4MALA

Tpr3 of fimv from p. aeruginosa (pao1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
TDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Motility protein FimV
publication title Crystal structure of TPR2 from FimV
rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
total genus 22
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4malA00
4MALA 4MBQA
chains in the Genus database with same CATH superfamily
1YW0A 1JNZA 3K3QC 4ZI3C 2X9YA 4E7SA 5LHIB 4ZZCA 4I50E 1M62A 3RHWA 3KV4A 2ODVA 1OEDA 1SHZC 2DNXA 4CI1B 3P8CD 3F57A 5CA1E 3K1SA 4Q25A 2JQ9A 4B3ST 5E0OA 4AISA 4ERRA 2C5IT 3BQKA 1IJ5A 3JCFA 3PUWF 4QX8B 4Z90A 4LMJA 2J62A 3FZKB 3KV9A 2DWKA 4HFEA 4O4LE 5AQVB 5J1GA 3PUVF 3ZT5A 3SOLA 4UELA 2F4VT 4O4JE 1US7B 3IBPA 3P50A 2V5CA 5DABA 2ZM2A 1J5WA 1Z8UA 5C8YE 1MIWA 3T1HT 4AIUA 2KXPB 3AAIA 2Q9QA 2XTLA 2WSSV 3KFWX 3HKCE 3AAEB 3VRAA 4GOUA 4AKLA 4WBOA 3ZPOA 2CMRA 3A5XA 4DV4T 3ZMVB 3ZSTA 3PU8A 3ZLIA 2CRBA 5IUXA 3VRBA 4EEDA 1I94T 3I0OA 1ZP0A 2IAKA 1UGOA 3CWZB 4H9RC 3RH3A 5AQFB 4DV3T 4HFDA 4A5XA 3HL6A 2LOSA 4HFVA 5AFUL 1VOMA 3VHLA 3X1DA 1D0ZA 3ANWA 2HPLA 2MPKA 3UUNA 2V7KA 4JI6T 3CQCB 5L3DB 5LGUB 4CN4A 2BZBA 1E2AA 3KVBA 2W62A 2WMNA 2PFVA 4AKGA 1IBKT 3AE3A 5A1LA 2LRLA 4E7ZA 3FHNA 2BDEA 4YY3T 4QH5A 4WBNE 2MTQA 2VL0A 1HNWT 1Y01A 2XQ6A 5L3GB 2Y8DA 2KNDA 3ETUA 1E1HB 1N32T 2CWYA 2XQ4A 1CUNA 5LGTB 3F31A 3I9WA 4X65T 4HTEA 1T98A 4HWCA 4U31A 1IZNB 2IC6A 2XQ5A 2VL8A 5L3CB 2LT3A 3PDYA 3Q5DA 4KHPT 3GN5A 5FVLA 2BG9E 2WU2A 3N9NA 1M7KA 3KINB 4DV6T 3QNUA 1WRDA 2XSBA 3SFDA 2VKDA 2J47A 2WP9A 4PJJA 3AA7B 3ZEFB 5HCMA 3LFMA 2X51A 3UU3A 5FYMA 3JADA 2UXCT 1SUMB 4TWHA 3RF1A 1MNDA 2BG9A 2Z6EA 3ZC1A 4G2AA 3JAFA 2LJLA 1FMVA 3NRYA 4X1KE 4O2AE 2M6BA 4DV0T 3ZYKA 4FI5A 3C51A 1Y64B 2RPAA 3FXEB 2MYSA 3C4XA 3AXJA 2BBJA 3D0TA 4J2CA 1D0XA 4JI4T 3N2GE 2J1DG 4EEBA 4IGUA 1T72A 2X0LB 3RYFE 2H7VC 2ZMAA 1HS7A 3TLTA 3N2OA 2DCFA 5BR8T 3TKLB 2X66A 3UQ7A 4O8SA 5CB4E 5KXJA 3LG7A 4YJ3E 4CXYA 4DV2T 2IC9A 2K24A 3ABVA 3NKZA 1YKHB 2V6XA 2BS2A 4MALA 4G63A 3GWHA 2XAFB 3K3NA 4DR7T 2LLYA 2CM0A 3L8RA 5JDGA 3SWHA 1D1AA 3ONJA 3BQIA 5EZYE 5AQPB 5HXHA 4HWHA 3C4WA 3QUJA 4IE4A 1S94A 1KF6A 4PK5A 4MLKA 2B1EA 3UU8A 2LRKA 4EB6E 3CVRA 4EV6A 2VKOA 4HEAA 4QXHB 2FJDA 4U72A 2WWVA 5JDMA 2KT9A 4YHJA 4GKKT 3JAEA 2HPJA 4JI0T 1W09A 3PE0A 3LSVA 2YEVC 3MJXA 4WYVA 2V7IA 4KP3C 4YLHA 4X66T 5FY7A 4ZI2C 4ILCA 2LSKA 2UXNB 1W0BA 2BS4A 2PTFA 1HR0T 4B3TT 2E9XA 5L47A 5KDMC 1LKXA 4B6XA 2G0UA 3P4RA 1BR4A 1QSDA 2L3LA 4O4HE 5HXEA 2ZM0A 4UIGA 3RX6A 3SRZA 5LMNT 3QB5A 1W0AA 3RYIE 4LFBT 4ISTA 3B5MA 4HWFA 4NXNT 2L9QA 4HKAA 5IWAT 3BK9A 1IAPA 2GK9A 2WCAA 4ILBA 3VR8A 5FY1A 1KNPA 2WDQA 3K8PC 3AB3B 2SPCA 2W4XA 3ZYMA 4JI3T 3UQ4A 