3KV9A

Structure of kiaa1718 jumonji domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
total genus 116
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv9A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv9A01
5FY8A 5FZ7A 5A7QA 2GP5A 5IVVA 2XUEA 2YBPA 5F5AA 5FZ9A 3ZPOA 4CCNA 5A7NA 3NJYA 4QXBA 5IVFA 4CCKA 5FZOB 5LY1A 5FYSA 4V2WA 5FYVA 5FZ3A 4EZHA 5F3EA 3U4SA 3UYJA 4QWNA 4CCMA 3N9MA 3N9PA 5F5IA 2Q8EA 4Y4RA 2YBKA 2YU2A 4UF0A 4C8DA 5FZAA 4EYUA 3K3OA 3KV9A 3PUAA 3DXTA 2YU1A 5FY4A 5FPBA 2XMLA 5FYMA 5FZ8A 4ASKA 4Y3OA 5LWBA 5FP8A 5FY9A 5FYHA 5A7PA 5IVJA 2OX0A 3PUSA 4QXCA 2WWUA 5A1FA 5FYYA 5FZCA 5IVCA 5FZBA 5LY2A 5FZ1A 4D6QA 2GP3A 5A1LA 5IVEA 4BISA 2XXZA 3LDBA 5FZDA 5CEHA 2P5BA 4TN7A 3N9NA 5FXVA 3N9OA 5E6HA 4CCOA 5FV3A 5FZIA 5FP3A 3KV6A 5F3GA 3K2OA 3AL6A 5KR7A 5F39A 5FZGA 5FXWA 5FYBA 4D6RA 5FP9A 5FZKA 3KVAA 5F3CA 5FYIA 5FZ4A 4LITA 3ZLIA 5FXZA 4AAPA 4E4HA 4AI9A 3N9LA 4GJZA 3PURA 2YPDA 5F2WA 5FYUA 3OPTA 3RVHA 2Q8DA 2W2IA 5FZLA 4CCLA 1VRBA 5FZOA 5FZHA 5F37A 3LD8A 4BXFA 2OQ7A 5FY7A 5F3IA 4V2VA 4NUBA 4HONA 4CUGA 3PUQA 4GJYA 5F2SA 4EZ4A 4URAA 5FUPA 4LXLA 5FZFA 4DO0A 3KVBA 5ISLA 3AVSA 5FJKA 3DXUA 5A7WA 2Q8CA 3PTRB 5FPVA 5LW9A 5A3PA 5FY1A 2XDVA 5ANQA 5A3WA 3U78A 4UF0B 5FZ6A 5A3NA 4Y33A 5IVYA 3PU8A 5FP4A 3PDQA 5F5CA 3PU3A 4QX7A 5A3TA 5K4LA 4GAZA 5FPAA 5FPLA 4QXHA 5FZ0A 4XDOA 5FYCA 5FWJA 2WWJA 4QX8A 2YBSA 5FPUA 5IW0A 4LIUA 4XDPA 5FP7A 3AVRA 3KV4A 4D6SA 4DIQA 3K3NA 2OQ6A 4IGPA 5FJHA 5FY0A 5FZMA 5FXXA 5A7OA 3OPWA 5FWEA 5FY5A 5A80A 4BU2A 5FYZA 5FUNA 2VD7A 5F32A 5FBJA 4HOOA 5FYTA 4CSWA 3AL5A 4LIVA 5IWFA 4IGQA 3KV5A 4CCJA 5IVBA 5A7WB 2OS2A 4QU1A 5FZEA 4GD4A 3N9QA 5A7SA 2OT7A 2PXJA 4IGOA
chains in the Genus database with same CATH superfamily
1KFYA 3VDDA 2PLV3 1BBT1 3SEPA 4WBBA 1MMDA 4HKAA 3ETQA 2X8KA 2E7AA 3JQXA 3WAJA 5C2TA 2BU9A 2RJ2A 4SBVA 1ZRCA 4CCNA 1QNYA 2HWC1 1O6UA 2D2SA 5C4WA 4CCCA 1JZ7A 4LBMA 2FMDA 2JDUA 1YNAA 4COUA 3OPZA 4YTNA 4EZHA 4HKOA 1VBB2 4YNIA 5FYVA 4J1XA 3UKVA 5CFDB 1RUC3 3I49A 4GA9A 3GMIA 1LOFA 2QE3A 4XJ9A 2VC9A 5F3CA 4OHYA 4UOJA 2MHFA 4KI0F 4DFSA 5L4HA 2R49A 4IGUA 1IQAA 3DXTA 3I2IA 3RGBA 2JJ9A 2ARBA 3HR0A 5JDMA 4CDUA 5J09A 1QJY1 4PF1A 1S2KA 4EB6E 2JG9B 4MSVA 1UX4A 5HEJA 4J1WA 4XF3A 3VR8A 4BH9A 2VBPA 3UUBA 2GDFA 2AXDS 4XIOA 4DUWA 1JMUB 4PI0A 5KC5A 1JYIA 4NIDA 2JQKA 1U5YA 5JVVA 4M3CF 3HOBA 3SMHA 5LZ6A 4D7SA 1N47A 5M4YA 2IVJA 2NLRA 2CYFA 2RVAA 2VURA 2RS13 2V72A 3LDBA 3ZFFC 5B4NA 3I3MA 4H9SE 1YQ4A 3S5QA 4HN9A 1HCIA 3BODA 2XJQA 4PBPA 3V0AB 1APNA 3O1PA 5JTGA 3BK9A 4X20E 4LA2A 3VDDB 2CXLA 1F2NA 1UYPA 3C7OA 3O1RA 3BVCA 3KZ4C 4N53B 2VVFA 2EHOC 3EUHA 4M0NA 2JWPA 4CYDA 1EPWA 5CKNA 4TUYE 3CBNA 4KI5M 1BMV1 4I02A 1U5XA 4YW5A 2WBLA 4TZ4C 1XPWA 2RR12 2VZOA 1XNRT 2A9UA 2E53A 2MEV3 4LKSA 1YI9A 2WNUB 1CESA 2ARXA 1H1AA 3VKFC 4MHCA 5CADA 3O1MA 4A7YA 2CHHA 4N90A 4Y4YA 2RHPA 1LEDA 3MI8A 1W9TA 4BXFA 2EIDA 4WBOA 2HN1A 5FY7A 1HRV1 1DU3D 3CWZB 1AYN3 4P9LA 1EP0A 2ZHNA 4URAA 2JDZA 3O0VA 5FMBA 3T2TA 3FZLB 3WG4A 5DZGA 5LBCA 4BOWA 1AR82 2ZX3A 4QX3A 3F2EA 3BIWE 2EXIA 1Z0PA 3LBXB 3WAKA 1PO13 2J62A 3H1WA 4DIDB 2Y8DA 2IC6A 3FZHB 2YGMA 4HZFA 4MOAA 4NVPA 4UFMA 3UGHA 4CXYA 4NE9A 3U78A 3ZSMA 5ABGA 2EHOA 3UT5E 4EN9B 4MLKA 1X82A 4JI2T 3PU3A 1G7YA 4ZOLE 1VBB1 3AE3A 3KD4A 1JU3A 1W9YA 3MIEA 3KLSA 5K4LA 5C4WC 3MZHA 1RB8G 1JUHA 2FJEA 1D1CA 4TWDA 4E7SA 5LBFA 1XYNA 1PK6A 2VZPA 2XAFB 1XZYA 5FYCA 4QXBB 4WVMA 3FBZA 1HF8A 3ZYKA 3ONLC 4E8DA 2CWMA 1OD5A 2R30A 1XNAA 3AYAA 2Z6EA 4DUYT 1CIWA 2P37A 3I97A 1O8PA 3WDYA 1DGLA 3FX3A 4KQ7A 2R073 3R84B 2OZ6A 1F4AA 1V0AA 1PVC2 4JHZA 4GWNA 4B3NA 2DUOA 4IGPA 3VL8A 1SMVA 4IE6A 3BQIA 5HV0A 5LG4A 3TEXA 1EAH3 2VXRA 2YDRA 3D0TA 4NXMT 1RHI2 4XFFA 4X6RB 1U5PA 2HHHT 1MNEA 3R4SA 4IW3A 4XQDA 2ORZA 4N7UA 1EV12 3WCSA 3B00A 4BB3A 1HB1A 1HJGA 3O1UA 2BW8A 2LM2A 5K0UC 2KZ7B 3IPVA 1KQRA 3RPQA 1ULCA 1ZRDA 1OLRA 2ZX2A 3ZFGB 3E08A 4PK4A 1DLCA 1MEC2 2VQTA 2GP5A 4JGYA 1RINA 5AFUL 4LLFA 1GKBA 2Q1MA 2ES0A 5F8PA 4ERRA 4UXNB 2PTMA 2W52A 2Y34A 3OG2A 3ZMTB 1C57A 4QPIB 5L73A 1OMIA 1QJY3 5GONE 5JOXA 5LY1A 1V6MA 3N2GE 3SITA 4YG6A 1MZ6A 2PHFA 5T52A 4RQPB 1OQEA 1XJAA 1ZP0A 4JCKA 2N2NA 5F6KA 5T5LA 1W9WA 1HXS2 3EXUA 1J1LA 4N43C 4OQ9A 2XZEA 2YU2A 1UW8A 3MIBA 3RG0A 1XDPA 3OUJA 4Z8BA 1XNBA 3HR9A 3O14A 2IAKA 3PUAA 3NAPA 4KBBA 2X09A 3ORJA 5EIYB 1JZ8A 3RYCE 2L8KA 1WRDA 3G06A 4DR1T 3ACIA 3WP3A 5IK5A 1H9WA 5IVJA 2V6YA 1I94T 4HFDA 1JOJA 4P1NA 3JADA 2VNOA 1BJQA 2W63A 1AHSA 2FDJA 4AVSA 4YT0A 1XYPA 4CU8A 5LG3A 1F5FA 2E5LT 3I2JA 1CAXB 1HNWT 1ODMA 3ENRA 3WQ1A 1PMJX 1VRH2 1ZA4A 2ZS6B 5EWSA 1UAIA 2I59A 4YM0A 3P1IA 2O8OA 4Q1PA 2CEAA 4HWIB 5FYBA 2E26A 1DIWA 4I2OA 4GK5E 1AR73 2X5IC 2YDEA 4EEBA 5D1IA 5HXSA 5JQGE 4NHXA 4WM8C 3V0BA 1H8TC 1W8WA 5EQUA 5C70A 1IOAA 1S0EA 2A6ZA 5CFDA 3J26N 2VE1A 4XIKA 5EJZB 5ACA3 3T0DA 1LB2A 1RUI1 4QB6A 2W61A 5J2UE 4AKHA 5HEOA 1FPN3 2VKOA 3RSJA 3RWNA 4CU9A 2XL7A 3LD8A 4JGZA 2IUWA 1HX1B 2ZGTA 4IHJE 1DGRN 2AREA 4QT6A 3WNXA 1Z8UA 4ATFA 3VD4A 2A2FX 2PBIA 1R1A2 2OA5A 3PUQA 2WZEA 4LHNA 3DGTA 4LQRA 1GP5A 1UY1A 3UK9A 1PGL2 4K6BA 2B76A 