3KV9A

Structure of kiaa1718 jumonji domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
b'PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 116
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv9A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv9A01
4Y33A 3AL5A 5IWFA 4HONA 5FXVA 3N9NA 4D6QA 4AAPA 2YU1A 3KVAA 4QX8A 5F5AA 5A7SA 5FYHA 5FZ4A 5F5CA 3N9OA 5FYZA 5FPAA 5FZIA 2OQ6A 2Q8EA 3RVHA 4LIUA 2VD7A 4CCKA 2XMLA 3KV4A 5K4LA 5FYYA 4QWNA 2YBPA 5FZBA 4EYUA 3K3NA 4LXLA 2XUEA 5FY7A 3AVRA 3ZLIA 3KVBA 5FZAA 3UYJA 3OPTA 4D6SA 5FZMA 5A1LA 5IVBA 3PU3A 5A7OA 4XDPA 3U78A 3N9LA 5FY5A 5E6HA 5CEHA 4Y4RA 2GP5A 2YBSA 2WWUA 2P5BA 3LDBA 5A3TA 3K2OA 5FZ7A 4UF0B 5FPVA 4TN7A 3KV9A 4LITA 5FZFA 2OT7A 4GD4A 4IGQA 2WWJA 5A7NA 4AI9A 4BU2A 5FP4A 5FZ8A 3KV5A 5FY8A 3U4SA 5FYMA 5F37A 5FXXA 4CCOA 5A3WA 4D6RA 4IGPA 2GP3A 5FP9A 2YBKA 5FYBA 4CCLA 5IVJA 4GJYA 5FZDA 5FY0A 4QX7A 3KV6A 4QXHA 3DXTA 5FY1A 5FJKA 4V2WA 5A7WB 5LWBA 3PDQA 4ASKA 5FP8A 3N9PA 2XDVA 5FJHA 1VRBA 4NUBA 5FWEA 5FZ6A 5FXZA 2YPDA 5A7WA 3PU8A 4E4HA 4QXCA 3PUSA 4BISA 5LY1A 5FYVA 4CUGA 5FP3A 4Y3OA 5FYUA 5IVEA 4XDOA 3LD8A 4QU1A 5FZEA 4GAZA 4C8DA 5FPUA 5KR7A 5FWJA 5FZ0A 5A3NA 3PURA 5FUNA 5FZ3A 5A7PA 2Q8DA 5FZ9A 4DIQA 4UF0A 3PTRB 5A80A 2Q8CA 3ZPOA 5FPLA 4CCMA 3OPWA 3NJYA 2PXJA 5FPBA 4EZHA 5A3PA 4DO0A 3AVSA 4CCJA 5ISLA 5F3CA 3PUQA 5FUPA 3N9QA 5FZKA 5FZOB 5FZCA 5LW9A 5IVFA 5FZGA 3AL6A 5LY2A 4BXFA 5FV3A 4QXBA 3K3OA 5F2SA 5A7QA 2YU2A 2W2IA 4GJZA 5F3IA 5F3GA 5FZOA 5ANQA 5F32A 5FY9A 3DXUA 5FYIA 5F39A 2OX0A 5FY4A 4CCNA 5FXWA 4URAA 5F2WA 4HOOA 2OQ7A 4IGOA 4V2VA 5FBJA 2OS2A 2XXZA 5IVVA 5FYCA 3PUAA 5A1FA 4LIVA 5FZ1A 5FZHA 3N9MA 4CSWA 5IVCA 5FP7A 5FYTA 5F5IA 5FYSA 5IVYA 5IW0A 5F3EA 4EZ4A 5FZLA
chains in the Genus database with same CATH superfamily
1EV13 2IDOB 2W66A 4E7ZA 2JDYA 2VPVA 3PUVF 5AQNB 4MX3A 3NRXA 3J9SA 5F5WA 2RR12 5CA6A 2B7YA 3M3EA 2E9QA 1V9DA 3KZ4C 1C28A 3O1UA 1ZM1A 1PO11 5LA9A 1QJX1 4TN7B 1BVP1 3WF1A 4KH9A 2WC2A 5BR8T 3H8XA 4BU2A 3P5BA 4LMFA 5FY8A 1FMVA 4DV1T 4Q4V3 3OEBA 4Z2AA 5C4WB 3K4DA 3TNQA 4EN7B 3W59A 4DV4T 4X1YE 4CPBA 4OZOA 2CHNA 2ZGQA 3IPVA 2D3RA 3LZZA 5JR9A 2IAKA 1MQTC 5FOJB 1ND2B 1OPOA 1HRV3 2H7OA 1FMD3 4BJMA 3N9MA 4K40A 2W47A 4HSLA 2R16A 3WP4A 1ZRIA 4ISRA 2ZM2A 5H6QB 2FJAA 4I01A 5LCWL 3NJXA 5F5CA 3KQRA 2YC0A 2AR6A 1IQAA 1VBC1 4GIQA 4LE4A 4CN4A 2NOXA 3B00A 3M1HA 5KX5E 2XM1A 4DUVA 4RA0A 2B46X 4XF3A 2IXCA 3RYCE 3UT5E 1XNQT 3EQEA 2HPJA 3C64A 4MBQA 1NEKA 2ZMAA 3ETUA 3T4VA 3CJIC 3UK9A 2BG9E 2D5HA 3DV8A 4FO9A 3BPZA 2ZHKA 5A3MA 3DECA 1AF9A 1DQ2A 5J2UE 1NCQC 4U2ZA 3HR0A 3WAKA 1GANA 1US3A 3CKHA 1S0IA 4R52A 2YPDA 4KI0F 4KU8A 3B94A 5FP3A 4I02A 1X79A 3FWEA 4HN0A 2IZWA 2RA1A 1K5JA 2VH9A 4CZSA 2RV9A 1U5ZA 1OOPA 1VBB1 5BXXA 2WO3A 3EBRA 4QKBA 4LORA 2C1FA 4GIWA 3D6EA 3AXDA 1HXS3 3JZVA 4I30A 4JHZA 1KQRA 2VCAA 3ZYJB 5FMBA 1QMJA 1YQ2A 3P3NA 3FB2A 1HRI2 4XF1A 2JE9A 2J1AA 4MHUA 3OF1A 3RZHA 4XFGA 1W09A 3M3IA 3WDYA 4P0AA 3RYFE 5T3NA 4ILBA 4GMP0 2BV4A 2YBSA 3RDIA 2KNDA 1XRUA 4C0HA 2YDSA 2I0MA 4G2AA 2VB6A 3X1DA 4RN5A 2LM2A 2BVLA 3MEPA 3RYHE 2X05A 1H2LA 2DWGA 2VMGA 5E16A 5KXEA 2D0TA 4HZFA 4BJNA 1HB2A 1VRH2 1AJOA 4KWKA 3JD72 1NAFA 1RUD1 5AVAA 5JIUA 3J7MA 2E7QA 1PGL1 4L11A 5CA1E 3RNSA 1JXNA 3C7HA 3ILRA 5FZOB 3I2IA 2AYHA 4E4DX 3SKVA 1SFNA 3AEGA 4S2GA 1VB2A 2EICA 2XXZA 4BQYA 4JGZA 4YSYA 1WCDJ 4IEZA 1NQJA 3NL1A 2EHOC 1W05A 2BGOA 3NZQA 1PNFA 4O4JE 1RJ7A 5GZFA 4GKXA 4HFIA 4KL1A 2QZ2A 4COYA 3LB9A 3GMIA 2VASA 1L7QA 1J5WA 2WWVA 2VZOA 5FZBA 2RPAA 4E9KA 2X51A 4IT4A 5FAXA 1FOD2 5FY7A 2WJSA 4LA3A 4IESA 2CMRA 3H0OA 2WRAA 3RKOA 4DV0T 1W9YA 5LGUB 3ZYHA 2OA2A 3PUYF 5A1AA 4AI9A 5JDFA 2EHOD 3LPGA 2RMU1 4A4AA 2RVAA 3O1VA 3N3HA 1QOOA 4QD2A 3TEWA 4XZCA 2ZPXA 3W15B 2Q4SA 2R043 4K1ZA 5H9PA 3H9AA 2VMDA 4ERRA 1MZ5A 4BK5A 4DIQA 4EB6E 3AYDA 2FHRA 3B9IA 1GBGA 3EMRA 2V5YA 1XSRA 3VBUC 2WNUC 3SQOA 2W2IA 1AX1A 1MEC1 3SLIA 3DCQA 1PO22 2Y64A 4AFAA 2CXLA 2C5IT 1QJY2 4Y33A 4NROA 4O8SA 3J8F3 1OWAA 2IWGB 3UGFA 5IFTA 4FQZA 2XQ8A 1YFYA 3RWNA 4DEVA 1HG5A 2Y60A 5A7SA 1MS3A 5LJMA 4HTEA 4YRDA 2Z4FA 4X20E 2WMOA 1KRIA 4QB1A 2V72A 2ZKLA 1AR63 2WMNA 1Q3EA 3OGGA 3AXJA 1ZRRA 2WT0A 3K77A 3VBSB 1UKRA 3HJRA 2R6QA 3M4FA 4QX7A 1KNRA 2XJUA 2LHNA 4L2NA 4WM8B 3D0SA 3AA6B 5IYYA 5KDMC 1RMU2 2WNVC 1QJZA 4KNCA 3I59A 2MNGA 1UCXA 4AISA 2BRTA 1G9CA 4D94A 3AMPA 4BYYA 1EYBA 4XFFA 3AVSA 4DUXA 1W6MA 4QDQA 5JOWA 1J1JA 4ZU4A 5FZGA 5C70A 3THDA 2UURA 4PJMA 4Q25A 1W6QA 3I2OA 1LOFC 5LK7B 3AP7A 1QH6A 4IUGA 5IAVA 4Q4Y3 3KBTA 3ZSJA 3AA0B 1KS5A 3UUMA 5K0UC 2WQ4A 4W6WA 2UWAA 4K6BA 5AQRB 4DY5A 1S0CA 3AM2A 3D0TA 4LXLA 3CX7B 3AK0A 4LBKA 1BLZA 4PDWB 2JG9C 3UKTA 3MF9A 4QPIA 3GN5A 2JRKA 2JQQA 4UELA 1ACCA 2E26A 5JR9B 1HNXT 4M0NA 2LTNA 1H9WA 1IJ6A 3RYRA 2W1UA 4CP1A 2VVSA 4LF6T 2C24A 3OGJA 2WDVA 1MPXA 1O3SA 3T1HT 2A3WA 5JR7B 4FFHA 3UJQA 5FPUA 4C90A 1DU2A 4AHYA 4LBQA 3VKHA 1LOAA 3KGLA 4FFFA 5J09A 1RYYA 3OYXA 2VUAA 4H7LA 2W4XA 1RUC3 4W4ZA 1Y01A 1V6LA 3OUIA 4P5YA 2OLTA 1RUH1 4GWIA 4BB3A 3RHWA 1PVC2 1UKGA 4XUNA 4CCDA 1UZZA 4FPLA 2H6CA 2Z2SB 2P34A 3KT1A 1VBE1 2I74A 