3KV9A

Structure of kiaa1718 jumonji domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv9A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv9A01
5FYCA 3OPTA 4XDPA 2YBSA 5FPLA 5FXXA 5FZ3A 4BU2A 2XMLA 4TN7A 4Y33A 4ASKA 5FP9A 5F2WA 3LD8A 4Y3OA 4LITA 5FPBA 3PU3A 3NJYA 5F3GA 4DIQA 3K2OA 5FUNA 4D6SA 5F5AA 4V2VA 5FUPA 5ISLA 2OQ7A 5FZ1A 4C8DA 3ZPOA 2OQ6A 4LIUA 5FP7A 5FV3A 5FZMA 2XDVA 3AVSA 5FY9A 3DXUA 3AVRA 5FZDA 5IVYA 5A7WB 5FY4A 3KVBA 4V2WA 2YBPA 4CCKA 3LDBA 3ZLIA 3PURA 4LIVA 2WWUA 5FZHA 5LY1A 4CCOA 5FYTA 4CUGA 4IGPA 3N9LA 2VD7A 5FZ7A 5IVJA 4GAZA 2P5BA 5FYUA 4E4HA 4QXBA 5F3EA 5ANQA 5F2SA 5E6HA 5FZ0A 5FP3A 5FJHA 5LY2A 3N9QA 5A80A 3N9PA 2YU2A 3PUSA 2GP3A 4UF0B 5FZFA 5A7WA 5A3PA 5FZCA 3N9NA 5FZ9A 5F5IA 3KVAA 5F5CA 5FYHA 3KV9A 5FZBA 5FZLA 5FYVA 5FZ4A 3RVHA 3PTRB 2OT7A 3AL5A 5FZOA 5IVCA 3PUQA 5A7SA 4QWNA 2WWJA 4IGOA 3PU8A 5FZ6A 3KV4A 2GP5A 5IW0A 2OX0A 5A1FA 5A7OA 5FYMA 1VRBA 5FY5A 5FP4A 4QXCA 4UF0A 5F3IA 5FZEA 5FXZA 3U78A 5A7NA 4D6QA 5FPAA 5FZOB 2XXZA 2Q8DA 5A3NA 3KV5A 5FP8A 5IVBA 4CCNA 5CEHA 4QU1A 4GJYA 5A3WA 5FYYA 3AL6A 5FY8A 5FYIA 3KV6A 5FY7A 5FY0A 5FBJA 5FZAA 4CCJA 3N9MA 5KR7A 3UYJA 3OPWA 4Y4RA 5FYSA 3K3NA 2Q8EA 5FPVA 5FXVA 4LXLA 5FPUA 5FWEA 4NUBA 3K3OA 4BISA 2W2IA 5FZIA 5FXWA 4XDOA 2OS2A 4AI9A 5A3TA 5F39A 4AAPA 5FZKA 4EYUA 5IVFA 3PUAA 2YBKA 5LWBA 4DO0A 2YU1A 4QXHA 4CCMA 5A1LA 5FWJA 4EZ4A 4IGQA 5F32A 5F3CA 5FYZA 3N9OA 5A7QA 5FZGA 5FZ8A 3PDQA 2XUEA 4GD4A 5F37A 4URAA 2PXJA 2YPDA 3DXTA 5FYBA 3U4SA 4BXFA 5IVVA 4EZHA 2Q8CA 5FY1A 5K4LA 4CCLA 5LW9A 4HONA 4QX7A 5IVEA 5FJKA 4D6RA 4HOOA 4CSWA 4QX8A 4GJZA 5IWFA 5A7PA
chains in the Genus database with same CATH superfamily
4IV3C 4CEWC 4EYYR 4Q4Y1 1XXNA 3NQHA 1CN1A 2C4XA 2QBXA 4D6SA 5AVAA 3L8RA 5JCTA 5HCFA 3UT0A 3KBUA 1ULEA 2OKXA 1PVC1 2TNFA 3ASIA 1CAXA 3VBUC 3I59B 2EA7A 2CE7A 5FBZA 3FHIB 3J7MA 4PDWA 1H6XA 5T55A 1W0AA 2WZPP 4F8HA 1TME3 4HZFA 1MR5A 2BV4A 4AQYT 5EYYA 2CSGA 3C98B 3O12A 2UXDT 3I2GA 3I2DA 2X9YA 3AP7A 4NXMT 4YJ2E 4RS5C 1HCIA 1WKYA 5FPVA 3ONJA 1QJEA 3JQWA 5CYYA 3VZNA 5HCBA 3MV01 2OYZA 4AQGA 2MEV1 2LRPA 4UBGA 3ZFEA 3UQ7A 2XASB 5HXHA 1UY3A 4OYKA 1VBA2 5BYNA 2E6VA 5C8YE 3RZKA 2YYOA 2ZEWA 5GZEA 5GZGA 3RI8A 1F15A 4O4LE 2PHUA 4Q0QA 1C8M1 4MH0E 3I7DA 1R082 1UQXA 1T98A 3B5MA 5LCYA 2A6ZA 5IYYA 3VBHB 1EAH3 4LUMA 2Z4FA 2JIJA 5KHKA 4M01A 5FLJA 1UZWA 3POWA 3C3VA 1AUYA 4QXKA 2NOXA 3PJAJ 3ATGA 2WUHA 1NQJA 2V6XA 3BTZA 2Z6EA 4P9YA 4AI8A 2W1UA 3LPFA 1JZ2A 4IDPA 3ZKRA 3H3AA 2YN6A 3WI3A 3MW3A 1YQ4A 2BERA 1RUH3 3KSCA 1QJU2 3U3IA 1N36T 2LW8A 4Y5SA 5FXZA 3N7LA 1HV1A 4FP2A 4AEMA 5DMYA 3FUOA 5HXCA 1CX1A 4IDZA 4TNWA 4EOZB 4G9SB 3MGUA 5H9SA 4GOUA 1JUIA 2AENA 4HWFA 4B3TT 1FATA 5FYBA 4UW5A 3OUIA 2NZ9A 1SBFA 4YG3A 3IB3A 5B2GB 4AAXA 5FXXA 1TVGA 4N53C 3Q5XA 2X9XA 3ABVA 2PQSA 5J7MA 3RGBA 1IGOA 3I3QA 5C7GA 1YXWA 1RUG3 2CGNA 4ZU7A 1U5IA 3O14A 3LEKA 1D2SA 4ORFA 1YFWA 3ZLIA 4JDOA 4EAHA 1XZYA 2VD7A 4IGPA 4PBPA 3E08A 4UFLA 2F4LA 4IE6A 3N9NA 4META 4D69A 4ASMB 3OJAA 4HWIB 2ZX1A 1ZRDA 2BVMA 3HBKA 1OHFA 1WW4A 5FZEA 5C3OA 1KFYA 4DFSA 5FYIA 3UU6A 3VDCA 1R1ZA 2R043 4XBQA 1F4HA 2D6PA 2NW9A 3MIFA 1A8DA 3GN5B 3J8F3 2ES3A 3BN6A 3HT1A 4XJZA 1L7QA 1RXFA 2G9FA 2VU9A 5CFCA 1QJY3 1CVNA 3I9WA 2BQPA 2CL2A 5HV4A 2WAOA 4JI8T 3D0TA 4U33A 4PCRA 2Q9QD 1MVQA 4BA9A 4RA0A 3CX7B 1OKQA 4ASKA 5C3PA 2Y6HA 4XAAA 3C7OA 2J1AA 3CJIC 4XUTA 3RNSA 2Y8DA 1W04A 4RYDA 4ZI3C 2BYVE 4UXAA 3O1TA 3F2ZA 1KNZA 1WLXA 2RR12 3AE3A 4COFA 4QQPA 2H6BA 5J1XA 3GYDA 2W08A 3ESLA 4YTMA 1HJFA 4W8JA 1RMU3 3I97A 4Y1ZA 1OQEA 2A7AA 3C8XA 2ARBA 1SLAA 2VW2A 3WP3A 1E2AA 1X79A 1S35A 2VE1A 2NM1A 4YGBA 1SLBA 4ZI7E 1QJX1 4D6QA 5ERLA 4OHYA 1GV9A 4KWUA 1JN2P 3M4FA 4KU8A 4BPZA 2XOMA 3BKZA 3CQOA 2VZUA 2VUCA 1F9KA 2W2IA 4P1NA 1YUDA 2ZGPA 4M3CF 4E9KA 4UXNB 3ZR6A 3LOIA 2FZ2A 3AECA 2W95A 1WCSA 3QBQA 1O5UA 2R6QA 5F37A 4URAA 3TEZA 4HK8A 2CDOA 5LCWL 2YROA 3POJA 2N2NA 4Q2FA 1Z8UA 4QGNA 4MGQA 5B4NA 5LYJE 3UTKA 2CBJA 1XRUA 2JDPA 1FMD2 4Q4W1 3PDYA 5GONE 4XQWA 1KNRA 2IUWA 1ACCA 2VZRA 4IV1C 3PUVF 5C4WA 4E4DX 1V9U3 3CX8B 4MGSA 2LUWA 1RUE3 2VOKA 3WX5A 2HHHT 4S2HA 4XVHA 4DV5T 1LOFA 2JG8C 3ZYIB 5AFUL 3HD8B 4B4RA 2JICA 5JMCA 1NY72 3IMMA 2XSAA 4AVCA 4M0HA 1QNYA 3OCPA 4YSFA 4CI2B 3OYXA 3IPVA 5HAXA 1G9CA 1ZZ6A 3FC0A 1HQNA 3W5MA 1C5IA 2AH2A 1COV3 2X5IB 2LALA 2D93A 2HEVF 5CJ5A 3UGGA 2P2KA 3CMGA 4FTEA 4I2OA 1ZBE3 4AVBA 4LF9T 2GC1A 3Q2MA 5AQKB 2HWE1 2WNVB 3ACLA 1AR93 2IZWA 2PLV2 4CDUC 4WBNE 3WR0A 1W8UA 2FJBA 1XNQT 2Y6KA 3RC3A 2P4EA 3ILFA 4XUOA 4HWCA 1ND3C 3M3EA 2C9KA 2OQ6A 1UX5A 5JDGA 3VRAA 4QPGA 1SE7A 4HANA 4CCKA 1BR0A 4GYSA 1GNYA 4YG6A 3PJAA 2AUYA 2XM1A 5EZYE 4QX3A 2V5DA 1L0VA 5FKYA 1GZWA 3L2YA 1LHOA 4GKJT 4DMVA 2GDFA 3AKTA 1BKZA 3QH7A 4N43B 3KV4A 1O91A 4FI9A 4CDWC 3ZFGB 4OI2A 5JR2A 2B1EA 4I09A 2CWSA 5LXTE 3T09A 1YQCA 3P1IA 2Q9QA 4DMIA 1BVP1 4Q4X1 2XAQB 2QQWA 3ZJ1A 2ZGQA 2VKJA 2X29A 3HQUA 3UJQA 5L4EA 3FXDB 3RC8A 4JUYA 3V0BA 4QXHA 4FFGA 3VBOB 3EHZA 3TEWA 2W61A 5JOWA 2OZJA 4DV2T 2L9QA 1YYNA 2HBTA 1BR2A 2NP0A 4IDOA 4AL9A 3LA2A 2CMRA 2TUNA 1JZ3A 3ZYBA 4A7ZA 2J47A 3N7JA 