4MALA

Tpr3 of fimv from p. aeruginosa (pao1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
TDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Motility protein FimV
publication title Crystal structure of TPR2 from FimV
rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4malA00
4MALA 4MBQA
chains in the Genus database with same CATH superfamily
3LFMA 5LG4A 3VRBA 1UK5A 3LSVA 3UUBA 3ETUA 1D0ZA 2K24A 1MMDA 4L5GA 4YY3T 5EK4A 1LKXA 2KXPB 5L3CB 1I94T 2M6BA 4HE8A 1HNXT 5ABGA 5M4YA 3RYHE 1XMOT 2MBGA 4AISA 3RRWA 2W00A 2RP4A 4ILCA 1QUUA 4GK5E 4GOUA 1KF6A 4UV8B 2A72A 4C91A 4LFAT 2X0LB 4Z91A 2PJQA 2PFVA 4TWDA 2CE7A 4J2CA 4JI7T 2H7OA 1SHZC 1U4QA 1HG5A 3FZLB 4I50E 3EUHA 5LXTE 4P0BA 1YW0A 2W2UA 3NKZA 1KEYA 4O2AE 2C5KT 4IT4A 5LCYA 2BG9B 2UXNB 3TLWA 3HL6A 2FJAA 2HPLA 2CWYA 4HWIB 2CMRA 3RLFF 5JQGE 2XAFB 4OHFA 4Z8XA 5JDNA 2EHOB 3BK9A 1U5PA 2Y8DA 4EAHA 2Q9QC 4KX6A 2CM0A 2LSIA 1I6ZA 2V7MA 2HN2A 3FHNA 3ZJ1A 1IBMT 3UFGA 4U2ZA 1MMAA 1S94A 4HN9A 3PE0A 3M3ZB 2LM2A 3ZJ2A 2N1GA 3Q5XA 4PJJA 5HXCA 2V5DA 4LF9T 3JAFA 1E2AA 4QX7B 2WS3A 2VB6A 2JPFA 3TLVA 4G63A 4LF7T 5AQPB 4DV3T 2NW7A 5FVKA 2WDQA 4WBOA 2XQYA 2ES0A 1XZYA 5JR9A 3K1SA 1NAFA 2CXDA 4IE7A 3JADA 2K5BB 2N9DA 3EI0A 4BJNA 1YQ4A 3CX7B 2E9XB 2ODVA 1OWAA 2XTLA 4MFRA 3FXEB 2X51A 4YTNA 5AQKB 5TAOA 4LFCT 4H9RC 3RC8A 2L9QA 2K3WA 5HCJA 3QOFA 5AQTB 2JQKA 2PG8A 4IDNA 3RHWA 3RH3A 3U78A 5ABEA 4X65T 4IDQA 4ISSA 2C5JA 3NZPA 4K0UA 5L3GB 3UQ7A 4H9NC 4ZI3D 4AXPA 1G8XA 1M7KA 3LK2B 4BAYB 4U74A 3O4XE 5KMGP 3OKQA 1HF8A 4EV6A 3IHRA 3N5LA 4GIWA 2JJ9A 2FBWA 4UV9B 2UUBT 2X9WA 4JI1T 2W63A 4I43B 2JMHA 2BG9A 4ERRA 3AE4A 4DNDA 3R84B 1IZNB 4ZZCA 4DUYT 3AE5A 1XMQT 1S35A 2BBHA 2EHOA 4H63V 2FJBA 2V6XA 1JNZA 5AQVB 2B1EA 5HEHA 5KDMC 2JRKA 3AA1B 2D2SA 1B7TA 2X9HA 3X1DA 4P09A 2WDRA 4GKKT 2XQ8A 4U31A 4MBQA 1FMVA 1N34T 2VK9A 3CMLA 2BZBA 4ILUA 3P4SA 5JDMA 2JMKA 3VRAA 1T98A 2XSAA 3ZYMA 4P0AA 3I9YA 2OLTA 3NZQA 3KV9A 2IMLA 2J1DG 2WSSV 2MAWA 5HXEA 4IE6A 3KBTA 5CGMA 2E2AA 3ZCJA 3OYZA 2E5LT 3B5MA 1ZEEA 2E9XA 2Y6XA 4HFIA 2H7VC 4HGAA 5HWYA 3M65A 2V5CA 3TLUA 4A97A 5JDHA 2D0UA 4IREA 2WWUA 4JUYA 3UFEA 2H88A 3N2OA 5L2LA 3KDSE 4JEHB 1D1AA 1G73A 1IJ5A 5JDGA 2LSKA 3AAIA 1X9BA 5FY0A 2LT3A 5LJMA 4I55E 2J62A 2BKPA 1WYBA 2J47A 3W15B 3P4RA 3H3MA 2CHNA 3GA8A 5F3JA 2Z6EA 3V5SA 2V7LA 2MYSA 2VKDA 4QXCB 3RQUA 1ZOYA 3UUMA 3H37A 2LOSA 4O4IE 3T1HT 1MIYA 2V1DB 4DUZT 5HAXA 3PU8A 4UIGA 1CHUA 4ZXLA 4WNKA 2X9XA 3PJAA 2UXBT 4TWFA 2XM2A 2XQ4A 5HYAA 3KVAA 3ZC1A 3A5XA 2FUPA 2LHNA 3ZEFB 5CA1E 3UTKA 4H9PC 5FL0A 2XAHB 3AXJB 2XSBA 3AE6A 3AEGA 4CI3B 4DBRA 3BQLA 4DV1T 4GKJT 5LOVE 5JVDE 5HEJA 2YU2A 3QC9A 1N33T 3ESLA 2XQ9A 1H7CA 3E22E 2Q9QB 2XQ5A 2XQ3A 3R6NA 4QXBB 2YN6A 3KV5A 4O4LE 3AB3B 5FY7A 3ANWB 2JIWA 3O1JA 4B3RT 5JDLA 3T8OA 2CCQA 4IL4A 2V7KA 3HA4A 4ZI7E 2XAGB 3N9OA 4A56A 1KNPA 3EDUA 2BKNA 3EAMA 3K3OA 3L39A 4TZ4C 4GYRA 4V1Av 3AAAB 3HKBE 3ZCIA 5J1GA 3RIAA 5DJQC 3FZHB 3AVRA 1FMWA 3EVYA 4B3ST 2NTYA 2NTXA 3AEDA 1VRBA 5DQWA 1YKHB 3SWHA 2BVLA 4QXHB 4U33A 3IA3A 4QH5A 1J5ET 1R8IA 4ANJA 4DR5T 5KX5E 4E7ZA 3C51A 4OYKA 2W0GA 2QA7A 2IDOB 5LGTB 2OA5A 1YKEB 2JQQA 3PUGA 2YOEA 4U7YA 5EK2A 3CX6B 1Z8UA 2LEHA 1UURA 1YD8G 2XQ6A 5FXZA 2VL0A 4X62T 3AXJA 4FI5A 4DV5T 1HR0T 3PUWF 2YK0A 1BR2A 1Y01A 3RRCA 4DR4T 2UXDT 4AKIA 1ZKEA 4L0RA 5EK3A 4K0KT 5L3FB 2Q9QA 3P4QA 5JTGA 5L3DB 3LK3B 2ODUA 3D0TA 4FJOA 4UELA 2KMFA 3UUXB 1MNEA 3JCFA 3C98B 5FXXA 1YXRA 3RX6A 3SFDA 3BQIA 2XJ7A 2KZ7B 3ANWA 4NXNT 4HWFA 2CLYC 5LP6E 4CI1B 4YJ2E 1O3XA 2NWBA 1ZP0A 2W61A 2W66A 4X66T 4LFBT 4KHZF 3DJBA 1KK7A 5LG3A 5AQRB 5JREA 4PFPA 2CHOA 5J0ZA 3C4WA 1HNWT 5L4EA 3AEBA 2D9DA 4HKAA 4O2BE 4OYJA 3N9PA 1UGOA 2M67A 3DP7A 4DR7T 2WMNA 2LE8A 2VURA 3J9X1 4E7SA 5LGNB 5LB7B 2IC9A 1VCSA 4TNVA 2LSYA 3HI2A 4I4TE 4ASKA 3GWHA 3RPUA 4AI6A 1XDOA 4IDOA 5LMUT 2ZM0A 2DHRA 3AAEB 2ACXA 2WU2A 5AQSB 5ABHA 3KVBA 4B3TT 1HS7A 3QUJA 2XHEB 4YSZA 5AQNB 4OK0A 4CN4A 3OVUA 5L3EB 3IBPA 2N2NA 1MIWA 5LMNT 3PUQA 2KT9A 5C8YE 4JI5T 2MTQA 3MA9A 3VR9A 2DWKA 4CXXA 5KXJA 5HXHA 4GYSA 4DIDB 1XNRT 5AQOB 1SA0E 4YHJA 1D1BA 2KINB 3FZKB 1WCRA 2XPKA 3Q5EA 4YTPA 3T1YT 1NEKA 4Z90A 4PFOA 4H63H 5ETWA 2LOPA 1Y64B 2BBJA 4AKGA 3AA0B 3PTRB 3N9LA 4EEBA 2BVMA 1DU2A 3RC3A 2KSRA 3ZN0B 4WYVA 2NW9A 4Q25A 1HFAA 