1YQ4A 5CAZA 3OGRA 1LTEA 3ONJA 3HAGA 3LKJA 3DPRC 4NXNT 1COV2 2RDSA 3KS7A 2Z69A 2C0ZA 3AE3A 3B7MA 4YZ2A 2IXKA 1ZRFA 3VBRC 3FX3A 4EN8B 1XNAA 3TAYA 3OD4A 3FZMB 2WP9A 5LNKA 5FYMA 1W6OA 5LBBA 3ZFFA 4CP0A 4YVWC 4GWMA 1T98A 2AACA 4O2AE 4OHYA 5FY0A 1OMIA 2NW7A 4AXOA 3KWVA 5FJHA 4JCKA 3H7JA 3IZOA 5A80A 1BHGA 3ZKYA 5FLIA 4D8MA 3I2KA 4M4RA 3UL2A 1QDOA 3GGLA 4CP9A 1ZRDA 3GCWA 3J7Yq 4GALA 2VKJA 3ZYKA 4H2AA 2X9XA 4I0BA 1UNBA 2D93A 4ES9A 1M06G 2XAQB 2RG4A 2XJTA 3IDEA 2W92A 4AEDC 1XE0A 2QZ3A 3LQCA 1XNRT 4YGCA 4RQPC 2RHPA 3F95A 2EAKA 3GJAA 2R1DA 4BMBA 3K3NA 4MGSA 2V4AA 1XQNA 3NKGA 2LW8A 3OGSA 4QH5A 3WNMA 1ST8A 4XHBA 4XYXA 4FXGB 1PK6C 2V09A 1XC6A 4NJ4A 2RM21 3GCXA 4MH0E 4HEAA 2KINB 1LENA 1GQEA 2RS53 3AZVA 4YW2A 4GJYA 4FPOB 4QHZA 3HIFA 2BDEA 3MA9A 3SITA 4HG6B 1WLXA 3N36A 2HWB3 4E27A 4TLFA 4AE2A 1RUOA 3LFIA 3ZX7A 4U2AA 2WYSA 3HL6A 1AR81 1TE1B 1MQTA 3UUNA 4K9SA 5FUIA 2B4KA 5KC5A 1GNZA 2JKBA 4META 3AMQA 2V6YA 3WD5A 3OBTA 2KWIB 2BYVE 1APNA 2ZX4A 4LF8T 5C2TA 2WO2A 5ACA3 2OKXA 1JODA 3WNKA 4DS0A 4ZOLE 1F5JA 5F1RA 4WBNE 3MK7C 1UURA 1S0BA 3POFA 3ZMSB 3QNUA 3O9XA 3ACHA 1OFNA 2LS6A 5B4XA 1QXPA 1V9U3 2W2UA 1WYCA 4U74A 3ZCIA 1JYTA 3PVBB 2GMPA 4WM7C 2CWMA 2A1XA 3CJIA 2NLRA 3IIIA 2V7LA 4NIAA 5IUQA 4J2CA 3I0QA 2PLV3 4LNVA 5HCBA 4A6SA 2WT2A 1NCQA 3GDBA 1O8PA 1CQ9A 4UW6A 1RUJ2 4E4HA 3AZWA 1GV9A 5LMUT 1CVNA 2EXKA 4HKOA 4XFCA 2DTYA 1WW6A 2XQAA 1O3XA 1XBFA 4DIDB 3WCSA 3IBPA 4O9EA 4XUOA 1WD4A 4G4FA 3TOJA 4NVPA 1L0VA 5GLVA 4IGUA 4JZRA 1H9PA 4IDPA 3BOPA 3RZZA 4QHOA 1W2TA 3LEIA 3AP4A 4HONA 1SDDB 3OY8A 5SV8A 4W65A 3SCFA 2WL1A 3NJVA 4DR6T 4I0UA 1PGSA 3EAMA 3HQXA 1FV3A 2DL1A 2RDNA 5DQ0A 4ZXLA 4QHBA 3POJA 5E0OA 4COVA 5IHRA 1SLTA 4E4SA 2JDHA 3I59B 2RJKA 1WCRA 3BKZA 5FZ7A 3SFEA 4P9JA 4PIYA 3U11A 2Z6EA 2WNEA 2WYFA 5AQJB 3ZKUA 2DFCA 4RSUA 1Q8OA 1W6QB 2VVEA 3HT1A 2V4VA 1C5IA 2J7MA 3LDQB 4UOJA 5GLWA 5EWSA 1REEA 1G6NA 1OD5A 1YRZA 3LA3A 3D8CA 4A44A 4YY3T 3ECQA 3VD3A 2CGNA 2HWD2 4F7ZA 1G9AA 3AZXA 5FYCA 2BZDA 4LIVA 4UW4A 1PO12 1FT9A 1QJX2 3RJ2X 4YWAA 4IERA 1J59A 1YQ3A 2CAVA 2MPKA 2VULA 3M7AA 4HN1A 2YEVC 2FCUA 3TEXA 4YVSC 5GLTA 4FPYA 1NLSA 4N9HA 2JWPA 4X8NA 4ZU7A 1KJRA 1MIVA 3RFRA 4YZ1A 1W03A 3AKRA 4LF7T 4BQ2A 2OZ6A 5FBZA 2GH8A 4UW5A 1ZZ7A 4LBQB 1SBEA 2FDJA 4PFPA 4D6RA 2VUDA 5IVJA 5A33A 2H89A 2W63A 5FP8A 3SNMA 4FTEA 4HL0A 1OXZA 3OTOT 1KJLA 3ZM8A 2Q0AA 4XILA 3JAFA 4QU1A 4OFZA 2ILMA 4ONUA 2WAUA 5JDMA 1LOEA 1VCTA 1FEWA 2WSSV 4JUYA 1VBC2 3B93A 3DKQA 1BK0A 1N3OA 5B4NA 2WS91 3WVJA 2WNUA 5I8SA 2A2FX 1CX1A 2VUJA 4Q5OA 3C51A 4TV8E 1PVXA 1RIRA 3ONLC 5SV5A 1W28A 1PZ8A 1WMEA 1RUG3 2QKDA 2Q9QC 4NHYA 4DXSA 3BTYA 1MNEA 4WBOA 1I3HA 3HKEE 3UUXB 1W6OB 3ZFFB 4YW7A 3MACA 1XE8A 5FO9B 3DTOA 2WM9A 4XTMA 4IXLA 2XJQA 3U37A 1IKPA 2FDIA 5C8CB 1Y9QA 4YPJA 2X67A 4NRPA 1FMWA 1Q8PA 2VVNA 4A98A 3GXUA 3AE7A 4KHZF 1UO9A 3AJZA 4OMDA 4LLFA 5GZDA 2Q9QD 3U4SA 3NBXX 1D0GA 4LLOA 1VBB2 1BBT3 2A6XA 5EV7A 1XNBA 4OQ8A 3RIAA 1NUKA 2VO5A 3T1YT 4XABA 1W9SA 1K5MC 1V6NA 4JI1T 2EAAA 2WNVA 4CDXB 1WCUA 4GMP3 4I09A 4XF0A 5JOYA 2XAGB 1SBDA 2A73B 4XW3A 3M70A 3QBQA 3EI0A 1F35A 3WP5A 5CKNA 5AQTB 1R083 5FL0A 1LOFA 4FVVA 1Q8SA 3K75B 2YYOA 4AQTA 3OSDA 2ZHLA 4AL9A 1RUI3 4RHV1 3OUHA 2B76A 4DR3T 3T08A 5K0UA 4O4LE 4CCKA 2V73A 2WBKA 1SUMB 4AAXA 5ADXL 2WLPA 1N1TA 4A6OA 4WVWA 2JG9A 1I5PA 4HMZA 4DFSA 2D6LX 5A7NA 1TME2 1PMJX 4PF5A 2XL7A 2ODUA 4L9IA 5DJQC 2PFWA 2XBO1 4XJ9A 3VD9A 1W9FA 2W46A 2PHWA 4H9NC 2VMHA 1DQ5A 1TMF1 3BIEA 2BFUS 4BISA 3FC0A 4M3CE 1T6GC 5HCHA 1PGW1 4WVMA 2V6YB 2P9BA 3M3OA 3H1MA 2WQZC 3VLBB 1RUF1 2CGPA 3NRUA 5T54A 4GULA 3VV1A 2CSGA 2VQFT 4RS5A 2UWBA 5LATA 5FBJA 5L3GB 3PUAA 5M0TA 3WINE 4AI8A 3MF6A 4LHSA 5IWFA 3AYCA 1C57A 1C3HA 4HKLA 5JTGA 3B69A 2RMU2 4PAGA 2B39A 3W20A 4Z07A 4LMLA 3Q8BA 5FOBB 3CKDA 1U0AA 1VLNA 5A70A 1QJEA 2VMFA 5LG3A 2DV9A 4MV2A 4C91A 4D6SA 4H9SE 3DPRA 2WS3A 2DCKA 2W61A 1HB3A 2XAHB 3T2QA 5FPVA 1VOMA 3IMNA 1DG6A 4PBPA 1VJ2A 3ZYRA 3VBRA 3WW2A 4JLEA 4QXHB 1H2MA 2YBKA 4SLIA 3AEBA 3L39A 1MEC2 2BW8A 3E22E 2Z5WA 2EXHA 4URTA 3K51A 2JDZA 3HNBM 4JRAA 4ASKA 2ZZJA 4NUBA 1OUXA 1Q8QA 2DUQA 3MUY1 4R4ZA 1J83A 1XYNA 3VKNA 5FVLA 2Y26A 3AB0A 3C4XA 4JKMA 2ZEWA 4HANA 2YROA 4FOQA 4OMCA 1C1FA 2GU9A 1G9BA 2BKOA 2DCJA 3U75A 1A34A 2UYAA 5JH7E 3WEZA 1FV2A 2ZGRA 4UR9A 4RGAA 4I4TE 3ZFGC 3VKLA 3RC8A 1D4VB 3BPSA 1KXGA 2ZGUA 4LKDA 5HCJA 4U72A 1D1CA 4DV6T 4HK8A 2OIIA 4QX8A 1BR1A 2D40A 5D2AA 4AEDA 3CK6A 3VZLA 4EXTA 4RQPA 2RR13 4DR7T 2IC6A 3ZC1A 3ZFEB 4HVOA 2CHHA 1KD7A 3ZSLA 2HBUA 3ZMNA 3IHRA 2NYYA 2ZHMA 2L3LA 3MFCA 4LHKA 5ABFB 3I54A 2CDPA 5FPZA 4PF1A 1CPNA 4YGDA 4CDWA 3AA7B 5L9RA 4LMJA 4QU2A 4X5TA 3IDBB 5FZ9A 1VMHA 4EN9B 1HG2A 3PJYA 1LJ7A 1GZWA 5FY9A 1H2KA 4ARXA 4V2VA 4Y4YA 3IWZA 1WGPA 2AEYA 3Q9DA 5IK8A 1MIYA 4FFGA 2VZ3A 3AYAA 3TBDA 3VRAA 1K45A 1XPWA 1W9TA 3WP3A 1CJPA 2ZGNA 2W5FA 3Q8AA 1UU5A 2J1EA 3M2MA 2EA7A 2JDPA 2V8SV 3ZMVB 4OYJA 4A42A 4WM7A 2TEPA 2CBJA 1G9FA 2LROA 4BXSV 3VD4A 1RUH2 4DUZT 5FDBA 2XQ5A 4HPKB 4KU7A 3VZOA 5C8YE 1HXS1 1UU4A 3VDBA 2WNUB 1IS6A 2VZSA 3PHMA 5H6RB 5DUUA 5IVEA 1SACA 2E63A 5A6XA 3QH7A 3WV6A 1F31A 1VBE2 