1C4RA 4QPIC 4LO4B 4Q29A 2FMDA 1XDPA 1VE0A 4AHYA 4FVVA 3GXUA 2H88A 4FOYA 5EP9A 3D0SA 2VOVA 5FK7A 2XWJB 1H8TA 1G9AA 5E8AA 3ZN1B 5FZ7A 3V0AB 1JS9A 2HEYF 3SQOA 3NRXA 1QDCA 3NBXX 2VR4A 1W2TA 4PNIA 1BXHA 3TAYA 1R083 1REEA 1X8MA 2NMOA 1H1IA 3UU4A 1VB2A 4ZI2C 1IKQA 4QAWA 2VY0A 2QQOA 1SFNA 5KXCA 1AJKA 1GYKA 4IQPA 4XQ4A 1UL9A 3DL3A 1H30A 2A6XA 5A3TA 3BI3A 4PDWC 4P0AA 3OG2A 5F3CA 3ACFA 2FJAA 3ENRA 5IYZE 5BNOA 1QJU3 2JDYA 3OD4A 3TN91 2WFPA 2AR6A 4A44A 1VBC2 1FMWA 2ARCA 4AGGA 2XQ3A 2VZQA 1W8TA 1R092 4FPEA 3KQ4B 4LMLA 3HIFA 3H3LA 3ZFEC 1W8HA 5FY9A 3NV4A 4IEUA 4ES8A 1QJZA 5EYXA 4H2AA 2RMU3 2DCTA 2VZTA 3VDBA 5FP3A 2PYTA 2RDRA 1UGOA 2JDMA 3RFRA 5AQFB 1N34T 3LE0A 4IV3B 4HPKA 4CEWB 5LATA 2VG9A 2W46A 2RM21 5KXBA 5LBEA 5ETWA 2D9DA 5KC5A 1TE1B 4LBMA 5FYMA 1YFYA 1UY1A 3GCWA 2VL0A 5A3WA 3VHOA 4IEZA 1VLNA 1WYBA 1JZ8A 3VZLA 2RJKA 3GF6A 1JXNA 2ZABA 3VBUB 1A8MA 4AI9A 3TYJA 3T1LA 2WSSV 5L4HA 4AFBA 3ONXA 2R061 3LK3B 4HN9A 1NCQB 3SEEA 1MS4A 4LHNA 4ZHQE 1WBLA 1SCSA 3IWZA 3Q8EA 5FPXA 4GK5E 4UFJA 3NNFA 2QVAA 3LOBA 1AXYA 3AJYA 1AR62 4ZHNA 3U14A 3GWHA 2E63A 4RS5B 3FL7A 2DHRA 3PTYA 1ZZCA 1RUF2 1FV2A 2BVVA 1GFF2 4FI5A 4LK6A 4XJUA 1NYWA 1MIWA 4O9EA 5FZHA 4U7YA 2R6GF 3VRBA 2IHR1 3I9YA 4UOJA 4BB3A 2NPIA 1KD7A 2JENA 1LOCA 4LF4T 3AKSA 2QUOA 3F95A 5FZ9A 1JYNA 3INAA 1VBA1 2FZ1A 1YFUA 3TEYA 3ZEFB 4H9SE 3H42B 3KHCA 5J98B 5FRAA 4EN7B 2RR13 2W0XA 5FBJA 2WAUA 5A33A 3RHWA 4XYXA 1F4AA 4IW3A 3FZHB 1J1LA 3UGFA 1CGPA 3L2HA 1URXA 1POQA 4XCAA 4MXVA 4U36A 2VQET 2QZ3A 4Z8BA 3FE5A 5A6YA 4X1YE 3IAPA 2ORZA 5J2TE 3OGSA 4XZUG 2PHFA 5FYCA 1W9WA 1W6MB 3FLTA 1K42A 4LR4A 2WP9A 5CFCC 2DVGA 2RS52 2W1QA 5FY4A 4V1Av 1W0BA 3N9LA 5FLHA 2LOSA 4IHJE 2C26A 3C7GA 4ANJA 4LKEA 1NZCA 2VZ3A 1WW5A 3TEXA 5HPOA 4AE2A 1S4CA 2ZGTA 1FMD3 1LRZA 1TQ5A 4YSXA 4CDXB 1FX5A 4Y20B 2A9UA 2OVUA 4NWVA 3VDAA 1RUI2 3KV6A 4A4AA 4MV2A 2ODVA 4Q4V2 3ON7A 1OXZA 3UGHA 4TSVA 4EYUA 5IVFA 1N3QA 4WBBA 3NV2A 4K6BA 4H9NC 3AJZA 1XNTA 4XMAA 3T30A 1HTJF 4CXWA 5DQWA 5LBMA 2VVNA 2YPDA 4JKKA 2CBIA 4PIYA 5LG4A 2RS13 5FJKA 3CMLA 4IEXA 4P02B 4MXWA 1WLTA 4R8HA 1W09A 2IXLA 4HT1T 3CHXA 1UIJA 1LVKA 4KNCA 2XLAA 4PAGA 4HFIA 3O1RA 2LKGA 5FUPA 3ZPOA 4RGAA 3FX3A 4UVCB 4JKMA 2P3KA 2P3IA 1W6QA 5HCMA 3MI8A 5LB7B 2V8SV 2WWUA 2HYXA 1GU3A 3HNBM 4X8NA 2PLV3 3WF0A 1NXMA 2IWGB 2VUJA 1XDOA 4UVBB 3ZYKA 3CJIB 5HCJA 1GZCA 3E6DA 4HK9A 3UKNA 3HJRA 1IBKT 5C4WC 3QUJA 1W2AX 3J7HA 2WSUA 2VVFA 2B5HA 2MYSA 3N7KA 3C4WA 3KS7A 2XHEB 4QHZA 2DUPA 4Y26A 1YIFA 1LOFC 3RWKX 4Q0UA 2ZEYA 5C6CA 3RGLA 3GDBA 4OUEA 2CM0A 5IVEA 2IC9A 5ACA2 1K3IA 3T8OA 4CDQA 4CP9B 1UURA 1QU0A 1X9TA 2V4AA 4HL0A 4Z92B 1BJQA 3A0KA 1BK1A 4I0WB 3LJCA 5DQVA 2P37A 3APBA 3LIHA 1YLLA 4LLOA 2EHOB 4EN9B 3WW2A 4LNVA 5DZEA 4MX3A 2HJIA 1CPMA 2DI4A 1NA1A 5L3BB 1Q3EA 3JD72 1S0IA 5JRCB 2JWPA 4XC9A 4L92A 4K21A 2W92A 1VPHA 1LGNA 2W9XA 2X8KA 1PIV2 5CA6A 4DV6T 4ISSA 1MVEA 3ZSJA 5CEHA 5GLTA 5FY7A 3I2KA 5DAPA 1JMUB 3GJBA 4OULA 1EPWA 2BFUL 2OIIA 4QPGC 5I0TA 4Q0VA 4IV1B 3U07A 1AL23 1E5RA 2I0MA 3GMIA 1H4HA 2QQKA 4NOTA 2WDVA 2JG8B 4XF1A 2VC9A 3K77A 4YW3A 1WRDA 3DPRA 2J62A 1MIYA 3HKCE 3LA3A 4NUUA 4DRVA 2VBBA 5LNKA 4GWJA 1L7LA 5IHYA 2VO5A 4D6RA 5JLVA 5SV8A 1O4TA 2X66A 2WDRA 3R05A 3EXUA 4X1IE 4TV9E 2Q9QC 3AE6A 3P3NA 2UXXB 1NY71 3LF7A 3ZC0A 4OYUA 1N1VA 4DIQA 1UMIA 2ZS6B 5FO8B 3KWVA 3PUHA 2CXLA 2V1DB 1VALA 2BS4A 3N2KE 5C33A 1IZ3A 4LKFA 5FO9B 4W6YA 4I50E 5T54A 3VKMA 5FZ0A 3ZXAC 3D4KA 2BJSA 1VBC3 1H1AA 4WVMA 4RQPA 5AQUB 1UW8A 1R093 3PUQA 2VECA 3SS1A 2VULA 5CA1E 2NTYA 1ND3B 1UMZA 4PLOA 1POV0 3U37A 3H9AA 2X9HA 1JI6A 1H8TC 5FZAA 2XJ7A 2FJDA 5KR7A 3OTFA 2X9WA 4E7SA 3KLSA 2OUJA 1A6CA 1D4M2 1AYN2 1MS8A 3MUY1 2JB4A 2BZDA 2D7FA 4PJMA 1H8VA 2VW1A 1W6NB 1BR4A 5L3DB 4CDWB 1I3HA 4JI2T 2JMHA 3TNPB 5DDJ1 4HOOA 2IFRA 5LA0A 1V70A 1PGL2 3I49A 1NOVA 2E53A 2XQ9A 4LPLA 2XJRA 3ETVA 2VCCA 1D1AA 4J25A 3OY8B 5F7UA 2VKDA 4YFZA 2CEAA 2WYSA 4K8FA 1ZBA1 5JSRA 4XF0A 3IDBB 4MGYE 5BNOC 5C8WA 4FPLA 1RGSA 3O0XA 3ZSSA 3N9QA 1QLBA 2XBO2 3LDKA 5A7WA 1AR63 4H3WA 1O8SA 5FZ4A 5DUWA 2VB6A 1F8VA 1FNZA 5JI7A 1KNPA 3NKZA 1OA2A 4QPIB 5FY5A 1DP0A 1RUF3 1V6OA 1V6JA 2R16A 2YEVC 1S0EA 2FCVA 4OZXA 4XW3A 1VB4A 1X9PA 2FDIA 3HN1A 5CB4E 4DO0A 2XKOA 4H9QC 3MO4A 1KFXL 5ABFA 2XJSA 1ND2A 4QX1A 2E9QA 3IDCB 4ZU4A 5C5UA 2CLYB 4LFCT 4B8EA 2Q30A 3B02A 1CAXB 2AACA 3RKGA 1W6PA 1APNA 4PDWB 1NUKA 1RUD2 3LDBA 2RS31 4DPNA 3FZLB 2E7AA 2FDJA 2PA7A 5F2SA 4GWMA 1S55A 2CYFA 2JDAA 1JU3A 4XJAA 3HI2A 1W9SA 2ZHNA 2VVSA 5IVCA 3ZYLA 1RHI3 4W4ZA 1Y9QA 2KINB 4C1WA 3AE1A 3MACA 3V65A 3RIAA 2RS53 1GKBA 5DN2A 3GZTB 4CXYA 2CU5A 5DJQC 3RZLA 2DCZA 3POFA 1MPXA 2E26A 4AAPA 2V5YA 3ZVXA 5AQIB 5JSOA 2LOPA 1GICA 4NIAA 5FL1A 3U0ZA 1HXS3 2VTXJ 2BG9B 2XPJA 1XSRA 1RUI3 1VBD1 4AVAA 2QQMA 4LE4A 3PV0F 4JHZA 4OCTA 4QX5A 3RYFE 2UUAT 5A3LA 3IZOA 2WZHA 4Q4V3 5FP9A 1D2QA 1LOAA 4RHV2 1ZRRA 5CADA 2HWF1 2VPVA 5A70A 3LEMA 5JSPA 4JBWF 3AFKA 1H2NA 3M1HA 4QPWA 4LHLA 2NW7A 3KGZA 1H2KA 1PMIA 4IDNA 4ZXLA 2W67A 1OD5A 2X05A 2WBLA 5A7OA 1OLQA 4RR3B 4MUVA 4CXXA 2BBVA 1VAMA 1DGWA 4TWTA 4L5GA 2GAUA 1HR0T 4M0NA 2E2AA 