3LG7A 3O1IA 3RYFE 2IHR1 3L8RA 4QHOA 2EHOD 3CKDA 3ZLIA 3PV0F 5FKYA 2NR4A 3MACA 1BR4A 4UF0B 4HTEA 4YJ3E 1JNRA 4YSYA 4X1YE 3PUYF 3DTOA 3ZSSA 2IAKA 3FBZA 4DR6T 4IE0A 1NWMX 2L8KA 3NRXA 3PUZF 3ZT5A 4ZI3C 4YHHT 2DI4A 3CIRA 3ZT7A 2C0SA 4EEDA 3SRZA 5IWAT 2VWAA 3JC6D 1W0BA 2Y48B 3N9MA 2BG9C 1XWMA 4HFEA 4UVAB 3ZMVB 2UUAT 3E0ZA 1IBKT 4DV7T 3MK7C 3ZYLA 2E9XD 2V26A 2VASA 1IAPA 4ISTA 4DO0A 4PJLA 2G0UA 5H6RB 4DMWA 3NVOA 3S4UA 4HWHA 2V7IA 2WMOA 1ZHCA 2LLYA 5E0OA 1WYCA 3RQWA 2C5IT 1SE7A 3MKDA 4ZS2A 3J7Yq 3Q5WA 4AQFC 1US7B 4CN1A 3O9XA 4YT0A 3OYXA 2LJLA 5AQQB 3Q5DA 3RI5A 5CB4E 2YEVC 2XUEA 3NWIA 3AA6B 3AE1A 4ZI2D 4IDPA 3ZSTA 2VQFT 5HEOA 2YDQA 3B57A 3OBVE 3AE3A 3PU3A 4LMLA 3RIUC 2WBLA 4CXYA 2WM9A 3NRYA 1XDPA 2BS4A 4CN6A 2WP9A 3UQ4A 3H3AA 2BS3A 1E7PA 4WZXA 3K3QC 4N78D 2V7JA 5JH7E 3LBXB 5C3JA 4EXTA 3ZMTB 2LSGA 1HNZT 1HX1B 3K8PC 1YQ3A 3PUVF 4O4JE 3ZC0A 2VVSA 4IL9A 4QWNB 3LDQB 5AQLB 5AQFB 4DBQA 2IW5B 1BR1A 2K48A 3BQKA 2W4XA 3A8YC 5HWXA 4OFZA 4UF0A 4ZHQE 2KWHA 4HEAA 2ZMAA 3I1AA 2M6IA 4QH1A 3F57A 4UR9A 1T72A 4X5TA 4TNWA 5IYZE 2SPCA 4X64T 3UU4A 3AE7A 2VQET 4U7IA 2KNDA 2BS2A 4PK4A 5FNVE 4U72A 4IIJE 4JYAT 4XBFB 2CLYB 1WR6A 3TLSA 4HFHA 3AA7B 5AQMB 5FXVA 1N32T 2QVAA 4ILBA 1N36T 5LA6E 4IE5A 3TLTA 1UX5A 3ZKRA 1QSDA 3ZMZB 4XZCA 5L3BB 4CQIA 4G2AA 1OEDC 3RF1A 2FJDA 4HFBA 4KMCA 3K3NA 3PUAA 4DR3T 1CUNA 3SFEA 2ZM6T 2YKSA 4NUVA 3C50A 1IBLT 2YDRA 1GQEA 2KLQA 2A2FX 5AQHB 5BR8T 2KWIB 4WW0A 4U2YA 5JDFA 5BMVE 4ZOLE 2H89A 2R6GF 1V9DA 4CXWA 2XAQB 5LHGB 4TWHA 5LNKA 3FZMB 3LBXA 1BR0A 4QH4A 4NUUA 3C64A 4PK6A 3ZMSB 2XM1A 2WY2A 2NP9A 3V5UA 3AEAA 1L0VA 2CWOA 5GONE 3GN5B 4UEMA 5FP3A 3UT5E 3CQXC 2QGSA 5HEGA 1MMGA 4ZS3A 3ONXA 3N2KE 4KP3C 5CFBA 1XNQT 2J4GA 2VKOA 4UVBB 1HTJF 4X20E 3ABVA 3CPZA 3AE9A 3SS1A 2X0HA 2V6YB 4MHCA 4JI4T 3AEEA 2Q9QD 2E5VA 3C4XA 2W67A 1FIOA 3TKLB 1OXZA 2B76A 3L09A 2VKHA 4KHPT 5ABFB 2UU9T 5FXWA 2L3LA 2JQ9A 3UU3A 3NBXX 2XQAA 3LJCA 5LYJE 3RYIE 2CA5A 5F8PA 5ADXL 4KBMB 1ZV4X 5LBMA 5JDQA 2LRLA 2FJEA 4LF4T 4PJNA 2LKHA 2WWVA 2W62A 1MIVA 3LK42 1LVFA 5JRCB 1MNDA 3QK6A 5L4HA 3CX8B 4PJMA 3EHZA 4DV2T 2NOXA 4ADZA 3FZFB 3Q2MA 2HHHT 4UXNB 4UVCB 5AQIB 4EB6E 4I0UA 5AQUB 3AE8A 4PNIA 2OV9A 2UXXB 4AIUA 4EZHA 3O1HA 3AE2A 5FMNA 4CI2B 3UU5A 4EOZB 2E8IA 2UUCT 4JI2T 2LRKA 5EZYE 3CWZB 2BDEA 5J2UE 2HH7A 2LKGA 1LVKA 1EZ3A 2X0YA 4AQGA 2K9AA 4ZEYA 2I0MA 4NXMT 1D0XA 3UU8A 2CRBA 3F31A 3E08A 2P9BA 5HCMA 4EIWA 4JI8T 2NW8A 2HN1A 4IHJE 3WI3A 4LF8T 1J1JA 2A3DA 5AQJB 3GN5A 3MXZA 5LGUB 5CJ5A 3P4PA 4P1NA 5FYMA 4BJMA 2XAJB 3MJXA 2CEAA 2XASB 4IE4A 3P8CD 4X1KE 4JLEA 4PK5A 3AEFA 2WCAA 4LMKA 1IJ6A 2X9YA 2VL8A 5JR9C 2V6YA 2DL1A 4H9OC 4MALA 3RGLA 2RA1A 4QKNA 4TV9E 2AE9A 4F6RC 2IC6A 5AFUL 5HXRA 4H9QC 2AXDS 2X68A 1D1CA 4M1PA 4LF6T 3B13A 3VKHA 3WAJA 4PAGA 2DLRA 2XQ7A 3ONJA 1MMNA 2CBIA 5ABFA 4JI6T 1FJGT 4X1IE 4IDZA 5H6QB 3KINB 3PJAJ 5DQVA 3P50A 3VU7H 4DMVA 3P7IA 1NENA 3CK6A 3IEEA 2PBIA 4TV8E 1UUSA 2A9UA 3KFWX 3OPCA 4YLHA 4TN7B 2UXCT 3OTOT 1WFDA 4MLKA 4EYUA 5C2TA 5JRCA 2ACZA 2BG9E 3KBUA 1D0YA 5F5WA 3UULA 1HX8A 3WAKA 3QB5A 1QLBA 3MZKB 4C90A 2VVNA 5LBQB 4U3CA 3ETVA 5LJNA 3AECA 4F8HA 3I9WA 4JV5T 1UX4A 5HEUA 2GK9A 3RYCE 1W0AA 2BKOA 2WZIA 3KV6A 1KNZA 3I0OA 1OEDB 2EHOC 4O8SA 1J5WA 3HKEE 4AQFA 4EYYR 1VCTA 3VHLA 5CA0E 1HCIA 2ZM8A 1E1HB 3EABA 2ZLYA 3QB5K 2WQYA 4NIQA 1WRDA 4EZ4A 3I0QA 3EDVA 4QX8B 3PDYA 3HKDE 1UCUA 4JI3T 3RIUA 2I59A 4L9IA 4WBNE 2XZEA 3OJAA 2PTFA 2LM9A 3AVSA 4HWDA 2IUBA 3CQCB 1WLXA 4HFDA 5A1LA 2CPTA 2QYWA 1KFYA 5IHYA 3PURA 5HXSA 4YXDA 3JC6C 3FB2A 4XAXB 4OX9T 2ZM2A 2H3RA 3Q9DA 5L47A 4HFCA 1AJ3A 2CXLA 1KNRA 3RKGA 1FEWA 2E9XC 5LHHB 2DNXA 3QNUA 2WZHA 4KUMB 4AKLA 3N9NA 4HFVA 2WU5A 4DVDA 2YDSA 1M62A 3ZN1B 3UUNA 1WR0A 5FL1A 4JBWF 4A98A 3ZT6A 3SOLA 4AQYT 3RIFA 4KI0F 4YSXA 4DR1T 4H9SE 4BA9A 2V8SV 4DV4T 3U3IA 2CXFA 3L3PA 3VR8A 2WDVA 2X66A 4ZI2C 3VKGA 3F2EA 1HG2A 4NPPA 3C4ZA 4LF5T 4AKHA 3JAEA 3IF8B 1LRZA 3P4WA 4AKRB 4B3MT 3PUXF 2VKJA 4O4HE 4TUYE 4COFA 3N9QA 2JQHA 2MPKA 1OEDA 1OEDE 5FVLA 2YU1A 3CVRA 4ILAA 4DV0T 4TX5A 4YFSA 2X67A 1VOMA 2MOZA 3ZYKA 3A7MA 4DR2T 3CQGB 4LMJA 2LSJA 4DV6T 2DCFA 1Z0PA 4B6XA 4IGUA 3GMIA 4EGWA 3N2GE 1W9RA 1X79A 4HWCA 3HKCE 2QRXA 1SUMB 3FBLA 1T8BA 2WAUA 4JI0T 1T7SA 3FXDB 4JEUB 3ZPOA 4ZZBA 3UU6A 2WB5A 2HPJA 5J2TE 2LHRA 4PW8A 2XY8B 3ZMUB 4YTMA 5LHIB 5DABA 2IIUA 2RPAA 2CBJA 3G06A 3ONLC 5IUXA 3RKOA 2D5UA 2I6HA 1W09A 3KV4A 2DWGA 2D0TA 5AQGB 2F4VT 4A5XA 3PUSA 5JR9B 4GK0E 3HR0A 2YINA 4CZZB 5FY1A