2JPFA 3H3MA 2NWBA 1HNZT 1G8XA 2XY8B 2VVSA 4X1IE 4IDNA 4CI2B 2XM2A 3S4UA 2M6IA 1WYCA 2V7JA 3EHZA 5ADXL 2JRKA 4YTNA 2DI4A 1MMAA 1X79A 1YQ4A 5AQHB 4ZXLA 2D2SA 4I55E 4QHOA 1HX1B 2D0UA 5LYJE 4UXNB 1NEKA 4IE0A 2XQ3A 4PW8A 5BMVE 3DP7A 4IE5A 2Y48B 4GYRA 4B3MT 1SA0E 4TUYE 2K48A 5JDLA 2LSJA 1N36T 3FZMB 1DU2A 4DUYT 1QLBA 4A98A 4EIWA 4DO0A 1XDPA 1YD8G 4ZI3D 4ILUA 5DQWA 3V5SA 5LGNB 3G06A 4CN1A 3I0QA 1HX8A 3HA4A 4QH4A 4DR3T 1HTJF 5L3EB 3AVRA 2EHOC 5FL0A 4YXDA 5F5WA 5AQUB 5LMUT 3N9OA 1NAFA 3AEEA 2E8IA 2CPTA 3C50A 1OEDE 3AE2A 1FIOA 4IIJE 5AQMB 5L4EA 1J5ET 4JI1T 3N9PA 2E5LT 4JLEA 2CHOA 1R8IA 2LEHA 3AE7A 2W61A 2B76A 4IDOA 4TN7B 3RRCA 2CXLA 2XZEA 5DJQC 4OYJA 3GMIA 3NZQA 4KX6A 2VURA 2PJQA 4C90A 2KLQA 4UEMA 4H9SE 3AEBA 3RLFF 5JR9B 2V1DB 5LB7B 5LA6E 3QOFA 1WCRA 2X9XA 4U3CA 5LG4A 3VR9A 4BA9A 3CX6B 2LE8A 5AQTB 5AQNB 5ABGA 5JREA 1LVFA 4DBRA 2DHRA 3PUGA 5ABHA 3RPUA 5HXSA 1SE7A 4I43B 5FKYA 1NWMX 2RP4A 2X0YA 2DWGA 4ZEYA 4IE6A 1WLXA 3RIUA 1IBLT 2NOXA 3O1JA 2I59A 2JMKA 3N2KE 2A72A 4L0RA 4X5TA 3C98B 4PNIA 2VQET 3PUSA 2FJEA 2PBIA 4CXWA 5F8PA 1D1CA 5LJNA 5JDFA 4K0UA 4IREA 5AQIB 4H9NC 2VKHA 3RI5A 2WS3A 1G73A 3AAAB 1XWMA 5ABFA 2V7MA 4OK0A 2LSIA 4ZHQE 2N1GA 1FMWA 2MAWA 3LDQB 3PJAJ 4DR5T 2X9WA 5JVDE 3SS1A 2C5KT 4LF7T 3UU6A 3NVOA 4DV1T 1IBMT 2HHHT 5FP3A 3KBUA 3ETVA 2Q9QB 2QGSA 5JR9C 2VVNA 4COFA 3ZSSA 4LF9T 3EABA 5FNVE 4H63V 4CXXA 3A8YC 2IIUA 3QK6A 4IDQA 1YQ3A 4X20E 4QH1A 2JQQA 5CGMA 1IJ6A 4JI7T 1FEWA 3Q5WA 3FXDB 2LHNA 1ZEEA 2ES0A 3RGLA 2H88A 1MMDA 2I0MA 5JDNA 4HFCA 2D0TA 3ZMUB 4DMWA 4EYYR 2BKOA 4LMLA 1U4QA 3EVYA 2V7LA 3M65A 2J4GA 3QC9A 5EK3A 2YN6A 1OEDC 1W9RA 4XAXB 4UVBB 1D1BA 3NZPA 3ANWB 3QB5K 5HWXA 1BR2A 2LSGA 5FXZA 3TLUA 1WYBA 2XAQB 3Q5EA 3T1YT 4WNKA 2UXBT 4AI6A 5LNKA 5C3JA 5HEUA 4NUUA 3UFGA 2NW9A 4CQIA 3ZMSB 1MMGA 1ZHCA 3RRWA 3J7Yq 5FMNA 3N9LA 3AVSA 4JEHB 4GYSA 2JQKA 3RIAA 3R84B 2IW5B 4F6RC 2YDRA 3OPCA 5IHYA 3I9YA 2Q9QC 4LF6T 5LJMA 3CMLA 4GKJT 4YHHT 3ZT7A 4X1YE 3O1HA 3EDVA 3ZCJA 3PJAA 3PUZF 2W66A 1KNRA 2W63A 1OWAA 4ISSA 4DVDA 1ZOYA 1XMQT 2ACXA 2NP9A 3ONXA 4XZCA 4AQFA 5L3BB 4HGAA 4ZI7E 2D9DA 2ODUA 4U7IA 4PFPA 3PUXF 4JI5T 2MBGA 2JIWA 3DTOA 4AQGA 4BJMA 4ZS3A 2BG9B 5IYZE 2BVMA 3O9XA 2CHNA 4A97A 2A2FX 4OX9T 2XPKA 1XZYA 3J9X1 5JDHA 4ZI2D 3CKDA 4I4TE 4WW0A 3AXJB 2OLTA 3U3IA 4H63H 3RYCE 5EK2A 4YTMA 3KV6A 5AQRB 2DLRA 2X0HA 3FBZA 3UUXB 3PURA 4IT4A 3JC6C 2W0GA 4JEUB 5CJ5A 4U2ZA 1UCUA 4EGWA 2R6GF 4IL4A 2YOEA 2VQFT 2XQYA 3HKDE 2YDSA 4WZXA 3C64A 3R6NA 3P7IA 1J1JA 2PG8A 4Z91A 2UUCT 5JRCA 1BR1A 3MACA 5HYAA 2WY2A 1GQEA 4H9OC 2WMOA 3LBXB 4O2BE 4CN6A 4JUYA 4IL9A 2XAJB 4QKNA 4QXBB 2H89A 2W2UA 4YJ2E 2CCQA 4TZ4C 5JQGE 1H7CA 3AA6B 4KBMB 1BR0A 1Z0PA 2WQYA 2CBJA 4QWNB 2KSRA 4ADZA 