3VD4A 1ZZ7A 1NWMX 2B7YA 1LOBA 2WO2A 5LG3A 2UWCA 5FDBA 5A6XA 1E57A 1AJ3A 2V7LA 2ZMAA 4EV6A 1H9WA 2CPTA 3VHRA 2JMKA 1FXZA 3NRUA 3UU8A 1EV13 2CCQA 3ZN5A 1ZRFA 5HEHA 1BBT1 2EIGA 4SBVA 5E0OA 2ZJCA 4KGQA 2BS3A 1S1AA 4GMP1 5HCHA 4EQVA 4YM2A 2XVKA 3RPUA 5EJZB 1YCIA 2ARAA 4V2WA 2YFUA 3S5AA 3MHZA 2ERFA 2CA5A 2CHNA 5C3SA 2YDRA 1MMDA 2VBPA 2DV9A 5ACA3 3H3MA 5CKNA 4PK6A 2DURA 1R1A3 4WV8A 1J59A 2F4VT 5JI9A 5T5JA 2KM2A 4UW6A 2IIUA 3X1DA 3J4UH 1GUIA 5CFCB 4NUVA 1DYPA 4CZZB 4B29A 4OHFA 2XUMA 1LHUA 3JBG1 3RI5A 3JD73 5LJMA 3ABZA 4B7KA 1QF3A 5DQ0A 2LSKA 3BIEA 1AJOA 2VCBA 2QVSB 3KZ4C 3M3IA 4I30A 2VKOA 3VD7A 1UX6A 2ZM0A 2Q8OA 4O2BE 5FTTC 3C64A 4BMBA 1PIV3 4XAEA 2UU9T 4GKKT 4XFGA 1UY2A 3N3HA 2XONA 2B8MA 3ZYHA 4Z2AA 4PQ9A 1GZ9A 2FHRA 4S2DA 5HXEA 3HA4A 4HGAA 4XXPA 2M67A 3OUJA 4GB33 1H7CA 3T0DA 3RZHA 5E89A 1NENA 2JIGA 1QXPA 1ZA7A 5AQTB 1Z0HA 1OT5A 5D8AA 4CDQC 2YZ4A 1W8NA 1GNHA 3WZ1A 2OT7A 2B46X 1JZ5A 5BNNA 5JMOA 1YRZA 2CTVA 4BIFA 4HWHA 2HBUA 3VLBB 4QX2A 5DZGA 4LJHA 3HKBE 4JTOA 1LVFA 2JE8A 4B3RT 4E8DA 1NA1C 5FXVA 4JDNA 5A3MA 1KEXA 4FTBA 3TKLB 1W6OA 4AI6A 3T2QA 2IFWA 3M3QA 3CQCB 2XJQA 4JKLA 3BU0A 2J22A 4CUCA 2LT3A 4CSWA 5G05L 5L9VA 3NO8A 3QD6A 2XQRA 4QQ2A 5C4WB 2LEHA 1RVF3 3LD8A 2A6YA 1AYN3 2LKHA 2VTFA 1PO11 2MAWA 3HVDA 2K46A 5FZDA 4U72A 1AX1A 4GIQA 3D6EA 2WT0A 5IK5A 4L0RA 3DPRC 4RD7A 3VV1A 4QH5A 2I59A 2NQYA 3WDXA 2UXBT 2PTMA 2ZX3A 5FCCA 5CB7A 2A75A 5E6HA 2DCYA 4N43A 2MOZA 2DTWA 3PUSA 1RTVA 3T08A 3FZKB 3ZFGA 1VRH3 3CBNA 1UXZA 5FYVA 4YYOA 2D97A 2DCKA 4AWDA 4P9WA 3LK2B 3O1PA 3NSTA 3CEWA 1XE0A 3MICA 3T0BA 3ZXGA 4ILBA 1C28A 1NLRA 5FYYA 2WT1A 5J1GA 5FY0A 4DQAA 5JDQA 3OGJA 5B4XA 3CPZA 4LXLA 4CEYA 2GU9A 1LTEA 3AA7B 2DVBA 2GN3A 3S5QA 4E2QA 4BLJA 5JVDE 1T6GC 1NE4A 4YSZA 5HV0A 3VKOA 3NRYA 3OEBA 4RQPC 1GQPA 2V7IA 1DQ1A 5L9BA 1SZBA 4OFZA 2C5IT 1YFXA 2FD8A 3VKFC 1EZ3A 2XLFA 4QPGB 1LHNA 1MMGA 3ZYMA 1UAIA 1VIWB 1RIRA 3V0AA 5FO7B 1GZWB 3OF1A 3SH3A 2EXKA 5KXDA 2WJSA 3VBSA 4Y22A 1F5FA 1F5JA 4MADA 4OVEA 4LLFA 2OPWA 1W0NA 2VKHA 4KBBA 2Q9QB 2XAJB 4LFAT 2PBIA 4MLOA 1WLCA 4CU9A 1IS6A 2E7TA 1LEMA 4CP0A 3MBWA 3V0BB 1KF6A 4QXHB 1JYIA 1RUD3 4AQSA 2YDSA 5IAXA 2C9AA 3ACGA 3AMPA 4W65A 1QOSA 3BQLA 5A6ZA 1AR72 2CGOA 3BPZA 4DVDA 2BNOA 3JAFA 1MS1A 2Y8KA 1BMV2 4N78D 1JOJA 1PZ9A 3OBZA 1DYKA 3VD3A 1G6NA 3Q5WA 4UAPA 4YZ3A 4B1LA 4YLHA 2SLIA 3HR9A 3RKOA 2LROA 3J9SA 2ZACA 4AEJA 3PVBB 3WHUA 1S0JA 1LHWA 5L2LA 4FPFA 3NZQA 5LBBA 3ES1A 2ZHLA 5EJ1B 5H6QB 1ND2C 2HWD1 3VZKA 4MZUA 1Q8QA 2C1FA 3CX6B 2P17A 4ES9A 4N9IA 4QXBA 5L73A 1D4M1 3HKEE 4MO3M 2ZKNA 4HKAA 2GH2A 4CTEA 3PU8A 3ZXLA 1D0XA 1W9FA 4BWOA 4XFCA 2ZZQA 1DZQA 4HKLA 4ZZ8A 2Q8DA 5LEKA 4WVZA 4RHV3 4XILA 2WZR2 4Y4YA 1AVBA 4CP2A 1AXZA 4Y4RA 5LHHB 4N90A 4PF5A 5BNOB 3S4UA 1NCQA 4NIDA 1GANA 4XBFB 4BQ4A 3PVNA 4IEWA 4GH4A 4DXZA 5FYZA 1ODNA 3Q9OA 4X6QB 4PFOA 1GQEA 1HRV1 2N7GA 2XLGA 4X8PA 5D1IA 3USSA 1I5PA 5EK4A 4DR5T 4Q26A 2WRAA 2XBO1 4XE9A 4HFVA 2W0GA 3DEMA 3WF2A 3OD0A 3K4DA 2QJVA 2AXDS 2XDVA 2AYHA 3AKPA 1E5IA 2PAKA 4BH9A 2FDKA 3OJBA 4KMCA 5F9TA 5F3EA 1EYBA 1WMXA 1KRIA 5FZCA 3AP4A 3K48A 2OLTA 2D44A 3IMNA 5CG8A 3EBRA 3I2JA 3MK7C 5A1FA 5D2AA 5LRRA 5FAXA 3NJZA 2BKPA 1FI2A 3ZX7A 3KBTA 3FBLA 2K9ZA 4L8QA 4HEAA 1UPIA 3AAIA 1Y01A 1SEFA 1A34A 1C57A 1CESA 2LM2A 5DAXA 1VMFA 2WA4A 3EYPA 2VQFT 1JYTA 1ZNPA 2BG9E 2CAUA 2D40A 1H2LA 4MGKE 3R4UA 3H8RA 4YTPA 5I0SA 3VL8A 3O9XA 3C2UA 1DQ6A 3W58A 4LTAA 4BQYA 2HN1A 2Z69A 3ANWA 3MZKB 3SFEA 5J0ZA 1AYM2 2WY2A 1CPNA 5IHRA 2XTLA 1UU5A 4LMJA 1YKHB 3ILNA 4GAZA 1UOFA 4HFCA 1O7FA 1XMQT 3D0JA 1AX0A 3ZXJA 4FFFA 3KVAA 4CDXA 3RJRA 1W2UA 1UNBA 5A33B 2JD9A 2WNUB 2UXNB 3U78A 4NRQA 3ZN0B 3ETQA 4Z2WA 4P5YA 2OA2A 5F3JA 4FSJA 3H3ZA 4Z82A 4ATEA 3VU7H 4OI4A 1SBEA 3IBMA 1RUH2 4LF5T 5FMOS 2LM3A 5JDFA 2W47A 4E2SA 3IIIA 1PK6B 1LKXA 4NPPA 1MZ6A 4QX8A 4GJZA 3JB4C 1JYVA 3P4RA 3H7YA 2BWCA 3CZUA 1XQNA 3H37A 2VW0A 4R9CA 2PFWA 2KA3A 1ZOYA 3ZMVB 4JTNA 1RINA 1QNWA 5AQJB 1OUXA 2XB6C 5FZMA 2SPCA 3QOPA 5E88A 1NEKA 2GP3A 3VDDA 3W20A 4QKNA 2ZM6T 2ZTNA 1KITA 2XSBA 4AGRA 3Q8CA 3ZPYA 1YHFA 1HNZT 4J1WA 3WINE 4ILUA 2VCMA 4RL7A 5C71A 2K9AA 1I94T 4JLEA 2YG0A 3CO2A 1KS4A 4KI0F 3G06A 1ULDA 1YJKA 3OTOT 4AF9A 1W28A 3UUMA 1OURA 4YVSA 1OPOA 2VGDA 3WQ0A 3AEBA 2WR9A 1UXXX 5D8AC 4O8SA 4MXWB 2YC4A 4Q27A 4AFCA 4ERRA 3AYAA 2A6VA 4JHTA 4DEQA 1BEV1 5BNNC 5J09A 1AR81 2UUBT 5CU1A 1MZ5A 1UOBA 3RQUA 2Y0OA 3FZFB 4AKGA 3AE4A 1W6QB 2EHOA 4ATFA 5FMCA 5L7OA 2IUBA 1WFDA 4RFRB 3LG7A 2M6BA 3HR0A 4XACA 1WCDJ 1HIXA 3EB7A 4YPJA 4TX5A 4WNKA 4YZ1A 1W2NA 5BNQA 2V7MA 3RH3A 3EVYA 5LK7B 1UCXA 5FOJB 1BBT3 1I6ZA 5F5CA 4P14A 3B94A 3QLQA 4EWAA 4YZ4A 3NAPB 3BQIA 2UURA 5DUVA 3PJQA 1DGRA 3JADA 3L09A 2IXCA 1SDDB 4QQHA 2JPFA 4RFT0 5H6RB 2LM9A 5A32A 4ZY9A 5FVKA 2TEPA 4YW1A 4AKIA 2PHLA 3ZMTB 3LFIA 5HYAA 3SITA 2WS91 4IIJE 4N43C 5DABA 4AQ6A 1XC6A 5IAVA 3ZFGC 1OQDA 4CDQB 5ABHA 1FOD2 4K20A 4ZXEA 5JOXA 1PZ7A 4AVSA 3W9AA 1ZHCA 1HQWA 3GJAA 3MLLA 1CIWA 1Y64B 2IW5B 3WUCA 5LRSA 1WR6A 4BJNA 1UZ0A 5GLZA 5I93A 4CEYC 1U5YA 1NA1B 2HWB2 5FIXA 2WO7A 3JQXA 4G3YC 1AR73 1OQ1A 3UNPA 3QACA 1CZTA 