chains in the Genus database with same CATH topology
5HYAA 5J2UE 2HH7A 3SRZA 1LVKA 3LFMA 3KVAA 5LG4A 3ZC1A 3ETUA 1EZ3A 4AQGA 2VWAA 1D0ZA 3A5XA 2K24A 2K9AA 1D0XA 1MMDA 2LHNA 3JC6D 2Y48B 3F31A 4L5GA 3ZEFB 3N9MA 5EK4A 1LKXA 3E08A 2P9BA 3UTKA 4H9PC 2KXPB 5CA1E 5L3CB 2XAHB 4UVAB 4EIWA 3ZMVB 2NW8A 4IHJE 4HE8A 3E0ZA 3WI3A 4CI3B 4DBRA 2A3DA 3GN5A 3MXZA 5M4YA 3BQLA 3MK7C 5LGUB 3RYHE 5LOVE 5JVDE 3ZYLA 2E9XD 2V26A 2VASA 1IAPA 2MBGA 5FYMA 4BJMA 2YU2A 3QC9A 4ISTA 4DO0A 4PJLA 2XAJB 2G0UA 5H6RB 3ESLA 4DMWA 3MJXA 3RRWA 2CEAA 2W00A 2XASB 2RP4A 1H7CA 4IE4A 3S4UA 3E22E 2V7IA 2WMOA 3P8CD 4X1KE 1QUUA 4GK5E 2Q9QB 1ZHCA 4GOUA 4UV8B 2A72A 4JLEA 4PK5A 3R6NA 5E0OA 1WYCA 4C91A 1IJ6A 2X9YA 4QXBB 2C5IT 3MKDA 4ZS2A 3J7Yq 2X0LB 3Q5WA 2VL8A 3KV5A 2PJQA 2PFVA 5JR9C 4AQFC 1US7B 4O4LE 3AB3B 5FY7A 2CE7A 4J2CA 3O9XA 3ANWB 4H9OC 4MALA 3OYXA 2LJLA 2H7OA 2RA1A 1SHZC 3O1JA 4QKNA 4TV9E 1U4QA 1HG5A 4I50E 2IC6A 4F6RC 5AFUL 5JDLA 5CB4E 3T8OA 5HXRA 4H9QC 3EUHA 5LXTE 4P0BA 2CCQA 2YEVC 2X68A 1D1CA 1YW0A 2XUEA 3AA6B 4ZI2D 4M1PA 2V7KA 3HA4A 3B13A 4ZI7E 2XAGB 3VKHA 3WAJA 4PAGA 3N9OA 2DLRA 4O2AE 4A56A 3B57A 3OBVE 3PU3A 3EDUA 1MMNA 2C5KT 3K3OA 4TZ4C 2WBLA 4CXYA 4X1IE 2WM9A 3NRYA 4IDZA 5H6QB 3KINB 5LCYA 2UXNB 3H3AA 3HL6A 4GYRA 2HPLA 2CWYA 5DQVA 2CMRA 5JQGE 2XAFB 3VU7H 3K3QC 4DMVA 3P7IA 4OHFA 4V1Av 4Z8XA 4N78D 3AAAB 5JDNA 2EHOB 3BK9A 1U5PA 2Y8DA 3IEEA 2PBIA 4EAHA 3HKBE 2V7JA 2Q9QC 4TV8E 3KFWX 3ZCIA 5JH7E 3LBXB 2CM0A 4YLHA 2LSIA 5J1GA 4EXTA 4TN7B 5DJQC 2V7MA 3ZMTB 2LSGA 3FHNA 3K8PC 3ZJ1A 3AVRA 1FMWA 3EVYA 4O4JE 3ZC0A 2NTYA 2NTXA 4MLKA 4EYUA 5JRCA 1MMAA 1S94A 4QWNB 1VRBA 5DQWA 3KBUA 4HN9A 3PE0A 1D0YA 1YKHB 3SWHA 2IW5B 4DBQA 3UULA 2BVLA 4QXHB 1BR1A 2K48A 3ZJ2A 2N1GA 3BQKA 3Q5XA 1HX8A 4PJJA 3WAKA 5HWXA 4OFZA 4UF0A 4ZHQE 2KWHA 4ANJA 4HEAA 3MZKB 5HXCA 2ZMAA 4C90A 5KX5E 3I1AA 4E7ZA 3C51A 5LBQB 4OYKA 2W0GA 4QX7B 2VB6A 3ETVA 2JPFA 2QA7A 3F57A 4G63A 5LGTB 5LJNA 2OA5A 3I9WA 1UX4A 1YKEB 2JQQA 5IYZE 2SPCA 3PUGA 2GK9A 3RYCE 2NW7A 5EK2A 2KNDA 4WBOA 2XQYA 3KV6A 2ES0A 1KNZA 3I0OA 2EHOC 3CX6B 4O8SA 4PK4A 3HKEE 5FNVE 5JR9A 4U72A 4AQFA 1NAFA 4EYYR 2LEHA 3VHLA 5CA0E 1HCIA 2CXDA 4IIJE 4IE7A 2K5BB 2N9DA 2ZM8A 1E1HB 4XBFB 4BJNA 2CLYB 2ZLYA 1YD8G 1WR6A 1WRDA 4EZ4A 3CX7B 5FXZA 3I0QA 2E9XB 2ODVA 1OWAA 3EDVA 2XTLA 4MFRA 3FXEB 4QX8B 2X51A 3AA7B 3PDYA 4FI5A 3HKDE 1UCUA 2YK0A 1BR2A 5TAOA 5FXVA 2I59A 4L9IA 4WBNE 4H9RC 3RC8A 3OJAA 2LM9A 3AVSA 3RRCA 5LA6E 4AKIA 1ZKEA 2L9QA 4L0RA 4IE5A 5EK3A 3CQCB 1WLXA 5A1LA 5L3FB 1UX5A 2PG8A 3RH3A 1QSDA 3ZMZB 5IHYA 2Q9QA 3U78A 5L3DB 3LK3B 3PURA 2ODUA 3D0TA 4FJOA 4ISSA 4UELA 5HXSA 4XZCA 5L3BB 2C5JA 3NZPA 4K0UA 5L3GB 4CQIA 2KMFA 4G2AA 4H9NC 1MNEA 3UUXB 4ZI3D 3JC6C 3C98B 5FXXA 4AXPA 3FB2A 1G8XA 4XAXB 2ZM2A 3LK2B 2H3RA 4BAYB 3Q9DA 4U74A 3O4XE 3RX6A 5KMGP 4KMCA 3BQIA 3OKQA 2KZ7B 3ANWA 3K3NA 1HF8A 3PUAA 1AJ3A 2CXLA 2CLYC 1CUNA 3IHRA 3N5LA 1FEWA 2E9XC 4GIWA 5LHHB 4NUVA 5LP6E 4CI1B 3C50A 2JJ9A 4YJ2E 1O3XA 2NWBA 2DNXA 2W61A 2KLQA 4KUMB 4AKLA 3N9NA 4UV9B 4HFVA 2A2FX 4DVDA 3DJBA 3ZN1B 1KK7A 3UUNA 2KWIB 2X9WA 2W63A 4I43B 2JMHA 4WW0A 4ERRA 4PFPA 5JREA 3SOLA 3R84B 3C4WA 4DNDA 5JDFA 1IZNB 5BMVE 4ZOLE 1V9DA 1S35A 4CXWA 4H9SE 4BA9A 2EHOA 2XAQB 4HKAA 5LHGB 4O2BE 4OYJA 3U3IA 4H63V 3N9PA 5LNKA 2M67A 3DP7A 3LBXA 1BR0A 2B1EA 2CXFA 2LE8A 2WMNA 3L3PA 3J9X1 4E7SA 4NUUA 3C64A 4PK6A 3ZMSB 5LGNB 2X66A 4ZI2C 5KDMC 2JRKA 3AA1B 2IC9A 3VKGA 3F2EA 2D2SA 2NP9A 3V5UA 2LSYA 1HG2A 3HI2A 1B7TA 2X9HA 4I4TE 4ASKA 4P09A 3C4ZA 2CWOA 3GWHA 5GONE 4AKHA 3GN5B 4MBQA 1FMVA 4UEMA 5FP3A 3CQXC 3UT5E 3RPUA 4AI6A 3IF8B 1LRZA 2QGSA 2ZM0A 2VK9A 2DHRA 3CMLA 3AAEB 1MMGA 2BZBA 2ACXA 4AKRB 3KVBA 4ILUA 1HS7A 4ZS3A 5JDMA 2JMKA 3ONXA 3QUJA 1T98A 3N2KE 2XHEB 4KP3C 2VKJA 4O4HE 4TUYE 3ZYMA 4P0AA 2VKOA 3I9YA 4UVBB 4OK0A 1HTJF 4X20E 3NZQA 3IBPA 5L3EB 3N9QA 2N2NA 1MIWA 3CPZA 3KV9A 3PUQA 2KT9A 2J1DG 3SS1A 5C8YE 2MTQA 4MHCA 2WSSV 3MA9A 2DWKA 2Q9QD 4CXXA 5HXEA 4IE6A 2YU1A 3CVRA 3KBTA 3C4XA 1FIOA 5HXHA 4GYSA 3TKLB 3ZCJA 1OXZA 3OYZA 4TX5A 4YFSA 2X67A 1VOMA 2MOZA 1SA0E 4YHJA 3L09A 1D1BA 2KINB 