3R6NA 3UU4A 1RHI1 3BOWA 4N43C 2VZQA 1NWMX 1ND2C 2UU9T 5EYXA 2BZBA 1NAEA 4GK5E 3PUIA 4M01A 1YKEB 1REDA 3CBNA 4AYUA 5EJ1B 4NPLA 3PJAA 1QWRA 4O7XA 5J0ZA 4G63A 2WZ8A 3CO2A 3HQUA 2BOIA 1F15A 4K3UA 5I8TA 2XWJB 2BGCA 3LEGA 2P3IA 3RZMA 1R1ZA 2PHTA 2VKHA 2PMWB 2YBPA 3AKSA 3JUUA 4AHXA 3SFDA 2BU9A 2H0VA 1HRI3 1R091 3RJRA 1D0XA 1SQ4A 2VBBA 4FP3A 5DUWA 2CRBA 1JYWA 1W8WA 4J1XA 2RE9A 4OUEA 4D0QA 3LBXA 3S30A 2RS32 4JI3T 4LPLA 1OKOA 4HWIB 2IC9A 5LK5A 1H6YA 2D43A 2LOSA 3CZUA 4P9IA 2X09A 2JDMA 3FUQA 2V7KA 4Y5TA 1ZP0A 2A70A 4H55A 1VRH3 2CBIA 4QT6A 1U4QA 3JD73 2F4VT 4DEQA 2CL2A 5J1XA 3PTYA 5CG8A 2XR4A 3H8OA 2LSJA 3PVEA 4LE3A 4YHJA 2QVSB 4DRVA 2P6CA 1LOBA 3I9WA 1TNFA 4QKFA 3O14A 4HXCA 3KF5A 2XHKA 1BR0A 4AEMA 1DQ6A 3R05A 1J3QA 3JB8A 4QX3A 4BQ1A 4YVSA 2JB4A 3B5LB 4LIUA 1HQLA 4WVZA 5FKCA 3X29B 4PFOA 1QEXA 1CX4A 3AVRA 3LG7A 4Q2FA 4UV8B 4ZXEA 2DU0A 5HEGA 5HXMA 3CWZB 4Z82A 5A1LA 2XQ4A 1FOD3 1ZBA1 2VNOA 5F8PA 1YQCA 3I2GA 3S7IA 4IEVA 5FY5A 3L09A 3E97A 1W0PA 4WVMB 3HR9A 5I0DA 4AZZA 2VNVA 5CKMA 1AR82 5L4HA 2GZWA 3PJAJ 4EWDA 3PE0A 1XNKA 4RS5B 3K3QC 1KFYA 4HKWA 1RINA 3ACIA 4FP2A 4FPCA 3CQXC 3GBWA 4COUA 4Z8BA 4B7KA 4H9OC 4CUGA 2P3KA 4X66T 1XDOA 1YKHB 1DBNA 2QQMA 1BMV1 5CVRA 1W8OA 2VE1A 1URXA 4GH4B 2W91A 3K3OA 3MLLA 5I93A 2ZMLA 4DV3T 1LEDA 2N9DA 4AVVA 5C3SA 1I6XA 2C6SA 1HDKA 1DQ4A 3JAEA 4WW0A 1PO23 4NRQA 2Q1FA 1NE6A 3DYMA 2X0HA 2MEV1 3VHPA 5FXVA 1QJY3 4AF9A 2Q9QA 2XJ7A 4CE8A 3H3AA 3FHNA 5APAA 1JZ5A 4ZI2D 2YGLA 3CF6E 5M4YA 2XJPA 4QGNA 3E5UA 4XJ8A 1YWKA 4CQIA 2CE7A 2JX9A 4XCAA 4FOVA 2B42B 3V0AA 3P4SA 4BQWA 4XC9A 1WLDA 3R4SA 3V56A 1PIV1 2AENA 1JYVA 2YDEA 1AL0G 5CA0E 4NR1A 3V5SA 3MIFA 2LRLA 2V5DA 5F3JA 2EF6A 5I0RA 5KHKA 1WCSA 1W2UA 4EV6A 5LASA 3T3YA 2XSAA 2VXRA 1R1A2 4QB2A 2V7IA 2CV6A 2ZACA 3RZLA 4ANJA 1RMU3 3ROUA 1OSGA 4QB6A 1K5MA 4UF0A 2DBIA 3FBLA 2E9XB 3THCA 2WO7A 3PUQA 4TWTA 3C4ZA 4AEDB 4W50A 5JI7A 2RP4A 1LU1A 5TAOA 2NM1A 3PUXF 5GKAC 1UMZA 4O4HE 1W8NA 4E8DA 3ZSTA 2FDFA 3CMGA 1MZEA 4NIIA 1IBMT 3KQ4B 2Y8KA 1LESA 2CHOA 2JQ9A 2C26A 2BNMA 3P6BA 2V26A 2W39A 3FLRA 1X7NA 3SISA 5KWRA 3AE5A 4CDWB 4YJ2E 3HT2A 1UYZA 2ZM6T 4KGGA 4YSFA 5EK4A 1RUC1 3W5MA 2JICA 1QSDA 2OT7A 3VBSC 2QNKA 4AOCA 1FNZA 2DCFA 3KCCA 1QF3A 1XYOA 1DIWA 2XVLA 4KG8A 4WM8C 1EAH1 3I0OA 2E31A 5IATA 3BQIA 3D82A 5LOVE 3ZJ1A 3BYWA 2GALA 1SFPA 1HJGA 4CA9A 2CEAA 3WW3A 4QX0A 5F3GA 5LA0A 1QLBA 1X9PA 3RWKX 1JU3A 2GMMA 2Y6GA 2HKXA 3QACA 1F2NA 4EZ4A 3P3PA 4AFCA 1PVC3 3LCPA 1TG7A 2XHNA 5CFCC 4DNYA 4WM7B 3TNPB 3VZKA 3ZYBA 3JC6C 2AC1A 4HVQA 4I3PA 2JG8B 2XMLA 1HV1A 4L0PA 4NRMA 3RI9A 3ZYLA 4OYUA 4IREA 1OF3A 4PDWC 2D5UA 3BGAA 4WVVA 1COV3 3H3ZA 1VCSA 2WZIA 5L3FB 4FXKB 3AEFA 4D7YA 2GNBA 4Q1PA 4NWWA 2SLIA 2YFZA 5CADA 3WI3A 1QNYA 2B45X 2MBGA 5JR9C 1CZVA 4PQQA 1C8M1 3JQXA 1IPKA 2OA5A 2WS92 2L9LA 4JKLA 1A3KA 2IIUA 5CIRA 4JI8T 1SFYA 1UU6A 3OCPA 3LE0A 4P9WA 4PI0A 5JXJA 1UX7A 2Q8DA 3RSJA 3QD6A 4CPBD 3UKVA 5JAXA 2VVFA 4W6YA 1WW7A 3BK9A 3TB0A 2HN1A 1OH3A 3AC0A 3VBHB 4MHCA 4B1MA 3S0MA 3ZFGA 4YTPA 2BOJA 5T55A 1H2NA 1C5HA 3V64A 3EHZA 3ZMOA 3DP7A 3EB7A 5FZMA 2ZAHA 3JADA 1WBLA 5J98B 5JZGA 5C3JA 3CJXA 4O9GA 2G9ZA 4YZ5A 4OUSA 3T1LA 5BYNA 1QHDA 1OI6A 3J9X1 3P1IA 2WB5A 5JPMB 2DCTA 4R8HA 3ZT5A 4IV1C 2XDVA 4LO7A 4NHKA 3L9JT 4QXCA 2JMHA 4L0RA 1WFDA 1Y43B 5FZ0A 5A3NA 1ZA4A 1U5YA 2NP0A 2K46A 4RHV2 1GKBA 3NMBA 2GNTA 1BYHA 5JI9A 1F4HA 4BMEA 5IJRA 5J1GA 2WDRA 1QQP2 1JYIA 3TLVA 4IDZA 1GU3A 4EN6B 2BQPA 3PVNA 3DEMA 1NA1B 5JDLA 2KT9A 1ND3B 1MACA 1GOGA 1RL3A 2XBO2 4B4RA 1UUSA 4Y1YA 5FYYA 1NZIA 1TMF2 2OZJA 1ZNPA 2FZ1A 4Y1XA 4ZZ5A 4AGRA 4DMVA 1PGW2 5BPXA 3WCRA 2ZHNA 2E5LT 3K2OA 3MIHA 4TN7A 3NRYA 5AQHB 2QQVA 4CEWB 4NAMA 1RUF2 4LHLA 5F37A 2M67A 4CUCA 1ZZ6A 3POIA 5AQFB 3DKWA 2W62A 3AFGA 5JOXA 1STMA 2R7EB 3WF2A 4CXWA 3AAEB 2GAUA 1C1LA 1GP6A 1RUJ3 1UW8A 1XDPA 3I3EA 1LRHA 1N1VA 1HV0A 3ELNA 4JI4T 5LGNB 1O5UA 4HFVA 3ZC0A 4AIUA 1HN0A 4N43A 2KLQA 4U3CA 2VK9A 1ND2A 4TX5A 3MIGA 1Q8VA 3V0AB 2XWBB 2VQAA 5F3EA 1YI9A 1O91A 2ES3A 4QQLA 4MG2A 2EIGA 3BN6A 3HKBE 2XQXA 2NPIA 3UETA 1YLLA 5CU1A 2NR4A 2Q30A 2TNFA 3FN9A 1EUTA 1HKDA 2NN8A 4PI2A 4ZEYA 2XQ6A 2W3JA 2CM0A 4Q4W2 1WW4A 2LHRA 4IEPA 3F31A 2DVAA 1JH5A 1WRDA 5E6HA 3TLTA 1K5MB 2YFUA 4UF0B 4CXYA 4HFSA 4LBLA 3SCHA 2CCQA 3MIEA 5F5QA 1LHNA 4ZY9A 4TUYE 5FIXA 1LCLA 4EWEA 1ASJ1 1UX4A 4DNDA 4YM3A 2BTVC 1NYWA 2UXDT 4F8HA 2YXSA 1GZTA 2BKPA 3ESLA 4P08A 3SH5A 3PTRB 5EHDA 2V7JA 1PM7A 4JTNA 5LW9A 2DU1A 3AL6A 2KWHA 1K42A 4DBQA 2K5BB 1OEDC 1FNYA 2E2AA 2NP9A 2BUKA 1US7B 3SWHA 2HWD3 4QPGB 3P8CD 2X9YA 1H8TC 2GK9A 5IFPA 1PO13 4CI3B 1QJX3 1U5XA 2YDRA 4A45A 1RXGA 3P7IA 3KVAA 5C8WA 3WUCA 1ULDA 2J1DG 1N3QA 4BHPA 4EIWA 2WSVA 1WR6A 2FQPA 5FO7B 4HETA 4TWHA 1PMIA 4CCCA 5LB7B 1GLHA 2GMEA 1QY4A 4A56A 2Y48B 4ET7A 1LGNA 4B4QA 3WDUA 5JXIA 4Q0UA 4AI3A 3QB5K 2ZAAA 4AFMA 3DJBA 3N5LA 1RITA 3WZ1A 3ZN6B 4YXDA 3JXSA 2EIDA 3ZIXA 2CWSA 2DVFA 3WQ0A 4ADZA 4Q27A 1WLTA 5DZFA 3T0AA 1UXXX 1AL21 4DY3A 4YFSA 5F3CA 2WIIB 5IVFA 5L47A 2XY8B 3GM8A 2Z79A 4Q8KA 5LA1A 5FZOA 5KXDA 1VBC3 4NXMT 3ZYPA 2QVAA 3CMLA 1B35B 5IVVA 1E5RA 3W5NA 2W67A 1PZ9A 3KFWX 