2YFZA 2J1SA 2RDSA 3OBVE 2WS3A 1JNRA 2XJTA 2KNDA 2WIIB 4XCBA 4NXNT 1YO8A 3HWJA 4HE8A 4IGOA 5FZ6A 3D5OA 5GLWA 4DUXA 4YW2A 1CR7A 3WF4A 2QKDA 3IEEA 2UYBA 3KT1A 1N1TA 4CA9A 3DPRB 4IEPA 4KX6A 2MPKA 4PBOA 4OQ9A 1RUJ1 3VBSC 2CWYA 1W6NA 4HFEA 4YW7A 4EE2A 3JUUA 2YXSA 2UWAA 2HWC1 2E5LT 3NVOA 4YLZA 2EALA 3WG4A 1PNFA 2YMZA 3LEGA 3ZYRA 2I6HA 5K4LA 2V73A 4BYYA 4FPGA 5LW9A 4QX7A 2L9LA 3CLPA 5FMBA 4XPVA 5CISA 3D8CA 3RS6A 1K5MB 2WZR3 4M3CA 3UK9A 3ZC1A 4W6XA 1COV2 2GMEA 2VURA 4Y3OA 4TZDA 3POSA 4LITA 3P50A 1LB2A 1IS3A 5AQNB 1ONAA 4IE5A 2WCAA 1AHSA 4WVMB 2B39A 1TMF2 2AC1A 4JYAT 1PMJX 4L9IA 2B45X 2E9XD 4JV5T 5LY2A 1H4GA 4JAAA 5I0UA 4FPCA 4UWDA 1U0AA 1V6LA 1XE7A 3NVCA 3KCYA 3L9JT 1QJFA 3M2MA 5AC91 1WR0A 2NW8A 4LBNA 3BK9A 1XWMA 2GK9A 3SISA 2WLQA 1LOGA 4LBQD 5F6KA 3VBRA 3VD5A 3DF0A 2QE3A 1ODMA 5KX5E 3ZMOA 3WDUA 2J1UA 2ATFA 2AGSA 1VMHA 5BMVE 1HNXT 4A45A 4UFHA 1QQP1 4XUNA 4KMQA 3ST7A 1WA6X 1ASJ2 3AZZA 4Z1VA 1IS5A 1J5ET 4NIGA 4FQZA 5L47A 2CNAA 2EAKA 3P4PA 1D1BA 1N32T 1YQ5A 1NCQC 5JAXA 1W8FA 4GH4C 3MLKA 2PAEA 5A7WB 1KS5A 2R32A 3P7IA 3I2FA 2GNBA 4AISA 4DV7T 3RZGA 5D21A 3M7AA 5FZFA 1W9RA 2UWBA 5A3PA 1ZYBA 1HX6A 3SKVA 4YTNA 4MOAA 1AYM3 1W90A 5IWAT 3CU7A 4EWEA 3S0MA 3N2GE 3VR9A 4YZ2A 1OSGA 4I3GA 4WZXA 4XMIA 2H3RA 4FO9A 5ABFB 3ZN6A 2RDNA 4A6OA 2HPJA 1ND2B 3JB8A 2GN7A 1H1MA 2J42A 4DXRA 2JKXA 4O4HE 4U2ZA 3WQ1A 2DYCA 1W05A 3Q8FA 2VOXA 5CG9A 4AHZA 3NV3A 2BG9A 1RUC1 1XNAA 3AYDA 1V6MA 4AKLA 5JQGE 4BCUA 4E8CA 3QNUA 1W6PB 5APAA 2JE9A 3AXEA 1Y9GA 3MF9A 1SFYA 2VQAA 4AVTA 4XAXB 1RJ7A 1YXRA 1QSDA 1FPN3 4AHXA 1Z7S3 5AQGB 2Q1MA 4C1XA 1LAJA 4XEZA 5FLIA 1XNRT 4LOSA 3K8PC 3ZCJA 4TUYE 1NQDA 3E6BA 4Z91A 3TWIA 1UYPA 1XOYA 3KDSE 5IVJA 4NWWA 4EEBA 1YQ6A 4OUSA 4FBFA 4FFHA 1IBLT 4YGEA 1OF3A 3FHNA 4RR3A 3K4ZA 1CAUA 4DY5A 1DZRA 2ZGKA 3VUOA 4NRPA 3KF5A 1JU4A 5KWRA 2VZ1A 3M8LA 2R071 1UKGA 2GMPA 2RMU2 1VMJA 2VNOA 3OPWA 4S2GA 4E2GA 3LB9A 4MGZE 4PJLA 1Q8OA 1SDWA 3LIGA 5FZKA 2ACXA 1G73A 5JXIA 3EHKA 2JQQA 4CDXC 4I43B 4AOCA 2WFF1 2PMWB 5LEJA 4CU7A 3V64A 4DUVA 2B42B 1ZX5A 4J6GA 4F7ZA 2E9XA 1PGW1 4A7KA 3ELNA 3GM8A 3BUCA 1WMFA 1HFAA 4XURA 1DGWX 4TLFA 1ALYA 3AB3B 3P4SA 5KDMC 2WLPA 2CHOA 1SFPA 2YBPA 4CPBD 1OVPA 4M00A 3SCHA 2ZX4A 1J3QA 3AEFA 3R0RA 5ANQA 4LBQA 4UBHA 1GR3A 2PHRA 2YU2A 3U75A 2W5FA 1TME1 3C4ZA 5FK8A 5LA9A 5EPAA 2BFUS 2WWJA 2J1RA 4L11A 3U11A 4UF0A 1NAFA 3KMHA 3RZJA 3ONLC 2A73B 3CL1A 4MGTA 3VZJA 2KWHA 1FT9A 4UW4A 4Q4Y2 1J5WA 3RJ2X 4AK3A 3TOJA 2VUDA 4BIOA 3VDDC 3IDEA 4K0UA 3JZVA 3WLUA 2D5HA 2XUEA 1PVC2 4XUQA 1EUTA 4K1YA 5BNPB 2J4GA 3AKRA 3B9IA 2V7KA 3M65A 1N1YA 3I0QA 3JC6C 4QQOA 2DLRA 4ARYA 5ABJA 1ULCA 3SOLA 1T7SA 2I74A 4X62T 1EAH1 1GOGA 3IHRA 2E51A 3POIA 4YVSC 2D2SA 4P9LA 1XYNA 2QQUA 3KVBA 1FOD3 3PURA 5LY1A 3ETPA 3H7JA 2CWOA 4GYRA 5I91A 1VBE1 3FUQA 1MS3A 2WSVA 1RUH1 1YKEB 4JRLA 4K8RB 1E7PA 5A7SA 2EHOC 1IS4A 1XBFA 5L7OC 2HWB3 4MHRA 4ZXKA 5H9RA 1MNEA 1QDOA 4D8MA 1GP6A 2X53S 1AL0G 3ZOIA 1O3TA 4HN0A 2FDHA 3OBRA 2FQPA 3L39A 1SCRA 2X51A 3OVUA 5FL0A 5JVVA 1RUNA 1Y3TA 2IAKA 1QWRA 1BYHA 2SBAA 4P5HA 1NAEA 1V00A 4FCAA 2BBHA 1K5JA 4GWNA 4GMP0 5AFBA 3RYPA 3LDRA 3OGVA 3PU3A 4G63A 4V2VA 1EPZA 3PVOA 4MGIE 4FPYA 2K3WA 1RUG1 1XNKA 3AX4A 4YSYA 5D8AB 2Q5TA 4ARXA 2RS12 4ZI3D 1S94A 3AEAA 4ITCA 3GA8A 4NPLA 4X66T 5BNNB 2WA3A 3ZT6A 3POGA 1IQAA 5JZGC 4DZGA 1OFSA 3DYPA 3ZMSB 1Y43B 3ZMNA 5HBAA 3MW2A 4DR7T 3ZCIA 1XMOT 2AZ5A 2JXAA 3WNOA 1W6OB 2R041 1TMF3 3UL2A 5J48A 3J8F1 2QDRA 1J3PA 1QJY1 4Y1XA 2YU1A 3RSJA 5I0DA 4DR3T 1PO23 3IN9A 3BOPA 2ZGSA 1U5PA 2X0LB 4QT6A 3THTA 2YPJA 3SH5A 1HRI3 4A98A 3O4XE 4CPBA 3OYZA 4KHZF 3AB0A 4AFAA 4IUGA 2IXKA 4A56A 3PIJA 2JE7A 3BODA 2D5UA 4QGLA 2XAHB 1N33T 3TBDA 2XJPA 1W8ZA 3K4AA 4TYSA 1ASJ3 4OZOA 4CUGA 1RMU1 3RLFF 2DBIA 4GZ9A 5A80A 5LA6E 3A7MA 4JGYB 5FZBA 3SMHA 1SACA 5H9PA 2DU0A 5KC6A 4CEYB 2LSGA 3TLWA 3VKLA 1VCTA 2EIDA 1G86A 5FY8A 3ZXEA 3UUBA 4QXCB 1UF2C 1NG0A 2WBKA 3WNLA 1HQLA 1F35A 1POV3 4YHJA 2F6BA 2ARXA 2D43A 5AFEA 1MEC3 3U4SA 1KJRA 2Q8CA 4HONA 2VMCA 4KU7A 2P1BA 1SHWB 2YK0A 5A7PA 1RUOA 2WS93 1AL22 3VBRC 4BE3A 3LSDA 4MFRA 4BJ0A 5EHDA 3D3AA 1QJX2 3I2IA 3VBSB 4Y22B 2EXIA 1V9U1 1G9BA 1PHMA 5FPZA 3SLIA 3NZPA 1RUE1 4DINB 5LASA 2CLYC 2XY8B 5LHGB 3F57A 2XHNA 2K5BB 2QRXA 4Y1VA 1HG5A 4XDQA 3URFA 2D0TA 2NYYA 2ZXQA 4LK7A 3VB9A 4V1PA 4XQDA 1PZ8A 4F3JA 3VBFA 3UQ4A 1UWWA 2RE9A 1DBNA 1ZZ8A 3ZSLA 2ZOEB 2JQKA 1COV1 3NWIA 1PM7A 3KB5A 1GP5A 4Q4W2 1SHZC 4LBJA 2C5KT 1ZBE1 1X9BA 4EZ4A 1VR3A 1O3QA 4AKHA 2YC2A 4EGWA 1AR91 1MZFA 2FCUA 2IXIA 1W3XA 1BQPA 3A22A 2CAVA 2LJLA 1VBB3 2XQAA 3W15B 1OH4A 2RVAA 5FZ3A 1WMEA 4NHYA 2Y0IA 2G0UA 1UU4A 4QXBB 1DF0A 2Q1FA 2LSIA 3PL0A 5BV6A 5HWYA 3N7MA 2BG9C 3PHMA 2VK9A 3VD9A 3WW3A 4F8AA 1IJ6A 3T2OA 1GSLA 2R1BA 3DYMA 4FAGA 3T0AA 4COWA 1YQ3A 3AP5A 4AQ2A 4FOQA 4NHLA 2R49A 4LHKA 5JXGA 4TWDA 4DB5A 4XHBA 4U3CA 3AAEB 4GH4B 3I3DA 4OUMA 1O3RA 4NUBA 4YG0A 3HMYA 5HXVA 5LZ6A 3DECA 4MHUA 4CCMA 4DNYA 5A1LA 5HEJA 5JIUA 3HEIA 2I07B 4I0AA 3MJXA 3CZJA 2WO3A 4RR3C 2YB7A 2RPAA 4A97A 4D7TA 4JC1A 4F83A 2NWBA 3POEA 1O3XA 4HSLA 4UI9L 4Q4Y3 5FPLA 3BALA 2XMLA 