1ZEEA 2E9XA 2VKHA 3ZYKA 2Y6XA 2H7VC 4HGAA 3CQGB 5FXWA 2L3LA 5HWYA 3M65A 2LSJA 2DCFA 1Z0PA 3NBXX 4B6XA 4IGUA 3LJCA 5JDHA 5LYJE 3RYIE 2D0UA 3GMIA 4PFOA 4H63H 2CA5A 2WWUA 3N2GE 5F8PA 4JUYA 5ADXL 5ETWA 4KBMB 2LOPA 1Y64B 3UFEA 4AKGA 1ZV4X 3AA0B 5LBMA 5JDQA 1X79A 3HKCE 3PTRB 3N9LA 2BVMA 3N2OA 5L2LA 3KDSE 4JEHB 3RC3A 3FBLA 4PJNA 3ZN0B 1D1AA 1G73A 2NW9A 1IJ5A 5JDGA 2LSKA 2W62A 2WAUA 1HFAA 3AAIA 3LG7A 3O1IA 3RYFE 3FXDB 4JEUB 3ZPOA 5FY0A 2LT3A 1MIVA 3LK42 4QHOA 1LVFA 2HPJA 4I55E 2EHOD 5LJMA 1MNDA 5J2TE 5JRCB 3QK6A 3CKDA 1WYBA 2LHRA 3CX8B 3ZLIA 4PW8A 4PJMA 3W15B 3MACA 1BR4A 2NOXA 4ADZA 3GA8A 5F3JA 3ZMUB 2Z6EA 4UF0B 4HTEA 4YJ3E 3V5SA 2V7LA 3Q2MA 2MYSA 4UXNB 5LHIB 4X1YE 5DABA 2VKDA 4QXCB 4UVCB 3UUMA 4EB6E 3H37A 3DTOA 4PNIA 2LOSA 4O4IE 3RKOA 2UXXB 2D5UA 1MIYA 2IAKA 2V1DB 3FBZA 4EZHA 5HAXA 3O1HA 3PU8A 3KV4A 5FMNA 4CI2B 4IE0A 4EOZB 4UIGA 2DWGA 2E8IA 2D0TA 1NWMX 2L8KA 3NRXA 5EZYE 3CWZB 4ZI3C 4WNKA 2X9XA 2DI4A 2BDEA 3PUSA 5JR9B 4GK0E 2C0SA 3HR0A 2YINA 4CZZB 5FY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAL A;  4MBQ A; 
#chains in the Genus database with same CATH topology
 3LFM A;  5LG4 A;  3VRB A;  1UK5 A;  3LSV A;  3UUB A;  3ETU A;  1D0Z A;  2K24 A;  1MMD A;  4L5G A;  4YY3 T;  5EK4 A;  1LKX A;  2KXP B;  5L3C B;  1I94 T;  2M6B A;  4HE8 A;  1HNX T;  5ABG A;  5M4Y A;  3RYH E;  1XMO T;  2MBG A;  4AIS A;  3RRW A;  2W00 A;  2RP4 A;  4ILC A;  1QUU A;  4GK5 E;  4GOU A;  1KF6 A;  4UV8 B;  2A72 A;  4C91 A;  4LFA T;  2X0L B;  4Z91 A;  2PJQ A;  2PFV A;  4TWD A;  2CE7 A;  4J2C A;  4JI7 T;  2H7O A;  1SHZ C;  1U4Q A;  1HG5 A;  3FZL B;  4I50 E;  3EUH A;  5LXT E;  4P0B A;  1YW0 A;  2W2U A;  3NKZ A;  1KEY A;  4O2A E;  2C5K T;  4IT4 A;  5LCY A;  2BG9 B;  2UXN B;  3TLW A;  3HL6 A;  2FJA A;  2HPL A;  2CWY A;  4HWI B;  2CMR A;  3RLF F;  5JQG E;  2XAF B;  4OHF A;  4Z8X A;  5JDN A;  2EHO B;  3BK9 A;  1U5P A;  2Y8D A;  4EAH A;  2Q9Q C;  4KX6 A;  2CM0 A;  2LSI A;  1I6Z A;  2V7M A;  2HN2 A;  3FHN A;  3ZJ1 A;  1IBM T;  3UFG A;  4U2Z A;  1MMA A;  1S94 A;  4HN9 A;  3PE0 A;  3M3Z B;  2LM2 A;  3ZJ2 A;  2N1G A;  3Q5X A;  4PJJ A;  5HXC A;  2V5D A;  4LF9 T;  3JAF A;  1E2A A;  4QX7 B;  2WS3 A;  2VB6 A;  2JPF A;  3TLV A;  4G63 A;  4LF7 T;  5AQP B;  4DV3 T;  2NW7 A;  5FVK A;  2WDQ A;  4WBO A;  2XQY A;  2ES0 A;  1XZY A;  5JR9 A;  3K1S A;  1NAF A;  2CXD A;  4IE7 A;  3JAD A;  2K5B B;  2N9D A;  3EI0 A;  4BJN A;  1YQ4 A;  3CX7 B;  2E9X B;  2ODV A;  1OWA A;  2XTL A;  4MFR A;  3FXE B;  2X51 A;  4YTN A;  5AQK B;  5TAO A;  4LFC T;  4H9R C;  3RC8 A;  2L9Q A;  2K3W A;  5HCJ A;  3QOF A;  5AQT B;  2JQK A;  2PG8 A;  4IDN A;  3RHW A;  3RH3 A;  3U78 A;  5ABE A;  4X65 T;  4IDQ A;  4ISS A;  2C5J A;  3NZP A;  4K0U A;  5L3G B;  3UQ7 A;  4H9N C;  4ZI3 D;  4AXP A;  1G8X A;  1M7K A;  3LK2 B;  4BAY B;  4U74 A;  3O4X E;  5KMG P;  3OKQ A;  1HF8 A;  4EV6 A;  3IHR A;  3N5L A;  4GIW A;  2JJ9 A;  2FBW A;  4UV9 B;  2UUB T;  2X9W A;  4JI1 T;  2W63 A;  4I43 B;  2JMH A;  2BG9 A;  4ERR A;  3AE4 A;  4DND A;  3R84 B;  1IZN B;  4ZZC A;  4DUY T;  3AE5 A;  1XMQ T;  1S35 A;  2BBH A;  2EHO A;  4H63 V;  2FJB A;  2V6X A;  1JNZ A;  5AQV B;  2B1E A;  5HEH A;  5KDM C;  2JRK A;  3AA1 B;  2D2S A;  1B7T A;  2X9H A;  3X1D A;  4P09 A;  2WDR A;  4GKK T;  2XQ8 A;  4U31 A;  4MBQ A;  1FMV A;  1N34 T;  2VK9 A;  3CML A;  2BZB A;  4ILU A;  3P4S A;  5JDM A;  2JMK A;  3VRA A;  1T98 A;  2XSA A;  3ZYM A;  4P0A A;  3I9Y A;  2OLT A;  3NZQ A;  3KV9 A;  2IML A;  2J1D G;  2WSS V;  2MAW A;  5HXE A;  4IE6 A;  3KBT A;  5CGM A;  2E2A A;  3ZCJ A;  3OYZ A;  2E5L T;  3B5M A;  1ZEE A;  2E9X A;  2Y6X A;  4HFI A;  2H7V C;  4HGA A;  5HWY A;  3M65 A;  2V5C A;  3TLU A;  4A97 A;  5JDH A;  2D0U A;  4IRE A;  2WWU A;  4JUY A;  3UFE A;  2H88 A;  3N2O A;  5L2L A;  3KDS E;  4JEH B;  1D1A A;  1G73 A;  1IJ5 A;  5JDG A;  2LSK A;  3AAI A;  1X9B A;  5FY0 A;  2LT3 A;  5LJM A;  4I55 E;  2J62 A;  2BKP A;  1WYB A;  2J47 A;  3W15 B;  3P4R A;  3H3M A;  2CHN A;  3GA8 A;  5F3J A;  2Z6E A;  3V5S A;  2V7L A;  2MYS A;  2VKD A;  4QXC B;  3RQU A;  1ZOY A;  3UUM A;  3H37 A;  2LOS A;  4O4I E;  3T1H T;  1MIY A;  2V1D B;  4DUZ T;  5HAX A;  3PU8 A;  4UIG A;  1CHU A;  4ZXL A;  4WNK A;  2X9X A;  