RA 3MA9A 5AQTB 1HX8A 3VZKA 1DIWA 4XF3A 2ACZA 1H1MA 3SS1A 4AEKA 1RUNA 1LOCA 1B09A 5EYXA 4DY3A 3N9LA 1OF4A 4YT0A 5E89A 5I8TA 4IE7A 4K9SA 3I59B 2NWBA 4DR2T 3PIGA 4DXTA 1WR0A 2DU0A 4JI8T 3K51A 1LCLA 3AKQA 1W9RA 3HT1A 5K9YA 3N9NA 4I2OA 4FOQA 1OH4A 5HV4A 1W8UA 1EUTA 3O1RA 2XM1A 4X1KE 4NO4A 1IKPA 2X5IB 1TME1 1AYN3 2DVAA 4BAYB 2CU5A 3I0OA 1A78A 3L09A 1QJY2 4LF4T 2WSUA 2O8QA 2CM0A 5FY9A 1W3VA 3CJIC 4DBQA 2GP5A 2WZPP 2PAMA 4PIYA 2WQ8A 4AZZA 1I9RA 1E57A 4W6YA 3NAPB 3MFAA 4TNVA 3VRAA 3MPBA 2JRKA 5FP8A 1ULPA 4GMP0 4KQ7A 1VP6A 3BPZA 3N7LA 1OA2A 3HOBA 1NCQA 5HCBA 4B7KA 1GP4A 4GZ9A 2D6PA 3RZJA 5J98B 3LB9A 1LHOA 4UVCB 3ETPA 5C8CB 2QQVA 4P08A 3SFDA 1UYZA 2TNFA 1FMWA 3CL1A 3IBPA 1Z78A 5E6HA 3THCA 1J1JA 2MHFA 1V6JA 1DP0A 5JOWA 1LEMA 2BBJA 3NL1A 4XF0A 2OVUA 2X5IC 5FO7B 1W90A 4Y22B 5A6YA 1W6NA 4QQHA 2IFWA 2VMHA 3UUBA 4PCRA 4QXCA 3RPQA 4KWJA 4Y1YA 1DQ1A 3O1MA 2JDZA 2A73B 2A7AA 1RC6A 5E0OA 1HNWT 4EN7B 2PAKA 5H6RB 1U5XA 2G19A 2Z6EA 2VWAA 3NAPC 3HKEE 3HBKA 4PIZA 2W94A 1EAH1 4LBOA 1ACCA 4LKSA 3KLSA 4P0AA 1KQRA 2HWE2 2PAEA 5J2UE 4XF9A 3UJOA 3B5LB 3J7LA 3FXDB 4AAXA 3C7GA 3MKDA 1W8WA 2VCBA 2GC2A 1R092 2ZGKA 3MIGA 4L92A 1HB2A 1LU1A 4AQTA 3Q9DA 1JZ8A 3QD6A 3CKHA 5CA1E 1L7QA 4BYYA 4Q4W3 1ST8A 4H63V 4XJ8A 2AACA 1WW4A 1IGOA 3ZJ1A 4YLZA 4MGTA 4XF4A 1OH3A 4L5GA 3NKGA 2CCQA 1C4RA 3LG7A 2W2UA 4BDVB 3I97A 2HWD2 4NOTA 1SLIA 1AUYA 4MUVA 2ACXA 1SMVA 4Y1XA 1S0BA 5T54A 2W0XA 1WMEA 3F2ZA 4BQXA 4YVSA 5A3PA 4FPOB 2L9QA 4HE8A 1MEC1 1A34A 4XZPA 3NVOA 1C28A 1RUC1 2VZQA 3AYEA 1ZX5A 3T8OA 1POV1 2WFPA 2ZGSA 2WWSA 4EE2A 4A7KA 4UBGA 4YG3A 3PDQA 5L3EB 3C7OA 4Q0UA 4X65T 1MIYA 2ZGRA 1QEXA 1G9AA 5ANQA 4N43A 2R30A 1UZZA 2CDOA 1R1A3 2VY0A 1VPHA 4GD4A 1H9WA 3R0RA 2NW9A 4QH4A 3EHKA 5FO8B 3ZXDA 3POFA 3SQOA 2ZX0A 3ZMNA 4AAPA 1UURA 2B46X 3OCPA 2P3IA 2GN7A 4MFRA 1RHI3 4QB6A 1XU2A 2AENA 2VKHA 3VZMA 4LORA 2HBUA 5JXIA 3RIAA 2DLRA 1XNAA 2K2SA 3P4RA 3GZTB 2GNDA 3OBTA 5DAQA 3W9AA 2VMDA 2BQPA 3ONJA 1Z7S2 4QPGA 1YKHB 1MZ6A 3KCYA 3UUXB 2R32A 1ODMA 2YHJA 1RIRA 5I8YA 2X10A 4ZU7A 3QLQA 4OHWA 2A70A 3GJAA 3HKDE 2LS6A 1DGWA 3HD8B 1FXZA 1B35B 4FP2A 4XTMA 5H9PA 1GFF2 4WM8B 3IA3A 3E5UA 4KI0F 3D4KA 1CN1A 1BR4A 1C5HA 1UZ0A 2VKOA 4UW5A 5DXDA 2D40A 4Z2WA 2NTYA 5LRSA 4JKKA 5EP9A 4P5YA 4UW4A 4Q8LA 4UFJA 1YNAA 2YFZA 4DMVA 4HFCA 2MEV3 3HPNA 4QM9A 3ZFGC 4PFPA 3E97A 4GJZA 1ALYA 2EF6A 2A6VA 2VPVA 2EIBA 2I59A 5EZWA 4IV3B 4FFHA 4LHSA 2X9WA 1GR3A 3J9X1 1J5WA 4BJNA 4QWNA 1UX6A 3PDYA 5FQ0B 4C0BA 1JZ2A 2WQYA 3WNLA 4RR3B 2VBPA 2IAKA 5GLWA 