4Q8KA 4A42A 1W06A 2Z79A 1OLMA 3NJYA 3JCFA 4C8DA 1NKGA 3KM5A 3QK6A 1ENRA 2J7MA 2UU8A 1N1SA 3R4SA 2FBEA 3MF6A 1PVC3 1LJ7A 2HH7A 4Q4X2 1OOPA 1VAKA 1DIWA 2QQIA 2LHNA 3AZYA 5HEGA 3N9PA 1QY4A 2O8QA 1R081 4BQ3A 2E9XC 2WNUA 4LOTA 5C5TA 3KT7A 4NPMA 3LAGA 3OBTA 4QM9A 1FJGT 1BVVA 2C6SA 4KL1A 5LBFA 2Q8EA 3DYOA 4WM8A 1PX3A 2MPFA 2MEV3 1PK6A 3AC0A 1RHI2 4XFHA 1QJU1 3HQXA 3ITQA 3ANWB 1DFQA 4COYA 2DVFA 5IWFA 1C8M3 1HS7A 4WM7B 2JJ6A 1W03A 4DY3A 4HFDA 2OXBA 2D6MA 1RYYA 1LU2A 2Y6XA 2ID4A 1SA0E 3S7EA 4ZOLE 1HXS2 4CI1B 3EDVA 4AYUA 2RMU1 2FDGA 4NHKA 3OOXA 4XF9A 4W50A 4COUA 3WDYA 1YD8G 5JDMA 4RN5A 5ABJC 4AI3A 4PFPA 3RYRA 2LSJA 4AEDB 3Q9DA 3N35A 1H0BA 4LBLA 4FPOB 3LBXA 3WP6A 4HWDA 1TNFA 4GA9A 5CZKA 5EJ3A 3OYWA 3TN92 4NO4A 5T5LA 5A3NA 1W8WA 3K51A 1WA4A 2DVAA 1CD3G 4JVAA 5IUXA 5F5QA 5L3EB 2AEYA 4OHWA 1AX2A 3AA1B 4YVWB 3O1JA 1OEDA 4JZRA 4XDOA 1Q43A 1WW7A 2ZGRA 1J1JA 2J1VA 3E6CC 4QX8B 1UN1A 4WYVA 3C50A 4WVWA 4ILAA 1WCUA 4H14A 3WNXA 4NAMA 2W3JA 3OB8A 1G8XA 2EICA 2QFEA 5FREA 4ISRA 2XVLA 4ET7A 4NMIA 3NJVA 4EN0A 2VMIA 3M3CA 2RM22 2QQPA 4XZPA 3V5SA 2WFF3 4R9DA 3FZMB 2CXFA 1SG3A 3WDWA 2B9UA 1IOAA 4MVTA 4XFBA 3VDDB 3H50A 3AVRA 3IAQA 3UFGA 1J84A 3T1HT 2PHDA 5C3JA 1H6YA 1NLSA 2DWKA 1EV12 4YXDA 3NAPA 4HLTA 4HXCA 2R062 2DUQA 4JI7T 4QPYA 3AL5A 2Y64A 3T2TA 3E5XA 2G19A 2WU2A 2RR11 4YVSB 3H1WA 3DP7A 1XPWA 3O1HA 4X64T 2VUAA 1HF8A 1R1A2 1OWAA 4QDQA 2WZIA 3A4UA 2VH9A 5FZGA 1GZTA 2JB8A 2WZ8A 3T1YT 2ZHKA 3RG0A 4JI5T 5L7OB 3EJKA 1I9RA 4KH9A 4QKDA 3T1MA 2ZLYA 4BM8A 2E32A 3O5SA 4U2AA 5FNVE 2QNKA 2V5CA 2ES0A 1LECA 2XQYA 2B76A 2AREA 5FP7A 4FPKA 2IDOB 2EVXA 4I02A 1CAVB 3MPPG 3ROUA 5FQ0A 1KEYA 2VL4A 3ORJA 3CJXA 2QQVA 2XQ6A 1IZNB 4XJ9A 1PM4A 3O1OA 4ADZA 2HKXA 2PTFA 1PX4A 3E5UA 5A32B 1FMD1 5KBFA 3E1F1 2VVDA 3PJYA 4JI3T 5FZOB 4CYDA 4QWNB 1QJX3 4QU2A 3RRWA 3CQXC 4GB32 4GIWA 1VBE3 1W39A 4QB2A 4YM1A 5ABEA 1KK7A 4UYBA 1OBNA 3ACHA 4B1MA 2WYFA 4EIWA 1B09A 3VZMA 4OI1A 2K0GA 5JR9B 1QEXA 1S2EA 4QKBA 5GZDA 1NZIA 3WSOA 4YGDA 2PXJA 3DXTA 5JZGB 2BGPA 4ZU5A 2RS11 1K5MA 3H8UA 4AZZA 4OHXA 1LOEA 4I3PA 2E33A 3NNLA 4Y24A 2A70A 5LK5A 2CY6A 4FOWA 2V6YA 2K2SA 3EAMA 3SKJE 2BW8A 2C5JA 4Q4W3 4YFWA 1SLCA 3SCGA 3TNQA 1R64A 4LO5B 5C3RA 4FXGB 4PLNA 5FV3A 1UYXA 3T2PA 3WOGA 5LBCA 5FYTA 2PLV1 2R0FA 4OK0A 5KHGA 2LRKA 5FJHA 1AXKA 4JRAA 4CUBA 2C24A 4CCEA 1KJLA 1RVF2 2L8KA 5IJRA 1GWKA 5F3IA 1U12A 4RGGA 1XNBA 1IPSA 1YI9A 4EXTA 4JQTA 3GALA 4PK4A 3K1SA 3X29B 2VJXA 2IVIB 1VRH2 4GXLA 4QX7B 1JZ4A 1Q8SA 2RG4A 3MA9A 2BDRA 1V6NA 5FZ8A 4M3CB 4DV1T 1STMA 2HWE3 1QKQA 3UJOA 3VBFC 2TBVA 1LEDA 3B57A 2XH6A 1N3OA 3WV6A 4DRRA 4L2NA 2FJEA 1IPJA 4YW6A 3U10A 3CIRA 1YW0A 4PT6A 1DZTA 1JBCA 2CGPA 5FZ1A 3ES4A 4KWLA 4K9SA 3WT3A 3TLUA 5JR7B 5BUVA 1SLTA 5JWPA 1S0GA 1GLHA 5HWXA 3ZDVA 3MFAA 5FYUA 4E4HA 3V5UA 4LF7T 2GC3A 1I1EA 2NMNA 2C0SA 5F5IA 3KV9A 4B4QA 4MG2A 1E5SA 2OUHA 2VZSA 4NJ4A 3ECQA 3VBRB 2FUPA 3K46A 3AE8A 3TRSB 2A1XA 2GSYA 4KBMB 3RPQA 5CFDB 4B6XA 4IREA 5M0TA 1XE8A 2QQJA 5LHIB 3J7Yq 5C9AB 3UUXB 3F31A 1JH5A 1OI6A 3NKTA 5JPMB 1E1HB 3KQRA 3ZO0B 1AL21 3BB6A 4Q4X3 4R4ZA 1ULOA 3QCWA 2BOJA 4YJ3E 4IEYA 1OH3A 4DIDB 1C5HA 1UD1A 4BK5A 3OSDA 4K7JA 4URTA 5HXMA 4LF8T 4KG0A 4Q1RA 2VASA 1JODA 2QTWB 1JHJA 3O1IA 4KUMB 4BQ2A 4CUAA 2XAFB 4YT0A 4AQTA 2VMGA 4ISQA 2KXPB 3PE0A 2GNMA 3IKWA 1MQTA 2FMYA 2JDHA 2VXRA 3RZMA 1RXGA 3IM0A 4JV4A 1D0ZA 3VKNA 1X36A 2G1MA 2Z2SB 3LDQB 1CAWB 1LENA 1H9PA 1TZOA 1VBC1 1ZKEA 2BWAA 3OPCA 1EP0A 4LBKA 1R091 1O59A 4BQWA 5F8PA 1T8BA 5K8SA 3ZN6B 4HETA 3AXJA 4DMWA 3BCWA 4IE0A 3AZWA 4CCNA 4IERA 2WMNA 4INDA 1V6KA 1LULA 1BLZA 4QB6A 3E0ZA 1MS0A 3GZEA 1D7PM 3TLTA 5FPUA 1OOPC 5FWEA 3ALQA 4AFMA 2XAGB 2W62A 2XZEA 2MBGA 3HBZA 4OHVA 2W4XA 3WD5A 3UKVA 3ME2A 5FOBB 3AE7A 2WNUC 3GZAA 3I8TA 2Q4SA 2Y6GA 5A6QA 2D3RA 1V9DA 3P8CD 3UV9A 4NVPA 5BXXA 2QZ2A 3TN93 5AVPA 4A2UA 3KFWX 1REFA 5L36A 4J2CA 2BTVC 3OPTA 3VR8A 4E4ZA 1ZA4A 4XF4A 4D94A 1YJLA 4WM8C 3WW4A 2X67A 5L3CB 5LMUT 4Q5OA 2RDQA 1PK6C 1WLWA 2PAMA 1PVXA 4PIXA 4COZA 1NT0A 4Y5Z0 5FMOL 2O8OA 4BAYB 1CAUB 2JDNA 4DBRA 4H9PC 5LGUB 1AR61 2A71A 3ZSEA 5CBLA 4UFIA 4Y1YA 4UR9A 1A78A 4XHXA 3RDIA 2RM23 2OX0A 5CKQA 1RUF1 5AQVB 2I45A 3R84B 3B01A 1E5HA 3AEDA 4LF6T 1CZVA 2H0VA 1LNSA 3C7EA 5DDJ2 3NW4A 2JG9A 1WCRA 4IEOA 3LGRA 1MS5A 2W39A 3RIFA 3G6JB 3RIUA 3VHLA 3QB5A 1WGPA 5BNPA 4DNDA 3I4IA 2XM2A 1M7KA 2R063 2E9XB 1ZBA2 3GCXA 1WCQA 5IVVA 4AI1A 3O0VA 2ZMKA 3ZM8A 4AXOA 3DTOA 3PVEA 2Z5WA 4KQ7A 3AEGA 2WDBA 4TN7A 4X6RB 1OEDC 5J2UE 3E5QA 2DVDA 1I6XA 1QGLA 3GHNA 4YWAA 4LBQB 1WLDA 1K12A 4YGCA 3U4XA 4QQLA 2ZM2A 1DCSA 4MHCA 1XU1A 3SNMA 1XNDA 1UMHA 3M3ZB 4UF0B 4PLMA 1JOPA 1OUSA 3CNAA 3KINB 1VBA3 1RHI1 3H8OA 5DUXA 1ZZBA 3FBZA 3WCRA 4X1KE 2XXZA 3KF3A 4YHHT 3MUZ1 2RS51 1J1TA 1LKNA 3WG3A 3B69A 3N9MA 1HG2A 4O65A 2PHWA 5AQSB 3KT4A 1DHKB 1QH7A 4A6SA 3NAPC 1GQGA 4FQ4A 3ZSMA 3QOFA 1ULPA 2WWVA 4ZONA 2X0HA 5ABJB 1HXS1 1BR1A 3O1VA 4SLIA 2D98A 2RS32 4CCLA 3IA3A 4XFFA 1RUI1 2WWSA 4PI2A 4AQFA 5EIYB 1WD4A 4LULA 1VCSA 2YBSA 3WCSA 1O4YA 4Q4V1 4Y33A 2A3DA 3AEEA 2DNXA 5FPBA 4HVRA 1YNAA 5F5AA 2W2UA 2B9VA 4Y1UA 