3PJA A;  2UXB T;  4TWF A;  2XM2 A;  2XQ4 A;  5HYA A;  3KVA A;  3ZC1 A;  3A5X A;  2FUP A;  2LHN A;  3ZEF B;  5CA1 E;  3UTK A;  4H9P C;  5FL0 A;  2XAH B;  3AXJ B;  2XSB A;  3AE6 A;  3AEG A;  4CI3 B;  4DBR A;  3BQL A;  4DV1 T;  4GKJ T;  5LOV E;  5JVD E;  5HEJ A;  2YU2 A;  3QC9 A;  1N33 T;  3ESL A;  2XQ9 A;  1H7C A;  3E22 E;  2Q9Q B;  2XQ5 A;  2XQ3 A;  3R6N A;  4QXB B;  2YN6 A;  3KV5 A;  4O4L E;  3AB3 B;  5FY7 A;  3ANW B;  2JIW A;  3O1J A;  4B3R T;  5JDL A;  3T8O A;  2CCQ A;  4IL4 A;  2V7K A;  3HA4 A;  4ZI7 E;  2XAG B;  3N9O A;  4A56 A;  1KNP A;  3EDU A;  2BKN A;  3EAM A;  3K3O A;  3L39 A;  4TZ4 C;  4GYR A;  4V1A v;  3AAA B;  3HKB E;  3ZCI A;  5J1G A;  3RIA A;  5DJQ C;  3FZH B;  3AVR A;  1FMW A;  3EVY A;  4B3S T;  2NTY A;  2NTX A;  3AED A;  1VRB A;  5DQW A;  1YKH B;  3SWH A;  2BVL A;  4QXH B;  4U33 A;  3IA3 A;  4QH5 A;  1J5E T;  1R8I A;  4ANJ A;  4DR5 T;  5KX5 E;  4E7Z A;  3C51 A;  4OYK A;  2W0G A;  2QA7 A;  2IDO B;  5LGT B;  2OA5 A;  1YKE B;  2JQQ A;  3PUG A;  2YOE A;  4U7Y A;  5EK2 A;  3CX6 B;  1Z8U A;  2LEH A;  1UUR A;  1YD8 G;  2XQ6 A;  5FXZ A;  2VL0 A;  4X62 T;  3AXJ A;  4FI5 A;  4DV5 T;  1HR0 T;  3PUW F;  2YK0 A;  1BR2 A;  1Y01 A;  3RRC A;  4DR4 T;  2UXD T;  4AKI A;  1ZKE A;  4L0R A;  5EK3 A;  4K0K T;  5L3F B;  2Q9Q A;  3P4Q A;  5JTG A;  5L3D B;  3LK3 B;  2ODU A;  3D0T A;  4FJO A;  4UEL A;  2KMF A;  3UUX B;  1MNE A;  3JCF A;  3C98 B;  5FXX A;  1YXR A;  3RX6 A;  3SFD A;  3BQI A;  2XJ7 A;  2KZ7 B;  3ANW A;  4NXN T;  4HWF A;  2CLY C;  5LP6 E;  4CI1 B;  4YJ2 E;  1O3X A;  2NWB A;  1ZP0 A;  2W61 A;  2W66 A;  4X66 T;  4LFB T;  4KHZ F;  3DJB A;  1KK7 A;  5LG3 A;  5AQR B;  5JRE A;  4PFP A;  2CHO A;  5J0Z A;  3C4W A;  1HNW T;  5L4E A;  3AEB A;  2D9D A;  4HKA A;  4O2B E;  4OYJ A;  3N9P A;  1UGO A;  2M67 A;  3DP7 A;  4DR7 T;  2WMN A;  2LE8 A;  2VUR A;  3J9X 1;  4E7S A;  5LGN B;  5LB7 B;  2IC9 A;  1VCS A;  4TNV A;  2LSY A;  3HI2 A;  4I4T E;  4ASK A;  3GWH A;  3RPU A;  4AI6 A;  1XDO A;  4IDO A;  5LMU T;  2ZM0 A;  2DHR A;  3AAE B;  2ACX A;  2WU2 A;  5AQS B;  5ABH A;  3KVB A;  4B3T T;  1HS7 A;  3QUJ A;  2XHE B;  4YSZ A;  5AQN B;  4OK0 A;  4CN4 A;  3OVU A;  5L3E B;  3IBP A;  2N2N A;  1MIW A;  5LMN T;  3PUQ A;  2KT9 A;  5C8Y E;  4JI5 T;  2MTQ A;  3MA9 A;  3VR9 A;  2DWK A;  4CXX A;  5KXJ A;  5HXH A;  4GYS A;  4DID B;  1XNR T;  5AQO B;  1SA0 E;  4YHJ A;  1D1B A;  2KIN B;  3FZK B;  1WCR A;  2XPK A;  3Q5E A;  4YTP A;  3T1Y T;  1NEK A;  4Z90 A;  4PFO A;  4H63 H;  5ETW A;  2LOP A;  1Y64 B;  2BBJ A;  4AKG A;  3AA0 B;  3PTR B;  3N9L A;  4EEB A;  2BVM A;  1DU2 A;  3RC3 A;  2KSR A;  3ZN0 B;  4WYV A;  2NW9 A;  4Q25 A;  1HFA A;  3LG7 A;  3O1I A;  3RYF E;  2IHR 1;  3L8R A;  4QHO A;  2EHO D;  3CKD A;  3ZLI A;  3PV0 F;  5FKY A;  2NR4 A;  3MAC A;  1BR4 A;  4UF0 B;  4HTE A;  4YJ3 E;  1JNR A;  4YSY A;  4X1Y E;  3PUY F;  3DTO A;  3ZSS A;  2IAK A;  3FBZ A;  4DR6 T;  4IE0 A;  1NWM X;  2L8K A;  3NRX A;  3PUZ F;  3ZT5 A;  4ZI3 C;  4YHH T;  2DI4 A;  3CIR A;  3ZT7 A;  2C0S A;  4EED A;  3SRZ A;  5IWA T;  2VWA A;  3JC6 D;  1W0B A;  2Y48 B;  3N9M A;  2BG9 C;  1XWM A;  4HFE A;  4UVA B;  3ZMV B;  2UUA T;  3E0Z A;  1IBK T;  4DV7 T;  3MK7 C;  3ZYL A;  2E9X D;  2V26 A;  2VAS A;  1IAP A;  4IST A;  4DO0 A;  4PJL A;  2G0U A;  5H6R B;  4DMW A;  3NVO A;  3S4U A;  4HWH A;  2V7I A;  2WMO A;  1ZHC A;  2LLY A;  5E0O A;  1WYC A;  3RQW A;  2C5I T;  1SE7 A;  3MKD A;  4ZS2 A;  3J7Y q;  3Q5W A;  4AQF C;  1US7 B;  4CN1 A;  3O9X A;  4YT0 A;  3OYX A;  2LJL A;  5AQQ B;  3Q5D A;  3RI5 A;  5CB4 E;  2YEV C;  2XUE A;  3NWI A;  3AA6 B;  3AE1 A;  4ZI2 D;  4IDP A;  3ZST A;  2VQF T;  5HEO A;  2YDQ A;  3B57 A;  3OBV E;  3AE3 A;  3PU3 A;  4LML A;  3RIU C;  2WBL A;  4CXY A;  2WM9 A;  3NRY A;  1XDP A;  2BS4 A;  4CN6 A;  2WP9 A;  3UQ4 A;  3H3A A;  2BS3 A;  1E7P A;  4WZX A;  3K3Q C;  4N78 D;  2V7J A;  5JH7 E;  3LBX B;  5C3J A;  4EXT A;  3ZMT B;  2LSG A;  1HNZ T;  1HX1 B;  3K8P C;  1YQ3 A;  3PUV F;  4O4J E;  3ZC0 A;  2VVS A;  4IL9 A;  4QWN B;  3LDQ B;  5AQL B;  5AQF B;  4DBQ A;  2IW5 B;  1BR1 A;  2K48 A;  3BQK A;  2W4X A;  3A8Y C;  5HWX A;  4OFZ A;  4UF0 A;  4ZHQ E;  2KWH A;  4HEA A;  2ZMA A;  3I1A A;  2M6I A;  4QH1 A;  