4MALA

Tpr3 of fimv from p. aeruginosa (pao1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
TDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of TPR2 from FimV
rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
molecule keywords Motility protein FimV
total genus 22
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4malA00
4MALA 4MBQA
chains in the Genus database with same CATH superfamily
3NRYA 1U5PA 5JR9C 3FZHB 1BR4A 4PFPA 4YJ3E 2L9QA 4PNIA 4AQGA 3DJBA 1WYCA 3RIUA 3ONJA 4AQFA 1UGOA 4ZI2C 4ILCA 4O2AE 3N5LA 5AQTB 3E08A 3RPUA 4DV3T 4NXNT 3KBUA 2XHEB 4ILUA 2VL0A 4JI5T 3HI2A 4GOUA 1FMWA 2H3RA 1E1HB 3LBXA 4V1Av 5FY1A 3ZCIA 3ZJ1A 4UVBB 1XNQT 2MTQA 2XSAA 5LXTE 1W9RA 4F8HA 3C4ZA 4B3MT 1UUSA 4BJNA 5HXSA 1UX4A 1ZP0A 3AE8A 4EZHA 5LGNB 3GN5A 2C5JA 3FZMB 2J47A 2LHRA 4NPPA 2KLQA 2LSGA 4IGUA 4QX8B 3RYFE 2FJAA 4OYKA 2X68A 2LKHA 2UXDT 4O2BE 5LHHB 2ZM8A 5FKYA 5AQGB 5J1GA 2UXNB 5EK4A 4ZXLA 2C5IT 4YHJA 4GIWA 3TLTA 2X51A 2WS3A 3AE1A 4O4JE 3GWHA 3OVUA 5JDFA 1UCUA 5IYZE 1QUUA 3I1AA 3RYIE 3O1JA 1DU2A 4CN4A 2X0LB 1SA0E 2LSYA 3MJXA 3OYZA 4AKIA 4IIJE 2V7MA 2PFVA 4HWHA 4PK5A 2XTLA 1N34T 2WZIA 3PU8A 2YOEA 3O4XE 1HF8A 3AAEB 4U3CA 4I43B 3S4UA 2VKJA 3EVYA 3O1IA 2OLTA 4Z91A 2WMOA 3OYXA 3PU3A 4YXDA 1UURA 1QSDA 5HAXA 5L3GB 5LJMA 5J2TE 4ZI3D 2BKNA 4PK6A 3FBLA 1HG2A 2X9XA 3ZYLA 5AQRB 4LF4T 4OX9T 5HEJA 2RP4A 3KV6A 4CQIA 4HWFA 2E5VA 3ZLIA 5A1LA 2N9DA 2YU2A 3AEDA 3BQKA 3H3MA 4WZXA 4HFIA 5L2LA 4X64T 4PFOA 1W09A 2V5CA 2WU2A 1KF6A 2YN6A 3EI0A 4AISA 4CI3B 5L3DB 5J2UE 2F4VT 3PUQA 3AA7B 2W0GA 4Q25A 4YT0A 1XZYA 3QB5K 3V5SA 2WM9A 5FL1A 5JQGE 2IC6A 4EEBA 4ZEYA 5JRCA 3AAAB 2QYWA 4H63H 3DP7A 2LE8A 4E7ZA 2V6YA 3J9X1 2D2SA 4PAGA 4TZ4C 3TLWA 4KHPT 2XQ7A 3BK9A 1O3XA 1T72A 1XWMA 2A9UA 4IDPA 3T8OA 2XQ5A 2CMRA 1I6ZA 5LB7B 2FBWA 3KFWX 4IHJE 4X1YE 2IW5B 3ZPOA 3ZEFB 4DR6T 4UVCB 4J2CA 2WSSV 2HPLA 4JI8T 2LHNA 3R6NA 3UUMA 2WMNA 5ABHA 3N2OA 2OV9A 3LK42 4I50E 5LG3A 5JREA 3GMIA 2LRLA 2E9XA 3O1HA 3P4WA 3RC3A 2KT9A 4HWIB 4IE0A 5GONE 4HFVA 4HTEA 2LT3A 4JEUB 4DR1T 3RLFF 4JI3T 4UIGA 2EHOA 5FYMA 3KVAA 2A2FX 4PJMA 3PV0F 2HHHT 2DCFA 3ZN0B 3LK2B 4EYUA 3ZKRA 5LNKA 1D0XA 3N9MA 3PJAJ 2LLYA 3LFMA 2XQAA 4DV2T 2MPKA 2R6GF 3FXDB 5AQUB 4OHFA 5AQQB 5HCJA 3WI3A 4CZZB 4DR3T 4LMKA 1YQ3A 5C8YE 4X5TA 2UUBT 4YFSA 3VRBA 2BG9A 3CQXC 2Q9QD 5FL0A 3HA4A 4HFCA 1IBKT 4JI7T 2NW8A 4TV8E 4HE8A 2L3LA 2DHRA 4EAHA 4IL4A 1V9DA 3CIRA 4BA9A 3L39A 3I0QA 4HFBA 4IE7A 4KP3C 2VKOA 4A56A 3AEBA 1JNRA 2KWHA 2WBLA 4MBQA 5AQJB 2UXBT 2NOXA 2M6IA 4C91A 1G8XA 3PURA 4WYVA 4NXMT 2KWIB 2ZMAA 2LM9A 4QKNA 4ZI3C 2WDQA 4JLEA 3KDSE 2WU5A 5F8PA 4LFBT 5EK2A 3ZSTA 1KK7A 5BR8T 1T7SA 5AQHB 3C51A 2B1EA 3AE3A 2MAWA 4H9NC 2PG8A 4HEAA 4YSZA 4F6RC 2J1DG 2JMKA 2XAQB 3AE5A 4I55E 4WBOA 4X1IE 1SUMB 3T1HT 1OEDE 2ACZA 4P0BA 3Q2MA 2E2AA 5TAOA 4EB6E 1LRZA 3AECA 3KV4A 4HFDA 4ADZA 5JR9B 2C5KT 1T8BA 4TUYE 2CE7A 3UQ7A 3L09A 2LSKA 4KHZF 1OWAA 1S94A 4YTPA 3FZKB 3JAFA 3QK6A 4G2AA 4O4IE 3QB5A 4UV9B 5AQLB 3RI5A 4AKGA 1LKXA 3G06A 5AQNB 3NBXX 4X1KE 3BQIA 4IL9A 4L9IA 4DBQA 5L3CB 2LRKA 1NENA 3T1YT 1D1CA 5LMUT 2H88A 2M6BA 1XDPA 2FJBA 2JQ9A 2MYSA 2V5DA 3PE0A 3HKBE 3Q5EA 3KV5A 4K0UA 4TNVA 3RRWA 4GYSA 1MIYA 1T98A 2CA5A 5LBMA 2WP9A 2XQ4A 3HKEE 4I4TE 3M65A 4ISSA 3N9NA 1MNDA 4MFRA 1H7CA 2D5UA 2V7JA 4DV4T 2IAKA 3SFEA 4N78D 3FZLB 3IA3A 1D1BA 3AEEA 3ZSSA 5IWAT 3TLUA 1KNRA 3X1DA 5JDQA 3P4RA 3RHWA 2VVSA 3ZCJA 5CFBA 2WZHA 2ZM2A 3PTRB 4DUYT 4WW0A 4PJLA 1HG5A 2XAJB 2V1DB 3FBZA 4QXCB 1XDOA 2V6XA 5KDMC 2JQHA 4PJJA 4X65T 5LA6E 5LMNT 2VURA 3GA8A 4LF9T 5FY7A 4GYRA 4Z90A 1OEDA 2GK9A 4U74A 5FVLA 1YQ4A 3RYHE 3ZMTB 3AA6B 3RQUA 5CA0E 4B6XA 3MXZA 2OA5A 3NRXA 3C50A 4JYAT 2W67A 3CX8B 4EOZB 5L4EA 5KXJA 4HWCA 1I94T 2JJ9A 3UQ4A 3MK7C 2I6HA 4CI2B 1Y64B 2V8SV 2XAGB 3F57A 1OEDC 2VWAA 2YKSA 3KINB 4L0RA 4ILAA 4QWNB 3WAJA 3B57A 5FP3A 5AQSB 5BMVE 1CHUA 3BQLA 3NZQA 2XM1A 2W62A 2BBJA 3D0TA 2A3DA 4UF0B 3RC8A 3SS1A 3P8CD 4UXNB 4UF0A 4HGAA 1QLBA 2YDSA 5L4HA 4U72A 4LF7T 4ISTA 1WYBA 4ILBA 5DABA 1MMDA 2Q9QC 3EAMA 5EK3A 4QH5A 5HEHA 2M67A 4H63V 1HTJF 2XQ3A 3CPZA 4XBFB 3Q5WA 3CVRA 4JUYA 5LHIB 2WAUA 3L3PA 3AVRA 2DL1A 4MALA 5AQVB 5HEOA 2K48A 3E22E 4GKKT 4B3RT 1AJ3A 2UUCT 3AE4A 4KMCA 3KBTA 3R84B 1WR6A 4A5XA 1HNZT 2XJ7A 2V6YB 4P09A 2UXXB 