3OEAA 3FFQA 3OPZA 2MNGA 3H3UA 5GJ6A 4CVUA 3LKJA 3C51A 1CJPA 2QA7A 1BZWA 4H63H 2XQ8A 2AE9A 2E8IA 5IK4A 5AQPB 1JYWA 4IDQA 4IETA 5FUIA 4MYEA 2XQXA 2ZX2A 4LO7A 2W52A 1S0CA 1VBD2 4TXWA 4OFGA 3UYJA 1QMJA 3I1AA 3V56A 3B93A 4BISA 4HVOA 4AW7A 1UK5A 2VWAA 1IPKA 1X7NA 1S0BA 3A23A 1IG0A 4LQRA 2WB5A 3PDQA 2HWF2 3AMQA 4ASLA 1SBDA 1EV11 4JGZA 3HNMA 4LKSA 4LEJA 2BVBA 2ZGUA 2G9GA 4PF1A 1JNZA 1X8EA 3Q8BA 2W1WA 5ANNA 5F2WA 2DTYA 3LFMA 4Y5TA 3PUGA 1O4ZA 4N9HA 3B5LB 3EO6A 2XL7A 1IJ5A 1U4QA 1S0DA 1MMNA 4JGYA 1K5MC 5ACA1 4Q8LA 1O3SA 2I2SA 3S57A 5AQMB 1R1A1 3LSEA 3EABA 3EQEA 2BPA2 4FJOA 4GKYA 5JTGA 2YGMA 4UV9B 3BTYA 4GALA 3W5NA 4DR6T 3FLRA 4QXCA 5IATA 4NR1A 4TNVA 2VQTA 1CONA 3AXDA 2RA1A 1GWMA 4H9OC 4B4PA 2XPKA 3ZMUB 2VOWA 3JD71 5I8YA 1HJGA 1B35A 1BBT2 1V6IA 4DUWA 4JCKA 4NHMA 5HI0A 2JDUA 5A3OA 2JECA 2VTXA 4EJRA 3LCPA 4QB1A 2WO1A 3DGTA 5F32A 4TWFA 2GZWA 5ADXL 4AI0A 2W94A 5C8CA 1PIV1 4TLGA 3LZZA 3FB2A 2WQZC 5FY1A 2R1DA 2VXJA 2CWMA 2DUOA 2HYKA 4XDPA 4HVQA 1CQ9A 3B9CA 3OUHA 3HKDE 3KD4A 4ZZCA 3AAAB 2G9ZA 2ETEA 2WN2A 4COVA 4FT8A 5K0UA 4BLIA 3AM2A 3Q8AA 4GB31 5GZFA 5JPNB 5LJNA 5DXDA 3LSVA 3JBG2 1UZVA 3O7OA 3ZYPA 1X33A 4W6WA 1DLLA 2RV9A 3CF6E 1VP6A 3BU7A 1XYPA 5J36A 5FZLA 4AVVA 1FIOA 3DJBA 1M62A 5FFOC 1EUUA 2W68A 2ACZA 1ULFA 2BUKA 5FPAA 4CI3B 4KWJA 4AFDA 2F4PA 3JXSA 4GJYA 4CCJA 4WBOA 4U2YA 1GWLA 1ZRIA 3ZXFA 5JDNA 4IE7A 2FDFA 2DFBA 4D0QA 1IG3A 4N53B 1DQ5A 4O2AE 2NLRA 4M3CE 1QXJA 2LSYA 4ZS2A 5HEUA 4XBLA 4NIHA 4R9BA 3WNNA 4X65T 2ENRA 3FWEA 2KWIB 1Q8PA 2C5DA 2JQ9A 1AZDA 3CK6A 5EZWA 4FOVA 1RVF1 2XJVA 1LCLA 3VKGA 1AYN1 3BYWA 4OYJA 2DWRA 3MIBA 4ZZBA 3K2OA 2VVEA 2WNOA 1NCRA 4UT5A 4XZCA 3AMNA 4O4JE 3DKQA 2RJLA 2VZPA 5LB6A 3BIWE 5GALA 1S2KA 1PGL1 3VBFB 1GQHA 1VRH1 1SPPB 3ZJ2A 2UUCT 4OLLA 3KCCA 2IMLA 5IW0A 3SCFA 2N1GA 3B7MA 5FP4A 4HFBA 2A3XA 3JCIA 1HKDA 2K24A 1MQTC 2KLQA 4QU1A 4HTEA 5KHHA 4CCCA 1V0AA 1ZREA 2WM9A 3HQRA 2LLYA 2XR4A 4EWDA 4P9IA 2R30A 2IXJA 1PO12 5FWJA 1C1LA 1BHGA 1QIQA 4YARA 2WQ4A 1N3PA 1YQ2A 3FJSA 4AI2A 1ST8A 5T5OA 1JZ6A 2OV9A 1XYOA 3VL9A 3GNEA 4AIUA 5FKBA 2YKSA 4I01A 4IL4A 3USUA 1XNCA 5DDJ3 4YY3T 1JZ7A 4KBZA 1YIPA 2ORXA 1WMDA 3OKQA 1Y7BA 3AFGA 1HW5A 1JW6A 3UUNA 2EXHA 3K3QC 5EQUA 2BKOA 1M06G 1OKOA 3DUIA 1DG6A 2YGLA 3S6PA 4K40A 1ZBA3 5GLUA 2BU9A 4AXPA 2ET7A 3R4DB 1GOHA 5DG2A 1CJDA 4CN4A 3SFDA 2GC2A 3GBWA 2ADEA 2OW4A 2BOIA 4D7SA 3THCA 3NNJA 4IEVA 4PJJA 4HKWA 3RF1A 2Y6LA 1RUD1 3UU3A 4O4IE 2EF6A 2GNTA 5J96B 1CWPA 3ZYGA 2QCSB 2IVJA 3FBMA 3VHNA 5LOVE 2IXHA 3RYKA 4TZ4C 2WT2A 3MV11 3HPNA 5AQHB 3MPBA 4PHZA 1GMMA 1UOJA 2H89A 2WQ8A 1CIYA 4WM7A 2LS6A 3PUZF 4A5XA 2PHXA 2G4IA 1CUNA 2CXDA 2HEWF 2JG9C 1NLQA 4O7XA 5EXOA 4NAOA 1J58A 3HT2A 3RIUC 4WZFA 2CV6A 4EN6B 2BVLA 1OOPB 4WW0A 4CRQA 5BNPC 4WVVA 1UIKA 2XQ4A 3KHBA 3WHTA 3PLQA 4QH4A 3UETA 3AKQA 3J7LA 3BPSA 3MW4A 2RS33 3MYXA 3HAGA 4CP1A 4NIIA 2ZX0A 3OGRA 4AEDA 1FPN2 2H7VC 3WDVA 1Z7S2 2PFVA 4Z8XA 4M4PA 1XSQA 5ABGA 1US7B 3E97A 1VRBA 1DU3D 1IBMT 3WG1A 4WM8B 4RHV1 4YVWA 2NP9A 4CDUB 2VL8A 3MDPA 3PUWF 2OZ6A 1JTZX 1MMAA 5T3NA 1OPMA 2VMDA 4LORA 5FXWA 4H9RC 3A0NA 4S2FA 1RL3A 2JDZA 5BR8T 3WNPA 4L99A 3I3MA 2D6KA 4CZSA 2FCTA 3VGIA 4UIGA 2V72A 1QH6A 4BQXA 2HWD2 4ILCA 5JDBA 2XL9A 1QOOA 2D6NA 3IF8B 4ONUA 3HL6A 4DOUA 3ILRA 1VBD3 1N47A 4HMZA 2ZEXA 4P9XA 3ZFFA 3N5LA 5TAOA 5BY5A 2BGCA 3WNKA 1UO9A 4GQ7A 4A41A 2KD7A 3WQ7A 1XJAA 1UPSA 4P00B 4XIOA 3AVSA 4NRMA 1IAPA 2HWF3 1SLLA 4JEHB 4LBOA 1ULGA 3LBXB 2J1EA 4AQFC 3OYWB 2P3YA 2XKPA 3RVHA 2NR4A 3I59A 1NE6A 2HH9A 1H2MA 1HRV2 2Q0AA 1OEDB 2A3WA 3IIAA 4DUYT 4YM3A 1K45A 4LE3A 3FZ3A 3MIDA 2VQUA 3RWNA 3HOBA 3DCQA 1DQ0A 3B3QE 2VNRA 1DGRN 1J83A 4PJNA 5FVLA 2UY9A 4IXLA 4JI6T 5F39A 3PUAA 4GK0E 3O1UA 5LWBA 1ZEEA 3LPGA 2DCFA 5A7QA 5F6LB 4R52A 1HV0A 1OXCA 3FHQA 4PIZA 3BTAA 2XQ5A 4HG6B 3UESA 4PK5A 1ENSA 3M70A 4XIKA 4Q0PA 5LA1A 4N7UA 3WY6A 5KMGP 2OQ7A 1G9DA 5FMDA 2MTQA 5KHJA 1YQ8A 4JI4T 3R6SA 1CAVA 4GMP3 1OMIA 3ETUA 4GULA 3VBHA 2O1QA 5M4YA 2BGOA 4HFHA 4XJ8A 1OC1A 3BGAA 3CWZB 4JGZC 2ZHMA 1DQ4A 3FMGA 2VNVA 5FZOA 1PNGA 4QWNA 2GP5A 3LQCA 4EB6E 3WVJA 2X09A 2KMFA 2DF7A 4A3ZA 3UULA 5G04L 2E31A 4JI0T 5JUVA 3AMHA 3K3OA 5JR9A 4JGYC 3JBG3 3PMSA 1D0GA 5JZGA 1GBGA 3SRZA 2ZMLA 3N9OA 4GD4A 5DAWA 3ZFEB 4YRDA 4CQIA 3RMYA 2GALA 2A6WA 4C0BA 3AA6B 1GNZA 1UX7A 4XTPA 2JQHA 4OMCA 2R7EB 2P9BA 2UYAA 1KXGA 4BU2A 2DU1A 1B35C 5FQ0B 2QYWA 2LRLA 3ZIWA 4MSVA 5JIAA 1WCKA 1BK0A 3DN7A 5L3GB 2YHJA 5C8CC 3MKDA 1HN1A 2Y26A 4R4XA 3CQGB 3FBYA 2W91A 2BEOA 1WD3A 5FR3A 4QM8A 5JDLA 2BDEA 3FHAA 2A3YA 2WL1A 4XETA 4I55E 2KXLA 4HSJA 2PELA 2JX9A 2VAUA 1U5XA 2WABA 5K0UC 3A7QA 4IL9A 2Y33A 2QDNA 4C90A 4XBNA 4OMDA 2EIBA 4P0BA 5CFBA 2WN3A 2BZBA 2WINB 2ZMNA 2KZ7B 4DR1T 2ODUA 2BNMA 3ZSTA 4QDSA 1MACA 4KGGA 2V6YB 2PN5A 5L3FB 3GN5A 3A8YC 4LUKA 2JD4A 1Y9MA 4LKDA 4XFAA 1W0OA 4LFBT 3IBPA 1OA3A 5CAZA 4DXTA 4FXKB 1PO22 2N9DA 5DUUA 1Z0PA 2YUEA 1PO13 2ZPXA 1HB3A 1HRI2 1D4VB 3S30A 1ZVFA 4BQ5A 2IC6A 1LR5A 2ZA9A 1F2NA 4YZ5A 4B3ST 2C0ZA 3ZIXA 2PJQA 5CFDA 1FAYA 5LBQB 1IQDC 5T50A 3VZOA 5C9AA 1JOBA 2J1DG 1BEV2 2XWBB 1HX1B 5BPXA 1NCRC 4OQ8A 