3F57 A;  4UR9 A;  1T72 A;  4X5T A;  4TNW A;  5IYZ E;  2SPC A;  4X64 T;  3UU4 A;  3AE7 A;  2VQE T;  4U7I A;  2KND A;  2BS2 A;  4PK4 A;  5FNV E;  4U72 A;  4IIJ E;  4JYA T;  4XBF B;  2CLY B;  1WR6 A;  3TLS A;  4HFH A;  3AA7 B;  5AQM B;  5FXV A;  1N32 T;  2QVA A;  4ILB A;  1N36 T;  5LA6 E;  4IE5 A;  3TLT A;  1UX5 A;  3ZKR A;  1QSD A;  3ZMZ B;  4XZC A;  5L3B B;  4CQI A;  4G2A A;  1OED C;  3RF1 A;  2FJD A;  4HFB A;  4KMC A;  3K3N A;  3PUA A;  4DR3 T;  1CUN A;  3SFE A;  2ZM6 T;  2YKS A;  4NUV A;  3C50 A;  1IBL T;  2YDR A;  1GQE A;  2KLQ A;  2A2F X;  5AQH B;  5BR8 T;  2KWI B;  4WW0 A;  4U2Y A;  5JDF A;  5BMV E;  4ZOL E;  2H89 A;  2R6G F;  1V9D A;  4CXW A;  2XAQ B;  5LHG B;  4TWH A;  5LNK A;  3FZM B;  3LBX A;  1BR0 A;  4QH4 A;  4NUU A;  3C64 A;  4PK6 A;  3ZMS B;  2XM1 A;  2WY2 A;  2NP9 A;  3V5U A;  3AEA A;  1L0V A;  2CWO A;  5GON E;  3GN5 B;  4UEM A;  5FP3 A;  3UT5 E;  3CQX C;  2QGS A;  5HEG A;  1MMG A;  4ZS3 A;  3ONX A;  3N2K E;  4KP3 C;  5CFB A;  1XNQ T;  2J4G A;  2VKO A;  4UVB B;  1HTJ F;  4X20 E;  3ABV A;  3CPZ A;  3AE9 A;  3SS1 A;  2X0H A;  2V6Y B;  4MHC A;  4JI4 T;  3AEE A;  2Q9Q D;  2E5V A;  3C4X A;  2W67 A;  1FIO A;  3TKL B;  1OXZ A;  2B76 A;  3L09 A;  2VKH A;  4KHP T;  5ABF B;  2UU9 T;  5FXW A;  2L3L A;  2JQ9 A;  3UU3 A;  3NBX X;  2XQA A;  3LJC A;  5LYJ E;  3RYI E;  2CA5 A;  5F8P A;  5ADX L;  4KBM B;  1ZV4 X;  5LBM A;  5JDQ A;  2LRL A;  2FJE A;  4LF4 T;  4PJN A;  2LKH A;  2WWV A;  2W62 A;  1MIV A;  3LK4 2;  1LVF A;  5JRC B;  1MND A;  3QK6 A;  5L4H A;  3CX8 B;  4PJM A;  3EHZ A;  4DV2 T;  2NOX A;  4ADZ A;  3FZF B;  3Q2M A;  2HHH T;  4UXN B;  4UVC B;  5AQI B;  4EB6 E;  4I0U A;  5AQU B;  3AE8 A;  4PNI A;  2OV9 A;  2UXX B;  4AIU A;  4EZH A;  3O1H A;  3AE2 A;  5FMN A;  4CI2 B;  3UU5 A;  4EOZ B;  2E8I A;  2UUC T;  4JI2 T;  2LRK A;  5EZY E;  3CWZ B;  2BDE A;  5J2U E;  2HH7 A;  2LKG A;  1LVK A;  1EZ3 A;  2X0Y A;  4AQG A;  2K9A A;  4ZEY A;  2I0M A;  4NXM T;  1D0X A;  3UU8 A;  2CRB A;  3F31 A;  3E08 A;  2P9B A;  5HCM A;  4EIW A;  4JI8 T;  2NW8 A;  2HN1 A;  4IHJ E;  3WI3 A;  4LF8 T;  1J1J A;  2A3D A;  5AQJ B;  3GN5 A;  3MXZ A;  5LGU B;  5CJ5 A;  3P4P A;  4P1N A;  5FYM A;  4BJM A;  2XAJ B;  3MJX A;  2CEA A;  2XAS B;  4IE4 A;  3P8C D;  4X1K E;  4JLE A;  4PK5 A;  3AEF A;  2WCA A;  4LMK A;  1IJ6 A;  2X9Y A;  2VL8 A;  5JR9 C;  2V6Y A;  2DL1 A;  4H9O C;  4MAL A;  3RGL A;  2RA1 A;  4QKN A;  4TV9 E;  2AE9 A;  4F6R C;  2IC6 A;  5AFU L;  5HXR A;  4H9Q C;  2AXD S;  2X68 A;  1D1C A;  4M1P A;  4LF6 T;  3B13 A;  3VKH A;  3WAJ A;  4PAG A;  2DLR A;  2XQ7 A;  3ONJ A;  1MMN A;  2CBI A;  5ABF A;  4JI6 T;  1FJG T;  4X1I E;  4IDZ A;  5H6Q B;  3KIN B;  3PJA J;  5DQV A;  3P50 A;  3VU7 H;  4DMV A;  3P7I A;  1NEN A;  3CK6 A;  3IEE A;  2PBI A;  4TV8 E;  1UUS A;  2A9U A;  3KFW X;  3OPC A;  4YLH A;  4TN7 B;  2UXC T;  3OTO T;  1WFD A;  4MLK A;  4EYU A;  5C2T A;  5JRC A;  2ACZ A;  2BG9 E;  3KBU A;  1D0Y A;  5F5W A;  3UUL A;  1HX8 A;  3WAK A;  3QB5 A;  1QLB A;  3MZK B;  4C90 A;  2VVN A;  5LBQ B;  4U3C A;  3ETV A;  5LJN A;  3AEC A;  4F8H A;  3I9W A;  4JV5 T;  1UX4 A;  5HEU A;  2GK9 A;  3RYC E;  1W0A A;  2BKO A;  2WZI A;  3KV6 A;  1KNZ A;  3I0O A;  1OED B;  2EHO C;  4O8S A;  1J5W A;  3HKE E;  4AQF A;  4EYY R;  1VCT A;  3VHL A;  5CA0 E;  1HCI A;  2ZM8 A;  1E1H B;  3EAB A;  2ZLY A;  3QB5 K;  2WQY A;  4NIQ A;  1WRD A;  4EZ4 A;  3I0Q A;  3EDV A;  4QX8 B;  3PDY A;  3HKD E;  1UCU A;  4JI3 T;  3RIU A;  2I59 A;  4L9I A;  4WBN E;  2XZE A;  3OJA A;  2PTF A;  2LM9 A;  3AVS A;  4HWD A;  2IUB A;  3CQC B;  1WLX A;  4HFD A;  5A1L A;  2CPT A;  2QYW A;  1KFY A;  5IHY A;  3PUR A;  5HXS A;  4YXD A;  3JC6 C;  3FB2 A;  4XAX B;  4OX9 T;  2ZM2 A;  2H3R A;  3Q9D A;  5L47 A;  4HFC A;  1AJ3 A;  2CXL A;  1KNR A;  3RKG A;  1FEW A;  2E9X C;  5LHH B;  2DNX A;  3QNU A;  2WZH A;  4KUM B;  4AKL A;  3N9N A;  4HFV A;  2WU5 A;  4DVD A;  2YDS A;  1M62 A;  3ZN1 B;  3UUN A;  1WR0 A;  5FL1 A;  4JBW F;  4A98 A;  3ZT6 A;  3SOL A;  4AQY T;  3RIF A;  4KI0 F;  4YSX A;  4DR1 T;  4H9S E;  4BA9 A;  2V8S V;  4DV4 T;  3U3I A;  2CXF A;  3L3P A;  3VR8 A;  2WDV A;  2X66 A;  4ZI2 C;  3VKG A;  3F2E A;  1HG2 A;  4NPP A;  3C4Z A;  4LF5 T;  4AKH