4F8HA 4MFRA 4JI2T 4IE7A 4LFCT 4TNVA 4U7YA 2UXDT 2YKSA 2BG9C 2EHOB 3UUMA 3OKQA 2FBWA 2H7OA 3RIFA 2CWOA 5AQGB 2NW8A 5LG3A 3CX7B 3UT5E 4IHJE 4DR6T 3IEEA 1UX5A 2CXDA 1E7PA 4TWDA 1WR0A 4UF0A 3P4PA 4DUZT 4JV5T 4HE8A 2E9XB 3N9MA 3UULA 1I6ZA 2ZM8A 2WU5A 5J0ZA 2LHRA 2V6YA 1V9DA 2LM9A 3AE9A 4I0UA 4GK0E 2EHOD 2QYWA 4ASKA 2LOPA 2C0SA 5CFBA 3AE6A 2VASA 3L39A 4DNDA 2CEAA 2WZIA 2X67A 2NW7A 2XASB 2NTYA 5AQOB 3AEAA 4PK4A 2H3RA 3OJAA 4L9IA 1VCTA 3LK42 3Q2MA 3RC8A 1T7SA 2E5VA 2BVLA 2QA7A 3W15B 4QX7B 3PTRB 3AEGA 2M67A 3EUHA 3RKGA 3ONLC 5HXCA 2XQ7A 5AQLB 2XSAA 5FVKA 4XBFB 2V5DA 3UU5A 3B13A 3O4XE 2BS3A 4HWIB 2OA5A 2XQ8A 4HFIA 3UTKA 4EXTA 3H3AA 4ZOLE 4ZZBA 2LKHA 2P9BA 1HG5A 4UV8B 2JMHA 3AE5A 2OV9A 2E9XC 4IDZA 4HFBA 3CQXC 2V26A 2IDOB 3OBVE 3SFEA 2MOZA 2WB5A 2HN1A 4L5GA 4UVAB 3KV5A 4TWFA 3OTOT 2C5JA 3N5LA 2LKGA 1ZKEA 4BJNA 3CK6A 3AA0B 4PAGA 2WAUA 5H6RB 4LF5T 2AE9A 2CLYB 5HCJA 2I6HA 3PUYF 5LBMA 3AE4A 4UR9A 2VKJA 3NBXX 2X9HA 4JBWF 3K3OA 4AKIA 5LHHB 3MK7C 4DR4T 3E08A 3WAJA 4NPPA 5JDQA 4TV9E 5KX5E 3MKDA 4GIWA 3ZCIA 4QXCB 2KWIB 5LCYA 2FUPA 1O3XA 3CIRA 2XM1A 1OEDB 1XNQT 5FY0A 2UXXB 3KDSE 4YFSA 2HH7A 2BKPA 5LXTE 5ABEA 5M4YA 4YSYA 3N9QA 2YINA 1X9BA 3RC3A 2WWUA 4K0KT 4BAYB 4EYUA 2FJBA 4DBQA 1UUSA 3VKHA 4LMKA 3IHRA 3BQLA 3TLSA 3F2EA 3RYHE 3P4QA 1B7TA 4YTPA 2UUBT 2CA5A 2IUBA 5L4HA 2AXDS 3Q9DA 4C91A 2CLYC 3FZHB 2VWAA 1T8BA 1NENA 4A56A 3ZYLA 2ZM6T 5DQVA 3T8OA 2XHEB 2Y6XA 5AQJB 3O1IA 3CX8B 3IA3A 4AXPA 5ABFB 4EOZB 1WR6A 5HEJA 1HF8A 4PJNA 4M1PA 2BBHA 3WI3A 2VB6A 3PUAA 4P09A 5F3JA 2Q9QD 1OXZA 3L09A 5LOVE 2RA1A 5FL1A 3EAMA 5LP6E 2XAGB 5HAXA 1EZ3A 5L3FB 1XDOA 3LK2B 3MXZA 4U33A 3E22E 4PJLA 5J2TE 3CPZA 4PFOA 4GK5E 1QUUA 2KINB 3ZN1B 4AKHA 4HFHA 1WFDA 2YU2A 3RIUC 5C2TA 4OHFA 1HNXT 1MIVA 2D5UA 2JQHA 3KVAA 3GN5B 4PK6A 4PJMA 3ZKRA 3H37A 3AECA 1YKEB 4YSXA 4NUVA 3NRXA 3LK3B 4DR1T 4ZS2A 5LBQB 5FXVA 2YU1A 1KEYA 5H6QB 2WM9A 4DIDB 4EZHA 5HEOA 3PU3A 2JJ9A 3TLWA 3IF8B 4KI0F 2UUAT 3ZMZB 3JC6D 4DV5T 4P0AA 3Q5XA 5AQKB 2XJ7A 4KMCA 3RQWA 3VKGA 3A7MA 3V5UA 2CXFA 2VK9A 1KFYA 3AEFA 4FJOA 1U5PA 2XAHB 3ZJ1A 1YXRA 1VRBA 3ZC0A 1JNRA 2K3WA 1S35A 1CHUA 3LBXA 4AKRB 2WDVA 5EK4A 4NXMT 2ZLYA 1UX4A 2K5BB 1ZV4X 5JTGA 1N33T 4DR2T 2LM2A 1HFAA 4HWDA 1N34T 4EAHA 4B3RT 1FJGT 2IHR1 2UU9T 4OYKA 4P0BA 3ZMTB 1D0YA 4TV8E 2EHOA 2WDRA 4YT0A 4KUMB 2K9AA 1VCSA 2LSYA 2KWHA 4OFZA 2FJAA 4UVCB 1HCIA 2ACZA 3OYZA 4MHCA 4TX5A 3OYXA 3HR0A 1KNZA 5GONE 1XMOT 2KZ7B 5KMGP 5HXRA 5J2UE 2YK0A 5ETWA 2QRXA 2N2NA 3L3PA 4NIQA 3AEDA 2IMLA 3WAKA 4CI3B 4H9PC 3NWIA 4UV9B 1HG2A 5HEHA 5AQSB 5FXWA 3MZKB 3P4WA 2W00A 3HKEE 2L8KA 3AA1B 5JRCB 3PV0F 3UUBA 3I1AA 4X62T 4EZ4A 4X64T 4LF4T 3HKBE 2V8SV 4AQFC 4HN9A 3RQUA 4P1NA 4DMVA 2XUEA 5HWYA 1MNEA 