3GYDA 3NNJA 4PIXA 2W08A 4N90A 1ZEEA 1FJGT 2LRPA 4P14A 3WP6A 2XVGA 1HNZT 2EIBA 1JNZA 4XMAA 5D1IA 3RVHA 3A7MA 1UAIA 2VD7A 4AQFC 1POV1 3O1IA 5HXRA 2CU5A 4FPEA 5LBEA 5DAVA 2XKPA 2G19A 1W9WA 5JXHA 1UK5A 2CGOA 4YTMA 3AE4A 4AQYT 1ZBE1 3A23A 1RHI2 3AAIA 4A7YA 2ACXA 5IT6A 3NJZA 4MUVA 1VBB3 5CZKA 1QXJA 1HIXA 2PELA 3URFA 2ZX1A 2PTFA 4IW3A 3O1JA 2VGDA 2XZEA 2QDNA 1RUI1 3H3LA 2VQUA 3L8RA 2ET7A 1XMQT 2D6MA 1T6BX 1AXZA 3M3CA 4CEYC 2DF7A 4HWDA 4JV5T 2VAUA 4ILCA 4LBQD 2Y6JA 2OVUA 1R092 4JAAA 1ZVFA 3FHQA 5FCCA 5FYSA 3ZT7A 5JZGB 2ET1A 1JTZX 3B5MA 2HH9A 3ZFFC 3UU6A 5FPAA 4K0UA 3MV01 3ZXGA 4JI0T 2L9QA 2RS11 3MW2A 4PW8A 1GNYA 3B02A 3NVOA 4ZHQE 3SCGA 2RDQA 2K9ZA 2TUNA 4AFDA 4QXCB 3VL8A 5C8CC 3AX4A 4SBVA 3FZFB 5AQVB 2MTQA 2NQYA 2WWJA 1W99A 3RIFA 3I3MA 4FPGA 1TME3 2VOVA 5FY1A 3LJCA 2XVKA 2VBPA 4RR3C 1RUE1 3CQCB 4WM8A 4MVTA 4AHWA 4CDXC 5I0SA 2D6PA 3ZPOA 4LO6B 4Z92B 2YC2A 2QTWB 1HQWA 3R6SA 2E7AA 4DRRA 1X82A 5JDGA 3WDTA 3IMMA 4X64T 3AE2A 4BQXA 1ZBA2 2J1RA 2N1GA 4XOGA 3ORJA 1YFWA 1GQPA 2XJRA 1S35A 5JDNA 3O1OA 1F4AA 5FYHA 2X68A 1DZRA 5CFCA 4AXPA 4P9YA 3PUWF 4UBHA 2RMU3 3FMGA 3ZXAC 4EYUA 3T1MA 2XJVA 2YB7A 3UYJA 3E6CC 2A5ZA 5IK5A 2LSYA 4JKKA 1LECA 2A72A 1AYM1 4PDWA 1OA3A 3I3BA 1A8MA 1BMV2 4OI2A 4HVRA 4COZA 2LSGA 1I1EA 2WUHA 4NIHA 3FE5A 1HQNA 2XSBA 5JMCA 5DAQA 2WA4A 2R061 1WUVA 4N43B 1MEC3 4ISQA 4ZS3A 3WW4A 1XMOT 3ZXFA 2MEV2 5FYUA 4Y1UA 4OI1A 4X65T 2W1QA 5JOZA 4HWCA 2ZGLA 3VKMA 1JI6A 2XJSA 1NT0A 2HWF1 4UFLA 1ZX5A 2XPJA 5F2WA 2FCVA 3HMYA 4S2HA 5FZHA 4B1LA 4CU9A 1PIV2 1Q5OA 3VHLA 3OYWA 5BNOC 1JZ4A 4AVSA 1PX4A 4XF9A 4XAAA 4HK9A 3ACGA 4AKHA 3AEAA 5FNVE 3ILFA 1WLWA 1LHUA 3POWA 4Y20B 2VOKA 2W1SA 5LHIB 4DINB 3OVUA 4PCRA 1XB9A 2XB6C 5FP4A 2H88A 4OVEA 1S2BA 2BWAA 4XACA 4CRQA 3R0RA 4KHPT 3DF0A 2G9GA 3KCXA 3I3QA 5LXTE 2IXHA 3TEYA 4IV1A 1VB4A 1V6OA 3MIDA 3F2EA 1Z7S2 4Q0QA 4IV3B 4YGEA 2D3PA 3ZCJA 3N9QA 1PZ7A 4KMQA 5IK4A 4FPKA 3UULA 1JZ2A 3IEEA 1FPN2 5F39A 1ODMA 2H6BA 2HHHT 5L19A 2OS2A 2F4LA 4XBQA 3HN3A 5I8YA 4EN0A 2ZBJA 3ZSEA 4EGWA 3WXPA 1JHJA 3WAJA 2VCMA 4X6QB 5T50A 4JI2T 1D2SA 4JYAT 4V1PA 2YY1A 3WW1A 2I59A 4RYDA 1EAH2 1ALYA 3ZFEC 1RTVA 4N78D 3O1HA 2VTFA 3C8XA 2GP5A 4JEUB 1BXHA 4P9LA 2K9AA 3OD0A 1UCUA 2NZ9A 2KZ7B 1OPMA 4QM9A 3POBA 4UBGA 2G0UA 1WBFA 3I97A 5KHIA 2E51A 2JIJA 1RUH3 2HBTA 4IE0A 1RJ8A 5LRSA 3ZSMA 4AEKA 1IHMA 2PAMA 2FD8A 1BR4A 1EP0A 4UXAA 4BE3A 5T5JA 2LJLA 4LA2A 3LF7A 4MGTA 1VAMA 1H1IA 2WZHA 5J2TE 2E5VA 1SHZC 3PV0F 5LA6E 4XEZA 1VBE3 2XGXA 5EJ3A 3FBMA 3IDAA 1S0EA 2WR9A 1HN1A 4LBMA 4NWVA 3IDCB 4FCAA 3LK2B 5LCYA 5A7QA 3WNPA 2HWC1 4EOZB 3WSOA 1UOBA 2W52A 5FK7A 4PIZA 3O1SA 3AMMA 4QX1A 2WZR2 3UESA 2CWYA 2A9UA 1C8M2 4TSVA 3B13A 1H4GA 2VR4A 1ENQA 4TNWA 1W0OA 1U5PA 5C5TA 3MPBA 3HNMA 1ENXA 4NPMA 2WO1A 3WNXA 3AP6A 4X6RB 3VRBA 1ZHCA 2NW9A 2ZX0A 3T4HB 4N7UA 4K0KT 1L7LA 2VL8A 4LITA 1B09A 2VMIA 4J25A 2X5IA 1N36T 1CAXB 2RS33 4Q4X2 4CCLA 3ONXA 3POYA 1ZZ9A 1OA2A 3PMEA 2QDRA 2VUCA 3C3VA 5EP9A 3CNAA 2V7MA 3VHRA 2CLYB 4C8DA 4IEYA 1ULEA 1OA4A 2ZGOA 4DO0A 3ZEFB 1WYBA 3AZZA 2NMNA 2X9HA 1OEDA 3GZTB 5IK7A 4DXTA 3I9YA 1YEWA 2A7AA 1WW5A 5F5IA 5IW0A 2FMYA 4U31A 3IM0A 4E2SA 1H8TA 3H50A 5C9AC 1H7CA 3CHXA 2XH6A 2A3YA 3R4UA 2X66A 1W0AA 3EABA 1S55A 4AQ6A 3LGRA 3GALA 1N34T 5CNAA 1NENA 3MKDA 3UTKA 4KBMB 1XJAA 5GLZA 1WCQA 3RGLA 3VGIA 5BY5A 1YQ5A 4YG0A 5KXJA 4IGPA 1UXZA 3DN7A 4RGGA 2QQWA 1OKQA 4CCEA 1MMDA 1QU0A 2W1WA 1AR83 4LO8A 1RC6A 4Q0PA 2R071 3VZMA 2OXBA 5FXZA 1FYUA 1T7SA 1KK7A 2LSKA 5FREA 1MS9A 4Y22B 2HH7A 4ZZBA 3WOGA 2DTWA 4ITCA 5JQGE 5CFCB 1FAYA 1O7FA 4Q29A 5FXWA 5JRCA 3E6BA 4K21A 2JXAA 1KDMA 2WLQA 5A6ZA 1FX5A 1YHFA 1KGYA 2GC3A 5J7MA 4MALA 3I2FA 3USUB 1UN1A 2C5DA 1IGOA 3Q5DA 3FFZA 3KVBA 3J7NA 4AQFA 4CU6A 1GZ9A 1AR71 1NE4A 3N9LA 4XFIA 2D2SA 4YZ3A 2VECA 4PLOA 4MGIE 4H9QC 3PIJA 5DDJ1 3RYPA 2XG3A 3RF1A 3CU7A 5LHHB 4EROA 3C7EA 4RS5C 2C4XA 1O3RA 1SLIA 1R1A3 3BU7A 2ZXQA 2W95A 2HJIA 3E5QA 4XF4A 1Z78A 5TSWA 3AMHA 3BQLA 1CIYA 2DURA 1RB8G 2WAAA 3OYWB 4LF5T 3GNEA 4IEOA 1DGRN 1NG0A 5HXCA 4YT0A 4GH4C 4EAHA 1IPJA 2FCTA 4ATEA 4GJZA 5I0UA 4CEYA 2DVDA 2PTMA 2WQ8A 3PJQA 4U36A 2ZEXA 3TN91 4AHZA 1CESA 2H0BA 2Y6HA 2ACZA 2HWE1 1SCSA 3APBA 2JQKA 2KA3A 2XOMA 4YNIA 2PFVA 1CN1A 1UWWA 5FYZA 3NWKA 1MS8A 1CR7A 3HN1A 1ASJ2 1RGSA 3QLQA 4Y5Z0 1TZOA 2JEMA 1W0NA 2YK0A 4IV1B 4M0HA 3HKDE 4CN1A 5C8CA 3S7EA 1SLBA 3ALQA 4LFCT 1LB2A 4OQ9A 2CTVA 4XVHA 1ZZCA 3NW4A 3UQ4A 5HCMA 1ONAA 4BPZA 1XU2A 5HXVA 5ABHA 1AYN1 1Y4WA 4BZ4A 4RR3A 1V70A 3HKCE 1OQEA 5FK8A 1Q43A 2XAJB 5A7PA 1EPWA 4CDXA 2WZEA 3GZUC 5D8AB 2E9XC 4IE7A 1YW0A 3OTFA 1YXWA 2V1DB 2VXJA 3N7MA 2XPKA 4OULA 2YDQA 1XWMA 3VBOA 1MS5A 4WV8A 3VL9A 1MMGA 4L99A 4EJRA 1HW5A 2NMOA 4RFRB 1OXCA 3ZSKA 2W00A 4WZCA 4R9BA 1ULPA 3Q8EA 3HVDA 3UU8A 3GZEA 4QAWA 1YCIA 3PUHA 5L73A 1D7PM 4D3WA 3KV4A 1H0BA 2E9XD 4QWNA 4AWDA 3O0WA 3RYKA 3ATGA 1VBD1 4CDWC 3S5AA 2XASB 2CYFA 1JW6A 2IXLA 5AFUL 3A5XA 3G06A 3S5QA 5HCAA 3LDRA 1AL22 5LZ6A 3JQWA 1J84A 2G1MA 3RQUA 4GD4A 1N47A 5KXCA 1WMDA 4AI0A 3RC3A 2UUBT 5FXXA 1JU4A 4ZI7E 1ULFA 4UFMA 2WS93 3ACLA 3ZDSA 1A6CA 3QCWA 2DI4A 4D7SA 4P02B 1BEV2 