4LXLA 3MLJA 3ZC1A 4CE8A 2D43A 3ZSLA 1LCLA 1HNXT 2PJQA 3AC0A 1SACA 4FAGA 1QY4A 3N7MA 2ZOEB 5G04L 4A42A 2LSKA 3PJAJ 5C8CB 4KMCA 1RGSA 3PUWF 1KEXA 4LE3A 4WVZA 4L92A 2MTQA 5ANQA 3CIRA 3CO2A 3P4PA 1SE7A 1CX4A 5DAQA 5FKBA 5A3NA 2R042 3NZPA 2G4IA 1CUNA 1K5MA 2IIUA 3OBVE 4COFA 4C90A 5KMGP 4KP3C 3RC8A 1GP6A 3I8TA 3KCXA 3K8PC 1JOBA 4JRLA 2GH8A 3UJOA 4Z1VA 1ZBA2 4QXHA 2Z5WA 2D3SA 1ZEEA 4CXWA 4SLIA 1T6BX 1CAWA 2QDRA 3PVBB 2XGXA 4QX8A 5JMOA 3VHLA 3SKVA 3FZKB 5CG9A 5AQNB 3JD72 5ABFA 1WR6A 1OUSA 3NV3A 4LORA 3RZJA 1NXMA 2WT0A 5J37A 1LEMA 2CWOA 3C50A 3CJIC 5FBZA 2QQVA 1GICA 3Q5EA 3CQGB 3WX5A 4CUBA 5FWEA 4GQ7A 2IXIA 2R1BA 2YC0A 1SPPA 4AGGA 3POFA 4UT5A 4QDQA 3QBQA 1FMVA 5AC92 1N36T 5LOVE 5FUNA 1V00A 3MIHA 5JSOA 4Y1UA 2QTWB 3RIUC 2Z4FA 3LQCA 4KU8A 5E1RA 4NMIA 4X62T 1COV2 1W0OA 4LIVA 4Z2AA 3KBUA 2VAUA 1NLSA 1R1ZA 4R9BA 2XQ4A 1DGRA 3HN1A 3H8OA 4W6YA 2A71A 3PVEA 4CEYC 1JBCA 1NT0A 3QC9A 1NY71 4R52A 3N5LA 2QGSA 1POV1 4JTOA 4YVSA 4QX7B 1WCKA 4U33A 2LHRA 2PLV1 5CG8A 1Q8OA 1KITA 3SNMA 5FQ0A 1UX5A 1S4CA 1D1AA 1WA6X 2R0HA 3HNBM 5IK7A 3S5AA 5GLUA 1X7NA 1SLTA 2UUCT 5AQVB 3ZSTA 5FMNA 3OY8B 4XUTA 4H55A 1QJU2 1BYHA 5IATA 1UCUA 1MIWA 4QWNA 5DDJ3 1URXA 2ZBJA 1DCSA 3KQRA 2CXFA 5J96B 3LEGA 2Q8EA 4BYYA 1W9SA 4E4DX 3AXDA 3U07A 2WM9A 3O9XA 5LGNB 2NTYA 3LBXA 2RS52 2PAEA 3T8OA 2W9XA 4Y3OA 3I2GA 4CP1A 3LK3B 1DGWA 3PUSA 3OJBA 4UW4A 3VDBA 3LAGA 4KHPT 3CKHA 1CX1A 3INAA 2UXBT 4XXPA 2HWF1 5DQWA 1HR0T 2GP3A 4DXTA 3JUUA 3D0JA 1RMU1 1OSGA 3HBKA 2NR4A 4QKNA 5FZDA 4BJ0A 5BNQA 4H63V 1YUDA 5FXVA 2WZR3 4L0PA 4YW4A 3RI8A 1NUKA 3PTYA 4QX0A 1ASJ1 3LJCA 2HEYF 1YW0A 2QQLA 2XJPA 2FUPA 1K45A 2D44A 3MIGA 5KBFA 5LA6E 4FPGA 3MV01 2JDKA 4O61A 4LBKA 1V6JA 4ZS2A 3LCPA 1Q56A 5FZ4A 3AXJB 2YEVC 3SCGA 4CVUA 1VAKA 2JX9A 1JYVA 2TNFA 5ANNA 2CHNA 4JKMA 4LO4B 1N3OA 4Z8XA 2XQ8A 5FXZA 1ULGA 4HXCA 4GJZA 1OEDE 1UOFA 2I45A 4A3XA 4KWLA 5FYUA 5M0TA 3ZXFA 2W2IA 1GWKA 5JDNA 3LPGA 5FZOA 1HV1A 5ABJB 1C8M1 1ZZCA 2BVBA 1UYYA 1AR62 1XWMA 5A6XA 2Y6FA 2JQHA 4EZ4A 2WO3A 4HWHA 5FVLA 1FOD3 2RM23 2FMYA 4IEVA 4QKBA 4QAWA 1SDWA 4UI9L 4WNKA 3C51A 1CAVA 4UFKA 1IBLT 1VBA3 3RZHA 4KBMB 4DV7T 1Y7BA 5DZEA 2D97A 1H8VA 3HT1A 4O9GA 1KK7A 1LULA 1LVFA 3BU7A 3UKNA 3VHPA 1WYCA 1RUG2 3NVOA 3RLFF 2OKXA 3GBGA 3CX6B 3TLSA 5L47A 4AVAA 3P4SA 4OZXA 3MW3A 2WLPA 1T2XA 4QPIA 2QZ2A 2CXDA 1UYXA 2EAKA 1HS7A 2EF6A 2BBAA 2F4LA 3VRBA 4Y24A 4MHRA 2DURA 3ETVA 4KWKA 3PMSA 3VKNA 4FTBA 5AQMB 1H4HA 2V09A 3FLTA 1DFQA 3Q5DA 4ZEYA 1WLWA 3MF6A 4Y1YA 1YKEB 3N7JA 4KGGA 3CX8B 5JR9B 5JVDE 1LGNA 1YI7A 2WJSA 2XL9A 5LB7B 4Y22B 3CX7B 2ZGOA 1VBD3 1BEV3 2QQIA 4MGIE 4Y22A 1SFYA 3OPWA 3V65A 1OF4A 3L2YA 2WS91 1RUJ3 2AUYA 4AFCA 4N43B 2BVLA 4XVHA 1B35B 1W2UA 2BVVA 3I4IA 4JI0T 3UT0A 4DEQA 4O4LE 4E7ZA 3OTFA 1ZBE3 4DNDA 1SLCA 3MPPG 4U3CA 1KS4A 1PO22 4KG8A 2YV8A 2R0FA 3U1XA 3VD7A 1N1VA 4CCJA 2QQUA 5FO8B 4AI2A 1N1TA 2GSYA 3U0ZA 3MV11 2ILMA 1R083 2PHTA 3AFGA 3POGA 1PMHX 1NWMX 2RG4A 4ORFA 4XCAA 3WOGA 2FJBA 1H2LA 2WQZC 2LM3A 5F5AA 3UKTA 3USSA 1JHNA 1Y9MA 3M4FA 3SEEA 2HJIA 1VB4A 2RP4A 3E6BA 2KT9A 3J7MA 1SCRA 3NW4A 5LGUB 2FZ2A 4OHVA 4FBFA 4X1YE 2WCAA 4JLEA 3CJIB 5F37A 3Q5XA 1AL23 2A70A 3IDEA 5AQTB 2MBGA 1QNWA 4AQTA 3I2OA 4FQ4A 5GALA 4ZXLA 1A3KA 3RKGA 2DVBA 4Y4RA 2VZVA 1BR4A 3OKQA 2CBJA 5C9AC 4KX6A 1E1HB 4XBFB 3FL7A 5T55A 5JLVA 3K3OA 4LK6A 4KHZF 2RDSA 4ASKA 1ULOA 1Q8PA 3FUQA 4TWHA 5FO9B 5L7OC 4O9EA 1A8DA 2WY2A 4DMVA 3MA9A 2Z69A 2TEPA 2Q9QA 5HCFA 4HE8A 5FZBA 2CAVA 5A1LA 4Z92B 2JDHA 3E6CC 1ODNA 2YMZA 3FJSA 1HRI3 4XDQA 3RYRA 4OX9T 3WG3A 5CFCC 4FTEA 5K9YA 3N9NA 1FV3A 3WF4A 5E6HA 4BMBA 4O4HE 4PJJA 2EXHA 3ZXKA 1QXJA 3VD9A 4YSYA 2WABA 1HB4A 2CHOA 4LF6T 4AQSA 2A6YA 1R093 5HYAA 1L3JA 1UX6A 2X68A 5J1GA 2LSYA 1WLCA 4R9AA 5LYJE 2BG9B 1NEKA 3AE5A 1K12A 1MS5A 2X9YA 3HKBE 1U5ZA 2FJDA 1W8UA 4Q0UA 2C1FA 3RMYA 2RPAA 4F8AA 3HPNA 4LITA 1UU4A 5F9TA 4BQ3A 1JYWA 1V6OA 4CU6A 3VBFB 4I01A 4B7EA 5LHHB 2UXDT 1XU1A 5JXJA 1OH4A 4CP0A 2W2UA 1GQHA 3H9AA 4H9OC 3DKQA 2X0HA 3MACA 4M00A 5AFEA 4D8MA 3H3ZA 5J1XA 3S4UA 3JB8A 4XJWA 4CCLA 4QB2A 4HFIA 5KC6A 1QDCA 3BCWA 2IWGB 5FKYA 2ACZA 5DZFA 1V9DA 3RGLA 3BPSA 1ZBA1 5BNPA 4HFHA 3RZKA 2YK0A 3SRZA 4JX0A 2Q9QB 3LDKA 1XRUA 2JDMA 3H7JA 4O65A 2BNNA 5LXTE 2MPKA 5AQJB 4FCAA 3N4MA 3PIJA 3U10A 2X5IA 1X8EA 1B35A 2MYSA 3J7Yq 1O4YA 1OURA 2ID4A 2VUAA 1RUE2 2VMEA 2W5FA 1POQA 3GNEA 5I93A 4UVCB 2Q30A 2VTFA 4L99A 3FMGA 2XAJB 4YZ2A 3SFEA 2YDSA 3PLQA 5IVYA 4CPBD 4IIJE 5H9RA 3RKOA 4GB33 1FXZA 4RL7A 4AR2A 4B1LA 1CAUA 3WF1A 3GCWA 1GNYA 4HFEA 2QQNA 1UY4A 5J2TE 2GAUA 2R071 4XHBA 2NW7A 4UV9B 1S2BA 1VJ2A 2LS6A 4IEPA 3LE0A 3NV4A 1O91A 2PFVA 4K3UA 3WF2A 2DCKA 1HV0A 4FXGB 3A5XA 3AVRA 1W8FA 5JMCA 3CU7A 3GZTB 4HKLA 3MEPA 4XQWA 2V7MA 4JI3T 4GKYA 2DU0A 3KDSE 1W6OB 3FXDB 5JDLA 4YTMA 1M7KA 3USUA 1NQDA 4TTGA 3ABZA 4UR9A 5HCMA 3ZSSA 2KD7A 1CAVB 4LBQD 4CEYB 4A41A 3IDBB 2NZ9A 4G3YC 2ZM6T 1J83A 2G1MA 4YW1A 4PK6A 1GZTA 1XE0A 4LPLA 4R8HA 3H3LA 2YHJA 1OA4A 1ND2B 3AMHA 4FPFA 4X5TA 5LA9A 1F15A 3HWJA 5FPXA 3WF3A 4PDWB 2UURA 4EN7B 3I1AA 1GV9A 3IIIA 3UU5A 3ZPOA 4AQGA 1KXGA 4BJMA 1OOPB 2G9ZA 