A;  3JAE A;  3IF8 B;  1LRZ A;  3P4W A;  4AKR B;  4B3M T;  3PUX F;  2VKJ A;  4O4H E;  4TUY E;  4COF A;  3N9Q A;  2JQH A;  2MPK A;  1OED A;  1OED E;  5FVL A;  2YU1 A;  3CVR A;  4ILA A;  4DV0 T;  4TX5 A;  4YFS A;  2X67 A;  1VOM A;  2MOZ A;  3ZYK A;  3A7M A;  4DR2 T;  3CQG B;  4LMJ A;  2LSJ A;  4DV6 T;  2DCF A;  1Z0P A;  4B6X A;  4IGU A;  3GMI A;  4EGW A;  3N2G E;  1W9R A;  1X79 A;  4HWC A;  3HKC E;  2QRX A;  1SUM B;  3FBL A;  1T8B A;  2WAU A;  4JI0 T;  1T7S A;  3FXD B;  4JEU B;  3ZPO A;  4ZZB A;  3UU6 A;  2WB5 A;  2HPJ A;  5J2T E;  2LHR A;  4PW8 A;  2XY8 B;  3ZMU B;  4YTM A;  5LHI B;  5DAB A;  2IIU A;  2RPA A;  2CBJ A;  3G06 A;  3ONL C;  5IUX A;  3RKO A;  2D5U A;  2I6H A;  1W09 A;  3KV4 A;  2DWG A;  2D0T A;  5AQG B;  2F4V T;  4A5X A;  3PUS A;  5JR9 B;  4GK0 E;  3HR0 A;  2YIN A;  4CZZ B;  5FY1 A; 
#chains in the Genus database with same CATH homology
 5HYA A;  5J2U E;  2HH7 A;  3SRZ A;  1LVK A;  3LFM A;  3KVA A;  5LG4 A;  3ZC1 A;  3ETU A;  1EZ3 A;  4AQG A;  2VWA A;  1D0Z A;  3A5X A;  2K24 A;  2K9A A;  1D0X A;  1MMD A;  2LHN A;  3JC6 D;  2Y48 B;  3F31 A;  4L5G A;  3ZEF B;  3N9M A;  5EK4 A;  1LKX A;  3E08 A;  2P9B A;  3UTK A;  4H9P C;  2KXP B;  5CA1 E;  5L3C B;  2XAH B;  4UVA B;  4EIW A;  3ZMV B;  2NW8 A;  4IHJ E;  4HE8 A;  3E0Z A;  3WI3 A;  4CI3 B;  4DBR A;  2A3D A;  3GN5 A;  3MXZ A;  5M4Y A;  3BQL A;  3MK7 C;  5LGU B;  3RYH E;  5LOV E;  5JVD E;  3ZYL A;  2E9X D;  2V26 A;  2VAS A;  1IAP A;  2MBG A;  5FYM A;  4BJM A;  2YU2 A;  3QC9 A;  4IST A;  4DO0 A;  4PJL A;  2XAJ B;  2G0U A;  5H6R B;  3ESL A;  4DMW A;  3MJX A;  3RRW A;  2CEA A;  2W00 A;  2XAS B;  2RP4 A;  1H7C A;  4IE4 A;  3S4U A;  3E22 E;  2V7I A;  2WMO A;  3P8C D;  4X1K E;  1QUU A;  4GK5 E;  2Q9Q B;  1ZHC A;  4GOU A;  4UV8 B;  2A72 A;  4JLE A;  4PK5 A;  3R6N A;  5E0O A;  1WYC A;  4C91 A;  1IJ6 A;  2X9Y A;  4QXB B;  2C5I T;  3MKD A;  4ZS2 A;  3J7Y q;  2X0L B;  3Q5W A;  2VL8 A;  3KV5 A;  2PJQ A;  2PFV A;  5JR9 C;  4AQF C;  1US7 B;  4O4L E;  3AB3 B;  5FY7 A;  2CE7 A;  4J2C A;  3O9X A;  3ANW B;  4H9O C;  4MAL A;  3OYX A;  2LJL A;  2H7O A;  2RA1 A;  1SHZ C;  3O1J A;  4QKN A;  4TV9 E;  1U4Q A;  1HG5 A;  4I50 E;  2IC6 A;  4F6R C;  5AFU L;  5JDL A;  5CB4 E;  3T8O A;  5HXR A;  4H9Q C;  3EUH A;  5LXT E;  4P0B A;  2CCQ A;  2YEV C;  2X68 A;  1D1C A;  1YW0 A;  2XUE A;  3AA6 B;  4ZI2 D;  4M1P A;  2V7K A;  3HA4 A;  3B13 A;  4ZI7 E;  2XAG B;  3VKH A;  3WAJ A;  4PAG A;  3N9O A;  2DLR A;  4O2A E;  4A56 A;  3B57 A;  3OBV E;  3PU3 A;  3EDU A;  1MMN A;  2C5K T;  3K3O A;  4TZ4 C;  2WBL A;  4CXY A;  4X1I E;  2WM9 A;  3NRY A;  4IDZ A;  5H6Q B;  3KIN B;  5LCY A;  2UXN B;  3H3A A;  3HL6 A;  4GYR A;  2HPL A;  2CWY A;  5DQV A;  2CMR A;  5JQG E;  2XAF B;  3VU7 H;  3K3Q C;  4DMV A;  3P7I A;  4OHF A;  4V1A v;  4Z8X A;  4N78 D;  3AAA B;  5JDN A;  2EHO B;  3BK9 A;  1U5P A;  2Y8D A;  3IEE A;  2PBI A;  4EAH A;  3HKB E;  2V7J A;  2Q9Q C;  4TV8 E;  3KFW X;  3ZCI A;  5JH7 E;  3LBX B;  2CM0 A;  4YLH A;  2LSI A;  5J1G A;  4EXT A;  4TN7 B;  5DJQ C;  2V7M A;  3ZMT B;  2LSG A;  3FHN A;  3K8P C;  3ZJ1 A;  3AVR A;  1FMW A;  3EVY A;  4O4J E;  3ZC0 A;  2NTY A;  2NTX A;  4MLK A;  4EYU A;  5JRC A;  1MMA A;  1S94 A;  4QWN B;  1VRB A;  5DQW A;  3KBU A;  4HN9 A;  3PE0 A;  1D0Y A;  1YKH B;  3SWH A;  2IW5 B;  4DBQ A;  3UUL A;  2BVL A;  4QXH B;  1BR1 A;  2K48 A;  3ZJ2 A;  2N1G A;  3BQK A;  3Q5X A;  1HX8 A;  4PJJ A;  3WAK A;  5HWX A;  4OFZ A;  4UF0 A;  4ZHQ E;  2KWH A;  4ANJ A;  4HEA A;  3MZK B;  5HXC A;  2ZMA A;  4C90 A;  5KX5 E;  3I1A A;  4E7Z A;  3C51 A;  5LBQ B;  4OYK A;  2W0G A;  4QX7 B;  2VB6 A;  3ETV A;  2JPF A;  2QA7 A;  3F57 A;  4G63 A;  5LGT B;  5LJN A;  2OA5 A;  3I9W A;  1UX4 A;  1YKE B;  2JQQ A;  5IYZ E;  2SPC A;  3PUG A;  2GK9 A;  3RYC E;  2NW7 A;  5EK2 A;  2KND A;  4WBO A;  2XQY A;  3KV6 A;  2ES0 A;  1KNZ A;  3I0O A;  2EHO C;  3CX6 B;  4O8S A;  4PK4 A;  3HKE E;  5FNV E;  5JR9 A;  4U72 A;  4AQF A;  1NAF A;  4EYY R;  2LEH A;  3VHL A;  5CA0 E;  1HCI A;  2CXD A;  4IIJ E;  4IE7 A;  2K5B B;  2N9D A;  2ZM8 A;  1E1H B;  4XBF B;  4BJN A;  2CLY B;  2ZLY A;  1YD8 G;  1WR6 A;  1WRD A;  4EZ4 A;  3CX7 B;  5FXZ A;  3I0Q A;  2E9X B;  2ODV A;  1OWA