4UIGA 1BK1A 3KVBA 2B76A 4IEPA 1OQEA 4QX7A 1IJ5A 1J1TA 4MSVA 4FPYA 4JRLA 3BTZA 2V1DB 3KMHA 3D82A 4OQ8A 3C8XA 3WINE 4CEYA 3OYWA 4AW7A 1RVF1 1VCTA 4LLOA 3MPPG 2JB4A 1R082 2CEAA 3ASIA 2B5HA 2X09A 4CP9B 4WM8C 4BB3A 5C3JA 2W95A 2V4AA 4BQ1A 4H9QC 4PFOA 1MMGA 3CDZB 2VXRA 2X66A 1O7FA 1FT9A 4NHXA 2LSKA 5HEHA 3G7DA 1KJRA 5CU1A 2WP9A 1WCDJ 4Q4W1 3NRUA 5FZCA 1YHFA 1ULEA 4IEXA 1TE1B 1UX5A 4CCMA 1F35A 4BU2A 1KK7A 2P17A 3WT3A 1QXRA 1RUH2 1VBC3 1IBKT 1AR93 3PURA 1FNZA 2W0GA 3U4SA 4GK5E 3I3QA 1AR71 2RJKA 1HN1A 1V6KA 4I4TE 4RR3C 2DYCA 5CG8A 2C9AA 1T6BX 2CDPA 4M3CB 2XJTA 5D1IA 4QPIB 2NPIA 5FP9A 1HX1B 2ENRA 3DXUA 5BNNB 3ENRA 2ZAAA 4N53A 2P2KA 3ZYHA 5FL0A 2D44A 4L0PA 1XYPA 1H4HA 5ABFA 4EN8B 3WUDA 2BOIA 4CP0A 3WG4A 5JR9B 3MLJA 2QZ2A 4IDNA 2Y6KA 1US7B 4P9LA 1QWRA 5JIUA 1A6CA 4K0KT 1GWKA 1RTVA 4XC9A 3ZJ2A 5L47A 3IMNA 3W5MA 2IW5B 5GLZA 1FX5A 5LG3A 5C33A 3JZVA 3F95A 4A44A 3RYIE 3WQ1A 4FFFA 2VBDA 2Q8OA 3SCHA 2R6GF 1VBA2 4TV8E 5KR7A 3WF3A 2B9VA 2PYTA 2JJ9A 2VMIA 2I07B 5JLVA 3VBOA 5AQPB 4MALA 4AIUA 1IS6A 1Z0PA 4UFHA 3AXDA 1ZZBA 4BCUA 4LPLA 2BWAA 4M3CE 2DVGA 5FLHA 2RM21 2QQWA 1W6OA 4UW6A 1GANA 2ZJCA 1UWWA 5IYZE 1UOJA 4ZU5A 2RDQA 2X68A 2X9HA 4QPIC 1GOHA 4QXHA 4IESA 3QH7A 3WEZA 3WG2A 3B94A 4OFGA 2XQ6A 4CI1B 3ZN5A 4DIQA 1EP0A 1L7LA 1SHWB 1LB2A 1DGLA 2R49A 5LA9A 4TZ4C 4XFBA 2EA7A 1MS1A 5E88A 4WW0A 2WINB 3K4ZA 4XILA 5KDMC 5LGNB 1FOD3 1PVC3 5DDJ1 1AYM2 1LHWA 3JBG2 2TUNA 3O1JA 3EXUA 1BVP1 5FZKA 4KMQA 4Y4RA 4QXBA 1OEDE 1QDCA 2XKOA 1ZZCA 1QSDA 5IVVA 1UY0A 3ANWA 2R061 4YJ3E 4GJYA 3X1DA 1OEDC 3OGGA 5FK7A 3ZMTB 2GAUA 3LEGA 5E1RA 3ZYIB 2HWF1 4EV6A 1GZCA 4V1PA 1ND3A 2C9KA 1NE4A 1UU4A 3N2GE 4HFDA 1YQCA 1HIXA 2WFF2 4Q1PA 4AG4A 3B5MA 1TZOA 2IUBA 3M3ZB 2G1MA 1KF6A 4COYA 4XJAA 1MACA 5FLJA 1EPZA 1CZTA 4DV7T 4AGGA 1DU2A 2OA5A 5FZ4A 2CHOA 1UN1A 4CCOA 1MVEA 5LHIB 2WZR3 2XAQB 4JTOA 4BK5A 1O3RA 4DPNA 3ON7A 1VBE2 1I6XA 2OUJA 2YMZA 4CP2A 2ERFA 2AC1A 4DV2T 2DCZA 3GWHA 3S0MA 4ILBA 2JMHA 1S2KA 3DGTA 1JNRA 1MS9A 4K1ZA 4NHKA 4NHYA 2D0TA 4NIHA 1D0YA 1AR91 3ONLC 2VW2A 4Y1ZA 3IAQA 3KZ4C 1CQ9A 3T08A 1AR63 4Y20B 5KXJA 3K4DA 4OX9T 5FDBA 1TMF2 1ZBA3 5FY1A 3HNBM 1G9FA 3VL9A 4JRAA 1UIJA 1ULGA 4YXDA 4XZUG 1W6MA 2QGSA 2XVGA 1IKQA 2VCAA 1VRH3 4BWOA 3APBA 4UF0B 3FZKB 2WMOA 4YVSC 4GALA 2RMU1 4OVEA 2JB8A 3ZYGA 3WUCA 2WRAA 5F5IA 2Q5TA 1JHNA 3RVHA 3CU7A 4FJOA 5AQUB 2VD7A 3W59A 2KT9A 1CWPA 3R6NA 3CHXA 1LAJA 5FTTC 2QQUA 1NZIA 5FJKA 5LA2A 2ZX3A 1DG6A 3ZIWA 2V5DA 1HXS1 3RQUA 5CISA 1VAKA 5FYVA 4DV3T 3KBTA 3KV9A 1JOBA 