3I3EA 1AR82 4I0BA 3CVRA 4BA6A 1F31A 3JAEA 2P3JA 4R9AA 1HB1A 3VHPA 3UFEA 2IC1A 5HEOA 4DBQA 1VAVA 2V7JA 4DR4T 2NN8A 4IGQA 1S2BA 3Q5EA 4O61A 3J9X1 1ZZ9A 3AP6A 1HX8A 2WZEA 3GGLA 2YINA 4KG8A 4EZHA 1WW6A 4ZPIA 2GC0A 1US2A 5C3QA 3WF1A 4C0HA 4PW8A 5L19A 1QHDA 2D5FA 5JREA 4QMAA 3U1XA 3POYA 1AR71 5LGNB 3T4VA 4QGMA 1MEC2 1CAWA 1BMV1 1OF4A 3MIGA 4LIVA 1KQRA 5LGTB 1L3JA 4IGUA 4QX0A 2WS92 3B13A 2BS2A 3K75B 3H0OA 5FYHA 4MLKA 4DV0T 1Q5OA 3BVCA 1WUVA 4DEVA 1RITA 1U5ZA 1HB2A 3EMRA 3AYCA 3PTRB 1TG7A 5CIRA 3C4XA 3THDA 1HNWT 3N36A 2HPLA 3DKWA 4GKXA 5IK8A 2Y34A 2O0OA 2EIEA 3AMMA 2YV8A 5FYSA 2BBJA 2AEZA 1Z78A 2DWGA 1G8WA 1CZSA 2W00A 5EK3A 2JKBA 4B3NA 3FLPA 5I0RA 2W63A 5I8SA 1HDKA 4IT4A 2X5IA 3SH4A 4BJMA 4M4RA 2DBNA 3HNYM 5DZFA 5IK7A 2WZR1 4AR2A 1MQTB 4LO6B 2ZEZA 3POBA 2WNVA 3O0WA 2XQ7A 5E16A 5I8TA 4BXSV 4NIQA 2V09A 3IT8A 3H1YA 1DU2A 4D7YA 2MHFA 4LO8A 1CX4A 1QXRA 1GP4A 1LRHA 3AZVA 2HWD3 4CU8A 2P5BA 4WM7C 3WQBA 3AXJB 1VBB2 5JOZA 2ET1A 1RUJ2 2R0HA 1D4M3 3A21A 2P6CA 2D6OX 4LT5A 4B3MT 5AQRB 2QQNA 1LGCA 2HWC2 4A3XA 5IUQA 1HB4A 4UFKA 5FP8A 1FNYA 2X0YA 3T4HB 4DV3T 1LODA 3RMXA 2VNGA 3SWHA 4X20E 1AF9A 5KHIA 3IPVB 1UX4A 2YBKA 4WZCA 2D3PA 4AEDC 2W66A 3AA0B 3TLVA 4XABA 5JOYA 5HCAA 4YW5A 1HRV3 1OLME 3SC7X 5H9QA 2NTXA 2KSRA 2WKKA 3AP9A 4YVWC 3VBOA 4EN8B 1ZRCA 2XBO3 3QB5K 4D3WA 1M4WA 4F6RC 3RX6A 3NNMA 3L3PA 1UCUA 5AC92 3BOWA 2ZGOA 4Z07A 2DCJA 3ZT5A 5IVYA 2X68A 3UKTA 5EFUA 3MXZA 1UY4A 4P9JA 1SMVA 1ENQA 3I3BA 1IKPA 4MBQA 2JRKA 1G9FA 1PMHX 5KXEA 1QQP2 2V4VA 4JEUB 2JG9B 1W9TA 3ZFFC 1AYM1 1HN0A 4I4TE 4ISTA 3O1MA 2VOTA 1YWKA 5IVBA 1LHVA 3ZR5A 3AL6A 5J37A 3PNAA 3D82A 5E1RA 3GBGA 2K48A 4IEQA 2M6IA 3AYEA 4DXSA 4LA3A 4QDRA 4YNIA 1P8JA 4BQ1A 3ZKUA 3I0OA 1LESA 1MIVA 3KCXA 5T52A 2Q1ZB 4TN7B 4IE4A 4KP3C 2HN2A 2VMFA 3UT5E 4RGKA 2J1TA 3RYIE 5GKAC 3CKHA 3VN4A 2A5ZA 4C91A 3M3OA 5TSWA 1DGLA 1FPN1 1Z7S1 2D0UA 4XJWA 3WXPA 1UOGA 1MZEA 2MEV2 3NJXA 2A2FX 5FUNA 5LMNT 4EEDA 3JU9A 3N4MA 1OD3A 2D6LX 5LA2A 3A5XA 2Y6JA 1SLIA 5DPNA 1ZP0A 4UFMA 4LMFA 1FEWA 4UEMA 1J3RA 1H8TB 4J1XA 4P08A 1C8M2 1RC6A 4H55A 1WBFA 3ZT7A 1KDMA 1OFNA 3P3PA 2WDQA 1UY0A 2JDKA 3ZXDA 4H63V 5AQQB 3OBAA 2Z42A 1QOTA 2ADDA 3RQWA 1RUC2 2EAAA 2VBDA 3GZUC 2XG3A 3SXWA 1OEDE 3GHMA 5A7NA 3SEPA 1OA4A 3WAJA 4OHZA 4IV3A 4CEWA 3E22E 4L0PA 2WQYA 2WNEA 3W21A 3VBHC 1UZYA 1OLRA 4I0UA 2XJUA 4HFSA 2OS2A 4AEKA 3F2EA 5DAVA 1W3VA 4XXAA 5IT6A 4AKRB 2Y38A 1Q8VA 3NMBA 1D0YA 4LHSA 4G2AA 3VBUA 2RHPA 3SHRA 3MIHA 1A3KA 1C3HA 3PUIA 2Y60A 5A1AA 1DQ2A 1PGSA 4IL7A 3JC6D 4DUZT 5JR9C 5F3GA 5FKCA 3LK42 3EUHA 1NX9A 5EK2A 3G7DA 5CKMA 2LE8A 4CE8A 1IHMA 4RS5A 2R072 2OPKA 1FV3A 2P34A 2CHHA 1O5LA 2KR2A 4TV8E 2VMEA 2WFF2 2JJ9A 4YW4A 1UYZA 4HPKB 3WEZA 1T6BX 1RB8G 4M1PA 2BRTA 4GWIA 4DS0A 1W0PA 2EHOD 4FTSA 3MFCA 1PGW2 1YC61 3KGLA 2H0BA 4NPRA 2HLEA 5T5PA 2YC0A 4JGZB 3W59A 3WUDA 5EV7A 4ZZ5A 3RYCE 3WNMA 4BOWA 5JXHA 4OI0A 4NROA 3ZMZB 5JDHA 4G4FA 4JQRA 1BEV3 2VMHA 4NHXA 1ZV4X 2WU5A 5CGMA 4NE9A 2JIWA 3AE5A 1AR83 1W9YA 3TLSA 3ZN4A 1TME2 4MALA 5AQLB 4Q0SA 2FBWA 2XHKA 3ZYFA 4UW3A 4FAHA 3T3YA 1XB9A 3FFZA 1W6MA 1ZM1A 1OVSA 2GH8A 1FOD1 1GOFA 2P6HA 4QHBA 5K7PA 1X82A 3WG2A 1XU2A 1KFUL 3AE2A 5K9YA 1KDKA 5GZCA 2HWB1 2GMMA 3P4QA 2ZGMA 3LEIA 3R6NA 3OGGA 1B35B 4HN1A 4YFSA 1C8NA 2EXJA 4PI0A 1DYOA 3MEPA 4H7LA 2O14A 4N53A 5GLVA 3NV1A 1EAH2 2BNNA 4Y20A 4UV8B 5C8CB 4NN0A 3I54A 1R8IA 4QKFA 2D3SA 3WP5A 1CHUA 5C2TA 2WMOA 4E27A 1O6UA 5FMNA 5CFDC 2VZOA 2V26A 3RZZA 1UUSA 5C9AC 2F17A 4N8MA 3DV8A 2ZAHA 4ZKTB 4CN1A 1VBE2 5HXSA 3B00A 3RQ0A 2ZKLA 1NXD1 4KWKA 3P4WA 5K0UB 1W99A 1TNRA 3H1MA 4FPJA 5SV5A 1UKRA 2H7OA 5DG1A 1WZXA 3O1SA 3WAKA 2Y48B 1HLCA 4U31A 2YOEA 5JH7E 4K0KT 1SPPA 4PJYA 3AK0A 4Q25A 4BZ4A 5GM0A 1KGYA 4YM0A 4TTGA 2E7QA 3NL1A 5CVRA 4B7EA 2DDUA 4ZEYA 3C7FA 1EY2A 1US3A 2VQ0A 1D1CA 4L9BA 3KV5A 2XVGA 3AZXA 4XFIA 1SQ4A 1BCXA 3CJIA 1TMF1 4KI5M 3FXEB 5LP6E 1JYCA 2VCAA 4UELA 3NWKA 1MS9A 3P6BA 3UU5A 1I5ZA 3CIHA 1RUJ3 1PO21 1RUG2 2PHTA 1WWYA 2CDPA 2ZBJA 2ZZJA 1JHNA 1HRI1 4QH1A 3MIEA 4CU6A 2HWC3 4EROA 1VOMA 1SUMB 3NNGA 3S7IA 4BHPA 1Q56A 1NCRB 1JUHA 2B4KA 5F5WA 3I2HA 4U7IA 5KXJA 4DV4T 1DDLA 2ILMA 5IFPA 4QHOA 5L9RA 4LMKA 1X50A 5J3UA 3BQKA 4CP9A 4AHWA 4TWHA 2HWE2 4JDMA 1ASJ1 2R042 3ZSKA 2X5IC 2XGXA 3J8F2 2QGSA 3H8XA 2LHRA 4E7ZA 4ZI2D 2YY1A 3LA7A 1QJY2 3ZYJB 3ZXKA 5AQOB 4HKOA 3PMEA 4CN6A 2WNVC 5JRCA 1UZZA 3J7NA 5AC93 1WYCA 3ZKYA 4P9GA 2ZCWA 4AGVA 2JEMA 3MLJA 4U74A 2BKNA 1POV1 4LA2A 4BMEA 4ZS3A 4Q1PA 3MZHA 4UVAB 2VZVA 4EV0A 1REDA 4PQQA 4IV1A 1QQP3 3USUB 4FPHA 1MEC1 2W1SA 3TB0A 2BBAA 4L97A 1D0HA 1RMU2 4P09A 2RP4A 2WAAA 5EWSA 2JG8A 4KHPT 3WW1A 2UXCT 3FN9A 5ISLA 3NKGA 1B7TA 4LIUA 2DFCA 4AG4A 2UY8A 4CCOA 2LTNA 3EDUA 3WF3A 4BK4A 1ENXA 3PIGA 5CA0E 3VBOC 2CRBA 2QQLA 4CCDA 4XOGA 4CDUA 3WDTA 4X5TA 2OA5A 4HBNA 3K3NA 4XUPA 5FZIA 4A7YA 4BDVB 2WC2A 1ND3A 3J26N 3QH6A 3HN3A 1O8PA 5HXRA 4Z90A 3THPA 2KT9A 2BP6A 1RJ8A 3CKDA 3PUXF 1V9U2 1DLCA 2W87A 2H6CA 1RUC3 4BXFA 1QUUA 1RUE2 2GNDA 1T72A 1FYUA 3ZDSA 4RSUA 1VBB1 1VJ2A 4N7IA 1L7RA 3Q5DA 4JI1T 3AE9A 2PQQA 1TEIA 4CDWA 2YDEA 2E5VA 2L3LA 5F1RA 3QC9A 4H7MA 3DXUA 1UYYA 3I2OA 1YI7A 5A3UA 3P5BA 4O9GA 1LGBA 1FMVA 3OY8A 2RJ2A 4DR2T 2DL1A 2ZAAA 1T2XA 5CNAA 3BTXA 5C70A 1ZBE2 2ZGNA 4XF3A 3RI9A 1Y4WA 1AR92 2VM9A 3CDZB 2X10A 1YEWA 4RQPB 4E4SA 4IESA 4QD2A 3WP4A 2Y6FA 1W2OA 4K3UA 2PG8A 3N2OA 4JX0A 4K1ZA 2A72A 2R073 4QPIA 1JYXA 3PUYF 4XTMA 3IDAA 1W8OA 5DAQA 1LU1A 4FFIA 3VKHA 3RRCA 1G7YA 3EI0A 4OX9T 2ZM8A 3GBFA 2ZGLA 5JXJA 1C1FA 3ACIA 3ZFFB 5IFTA 4FP3A 2YDQA 1UU6A 3RYHE 3C7HA 1MNDA 1S0FA 3RRDA 3LWCA