3I3BA 1LHVA 1V9U1 3MICA 4S2GA 5HPOA 2EA7A 2MEV1 2WSUA 2XQXA 4Y5Z0 4Z82A 1UIJA 4LBQA 1B09A 4V2WA 2XSAA 1K5JA 3ZXLA 3QH7A 5IHRA 1YQ2A 5EZYE 4HVRA 3B01A 4LO7A 3HA4A 1HNZT 4V1Av 1YFWA 2H89A 2BBHA 3AE8A 1YLLA 3CDZB 3FN9A 3K4ZA 4BQ2A 5KHJA 1DQ2A 4Y20B 2DWRA 1LNSA 4QX1A 3D0SA 1RUH2 4ZU7A 3X29B 4IV1B 4YSFA 5IT6A 5FYMA 4EWDA 3MW4A 1IGOA 4P9YA 2WSVA 1W6MA 5A7PA 5FYHA 4LO8A 3J9SA 2GMMA 3NVCA 3NJZA 4UBGA 2WAOA 2W66A 3RF1A 1PGSA 5AVAA 3TN93 2XKPA 5GLTA 3VBFA 2PHRA 1TME3 5FMCA 4JI4T 1ENSA 3NWKA 5JR2A 1DG6A 1LENA 4KGQA 1AX1A 1ND2C 3GJBA 2UXXB 3EDVA 3WW3A 2B42B 5I91A 1EV11 4OUEA 4Q5OA 3VU7H 1GOGA 2LKHA 3AK0A 4QWNB 1OFSA 4IEXA 4O4IE 2UXCT 1W8ZA 4YXDA 5C3QA 1XU2A 2XQYA 3RYHE 4DV3T 3ETUA 1Z7S3 3GBFA 3ZLIA 4DR3T 2XVGA 3NJVA 3W9AA 3KCYA 3WNLA 3DPRC 2LSGA 1A8MA 3DYOA 1LAJA 1HN0A 4XBLA 1MMNA 3ZO0B 1V9U3 4XJ8A 2HH9A 4ES9A 1NE4A 4J2CA 2PHWA 1GWMA 2OW4A 4MHUA 4LO5B 2B45X 3AJYA 4YLHA 1LOEA 1W8HA 2AEYA 1LRHA 1QQP3 2R063 5FZHA 1NY72 3RPUA 1PZ8A 2E7QA 5F3IA 3AFKA 4NUBA 4A98A 3GALA 1FNZA 1CZSA 3T30A 3O1VA 5L2LA 1QOOA 3KCCA 3IMNA 2IFRA 4IV3B 3OBAA 4FPYA 4NRQA 1EY2A 5I0SA 4PI2A 1PIV1 1H2MA 4HK9A 4Q29A 1Y9GA 3DF0A 5C33A 3ZFFB 3FHQA 1L7RA 3DL3A 1SZBA 2F4VT 2NN8A 3M3EA 3IF8B 5A3WA 4U31A 2K3WA 2Y0IA 2WMNA 2R6GF 1YWKA 2N7GA 3GZAA 3VZOA 1PM4A 2VW1A 2RDQA 2E31A 5I0RA 4NPLA 1WYBA 4BQXA 3JCIA 3N2OA 4YFSA 3KF5A 2AE9A 2WZHA 1X9BA 3POSA 4HT1T 1HRV3 4Q2FA 2DV9A 4GKXA 1HG2A 1GOFA 1C8M2 4IETA 1ZZ9A 3ZXEA 4DR2T 4U2YA 2W00A 1WBLA 1BBT3 1SCSA 3TLUA 3MK7C 2BQPA 2HWB3 1VCSA 1I6ZA 3POIA 4MYEA 1X8MA 1ZNPA 2ZMKA 4OULA 3H8XA 1XBFA 4ZI7E 2NPIA 3OYZA 2XLFA 2XASB 1ND3C 2JIGA 2D40A 2PFWA 1VPHA 2H3RA 5JZGB 2GMPA 3OF1A 4IEYA 1O3XA 3L39A 3TEYA 4PLNA 4XFHA 3T1LA 4DXSA 4XMAA 3D82A 5FREA 4J6GA 3CKDA 5BXXA 2E7TA 4EWAA 4FAHA 4MVTA 3D8CA 3R4DB 3WG1A 5F32A 4O2AE 4AI0A 5FDBA 4DRRA 5GZCA 3FFZA 2ET7A 1UWWA 4H63H 3MZKB 4AZZA 3PJAA 1OQDA 4PFOA 3ZC0A 3IB3A 3KHBA 3M3QA 2BFUL 4INDA 2C0ZA 3NSTA 3A22A 3N9QA 2M6IA 2ZZJA 4ZXEA 3ZDSA 1D7PM 4EOZB 1JS9A 1NYWA 1UGOA 4B4PA 3AEDA 4AGRA 1QJX2 5EK4A 3WLUA 4G9SB 4CDXB 3FZFB 2BRTA 4A97A 2RMU3 1KJRA 3NZQA 3DN7A 4M3CB 3NJYA 1O4TA 1J3RA 2D6PA 3PJQA 2VNVA 3AAIA 5CFCA 1H2NA 4ZU5A 3KQ4B 1OQ1A 3FHNA 4LKDA 2ZX4A 4Y5SA 4EJRA 2W95A 3PUIA 5BMVE 3VBHB 2JRKA 4YHJA 4CCMA 2JDNA 3N9MA 4B3MT 2VUCA 3HQUA 3WUCA 5F5IA 1T8BA 4L2NA 1WFDA 5KXCA 1SFPA 1YHFA 2XWJB 1H0BA 1LHNA 5FPBA 3TAYA 2UY9A 2DUPA 3VBUC 2CE7A 5ABJA 2PN5A 2PAMA 3VKGA 4WVVA 4LKFA 5FY9A 3WR0A 3O1OA 5JPNB 4JAAA 2LEHA 2WWSA 2DCJA 3SXWA 2Y6GA 2D5FA 4YHHT 2WFF2 2W08A 1D0YA 5J0ZA 4XILA 4XUPA 5IJRA 2G0UA 4GK0E 2EALA 4ZZ8A 1FMD2 3ZYJB 1ZHCA 3IWZA 3POYA 1J3PA 3N9OA 2OYZA 4EN0A 3CQCB 4LF8T 3ZSJA 1COV1 2FCUA 4KU7A 2RV9A 3WVJA 4XAEA 5F39A 1MACA 4HK8A 1QIQA 3WEZA 4UWDA 4D6RA 2E5VA 1RUD2 3H37A 2D6OX 2YFUA 3OGVA 5EK2A 3C4ZA 2RS32 1O5UA 1NLQA 5T5PA 1GBGA 4AKLA 3ZSKA 3GCXA 2DF7A 1LRZA 4ES8A 1RUF1 2B5HA 3NRXA 2RM21 2GALA 3CZJA 3P5BA 4MV2A 1HX6A 1S0CA 2C9KA 2V5YA 1G6NA 4FFIA 2OLTA 2ZX0A 4DY3A 3O1JA 2P3JA 2Q8DA 1MPXA 1EUTA 4XCBA 2VUDA 2NW9A 4X1KE 3WCRA 4CCDA 4TV8E 1AYM1 5K7PA 4BIOA 3MIDA 4WM7C 4RGGA 5EV7A 4V2VA 3VN4A 4CUGA 4AVCA 1RIRA 3P3NA 1WCQA 4PDWA 1L7LA 3ZYBA 5DXDA 3B5LB 4DO0A 1W8NA 3J8F2 4MH0E 4AHYA 3BU0A 4L8QA 3KGZA 3NAPB 5BNNB 2O14A 2XWBB 4NXNT 4E8CA 3RZGA 2WT1A 4K0KT 5FQ0B 2PG8A 1W09A 3ASIA 3MW2A 1ASJ2 4BWOA 4BDVB 4V1PA 4TYSA 3M3CA 3WNNA 2BTVC 2ZEZA 1W2NA 1VBC2 2B39A 4K20A 3E1F1 5JXGA 2IUBA 3U11A 3ZFEC 4FFGA 2ZAAA 1OLME 3HNYM 5FAXA 4CU7A 4OCTA 3Q9OA 3PUYF 3M8LA 2K9AA 5CFDC 3S6PA 1ZVFA 2YBSA 4AXOA 1B35C 5FTTC 1KRIA 4CEWB 5GZFA 4GMP3 2UU9T 2D6KA 1BCXA 1G8WA 4IERA 2VBBA 4AAXA 3S57A 4C0HA 4QHOA 4YSXA 3DYMA 5FJHA 5A7OA 3ACHA 3KT4A 2XJRA 2IVIB 4F3JA 3C64A 2PAKA 3I59B 2VZUA 1D1BA 5FY5A 5JR9C 2VJXA 4NWVA 2JENA 3GZEA 1O59A 4HOOA 2IC1A 2WS92 2J1UA 4WM8B 2XB6C 1HDKA 4HKWA 2K24A 3KV5A 2JEMA 2XBO2 4HANA 2X9XA 4XTPA 3T2QA 3ZSEA 2J7MA 2Z42A 2ERFA 3JXSA 4PFPA 3M3OA 1JTZX 2K2SA 4NIAA 3ZDVA 3QB5K 2W94A 2DVGA 2PLV2 4XJAA 4WZCA 4AI8A 2VMFA 3JZVA 5A7QA 3WP6A 5IVVA 2XUEA 2WNUA 3NNMA 5JPMB 1BK0A 2GNTA 1S2EA 2W3JA 3QCWA 4BJNA 5CYYA 3SH4A 2ZGNA 4YGEA 3THTA 1VMFA 4Q26A 2P9BA 3RRCA 1QH7A 1TVGA 4OI4A 2AC1A 5GKAC 1IAPA 4JYAT 1RUC2 3GN5A 2K46A 1Z7S1 4Q0PA 3URFA 2HWD1 3KT1A 4ASLA 4ONUA 3LIGA 3F31A 4RS5B 4CRQA 2VNGA 2LTNA 5LJNA 1GYKA 2WDBA 2XJSA 3VDDC 4C8DA 1FEWA 5JIUA 5IYYA 1GNHA 1IKPA 3LWCA 5LHGB 2CV6A 4L5GA 5CAZA 2BS4A 5HXCA 1FMWA 5LBQB 1GZWA 1LGCA 1U0AA 1YCIA 2CY6A 1CPMA 5LMUT 4XQ4A 4E2SA 1X9PA 5T54A 4GMP1 2VW2A 2ZEYA 3E97A 2WWUA 2VOVA 1V6IA 4CXXA 1ULPA 2RJKA 3PUXF 3S7EA 4I50E 3ACLA 1MEC1 1WKYA 3ES4A 5LY2A 4D6QA 5C8WA 1UXXX 1W6PB 3EO6A 1ZZ8A 3LKJA 1WD3A 4GIQA 2E2AA 4UW6A 4XPVA 1PX3A 3HEIA 2YYOA 3KT7A 2V26A 3DPRB 4B8EA 1CZTA 2UWAA 4CI2B 1DHKB 3MGUA 2WA3A 3GXUA 4FXKB 4LBLA 3H8UA 2DI4A 3IIAA 3J7HA 1UU5A 1MS3A 3ANWA 1CAXA 1DZTA 3POJA 4PLMA 5GLVA 4LMKA 5EJ3A 5C4WB 2OV9A 1NZIA 1E5SA 4ITCA 4YVWB 5T3NA 3N9LA 5DAXA 3FHAA 1BQPA 4QHBA 3VD5A 2BZDA 2SPCA 1MMAA 3CJIA 5C6CA 1GZ9A 2HBUA 4AQ2A 4I30A 2Y6XA 1M4WA 1ZM1A 4F6RC 4OMCA 3JAFA 2JB8A 5I8TA 