2BWCA 1QJY3 2UWBA 3V5UA 3QB5A 3IEEA 4XDOA 1IZ3A 1D4M2 1MS8A 5ACA2 5JQGE 4ZPIA 3MGUA 3EHZA 3VDBA 4PJJA 3BKZA 5C4WA 3INAA 3OGJA 4U33A 3S5AA 4LFAT 1QOTA 5K8SA 3VBHB 4QM8A 1DYOA 4DMIA 4S2FA 5F37A 2XBO1 1B7TA 2LW8A 1CPNA 4OI1A 4ZEYA 3ZCIA 3S7IA 3O7OA 1X33A 2AREA 3ZSTA 2VZOA 4HN0A 1BMV2 1T2XA 1OLME 1W8TA 1PVC1 1MS5A 1UCUA 1GWMA 2HWC1 4EV0A 2W08A 1QNYA 2J1RA 1SFNA 1VRBA 2OQ7A 1M62A 1PK6B 4A4AA 4MHCA 3FLPA 3V5SA 4A98A 4KG0A 3VZJA 1C8M2 4U3CA 4LULA 4EWEA 1JTZX 4DEVA 2D5UA 5FMOL 4M00A 2OV9A 2W00A 1QGLA 5BNOB 3ZXFA 2NW8A 3P4PA 4U7IA 1F31A 3MYXA 5F2WA 4QX0A 4KU7A 4BOWA 4R9BA 1XSRA 2CGOA 4HANA 4BMBA 5I0UA 2A3YA 3U3IA 4DNDA 4DUYT 3FZLB 3VZOA 1W9WA 5DAWA 1GZ9A 3LBXA 2RPAA 1OPMA 3VD3A 1UO9A 3E6CC 4QU1A 1COV3 3OB8A 1W28A 1SDWA 4AQFA 3RZLA 4IGQA 3ZVXA 2LSIA 2OLTA 4Z2AA 5IK7A 4QKBA 4CCCA 3KQ4B 3URFA 1G7YA 4WNKA 2IUWA 2WQZC 5BXXA 2ZA9A 1DGWX 4C91A 5FUPA 2XAHB 3BB6A 4F8AA 4UEMA 5GZEA 4D7YA 1XDPA 4Q29A 1G8WA 2K24A 3OEAA 3VB9A 1DGRN 3NZQA 4XXPA 4H9SE 3IKWA 4AKHA 3B13A 1POV0 1PM4A 5BNOC 3VKGA 1VOMA 2HH9A 2CXDA 3GF6A 1JZ4A 1URXA 2VR4A 1SLBA 3ORJA 3PE0A 4YM3A 2NM1A 2ZZJA 4U2ZA 1WD4A 4QX8B 2GALA 1RUD2 2VVDA 1PVXA 4RYDA 1OUSA 1WZXA 4AHWA 4OI2A 3PUXF 5AQLB 1RUOA 2SPCA 3AEBA 5J0ZA 4ORFA 2QQMA 2W91A 4E2GA 1FMD3 4RSUA 5KXDA 4FCAA 5JMOA 3CMLA 2R0HA 1PGW2 4Z8BA 4OHFA 3HAGA 2Y26A 2XQXA 4IHJE 2XAJB 3A0NA 1HN0A 2LHNA 1SE7A 1ZA4A 2BNMA 1R1ZA 3OY8B 1OA4A 3SH4A 4W8JA 2JQHA 4CVUA 3UU6A 3MXZA 4Z8XA 2YBSA 3RYPA 4RQPB 2JG9B 4Y4YA 1LOGA 1UOFA 5A3UA 2PQQA 1LNSA 1OQ1A 2PFWA 3B02A 1M06G 1WA4A 4KGGA 1NLQA 2WS3A 3WF2A 1NAFA 3BCWA 5FZ0A 1H1AA 4IL4A 4O4LE 4NIAA 3ZMVB 5C9AB 4H2AA 1XBFA 3DECA 5LA1A 2A3DA 2WS91 5KHGA 2AH2A 3KFWX 1K5MA 2PHDA 4B3RT 3P50A 4YFZA 2PA7A 4CCDA 5F7UA 2VH9A 5DAVA 5B2GB 4B3ST 2VQTA 2V6YA 1LOBA 1IBMT 3T2TA 5AVAA 2JD9A 4AK3A 4LIVA 2PN5A 2Q9QD 4COVA 1U12A 3A22A 1LTEA 4XFCA 1S0IA 2XKPA 4LBKA 3LJCA 3V0AA 2D97A 4K1YA 4G9SB 4HBNA 3T30A 1MQTB 3GA8A 3VHLA 1Y9MA 4BHPA 1BVVA 1ND2A 4COUA 4LFBT 1VR3A 2X9XA 3RC8A 2JG9C 3IPVA 2XR4A 1JYNA 1BEV2 1WRDA 3I2KA 2VZ3A 1Y7BA 1NA1C 5GLTA 2LSYA 2IHR1 3N3HA 2O14A 3BYWA 2X29A 3U14A 2V7IA 4LUMA 3KHCA 2CHNA 1QQP2 3E08A 1XMOT 1NOVA 4BQ4A 5FXXA 1GZWB 4DR1T 3AMNA 2PHUA 1ND3C 2DL1A 3M3OA 1YQ5A 4PJLA 1H4GA 1EUUA 3KQRA 1LU2A 2XQ9A 5IUQA 3VD5A 3C98B 2BJSA 5FP7A 3U78A 4GB31 1ASJ1 3N9OA 4CZZB 4YZ2A 3KBUA 4WZXA 2JG8B 3CX8B 1MVQA 2LSJA 1J3PA 4FVVA 1MQTC 4XXAA 2WDQA 3ILRA 5IVBA 4PF1A 2E53A 2EICA 4ARYA 2BGCA 5FVLA 1RL3A 3QBQA 4Q0QA 3C51A 1OUXA 1UIKA 2BFUL 3AMQA 