chains in the Genus database with same CATH topology
3B57A 4X1IE 2CCQA 4EYYR 3Q5WA 4TV9E 3GWHA 5LYJE 2Q9QC 1HS7A 2P9BA 4XAXB 2YBSA 3UTKA 4AKGA 2UXXB 1QSDA 4BU2A 4A56A 4F6RC 4Y33A 2EHOA 2A3DA 3RX6A 4YLHA 2DHRA 3OKQA 3ZC0A 3RKOA 2DNXA 3L3PA 3PDYA 2D5UA 1YW0A 5E0OA 5FPBA 4DIQA 5GONE 1UCUA 4D6SA 5F5AA 2Y6XA 5FZ1A 3UUNA 3LG7A 1SA0E 2H7OA 3HR0A 2XAHB 3K3QC 4FI5A 5L2LA 3KBUA 3K8PC 2CXLA 2V1DB 4ZOLE 4TUYE 3ZCJA 3NZQA 5L3GB 1MIWA 3RPUA 4CI1B 5IVYA 3N2KE 3EDVA 3WAKA 4V2WA 2X68A 4TX5A 2Y48B 4WNKA 5H6QB 3CX8B 4UEMA 2CA5A 3MKDA 5FZHA 4CUGA 5JH7E 2V7MA 3RH3A 3KDSE 5HWXA 3EVYA 3CX6B 3I9YA 5IVJA 5FYUA 4I50E 4E4HA 4QXBA 3V5UA 2CE7A 3MXZA 4AXPA 5FZ0A 1MMDA 3HKEE 3CQGB 5A80A 3C51A 5LA6E 2QA7A 5AFUL 4PK6A 2C0SA 1YD8G 4H63H 4MBQA 5JDMA 5F5IA 5F5CA 2E8IA 2JRKA 3KV9A 5FZ9A 5FZBA 4JEUB 4PFPA 4HKAA 3FHNA 5JDLA 2LSJA 2BDEA 3BQIA 3PUQA 3PU8A 3Q9DA 1D0XA 4I4TE 4KBMB 4ISTA 3SS1A 3LBXA 4I55E 3ZEFB 3L09A 4B6XA 4H9SE 5CA1E 2NTYA 4PJJA 1D1CA 3C98B 2Q8DA 5A3NA 2LSGA 5LHIB 2JPFA 3KV5A 5IVBA 5H6RB 3J7Yq 4CI2B 3UUXB 3OYXA 2X9HA 3AL6A 5FY8A 3F31A 2X9YA 5HAXA 5FBJA 2LM9A 5FZAA 5KR7A 4YJ2E 1E1HB 4QXCB 4NUVA 2WAUA 1HCIA 3FXEB 4O4IE 5LP6E 3UYJA 2X9WA 3OPWA 4Y4RA 4C90A 4E7SA 5LHHB 4AKIA 4CZZB 5L3EB 3I1AA 5FPVA 3AA1B 3O1JA 4OHFA 4BISA 4UELA 3ZMTB 5HYAA 2K48A 3S4UA 4PJLA 5LJMA 4XDOA 2LSKA 4YJ3E 4YHJA 2VWAA 4IIJE 4P0BA 4AQGA 4XBFB 5FZKA 5LOVE 2BZBA 2ACXA 1G73A 2XASB 5DABA 5HXHA 2VKOA 4OYKA 4TZ4C 2JQQA 2KZ7B 3I0OA 2ODUA 4QX8B 5FYZA 4I43B 4PJMA 5C8YE 1MIVA 3PDQA 3C50A 2ZM0A 4O2BE 3Q2MA 4PFOA 3C64A 3U4SA 5L3FB 3GN5A 1VOMA 4TN7B 4IE4A 4KP3C 4X1YE 3UT5E 2Q8CA 4HONA 1BR4A 5EK4A 5L3DB 3RYIE 5J2TE 4WBNE 1G8XA 1ZHCA 2JMHA 2VASA 4O4LE 2YK0A 4HOOA 1Y64B 5A7PA 4C91A 1CUNA 5FYCA 2CXDA 2IW5B 2E9XA 1T98A 1WR6A 3IBPA 3O1IA 4BJNA 5LCYA 4KUMB 4HFVA 2XAFB 2W0GA 1HFAA 2KXPB 3ETVA 3RC3A 5F2WA 4QHOA 2D0UA 2BVLA 3LFMA 3PE0A 4MFRA 4WW0A 2A2FX 3V5SA 1D1AA 3AB3B 3PUGA 5FUNA 2CXFA 2N9DA 1Z0PA 2VKDA 5KDMC 2OQ6A 1UX5A 3BQKA 5JDGA 3A5XA 2CEAA 2NOXA 2XDVA 3AVRA 5HXEA 5FY4A 3HA4A 4HGAA 1D0ZA 2M67A 2YBPA 4CCKA 1H7CA 3NZPA 1IJ5A 4V1Av 1BR0A 1U4QA 1FEWA 2IC6A 3OBVE 2Z6EA 1MMNA 3N9LA 2CLYC 4GYSA 2LOSA 4KMCA 4IHJE 2DWKA 5F3EA 5ANQA 2KNDA 2QGSA 2LHRA 4ANJA 4E7ZA 5EZYE 3N9QA 4ZI2D 5LHGB 2PJQA 2YU2A 1ZKEA 3F57A 2K5BB 4H63V 5A7WA 5FZCA 1HG5A 2H7VC 3H3AA 3C4ZA 2D0TA 3WI3A 4DMVA 5FZ4A 2PFVA 4HE8A 4Z8XA 5F8PA 5LBQB 2VB6A 4FJOA 2OT7A 3AL5A 2WWJA 4IGOA 5FZ6A 1US7B 3KV4A 5JRCA 3U3IA 1LRZA 3MK7C 5A1FA 4UV9B 4DMWA 1VRBA 5FY5A 2J1DG 4UF0A 5FXZA 4QXCA 4IE0A 5A7NA 1WYCA 1NAFA 2B1EA 5LXTE 3WAJA 4CCNA 3KBTA 2NP9A 3E22E 3DP7A 2Q9QA 3FBLA 2WMNA 2YEVC 2RA1A 3CVRA 2KWHA 3IEEA 3KV6A 2VL8A 5HXCA 3HKBE 1LVFA 4H9OC 3E0ZA 3O1HA 4U74A 2ODVA 3ZMUB 1MMAA 4HEAA 4IDZA 5FXVA 5FPUA 5FWEA 2XAQB 3ZJ1A 3AAIA 4EOZB 5FXWA 1HF8A 2XAGB 2VKJA 4H9RC 2OS2A 4GOUA 1OXZA 1SHZC 4ZS3A 2W62A 3FXDB 3UFEA 2MBGA 2CWYA 1OWAA 3F2EA 3TKLB 4DBQA 4EYUA 3RC8A 5IVFA 2V7JA 4JUYA 4UVAB 5CB4E 4DO0A 4H9QC 2C5KT 4AKRB 4AI6A 4QXHA 4EZ4A 4IGQA 5F32A 4K0UA 4AKHA 4H9NC 3J9X1 5ADXL 5FZGA 1D0YA 1HTJF 4CXWA 5DQWA 2XUEA 3CQCB 1HX8A 4UIGA 5LBMA 4G2AA 2W61A 2YINA 2YPDA 5FYBA 1V9DA 2L9QA 3P8CD 4EZHA 2V7KA 3FB2A 5FY1A 5K4LA 3M65A 5LW9A 5LG4A 3I0QA 4QX7A 3JC6C 3CMLA 4P09A 5FJKA 2RP4A 2LT3A 1BR2A 3KFWX 4CSWA 2LJLA 3IF8B 2CLYB 2DLRA 3HL6A 3O9XA 4J2CA 3OPTA 4XDPA 3W15B 2ZLYA 3ZC1A 3SOLA 1LVKA 5FXXA 2CMRA 5FZ3A 4PAGA 3Q5XA 3ANWA 4PW8A 3MZKB 3N5LA 2G0UA 5TAOA 2LEHA 5JREA 3HKDE 3JC6D 2X9XA 3LD8A 4Y3OA 3IHRA 5JR9C 4LITA 5FNVE 3AAAB 5F3GA 5ISLA 5FUPA 3LK42 2X67A 2ES0A 4QXBB 2D2SA 3ZPOA 5L3CB 2XQYA 3EUHA 1B7TA 2XTLA 4IE5A 4LIUA 4UVCB 5EK2A 5LGNB 5FP7A 3AVSA 2LE8A 5FZDA 4U72A 2LSIA 5HWYA 3KVBA 1IAPA 3ZLIA 3LDBA 4L0RA 3PURA 4LIVA 2VK9A 2WWUA 4BAYB 5LY1A 2I59A 4L9IA 5LGTB 4CCOA 3ZN1B 5LJNA 4EAHA 4IGPA 2CWOA 4GYRA 2VD7A 3EDUA 5FZ7A 2E9XD 4JEHB 1YKHB 1IJ6A 4GAZA 3E08A 4IGUA 3NRXA 5F2SA 5E6HA 3LBXB 5LY2A 4DBRA 2MOZA 4H9PC 3NBXX 3PUSA 4TV8E 5LGUB 4AQFC 3B13A 1IZNB 4IE6A 3N9NA 4PNIA 3KVAA 4UVBB 4MLKA 3HI2A 3OJAA 5CA0E 5FYHA 5FZLA 4ADZA 3ZYKA 1FIOA 5FYVA 3RVHA 1YKEB 3DJBA 3PTRB 5IVCA 4ZI2C 5A7SA 2EHOC 3C4XA 2BVMA 2JJ9A 3LK2B 3ZYLA 2OX0A 2UXNB 3R84B 5FZEA 2HPLA 2NW8A 3U78A 5FPAA 5FZOB 2KINB 4CI3B 4M1PA 4QWNB 3BK9A 3ZN0B 3MACA 1MNEA 3RRWA 3CQXC 2GK9A 3AAEB 4GIWA 4GJYA 5FYYA 5J1GA 5FYIA 5FY0A 2OA5A 4CCJA 2EHOD 4WBOA 5F3JA 4PJNA 5JDQA 3QUJA 1KK7A 5FYSA 3CPZA 3K3NA 4CXYA 5JDNA 4LXLA 4NUBA 5DJQC 5KX5E 2NW9A 2MYSA 5FZIA 4IE7A 3C4WA 3VHLA 2DWGA 2XHEB 3GN5B 3VU7H 5F39A 5A3TA 5BMVE 4AAPA 2W00A 5EK3A 5HXRA 3PUAA 4GK0E 3AA7B