4PJNA 3AXJA 5AQFB 3PUXF 2YDRA 1B7TA 3EABA 4IREA 3ZC0A 1IZNB 2H7VC 1SE7A 2CWOA 5ABEA 1BR2A 4JEHB 3CX7B 2VASA 2E9XC 2XSBA 4P0AA 5DQWA 4HFHA 3RYCE 3RIAA 4ANJA 3B5MA 1IBLT 5HWYA 1Y01A 3O9XA 1D1AA 2CXDA 3ZN1B 5LP6E 3JC6D 4A97A 3B13A 2L8KA 2ZM0A 2CBIA 1KEYA 3ABVA 2VQET 1R8IA 1XMQT 1N36T 5J0ZA 2X66A 3RQWA 1N33T 4JI0T 2ODUA 2JQKA 4CN6A 1IJ5A 3ZT6A 4GKJT 2UXCT 4LF5T 1Z0PA 3VRAA 1HCIA 5HYAA 1IJ6A 4L5GA 1WR0A 2HPJA 3F2EA 4U7IA 4U33A 1G73A 4QXBB 2JIWA 4TWHA 4Z8XA 2C0SA 4IE4A 3LJCA 1HR0T 4DR4T 4B3ST 5L3EB 1XNRT 4ASKA 2VL8A 2IHR1 3QOFA 5FXVA 2FUPA 2JRKA 5HEGA 3K3QC 4EYYR 3P4SA 4IDNA 3HKCE 5FVKA 2KINB 2X9HA 3FB2A 1W0AA 2DNXA 3ONLC 3CMLA 5JVDE 5JR9A 3E0ZA 4C90A 3AEAA 3RRCA 1J5ET 2Y8DA 4IDOA 4HKAA 3VR9A 3P4PA 4JV5T 4ZI7E 3VKGA 2XQ8A 2W63A 2W00A 4JI2T 4TX5A 1J5WA 1FMVA 1HNXT 2JQQA 4M1PA 1MIVA 1VCSA 4UR9A 1U4QA 2CPTA 2J4GA 2VK9A 2AXDS 3I9WA 4NIQA 4ZOLE 5FXWA 5FNVE 3AEFA 2EHOD 2IIUA 2XY8B 2K9AA 3MA9A 2YU1A 4IT4A 2ZLYA 3CWZB 2W4XA 3MACA 5JDMA 2WY2A 2Z6EA 2K5BB 1OXZA 1KNZA 2J62A 2CXLA 3TKLB 3K8PC 5DJQC 5E0OA 3QUJA 5FY0A 2JPFA 5LGTB 2QRXA 3NZPA 4U31A 1LVFA 1YKHB 2EHOB 1MMAA 2BKPA 4EEDA 3N2GE 2BKOA 4QH1A 4DBRA 5C2TA 3J7Yq 2XPKA 3NWIA 1J1JA 4QXHB 3AE9A 4YTNA 2KZ7B 3UU5A 3EDVA 3UU3A 4ZZBA 3N9LA 2CCQA 5HXCA 1D0YA 1X79A 3OKQA 4IE6A 2CWYA 4NUVA 3IF8B 4YHHT 4LFCT 1ZOYA 3N9QA 4LF6T 4OFZA 4FI5A 1BR1A 4JBWF 5C3JA 4GK0E 3RKOA 4KI0F 4IE5A 1JNZA 1HS7A 2VVNA 3C4WA 4FJOA 4LMJA 4KBMB 3QC9A 3WAKA 5F3JA 5F5WA 2I59A 4H9QC 2K3WA 3AVSA 4YJ2E 5AFUL 2PJQA 5FXXA 4DV0T 5IUXA 3A7MA 4BAYB 2BS3A 2LM2A 2I0MA 3ZT7A 3ETUA 1MMNA 4UEMA 2WQYA 3GN5B 1M7KA 5L47A 3RGLA 5HXEA 3UUXB 2N1GA 3I9YA 3JAEA 3PUGA 5LCYA 3OBVE 4DV6T 3PUVF 3RKGA 3AA0B 2FJDA 2UUAT 3ZMSB 1WRDA 2RA1A 5FMNA 4AKHA 4TWDA 2W66A 5DQVA 4HN9A 5ADXL 2BBHA 1XMOT 2CRBA 2BS2A 2Y6XA 3ZT5A 4KUMB 4ZI2D 5HXRA 4UV8B 3HL6A 5EZYE 1YD8G 2IC9A 2BZBA 2X0YA 3ESLA 3N2KE 2V7LA 4HWDA 2WWUA 4TNWA 2NP9A 4TWFA 2MBGA 2LSIA 1YKEB 2CXFA 2VKHA 2WB5A 4E7SA 4WBNE 2BVLA 2LKGA 2NTXA 2X67A 2Y48B 3N9PA 2XQ6A 1HX1B 2BVMA 2CEAA 4CXYA 2LSJA 1HX8A 2D0TA 2YK0A 2AE9A 4CXWA 1WFDA 2LJLA 4P1NA 4BJMA 2QA7A 2YDQA 1SHZC 5IHYA 3V5UA 2P9BA 3KVBA 3H3AA 4O4LE 1MNEA 2KSRA 1KFYA 2BS4A 1IAPA 4DR5T 2UU9T 2DWKA 5L3FB 3AE2A 2ACXA 5LHGB 3RX6A 3PUAA 2D0UA 3CX6B 2YEVC 2A72A 2HH7A 3L8RA 2NTYA 1FIOA 1WCRA 2PTFA 3RIFA 4TN7B 2E8IA 1EZ3A 2X9WA 4PK4A 3SRZA 4A98A 4ZHQE 4DV5T 3ZMVB 4JI4T 5JRCB 2CM0A 3K3NA 2YINA 4XZCA 2Q9QA 5L3BB 5LGUB 4DV7T 3IBPA 2G0UA 2Q9QB 3Q5XA 4LFAT 3CQGB 4AKRB 1NAFA 1NWMX 3AXJB 3CK6A 4ZS2A 5LBQB 5H6RB 2CLYC 3LG7A 2WWVA 3ANWB 3QNUA 4HFEA 3SOLA 3UT5E 5JDGA 3OJAA 4EV6A 1FEWA 5LJNA 3KV9A 1NEKA 1OEDB 5JDHA 2XM2A 3LSVA 4DUZT 3JC6C 2NW7A 2V7KA 2XAHB 4AQFC 2PBIA 3RIUC 3PJAA 4YSYA 3M3ZB 5CJ5A 3LBXB 2DWGA 4TV9E 5JDNA 5AQKB 3JCFA 4H9SE 4KX6A 4O8SA 2WDVA 3EUHA 3UU6A 2CHNA 4DMWA 4YY3T 3P50A 1WLXA 4MHCA 4QH4A 3NKZA 3Q9DA 5HWXA 3AA1B 4UELA 3W15B 5KX5E 1LVKA 4DMVA 4DV1T 5HEUA 3FHNA 2DLRA 4AXPA 3A8YC 5ABFA 3JADA 3UFEA 3C98B 2IDOB 2E9XD 5JTGA 5ABGA 4DVDA 5M4YA 1IBMT 3TLVA 2LEHA 2KMFA 1X9BA 4X66T 4IDZA 5JDLA 4EGWA 4AQYT 3AE6A 1L0VA 3UULA 3DTOA 2W61A 3I0OA 3MZKB 4B3TT 2K24A 1GQEA 2VQFT 5HCMA 5AQOB 1VCTA 1ZV4X 2IUBA 4U2ZA 4U2YA 3PUYF 4JI1T 3UUBA 4UVAB 1HFAA 2LOSA 2MOZA 3VR8A 3HKDE 4EXTA 3ZYMA 4DIDB 5LYJE 1FJGT 4ZS3A 1ZKEA 5ETWA 4AI6A 4ZZCA 2HN2A 2D9DA 3EHZA 5CB4E 3ZMUB 3UTKA 3P4QA 4EZ4A 1M62A 2ODVA 1UX5A 1MIWA 3EDUA 2EHOC 3K3OA 2BG9E 2QVAA 3LK3B 4DNDA 3C4XA 2XQ9A 3HR0A 2WCAA 1VRBA 2RPAA 3PUZF 4G63A 5HXHA 5LOVE 2XQYA 3Q5DA 4MLKA 3UU4A 1Z8UA 1D0ZA 2ES0A 3PUSA 2N2NA 2NR4A 2W2UA 3CKDA 4I0UA 3SFDA 1VOMA 4H9OC 3A5XA 3OPCA 2IMLA 5JH7E 4YTMA 4LMLA 5FXZA 5H6QB 4EIWA 2DI4A 3VHLA 4XAXB 2H7OA 2BG9C 2WDRA 1CUNA 5AQPB 4CXXA 1BR0A 3RF1A 1YXRA 3FXEB 3H37A 1ZEEA 3AB3B 3PUWF 4WNKA 3U78A 4DR2T 3ZYKA 1N32T 2E5LT 1ZHCA 4AIUA 1E7PA 3ANWA 2KXPB 4QHOA 3VKHA 4DO0A 2BG9B 3N9OA 2V26A 4NUUA 4COFA 3UUNA 4CI1B 3LDQB 3VU7H 2KNDA 3ZC1A 3ETVA 5AQIB 2NW9A 2JMHA 3TLSA 5CA1E 3K1SA 2E9XB 3F31A 3IEEA 2SPCA 4YSXA 5KMGP 2NWBA 5LG4A 4U7YA 4AKLA 4X62T 2V7IA 4QX7B 5AQMB 5CGMA 4GK5E 1KNPA 4X20E 3AEGA 4O4HE 2HN1A 4OK0A 3UFGA 3UU8A 4DR7T 1UK5A 2CBJA 1E2AA 4PW8A 3IHRA 2XUEA 2H89A 2XAFB 4ERRA 2QGSA 2B76A 2ZM6T 5ABFB 3ZJ2A 1YW0A 3MKDA 1HNWT 2BDEA 4H9RC 4LF8T 4K0KT 2X9YA 3AAIA 3SWHA 1S35A 4CN1A 2VB6A 4YLHA 3FZFB 4IDQA 3AE7A 3ONXA 3OTOT 1US7B 1W0BA 2CHOA 2XZEA 4OYJA 2XASB 3NVOA 1MMGA 4H9PC 2X0HA 3CQCB 3P7IA 2VKDA 3U3IA 3ZMZB 2FJEA 3PDYA 4JI6T 3RH3A 2LOPA 3C64A 2CLYB