3AP7A 3RJ2X 4XIOA 1WW7A 3PVEA 3VBUB 3N9PA 4AVTA 5LB6A 1RUH3 4A6SA 2H7OA 1VMHA 2P3KA 4D7SA 4DBRA 2W9XA 3OYXA 1US2A 1JU3A 5JCTA 2XQYA 1JUHA 2BVLA 5FZBA 3UETA 4I3GA 4GYSA 4XTPA 3VKNA 2VNRA 1IPKA 2BUKA 2ZGLA 3JD72 4H7LA 4FI9A 2QA7A 4AKGA 1W9SA 3RSJA 2W47A 4YZ3A 1WLDA 4U2YA 2EVXA 1FMD1 2VURA 2V5YA 4KP3C 2C5IT 1N1VA 2HPLA 4PAGA 1JNZA 2X0LB 4OHZA 3ZN6B 1AR83 5EIYB 1JU4A 3DF0A 3T3YA 5FO9B 4A3XA 3TN93 2E9XA 1X82A 5C8WA 5FZAA 2LEHA 5F32A 2NLRA 4A45A 3A21A 2B42B 3HNYM 1FPN1 3AVRA 3THTA 4O8SA 1DFQA 3KT7A 3BVCA 1CD3G 5LK7B 3KT1A 3UULA 1ULFA 3VBUC 3EJKA 3NJZA 4CUAA 2W67A 2YDSA 2B9UA 3WX5A 3BI3A 4ONUA 3IM0A 3PTYA 4IGPA 3HJRA 1OT5A 1PO11 3DKQA 4GMP3 4TX5A 3VDDA 4NMIA 2PHXA 1IQDC 1FAYA 3CBNA 3VGIA 2FJEA 3B69A 4L9BA 2VW0A 3O1HA 4ZI2D 2QTWB 1RUE2 2HWB1 1WR6A 3OBVE 2KSRA 1Q5OA 2D6KA 2E5VA 1N34T 2W1WA 2RDNA 2XHNA 3ZXEA 5FZ1A 5DUUA 5A1FA 3RMYA 5AC91 1WW5A 4QX3A 2MYSA 2YPJA 1CHUA 1EAH2 4YG6A 3M3QA 2NYYA 3AE2A 4LF5T 3JBG3 3PIJA 5FPUA 1RINA 1JXNA 4DFSA 3BUCA 2GSYA 5A7NA 4FI5A 3FWEA 4AEDA 4CXWA 1X50A 4WBNE 1YFUA 1TEIA 4YSYA 2DVDA 5ABJC 2QQNA 3PJYA 1BBT3 3ES1A 4UR9A 2PTMA 3AP9A 5JUVA 3AFGA 4DUXA 2CWYA 4HVQA 1NCQB 3OGRA 4XOGA 3MHZA 2IC9A 1SACA 4IEUA 4MV2A 5IFPA 1RUI3 5FFOC 3WNXA 2WFF3 3CQCB 2WNVA 1ZHCA 1WCRA 1CAVB 4OMCA 4LK6A 4SBVA 1SDDB 2VZSA 4KHPT 2Y34A 4PQQA 3ZR6A 3WSOA 3ZEFB 4OULA 4X6RB 5J1GA 3NMBA 4KNCA 2R042 3ACIA 5KHJA 3LWCA 3U1XA 2WB5A 1MEC2 2CYFA 4HFBA 4CPBD 2XB6C 4WVMA 4IREA 1O4TA 2G9FA 1OWAA 5JRCA 4E9KA 1S94A 2P9BA 2PLV3 5HEGA 5ADXL 3TWIA 5AQMB 3JXSA 2D9DA 4BZ4A 4QXCB 2FDGA 1HB3A 5A6XA 3O1PA 1W2AX 1NG0A 2UWCA 3M70A 4PT6A 1SHZC 1MIWA 5JDQA 4DXZA 3HKBE 2LOSA 5A6ZA 1MNEA 3ZFFB 4A3ZA 5K4LA 1J83A 4KMCA 2X8KA 4CCKA 2UXXB 4LO8A 2JDMA 2F17A 5CNAA 3ZPOA 4KWLA 2BG9A 5FZMA 1OSGA 5A7OA 3HQRA 1JODA 3ILNA 5JSPA 1TMF3 1XNQT 4PLOA 2B45X 3CX7B 4K8FA 3ZFEB 2VZTA 2Y64A 5D2AA 3MICA 3MW3A 5CB4E 4E4DX 1CPMA 1SA0E 3J8F3 4YM2A 1G6NA 4YGEA 2JIWA 1W8HA 1RGSA 2FD8A 3E5QA 4HWDA 4LO7A 5C2TA 4RS5B 1O5LA 4MXWA 2GH2A 4AI0A 1ZV4X 2DFBA 3TNPB 4HEAA 2W66A 4XAXB 3V56A 4CDQB 2XVKA 3AP4A 2M67A 3TBDA 1QHDA 4WZFA 1STMA 4OHYA 4EYYR 2WU5A 3I54A 5HCMA 4CDWA 2A1XA 3ZFFC 2ODVA 1D4VB 3AE6A 2XPJA 5ABEA 4QKDA 2P6HA 1W0BA 4DNYA 3ZSEA 3M3IA 4IDQA 3QB5K 5GLVA 1W9FA 4ZONA 3MIHA 3ZFEC 1Z8UA 2WNUB 2JDUA 1W2UA 5FMNA 5FPAA 1VBD3 3PJAJ 5JDLA 1KFXL 1NY71 4YW7A 2CWOA 3P5BA 2ZBJA 2W4XA 4XHBA 5FV3A 2QUOA 1FI2A 2VUAA 3AYDA 1FV3A 4WV8A 5FY0A 5F1RA 3AKTA 1RVF2 4TV9E 2D98A 4GWIA 4RS5C 4Y33A 2VM9A 1GLHA 2L8KA 2LM9A 