2NR4A 3OVUA 5L2LA 4AQYT 4KHZF 4LF8T 3KBTA 1MIYA 2X68A 3VU7H 3FBLA 4TNWA 2N9DA 3DJBA 5TAOA 4IDPA 3ZT6A 3EDUA 3ZN0B 2WZHA 2XQAA 3B57A 3RKOA 2HN2A 2A9UA 3P4SA 3UU4A 4CZZB 3TLVA 4Z8XA 3ESLA 3M3ZB 2A3DA 3LJCA 2CBIA 3PUQA 4MBQA 3HI2A 2NTXA 4UF0B 2E9XD 1KK7A 2BKNA 5HEGA 3MA9A 3UFEA 1LRZA 3GA8A 3ZJ2A 2CE7A 4ANJA 3FB2A 2V6YB 4N78D 1UK5A 5AQQB 5FXXA 5JH7E 5JR9A 4U2YA 2WBLA 5LHGB 3U78A 5CA0E 4JI8T 3C4ZA 4ILAA 4U74A 2QVAA 4JYAT 1AJ3A 1UURA 1LVKA 4DV7T 4YSZA 3E0ZA 1MMNA 1XNRT 3AE1A 4LFAT 2DL1A 2E2AA 4O4IE 4H9QC 4V1Av 3AE8A 3FZFB 1L0VA 2XQ9A 2W67A 3EI0A 3FZLB 3CQGB 2KMFA 2YDQA
chains in the Genus database with same CATH topology
1YW0A 2MBGA 3K3QC 4ZI3C 3DTOA 2CLYC 4AQGA 2X9YA 2VWAA 3K8PC 3AB3B 2SPCA 4E7SA 4BJMA 3ZYMA 4A56A 3ZYLA 5DQVA 5LHIB 4ZS3A 5IYZE 4I50E 2JPFA 2NWBA 2BVMA 3T8OA 3KV4A 2ODVA 1SHZC 2DNXA 1G8XA 4CI1B 3P8CD 2XHEB 2Y6XA 3O9XA 4X1IE 3F57A 3O1IA 4CI2B 5CA1E 3CX8B 3S4UA 4AXPA 4EOZB 1WR6A 1HF8A 4PJNA 5E0OA 1WYCA 2A2FX 4ERRA 2V7JA 5ADXL 4M1PA 2C5IT 2JRKA 3WI3A 3BQKA 2DI4A 3J9X1 2VB6A 1IJ5A 1MMAA 1X79A 4ZI2D 5JDHA 3CKDA 4I4TE 3PUAA 4WW0A 2D2SA 4P09A 5F3JA 4I55E 4QHOA 2Q9QD 4QX8B 2D0UA 5LYJE 3U3IA 3KV9A 1OXZA 4H63H 2DWKA 4UXNB 3RYCE 3L09A 5LOVE 4IE0A 5EK2A 2RA1A 3KV6A 4O4LE 2DLRA 4PW8A 5J1GA 3FBZA 3UUXB 5LP6E 3PURA 2XAGB 3SOLA 5BMVE 4UELA 3JC6C 2W0GA 4O4JE 4JEUB 1US7B 5HAXA 1EZ3A 3IBPA 3DP7A 5L3FB 5DABA 2ZM2A 4IE5A 2Y48B 4GYRA 1UCUA 1SA0E 3LK2B 5C8YE 1MIWA 3MXZA 3E22E 4TUYE 2KXPB 4PJLA 3AAIA 5J2TE 2Q9QA 2K48A 3CPZA 2XTLA 5JDLA 2XQYA 3HKDE 2LSJA 4PFOA 2WSSV 4GK5E 3KFWX 1QUUA 2KINB 3ZN1B 3C64A 4AKHA 3HKCE 3AAEB 4GOUA 3R6NA 3P7IA 4AKLA 4EIWA 4WBOA 3ZPOA 2CMRA 2PG8A 4DO0A 3A5XA 5JRCA 1BR1A 3MACA 3ZMVB 5HYAA 1YD8G 3PU8A 2YU2A 3ZLIA 4H9OC 4ZI3D 4ILUA 2WMOA 5DQWA 3V5SA 5LGNB 3LBXB 4O2BE 4JUYA 4OHFA 2XAJB 3I0QA 4QKNA 4QXBB 1HX8A 3HA4A 4YJ2E 1MIVA 2CCQA 1HTJF 5L3EB 4TZ4C 2D5UA 5JQGE 3I0OA 1H7CA 3AA6B 3AVRA 2EHOC 2IAKA 4KBMB 1BR0A 1Z0PA 3KVAA 4QWNB 3CWZB 3GN5B 4H9RC 4PK6A 4PJMA 4ADZA 3N9OA 1NAFA 3RH3A 3H37A 4MFRA 4IE7A 1YKEB 3HL6A 2E8IA 4NUVA 3NRXA 3C50A 3LK3B 4ZS2A 2LOSA 5LBQB 2EHOB 3UUMA 3OKQA 5FXVA 2YU1A 4HFVA 1FIOA 2H7OA 2CWOA 4IIJE 5H6QB 5AFUL 2WM9A 1VOMA 3VHLA 2NW8A 3N9PA 4EZHA 4JLEA 3CX7B 3UT5E 1D0ZA 3PU3A 3ANWA 2HPLA 3UUNA 2LEHA 2V7KA 2JJ9A 3CQCB 2W61A 3IF8B 5L3DB 4IHJE 4TN7B 3ZMZB 3RRCA 3JC6D 2CXLA 5LGUB 3IEEA 2BZBA 1UX5A 2CXDA 3KVBA 5DJQC 4OYJA 3GMIA 4P0AA 3Q5XA 3NZQA 2W62A 4KMCA 2WMNA 2PJQA 2PFVA 4C90A 2KLQA 4UEMA 4H9SE 4AKGA 3VKGA 5A1LA 4E7ZA 3FHNA 3V5UA 2BDEA 2CXFA 4UF0A 2VK9A 4WBNE 2MTQA 5JR9B 4FJOA 4HE8A 2V1DB 2E9XB 3N9MA 3UULA 1U5PA 2XAHB 3ZJ1A 5LA6E 5L3GB 2X9XA 2Y8DA 2KNDA 5LG4A 3ETUA 2ZM8A 4BA9A 1VRBA 3ZC0A 1E1HB 2LHRA 