A;  3EDV A;  2XTL A;  4MFR A;  3FXE B;  4QX8 B;  2X51 A;  3AA7 B;  3PDY A;  4FI5 A;  3HKD E;  1UCU A;  2YK0 A;  1BR2 A;  5TAO A;  5FXV A;  2I59 A;  4L9I A;  4WBN E;  4H9R C;  3RC8 A;  3OJA A;  2LM9 A;  3AVS A;  3RRC A;  5LA6 E;  4AKI A;  1ZKE A;  2L9Q A;  4L0R A;  4IE5 A;  5EK3 A;  3CQC B;  1WLX A;  5A1L A;  5L3F B;  1UX5 A;  2PG8 A;  3RH3 A;  1QSD A;  3ZMZ B;  5IHY A;  2Q9Q A;  3U78 A;  5L3D B;  3LK3 B;  3PUR A;  2ODU A;  3D0T A;  4FJO A;  4ISS A;  4UEL A;  5HXS A;  4XZC A;  5L3B B;  2C5J A;  3NZP A;  4K0U A;  5L3G B;  4CQI A;  2KMF A;  4G2A A;  4H9N C;  1MNE A;  3UUX B;  4ZI3 D;  3JC6 C;  3C98 B;  5FXX A;  4AXP A;  3FB2 A;  1G8X A;  4XAX B;  2ZM2 A;  3LK2 B;  2H3R A;  4BAY B;  3Q9D A;  4U74 A;  3O4X E;  3RX6 A;  5KMG P;  4KMC A;  3BQI A;  3OKQ A;  2KZ7 B;  3ANW A;  3K3N A;  1HF8 A;  3PUA A;  1AJ3 A;  2CXL A;  2CLY C;  1CUN A;  3IHR A;  3N5L A;  1FEW A;  2E9X C;  4GIW A;  5LHH B;  4NUV A;  5LP6 E;  4CI1 B;  3C50 A;  2JJ9 A;  4YJ2 E;  1O3X A;  2NWB A;  2DNX A;  2W61 A;  2KLQ A;  4KUM B;  4AKL A;  3N9N A;  4UV9 B;  4HFV A;  2A2F X;  4DVD A;  3DJB A;  3ZN1 B;  1KK7 A;  3UUN A;  2KWI B;  2X9W A;  2W63 A;  4I43 B;  2JMH A;  4WW0 A;  4ERR A;  4PFP A;  5JRE A;  3SOL A;  3R84 B;  3C4W A;  4DND A;  5JDF A;  1IZN B;  5BMV E;  4ZOL E;  1V9D A;  1S35 A;  4CXW A;  4H9S E;  4BA9 A;  2EHO A;  2XAQ B;  4HKA A;  5LHG B;  4O2B E;  4OYJ A;  3U3I A;  4H63 V;  3N9P A;  5LNK A;  2M67 A;  3DP7 A;  3LBX A;  1BR0 A;  2B1E A;  2CXF A;  2LE8 A;  2WMN A;  3L3P A;  3J9X 1;  4E7S A;  4NUU A;  3C64 A;  4PK6 A;  3ZMS B;  5LGN B;  2X66 A;  4ZI2 C;  5KDM C;  2JRK A;  3AA1 B;  2IC9 A;  3VKG A;  3F2E A;  2D2S A;  2NP9 A;  3V5U A;  2LSY A;  1HG2 A;  3HI2 A;  1B7T A;  2X9H A;  4I4T E;  4ASK A;  4P09 A;  3C4Z A;  2CWO A;  3GWH A;  5GON E;  4AKH A;  3GN5 B;  4MBQ A;  1FMV A;  4UEM A;  5FP3 A;  3CQX C;  3UT5 E;  3RPU A;  4AI6 A;  3IF8 B;  1LRZ A;  2QGS A;  2ZM0 A;  2VK9 A;  2DHR A;  3CML A;  3AAE B;  1MMG A;  2BZB A;  2ACX A;  4AKR B;  3KVB A;  4ILU A;  1HS7 A;  4ZS3 A;  5JDM A;  2JMK A;  3ONX A;  3QUJ A;  1T98 A;  3N2K E;  2XHE B;  4KP3 C;  2VKJ A;  4O4H E;  4TUY E;  3ZYM A;  4P0A A;  2VKO A;  3I9Y A;  4UVB B;  4OK0 A;  1HTJ F;  4X20 E;  3NZQ A;  3IBP A;  5L3E B;  3N9Q A;  2N2N A;  1MIW A;  3CPZ A;  3KV9 A;  3PUQ A;  2KT9 A;  2J1D G;  3SS1 A;  5C8Y E;  2MTQ A;  4MHC A;  2WSS V;  3MA9 A;  2DWK A;  2Q9Q D;  4CXX A;  5HXE A;  4IE6 A;  2YU1 A;  3CVR A;  3KBT A;  3C4X A;  1FIO A;  5HXH A;  4GYS A;  3TKL B;  3ZCJ A;  1OXZ A;  3OYZ A;  4TX5 A;  4YFS A;  2X67 A;  1VOM A;  2MOZ A;  1SA0 E;  4YHJ A;  3L09 A;  1D1B A;  2KIN B;  1ZEE A;  2E9X A;  2VKH A;  3ZYK A;  2Y6X A;  2H7V C;  4HGA A;  3CQG B;  5FXW A;  2L3L A;  5HWY A;  3M65 A;  2LSJ A;  2DCF A;  1Z0P A;  3NBX X;  4B6X A;  4IGU A;  3LJC A;  5JDH A;  5LYJ E;  3RYI E;  2D0U A;  3GMI A;  4PFO A;  4H63 H;  2CA5 A;  2WWU A;  3N2G E;  5F8P A;  4JUY A;  5ADX L;  5ETW A;  4KBM B;  2LOP A;  1Y64 B;  3UFE A;  4AKG A;  1ZV4 X;  3AA0 B;  5LBM A;  5JDQ A;  1X79 A;  3HKC E;  3PTR B;  3N9L A;  2BVM A;  3N2O A;  5L2L A;  3KDS E;  4JEH B;  3RC3 A;  3FBL A;  4PJN A;  3ZN0 B;  1D1A A;  1G73 A;  2NW9 A;  1IJ5 A;  5JDG A;  2LSK A;  2W62 A;  2WAU A;  1HFA A;  3AAI A;  3LG7 A;  3O1I A;  3RYF E;  3FXD B;  4JEU B;  3ZPO A;  5FY0 A;  2LT3 A;  1MIV A;  3LK4 2;  4QHO A;  1LVF A;  2HPJ A;  4I55 E;  2EHO D;  5LJM A;  1MND A;  5J2T E;  5JRC B;  3QK6 A;  3CKD A;  1WYB A;  2LHR A;  3CX8 B;  3ZLI A;  4PW8 A;  4PJM A;  3W15 B;  3MAC A;  1BR4 A;  2NOX A;  4ADZ A;  3GA8 A;  5F3J A;  3ZMU B;  2Z6E A;  4UF0 B;  4HTE A;  4YJ3 E;  3V5S A;  2V7L A;  3Q2M A;  2MYS A;  4UXN B;  5LHI B;  4X1Y E;  5DAB A;  2VKD A;  4QXC B;  4UVC B;  3UUM A;  4EB6 E;  3H37 A;  3DTO A;  4PNI A;  2LOS A;  4O4I E;  3RKO A;  2UXX B;  2D5U A;  1MIY A;  2IAK A;  2V1D B;  3FBZ A;  4EZH A;  5HAX A;  3O1H A;  3PU8 A;  3KV4 A;  5FMN A;  4CI2 B;  4IE0 A;  4EOZ B;  4UIG A;  2DWG A;  2E8I A;  2D0T A;  1NWM X;  2L8K A;  3NRX A;  5EZY E;  3CWZ B;  4ZI3 C;  4WNK A;  2X9X A;  2DI4 A;  2BDE A;  3PUS A;  5JR9 B;  4GK0 E;  2C0S A;  3HR0 A;  2YIN A;  4CZZ B;  5FY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...