3OD0A 4YVWC 4RHV1 3CQOA 3AMQA 2O1QA 1UUSA 1JHJA 1QXRA 1J5ET 2DCYA 2LLYA 4K21A 2R1DA 4UXAA 4PK5A 4XFIA 2P1BA 3A21A 3H1MA 5FCCA 2FCTA 4TNWA 2YZ4A 3W59A 4XUNA 1AR83 3KVBA 1SA0E 2W1QA 4RQPA 2WZPP 4QGMA 1PO12 2NOXA 3ZMSB 2WN2A 5A7WA 5HXHA 5A3PA 5LK7B 1G9CA 4YGBA 2HPLA 1SBDA 2P2KA 1CVNA 3O1IA 1XDOA 2XJTA 3CF6E 1OT5A 3H7YA 4GULA 3KB5A 1O5LA 1HFAA 3RRWA 4LF5T 3T0BA 5LJMA 1CN1A 1GZCA 4NHLA 4OI2A 1OA3A 3BN6A 2BOJA 4RHV2 4H9QC 3C7GA 4ADZA 4IL7A 4UBHA 1TMF3 5J98B 1LU2A 3C4XA 2PQSA 4MGSA 2R32A 1F35A 1GUIA 1I5ZA 3NWIA 3AE9A 4LIUA 4QM8A 5FP7A 3AA6B 5AQOB 3KV4A 2VO5A 4HFVA 4IDZA 3RQWA 1UZVA 2VCMA 2L3LA 1FV2A 1S0DA 2ZJCA 3FUOA 2RR11 4AKGA 1EYBA 4FOQA 5C9AA 1BMV2 3H8RA 4JDMA 3WHTA 4DNYA 1EAH2 4NR1A 4DR6T 3AP4A 3VBRA 1UKGA 3UNPA 2G19A 1X9TA 4L11A 3NQHA 2W0GA 5CA1E 4COVA 3AL5A 1EV13 3ZYLA 1C8NA 4B4RA 3R6NA 4I43B 1SHZC 4QU1A 2JQ9A 1Q8QA 3VZJA 4NPMA 3HI2A 1WW4A 2YU1A 1FAYA 4JC1A 4MBQA 3V5SA 5FZ7A 3N3HA 2BKPA 4N9HA 2HWF3 2RJLA 1F9KA 4KWJA 4RFRB 3ZCIA 1J84A 2XQ5A 1CQ9A 1REDA 1XNDA 2FDIA 3PMEA 4MXWB 5H9QA 1W6QB 4D7TA 2WQ4A 2Q9QD 1QJY2 5FZOB 2VNRA 1R64A 4S2DA 2V8SV 1W2AX 4AEDA 3RZMA 1LTEA 5F3EA 3KFWX 3OYWB 5FO7B 4E2GA 1RUNA 1IPJA 3FXEB 2XKOA 3N9PA 3HBZA 3LFMA 3AMPA 3ZJ1A 2AYHA 2XUMA 4IT4A 4FP3A 1US2A 4XZUG 3SCFA 3Q8EA 2HWE3 2VECA 4LEJA 2BG9E 4DINB 2OVUA 1XQNA 3GYDA 3T09A 3E6DA 1PVC1 3ATGA 1C5IA 4LUMA 4CA9A 1DF0A 4IEZA 4BA6A 2IXKA 1UZWA 3V64A 4CDQA 3P8CD 4M01A 3M7AA 3QLQA 2CLYC 4ZZCA 2C24A 2HN2A 1FPN1 5FZ1A 1LODA 5B4XA 4BISA 4PIZA 3TLVA 1HX8A 1LJ7A 4XFGA 2VL8A 3CQXC 1J58A 2VQFT 1WLTA 5DG1A 1DGWX 3ZFGC 3PE0A 5EXOA 4CN1A 4B6XA 2HWE1 4BK5A 4IDQA 4HMZA 2CNAA 2FHRA 3JU9A 3MHZA 5C3SA 4AI3A 5FZKA 4LFBT 2JG8B 1F8VA 1W0BA 4C91A 4DV4T 3K4DA 1SEFA 3PJYA 4JDNA 2C5DA 4NIIA 1JYXA 2DHRA 2VVSA 3TLTA 3AAEB 1GOHA 3KBTA 1UZZA 1MS9A 4M3CE 1OC1A 4XFAA 4XZPA 1MS8A 4MXWA 4BPZA 3B69A 4YWAA 4EV0A 4B3ST 4AKIA 5HV4A 5C3PA 5LRSA 2ZTNA 1U12A 4LMFA 1QSDA 1W0AA 2A72A 4QXCB 1HRI1 3VHOA 4CPBA 3AZZA 3MFCA 4DRVA 5ACA2 3AE7A 1FPN2 4BM8A 5AFBA 1VRBA 5KWRA 2KWIB 3LG7A 3MF9A 1LGBA 1YQ3A 2XJVA 3I54A 4LTAA 3I3EA 1SLAA 2JDPA 2RDNA 4S2FA 5CKMA 2JDYA 5CISA 5AQRB 1PZ9A 5L9BA 2CWYA 5AQPB 3UULA 5DUWA 2FJAA 2CGPA 1G9BA 3PUVF 4GYRA 1QHDA 2WQ8A 4MG2A 2XQ6A 4GH4A 1AF9A 1OWAA 2NP9A 3EBRA 4MLOA 4AFDA 3HD8B 4Q4V3 4Q25A 1RVF3 2VMHA 4WM8A 1GU3A 5AVPA 4I0BA 3UTKA 2R043 5FP4A 1ENQA 2BP6A 2JE9A 5JR9A 1SQ4A 1ENRA 3GZUC 3WW2A 4AKRB 2YGLA 1DP0A 4ILCA 4KBZA 2QYWA 3RIFA 3KSCA 1GFF2 4WM7A 3WINE 2H7OA 1RL3A 2WWJA 1Z78A 3O0WA 4COWA 1W2TA 4UFIA 5C5TA 4DUZT 1KDKA 2SLIA 1LHUA 1ZKEA 3RJRA 2P6CA 4YVSC 3P50A 4XHXA 4XUOA 2CRBA 5J3UA 2VZ1A 2P3YA 4QX8B 1CAWB 2FCVA 2P4EA 3ZVXA 4B29A 2NW8A 5FKCA 4UW3A 4CP9B 5JXIA 1KNZA 5E89A 1NE6A 1W05A 4ZHQE 1YXWA 3ZXDA 1GQEA 2FBEA 4JV5T 1Y43B 3AZWA 1BR0A 4NN0A 3HKCE 4JKLA 1KD7A 1VBA1 1COV3 4CI3B 1QDOA 1OD3A 3Q5WA 2X9WA 3EDUA 2WNVA 3HAGA 4IGQA 2IXHA 5BNOA 2D6LX 5BYNA 5A3UA 2OS2A 3FBLA 3MKDA 4JEUB 2N9DA 1HLCA 2H7VC 1QJFA 1FMD1 2HWC3 4OVEA 4PJNA 1NG0A 2HWB1 4QKDA 5FPZA 3W58A 4XACA 4DOUA 1QWRA 5JOYA 1BHGA 2WINB 3S30A 3DTOA 4AYUA 1W04A 2B4KA 4FOWA 2JDAA 3ACFA 1OLQA 1X36A 1GR3A 1MVQA 4IL9A 5FUIA 2VMDA 4AFAA 4NPPA 3ZPYA 4P0AA 3ZXAC 4AHWA 5LMNT 3SC7X 2J47A 3ILFA 2MAWA 1OUXA 4Q4Y3 4HFBA 3AA7B 3P4QA 1AR92 1IKQA 3M2MA 3V0BB 2F17A 4DR7T 1PO11 2YBKA 2A6VA 1DQ6A 3I3DA 4X6QB 4OI0A 4D0QA 2FDGA 2RS53 2ZAHA 3WI3A 4H2AA 3WP5A 5JSRA 3MLKA 3U4XA 4FOVA 4TV9E 4LOSA 4NAOA 5CVRA 2VOWA 1XOYA 1OKQA 4XOGA 1HG5A 4CN6A 3IDCB 1XE7A 4QXCA 2VW0A 3QOFA 2UXNB 2W1WA 2ATFA 3LA2A 3Q8BA 5EHDA 5JREA 4BXSV 2WYSA 3BPZA 4DMIA 3OUIA 1J1JA 4GWIA 1P8JA 1FJGT 5L7OB 4F7ZA 4GH4C 2H6BA 4JQTA 5BR8T 4U7IA 1LECA 1R081 2P5BA 4TN7A 1WCRA 5FLHA 3FFQA 5JIAA 1VE0A 3THDA 3IDAA 2HKXA 5DUVA 5A3LA 1JZ5A 3L9JT 3MIFA 2VR4A 2ZXQA 2XOMA 3NNFA 2XM2A 2PELA 4Q4V1 4YVWA 3C7FA 2UWBA 5CIRA 4EV6A 3AXJA 3ZMUB 3B93A 1LKXA 2XM1A 4AISA 2HWD3 3OY8A 4AVBA 3IAQA 3RH3A 1G86A 3WV6A 1NCQB 3AKTA 3L2HA 1QJZA 3HQRA 4MXVA 4RR3B 2EIEA 2W62A 4E4ZA 4E4HA 5F2WA 4YFZA 1TG7A 1K3IA 3OPTA 4CDUC 3AKRA 1TME1 5IUQA 1ULFA 1QU0A 3FZMB 1RMU3 2GNBA 2P34A 3ALQA 4I4TE 1HIXA 2ZHMA 1YXRA 3HVDA 5FZLA 3LOBA 1CPNA 3DKWA 2EXKA 1W6PA 3M70A 3NKTA 2ZPXA 3ONJA 3VBSB 1JYTA 2OZJA 4IL4A 4CN4A 4JGYB 2RM22 4LT5A 3Q2MA 5FZFA 1O3RA 3Q9DA 1BKZA 3Q8FA 4BQ5A 1QOTA 2UU8A 3X1DA 5IK4A 3LSVA 4DVDA 5FJKA 1H9PA 2VQ0A 3PDYA 3SQOA 3TRSB 4AXPA 1W6NA 1ZZBA 2D6MA 3POBA 3WNKA 2QRXA 2GC0A 2JB4A 2XDVA 2XHNA 4NAMA 5J48A 1UKRA 4EYYR 1E5HA 1UOBA 5FZ6A 3QB5A 2KR2A 3NRUA 5F5CA 4NRMA 5DUUA 4OLLA 1F4HA 1UK5A 1IS4A 1W3XA 3MPBA 4FT8A 1KFXL 5LATA 3RMXA 5FK8A 2XVLA 5HWYA 4ATEA 2WDVA 2CGNA 2OUHA 1E2AA 4H9PC 5FPUA 5IW0A 3VZNA 4DV1T 3AEGA 4Q4W2 4XDPA 1VBC1 3RQ0A 1S0IA 1VAVA 4C1XA 4DEVA 3GBWA 1BEV2 5AQQB 1JU4A 3VHNA 4CI1B 4JI5T 4U7YA 3IEEA 2XR4A 3MDPA 1PK6B 3POWA 2VL4A 1WA4A 4LR4A 4N43A 1RUJ2 1W8TA 1AXKA 2J1EA 4EGWA 4UVAB 2IW5B 5JRCB 3AYEA 4XAAA 3H3MA 2OXBA 5LEJA 1RUE1 4LA3A 2Y6JA 2BG9C 4LULA 4AWDA 1ENXA 1T7SA 4PJLA 1W0PA 3L3PA 2JJ6A 1ZBE2 4WW0A 5IWFA 1PO23 2J22A 3EHZA 2WRAA 1NCRA 1W6NB 1WCSA 2DBIA 5DN2A 