2QQIA 1DF0A 3MIBA 4OYKA 2CSGA 4CDQC 2ZTNA 3QCWA 2BU9A 5FY4A 3AE4A 3VD7A 4EAHA 4HZFA 2YU2A 4IV1B 3H3LA 4W6XA 1YIPA 5T3NA 5GZCA 1OLRA 4LR4A 2L3LA 4Q4W2 1BBT1 4CCNA 3HQUA 1RUF3 3DEMA 3WW1A 1ND2C 3NBXX 5CFDA 4GKKT 5FKBA 1DLLA 2LKGA 1W6PA 2CNAA 5DJQC 1RUI1 3AE5A 3K1SA 4HSLA 4K21A 1AZDA 1REDA 4ATEA 5I93A 2CGPA 1OF3A 3ETUA 1JYXA 5BNQA 1M4WA 4UXAA 1ENQA 4RGGA 3AM2A 3VKFC 5JDBA 4RHV1 3WG1A 4ILUA 2VECA 2BDRA 1YQ2A 5F5QA 1AJKA 4R52A 5JR7B 4GWNA 1NWMX 1UMHA 4YTMA 4ZU4A 1SFYA 4FFGA 1FMVA 4AVAA 4ZZ5A 1EV13 5FNVE 3UFEA 1PO23 2PLV1 5FPBA 4HFVA 1HRV1 1WMXA 3BIEA 4Y24A 3VBRB 5I0TA 5LCYA 5LK5A 1HKDA 1AX0A 1W2NA 5FUIA 1CAXA 2XASB 4DV0T 2PHWA 4XJZA 2WN2A 3NKTA 2C26A 4K0UA 3HVDA 2VUJA 2WSVA 3WG3A 4FOYA 4IV1C 4HFHA 2VW1A 3POGA 3JB4C 1R1A2 4CEYB 3FHAA 2B4KA 2JDPA 4LA2A 4HLTA 3S6PA 2WU2A 5D8AB 2WDBA 3ONXA 5HAXA 3RYHE 1WUVA 1V6LA 5IYYA 2GDFA 5J2TE 1YI9A 2EHOD 3CIHA 1JYVA 1RUD3 5I0SA 2ZM6T 3CJIA 5KXCA 4LF6T 1RHI2 4DRVA 4JGYB 4JI1T 1EY2A 3ITQA 2CGNA 4NUBA 5LBQB 5C6CA 5HEOA 1HB1A 2HLEA 1Y9QA 1W6QB 1HJGA 1YC61 4PDWC 4MGIE 1ZYBA 3SITA 5APAA 4X62T 2ZS6B 3FBZA 1D1AA 4LHNA 4Z90A 4P02B 3Q9OA 4H9NC 4TWFA 4UWDA 4FT8A 3GN5A 4BM8A 4IEYA 2XWJB 2X0HA 3T0BA 2VKDA 4E8DA 5CIRA 3ZYBA 1TNFA 4NJ4A 3VBRC 3I59A 4XIKA 1U5ZA 5IATA 5JVVA 3OOXA 4CU8A 3NW4A 1LRHA 3FB2A 5BUVA 2VJXA 5A3LA 3M1HA 5DDJ2 3H9AA 5D8AC 4Q4X1 2X5IA 1YUDA 5HCHA 1O3TA 1WYCA 4E7ZA 1GMMA 1WD3A 1H1IA 4IE6A 1H8TC 4AXPA 3WDTA 2CRBA 5A32B 1W99A 1YLLA 2Q9QB 3PNAA 4KWKA 1V6NA 4FAHA 5A6QA 1RXFA 4DUZT 1O59A 4LF7T 1OXCA 2HWF2 3NAPA 4HETA 4YPJA 1S2EA 1QOOA 1HRI3 4U31A 2UY9A 4FPGA 4HKLA 1XE8A 3VDAA 2WKKA 4U36A 2CBJA 3VBOB 2R073 4P0BA 2H0VA 1HF8A 2WWJA 5LJMA 3AB3B 4WVVA 4MZUA 1ZVFA 3Q8EA 3WQBA 3FFQA 4OZOA 1REEA 5C8CA 1T72A 2RS31 4N78D 4NPRA 2FMYA 4Q0VA 2OX0A 2GN3A 1TQ5A 2QCSB 3D8CA 4KWUA 3OPTA 4A42A 4LQRA 3T1HT 1VLNA 2XQ7A 2BKNA 4QXHB 5A3OA 1E1HB 2RA1A 2BP6A 4GAZA 3H1WA 1NQDA 1V00A 4PK4A 1Y64B 1GP5A 4QGLA 1PIV3 1HNZT 1RUF1 4Y22A 4FPCA 4JTNA 4AEMA 4NIDA 3N7MA 3FX3A 4AISA 2VXJA 3POIA 5I0DA 1QQP3 1SCRA 4N8MA 2Q9QC 3AEGA 5T5OA 5C3SA 5DMYA 4BMEA 4Q8KA 3NNFA 1DQ0A 4YSZA 3FLRA 2VNGA 1OKQA 2ZEWA 1AR92 1JYIA 3NV1A 1W8FA 3AXJB 2WY2A 1UY2A 4XMAA 5IVJA 4YFWA 3Q2MA 3IT8A 5JI9A 5IW0A 5LA0A 4X6QB 2DUOA 3OJBA 3VHNA 1PZ7A 1US3A 4NUVA 4QMAA 2K9AA 4PBOA 3AJYA 2M6IA 2FUPA 1S0EA 1LHUA 1RB8G 4QX1A 4DR6T 3RZMA 5DZFA 4CRQA 3SEPA 5KHHA 1DBNA 4U74A 3EO6A 2ID4A 5J48A 3LOIA 2ARAA 3SCGA 3LA2A 2BVBA 3AP5A 1HFAA 3A5XA 4ANJA 2QQOA 3ZKYA 3POSA 1UQXA 3LKJA 3UU3A 