chains in the Genus database with same CATH topology
3NRYA 1U5PA 5JR9C 1BR4A 4PFPA 4YJ3E 2L9QA 4PNIA 4AQGA 3DJBA 1WYCA 4AQFA 4ZI2C 4O2AE 3N5LA 3RPUA 3E08A 3KBUA 2XHEB 4ILUA 3HI2A 4GOUA 1FMWA 2H3RA 1E1HB 3LBXA 4V1Av 5FY1A 3ZCIA 3ZJ1A 4UVBB 2MTQA 5LXTE 3C4ZA 4BJNA 5HXSA 1UX4A 4EZHA 5LGNB 3GN5A 2C5JA 4QX8B 2LHRA 2KLQA 2LSGA 4IGUA 3RYFE 4OYKA 2X68A 4O2BE 5LHHB 2ZM8A 5J1GA 2UXNB 5EK4A 2C5IT 4YHJA 4GIWA 2X51A 4O4JE 3GWHA 5JDFA 1UCUA 5IYZE 1QUUA 3I1AA 3RYIE 3O1JA 2X0LB 1SA0E 2LSYA 3MJXA 3OYZA 4AKIA 4IIJE 2V7MA 2PFVA 4PK5A 2XTLA 3PU8A 3O4XE 1HF8A 3AAEB 4I43B 3S4UA 2VKJA 3EVYA 3O1IA 2WMOA 3OYXA 3PU3A 5L3GB 1QSDA 5HAXA 5LJMA 5J2TE 4ZI3D 4PK6A 3FBLA 1HG2A 2X9XA 3ZYLA 2RP4A 3KV6A 4CQIA 5A1LA 3ZLIA 2N9DA 2YU2A 3BQKA 5L2LA 4PFOA 5L3DB 4CI3B 5J2UE 3PUQA 3AA7B 2W0GA 3V5SA 2WM9A 5JQGE 2IC6A 5JRCA 3AAAB 4H63H 3DP7A 2LE8A 4E7ZA 3J9X1 2D2SA 4PAGA 4TZ4C 3BK9A 1O3XA 3T8OA 2CMRA 3KFWX 4IHJE 4X1YE 2IW5B 3ZPOA 3ZEFB 4UVCB 4J2CA 2WSSV 2HPLA 2LHNA 3R6NA 3UUMA 2WMNA 3N2OA 3LK42 4I50E 5JREA 3GMIA 3O1HA 2E9XA 3RC3A 2KT9A 4IE0A 5GONE 4HFVA 4JEUB 2LT3A 4UIGA 2EHOA 5FYMA 3KVAA 2A2FX 4PJMA 2DCFA 3ZN0B 3LK2B 4EYUA 5LNKA 1D0XA 3N9MA 3LFMA 3FXDB 4OHFA 3WI3A 4CZZB 5C8YE 4YFSA 3CQXC 2Q9QD 3HA4A 2NW8A 4TV8E 4HE8A 2L3LA 2DHRA 4EAHA 1V9DA 4BA9A 3I0QA 4IE7A 4KP3C 4A56A 2VKOA 2KWHA 2WBLA 4MBQA 2NOXA 4C91A 1G8XA 3PURA 2KWIB 2ZMAA 2LM9A 4QKNA 4ZI3C 4JLEA 3KDSE 5F8PA 5EK2A 1KK7A 3C51A 2B1EA 4H9NC 4HEAA 2PG8A 4F6RC 2J1DG 2JMKA 2XAQB 4I55E 4WBOA 4X1IE 4P0BA 3Q2MA 5TAOA 4EB6E 1LRZA 3KV4A 4ADZA 5JR9B 2C5KT 4TUYE 2CE7A 3L09A 2LSKA 1OWAA 1S94A 4O4IE 3QK6A 4G2AA 4UV9B 1LKXA 3NBXX 4X1KE 3BQIA 4DBQA 4L9IA 5L3CB 2MYSA 4HTEA 3PE0A 3HKBE 4K0UA 3KV5A 3RRWA 4GYSA 1MIYA 1T98A 2CA5A 5LBMA 3HKEE 4I4TE 3M65A 4ISSA 3N9NA 1MNDA 4MFRA 1H7CA 2D5UA 2V7JA 2IAKA 4N78D 1D1BA 5JDQA 3ZCJA 2ZM2A 3PTRB 4WW0A 4PJLA 1HG5A 2XAJB 2V1DB 3FBZA 4QXCB 5KDMC 4PJJA 5LA6E 3GA8A 5FY7A 4GYRA 2GK9A 4U74A 3RYHE 5CA0E 3ZMTB 3AA6B 4B6XA 3MXZA 2OA5A 3NRXA 3C50A 3CX8B 4EOZB 2JJ9A 3MK7C 4CI2B 1Y64B 2XAGB 3F57A 2VWAA 3KINB 4L0RA 4QWNB 3WAJA 4AKGA 3B57A 5FP3A 5BMVE 3BQLA 3NZQA 2W62A 3D0TA 2A3DA 4UF0B 3RC8A 3SS1A 3P8CD 4UXNB 4UF0A 4HGAA 4U72A 4ISTA 1WYBA 5DABA 1MMDA 2Q9QC 5EK3A 4XBFB 2M67A 4H63V 1HTJF 3CPZA 3Q5WA 3CVRA 4JUYA 5LHIB 2WAUA 3L3PA 3AVRA 4MALA 3E22E 2K48A 1AJ3A 4KMCA 3KBTA 3R84B 1WR6A 4P09A 4PJNA 2UXXB 1B7TA 3ZC0A 1IZNB 2H7VC 2CWOA 1BR2A 4JEHB 3CX7B 2VASA 2E9XC 4P0AA 5DQWA 4ANJA 3RYCE 5HWYA 3O9XA 1D1AA 2CXDA 3ZN1B 5LP6E 3JC6D 3B13A 2L8KA 2ZM0A 2X66A 2ODUA 1IJ5A 1Z0PA 1HCIA 5HYAA 1IJ6A 4L5GA 3F2EA 2HPJA 4Z8XA 1G73A 4QXBB 2C0SA 4IE4A 3LJCA 5L3EB 4ASKA 2VL8A 5FXVA 2JRKA 3K3QC 4EYYR 3HKCE 2KINB 2X9HA 3FB2A 2DNXA 5JVDE 5JR9A 3CMLA 4C90A 3E0ZA 3RRCA 2Y8DA 4HKAA 4ZI7E 3VKGA 2W63A 2W00A 4TX5A 1FMVA 2JQQA 4M1PA 1MIVA 4ZOLE 1U4QA 2VK9A 3I9WA 5FXWA 5FNVE 2EHOD 3MA9A 2K9AA 2YU1A 2ZLYA 3CWZB 3MACA 5JDMA 2Z6EA 2K5BB 1OXZA 1KNZA 2CXLA 3TKLB 3K8PC 5DJQC 5E0OA 3QUJA 5FY0A 2JPFA 5LGTB 3NZPA 1LVFA 1YKHB 2EHOB 1MMAA 3N2GE 4DBRA 3J7Yq 4QXHB 2KZ7B 3EDVA 3N9LA 2CCQA 5HXCA 1D0YA 1X79A 3OKQA 4IE6A 2CWYA 4NUVA 3IF8B 3N9QA 4OFZA 4FI5A 1BR1A 4GK0E 3RKOA 4IE5A 1HS7A 3C4WA 4FJOA 4KBMB 3QC9A 3WAKA 5F3JA 2I59A 4H9QC 4YJ2E 3AVSA 2PJQA 5FXXA 4BAYB 3ETUA 1MMNA 4UEMA 3GN5B 5HXEA 3UUXB 2N1GA 3I9YA 3PUGA 5LCYA 3OBVE 3AA0B 3ZMSB 1WRDA 2RA1A 5FMNA 4AKHA 5DQVA 4HN9A 5ADXL 2Y6XA 4ZI2D 4KUMB 5HXRA 4UV8B 3HL6A 5EZYE 1YD8G 2IC9A 2BZBA 3N2KE 3ESLA 2V7LA 2WWUA 2NP9A 2MBGA 2LSIA 1YKEB 2CXFA 2VKHA 4E7SA 4WBNE 2BVLA 2NTXA 2X67A 2Y48B 3N9PA 4CXYA 2BVMA 2CEAA 2LSJA 1HX8A 2D0TA 2YK0A 4CXWA 2LJLA 4BJMA 2QA7A 1SHZC 5IHYA 3V5UA 2P9BA 3KVBA 3H3AA 4O4LE 1MNEA 1IAPA 2DWKA 5L3FB 2ACXA 5LHGB 3RX6A 3PUAA 2D0UA 3CX6B 2YEVC 2A72A 2HH7A 2NTYA 1FIOA 4TN7B 2E8IA 1EZ3A 2X9WA 4PK4A 3SRZA 4ZHQE 5JRCB 3ZMVB 2CM0A 3K3NA 2YINA 4XZCA 2Q9QA 5L3BB 5LGUB 3IBPA 2G0UA 2Q9QB 3Q5XA 3CQGB 4AKRB 1NAFA 1NWMX 4ZS2A 5LBQB 3SOLA 5H6RB 2CLYC 3LG7A 3UT5E 3ANWB 5JDGA 3OJAA 1FEWA 5LJNA 3KV9A 5JDHA 3JC6C 2NW7A 2V7KA 