2WZR1 4HETA 2VZ3A 4RA0A 4EN6B 4QDSA 3B02A 3ON7A 4I09A 5JDFA 2ES3A 2OT7A 4IGOA 1GQGA 4OZOA 4XUQA 5FY8A 2AH2A 3O1SA 2V1DB 2J1AA 3AKSA 1IG3A 4AQFC 2YBPA 3AEAA 3AJZA 3ZMOA 5CBLA 4ISRA 2RA1A 3POEA 5FZ9A 3VBRC 3VBSA 1SLBA 3BALA 2JICA 5DQ0A 4UEMA 2QCSB 4ZPIA 5CB7A 4A3ZA 2WP9A 5IVFA 1TZOA 2C5JA 5K8SA 5HCHA 1YEWA 1W3VA 4DV6T 1RUF2 3WW1A 3G6JB 1POV0 1C3HA 3OUHA 1MIYA 4QQOA 4ZY9A 4LF4T 2CM0A 1FI2A 3EHKA 2KXLA 4XABA 5LASA 2XQ7A 2H0BA 3CIHA 4A7KA 3VKMA 1ZYBA 1AJKA 2OA2A 4CUAA 3AZYA 3QUJA 1D4M1 2LRKA 3EI0A 3K3QC 1D2QA 4DR5T 1OVPA 1RUC1 2DYCA 2MPFA 3DECA 1W9FA 3O1TA 1RYYA 4H7MA 3LB9A 5CKQA 5FZ8A 2XPKA 1Q5OA 2Y8KA 4YG0A 4D7YA 1US7B 3VBOC 2E32A 2OX0A 1VMJA 5FOJB 3LDRA 2H88A 3ZEFB 3K1SA 4IEWA 2BBVA 4YZ4A 2OPWA 3CZUA 3V0AA 5FL1A 2B7YA 5KHHA 1RUI3 5KHGA 1NXD1 4GWMA 2WAAA 2WN3A 1HRI2 4LHSA 1NAEA 3Q8CA 2WQYA 5IUXA 2UUBT 2ODUA 1DQ5A 4AEDC 4YM3A 2FZ1A 4UW5A 2XBO1 3KV6A 4Q4X3 1U5IA 3UL2A 3WP4A 1XNCA 4QQLA 3K2OA 2W47A 5T5JA 2Y6LA 4IDPA 4W50A 3A8YC 5FZGA 5I0UA 2RS31 1RXFA 2QBXA 2KINB 3GA8A 2KM2A 2UYAA 2VCAA 3IMMA 5BNPC 3BTXA 4LK7A 3BKZA 3J9X1 2ZABA 5FYIA 4HGAA 3CMLA 2HLEA 1PIV2 3RNSA 3ZCJA 1NA1A 4IE4A 4YW2A 1E7PA 2CA5A 3U14A 4CDWA 1DZRA 2CSGA 4YJ2E 4N53C 5A70A 4CDXA 3SWHA 3OOXA 3WDWA 2WC2A 3SKJE 2RMU1 3OJAA 2QQJA 2GNDA 2MOZA 1GZWB 3OGGA 4JKKA 5FMOS 5JWPA 2Q8OA 5LHIB 2QQWA 2PHXA 3CVRA 3ZT5A 2BYVE 4P9WA 4QKFA 4RFT0 3T4HB 4AQ6A 2DWKA 1ONAA 2ZM8A 5HXVA 3H42B 5FUPA 3UETA 2D0UA 4PW8A 4ZKTB 3SOLA 2VKJA 3GN5B 1JI6A 1RC6A 3AVSA 4XE9A 1D4M3 1D2SA 2WA4A 2WU2A 3DXUA 4Y26A 1CD3G 5FMDA 3SCHA 2XY8B 3JC6D 2WNVB 1WBFA 5HWXA 2CBIA 4A6SA 5GZGA 1N3QA 3DUIA 1C1FA 2PA7A 2PYTA 3PU8A 1MZFA 3MFAA 1VCTA 2C5KT 1Q8SA 4GB32 4CEYA 1HN1A 1OVSA 4HSJA 2BZBA 5A3TA 2NMOA 4XAXB 1J1TA 2BWAA 2QVSB 3WW4A 4ZHNA 1J59A 4JHTA 1W6OA 3ROUA 4A5XA 3USUB 3VRAA 2XQ3A 1YFXA 2ORXA 4OHXA 2XAHB 4S2HA 2LT3A 1AYM2 4M3CA 5DPNA 3VGIA 5FWJA 4G4FA 2VMGA 3FZ3A 5LGTB 2V5DA 2KWHA 1YFUA 2JMKA 4GALA 5LA0A 4NJ4A 3JBG3 4QGNA 3ZN6B 1SG3A 3PVOA 3AE4A 4XETA 4X65T 5C8YE 4O4JE 1SDDB 5FZMA 5C3RA 3ZR5A 2W68A 4QH1A 2TBVA 2A5ZA 3R0RA 4X8NA 1VBE2 4L0RA 4BAYB 2VG9A 2NQYA 1AR71 3OSDA 2NWBA 2DBNA 1M06G 2WO1A 4M0HA 3VBOA 4KUMB 2DVDA 4A2UA 2EIGA 3H1YA 5DDJ1 4YG3A 1JXNA 4CEWA 4XTMA 4JUYA 2DTYA 3TBDA 3VDCA 1PNGA 3ZYPA 3IHRA 5JRCA 1NLRA 2R6QA 1AX2A 4YGCA 4AEKA 2W92A 4GH4B 4AVVA 5F1RA 5B2GB 4CUCA 2Y26A 5KX5E 1WMDA 5A7SA 1K5MC 1Q8VA 2W39A 4ZONA 1XB9A 3VL9A 2DVAA 4QU2A 4COZA 1QQP1 4P14A 4A7ZA 4H9RC 4O2BE 1I6XA 1IQDC 1F5JA 2OIIA 2VPVA 4EIWA 1MZEA 5EZWA 5HBAA 3OD4A 4UFLA 3T0AA 4HVQA 2D93A 1XE8A 3E5QA 1J3QA 5BNPB 1OLMA 5A7NA 3NRYA 1NCQA 4RR3A 4QXBA 4WVMB 3C4WA 3LOIA 4U74A 5FK7A 5GM0A 3ZXGA 3UGGA 1VBB3 1O3TA 4P09A 2ZX1A 3RZLA 2YFZA 4HWFA 1QEXA 1UMZA 3U75A 5L4EA 2BS2A 3D5OA 4PQQA 5SV5A 4BE3A 5AQGB 4B3TT 1AXYA 3UU4A 2BFUS 2IDOB 2IHR1 4FJOA 2NP0A 1UX7A 1WUVA 2CU5A 2ZA9A 4TN7B 2JG8A 2X05A 3WDVA 3TKLB 5FNVE 4EE2A 3KINB 4LLOA 3T2OA 1W39A 2XJ7A 2C4XA 2HEVF 5JDGA 2RS11 1ULDA 4Z90A 2X0YA 4DV0T 3WDXA 2A3XA 5A32A 5F5WA 5L19A 5FZCA 1UY2A 4PHZA 2KLQA 2CDOA 2JG9A 3FE5A 3TN92 1LKNA 1MVEA 4AI1A 5CEHA 5FFOC 2RS12 1XMOT 3AZXA 4OUMA 4IREA 5DAPA 5DAWA 2XTLA 3RIAA 2VUJA 5FV3A 4XJZA 5FZIA 4XW3A 4TZDA 2ZMAA 1ST8A 4UYBA 1BR1A 5T50A 1D0GA 3NNJA 5KR7A 4Q27A 3E5UA 2Y60A 1PGW2 4P9XA 1ZX5A 4EN8B 5G05L 2FDKA 3PUZF 3HJRA 2I2SA 5CZKA 2M67A 1DQ1A 1LOBA 3NO8A 5ABHA 3TNQA 4MGQA 5LRRA 1O8SA 2RR13 3FC0A 3LGRA 4AAPA 2QDNA 1AJOA 1TEIA 1VBD1 2K9ZA 1DYKA 2MEV2 2WU5A 3ILNA 1V9U2 2ZMLA 2LOSA 1WMXA 3B13A 1CJPA 4FFHA 1ZA7A 2ADDA 4K40A 2HPJA 3RZZA 1ND2A 1XSQA 2YXSA 5I8YA 3EMRA 1TMF1 2DUQA 3SHRA 4BQWA 1T6GC 1QQP2 3RFRA 2OQ7A 4Y1XA 5L7OA 5IK8A 1OEDA 5DMYA 1I1EA 1DZQA 2QQOA 2ZLYA 1AYN2 4HONA 4P5YA 4B3RT 1BLZA 2BNOA 2JG9C 1UY3A 2VL0A 2C9AA 1PK6C 2VZRA 2ZKLA 2WS3A 4IEOA 4R4XA 3EAMA 3MUZ1 2A7AA 5HCJA 5CA6A 4R9CA 3JAEA 3OCPA 1VOMA 2WKKA 2IXCA 1GMMA 2VOTA 4LBNA 4P08A 2Y6HA 4PAGA 4I3GA 5C5UA 5CGMA 2C26A 5CFCB 4CP9A 3OVUA 2BJSA 5F3JA 2X0LB 2VVDA 5EPAA 3S0MA 2MNGA 2LRPA 2E6VA 5H9SA 1VBE1 3IBMA 5C71A 5ISLA 3C7EA 5L3DB 3AP9A 3H3AA 2CWSA 2BV4A 2VM9A 3VBRB 3WZ1A 4OYJA 1WMFA 1BVVA 1XNKA 3MBWA 1XNTA 5FPAA 2FDHA 5JI9A 2X53S 1QUUA 3O7OA 3AAAB 1QMJA 3EVYA 4FPHA 4ANJA 4GKKT 1C8M3 5FIXA 3VR9A 1I3HA 3R6SA 4XFBA 2RDRA 1ULEA 2VWAA 3P4RA 4TNVA 3NKZA 1POV3 3ZT7A 2DFBA 2GMEA 2WFF1 1YRZA 3DV8A 3IZOA 3I0OA 3OEBA 3BTZA 1JNRA 1EZ3A 2R072 1WZXA 4HLTA 4DZGA 1PVC3 5IFPA 2D0TA 4FPCA 2OQ6A 2JXAA 1D0XA 2VKDA 5ADXL 1BZWA 1Y4WA 4FOYA 1PGL1 2R041 4LFCT 4JGYC 3ZYGA 2W87A 5DABA 3OEAA 3GGLA 2NTXA 2XSBA 2R7EB 1CHUA 1KGYA 1PM7A 1RHI3 3AE2A 1UCXA 1Q3EA 2EICA 2FQPA 2X5IB 5FYZA 4ARXA 1KJLA 4FTSA 2LM9A 2JIJA 2E9XD 4E4SA 4ET7A 4AIUA 1YQCA 1AL21 2BNMA 2P3KA 4PIYA 3KWVA 1BVP1 3ZN5A 4BIFA 2NM1A 2V6XA 2BDEA 3UUNA 4DMWA 1H2KA 1SBEA 5H6RB 1W2OA 3PNAA 1OBNA 1WWYA 1XC6A 2WR9A 3NAPC 4FO9A 4XZCA 1PX4A 3ZOIA 1UOJA 2YY1A 3KM5A 4K1ZA 4AFMA 5IAXA 1DDLA 2IXJA 2FDFA 4QX2A 1MEC3 1CGPA 1QJX3 5AQHB 4L97A 4COYA 4JI8T 1HTJF 5H6QB 1I5PA 1WW6A 2VMCA 2RMU2 3ACGA 4N9IA 2ODVA 2WDRA 3VLBB 4AEJA 5BUVA 3AB3B 1N32T 4WM7B 4BK4A 2AACA 