3L8RA 4QD2A 5M4YA 5FL1A 5A33B 1IQAA 2JJ6A 4Q2FA 4F6RC 1I5PA 1LECA 3IDAA 1HXS2 3O1OA 5DUXA 3JC6D 3RPUA 4JI5T 1F5FA 2XLFA 1TME3 3GZUC 5BY5A 5CKQA 1JZ3A 1LESA 4J2CA 2ZEYA 4P1NA 5L7OC 3K4AA 3RIFA 2OKXA 1UAIA 3L39A 1XRUA 1MMAA 1SBFA 1VB2A 4R9DA 1YI7A 5CFCB 2FDHA 3PUYF 4LMJA 2MPKA 3VZNA 2A72A 4HSJA 1S55A 2W68A 1S0CA 3H0OA 2F6BA 3V0BB 2XBO2 2WLQA 5JZGB 1DZRA 1C3HA 4HONA 2FDJA 4B1LA 2SBAA 1LHNA 3CLPA 4IL9A 2Y48B 1W0AA 2FCTA 3RQWA 3GZAA 4JV4A 2HWE1 2TEPA 3LDQB 1WGPA 1ZREA 3ZFGA 5FK8A 2WO3A 2M6BA 4LEJA 2XH6A 2VZRA 1UUSA 4H3WA 3H8UA 1FOD2 1PVC2 1R091 4MGSA 3WD5A 1PGL1 2WJSA 2DUPA 4CCJA 1WLWA 5I91A 5EK3A 1OMIA 4ZHNA 4PI0A 4NAOA 1W8OA 4TLFA 4B8EA 4D6QA 3WHTA 2QRXA 4M0HA 1ZBE1 4OZXA 3EVYA 2J1DG 4OFZA 4J6GA 1YFXA 2H89A 4BQ5A 3AAIA 1DU3D 3KM5A 4B4PA 3WY6A 4DMWA 4EN9B 2XWBB 2Q8EA 2E6VA 1DGRA 5FYIA 1WBLA 2XQ4A 1YO8A 4MGZE 4NPMA 2P5BA 1EZ3A 4PJYA 4R9CA 1GNYA 5LATA 4WM8A 1O3QA 2LE8A 4E2QA 4CQIA 2WZ8A 3DXTA 3P4WA 4XDPA 3FJSA 3O1VA 5JZGC 5LHHB 1EAH3 3F31A 4AFAA 2QQJA 3N9MA 2BBHA 3LGRA 1SG3A 1DDLA 4I0AA 4AI8A 3CEWA 2D6NA 1KGYA 3A4UA 5LOVE 3TAYA 4CTEA 4DQAA 3JQXA 4CI2B 1WMDA 2O0OA 1F8VA 3LOBA 1W0OA 4IL7A 4DV4T 3MF9A 4HVOA 4ZKTB 3OYZA 3NO8A 5EK2A 2W52A 5LGUB 2UYAA 3EI0A 5FZLA 4TZDA 4LBQD 4YVWB 3WP6A 5JPNB 1PIV1 1I6ZA 2V7MA 3I2OA 3O0XA 2QBXA 1SEFA 4JGZB 5AQQB 4ZI2C 1IPSA 3K48A 2AUYA 5FQ0A 2RDSA 5J37A 3AEEA 4RR3A 5L3CB 2RVAA 3B9IA 3OPZA 1Z0HA 3RDIA 3ZSSA 2J22A 3D0JA 5TAOA 4W6WA 5CFDC 2WZIA 1O6UA 5FZHA 4FFIA 2LT3A 4XF1A 4E4ZA 3BN6A 4I3PA 1EYBA 2VMGA 4AFBA 4CP9A 2OUHA 2W87A 2QVAA 1HW5A 2WAUA 4WM7C 2PG8A 3G06A 3QACA 2ET7A 1RUC3 3U37A 5AQGB 2V72A 3VR9A 4D6SA 2JKBA 3FC0A 4ZOLE 1RUJ1 3CWZB 3USUA 3MJXA 1AX2A 4ZXKA 1V9U3 4M01A 2ZM8A 4ES8A 2OXBA 4PK5A 3T1LA 1GOFA 1IBLT 4OUMA 4JUYA 4YVWC 4UV8B 1RJ7A 3JAEA 1T8BA 4MLKA 1UU5A 3OPWA 3LK2B 2XAFB 5HCJA 1Q43A 3RZHA 4X64T 3ES4A 4JDNA 3S57A 3NV2A 4JGZC 2QNKA 5JOYA 4QKNA 5FXZA 3N2OA 3ZN0B 1MZ5A 4PBPA 4QPIA 3OTOT 2QE3A 5HBAA 4QDSA 3AL6A 3ZPYA 1UY3A 3I2HA 5FZ6A 2H88A 5GZDA 2GK9A 1I5ZA 4QDRA 4PHZA 1XWMA 2FJBA 3PV0F 5BPXA 3CZJA 3I3DA 1S2BA 5KXEA 2VC9A 5L9VA 1IHMA 4LA3A 4DUVA 1X7NA 3P4QA 3HMYA 4KG8A 4FXKB 4E8CA 4KBMB 4AR2A 3NZPA 3T0DA 3KSCA 2XHKA 3I0QA 4LT5A 5FOBB 3WNOA 4H9RC 1PX3A 3AA6B 1QXJA 4Z1VA 3IDEA 1MS0A 2R16A 3W21A 1Q8QA 5FZ9A 5LGTB 1GKBA 3UKVA 1OEDA 4TYSA 2E33A 3S4UA 3L2HA 4COWA 2G4IA 2RS11 3ACFA 5LY1A 2XUEA 3PUVF 1OC1A 5IVYA 1T7SA 2RS51 4ZZ8A 2OW4A 2X0YA 2XQ8A 1SFPA 5KWRA 5FRAA 4L2NA 2C4XA 4E27A 3PUSA 2ET1A 3VBSB 3CIRA 1DQ6A 3MV11 