2XAHB 4AQFC 2PBIA 3LBXB 2DWGA 4TV9E 5JDNA 4H9SE 4O8SA 3EUHA 4DMWA 1WLXA 4MHCA 3Q9DA 5HWXA 3AA1B 4UELA 3W15B 5KX5E 1LVKA 4DMVA 3FHNA 2DLRA 4AXPA 3UFEA 3C98B 2E9XD 4DVDA 5M4YA 2LEHA 2KMFA 4IDZA 5JDLA 3UULA 3DTOA 2W61A 3I0OA 3MZKB 2K24A 1ZV4X 4UVAB 1HFAA 2LOSA 2MOZA 4EXTA 3HKDE 3ZYMA 5LYJE 4ZS3A 1ZKEA 5ETWA 4AI6A 5CB4E 3ZMUB 3UTKA 4EZ4A 2ODVA 3EDUA 1UX5A 1MIWA 3K3OA 2EHOC 3LK3B 4DNDA 3C4XA 3HR0A 5HXHA 1VRBA 4G63A 5LOVE 2XQYA 4MLKA 1D0ZA 2ES0A 3PUSA 2N2NA 3CKDA 1VOMA 4H9OC 3A5XA 5JH7E 5FXZA 5H6QB 4EIWA 2DI4A 3VHLA 4XAXB 2H7OA 1BR0A 1CUNA 4CXXA 3FXEB 3H37A 1ZEEA 3AB3B 4WNKA 3U78A 3ZYKA 1ZHCA 3ANWA 2KXPB 4QHOA 3VKHA 4DO0A 3N9OA 2V26A 4NUUA 3UUNA 4CI1B 3VU7H 2KNDA 3ZC1A 3ETVA 2NW9A 2JMHA 5CA1E 2E9XB 3F31A 3IEEA 2SPCA 5KMGP 2NWBA 5LG4A 4AKLA 2V7IA 4QX7B 4GK5E 4X20E 4O4HE 4OK0A 4PW8A 3IHRA 2XUEA 2XAFB 4ERRA 2QGSA 3ZJ2A 1YW0A 3MKDA 2BDEA 4H9RC 2X9YA 3AAIA 3SWHA 1S35A 2VB6A 4YLHA 3ONXA 1US7B 4OYJA 3U3IA 2XASB 3ZMZB 1MMGA 4H9PC 3P7IA 3CQCB 2VKDA 5AFUL 1D1CA 3PDYA 3RH3A 2LOPA 3C64A 2CLYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAL A;  4MBQ A; 
#chains in the Genus database with same CATH topology
 3NRY A;  1U5P A;  5JR9 C;  3FZH B;  1BR4 A;  4PFP A;  4YJ3 E;  2L9Q A;  4PNI A;  4AQG A;  3DJB A;  1WYC A;  3RIU A;  3ONJ A;  4AQF A;  1UGO A;  4ZI2 C;  4ILC A;  4O2A E;  3N5L A;  5AQT B;  3E08 A;  3RPU A;  4DV3 T;  4NXN T;  3KBU A;  2XHE B;  4ILU A;  2VL0 A;  4JI5 T;  3HI2 A;  4GOU A;  1FMW A;  2H3R A;  1E1H B;  3LBX A;  4V1A v;  5FY1 A;  3ZCI A;  3ZJ1 A;  4UVB B;  1XNQ T;  2MTQ A;  2XSA A;  5LXT E;  1W9R A;  4F8H A;  3C4Z A;  4B3M T;  1UUS A;  4BJN A;  5HXS A;  1UX4 A;  1ZP0 A;  3AE8 A;  4EZH A;  5LGN B;  3GN5 A;  2C5J A;  3FZM B;  2J47 A;  2LHR A;  4NPP A;  2KLQ A;  2LSG A;  4IGU A;  4QX8 B;  3RYF E;  2FJA A;  4OYK A;  2X68 A;  2LKH A;  2UXD T;  4O2B E;  5LHH B;  2ZM8 A;  5FKY A;  5AQG B;  5J1G A;  2UXN B;  5EK4 A;  4ZXL A;  2C5I T;  4YHJ A;  4GIW A;  3TLT A;  2X51 A;  2WS3 A;  3AE1 A;  4O4J E;  3GWH A;  3OVU A;  5JDF A;  1UCU A;  5IYZ E;  1QUU A;  3I1A A;  3RYI E;  3O1J A;  1DU2 A;  4CN4 A;  2X0L B;  1SA0 E;  2LSY A;  3MJX A;  3OYZ A;  4AKI A;  4IIJ E;  2V7M A;  2PFV A;  4HWH A;  4PK5 A;  2XTL A;  1N34 T;  2WZI A;  3PU8 A;  2YOE A;  3O4X E;  1HF8 A;  3AAE B;  4U3C A;  4I43 B;  3S4U A;  2VKJ A;  3EVY A;  3O1I A;  2OLT A;  4Z91 A;  2WMO A;  3OYX A;  3PU3 A;  4YXD A;  1UUR A;  1QSD A;  5HAX A;  5L3G B;  5LJM A;  5J2T E;  4ZI3 D;  2BKN A;  4PK6 A;  3FBL A;  1HG2 A;  2X9X A;  3ZYL A;  5AQR B;  4LF4 T;  4OX9 T;  5HEJ A;  2RP4 A;  3KV6 A;  4CQI A;  4HWF A;  2E5V A;  3ZLI A;  5A1L A;  2N9D A;  2YU2 A;  3AED A;  3BQK A;  3H3M A;  4WZX A;  4HFI A;  5L2L A;  4X64 T;  4PFO A;  1W09 A;  2V5C A;  2WU2 A;  1KF6 A;  2YN6 A;  3EI0 A;  4AIS A;  4CI3 B;  5L3D B;  5J2U E;  2F4V T;  3PUQ A;  3AA7 B;  2W0G A;  4Q25 A;  4YT0 A;  1XZY A;  3QB5 K;  3V5S A;  2WM9 A;  5FL1 A;  5JQG E;  2IC6 A;  4EEB A;  4ZEY A;  5JRC A;  3AAA B;  2QYW A;  4H63 H;  3DP7 A;  2LE8 A;  4E7Z A;  2V6Y A;  3J9X 1;  2D2S A;  4PAG A;  4TZ4 C;  3TLW A;  4KHP T;  2XQ7 A;  3BK9 A;  1O3X A;  1T72 A;  1XWM A;  2A9U A;  4IDP A;  3T8O A;  2XQ5 A;  2CMR A;  1I6Z A;  5LB7 B;  2FBW A;  3KFW X;  4IHJ E;  4X1Y E;  2IW5 B;  3ZPO A;  3ZEF B;  4DR6 T;  4UVC B;  4J2C A;  2WSS V;  2HPL A;  4JI8 T;  2LHN A;  3R6N A;  3UUM A;  2WMN A;  5ABH A;  3N2O A;  2OV9 A;  3LK4 2;  4I50 E;  5LG3 A;  5JRE A;  3GMI A;  2LRL A;  2E9X A;  3O1H A;  3P4W A;  3RC3 A;  2KT9 A;  4HWI B;  4IE0 A;  5GON E;  4HFV A;  4HTE A;  2LT3 A;  4JEU B;  4DR1 T;  3RLF F;  4JI3 T;  4UIG A;  2EHO A;  5FYM A;  3KVA A;  2A2F X;  4PJM A;  3PV0 F;  2HHH T;  2DCF A;  3ZN0 B;  3LK2 B;  4EYU A;  3ZKR A;  5LNK A;  1D0X A;  3N9M A;  3PJA J;  2LLY A;  3LFM A;  2XQA A;  4DV2 T;  2MPK A;  2R6G F;  3FXD B;  5AQU B;  4OHF A;  5AQQ B;  5HCJ A;  3WI3 A;  4CZZ B;  4DR3 T;  4LMK A;  1YQ3 A;  5C8Y E;  4X5T A;  2UUB T;  4YFS A;  3VRB A;  2BG9 A;  3CQX C;  2Q9Q D;  5FL0 A;  3HA4 A;  4HFC A;  1IBK T;  4JI7 T;  2NW8 A;  4TV8 E;  4HE8 A;  2L3L A;  2DHR A;  4EAH A;  4IL4 A;  1V9D A;  3CIR A;  4BA9 A;  3L39 A;  3I0Q A;  4HFB A;  4IE7 A;  4KP3 C;  2VKO A;  4A56 A;  3AEB A;  1JNR A;  