1WW7A 1JZ2A 2QUOA 1Y01A 2WT2A 3GDBA 5FZ3A 2E9XA 3UU3A 1SUMB 3LIHA 5E8AA 3U3IA 2LRLA 1RVF1 3EJKA 1UYZA 1DQ0A 1HXS3 3ZXJA 4JZRA 4MALA 4GWJA 4MADA 2IMLA 2WWVA 4XEZA 1LESA 5LWBA 1VRH1 1VR3A 3VBSC 1MQTA 1W8OA 2KA3A 4YGDA 4FPKA 2V7LA 4OYUA 3ZIWA 1SLLA 3I3QA 4ZI3C 1FX5A 4XXAA 4XYXA 3FHIB 2E8IA 1XMQT 3ELNA 3T1HT 4OUSA 1FIOA 5BNOC 3AX4A 1YIFA 2YC4A 2IFWA 4HTEA 1FMD3 1MZ5A 1GNZA 2DVFA 4XBQA 3VD3A 3BGAA 5E88A 3I2DA 3Q8AA 3D6EA 1N1YA 5KXBA 2V5CA 1VRH3 5FP3A 2DTWA 2J42A 1UMIA 3C8XA 2B9VA 1XXNA 2BGOA 3EABA 3P3PA 1MS1A 5I8SA 4PJYA 3OYWA 1OH3A 4JBWF 2B8MA 3WSOA 3UQ4A 1RUD3 2X9HA 4YRDA 5FP9A 4AEDB 2E9XB 1AR72 1YFYA 3OPCA 1H4GA 1OFNA 3AYCA 3CLPA 3NL1A 4P00B 2QQMA 4GIWA 1YQ5A 3BOWA 3QH6A 3RYPA 1WW5A 1UIKA 3NNLA 3PUHA 5JSPA 4I0AA 4Z07A 3IT8A 2Y0OA 1OPOA 4RS5A 4GXLA 2ZM2A 4MGTA 1HKDA 3ZKRA 1WLDA 1C1LA 1J5WA 3I9YA 2AZ5A 4DUXA 5JXHA 4IDNA 1RJ8A 3ES1A 2YKSA 1DYPA 3QK6A 4MO3M 5JUVA 2V73A 1H6XA 4I0WB 4IV1A 4Y1ZA 1R1A3 1N33T 1VMHA 3VDAA 4DV2T 3GJAA 4P9IA 4EQVA 1YIPA 3LPFA 2AENA 2M6BA 1NA1C 4LE4A 3VB9A 4CDWC 1MQTB 4F83A 2PHLA 3A4UA 3H50A 3J8F3 2HBTA 4QXKA 4DV5T 5L3CB 4J25A 4NPRA 5AQSB 4HBNA 1A78A 3ZYFA 3TEWA 1PGW1 5C9AB 2WL1A 3JC6C 4TLGA 1QH6A 1RUJ1 2BOIA 4BA9A 5HXEA 3K75B 3H3UA 1I9RA 2PHDA 1ASJ3 3ONXA 3RYIE 2CL2A 2V7IA 1Y9QA 4JGZC 4L9BA 1UNBA 5DAVA 3VBOB 2O0OA 4LHKA 2A3YA 4LMJA 1QJEA 1VBC3 1JW6A 1L7QA 1ZBA3 4P5HA 4UFJA 2I07B 5FZ0A 1AXZA 5IFTA 2I0MA 3G7DA 3RDIA 4X66T 1AX0A 3MUY1 1W6QA 2BWCA 1DQ4A 4HG6B 1QJX1 4KH9A 3PIGA 5DQVA 4N7IA 3JD73 2CLYB 2DU1A 1TNFA 2WNEA 4Q0SA 2BGCA 1VAMA 4BMEA 2ADEA 2B9UA 2WNUC 2WNOA 1JNZA 2QQKA 4XFCA 5KHKA 4WBNE 2ZEXA 1WMEA 1TE1B 3WQ0A 4G63A 4QXHB 3ZN1B 1V6LA 2DFCA 4Y5TA 3P7IA 2VCBA 1RUH1 4LBJA 4DPNA 3KF3A 3KGLA 5AC93 4QGLA 1K5MB 2BEOA 5CFBA 3MO4A 4CDQC 4M4RA 3ZYHA 3JCFA 2WS93 1AR81 4A44A 3F95A 5ETWA 2XBO3 5AQKB 1V70A 3I0QA 3PV0F 1QKQA 2P17A 4LJHA 4PCRA 4QPWA 4RGAA 1YYNA 5FZEA 3RS6A 1A6CA 1G9AA 4JI1T 1REEA 3WXPA 4AEMA 4WVWA 1C5HA 1O4ZA 3SFDA 4Q1RA 2V7KA 5DG2A 2LSIA 3A0KA 3CHXA 4QH5A 1NKGA 3JQWA 5EJ1B 2J4GA 4GYSA 1LOGA 2L9LA 4JVAA 2XONA 3AP5A 3K46A 3ZM8A 3WY6A 4EROA 3NV2A 5A3MA 2VULA 2YDQA 3I2FA 2G9FA 4YYOA 3LK42 3A23A 2VTXJ 1QJU3 4FP2A 4HEAA 4P9GA 5HEUA 1IZ3A 2ZGUA 2G9GA 3VBUB 2QQPA 4DBQA 5DDJ2 2WDQA 3UUXB 4CZZB 2QZ3A 3DPRA 2BGPA 1RITA 4QMAA 4HFCA 1NZCA 3W21A 3WQBA 5HCAA 1O3QA 1MNDA 3FLPA 1Z0HA 1Y64B 1W03A 3F2ZA 4W6XA 1LVKA 5BPXA 4YZ5A 2UWCA 3WNOA 3ZYIB 2XMLA 1A34A 5HAXA 3CNAA 4KWUA 4ZXKA 4XMIA 5LBBA 2ZGQA 4DXRA 4PNIA 3JD71 2A6WA 3APBA 4O7XA 4QPGC 4F8HA 3LSDA 1JZ3A 1R8IA 2VOKA 1BXHA 1WCDJ 1OEDB 2KMFA 3DJBA 3UQ7A 2VOXA 4RGKA 5IVEA 2NYYA 3BI3A 2Y48B 3DYPA 3O12A 4X64T 2A75A 4LOTA 5L9RA 1UU6A 5A3OA 2V7JA 2GC2A 2WZR2 4XF1A 3ZKYA 3ZX7A 4BZ4A 3AA1B 1HQWA 2D6NA 1IHMA 1S55A 1ZZ7A 1RJ7A 2VK9A 4EXTA 2GC1A 2RS51 3AA0B 1DU2A 4LNVA 4JI7T 1NOVA 1UMHA 3FB2A 4IQPA 1ALYA 4QB1A 3I2KA 2D98A 1VB2A 3ANWB 1G8XA 1NQJA 4BQ4A 3IA3A 1SHWB 3RJ2X 3V5UA 4B4QA 1OKOA 4OYKA 4NOTA 1MR5A 3SLIA 3A0NA 4PQ9A 2VVNA 4RYDA 3KMHA 2NMNA 2O8QA 1LHOA 5A33A 2BDRA 3TN91 4UELA 2VTXA 5C8CC 1IBKT 2A1XA 4AQYT 2X29A 3K4AA 1D0ZA 2X66A 3ST7A 1DLLA 3UFEA 1AR63 3BOPA 4LF7T 3THCA 1JOPA 4I55E 3ZMZB 1D4VB 1FOD2 1UF2C 4WZFA 4XF0A 3AE1A 3L09A 4QD2A 5E16A 3SS1A 3AXEA 2LROA 3O4XE 1VBA2 4QH4A 2VZSA 1DBNA 3IPVB 4TWTA 5LB6A 2WZ8A 1CIYA 4ASMB 4JDOA 5J7MA 3I9WA 4NO4A 3FBYA 1RUG3 5AC91 3P4WA 1KEYA 3C2UA 4QPYA 2BPA2 2IC9A 4UF0B 3GWHA 2KSRA 5ABEA 2WBKA 2GK9A 2ZGLA 2ZGRA 4K8FA 5LK5A 4MZUA 2WZIA 1LOCA 2JD4A 2XHKA 3T2PA 3PHMA 4NIHA 4TLFA 1ZRFA 2ZHLA 5HEGA 2DWGA 1ND3B 2LHNA 1UY0A 4RHV3 5E0OA 5FLJA 2W67A 1OEDC 4FPOB 4HN0A 4MUVA 4XDOA 5JZGA 1TMF2 3ZYRA 4W65A 3CJXA 4ISSA 1OA2A 3VBHC 4DXZA 4MGKE 3NJXA 2ZGPA 4Q8LA 1H8TA 4E27A 5F7UA 1UZYA 2BKOA 2X67A 4AFBA 4OHWA 1IS6A 2ZACA 4HPKB 1G73A 1IJ6A 1VBD2 4LO6B 2H0VA 5FY0A 4Q0QA 4RQPC 2DL1A 5FXXA 4JV4A 4A56A 2EVXA 4R9DA 3LK2B 2A6XA 4NIGA 2EHOD 2VBDA 5I0DA 2XQAA 2VMIA 3HL6A 1VALA 3VZLA 1LU1A 2CCQA 4PBOA 4QPGA 5FBJA 4AHXA 4XBNA 5BV6A 3HT2A 2JD9A 2E9XC 3HQXA 5GLWA 4A4AA 4DUVA 4PT6A 3H0OA 1F31A 5H9PA 1QXPA 3MJXA 3NV1A 2ETEA 3ZFFA 2QKDA 5IVBA 4JGZB 4ISQA 4W8JA 4ZI2D 3VKHA 1R082 2VQUA 3ETPA 4GD4A 2KXPB 4ZU4A 1O3SA 2E9QA 3RHWA 2VQET 3ZN6A 2HWF2 2X51A 4M4PA 2WYFA 1MIVA 4HL0A 4H14A 2Q9QC 2F4PA 1KS5A 2RE9A 3DEMA 5ACA1 4FSJA 3M65A 3M3IA 4I3PA 1NA1B 4CDWB 3AE6A 2W46A 3QD6A 1XSRA 4CCKA 4IEQA 1MMGA 2K48A 5FYSA 5JI7A 4ZZBA 1PO21 5KXJA 3BYWA 1AL22 1HW5A 3UYJA 1UN1A 4OQ8A 4OFGA 5ERLA 1YD8G 3WHUA 4YARA 4LBOA 3WD5A 4XC9A 5FZAA 2Y38A 4EYUA 3KV9A 2HWE2 4YM1A 2JPFA 4PJMA 3F57A 1IPKA 1YO8A 2HYKA 4RN5A 2C6SA 4K7JA 2PHUA 4AL9A 1SBFA 1MS4A 1OF3A 1GLHA 5FVKA 5GJ6A 3LZZA 4JRAA 3VZKA 1E57A 1UO9A 4ZI3D 2YN6A 3ZYMA 5IVCA 4X8PA 3IN9A 5K0UA 1S0FA 4IEUA 4MGZE 3A7MA 4CCEA 2JIWA 2VXJA 5APAA 2D7FA 3BB6A 3I7DA 3T08A 4IV3C 2GU9A 4GMP0 1UXZA 2A3WA 2ZGSA 1IZNB 1UPIA 5LBEA 3WNPA 4ZZ5A 4U2ZA 1UURA 2JKBA 5KXEA 1R092 2C0SA 5FXWA 4DBRA 2XAGB 5KDMC 1W6MB 2B46X 1RUG1 3AEFA 4CDUB 5BNNA 2WO7A 5FL0A 2I74A 4AE2A 3IBPA 1STMA 4DS0A 4DB5A 2BVMA 4JI6T 4IUGA 4NIQA 4YW3A 5TSWA 3W5NA 5L3GB 