1Y9GA 1I1EA 2KR2A 1WCSA 2ZACA 1NYWA 3IHRA 5A3TA 3KGLA 3MLLA 1SPPB 4JKLA 4YY3T 1RVF3 2NP9A 3I2JA 4Y1VA 2YC2A 2NTXA 2HN2A 3TLWA 1ZZ6A 2N1GA 3MBWA 4CE8A 1COV2 2D5FA 3RNSA 3T09A 2BRTA 4L97A 5IFTA 4LO4B 2YGMA 1LOEA 4FOVA 4ZI3D 1ZRFA 5C8CC 3JAFA 1UZVA 2UURA 3S7EA 3WNMA 4DB5A 5AFEA 3J26N 3I3MA 5BNPB 2EIDA 1UCXA 4MX3A 1N32T 3H3AA 4JHTA 3VDCA 1DZTA 4X8NA 3WHUA 1VBA1 1GUIA 4M3CF 2CY6A 3P6BA 5T5LA 4GH4B 2QJVA 4P9WA 2MPFA 2K9ZA 1JYWA 5SV5A 3K75B
chains in the Genus database with same CATH topology
3FBZA 4FJOA 1D1AA 3ZMZB 3ZLIA 4EXTA 5FZCA 1IZNB 2NOXA 4KUMB 3UTKA 2VD7A 2KT9A 2LSGA 3K3QC 2PXJA 3R6NA 4P09A 5F3JA 2P5BA 5FYUA 1EZ3A 5BMVE 3BK9A 1OWAA 4UVAB 4H9NC 5JRCA 5FYTA 1QUUA 1S94A 3O1IA 1UX5A 5FJHA 3PTRB 2P9BA 3GN5A 4I50E 3LFMA 2OQ6A 5FJKA 2WBLA 4CUGA 2BZBA 2LE8A 1LKXA 5FYYA 5CEHA 2CE7A 5ADXL 4CCMA 3E0ZA 3GA8A 5JVDE 3VHLA 3ZYMA 2PBIA 2ZM2A 2PJQA 4HTEA 4QXCB 3KV5A 3UUNA 4CQIA 2VKDA 3DXTA 4XDPA 5A7WB 4NUUA 1KK7A 4BU2A 2D2SA 3EDVA 5LHHB 3F31A 2XMLA 5FZIA 5FYVA 4HKAA 3RYCE 1SHZC 2X9XA 3RC8A 3B57A 5HXSA 3N9MA 4ADZA 3KBTA 3UT5E 3PURA 4QXCA 1WRDA 4UELA 4L9IA 1MIWA 4DO0A 4CSWA 5JDQA 3KV9A 5IHYA 2W0GA 4ISTA 3U4SA 3P7IA 5LOVE 3LBXB 2LSYA 2YEVC 4GK5E 4IGUA 3HKBE 4I4TE 3V5UA 3FB2A 5E0OA 5A7SA 2LOSA 5LWBA 3I9WA 3RH3A 1MNEA 5A80A 4CI2B 3IEEA 5LNKA 2XDVA 5H6RB 3F57A 1D1CA 3K3NA 5K4LA 4XDOA 2Z6EA 4D6RA 3M65A 2VKJA 2VWAA 4KMCA 2V7IA 2LOPA 3CQGB 4E7SA 4CCKA 2UXXB 5JR9C 4PW8A 5JQGE 3OYZA 5F8PA 3HKEE 4AI6A 2K5BB 5L3GB 3BQLA 5EK2A 5LGUB 2A2FX 4PJJA 3ZPOA 1WYCA 5FYZA 4IIJE 2LHRA 3E08A 5FP9A 4E7ZA 3DXUA 4O2AE 5FZMA 5FZLA 5IWFA 3SRZA 5FWEA 5A7OA 3AVSA 3HKCE 4P0AA 2EHOB 4QHOA 4IE6A 5J2UE 5FP4A 4YFSA 5F5AA 5A7QA 4AXPA 2V7MA 5FXXA 3FXDB 2B1EA 2X9YA 5IVEA 5F37A 2C5JA 4EOZB 2YINA 3UUMA 1B7TA 3CX7B 4EB6E 3JC6C 3AA1B 3MKDA 2Q9QB 4C90A 5LG4A 4QXBB 5JR9B 5HXCA 2V7KA 4ZI2C 5FY5A 1WYBA 3ZCIA 2DCFA 3SOLA 5HWYA 1KNZA 4PJLA 1US7B 5L3CB 4IDZA 2YU1A 3I1AA 3Q9DA 5CB4E 3KV4A 2BVMA 3ANWB 4XBFB 2H7VC 5CA1E 5JR9A 5LYJE 3ZJ2A 1SA0E 2W2IA 4ASKA 3K8PC 4IGOA 3CQXC 5FPVA 2WM9A 4LITA 4H63V 5FYMA 2IW5B 2Q8DA 1WLXA 5TAOA 3ZYKA 3C98B 5FP7A 3U78A 5FWJA 5F2SA 5FZHA 3N9OA 3ZJ1A 3RYIE 4CZZB 3L3PA 3KVAA 4CXXA 3KBUA 4X1IE 2LT3A 3VKHA 2KLQA 3IF8B 3CX6B 3O4XE 4PJNA 2V7JA 4JLEA 5A3NA 2JMKA 1UCUA 3CX8B 3LK42 4L5GA 4P0BA 2CLYB 4A56A 2LSJA 5FPLA 5L3DB 4H9PC 3Q5XA 5FXWA 5L3BB 2CCQA 1HF8A 2KWHA 2WWJA 4TV8E 1VRBA 5AFUL 5LJMA 2OQ7A 4BISA 5KR7A 3OJAA 3AB3B 4HN9A 4ZS3A 4YJ2E 4UF0A 2WAUA 3LG7A 2JJ9A 4MHCA 4EYUA 3V5SA 