3CX6B 1V9DA 2CWYA 1S35A 2LM9A 1CUNA 5LGTB 3LBXA 2LE8A 3F31A 3I9WA 4AKRB 4HTEA 5EK4A 1T98A 2ZLYA 1UX4A 4GK0E 2EHOD 5JREA 1LVFA 4ASKA 2LOPA 2K5BB 2C0SA 4DBRA 1IZNB 2IC6A 1ZV4X 2DHRA 3PUGA 2VL8A 2VASA 2LT3A 3PDYA 5L3CB 3RPUA 5HXSA 4I43B 3GN5A 4DNDA 1NWMX 2CEAA 2RP4A 2DWGA 4IE6A 1WLXA 1HFAA 2NOXA 3O1JA 2X67A 2I59A 4EAHA 2NW7A 2JMKA 2NTYA 2XASB 3N9NA 4PK4A 2H3RA 3OJAA 3N2KE 3KINB 4OYKA 4P0BA 2A72A 4L0RA 3ZMTB 1D0YA 4TV8E 4L9IA 1WRDA 2EHOA 3LK42 3Q2MA 3RC8A 2BVLA 3C98B 4PNIA 2VKDA 2QA7A 3W15B 4PJJA 4KUMB 4QX7B 3AA7B 3ZEFB 2K9AA 3PUSA 3PTRB 2LSYA 2M67A 3LFMA 2KWHA 2X51A 4OFZA 2PBIA 5FYMA 3EUHA 4CXWA 5F8PA 4UVCB 1HCIA 5HXCA 3OYZA 1D1CA 4MHCA 5LJNA 1MNDA 5JDFA 2Z6EA 4G2AA 4K0UA 3ZC1A 2LJLA 1FMVA 4H9NC 4TX5A 3NRYA 2VKHA 3OYXA 4X1KE 4XBFB 3B13A 4O2AE 3HR0A 1KNZA 3O4XE 5GONE 1G73A 3AAAB 2KZ7B 2V7MA 5KMGP 4OK0A 2LSIA 4ZHQE 2N1GA 1FMWA 5HXRA 2OA5A 3ZYKA 4FI5A 5J2UE 3C51A 1Y64B 2YK0A 5ETWA 3UTKA 4EXTA 3FXEB 3H3AA 4ZOLE 2N2NA 2MYSA 3L3PA 2X9WA 3C4XA 5JVDE 3SS1A 2C5KT 2P9BA 3D0TA 4J2CA 1D0XA 3N2GE 1HG5A 2J1DG 4IGUA 3WAKA 4CI3B 4H9PC 4UV9B 4UV8B 3KBUA 5FP3A 3ETVA 2JMHA 2Q9QB 2QGSA 5JR9C 1HG2A 2X0LB 5FNVE 2E9XC 4H63V 3RYFE 4IDZA 2H7VC 4CXXA 5FXWA 2ZMAA 3CQXC 3MZKB 3QK6A 2V26A 3OBVE 2W00A 1HS7A 3HKEE 4X20E 2L8KA 3AA1B 3N2OA 5JRCB 2MOZA 2JQQA 3I1AA 2DCFA 4EZ4A 4L5GA 3TKLB 1IJ6A 2X66A 4O8SA 3HKBE 1FEWA 5CB4E 3Q5WA 4AQFC 4HN9A 3FXDB 3LG7A 4UVAB 2LHNA 1ZEEA 2ES0A 3KV5A 4YJ3E 4CXYA 4DMVA 1MMDA 5JDNA 2XUEA 2IC9A 2K24A 5HWYA 1YKHB 2D0TA 2C5JA 3N5LA 4MALA 4G63A 3GWHA 2XAFB 3K3NA 1ZKEA 3ZMUB 1MNEA 4BJNA 4DMWA 3AA0B 4PAGA 4EYYR 2WAUA 5H6RB 2CM0A 5L2LA 5JDGA 2CLYB 3SWHA 3KBTA 1MIYA 1U4QA 1D1AA 3BQIA 5EZYE 3EVYA 5LBMA 2V7LA 2X68A 3M65A 3VU7H 3QC9A 3FBLA 5EK3A 2VKJA 2N9DA 5HXHA 3DJBA 3NBXX 5TAOA 3C4WA 3QUJA 2X9HA 4IE4A 1S94A 3EDUA 4XAXB 3K3OA 4UVBB 3ZN0B 4AKIA 4PK5A 1D1BA 3B57A 3MK7C 2B1EA 3E08A 3NZPA 4MLKA 3RKOA 5LHHB 3ANWB 3WAJA 4EB6E 3CVRA 5JDQA 4TV9E 5HWXA 4CZZB 5KX5E 2VKOA 3MKDA 4GIWA 3ZCIA 1BR2A 4HEAA 4QXCB 2LSGA 4QXHB 5FXZA 1WYBA 2KWIB 5LCYA 2XAQB 4Z8XA 3ESLA 2A3DA 4U72A 4WNKA 4AI6A 5LNKA 1O3XA 3LJCA 3PUQA 4NUUA 5JDMA 4MBQA 3HI2A 2NTXA 2KT9A 4YHJA 2NW9A 4CQIA 5FY0A 3ZMSB 1MMGA 2HPJA 1ZHCA 4UF0B 2E9XD 1KK7A 2UXXB 3PE0A 3KDSE 3RRWA 2YEVC 3MJXA 3J7Yq 3MA9A 2HH7A 4YFSA 3UFEA 1LRZA 5FMNA 5LXTE 3GA8A 3ZJ2A 2V7IA 4KP3C 5M4YA 4YLHA 2CE7A 3N9LA 3AVSA 4ANJA 4JEHB 3FB2A 4GYSA 3N9QA 5FY7A 2YINA 3R84B 4ZI2C 2IW5B 3RC3A 2LSKA 2UXNB 4F6RC 2WWUA 4N78D 5IHYA 4BAYB 3I9YA 2Q9QC 4EYUA 5FXXA 5JH7E 5LJMA 5JR9A 2WBLA 3CMLA 5LHGB 2E9XA 4DBQA 3U78A 5CA0E 5KDMC 1LKXA 3C4ZA 4X1YE 4U74A 4B6XA 2G0UA 3O1HA 1AJ3A 1BR4A 3EDVA 3ZCJA 1QSDA 1LVKA 2L3LA 4O4HE 2W63A 3VKHA 5HXEA 1OWAA 2ZM0A 4ISSA 4DVDA 3E0ZA 4UIGA 3RX6A 3SRZA 1MMNA 3IHRA 3BQLA 2ACXA 2NP9A 3ONXA 3RYIE 4XZCA 4AQFA 5L3BB 3F2EA 4O4IE 4HGAA 4ISTA 4ZI7E 3RYHE 4H9QC 4V1Av 1B7TA 2ODUA 2L9QA 2CA5A 4HKAA 3BK9A 1IAPA 3CQGB 2KMFA 2GK9A 3Q9DA 4PFPA 5FY1A 4C91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAL A;  4MBQ A; 