3UESA 3OGJA 5JH7E 4YJ3E 4OMDA 1WD4A 3L8RA 2WMOA 3PURA 3OGRA 4K8RB 4LHLA 3ZKUA 4BLJA 5IYZE 5FLIA 2ZEWA 4NHYA 4Q0VA 5A32B 1NAFA 1Y3TA 2K5BB 3HKDE 1RTVA 3VBUA 3ZFGA 5JOWA 4FPLA 4LBQB 3OYXA 4QQHA 2YINA 1IS3A 5JAXA 2H6CA 3T3YA 4Z2WA 1OOPA 2W91A 1YKHB 1DYOA 4M1PA 4YZ3A 2ZMNA 1BK1A 3UU8A 2YUEA 1RXGA 2V6YB 3HN3A 4QPGB 3B9IA 4WV8A 3TWIA 1UL9A 2XAQB 4ARYA 4D3WA 1LR5A 2YC2A 4LUKA 3VHRA 5EK3A 3ME2A 3SH5A 2Q8CA 4K0UA 3PTRB 1H30A 1RUE3 2YG0A 4R4ZA 5FPVA 5FY1A 2ARCA 1RVF2 2LJLA 2LOPA 4Q4V2 1K42A 4Y33A 3O1HA 1GANA 2XHEB 2VH9A 5LBMA 1V6KA 3HKEE 5FR3A 3WQ7A 5EP9A 5TAOA 3GHMA 4UV8B 4YVSB 2CTVA 1C4RA 1FYUA 2Q0AA 1OPMA 4GAZA 3UV9A 3PVNA 2WNVC 3AYDA 3OTOT 1S0JA 4IXLA 1PNFA 5IAVA 4BQ1A 5EYXA 1NCQC 3RC3A 4RR3C 2D3PA 2K0GA 1L0VA 4ZS3A 1D0HA 1ZZ6A 2JE7A 2QJVA 1CWPA 4META 1WR0A 1H6YA 2SBAA 4XF4A 4XJUA 3SISA 2CAUA 2YROA 2FD8A 5EFUA 2ACXA 1ZRRA 1CONA 1SPPB 5IWAT 2XQ9A 1ZBE1 1UOGA 3I59A 3ZN0B 1NCRB 5D2AA 3WDTA 3R4UA 4W6WA 4H3WA 4UVBB 4HFSA 2J1DG 2E33A 4C1WA 5JOZA 3EYPA 2GH2A 3BTAA 4YFWA 1LOFC 2BUKA 2PQQA 5C3JA 3RI5A 5ABFB 2AGSA 3ILRA 4H7LA 5T5OA 3ZMNA 2R16A 5D21A 4CTEA 3ZT6A 2WAUA 4X1IE 2HWC2 3C3VA 4MX3A 2PXJA 4BU2A 3M3ZB 5AQIB 1OHFA 2Y33A 1SLIA 4HPKA 4ISTA 3ZFEB 3BQKA 3WDUA 1YJKA 1LOAA 3LA3A 3NBXX 5L3EB 3O0XA 4YLZA 1B7TA 1G9FA 4NUVA 1YQ6A 2E63A 3AECA 1OXZA 1N1SA 2ZM0A 1QF3A 2E51A 2Q1FA 3LDQB 4U2AA 4TSVA 4Y1VA 4BCUA 4RD7A 3THPA 2D5UA 2WSSV 3VBFC 3W5MA 3J4UH 4ILUA 2BERA 4N53A 1QOSA 3AB0A 4Q4Y2 5CU1A 1ZV4X 4I0UA 1AR93 4NHMA 5FMOL 1JYCA 4UF0A 2N1GA 1RUH3 1C28A 2F6BA 3N35A 1JYNA 5LCYA 2D3RA 1BR2A 2JQQA 2HYXA 1M62A 2DCFA 3AKQA 3D4KA 3RIUA 2CDPA 4QHZA 4QX5A 1TQ5A 2CGOA 2WLQA 2JKXA 4UAPA 3ABVA 4WYVA 1AYN1 4FVVA 3JB4C 1G9DA 1AR61 4ILAA 2GC3A 3I2HA 5A1FA 4EAHA 5FYYA 3K51A 3NKGA 4A6OA 3BIEA 1QLBA 4YW7A 3VKOA 3E22E 3J7NA 3B57A 1TME2 4HN1A 3TYJA 3LEIA 3TLWA 4N8MA 4OHZA 4JQRA 2BKNA 5A33B 2GN7A 3MXZA 4CCOA 3ITQA 1E5IA 1JH5A 4GB31 4KNCA 2P3IA 3ECQA 4U72A 3IM0A 5CNAA 5F3GA 4Y20A 3V56A 4G2AA 3GM8A 3T1MA 3AL6A 1YJLA 1Q43A 1N34T 2WO2A 1U4QA 1UPSA 1S0GA 2A3DA 4QPIC 5LA2A 5A6ZA 4DQAA 5KXDA 3CEWA 2A73B 2HWD2 3B7MA 1Z7S2 5GZDA 3RRDA 4GOUA 1ZREA 3NNGA 3C98B 2EIBA 3OBRA 1PMIA 5F6LB 2Q4SA 4NROA 1YQ8A 4DY5A 1US3A 2ARAA 3WG2A 2QFEA 4AI9A 5K0UB 2Z79A 1R1A1 2GZWA 4FI9A 3QOPA 4B7KA 2JG8C 1GSLA 2W1SA 4HWCA 1RMU2 4LKEA 4BHPA 2ZZQA 4GKJT 1GWLA 2R062 1PHMA 4LF9T 2ZHKA 1UQXA 2EAAA 2I6HA 1W06A 1CJDA 1W9RA 5BNOB 3A7QA 2XQRA 3O5SA 4L9IA 1PVXA 4GJYA 1UZ0A 1VP6A 2DNXA 1HB2A 2XLGA 1X79A 4ILBA 3B3QE 4MFRA 4QQPA 4IE0A 3B9CA 3AP6A 1WCUA 3U37A 3VBHA 2HEWF 3S7IA 4RSUA 1JODA 5A6QA 5LEKA 4H9NC 2LKGA 3DCQA 5LW9A 4B1MA 2JE8A 1IPSA 3MYXA 2BS3A 1FNYA 4P9JA 2IZWA 1HB3A 1UD1A 1H1MA 1QJU1 1ZRIA 2ZKNA 3K77A 1E5RA 4EWEA 2TUNA 3BTYA 4PLOA 1NX9A 4IE5A 5HEHA 3UFGA 2DCZA 3LA7A 4K1YA 3WUDA 3ZR6A 4AI6A 1ZOYA 2Q5TA 5FPLA 4E9KA 1HRV2 3ESLA 5D8AA 4E2QA 1JZ6A 3N36A 4TX5A 2JMHA 5JDQA 3E0ZA 2GN3A 2R061 4URTA 5C3OA 2VCCA 2GNMA 3AKPA 5DUXA 4CZSA 1BBT2 1NCRC 1IJ5A 5L3FB 1CAUB 2HWB2 4FFFA 4RS5C 2VVEA 1KF6A 4UIGA 2OPKA 4JTNA 4KG0A 2Y6KA 4Q4W3 4AQFA 1HJFA 2P6HA 1KNRA 3K3NA 3AMMA 3CK6A 4O8SA 2UUAT 5IHYA 1PZ7A 3HNMA 3M1HA 3CPZA 5BY5A 3ZJ2A 3E5XA 1S1AA 4HSLA 5L36A 2LUWA 3MLLA 3VUOA 1HXS1 1FT9A 2XLAA 3BUCA 1S0BA 1RUOA 4DIQA 3AMNA 5FYTA 4W4ZA 4CSWA 4EEDA 5JZGC 3T1YT 2J1RA 2XVKA 2EXJA 2LSJA 1H8TB 2W1UA 2Y64A 3J8F1 4OI1A 4YPJA 4TWFA 3KS7A 3VKLA 1KNPA 2UY8A 5A7WB 3OBZA 5CJ5A 2D5HA 3TOJA 2DCTA 3RYKA 2OUJA 3JBG1 1ND3A 4ZI2C 1X50A 5L3BB 1XYOA 2Q1ZB 5LA1A 3K48A 2VB6A 1YC61 1X33A 5D8AC 3HMYA 2V4VA 4QM9A 5ABJC 2EHOB 5CB4E 1VIWB 3LSEA 2CPTA 3OBTA 4AF9A 5JDHA 3UGFA 4AHZA 3D3AA 5HXMA 5FRAA 2J1SA 2LE8A 1N3PA 2VKHA 4FI5A 1OXCA 1RUF3 4PF5A 5I0TA 1MS0A 4AK3A 1V6NA 4QX7A 3U4SA 2BG9A 4XURA 2WFPA 5SV8A 4GZ9A 3WNMA 1KDMA 1W0NA 4YSZA 2PMWB 3UU6A 1RUD1 1AR91 2YB7A 4IV3A 5A6YA 1O7FA 1AZDA 2QNKA 5DJQC 3C7HA 3FWEA 1EAH1 3QACA 1R091 4QQ2A 5LNKA 5JDBA 2ZGKA 5D8AB 1OI6A 1REFA 4NWWA 3RWKX 1T98A 5FY4A 4AVTA 3TNPB 2IXLA 5A1AA 5KHIA 3LEKA 1LHWA 5FP8A 2ZGMA 4Q4W1 5CA0E 2VZTA 2XH6A 2KNDA 1AUYA 1TNRA 3AZVA 5LP6E 1JN2P 1H7CA 3FLRA 3AM2A 1S35A 3BQLA 4KL1A 1HQLA 2WFF3 5EYYA 4OFZA 3J7LA 4D69A 4FQZA 3OB8A 2FBWA 4OHFA 1IG0A 1RUI2 4NRPA 1W90A 2XXZA 3N7KA 2WB5A 3LF7A 2VU9A 5C8CA 2CMRA 4OK0A 2B1EA 4Q4X2 4D94A 2ENRA 4AG4A 4MGYE 4YTPA 1CR7A 2X10A 1OOPC 2BBJA 4BLIA 1QGLA 4YZ1A 4DR4T 3B5MA 2RS33 1H1IA 1AL0G 2QVAA 3UJQA 4AGVA 5C7GA 1PIV3 2LW8A 5LCWL 3N7LA 4IE7A 4IESA 5AQLB 3PL0A 2XPJA 2Z2SB 2ET1A 3P6BA 2HH7A 1HQNA 2YPDA 4HVOA 3NMBA 3RX6A 3RVHA 4LFAT 2XG3A 3WF0A 4CP2A 1EUUA 3TEZA 1GQPA 4HWDA 2VGDA 2VQAA 4YM2A 4LMLA 5GZEA 2W4XA 3PUGA 1CZVA 2UYBA 2J1VA 3VV1A 3W20A 3UUMA 4P02B 4UFHA 5HI0A 5JCTA 1W99A 4YW6A 4FPEA 3VZMA 5F2SA 3CMGA 3W15B 4AOCA 3ZFEA 4CDQB 1EPZA 2VY0A 4KMQA 1JZ4A 2C5IT 2ZCWA 3T4VA 2LALA 1T72A 2WIIB 5BNNC 2PTFA 4Z91A 1D4M2 1GP4A 2D9DA 3SH3A 2AR6A 4CQIA 2VZQA 2DDUA 1ACCA 4P0BA 1IBMT 4NUUA 5L9VA 3EQEA 3R05A 2WUHA 3HIFA 2JECA 3WT3A 4N78D 1SFNA 3PDQA 3ZN4A 4CDXC 1S94A 3EB7A 4NHKA 5AQUB 1XNQT 3AEBA 1FATA 2XJUA 4CEWC 1WGPA 2L9QA 1VLNA 1AVBA 3GHNA 3QNUA 4PDWC 1AYM3 3KHCA 4IDOA 3LEMA 1NENA 4YY3T 4A45A 4AW7A 4PIXA 4XF9A 3JBG2 3AP7A 3RQUA 3LFIA 1AJ3A 4QDRA 1IS5A 1KFUL 4D6SA 4TXWA 5F5QA 3TB0A 3RI9A 5AQFB 4IV1C 4K9SA 2AEZA 3DP7A 4U36A 4Q8KA 1VBE3 3B94A 2V4AA 5A80A 1MQTC 3FBMA 5HCBA 2DLRA 2W0XA 3ZIXA 5J36A 3CL1A 2VD7A 3ZMVB 4Q4Y1 1RHI1 5HXRA 2YPJA 3IKWA 3IAPA 2QA7A 4BQYA 4JEHB 2J1TA 5JR7B 4C0BA 3OGSA 4FPJA 3GF6A 3AEEA 4Q4X1 1W28A 1BEV1 1FOD1 3N2KE 1JUIA 5GLZA 3RYFE 2VASA 3KVAA 1WLXA 5FOBB 4WZXA 2YOEA