3FBYA 4DVDA 3U14A 3LPFA 3WDXA 2JDNA 4IEQA 3N7KA 4L8QA 1U12A 4AEJA 4E8CA 4XETA 4GA9A 5FYIA 3VDDC 1W0BA 3C50A 1JYCA 1P8JA 1DHKB 3JBG2 4BAYB 1YIFA 4K1YA 3P4PA 3POGA 3NVCA 4I2OA 3I1AA 1ZBE2 5BNOA 4TZDA 4KUMB 2X5IB 1DZTA 3IF8B 1WR0A 2JG8C 1W8ZA 3S4UA 3ABZA 5FZAA 2X53S 2F17A 3A21A 4AI2A 4IEUA 1Y64B 2XKOA 2QQIA 1EZ3A 4CDQB 3A4UA 4XBNA 3KV9A 1O6UA 4ILUA 4AKGA 3OBVE 2NTYA 1ZREA 3WF0A 2Y0IA 2MPFA 1D1BA 4QXHA 4R4XA 1OEDB 1UL9A 3UT0A 2R1BA 5FWEA 1OURA 5LEKA 5L36A 2JKXA 1ZKEA 1H8TB 2HPLA 4DBRA 2Q8CA 1B7TA 3NJYA 5ABJC 1IBKT 5ABEA 1IS5A 2Q1ZB 2LLYA 4YGBA 4BXFA 2J1TA 3IN9A 2XQ9A 5GM0A 4RHV3 2RS12 3VBHC 1N3PA 3T2OA 1M7KA 1FXZA 5A3LA 4WBBA 3AEEA 2OQ7A 3T09A 3CDZB 4J6GA 3K48A 2K3WA 3SEPA 3SS1A 1QQP3 4TWDA 5ANNA 4BWOA 1HB1A 3NKZA 4GWJA 1CPMA 1SLCA 5FRAA 3ZXEA 4K8FA 1E7PA 1MS0A 1W2OA 3WLUA 1V6JA 4XTPA 3LOBA 1J5ET 3VUOA 3LEKA 5CB7A 4CU8A 2XBO3 4QKDA 1RUJ1 1O59A 1RUE2 4R9CA 3KB5A 1MR5A 1TMF3 2J1UA 3ZFEA 3WUDA 5AQGB 1HF8A 4LF4T 2J1VA 1J3PA 4HN9A 4UT5A 1MNDA 4AKRB 3AKPA 1W04A 5HEHA 5ABFA 3WR0A 2A6VA 1RUF3 1JHNA 2ZMNA 5BNPC 5JRCB 4U7IA 1YFUA 4BM8A 1G8WA 3WNNA 3PUSA 1DFQA 1T72A 4XDOA 2ORZA 4AI6A 3VKGA 3MIBA 3NNGA 2C5KT 3RIUC 4Q26A 5FZCA 3AB3B 4Z2WA 4IL7A 3GA8A 2XLFA 4P0BA 2VZRA 3N2GE 3KD4A 4WNKA 1Q56A 1AYM2 1W8FA 2Y8DA 1UYXA 1NA1C 4PLMA 2IXIA 1VP6A 3KT4A 2ES0A 4QDRA 1ND3C 3ZSSA 1QJU1 3AECA 2JIGA 2R062 5IYZE 5FMOS 1O4ZA 2BVBA 1HFAA 1W90A 3IIAA 4A41A 1I94T 4XBFB 4OK0A 1V6KA 1OC1A 4Q4W3 2MAWA 1JOBA 1CGPA 2HLEA 1IZ3A 5LB6A 5LBMA 4DMIA 4YM1A 3AE8A 3ILNA 1LVFA 1QOTA 3LFMA 1W8TA 4HBNA 5EYYA 2ZEZA 1D4M1 3NO8A 4CEWC 5FVKA 2LT3A 2HWD1 4X8PA 1GQGA 1RUNA 2CXFA 5IWAT 4CEYB 2HWF2 3VD5A 3NV1A 2X8KA 1T8BA 4XCBA 3CEWA 4HPKA 1E5HA 2VW1A 5HEOA 1UY4A 4K8RB 1E1HB 3W9AA 3EVYA 4NMIA 4L97A 5KBFA 4B3TT 5A3PA 4KMCA 3N7LA 3O12A 4GB31 1ZZBA 1VIWB 4L92A 2WFF1 1BZWA 3DXUA 4M4PA 2NTXA 1DYOA 1OLRA 3D4KA 4HWFA 3RMYA 1YC61 2O1QA 3EJKA 1REFA 5E89A 2R0HA 3U4XA 1N33T 1GWKA 3V5UA 4YLHA 4BA9A 4XXPA 5C9AA 5CJ5A 2CA5A 4U33A 3UKNA 1VBA1 1X9TA 3BTXA 4LMKA 5LHGB 4MGQA 1YNAA 5C3PA 1AJ3A 1SMVA 2Y6XA 4RR3B 2P37A 1R64A 3OJBA 4LBOA 4MXWB 1XNTA 5FLJA 1LHVA 5HCFA 3ZN0B 3CPZA 3TLSA 2ZMKA 1QXRA 3KV5A 1W3XA 1DDLA 1OQDA 3OB8A 4IL4A 2C9KA 4QPYA 5A7WB 4XZPA 3VBOB 3AE1A 5JCTA 1UGOA 3PLQA 1IG0A 4YM0A 1RVF1 4OHWA 4DUYT 3N35A 1V6IA 3ASIA 1C8NA 5FZKA 2R30A 5CFDA 1SZBA 2ERFA 4OCTA 1GP5A 2YZ4A 4QDSA 3AMNA 4QWNB 4CCNA 5I91A 5DABA 1Y9GA 1MMNA 4F3JA 4QPGC 1JNRA 4FPJA 5FZLA 4BH9A 3OUJA 2E33A 5C3RA 4Q0SA 4BDVB 4WZFA 4UWDA 4P00B 4DOUA 3QOPA 1RUD2 3C98B 4M1PA 3Q5EA 1PGL2 3Q8FA 5CFBA 3F2ZA 3GHMA 5HPOA 4AK3A 3MLKA 3OBRA 2BG9C 3FLPA 3OPTA 5JDQA 2LKGA 2BS2A 1I5ZA 4Y1ZA 4HFCA 1WD3A 1RXFA 4OZXA 5L9VA 1A78A 2RJLA 4XPVA 4FBFA 2D7FA 1GZCA 2VW2A 3O0XA 1HR0T 1RHI3 3BODA 4ZKTB 1J3RA 3MO4A 3OBAA 3QB5A 5AC91 1POV0 2HWC2 4OHXA 4A3ZA 2WN3A 1JZ7A 5CYYA 1GQHA 1KITA 1AR91 3ZXDA 5BNOB 4XQWA 1R8IA 4W8JA 4DMWA 5F2SA 1ULOA 5C6CA 4GH4A 1LEMA 1V00A 1JUHA 4XAEA 3JCIA 2JD4A 1B35C 3EDUA 4A3XA 1R093 2Q8OA 1J1LA 3H8UA 3MJXA 1TME1 1XNDA 3K1SA 1BK1A 4PNIA 5F5AA 3J26N 2BVMA 4FAGA 4I3GA 4TWFA 4TLGA 5AFEA 4QX5A 2AZ5A 4E2QA 4JI5T 4UEMA 5LG4A 1EV11 4XDPA 1YJLA 3BIWE 4P09A 4MO3M 4Z8XA 4LQRA 1XOYA 5FR3A 4N8MA 1S4CA 5FKBA 2WDBA 2LE8A 1JMUB 3CQOA 1W6PA 3KF3A 3LOIA 5J37A 5LY1A 2PAEA 4RD7A 3VZJA 4O65A 3RLFF 5A3UA 2WQYA 1SCRA 4BCUA 4K20A 4Q4V1 3FXEB 5DPNA 3Q5WA 2UUCT 2J4GA 2E9XA 4EEDA 5F3IA 3WG3A 4B3ST 4IGOA 5DAPA 4XJAA 2A3XA 3C4WA 2XL9A 1BKZA 4JC1A 4FT8A 3FZKB 5JZGC 1ZBA3 1YI7A 2YG0A 3FL7A 3JU9A 5G04L 3LK3B 2VOWA 4V1Av 1OVSA 4A5XA 5DMYA 3CQGB 2WU2A 5C71A 3HPNA 1TEIA 2DUPA 1NLQA 5T52A 1HRV1 1FMD1 4AKLA 1MVEA 5DUXA 3WHUA 4YTNA 2QQUA 5E1RA 3ZLIA 2R072 2ZEYA 2BS4A 5GLUA 4L5GA 4Y4RA 3LDBA 5A3TA 2MHFA 3CIHA 4ASMB 2X0LB 4ZI3C 4ES8A 2R6GF 4IETA 4WYVA 2R32A 2XQ7A 4EE2A 4MOAA 4DR5T 3N7JA 4JRLA 4DZGA 2GDFA 4XQ4A 3N2KE 2QQLA 3TWIA 3Q8CA 3MDPA 1FATA 3KINB 2PYTA 5FZ3A 2MEV3 5HXSA 2QQKA 2QYWA 5HWXA 2WBLA 1S2KA 5LY2A 2PA7A 1OVPA 1LKNA 5EK2A 4A7ZA 2WDQA 2VL0A 2A75A 1LVKA 4MHRA 4ZI3D 3VKFC 2UU8A 3VDDA 1DF0A 1AR72 5FMOL 4UFIA 3KMHA 1PIV3 3OPCA 5DDJ2 3UUBA 4HSJA 3P4QA 4JDMA 3SHRA 2ATFA 1G9DA 1X8MA 2CDOA 1LKXA 5K4LA 4TTGA 3RS6A 4RGKA 2JG8A 4LULA 1Z0HA 3NAPC 5JPNB 1LHWA 4OFGA 1CUNA 2GH2A 1AXYA 2SPCA 1NCRC 1F8VA 3DL3A 5FZ8A 3LA2A 2WAOA 3RQWA 2DVGA 3WF3A 3WY6A 5JR2A 5HEUA 4YSZA 2UXXB 5A32A 3ZXKA 3RZGA 4BIOA 3TN92 1UIJA 3ZN5A 3ZPYA 4KWJA 3IPVB 4XAXB 4EWAA 2IUBA 2HWE2 1SLLA 4DR2T 2J47A 1Z7S3 5FPBA 1FIOA 4NHLA 4CCJA 4N53C 1VPHA 2VG9A 2ZTNA 5C9AB 5IAXA 2J1SA 2V6XA 5ABJA 1K3IA 4N7IA 1MZ6A 1DGLA 5CISA 2DUOA 4XUPA 5FY4A 3RH3A 2D6OX 2D5FA 1FPN3 2OYZA 2KSRA 2HYXA 3VBHA 3AFKA 5AQOB 4QKNA 1IBLT 5BNQA 4QH4A 4YG3A 3N2OA 3BALA 3KHCA 1JZ6A 4R9AA 3TRSB 2ORXA 3L2YA 3CX6B 4GK0E 5DN2A 3POEA 2W68A 1AYN2 1LU2A 3VR9A 4QX2A 1DGWA 4XFAA 3U78A 1EAH3 4Y24A 3MZKB 1J58A 5AQMB 4AGVA 2YOEA 5CFDB 2VW0A 2PHXA 4JV4A 1YD8G 4V2WA 2XLGA 3RMXA 1UZYA 3INAA 2VKOA 2YUEA 3OOXA 5BNPA 4N9IA 4ZONA 3ES1A 2QJVA 3JB4C 3QK6A 3LD8A 1KF6A 4H9RC 4IV3C 1L3JA 1OOPB 4AFBA 5LP6E 3WNLA 3RIUA 1W2NA 2RM22 5L7OC 