#chains in the Genus database with same CATH topology
 1YW0 A;  1JNZ A;  3K3Q C;  4ZI3 C;  2X9Y A;  4E7S A;  5LHI B;  4ZZC A;  4I50 E;  1M62 A;  3RHW A;  3KV4 A;  2ODV A;  1OED A;  1SHZ C;  2DNX A;  4CI1 B;  3P8C D;  3F57 A;  5CA1 E;  3K1S A;  4Q25 A;  2JQ9 A;  4B3S T;  5E0O A;  4AIS A;  4ERR A;  2C5I T;  3BQK A;  1IJ5 A;  3JCF A;  3PUW F;  4QX8 B;  4Z90 A;  4LMJ A;  2J62 A;  3FZK B;  3KV9 A;  2DWK A;  4HFE A;  4O4L E;  5AQV B;  5J1G A;  3PUV F;  3ZT5 A;  3SOL A;  4UEL A;  2F4V T;  4O4J E;  1US7 B;  3IBP A;  3P50 A;  2V5C A;  5DAB A;  2ZM2 A;  1J5W A;  1Z8U A;  5C8Y E;  1MIW A;  3T1H T;  4AIU A;  2KXP B;  3AAI A;  2Q9Q A;  2XTL A;  2WSS V;  3KFW X;  3HKC E;  3AAE B;  3VRA A;  4GOU A;  4AKL A;  4WBO A;  3ZPO A;  2CMR A;  3A5X A;  4DV4 T;  3ZMV B;  3ZST A;  3PU8 A;  3ZLI A;  2CRB A;  5IUX A;  3VRB A;  4EED A;  1I94 T;  3I0O A;  1ZP0 A;  2IAK A;  1UGO A;  3CWZ B;  4H9R C;  3RH3 A;  5AQF B;  4DV3 T;  4HFD A;  4A5X A;  3HL6 A;  2LOS A;  4HFV A;  5AFU L;  1VOM A;  3VHL A;  3X1D A;  1D0Z A;  3ANW A;  2HPL A;  2MPK A;  3UUN A;  2V7K A;  4JI6 T;  3CQC B;  5L3D B;  5LGU B;  4CN4 A;  2BZB A;  1E2A A;  3KVB A;  2W62 A;  2WMN A;  2PFV A;  4AKG A;  1IBK T;  3AE3 A;  5A1L A;  2LRL A;  4E7Z A;  3FHN A;  2BDE A;  4YY3 T;  4QH5 A;  4WBN E;  2MTQ A;  2VL0 A;  1HNW T;  1Y01 A;  2XQ6 A;  5L3G B;  2Y8D A;  2KND A;  3ETU A;  1E1H B;  1N32 T;  2CWY A;  2XQ4 A;  1CUN A;  5LGT B;  3F31 A;  3I9W A;  4X65 T;  4HTE A;  1T98 A;  4HWC A;  4U31 A;  1IZN B;  2IC6 A;  2XQ5 A;  2VL8 A;  5L3C B;  2LT3 A;  3PDY A;  3Q5D A;  4KHP T;  3GN5 A;  5FVL A;  2BG9 E;  2WU2 A;  3N9N A;  1M7K A;  3KIN B;  4DV6 T;  3QNU A;  1WRD A;  2XSB A;  3SFD A;  2VKD A;  2J47 A;  2WP9 A;  4PJJ A;  3AA7 B;  3ZEF B;  5HCM A;  3LFM A;  2X51 A;  3UU3 A;  5FYM A;  3JAD A;  2UXC T;  1SUM B;  4TWH A;  3RF1 A;  1MND A;  2BG9 A;  2Z6E A;  3ZC1 A;  4G2A A;  3JAF A;  2LJL A;  1FMV A;  3NRY A;  4X1K E;  4O2A E;  2M6B A;  4DV0 T;  3ZYK A;  4FI5 A;  3C51 A;  1Y64 B;  2RPA A;  3FXE B;  2MYS A;  3C4X A;  3AXJ A;  2BBJ A;  3D0T A;  4J2C A;  1D0X A;  4JI4 T;  3N2G E;  2J1D G;  4EEB A;  4IGU A;  1T72 A;  2X0L B;  3RYF E;  2H7V C;  2ZMA A;  1HS7 A;  3TLT A;  3N2O A;  2DCF A;  5BR8 T;  3TKL B;  2X66 A;  3UQ7 A;  4O8S A;  5CB4 E;  5KXJ A;  3LG7 A;  4YJ3 E;  4CXY A;  4DV2 T;  2IC9 A;  2K24 A;  3ABV A;  3NKZ A;  