2KWH A;  2WBL A;  4MBQ A;  5AQJ B;  2UXB T;  2NOX A;  2M6I A;  4C91 A;  1G8X A;  3PUR A;  4WYV A;  4NXM T;  2KWI B;  2ZMA A;  2LM9 A;  4QKN A;  4ZI3 C;  2WDQ A;  4JLE A;  3KDS E;  2WU5 A;  5F8P A;  4LFB T;  5EK2 A;  3ZST A;  1KK7 A;  5BR8 T;  1T7S A;  5AQH B;  3C51 A;  2B1E A;  3AE3 A;  2MAW A;  4H9N C;  2PG8 A;  4HEA A;  4YSZ A;  4F6R C;  2J1D G;  2JMK A;  2XAQ B;  3AE5 A;  4I55 E;  4WBO A;  4X1I E;  1SUM B;  3T1H T;  1OED E;  2ACZ A;  4P0B A;  3Q2M A;  2E2A A;  5TAO A;  4EB6 E;  1LRZ A;  3AEC A;  3KV4 A;  4HFD A;  4ADZ A;  5JR9 B;  2C5K T;  1T8B A;  4TUY E;  2CE7 A;  3UQ7 A;  3L09 A;  2LSK A;  4KHZ F;  1OWA A;  1S94 A;  4YTP A;  3FZK B;  3JAF A;  3QK6 A;  4G2A A;  4O4I E;  3QB5 A;  4UV9 B;  5AQL B;  3RI5 A;  4AKG A;  1LKX A;  3G06 A;  5AQN B;  3NBX X;  4X1K E;  3BQI A;  4IL9 A;  4L9I A;  4DBQ A;  5L3C B;  2LRK A;  1NEN A;  3T1Y T;  1D1C A;  5LMU T;  2H88 A;  2M6B A;  1XDP A;  2FJB A;  2JQ9 A;  2MYS A;  2V5D A;  3PE0 A;  3HKB E;  3Q5E A;  3KV5 A;  4K0U A;  4TNV A;  3RRW A;  4GYS A;  1MIY A;  1T98 A;  2CA5 A;  5LBM A;  2WP9 A;  2XQ4 A;  3HKE E;  4I4T E;  3M65 A;  4ISS A;  3N9N A;  1MND A;  4MFR A;  1H7C A;  2D5U A;  2V7J A;  4DV4 T;  2IAK A;  3SFE A;  4N78 D;  3FZL B;  3IA3 A;  1D1B A;  3AEE A;  3ZSS A;  5IWA T;  3TLU A;  1KNR A;  3X1D A;  5JDQ A;  3P4R A;  3RHW A;  2VVS A;  3ZCJ A;  5CFB A;  2WZH A;  2ZM2 A;  3PTR B;  4DUY T;  4WW0 A;  4PJL A;  1HG5 A;  2XAJ B;  2V1D B;  3FBZ A;  4QXC B;  1XDO A;  2V6X A;  5KDM C;  2JQH A;  4PJJ A;  4X65 T;  5LA6 E;  5LMN T;  2VUR A;  3GA8 A;  4LF9 T;  5FY7 A;  4GYR A;  4Z90 A;  1OED A;  2GK9 A;  4U74 A;  5FVL A;  1YQ4 A;  3RYH E;  3ZMT B;  3AA6 B;  3RQU A;  5CA0 E;  4B6X A;  3MXZ A;  2OA5 A;  3NRX A;  3C50 A;  4JYA T;  2W67 A;  3CX8 B;  4EOZ B;  5L4E A;  5KXJ A;  4HWC A;  1I94 T;  2JJ9 A;  3UQ4 A;  3MK7 C;  2I6H A;  4CI2 B;  1Y64 B;  2V8S V;  2XAG B;  3F57 A;  1OED C;  2VWA A;  2YKS A;  3KIN B;  4L0R A;  4ILA A;  4QWN B;  3WAJ A;  3B57 A;  5FP3 A;  5AQS B;  5BMV E;  1CHU A;  3BQL A;  3NZQ A;  2XM1 A;  2W62 A;  2BBJ A;  3D0T A;  2A3D A;  4UF0 B;  3RC8 A;  3SS1 A;  3P8C D;  4UXN B;  4UF0 A;  4HGA A;  1QLB A;  2YDS A;  5L4H A;  4U72 A;  4LF7 T;  4IST A;  1WYB A;  4ILB A;  5DAB A;  1MMD A;  2Q9Q C;  3EAM A;  5EK3 A;  4QH5 A;  5HEH A;  2M67 A;  4H63 V;  1HTJ F;  2XQ3 A;  3CPZ A;  4XBF B;  3Q5W A;  3CVR A;  4JUY A;  5LHI B;  2WAU A;  3L3P A;  3AVR A;  2DL1 A;  4MAL A;  5AQV B;  5HEO A;  2K48 A;  3E22 E;  4GKK T;  4B3R T;  1AJ3 A;  2UUC T;  3AE4 A;  4KMC A;  3KBT A;  3R84 B;  1WR6 A;  4A5X A;  1HNZ T;  2XJ7 A;  2V6Y B;  4P09 A;  2UXX B;  4PJN A;  3AXJ A;  5AQF B;  3PUX F;  2YDR A;  1B7T A;  3EAB A;  4IRE A;  3ZC0 A;  1IZN B;  2H7V C;  1SE7 A;  2CWO A;  5ABE A;  1BR2 A;  4JEH B;  3CX7 B;  2VAS A;  2E9X C;  2XSB A;  4P0A A;  5DQW A;  4HFH A;  3RYC E;  3RIA A;  4ANJ A;  3B5M A;  1IBL T;  5HWY A;  1Y01 A;  3O9X A;  1D1A A;  2CXD A;  3ZN1 B;  5LP6 E;  3JC6 D;  4A97 A;  3B13 A;  2L8K A;  2ZM0 A;  2CBI A;  1KEY A;  3ABV A;  2VQE T;  1R8I A;  1XMQ T;  1N36 T;  5J0Z A;  2X66 A;  3RQW A;  1N33 T;  4JI0 T;  2ODU A;  2JQK A;  4CN6 A;  1IJ5 A;  3ZT6 A;  4GKJ T;  2UXC T;  4LF5 T;  1Z0P A;  3VRA A;  1HCI A;  5HYA A;  1IJ6 A;  4L5G A;  1WR0 A;  2HPJ A;  3F2E A;  4U7I A;  4U33 A;  1G73 A;  4QXB B;  2JIW A;  4TWH A;  4Z8X A;  2C0S A;  4IE4 A;  3LJC A;  1HR0 T;  4DR4 T;  4B3S T;  5L3E B;  1XNR T;  4ASK A;  2VL8 A;  2IHR 1;  3QOF A;  5FXV A;  2FUP A;  2JRK A;  5HEG A;  3K3Q C;  4EYY R;  3P4S A;  4IDN A;  3HKC E;  5FVK A;  2KIN B;  2X9H A;  3FB2 A;  1W0A A;  2DNX A;  3ONL C;  3CML A;  5JVD E;  5JR9 A;  3E0Z A;  4C90 A;  3AEA A;  3RRC A;  1J5E T;  2Y8D A;  4IDO A;  4HKA A;  3VR9 A;  3P4P A;  4JV5 T;  4ZI7 E;  3VKG A;  2XQ8 A;  2W63 A;  2W00 A;  4JI2 T;  4TX5 A;  1J5W A;  1FMV A;  1HNX T;  2JQQ A;  4M1P A;  1MIV A;  1VCS A;  4UR9 A;  1U4Q A;  2CPT A;  2J4G A;  2VK9 A;  2AXD S;  3I9W A;  4NIQ A;  4ZOL E;  5FXW A;  5FNV E;  3AEF A;  2EHO D;  2IIU A;  2XY8 B;  2K9A A;  3MA9 A;  2YU1 A;  4IT4 A;  2ZLY A;  3CWZ B;  2W4X A;  3MAC A;  5JDM A;  2WY2 A;  2Z6E A;  2K5B B;  1OXZ A;  1KNZ A;  2J62 A;  2CXL A;  3TKL B;  3K8P C;  5DJQ C;  5E0O A;  3QUJ A;  