1WKYA 2IC1A 1I6ZA 1OF4A 2R041 1VBD2 3ENRA 5FMCA 2PQSA 2QE3A 3HQRA 5FMNA 4A97A 2RS31 2PHRA 4I55E 3I2HA 3M3QA 5L4EA 1NA1A 3AXEA 3SOLA 2WZR3 2JJ6A 2E32A 1GFF2 1ND3A 3ABVA 1S0GA 5JDBA 1C8M3 4NHXA 4LFAT 3LWCA 1YXRA 3C7GA 3ZO0B 3J8F1 1OLMA 5A6QA 4RL7A 5AQPB 1LHOA 1GSLA 1U5IA 2FUPA 1AZDA 3EXUA 1CAVA 3WQ7A 1DQ1A 4CEWA 3MXZA 2VZUA 1YJKA 4Q4X3 2O8QA 1AR61 3B9CA 5C3QA 4OHVA 3VHNA 2QFEA 2F4PA 4AG4A 4Q0VA 2WA3A 2UWCA 3O4XE 5FUNA 2KXLA 3ETPA 3TYJA 3V0BA 2R0FA 2CXDA 3ZMUB 2C9AA 2YINA 1PMHX 4JGZB 3OG2A 4O61A 5A1FA 4ZS2A 3UGHA 4JQRA 3HI2A 3U07A 3UJOA 3MUZ1 3ZVXA 2A6WA 1VR3A 4HE8A 1ZYBA 4JHTA 1L7RA 4LF9T 4B29A 3OJAA 5GALA 3SH3A 2O14A 2M6IA 4DUWA 3NKTA 2H7VC 1W6PB 4HLTA 4QM8A 2QQNA 3E08A 4Q4Y1 2OV9A 4YARA 3B3QE 2DWKA 2LALA 3G6JB 2DWRA 2VZ1A 3VD7A 5DG1A 5BNNC 5LBFA 1POQA 5T5PA 4GOUA 4MSVA 4XFBA 4LKEA 2XAFB 3BUCA 1WMFA 2CLYC 3VDAA 4YG6A 3ZIWA 1DYPA 4COFA 2PHLA 4NPRA 1JS9A 3GWHA 4LBNA 2CPTA 2ZCWA 5A3OA 4C1XA 1GOHA 3ETVA 3ZXLA 1WMXA 1WA4A 1XXNA 3T0DA 4U7YA 2JE8A 5FP7A 4LUMA 3AKTA 4QPGA 4LKSA 3UQ7A 1X33A 3RI5A 1EPZA 1GICA 1UYYA 5BUVA 5DUVA 2AREA 2XTLA 1G7YA 4DPNA 2VL4A 4MLOA 3O5SA 2N2NA 1R1A1 2Y6LA 2P4EA 1DU3D 1HTJF 1WLCA 1YFXA 5FLHA 2X9WA 3AXJB 4M3CF 4B3RT 2BG9A 3I49A 2P5BA 2VNRA 4BK4A 4QH1A 4UXNB 4IDOA 2ZGTA 4Y1VA 4MYEA 4QX7B 5A3WA 4PJJA 3PMSA 2PBIA 2PQQA 2YN6A 2JMKA 4NIDA 1VALA 1F5FA 1SG3A 4IE6A 3VDDB 3ZN6A 2FJBA 2C5JA 1BQPA 2YV8A 1X8EA 4HFDA 4AGGA 1W6MB 4O2BE 3W58A 4AQGA 2QA7A 1QJU2 3EDVA 4COWA 3WDVA 3D0JA 5F32A 2VZPA 3CZJA 1YYNA 4JGYC 3OPZA 1O4TA 3NWIA 1E5SA 1OT5A 1W6NA 1B35A 2W87A 1HCIA 2FBWA 1HJFA 2BDRA 1S0JA 2BBVA 1D4M2 3NQHA 3RQ0A 5LYJE 1OLQA 3HD8B 3BCWA 3CX8B 2PN5A 3KDSE 3ZOIA 4CN6A 4DQAA 1GR3A 2WNOA 1IQDC 3SH4A 4XURA 1QNWA 1KS4A 4NN0A 4XIKA 1IAPA 3MV11 5A32B 4QPIB 3GN5B 1ASJ3 4LK7A 1ENRA 4H3WA 3C7OA 2EHOA 2ARBA 4B4PA 3JC6D 1KEYA 5E8AA 4GB32 1GNHA 3U1XA 5JSOA 2WCAA 3J7LA 3WG4A 5HYAA 2GP3A 4CP2A 5ABJB 2WFF2 3ZKRA 2EXIA 2WINB 3NV4A 1C4RA 3K8PC 2B9UA 5FJKA 4OX9T 4YFWA 5DZGA 2IHR1 1WZXA 4YJ3E 1KNZA 3VKOA 4Y3OA 3QUJA 3IT8A 1UY0A 3Q2MA 4MLKA 2G4IA 2JDAA 1DGRA 5EJZB 4FPFA 2XLAA 5J3UA 4MADA 2DYCA 4TXWA 2RS51 1VBA2 3O1MA 1NY71 3RZKA 4IDNA 2QQOA 3TLUA 1V0AA 2HWB1 2ARCA 2K2SA 4QQHA 5L3CB 4K7JA 4F8AA 2WABA 2ZGMA 2XQRA 4ASLA 1UY2A 1AJKA 5FZ4A 4NAOA 3VBUA 2G9FA 1O3TA 1CHUA 3VN4A 3LIGA 3A22A 4DR4T 4GWNA 3T0BA 4BLIA 5BNPB 4UYBA 3MW3A 1RVF2 1W06A 2BGPA 4CDUC 1KNPA 4LK6A 5T5OA 3ST7A 4YW4A 4EEBA 3UFGA 5ACA1 1PNGA 1ZV4X 1AL23 5JVVA 3RKGA 4YM2A 4F83A 1SA0E 2K24A 4OLLA 5JREA 3ZT6A 1V9U1 1W8UA 1IS4A 5FPLA 1BEV3 5D8AC 3IA3A 4MGZE 4IIJE 2PLV1 3NNLA 1MZFA 1Y3TA 3O1RA 4CP9B 1NOVA 5LRRA 4INDA 2HEYF 4ORFA 1HNWT 2EIEA 1DLLA 3SKJE 1POV3 3U10A 4UW3A 2JJ9A 3P4RA 3SRZA 3MZHA 1LRZA 5J48A 4IQPA 3JBG3 3BQKA 3IB3A 1CAVB 2XM2A 2DCZA 1NX9A 1ZBE3 1YQ8A 2VQTA 2Y33A 3OKQA 2BWCA 5AC92 3H8RA 5FKYA 2DDUA 2AEZA 2D6KA 5FFOC 2YMZA 1VAVA 2B5HA 1SBFA 5CEHA 1E2AA 3NAPA 1LGCA 1PHMA 3IKWA 2Y38A 1AR92 4YW1A 5HV0A 4CI2B 5KHHA 3VR8A 5L2LA 1NCRA 5AVPA 5FP9A 3V0BB 2LEHA 3AE9A 3AJYA 5B2GB 4G3YC 1QQP1 1I9RA 4FOYA 3AE6A 5JXGA 4HT1T 3RYIE 1G8XA 3AKQA 2CNAA 5J36A 5F7UA 3Q9OA 2PXJA 3I7DA 3UNPA 3E6DA 1GUIA 1MQTB 2KD7A 5DG2A 4N53A 1V6MA 2FDHA 2FMDA 2E53A 2VZVA 3ZN1B 5JLVA 4CVUA 1OQ1A 2RS13 1OEDE 3VHOA 3KLSA 2V5CA 1GMMA 1EV12 3O7OA 5IVYA 1YIPA 2I2SA 3P4WA 5AQLB 4QMAA 5F6KA 1DGWX 3VBFC 1MMAA 1LULA 4NUUA 3KGZA 2X5IC 2W0XA 2QQPA 2ARXA 2GNMA 2ZABA 2DCYA 2E8IA 1SLAA 2BVVA 4BQ3A 1ULGA 4PJYA 3BU0A 3PUGA 3FBZA 1RUE3 3CJIB 4LOTA 3FLTA 4CDQC 2FJDA 1DLCA 4Y20A 1DP0A 3RZJA 4JDOA 4Q4V2 4JVAA 4L9BA 1HB4A 2PHDA 4HFBA 4YYOA 5FZDA 1NCQB 3KV6A 1VMJA 4H14A 4FSJA 2RJ2A 4HFHA 3HOBA 5A6YA 4LJHA 4H9PC 4GZ9A 3PU8A 1F9KA 3PNAA 4MGYE 3T2PA 4E4ZA 2P17A 1IOAA 5G05L 3CLPA 2EXJA 3MLJA 3SMHA 2PHUA 2WFPA 4KBBA 4IV3A 4JDNA 4AR2A 2JDUA 4YVWA 4XZUG 1HRV2 1FMD2 3BB6A 4Q4W1 1IZNB 3AZYA 3L2HA 3RGBA 5L7OA 4BQ5A 5GZGA 5K7PA 1H8VA 3LSVA 3H3UA 3OY8B 2ZX3A 2BG9B 1MS4A 1AYM3 1TNRA 1W9RA 4HFEA 4AW7A 4D7TA 2IFWA 3AA1B 5JIAA 2OPWA 3ANWA 4IL9A 4NIQA 2ZKNA 4TNVA 2FDKA 4CUAA 2R063 2WZPP 1RUG1 2NWBA 2ODVA 5DZEA 4NO4A 4ISTA 2BEOA 4JI6T 5C33A 5E88A 1XE7A 5AQSB 1OUSA 4GKYA 3ZN4A 3ME2A 4ZPIA 4CZZB 1KFXL 5GZCA 2GSYA 5CKQA 2HWF3 5HXHA 4BJ0A 1H30A 2Y6FA 1W6NB 2IFRA 4AVAA 4A7KA 4FTBA 1IKQA 2D9DA 2P3JA 2N7GA 4LEJA 3NSTA 1PK6A 1KFUL 2EVXA 4PK4A 1ENSA 4ATFA 1BBT1 4X62T 3O1PA 4QXBA 2HEWF 2M6BA 1NXD1 3M65A 4UFKA 3R4DB 2WN2A 5K9YA 1HXS2 5IVCA 5FYTA 1JZ3A 4GMP1 2EHOB 5LEJA 3TLWA 3N9NA 3FFQA 4AAPA 5CGMA 3A8YC 1UIKA 2A71A 4UFJA 4XJUA 4KX6A 5EZYE 4NIGA 1UX5A 1R081 3I2JA 4QQPA 2IUWA 1K12A 5H9QA 4FI5A 1DCSA 4NPPA 5IUXA 5JWPA 2VVDA 3ZDVA 4YW3A 1BVVA 1DZQA 2JECA 5FYBA 1VMFA 5A33B 2B8MA 4BA6A 1CAXA 5BNNA 1KEXA 5LWBA 2LM9A 4ZU5A 1EUUA 4YHHT 1HLCA 2D0UA 5ERLA 3HWJA 3IBMA 4YW6A 5JSRA 5HAXA 5F9TA 4CCMA 2LKHA 2IVJA 1LNSA 5HXEA 4DV7T 4QGLA 2WY2A 5C4WC 1JUIA 3VBUB 5AQQB 2XHEB 4PJLA 2BJSA 3WNOA 5FO8B 1PM4A 4EV0A 1NZCA 3CIRA 5HWYA 2O0OA 4TYSA 3N4MA 4HKAA 5L3DB 2Y0OA 1QUUA 4G9SB 4DR1T 2VWAA 5C7GA 2MOZA 2IMLA 4LBJA 1RUD3 3KHBA 3AAAB 2BNOA 1YO8A 4IE4A 1JZ8A 4X1IE 