chains in the Genus database with same CATH topology
1MMDA 4HKAA 2V7KA 3DTOA 3I1AA 2LSIA 3WAJA 3ZPOA 4AQGA 4GYSA 4BJMA 4CCNA 2D2SA 4EZHA 4V2WA 5FYVA 4P0AA 3LK42 4HEAA 5EZYE 3HA4A 4V1Av 4DBQA 3GMIA 3UUXB 3AA7B 4CZZB 2YBKA 1MNDA 4IGUA 1Y64B 3DXTA 1LVKA 2JJ9A 3HR0A 5FYMA 3WI3A 5JDMA 2XMLA 4TV9E 5HAXA 5FYHA 5A7PA 4EB6E 1UX4A 1HG5A 4QXCA 4PNIA 2UXNB 5JREA 5IVEA 2KMFA 3DJBA 5M4YA 3LDBA 2Y48B 2P5BA 4TN7A 4H9SE 2V7JA 4HN9A 1HCIA 3AA1B 3BK9A 4X20E 2UXXB 3EDVA 2VK9A 4EXTA 3AA0B 2CXLA 3VU7H 3FB2A 4QWNB 4O4IE 2EHOC 3EUHA 3ANWB 3ZMUB 1G8XA 1LKXA 2XQYA 3RYHE 3ETUA 3ZLIA 4TUYE 3RH3A 2LSGA 2WBLA 4TZ4C 3V5UA 2W62A 4E4HA 4OYKA 5F2WA 1MMNA 3OPTA 4J2CA 4MHCA 5FZLA 4I4TE 4UELA 5FZHA 4YLHA 4BXFA 1D0ZA 2X66A 4WBOA 5FY7A 3RPUA 3UFEA 5F3IA 4NUBA 3CWZB 4URAA 4I55E 3ZMZB 5L2LA 3L09A 3Q2MA 5FZFA 3SS1A 3Q9DA 3O4XE 3F2EA 4DVDA 5FJKA 1Z0PA 3LBXB 3PDYA 3I9WA 3WAKA 4AXPA 2Y8DA 2IC6A 2XDVA 5A3WA 4CXYA 3IF8B 2IC9A 4UF0B 3GWHA 3U78A 4EYYR 5FZ6A 2EHOA 2GK9A 2WMNA 3UT5E 4MLKA 5F5CA 3PU3A 4ZOLE 1WYBA 5K4LA 3N2OA 4YFSA 1D1CA 4E7SA 2DWGA 2LHNA 2XAFB 1HG2A 5E0OA 4QXBB 4XDOA 5FYCA 3FBZA 1HF8A 3ZYKA 2W00A 5HWYA 4ISSA 2Z6EA 3MK7C 4H9PC 5FPUA 5IW0A 4XDPA 2X67A 3R84B 4ZI7E 3OYZA 1G73A 1IJ6A 2XASB 4IGPA 5FY0A 2H3RA 5FXXA 4CI1B 1O3XA 3IEEA 4A56A 3LK2B 4IE6A 3BQIA 5LG4A 2EHOD 5JRCB 4UVAB 3D0TA 2IW5B 3CKDA 3HL6A 1U5PA 5F32A 4O2AE 1MNEA 2CCQA 5FBJA 4PJLA 3L3PA 2E9XC 4WW0A 5IWFA 4H63H 3MZKB 3MJXA 4PFOA 3ZC0A 5IVBA 4ZI2D 3VKHA 4GD4A 3N9QA 2KZ7B 2KXPB 5JDFA 2OT7A 4IGOA 4EOZB 5FY8A 2V1DB 3E08A 4PK4A 2X51A 5EK4A 2GP5A 2YBPA 4AQFC 5AFUL 1MIVA 2ES0A 2Q9QC 2RA1A 4UXNB 5F8PA 4ERRA 5FZ9A 3M65A 3NZQA 3ZMTB 4UEMA 3NJYA 5IVFA 4CCKA 5GONE 2C5JA 3AAIA 5FYSA 1MMGA 2K48A 3N2GE 5LY1A 3FHNA 1MIYA 5BMVE 2CM0A 3UYJA 2JRKA 4YHJA 2N2NA 4CCMA 1YD8G 3N9MA 5F5IA 2YU2A 3QUJA 5FZAA 3K3QC 4EYUA 3KV9A 2IAKA 3PUAA 2JPFA 4PJMA 3F57A 5FPBA 5FZ8A 3RYCE 2CE7A 1WRDA 2L8KA 3VKGA 5FY9A 1US7B 5IVJA 2OX0A 2LEHA 3ZEFB 4ZI3D 5IVCA 3ZYMA 1D0YA 2W63A 2G0UA 4GK0E 1ZHCA 2ODUA 3N9OA 1IZNB 3KV6A 3CQCB 3K2OA 2I59A 5F39A 5FZGA 2C0SA 5FXWA 4DBRA 2CEAA 2XAGB 5KDMC 5FYBA 4D6RA 2KINB 3GA8A 3H37A 5EK2A 3C4ZA 4GK5E 3IBPA 3J9X1 5FYIA 4HGAA 2BVMA 3CMLA 4AKLA 3ZCJA 4IE4A 5HXSA 1LRZA 2CA5A 5L3GB 5JQGE 3NRXA 5JH7E 4YJ3E 4YJ2E 2WMOA 3PURA 3SWHA 5IYZE 3O1JA 1NAFA 2Q8DA 2K5BB 3HKDE 3OJAA 2W61A 2NW9A 3OYXA 5J2UE 2MOZA 2VKOA 2YINA 4X1KE 4TV8E 4AKHA 3LD8A 5LHIB 4IHJE 3CVRA 4V2VA 1YKHB 2A2FX 2DWKA 2PBIA 2OA5A 3PUQA 4M1PA 4CUGA 2ZM8A 5FUPA 4LXLA 2D0UA 3ZC1A 4PW8A 4DO0A 2XAQB 3SOLA 2VKJA 2PJQA 3GN5B 3AVSA 5EK3A 3DXUA 2LSKA 4K0UA 3PTRB 2Q8CA 3JC6D 4KMCA 5FPVA 5FY1A 5HWXA 2MTQA 5ANQA 2LJLA 2LOPA 5A3NA 4Y33A 3O1HA 3PU8A 2PG8A 3NZPA 2XHEB 2C5KT 1CUNA 5LBMA 3OBVE 3HKEE 4C90A 5KMGP 4QX7A 2BZBA 4KP3C 4UV8B 4XAXB 5TAOA 3K8PC 3RC8A 4GAZA 4QXHA 2XAHB 1ZEEA 2LT3A 4CXWA 5FWJA 4QX8A 2K9AA 3RC3A 3VHLA 2YBSA 5LGTB 2KWHA 2JMKA 4ZS3A 1WR6A 2CWOA 3C50A 5C8YE 4O4JE 5FZMA 4QHOA 5FJHA 5A7OA 2ACXA 3CQGB 5FWEA 3C64A 4L0RA 4BAYB 3ZN0B 1D1BA 5FY5A 5JR9C 2NWBA 1FMVA 4UVBB 2J1DG 4KUMB 5LOVE 5FUNA 4HOOA 4LIVA 4JUYA 3KBUA 3IHRA 5JRCA 2K24A 3KV5A 2X9XA 2WAUA 4X1IE 4PFPA 5KX5E 5A7SA 4BU2A 2PXJA 3QC9A 3N5LA 2QGSA 4ISTA 4H9RC 5A7QA 4O2BE 3BQKA 2XUEA 4QX7B 5IVVA 4EIWA 2LHRA 3NBXX 5L3EB 1B7TA 4NUVA 4BJNA 1UX5A 1OXZA 1D1AA 3NRYA 5A7NA 4QXBA 2ZM0A 3C4WA 4U74A 2P9BA 3RRCA 5FMNA 4P09A 1IAPA 2D5UA 2WSSV 3GN5A 1UCUA 1MIWA 4ILUA 4QWNA 1ZV4X 2CXFA 3F31A 2Q8EA 4UF0A 5LJNA 2N1GA 4C8DA 1FEWA 4FJOA 2WM9A 5LCYA 1BR2A 2JQQA 5LGNB 5LHGB 2DCFA 2NTYA 3LBXA 4L5GA 4TN7B 5HXCA 1FMWA 5LBQB 3T8OA 4Y3OA 3TKLB 5FNVE 3LK3B 3KINB 3PUSA 5JDGA 2WWUA 5A1FA 4EAHA 4CXXA 5FYYA 5FZCA 4I50E 2KLQA 5DQWA 5LY2A 2GP3A 4D6QA 3E22E 5FZDA 3B57A 4QKNA 5CEHA 4H63V 2XTLA 5FXVA 4CCOA 3MXZA 5FV3A 5FZIA 2ZMAA 3LJCA 4U72A 1YW0A 1BR1A 2V26A 5F3GA 4G2AA 3AL6A 5LA6E 5KR7A 4CI2B 1U4QA 2A3DA 2DI4A 5F3CA 4ZS2A 5FZ4A 3ANWA 2YEVC 2M67A 4GOUA 3C98B 4Z8XA 5FXZA 4AAPA 4AI9A 3N9LA 4GJZA 2LOSA 5FYUA 3B13A 2SPCA 1MMAA 2W2IA 2HPJA 2Y6XA 5JDNA 4F6RC 5FZOA 2OQ7A 4HONA 2ZLYA 4L9IA 4GJYA 4EZ4A 2DNXA 1X79A 4PK5A 4MFRA 4WNKA 3C51A 4IE0A 3KVBA 1SA0E 4KBMB 5ISLA 1VOMA 1KK7A 1LVFA 2NOXA 4PAGA 3ZMSB 1WYCA 5A7WA 4H9NC 5HXHA 5A3PA 3CX6B 5LW9A 5F3JA 2X0LB 2HPLA 3O1IA 2CXDA 5L3DB 3H3AA 1HFAA 4IE5A 3RRWA 1HS7A 5LJMA 4OYJA 5FPAA 4AI6A 3ETVA 5FPLA 1QUUA 3AAAB 3ESLA 3EVYA 4H9QC 4ANJA 4TX5A 2JMHA 5JDQA 3E0ZA 4ADZA 2VWAA 3C4XA 1YKEB 1IJ5A 3CX8B 5JR9B 5JVDE 3I0OA 5L3FB 4UIGA 4LIUA 5FP7A 1EZ3A 3AA6B 4AQFA 3KV4A 3CX7B 4HFVA 4IDZA 2D0TA 4DIQA 2L3LA 3K3NA 2OQ6A 1D0XA 2VKDA 4O8SA