5FY0 A;  2JPF A;  5LGT B;  2QRX A;  3NZP A;  4U31 A;  1LVF A;  1YKH B;  2EHO B;  1MMA A;  2BKP A;  4EED A;  3N2G E;  2BKO A;  4QH1 A;  4DBR A;  5C2T A;  3J7Y q;  2XPK A;  3NWI A;  1J1J A;  4QXH B;  3AE9 A;  4YTN A;  2KZ7 B;  3UU5 A;  3EDV A;  3UU3 A;  4ZZB A;  3N9L A;  2CCQ A;  5HXC A;  1D0Y A;  1X79 A;  3OKQ A;  4IE6 A;  2CWY A;  4NUV A;  3IF8 B;  4YHH T;  4LFC T;  1ZOY A;  3N9Q A;  4LF6 T;  4OFZ A;  4FI5 A;  1BR1 A;  4JBW F;  5C3J A;  4GK0 E;  3RKO A;  4KI0 F;  4IE5 A;  1JNZ A;  1HS7 A;  2VVN A;  3C4W A;  4FJO A;  4LMJ A;  4KBM B;  3QC9 A;  3WAK A;  5F3J A;  5F5W A;  2I59 A;  4H9Q C;  2K3W A;  3AVS A;  4YJ2 E;  5AFU L;  2PJQ A;  5FXX A;  4DV0 T;  5IUX A;  3A7M A;  4BAY B;  2BS3 A;  2LM2 A;  2I0M A;  3ZT7 A;  3ETU A;  1MMN A;  4UEM A;  2WQY A;  3GN5 B;  1M7K A;  5L47 A;  3RGL A;  5HXE A;  3UUX B;  2N1G A;  3I9Y A;  3JAE A;  3PUG A;  5LCY A;  3OBV E;  4DV6 T;  3PUV F;  3RKG A;  3AA0 B;  2FJD A;  2UUA T;  3ZMS B;  1WRD A;  2RA1 A;  5FMN A;  4AKH A;  4TWD A;  2W66 A;  5DQV A;  4HN9 A;  5ADX L;  2BBH A;  1XMO T;  2CRB A;  2BS2 A;  2Y6X A;  3ZT5 A;  4KUM B;  4ZI2 D;  5HXR A;  4UV8 B;  3HL6 A;  5EZY E;  1YD8 G;  2IC9 A;  2BZB A;  2X0Y A;  3ESL A;  3N2K E;  2V7L A;  4HWD A;  2WWU A;  4TNW A;  2NP9 A;  4TWF A;  2MBG A;  2LSI A;  1YKE B;  2CXF A;  2VKH A;  2WB5 A;  4E7S A;  4WBN E;  2BVL A;  2LKG A;  2NTX A;  2X67 A;  2Y48 B;  3N9P A;  2XQ6 A;  1HX1 B;  2BVM A;  2CEA A;  4CXY A;  2LSJ A;  1HX8 A;  2D0T A;  2YK0 A;  2AE9 A;  4CXW A;  1WFD A;  2LJL A;  4P1N A;  4BJM A;  2QA7 A;  2YDQ A;  1SHZ C;  5IHY A;  3V5U A;  2P9B A;  3KVB A;  3H3A A;  4O4L E;  1MNE A;  2KSR A;  1KFY A;  2BS4 A;  1IAP A;  4DR5 T;  2UU9 T;  2DWK A;  5L3F B;  3AE2 A;  2ACX A;  5LHG B;  3RX6 A;  3PUA A;  2D0U A;  3CX6 B;  2YEV C;  2A72 A;  2HH7 A;  3L8R A;  2NTY A;  1FIO A;  1WCR A;  2PTF A;  3RIF A;  4TN7 B;  2E8I A;  1EZ3 A;  2X9W A;  4PK4 A;  3SRZ A;  4A98 A;  4ZHQ E;  4DV5 T;  3ZMV B;  4JI4 T;  5JRC B;  2CM0 A;  3K3N A;  2YIN A;  4XZC A;  2Q9Q A;  5L3B B;  5LGU B;  4DV7 T;  3IBP A;  2G0U A;  2Q9Q B;  3Q5X A;  4LFA T;  3CQG B;  4AKR B;  1NAF A;  1NWM X;  3AXJ B;  3CK6 A;  4ZS2 A;  5LBQ B;  5H6R B;  2CLY C;  3LG7 A;  2WWV A;  3ANW B;  3QNU A;  4HFE A;  3SOL A;  3UT5 E;  5JDG A;  3OJA A;  4EV6 A;  1FEW A;  5LJN A;  3KV9 A;  1NEK A;  1OED B;  5JDH A;  2XM2 A;  3LSV A;  4DUZ T;  3JC6 C;  2NW7 A;  2V7K A;  2XAH B;  4AQF C;  2PBI A;  3RIU C;  3PJA A;  4YSY A;  3M3Z B;  5CJ5 A;  3LBX B;  2DWG A;  4TV9 E;  5JDN A;  5AQK B;  3JCF A;  4H9S E;  4KX6 A;  4O8S A;  2WDV A;  3EUH A;  3UU6 A;  2CHN A;  4DMW A;  4YY3 T;  3P50 A;  1WLX A;  4MHC A;  4QH4 A;  3NKZ A;  3Q9D A;  5HWX A;  3AA1 B;  4UEL A;  3W15 B;  5KX5 E;  1LVK A;  4DMV A;  4DV1 T;  5HEU A;  3FHN A;  2DLR A;  4AXP A;  3A8Y C;  5ABF A;  3JAD A;  3UFE A;  3C98 B;  2IDO B;  2E9X D;  5JTG A;  5ABG A;  4DVD A;  5M4Y A;  1IBM T;  3TLV A;  2LEH A;  2KMF A;  1X9B A;  4X66 T;  4IDZ A;  5JDL A;  4EGW A;  4AQY T;  3AE6 A;  1L0V A;  3UUL A;  3DTO A;  2W61 A;  3I0O A;  3MZK B;  4B3T T;  2K24 A;  1GQE A;  2VQF T;  5HCM A;  5AQO B;  1VCT A;  1ZV4 X;  2IUB A;  4U2Z A;  4U2Y A;  3PUY F;  4JI1 T;  3UUB A;  4UVA B;  1HFA A;  2LOS A;  2MOZ A;  3VR8 A;  3HKD E;  4EXT A;  3ZYM A;  4DID B;  5LYJ E;  1FJG T;  4ZS3 A;  1ZKE A;  5ETW A;  4AI6 A;  4ZZC A;  2HN2 A;  2D9D A;  3EHZ A;  5CB4 E;  3ZMU B;  3UTK A;  3P4Q A;  4EZ4 A;  1M62 A;  2ODV A;  1UX5 A;  1MIW A;  3EDU A;  2EHO C;  3K3O A;  2BG9 E;  2QVA A;  3LK3 B;  4DND A;  3C4X A;  2XQ9 A;  3HR0 A;  2WCA A;  1VRB A;  2RPA A;  3PUZ F;  4G63 A;  5HXH A;  5LOV E;  2XQY A;  3Q5D A;  4MLK A;  3UU4 A;  1Z8U A;  1D0Z A;  2ES0 A;  3PUS A;  2N2N A;  2NR4 A;  2W2U A;  3CKD A;  4I0U A;  3SFD A;  1VOM A;  4H9O C;  3A5X A;  3OPC A;  2IML A;  5JH7 E;  4YTM A;  4LML A;  5FXZ A;  5H6Q B;  4EIW A;  2DI4 A;  3VHL A;  4XAX B;  2H7O A;  2BG9 C;  2WDR A;  1CUN A;  5AQP B;  4CXX A;  1BR0 A;  3RF1 A;  1YXR A;  3FXE B;  3H37 A;  1ZEE A;  3AB3 B;  3PUW F;  4WNK A;  3U78 A;  4DR2 T;  3ZYK A;  1N32 T;  2E5L T;  1ZHC A;  4AIU A;  1E7P A;  3ANW A;  2KXP B;  4QHO A;  3VKH A;  4DO0 A;  2BG9 B;  3N9O A;  2V26 A;  4NUU A;  4COF A;  3UUN A;  4CI1 B;  