1SE7A 5CB4E 3M8LA 3LSEA 3NNMA 2K48A 3BTAA 2VQ0A 3MI8A 4KG0A 2WWUA 5JVDE 1QJFA 2ARAA 1UD1A 1M62A 2BNNA 5FZFA 2OW4A 4JQTA 5CBLA 3IAQA 4Q8LA 3MFAA 2ADEA 2R042 3ZMTB 3VBOC 2WNVB 4UAPA 5H9RA 2UYBA 5FYVA 4DB5A 4IDQA 4HWHA 3MYXA 2HWC3 3AYEA 1AX0A 4OHZA 1SHWB 3W21A 1ZOYA 3RRWA 1W3VA 4FOWA 3WG2A 5FV3A 4Y22A 3OEAA 5KMGP 4R9DA 1N1SA 3DUIA 4B6XA 4F6RC 3J8F2 4JGYA 4S2FA 3B57A 5J96B 1EY2A 3AL5A 3E0ZA 3NAPB 3R84B 3ZYGA 3PIGA 2YU1A 5FPXA 4ZHNA 3RI8A 1AXKA 1S0DA 3A0KA 4E2GA 2FBEA 1IPSA 5K0UB 5KC6A 5DAWA 1NCRB 3ACFA 4ARYA 4JBWF 4FFIA 3U3IA 2VQET 3USUA 4QPWA 3ON7A 4B3MT 2AH2A 1AR62 1UY1A 2PJQA 2JG9B 2AE9A 2QCSB 3V65A 1TQ5A 2UY9A 2AGSA 1JYNA 3FJSA 3KM5A 4PK6A 4NUVA 1QGLA 1XNCA 1GP4A 1IS3A 1LOCA 4FPHA 4N53B 4YW5A 2RR11 5JMOA 1MS1A 1X36A 2BBJA 3PDYA 5EQUA 4O4IE 3UGGA 2BFUL 3SEEA 5FWJA 3HA4A 2WWSA 1CAWA 4OUMA 1J1TA 1Y7BA 1D0YA 4EQVA 4UFHA 1G86A 1UOJA 1UF2C 3SXWA 4J1WA 4WZXA 4GKJT 4C0BA 4ZI2C 4IHJE 1UZ0A 2F6BA 2BERA 4OHFA 4CSWA 4CXXA 4MFRA 4Q4Y2 1MVQA 5AQUB 2CY6A 3THTA 2B9VA 3M3ZB 4KQ7A 3WT3A 4C1WA 5LGTB 2UXCT 2DBNA 2UY8A 3C2UA 4W6XA 4MGKE 3GBGA 4OYKA 3ITQA 2VOTA 3DPRB 3O1TA 3E1F1 3LA7A 3PU3A 3JCFA 2GN3A 2R073 4XE9A 2VNGA 1JYXA 4CDUA 3VBRB 5L3EB 1O8SA 2LSIA 1NKGA 2QGSA 5LBQB 1UMHA 1XYPA 4B8EA 4YVWB 2BKNA 4LFBT 1JN2P 5HEJA 3PDQA 2DLRA 1ZRCA 3NV2A 1UQXA 5L7OB 3TKLB 1T2XA 2VMCA 4UIGA 1O3QA 2HEVF 1AHSA 1ODNA 1E5IA 2VOXA 2P6HA 5JUVA 5ABGA 4GKKT 1HX6A 5AFBA 1RUC2 3ZJ2A 4P1NA 5FUPA 1QOSA 5D8AA 2VTXA 1CZSA 1FI2A 3ANWB 1NQDA 5EK3A 3RPQA 4DV5T 1YUDA 3GBFA 3RPUA 3FUOA 4FI9A 2PHFA 3LK42 4I0WB 4QX8B 1AR73 4RFT0 1M4WA 5L9BA 1UPSA 1D0ZA 2ZGPA 5GJ6A 4RQPB 5DDJ3 1N32T 2AUYA 3HBZA 2LOPA 1A8DA 2VMEA 2ZA9A 1Z7S1 1ULCA 2AXDS 4H63H 1XSQA 1LGBA 2JE7A 4JTOA 4FJOA 5HBAA 1PK6B 3NV3A 1MIWA 1W8HA 2YKSA 3EUHA 3GJBA 5KHGA 1FPN1 4LOSA 3Q5XA 3MPPG 2HYKA 4QXBB 1US2A 2BP6A 4AQ2A 3GHNA 5JDHA 2WSUA 2ETEA 1HRI1 4HGAA 1W2AX 2D97A 4ZZCA 4LHNA 2LM3A 3TN93 5KXBA 2WT1A 3FHAA 4M00A 2IVIB 1X50A 5IHYA 2HWE3 2ZX2A 1JOPA 1GZWB 4XHXA 4QQ2A 5DAXA 5LA2A 2YC4A 2P3YA 2YU2A 1CWPA 4JEHB 3ZMZB 2ENRA 5FQ0A 4KP3C 3WQBA 5K8SA 3EYPA 1NLRA 1GOFA 2OPKA 2ZM0A 1HS7A 1AUYA 2OUJA 4XIOA 4LO4B 1VRH1 5FMDA 3OBZA 3JD71 3I2DA 1Y9MA 1SPPA 5H9SA 1QIQA 3VBFA 5ETWA 2K0GA 3ZYFA 5BNNB 1Z8UA 4QXKA 1KDKA 1ZZ8A 4IEXA 3WQ1A 4BLJA 4GYSA 3PUZF 2DNXA 4UVBB 4ISSA 3IAPA 2VTXJ 1AYN3 3HEIA 3RRDA 4LT5A 4CDQA 4LR4A 2RS52 5LBCA 2JQHA 4XMIA 4NE9A 3D5OA 1NY72 3UU5A 4YZ4A 2I07B 3PL0A 5BMVE 3QC9A 2HWB2 3I4IA 1FOD1 4M3CA 3BTZA 4S2DA 4E7SA 2GC2A 5FZEA 2UXNB 2WZR1 1CZTA 2KXPB 2LUWA 4IEWA 3H7YA 2Z42A 4P9GA 3J7HA 4BOWA 3H1WA 1S0FA 3H37A 3QH6A 2JDKA 5ANQA 2BBAA 2KMFA 1O4YA 5D21A 3AP9A 2RM23 2BBHA 2DVBA 4H7MA 1DQ0A 1VBD3 3LIHA 1XU1A 1BCXA 3AP5A 5EPAA 4PT6A 3WF4A 4MXVA 3SC7X 5ACA2 2VKDA 4XXAA 1QDCA 4Q4X1 4I50E 1WCKA 4NOTA 2YHJA 1PO21 2ADDA 1V9U2 4B3NA 1QJY1 3VZNA 1UY3A 3LBXB 3POSA 4PK5A 4AVTA 3LAGA 4KWUA 3KCYA 3FZHB 2DHRA 1GWLA 2PLV2 1UZVA 2JB8A 5CG9A 1VAKA 2VU9A 3A7QA 5CFDC 3ETQA 2E7TA 3ZXJA 1UOGA 3U0ZA 5EXOA 3DXTA 4PQ9A 2TBVA 3UU3A 2R49A 3B01A 4JGYB 3VU7H 4ILAA 1CONA 3GZAA 3H1YA 5GONE 3PURA 4OI0A 3ZYMA 3CVRA 4PHZA 5ISLA 3E5XA 1OOPC 2P2KA 2QRXA 3FZ3A 1UZWA 4Q1RA 1CAUA 2ZLYA 3O0VA 1RMU1 4I43B 4LUKA 1UOFA 2D3SA 4I0AA 4JX0A 4D6QA 1IG3A 3MHZA 3P50A 4XUTA 3FZLB 4YVSB 2YGMA 1AX2A 3MW4A 3RRCA 5C3OA 3RG0A 3KSCA 4XDQA 4DXZA 3H3MA 4LO5B 4EYYR 4AVCA 4ZZ8A 4XFHA 4UVAB 3C7FA 1BJQA 2VCBA 2W9XA 4BQ4A 2DFBA 3F57A 1CAWB 2E6VA 3T8OA 1WA6X 3DYOA 3LSDA 1JBCA 2L8KA 4FTSA 3K4AA 4CU7A 5AQIB 2FZ2A 4ZXKA 2VURA 4GYRA 1XZYA 2Y34A 2QUOA 1W39A 2PAKA 3ZR6A 3MICA 2ZS6B 4TV9E 1UMIA 1E57A 4NHMA 4P5HA 3QOFA 3H42B 1OFSA 4AVBA 4Z1VA 4UV9B 5C4WA 3T2TA 4JGZC 4A2UA 4AI1A 3PVOA 4PLNA 3FXDB 2D44A 2ZJCA 3L3PA 2Q9QB 4YFZA 5FL1A 4DXRA 1NXMA 4CDUB 2VC9A 1LOGA 3EO6A 3NNFA 2QQJA 5I0TA 2J62A 2A6ZA 4XBLA 3WDWA 2XUEA 3D3AA 2FJEA 4LTAA 2JENA 4P9XA 1PVC1 1SDWA 2KM2A 3MBWA 4MXWA 1ZA7A 4YSXA 4AKIA 1D0HA 1X9BA 4CTEA 2VCCA 4XQDA 3N9PA 1COV1 2VBDA 5A7WA 4Y5SA 4XJZA 4AQSA 2RDRA 4UVCB 2XQYA 1CJDA 3THPA 5HI0A 1TVGA 1SEFA 1QJU3 2H3RA 1QKQA 3A0NA 3T30A 2OX0A 3CL1A 2I45A 2SBAA 2MYSA 4HOOA 1RUG2 3DYPA 2GNDA 4TZ4C 2D98A 4BIFA 1DYKA 2JIWA 2B1EA 2JD9A 3G7DA 4XJWA 4GQ7A 4PBOA 1D4M3 4Z90A 2Q8EA 4UI9L 4KBZA 3MGUA 3AEDA 3FHIB 5IVBA 2ZM8A 5A7OA 1LODA 2BPA2 2J22A 5GZEA 2VY0A 2ZZQA 4OI4A 2VM9A 4IGQA 4Z91A 1BBT2 1Z0PA 4GB33 2XQ3A 4KI5M 1CIWA 1D2QA 2ZGKA 5FQ0B 2WFF3 1H1AA 5EIYB 1H4HA 3USSA 1VRBA 4CI1B 4B7EA 1LR5A 5T5LA 3K4ZA 2VJXA 5LMNT 2Q1MA 1SPPB 2O8OA 1JOJA 3WHTA 3LEMA 2A6YA 3VBFB 3LDKA 3HNYM 3ES4A 1VBA3 1CD3G 1R082 5JSPA 2Y6KA 1HX1B 4U2YA 1OHFA 5LJNA 3ZYIB 1RUI2 3TEZA 2IXJA 3UFEA 4JI7T 2D6NA 4YLZA 1UYPA 3N9OA 1S1AA 3HBKA 4CUBA 5DXDA 5DQWA 5C5UA 1N1YA 4QPIC 1HX8A 3NZPA 1QH7A 1BEV1 4M3CB 1S2EA 1IJ5A 3ZR5A 1AVBA 1RVF3 1GYKA 5KHJA 4KWLA 4QGMA 4Y26A 1H6XA 1OD3A 1H1MA 4CCOA 3OGVA 2IW5B 2ZOEB 2X29A 2NW8A 3OYZA 2XUMA 1WWYA 5FZ6A 3JBG1 2JPFA 4FAHA 1YQ6A 2GC1A 3BVCA 3KBUA 2UXBT 1D1AA 1VE0A 1UPIA 2FDGA 5HV4A 4CYDA 3OPWA 2GC0A 2ID4A 3GF6A 1OH4A 2HN2A 3UV9A 3RX6A 1O5LA 1OBNA 2X10A 3DGTA 3WX5A 3I3DA 4URAA 2QBXA 3ZFGB 2XONA 5EFUA 2YPJA 2A3DA 2BS3A 2J42A 3J4UH 4LKFA 2KR2A 2X0YA 5FZIA 1S94A 2OQ6A 4XUQA 3S57A 2LRKA 2P1BA 4MZUA 4FQ4A 4QQOA 2VZTA 5F6LB 2I6HA 5AC93 2ZGSA 1OLME 5L3BB 4D69A 4PJNA 3VB9A 4KGQA 1AR93 2WU5A 2OUHA 4IE5A 3WG1A 3S6PA 2EALA 5BV6A 2UUAT 1CAUB 3BI3A 2CWOA 2WKKA 3K46A 5KR7A 3KT7A 4GAZA 1GWMA 2W94A 4DV2T 5DQVA 2GN7A 4EZHA 3VBSA 2CAUA 3EHKA 4H63V 5FTTC 2Q5TA 4GXLA 1LAJA 2PG8A 1UX6A 5EZWA 1G73A 2C0SA 3I8TA 4X1KE 5AQKB 1PX3A 2W0GA 5FZ1A 1BR2A 3VDCA