1YKH B;  2V6X A;  2BS2 A;  4MAL A;  4G63 A;  3GWH A;  2XAF B;  3K3N A;  4DR7 T;  2LLY A;  2CM0 A;  3L8R A;  5JDG A;  3SWH A;  1D1A A;  3ONJ A;  3BQI A;  5EZY E;  5AQP B;  5HXH A;  4HWH A;  3C4W A;  3QUJ A;  4IE4 A;  1S94 A;  1KF6 A;  4PK5 A;  4MLK A;  2B1E A;  3UU8 A;  2LRK A;  4EB6 E;  3CVR A;  4EV6 A;  2VKO A;  4HEA A;  4QXH B;  2FJD A;  4U72 A;  2WWV A;  5JDM A;  2KT9 A;  4YHJ A;  4GKK T;  3JAE A;  2HPJ A;  4JI0 T;  1W09 A;  3PE0 A;  3LSV A;  2YEV C;  3MJX A;  4WYV A;  2V7I A;  4KP3 C;  4YLH A;  4X66 T;  5FY7 A;  4ZI2 C;  4ILC A;  2LSK A;  2UXN B;  1W0B A;  2BS4 A;  2PTF A;  1HR0 T;  4B3T T;  2E9X A;  5L47 A;  5KDM C;  1LKX A;  4B6X A;  2G0U A;  3P4R A;  1BR4 A;  1QSD A;  2L3L A;  4O4H E;  5HXE A;  2ZM0 A;  4UIG A;  3RX6 A;  3SRZ A;  5LMN T;  3QB5 A;  1W0A A;  3RYI E;  4LFB T;  4IST A;  3B5M A;  4HWF A;  4NXN T;  2L9Q A;  4HKA A;  5IWA T;  3BK9 A;  1IAP A;  2GK9 A;  2WCA A;  4ILB A;  3VR8 A;  5FY1 A;  1KNP A;  2WDQ A;  3K8P C;  3AB3 B;  2SPC A;  2W4X A;  3ZYM A;  4JI3 T;  3UQ4 A;  2JPF A;  3H3M A;  2NWB A;  1HNZ T;  1G8X A;  2XY8 B;  2VVS A;  4X1I E;  4IDN A;  4CI2 B;  2XM2 A;  3S4U A;  2M6I A;  1WYC A;  2V7J A;  3EHZ A;  5ADX L;  2JRK A;  4YTN A;  2DI4 A;  1MMA A;  1X79 A;  1YQ4 A;  5AQH B;  4ZXL A;  2D2S A;  4I55 E;  4QHO A;  1HX1 B;  2D0U A;  5LYJ E;  4UXN B;  1NEK A;  4IE0 A;  2XQ3 A;  4PW8 A;  5BMV E;  3DP7 A;  4IE5 A;  2Y48 B;  4GYR A;  4B3M T;  1SA0 E;  4TUY E;  2K48 A;  5JDL A;  2LSJ A;  1N36 T;  3FZM B;  1DU2 A;  4DUY T;  1QLB A;  4A98 A;  4EIW A;  4DO0 A;  1XDP A;  1YD8 G;  4ZI3 D;  4ILU A;  5DQW A;  3V5S A;  5LGN B;  3G06 A;  4CN1 A;  3I0Q A;  1HX8 A;  3HA4 A;  4QH4 A;  4DR3 T;  1HTJ F;  5L3E B;  3AVR A;  2EHO C;  5FL0 A;  4YXD A;  5F5W A;  5AQU B;  5LMU T;  3N9O A;  1NAF A;  3AEE A;  2E8I A;  2CPT A;  3C50 A;  1OED E;  3AE2 A;  1FIO A;  4IIJ E;  5AQM B;  5L4E A;  1J5E T;  4JI1 T;  3N9P A;  2E5L T;  4JLE A;  2CHO A;  1R8I A;  2LEH A;  3AE7 A;  2W61 A;  2B76 A;  4IDO A;  4TN7 B;  3RRC A;  2CXL A;  2XZE A;  5DJQ C;  4OYJ A;  3GMI A;  3NZQ A;  4KX6 A;  2VUR A;  2PJQ A;  4C90 A;  2KLQ A;  4UEM A;  4H9S E;  3AEB A;  3RLF F;  5JR9 B;  2V1D B;  5LB7 B;  5LA6 E;  3QOF A;  1WCR A;  2X9X A;  4U3C A;  5LG4 A;  3VR9 A;  4BA9 A;  3CX6 B;  2LE8 A;  5AQT B;  5AQN B;  5ABG A;  5JRE A;  1LVF A;  4DBR A;  2DHR A;  3PUG A;  5ABH A;  3RPU A;  5HXS A;  1SE7 A;  4I43 B;  5FKY A;  1NWM X;  2RP4 A;  2X0Y A;  2DWG A;  4ZEY A;  4IE6 A;  1WLX A;  3RIU A;  1IBL T;  2NOX A;  3O1J A;  2I59 A;  2JMK A;  3N2K E;  2A72 A;  4L0R A;  4X5T A;  3C98 B;  4PNI A;  2VQE T;  3PUS A;  2FJE A;  2PBI A;  4CXW A;  5F8P A;  1D1C A;  5LJN A;  5JDF A;  4K0U