3LDQ B;  3VU7 H;  2KND A;  3ZC1 A;  3ETV A;  5AQI B;  2NW9 A;  2JMH A;  3TLS A;  5CA1 E;  3K1S A;  2E9X B;  3F31 A;  3IEE A;  2SPC A;  4YSX A;  5KMG P;  2NWB A;  5LG4 A;  4U7Y A;  4AKL A;  4X62 T;  2V7I A;  4QX7 B;  5AQM B;  5CGM A;  4GK5 E;  1KNP A;  4X20 E;  3AEG A;  4O4H E;  2HN1 A;  4OK0 A;  3UFG A;  3UU8 A;  4DR7 T;  1UK5 A;  2CBJ A;  1E2A A;  4PW8 A;  3IHR A;  2XUE A;  2H89 A;  2XAF B;  4ERR A;  2QGS A;  2B76 A;  2ZM6 T;  5ABF B;  3ZJ2 A;  1YW0 A;  3MKD A;  1HNW T;  2BDE A;  4H9R C;  4LF8 T;  4K0K T;  2X9Y A;  3AAI A;  3SWH A;  1S35 A;  4CN1 A;  2VB6 A;  4YLH A;  3FZF B;  4IDQ A;  3AE7 A;  3ONX A;  3OTO T;  1US7 B;  1W0B A;  2CHO A;  2XZE A;  4OYJ A;  2XAS B;  3NVO A;  1MMG A;  4H9P C;  2X0H A;  3CQC B;  3P7I A;  2VKD A;  3U3I A;  3ZMZ B;  2FJE A;  3PDY A;  4JI6 T;  3RH3 A;  2LOP A;  3C64 A;  2CLY B; 
#chains in the Genus database with same CATH homology
 3NRY A;  1U5P A;  5JR9 C;  1BR4 A;  4PFP A;  4YJ3 E;  2L9Q A;  4PNI A;  4AQG A;  3DJB A;  1WYC A;  4AQF A;  4ZI2 C;  4O2A E;  3N5L A;  3RPU A;  3E08 A;  3KBU A;  2XHE B;  4ILU A;  3HI2 A;  4GOU A;  1FMW A;  2H3R A;  1E1H B;  3LBX A;  4V1A v;  5FY1 A;  3ZCI A;  3ZJ1 A;  4UVB B;  2MTQ A;  5LXT E;  3C4Z A;  4BJN A;  5HXS A;  1UX4 A;  4EZH A;  5LGN B;  3GN5 A;  2C5J A;  4QX8 B;  2LHR A;  2KLQ A;  2LSG A;  4IGU A;  3RYF E;  4OYK A;  2X68 A;  4O2B E;  5LHH B;  2ZM8 A;  5J1G A;  2UXN B;  5EK4 A;  2C5I T;  4YHJ A;  4GIW A;  2X51 A;  4O4J E;  3GWH A;  5JDF A;  1UCU A;  5IYZ E;  1QUU A;  3I1A A;  3RYI E;  3O1J A;  2X0L B;  1SA0 E;  2LSY A;  3MJX A;  3OYZ A;  4AKI A;  4IIJ E;  2V7M A;  2PFV A;  4PK5 A;  2XTL A;  3PU8 A;  3O4X E;  1HF8 A;  3AAE B;  4I43 B;  3S4U A;  2VKJ A;  3EVY A;  3O1I A;  2WMO A;  3OYX A;  3PU3 A;  5L3G B;  1QSD A;  5HAX A;  5LJM A;  5J2T E;  4ZI3 D;  4PK6 A;  3FBL A;  1HG2 A;  2X9X A;  3ZYL A;  2RP4 A;  3KV6 A;  4CQI A;  5A1L A;  3ZLI A;  2N9D A;  2YU2 A;  3BQK A;  5L2L A;  4PFO A;  5L3D B;  4CI3 B;  5J2U E;  3PUQ A;  3AA7 B;  2W0G A;  3V5S A;  2WM9 A;  5JQG E;  2IC6 A;  5JRC A;  3AAA B;  4H63 H;  3DP7 A;  2LE8 A;  4E7Z A;  3J9X 1;  2D2S A;  4PAG A;  4TZ4 C;  3BK9 A;  1O3X A;  3T8O A;  2CMR A;  3KFW X;  4IHJ E;  4X1Y E;  2IW5 B;  3ZPO A;  3ZEF B;  4UVC B;  4J2C A;  2WSS V;  2HPL A;  2LHN A;  3R6N A;  3UUM A;  2WMN A;  3N2O A;  3LK4 2;  4I50 E;  5JRE A;  3GMI A;  3O1H A;  2E9X A;  3RC3 A;  2KT9 A;  4IE0 A;  5GON E;  4HFV A;  4JEU B;  2LT3 A;  4UIG A;  2EHO A;  5FYM A;  3KVA A;  2A2F X;  4PJM A;  2DCF A;  3ZN0 B;  3LK2 B;  4EYU A;  5LNK A;  1D0X A;  3N9M A;  3LFM A;  3FXD B;  4OHF A;  3WI3 A;  4CZZ B;  5C8Y E;  4YFS A;  3CQX C;  2Q9Q D;  3HA4 A;  2NW8 A;  4TV8 E;  4HE8 A;  2L3L A;  2DHR A;  4EAH A;  1V9D A;  4BA9 A;  3I0Q A;  4IE7 A;  4KP3 C;  4A56 A;  2VKO A;  2KWH A;  2WBL A;  4MBQ A;  2NOX A;  4C91 A;  1G8X A;  3PUR A;  2KWI B;  2ZMA A;  2LM9 A;  4QKN A;  4ZI3 C;  4JLE A;  3KDS E;  5F8P A;  5EK2 A;  1KK7 A;  3C51 A;  2B1E A;  4H9N C;  4HEA A;  2PG8 A;  4F6R C;  2J1D G;  2JMK A;  2XAQ B;  4I55 E;  4WBO A;  4X1I E;  4P0B A;  3Q2M A;  5TAO A;  4EB6 E;  1LRZ A;  3KV4 A;  4ADZ A;  5JR9 B;  2C5K T;  4TUY E;  2CE7 A;  3L09 A;  2LSK A;  1OWA A;  1S94 A;  4O4I E;  3QK6 A;  4G2A A;  4UV9 B;  1LKX A;  3NBX X;  4X1K E;  3BQI A;  4DBQ A;  4L9I A;  5L3C B;  2MYS A;  4HTE A;  3PE0 A;  3HKB E;  4K0U A;  3KV5 A;  3RRW A;  4GYS A;  1MIY A;  1T98 A;  2CA5 A;  5LBM A;  3HKE E;  4I4T E;  3M65 A;  4ISS A;  3N9N A;  1MND A;  4MFR A;  1H7C A;  2D5U A;  2V7J A;  2IAK A;  4N78 D;  1D1B A;  5JDQ A;  3ZCJ A;  2ZM2 A;  3PTR B;  4WW0 A;  4PJL A;  1HG5 A;  2XAJ B;  2V1D B;  3FBZ A;  4QXC B;  5KDM C;  4PJJ A;  5LA6 E;  3GA8 A;  5FY7 A;  4GYR A;  2GK9 A;  4U74 A;  3RYH E;  5CA0 E;  3ZMT B;  3AA6 B;  4B6X A;  3MXZ A;  2OA5 A;  3NRX A;  3C50 A;  3CX8 B;  4EOZ B;  2JJ9 A;  3MK7 C;  4CI2 B;  1Y64 B;  2XAG B;  3F57 A;  2VWA A;  3KIN B;  4L0R A;  4QWN B;  3WAJ A;  4AKG A;  3B57 A;  5FP3 A;  5BMV E;  3BQL A;  3NZQ A;  2W62 A;  3D0T A;  2A3D A;  4UF0 B;  3RC8 A;  3SS1 A;  3P8C D;  4UXN B;  4UF0 A;  4HGA A;  4U72 A;  4IST A;  1WYB A;  5DAB A;  1MMD A;  2Q9Q C;  5EK3 A;  4XBF B;  2M67 A;  4H63 V;  1HTJ F;  3CPZ A;  3Q5W