chains in the Genus database with same CATH topology
4Y33A 2Q9QB 2EHOB 5FMNA 4O8SA 3VHLA 4QX8B 5L3CB 4CI3B 1OWAA 3N9NA 3MJXA 4G63A 4I55E 4AAPA 3P7IA 4E7ZA 1D0ZA 3KVAA 2KWIB 1HG5A 4PNIA 5F5AA 5A7SA 4MALA 2J1DG 5FZ4A 3NRXA 4EIWA 5LJMA 3SOLA 1WR6A 2BVMA 3JC6C 4HTEA 4ZOLE 2VKHA 4O4LE 4AKHA 4CCKA 2XMLA 4WBNE 3MK7C 4X20E 2WMOA 2YBPA 5EZYE 3ZMSB 5FNVE 1V9DA 1UX5A 2LOPA 2XUEA 3ZYLA 3O9XA 5ADXL 3KVBA 4AQFA 5LG4A 4UEMA 1D0XA 2D5UA 2WMNA 4XDPA 1WYCA 2Y48B 4A56A 3N9LA 4H63H 4TN7B 4U74A 3ZCIA 4FI5A 4P09A 1HF8A 4FJOA 5L3FB 2D2SA 5LHIB 4HN9A 1MIWA 3LBXA 1MNDA 3WI3A 4AKRB 3EUHA 4H9QC 5A7NA 4Z8XA 2MBGA 5JR9C 5FP4A 4BU2A 1ZV4X 5FY8A 3Q5XA 2V7LA 1FMVA 4J2CA 2ODUA 3I0QA 4L9IA 5FYBA 1SA0E 4QXBB 5DJQC 4AKIA 2K24A 2OA5A 2IC9A 3MXZA 5JDHA 5LHHB 4QX7A 3DJBA 5JREA 3N5LA 5LWBA 2LHNA 2LM9A 2LOSA 3AA6B 4H9NC 5KDMC 3N9PA 5LXTE 5JRCB 2LE8A 4HGAA 2D0UA 4X1YE 5A7WA 4E4HA 3PUSA 4BISA 5LY1A 2V7KA 4ADZA 3BQLA 4XDOA 3F2EA 4AI6A 3VKGA 5HAXA 3O4XE 5FUNA 2Q8DA 4CCMA 5FPLA 2C5KT 2P9BA 5IHYA 1O3XA 1U4QA 4UVCB 3AVSA 5JR9A 2XQYA 4IIJE 4YFSA 5HXEA 5F3CA 3ZCJA 3N9QA 3FXEB 5FZCA 3Q5WA 5HXCA 2IAKA 5IVFA 5FZGA 2E9XA 3AB3B 3IBPA 4EAHA 2CXDA 3ZMUB 3UULA 2XHEB 3GA8A 3BK9A 2YINA 2YU2A 3IEEA 4PJLA 2LSJA 4JEHB 4GJZA 4PJMA 2H3RA 4P0BA 5F39A 3ZMZB 2OX0A 4KP3C 3N2GE 4MHCA 4IGUA 3CMLA 2H7OA 2MYSA 4HOOA 4IGOA 5FBJA 4YHJA 3C4WA 5L3GB 2OS2A 4BJMA 5IVVA 3PUAA 4TZ4C 4WNKA 5A1FA 4ZS2A 2ZM0A 3N9MA 1HS7A 3HI2A 3I9WA 3KFWX 5HWYA 4QHOA 2JJ9A 5IWFA 2B1EA 4HONA 4HKAA 2Y8DA 3KBTA 3SRZA 1LRZA 3LK3B 2ZM2A 5L3DB 5H6QB 1QUUA 1BR0A 4V1Av 3AA0B 1ZEEA 2PFVA 2ES0A 2VWAA 3BQKA 3CQGB 3UUMA 3WAJA 4HE8A 4PAGA 5F5CA 2MOZA 5FYZA 2Q8EA 3RVHA 3AAAB 2NOXA 3OJAA 5ETWA 4LIUA 5KX5E 2VD7A 3CKDA 5IYZE 4AKLA 4IE4A 4PFOA 3OKQA 1HFAA 3D0TA 4AQFC 4X1IE 4LXLA 3CX7B 2H7VC 3AVRA 2I59A 3DP7A 3LG7A 4OK0A 5E0OA 4GYSA 4UV8B 5CB4E 3ZLIA 4C91A 4D6SA 5FZMA 4N78D 3RYCE 3CWZB 3O1HA 3O1IA 4H9SE 5HXRA 3UT5E 5A1LA 5IVBA 2ZM8A 2DNXA 2K48A 3E08A 4UVBB 2YK0A 2HPJA 4L5GA 3C64A 4ISSA 4MBQA 3HKDE 5F8PA 5A7OA 5FY5A 3GN5A 5CEHA 2ZMAA 3ETUA 3L09A 4Y4RA 2W61A 2GP5A 4JEUB 5LBMA 2WWUA 5JVDE 3LDBA 5A3TA 2DWKA 2XAHB 1LVFA 5FZ7A 2JRKA 2JQQA 3LFMA 5FPVA 1VOMA 2K9AA 2X0LB 1UCUA 4UELA 5FZFA 2KZ7B 4CI2B 4ZI3C 5JR9B 4IGQA 2Z6EA 4JLEA 5L2LA 4XBFB 4QXHB 2LT3A 3J9X1 3AAIA 5FP9A 2YBKA 1Z0PA 2ACXA 2LEHA 2G0UA 2CXFA 1IJ6A 3E22E 5J2UE 4GOUA 3PE0A 3HR0A 3ZMTB 3WAKA 3N2KE 3K3QC 4ASKA 5BMVE 3QC9A 2XAFB 4IE0A 2XDVA 1VRBA 4CI1B 4NUBA 3CQXC 3RYIE 2YPDA 4QXCA 1G8XA 3O1JA 4H9OC 1BR4A 2CLYC 5FYVA 2JMHA 3HKCE 3KINB 5FP3A 4E7SA 1E1HB 4CUGA 3EVYA 5FZEA 4L0RA 1X79A 5FPUA 2XAJB 5FZ0A 5A3NA 5FZ3A 2UXNB 4C90A 2LJLA 5A7PA 2KXPB 5HXSA 3VKHA 1YKHB 3GWHA 2PXJA 2E9XC 5A3PA 3OYXA 4IE7A 1YW0A 4KMCA 2V1DB 5HWXA 2RA1A 3RRWA 5J2TE 2WBLA 3C4XA 5LY2A 3H37A 1SHZC 5FV3A 3K3OA 5LA6E 5EK2A 3ETVA 5ANQA 2KMFA 3DXUA 1LVKA 5KMGP 2NTXA 2N9DA 4ZI3D 3ZN1B 5J1GA 5JH7E 4I4TE 5FYCA 4WW0A 4B6XA 4F6RC 4LIVA 4GIWA 3RC8A 1MMGA 5FP7A 5IVYA 3LK2B 5LCYA 5FYSA 3B57A 5A7QA 4EOZB 2W00A 3AL5A 3E0ZA 4IDZA 5FXVA 3R84B 5LJNA 4U72A 1D1CA 2Q9QA 2YEVC 3V5UA 2YU1A 3H3AA 4YLHA 4QX8A 2VKDA 4BA9A 3FHNA 3UFEA 1BR1A 2XTLA 5JDLA 2KT9A 2CWYA 4ZI2D 2CA5A 1MMAA 5M4YA 3N9OA 4NUUA 4I50E 5FPAA 2N2NA 4K0UA 3B13A 3FB2A 1MIVA 2E8IA 4CQIA 1LKXA 3KV4A 3U3IA 5K4LA 2E9XD 2L9QA 4EXTA 4QWNA 5FYYA 2CE7A 4PW8A 5DQWA 1HTJF 1U5PA 2IC6A 3ZC1A 2PJQA 4ZHQE 3PUGA 5LHGB 1HX8A 2X9WA 2XASB 3NZPA 1AJ3A 4P0AA 3RYFE 4QXCB 2Y6XA 4DMVA 3FBZA 1IJ5A 1ZHCA 2NW9A 5AFUL 1CUNA 3LBXB 3A5XA 3IHRA 4PK5A 2YBSA 2P5BA 2MTQA 3K2OA 2VL8A 2DHRA 2L3LA 2KNDA 5CA0E 3NRYA 4TN7A 4LITA 3ZN0B 2SPCA 4PK6A 3CPZA 4NUVA 4GD4A 4UXNB 2WWJA 5FZ8A 3KV5A 4PFPA 3RC3A 5FYMA 3V5SA 5LNKA 4G2AA 4QX7B 5FXXA 4CCOA 5F37A 5A3WA 4D6RA 4PJJA 2VB6A 2M67A 4ZI7E 5F3JA 4CCLA 2PBIA 5IVJA 1T98A 3ONXA 2IW5B 2NW8A 5FZDA 4O2AE 5FY0A 3KV6A 3DXTA 2NW7A 3OYZA 5FY1A 2JMKA 2W63A 5A7WB 2W62A 2V7IA 3LJCA 5FP8A 2UXXB 2BVLA 3AA7B 4CXWA 3AAEB 3RYHE 1OXZA 3PDYA 5FJHA 4IE6A 3CQCB 4O4IE 5FZ6A 4H9PC 2DWGA 2JPFA 3PU8A 2V7MA 2D0TA 2C5JA 3VU7H 2DI4A 2CLYB 4ANJA 3KBUA 4BJNA 1D1AA 4C8DA 4XAXB 4OFZA 4QU1A 5GONE 5FWJA 2WAUA 3PURA 1NAFA 4DVDA 5FZ9A 5JDMA 3HA4A 4O2BE 4UF0A 5A80A 3ZPOA 3FBLA 3ZYMA 3OPWA 2E9XB 3CVRA 1FIOA 5FPBA 5CA1E 4DO0A 1FEWA 2WSSV 4AQGA 3ZEFB 4CCJA 3PUQA 5ISLA 2QA7A 1HG2A 5FZKA 5FZOB 5LGNB 3C4ZA 3EDVA 1D0YA 1WYBA 4JUYA 4HFVA 5JDGA 3RX6A 3ZC0A 5F32A 5FY9A 1IZNB 2X9HA 5FYIA 2RP4A 4QWNB 5FY4A 4CCNA 3RH3A 2KLQA 2A2FX 4URAA 3J7Yq 5DABA 2VK9A 4V2VA 3C51A 2VKJA 2ZLYA 4TV8E 3ZYKA 4ZI2C 1MMNA 2XXZA 4IHJE 4TX5A 5TAOA 3I9YA 4I43B 2X9XA