3MZKB 3F2EA 3KV6A 5IVBA 2PG8A 3BQKA 5DQWA 4URAA 1ZV4X 4HEAA 4AKRB 1V9DA 3C51A 4MALA 2OS2A 3C50A 4ZHQE 4XAXB 5DABA 4N78D 2D5UA 5FZDA 1Z0PA 4OK0A 5JREA 3P8CD 2OX0A 4D6SA 2W00A 4ZOLE 3HI2A 2M67A 5LJNA 1HTJF 5HYAA 5ISLA 3DP7A 3CWZB 5JDNA 2ACXA 3MJXA 3I9YA 3N9PA 1UX4A 1IAPA 2C5KT 4UXNB 4EYYR 4BXFA 3OPTA 2Q8CA 3GMIA 5IVCA 2NW8A 1CUNA 5A3PA 2ODVA 4BA9A 4LXLA 3C4ZA 2H7OA 4HGAA 3SWHA 4DBRA 5F2WA 2ZM8A 3OYXA 4QXHB 5FBJA 1BR0A 4ZI3C 4PK5A 5LHGB 2L9QA 1E1HB 2RA1A 4OYJA 4HE8A 5LXTE 2XXZA 3NRYA 2XQYA 4GAZA 5IYZE 4AQFC 2BVLA 4PK4A 1Y64B 2KXPB 2X68A 2Y8DA 5FZBA 2X9HA 5A7WA 2W61A 4GYSA 1X79A 3HA4A 4GYRA 4JUYA 4QXHA 1U5PA 3T8OA 5KMGP 2EHOC 4UV8B 1ZKEA 2LJLA 4YHJA 3KDSE 1YD8G 5FP3A 3U3IA 2E9XC 5FZEA 5FZOB 4MLKA 4IE4A 4DNDA 3LK2B 3OPWA 3WI3A 3LD8A 2ZMAA 3PDQA 1IJ6A 2XAFB 4CI1B 5FY8A 2DI4A 2CA5A 2QA7A 5L3EB 1HG2A 4DIQA 4AKGA 1G8XA 3C64A 2C0SA 2Q9QC 4PK6A 3RX6A 4C8DA 1MIYA 3LBXA 3ZN1B 3LK3B 4TZ4C 5FMNA 4QU1A 2RP4A 5FPAA 5HWXA 4KP3C 5FZ3A 5ANQA 5JDLA 2C5IT 5JDHA 4M1PA 1MIVA 4YLHA 4QKNA 3N2KE 3N2OA 5FXZA 3R84B 4WW0A 2CWOA 4AQFA 4GD4A 4IGQA 2E9XB 2HPLA 4O4IE 4PAGA 3ZN0B 5KDMC 2X0LB 5LGNB 5F3CA 2LSIA 4QWNB 3DJBA 4HOOA 5KX5E 5IVJA 3PU8A 2HH7A 2KNDA 2NW9A 4ISSA 3ZCJA 5FZ8A 4WNKA 2EHOA 5FV3A 2IC6A 1D1BA 3Q2MA 4X1YE 5FXVA 3AL6A 3ZYLA 2E9XA 5FZ6A 2VK9A 2VL8A 3O1JA 2DHRA 2XHEB 4C91A 5CA0E 3MACA 5HXHA 2CLYC 4EZ4A 2GK9A 5F3IA 5FY0A 1HG5A 2XAHB 5FUPA 4QX7B 5FZKA 5FZAA 4X20E 4AAPA 4UEMA 4H63H 2LEHA 2X51A 3EDUA 2Q9QA 4G63A 1H7CA 5F32A 4XZCA 4Y4RA 4QXBA 4G2AA 3ZMSB 3E22E 2WWUA 5IW0A 2CXLA 5ETWA 4TV9E 4MFRA 5A1LA 3AVRA 4Y33A 4PJMA 4NUVA 3BQIA 2CXFA 2K9AA 2V7LA 1QSDA 2L8KA 5IVVA 2YK0A 2KMFA 4O2BE 2LM9A 2VKHA 3ANWA 4E4HA 2K24A 4OYKA 2WMNA 3LDBA 4YJ3E 4UVBB 4O8SA 3AAAB 5FY7A 3WAJA 4GJYA 2W62A 3NZQA 3PUGA 1S35A 5JH7E 2DLRA 4H9SE 4AKHA 3B13A 3PUQA 3ZMTB 2XAGB 3QK6A 3UULA 4DVDA 3O9XA 4KBMB 5FY4A 4WBOA 4ZS2A 3NZPA 4V2WA 4EAHA 5FZ7A 3VKGA 2YBPA 1YW0A 2YU2A 3RYFE 1VOMA 4U74A 1YKHB 4BJMA 3RRWA 3I0QA 3Q5WA 2CXDA 3UUXB 3N2GE 4H9RC 3AA7B 2L3LA 4I43B 4CCNA 4V2VA 4EIWA 3PE0A 2K48A 3AA6B 4IGPA 2ES0A 5FYSA 1HFAA 3A5XA 4QX8B 4ANJA 5F39A 5FUNA 5L3FB 1MMNA 4TX5A 3EUHA 3RRCA 4L0RA 5FZGA 3HKDE 3NBXX 3ESLA 4GK0E 3MA9A 5HXEA 5FZ9A 5H6QB 1HX8A 1D0XA 5M4YA 1BR1A 1D0ZA 5LGTB 2SPCA 3NRXA 4CI3B 2NW7A 5DJQC 4F6RC 1MMDA 3SS1A 3W15B 3S4UA 1BR2A 2Y6XA 5JRCB 1U4QA 2VB6A 5IVFA 2D0UA 2CMRA 4O4JE 3JC6D 3RPUA 2N2NA 3ETVA 2OA5A 3O1HA 5LY1A 2XUEA 3VU7H 5JDFA 3CMLA 3ZC1A 4ZI2D 5FZ4A 3N9LA 3ETUA 1OXZA 1BR4A 2PFVA 5FYCA