A;  3CVR A;  4JUY A;  5LHI B;  2WAU A;  3L3P A;  3AVR A;  4MAL A;  3E22 E;  2K48 A;  1AJ3 A;  4KMC A;  3KBT A;  3R84 B;  1WR6 A;  4P09 A;  4PJN A;  2UXX B;  1B7T A;  3ZC0 A;  1IZN B;  2H7V C;  2CWO A;  1BR2 A;  4JEH B;  3CX7 B;  2VAS A;  2E9X C;  4P0A A;  5DQW A;  4ANJ A;  3RYC E;  5HWY A;  3O9X A;  1D1A A;  2CXD A;  3ZN1 B;  5LP6 E;  3JC6 D;  3B13 A;  2L8K A;  2ZM0 A;  2X66 A;  2ODU A;  1IJ5 A;  1Z0P A;  1HCI A;  5HYA A;  1IJ6 A;  4L5G A;  3F2E A;  2HPJ A;  4Z8X A;  1G73 A;  4QXB B;  2C0S A;  4IE4 A;  3LJC A;  5L3E B;  4ASK A;  2VL8 A;  5FXV A;  2JRK A;  3K3Q C;  4EYY R;  3HKC E;  2KIN B;  2X9H A;  3FB2 A;  2DNX A;  5JVD E;  5JR9 A;  3CML A;  4C90 A;  3E0Z A;  3RRC A;  2Y8D A;  4HKA A;  4ZI7 E;  3VKG A;  2W63 A;  2W00 A;  4TX5 A;  1FMV A;  2JQQ A;  4M1P A;  1MIV A;  4ZOL E;  1U4Q A;  2VK9 A;  3I9W A;  5FXW A;  5FNV E;  2EHO D;  3MA9 A;  2K9A A;  2YU1 A;  2ZLY A;  3CWZ B;  3MAC A;  5JDM A;  2Z6E A;  2K5B B;  1OXZ A;  1KNZ A;  2CXL A;  3TKL B;  3K8P C;  5DJQ C;  5E0O A;  3QUJ A;  5FY0 A;  2JPF A;  5LGT B;  3NZP A;  1LVF A;  1YKH B;  2EHO B;  1MMA A;  3N2G E;  4DBR A;  3J7Y q;  4QXH B;  2KZ7 B;  3EDV A;  3N9L A;  2CCQ A;  5HXC A;  1D0Y A;  1X79 A;  3OKQ A;  4IE6 A;  2CWY A;  4NUV A;  3IF8 B;  3N9Q A;  4OFZ A;  4FI5 A;  1BR1 A;  4GK0 E;  3RKO A;  4IE5 A;  1HS7 A;  3C4W A;  4FJO A;  4KBM B;  3QC9 A;  3WAK A;  5F3J A;  2I59 A;  4H9Q C;  4YJ2 E;  3AVS A;  2PJQ A;  5FXX A;  4BAY B;  3ETU A;  1MMN A;  4UEM A;  3GN5 B;  5HXE A;  3UUX B;  2N1G A;  3I9Y A;  3PUG A;  5LCY A;  3OBV E;  3AA0 B;  3ZMS B;  1WRD A;  2RA1 A;  5FMN A;  4AKH A;  5DQV A;  4HN9 A;  5ADX L;  2Y6X A;  4ZI2 D;  4KUM B;  5HXR A;  4UV8 B;  3HL6 A;  5EZY E;  1YD8 G;  2IC9 A;  2BZB A;  3N2K E;  3ESL A;  2V7L A;  2WWU A;  2NP9 A;  2MBG A;  2LSI A;  1YKE B;  2CXF A;  2VKH A;  4E7S A;  4WBN E;  2BVL A;  2NTX A;  2X67 A;  2Y48 B;  3N9P A;  4CXY A;  2BVM A;  2CEA A;  2LSJ A;  1HX8 A;  2D0T A;  2YK0 A;  4CXW A;  2LJL A;  4BJM A;  2QA7 A;  1SHZ C;  5IHY A;  3V5U A;  2P9B A;  3KVB A;  3H3A A;  4O4L E;  1MNE A;  1IAP A;  2DWK A;  5L3F B;  2ACX A;  5LHG B;  3RX6 A;  3PUA A;  2D0U A;  3CX6 B;  2YEV C;  2A72 A;  2HH7 A;  2NTY A;  1FIO A;  4TN7 B;  2E8I A;  1EZ3 A;  2X9W A;  4PK4 A;  3SRZ A;  4ZHQ E;  5JRC B;  3ZMV B;  2CM0 A;  3K3N A;  2YIN A;  4XZC A;  2Q9Q A;  5L3B B;  5LGU B;  3IBP A;  2G0U A;  2Q9Q B;  3Q5X A;  3CQG B;  4AKR B;  1NAF A;  1NWM X;  4ZS2 A;  5LBQ B;  3SOL A;  5H6R B;  2CLY C;  3LG7 A;  3UT5 E;  3ANW B;  5JDG A;  3OJA A;  1FEW A;  5LJN A;  3KV9 A;  5JDH A;  3JC6 C;  2NW7 A;  2V7K A;  2XAH B;  4AQF C;  2PBI A;  3LBX B;  2DWG A;  4TV9 E;  5JDN A;  4H9S E;  4O8S A;  3EUH A;  4DMW A;  1WLX A;  4MHC A;  3Q9D A;  5HWX A;  3AA1 B;  4UEL A;  3W15 B;  5KX5 E;  1LVK A;  4DMV A;  3FHN A;  2DLR A;  4AXP A;  3UFE A;  3C98 B;  2E9X D;  4DVD A;  5M4Y A;  2LEH A;  2KMF A;  4IDZ A;  5JDL A;  3UUL A;  3DTO A;  2W61 A;  3I0O A;  3MZK B;  2K24 A;  1ZV4 X;  4UVA B;  1HFA A;  2LOS A;  2MOZ A;  4EXT A;  3HKD E;  3ZYM A;  5LYJ E;  4ZS3 A;  1ZKE A;  5ETW A;  4AI6 A;  5CB4 E;  3ZMU B;  3UTK A;  4EZ4 A;  2ODV A;  3EDU A;  1UX5 A;  1MIW A;  3K3O A;  2EHO C;  3LK3 B;  4DND A;  3C4X A;  3HR0 A;  5HXH A;  1VRB A;  4G63 A;  5LOV E;  2XQY A;  4MLK A;  1D0Z A;  2ES0 A;  3PUS A;  2N2N A;  3CKD A;  1VOM A;  4H9O C;  3A5X A;  5JH7 E;  5FXZ A;  5H6Q B;  4EIW A;  2DI4 A;  3VHL A;  4XAX B;  2H7O A;  1BR0 A;  1CUN A;  4CXX A;  3FXE B;  3H37 A;  1ZEE A;  3AB3 B;  4WNK A;  3U78 A;  3ZYK A;  1ZHC A;  3ANW A;  2KXP B;  4QHO A;  3VKH A;  4DO0 A;  3N9O A;  2V26 A;  4NUU A;  3UUN A;  4CI1 B;  3VU7 H;  2KND A;  3ZC1 A;  3ETV A;  2NW9 A;  2JMH A;  5CA1 E;  2E9X B;  3F31 A;  3IEE A;  2SPC A;  5KMG P;  2NWB A;  5LG4 A;  4AKL A;  2V7I A;  4QX7 B;  4GK5 E;  4X20 E;  4O4H E;  4OK0 A;  4PW8 A;  3IHR A;  2XUE A;  2XAF B;  4ERR A;  2QGS A;  3ZJ2 A;  1YW0 A;  3MKD A;  2BDE A;  4H9R C;  2X9Y A;  3AAI A;  3SWH A;  1S35 A;  2VB6 A;  4YLH A;  3ONX A;  1US7 B;  4OYJ A;  3U3I A;  2XAS B;  3ZMZ B;  1MMG A;  4H9P C;  3P7I A;  3CQC B;  2VKD A;  5AFU L;  1D1C A;  3PDY A;  3RH3 A;  2LOP A;  3C64 A;  2CLY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...