A;  4IRE A;  5AQI B;  4H9N C;  2VKH A;  3RI5 A;  2WS3 A;  1G73 A;  3AAA B;  1XWM A;  5ABF A;  2V7M A;  4OK0 A;  2LSI A;  4ZHQ E;  2N1G A;  1FMW A;  2MAW A;  3LDQ B;  3PJA J;  4DR5 T;  2X9W A;  5JVD E;  3SS1 A;  2C5K T;  4LF7 T;  3UU6 A;  3NVO A;  4DV1 T;  1IBM T;  2HHH T;  5FP3 A;  3KBU A;  3ETV A;  2Q9Q B;  2QGS A;  5JR9 C;  2VVN A;  4COF A;  3ZSS A;  4LF9 T;  3EAB A;  5FNV E;  4H63 V;  4CXX A;  3A8Y C;  2IIU A;  3QK6 A;  4IDQ A;  1YQ3 A;  4X20 E;  4QH1 A;  2JQQ A;  5CGM A;  1IJ6 A;  4JI7 T;  1FEW A;  3Q5W A;  3FXD B;  2LHN A;  1ZEE A;  2ES0 A;  3RGL A;  2H88 A;  1MMD A;  2I0M A;  5JDN A;  4HFC A;  2D0T A;  3ZMU B;  4DMW A;  4EYY R;  2BKO A;  4LML A;  1U4Q A;  3EVY A;  2V7L A;  3M65 A;  2J4G A;  3QC9 A;  5EK3 A;  2YN6 A;  1OED C;  1W9R A;  4XAX B;  4UVB B;  1D1B A;  3NZP A;  3ANW B;  3QB5 K;  5HWX A;  1BR2 A;  2LSG A;  5FXZ A;  3TLU A;  1WYB A;  2XAQ B;  3Q5E A;  3T1Y T;  4WNK A;  2UXB T;  4AI6 A;  5LNK A;  5C3J A;  5HEU A;  4NUU A;  3UFG A;  2NW9 A;  4CQI A;  3ZMS B;  1MMG A;  1ZHC A;  3RRW A;  3J7Y q;  5FMN A;  3N9L A;  3AVS A;  4JEH B;  4GYS A;  2JQK A;  3RIA A;  3R84 B;  2IW5 B;  4F6R C;  2YDR A;  3OPC A;  5IHY A;  3I9Y A;  2Q9Q C;  4LF6 T;  5LJM A;  3CML A;  4GKJ T;  4YHH T;  3ZT7 A;  4X1Y E;  3O1H A;  3EDV A;  3ZCJ A;  3PJA A;  3PUZ F;  2W66 A;  1KNR A;  2W63 A;  1OWA A;  4ISS A;  4DVD A;  1ZOY A;  1XMQ T;  2ACX A;  2NP9 A;  3ONX A;  4XZC A;  4AQF A;  5L3B B;  4HGA A;  4ZI7 E;  2D9D A;  2ODU A;  4U7I A;  4PFP A;  3PUX F;  4JI5 T;  2MBG A;  2JIW A;  3DTO A;  4AQG A;  4BJM A;  4ZS3 A;  2BG9 B;  5IYZ E;  2BVM A;  3O9X A;  2CHN A;  4A97 A;  2A2F X;  4OX9 T;  2XPK A;  1XZY A;  3J9X 1;  5JDH A;  4ZI2 D;  3CKD A;  4I4T E;  4WW0 A;  3AXJ B;  2OLT A;  3U3I A;  4H63 H;  3RYC E;  5EK2 A;  4YTM A;  3KV6 A;  5AQR B;  2DLR A;  2X0H A;  3FBZ A;  3UUX B;  3PUR A;  4IT4 A;  3JC6 C;  2W0G A;  4JEU B;  5CJ5 A;  4U2Z A;  1UCU A;  4EGW A;  2R6G F;  4IL4 A;  2YOE A;  2VQF T;  2XQY A;  3HKD E;  2YDS A;  4WZX A;  3C64 A;  3R6N A;  3P7I A;  1J1J A;  2PG8 A;  4Z91 A;  2UUC T;  5JRC A;  1BR1 A;  3MAC A;  5HYA A;  2WY2 A;  1GQE A;  4H9O C;  2WMO A;  3LBX B;  4O2B E;  4CN6 A;  4JUY A;  4IL9 A;  2XAJ B;  4QKN A;  4QXB B;  2H89 A;  2W2U A;  4YJ2 E;  2CCQ A;  4TZ4 C;  5JQG E;  1H7C A;  3AA6 B;  4KBM B;  1BR0 A;  1Z0P A;  2WQY A;  2CBJ A;  4QWN B;  2KSR A;  4ADZ A;  4F8H A;  4MFR A;  4JI2 T;  4IE7 A;  4LFC T;  4TNV A;  4U7Y A;  2UXD T;  2YKS A;  2BG9 C;  2EHO B;  3UUM A;  3OKQ A;  2FBW A;  2H7O A;  3RIF A;  2CWO A;  5AQG B;  2NW8 A;  5LG3 A;  3CX7 B;  3UT5 E;  4IHJ E;  4DR6 T;  3IEE A;  1UX5 A;  2CXD A;  1E7P A;  4TWD A;  1WR0 A;  4UF0 A;  3P4P A;  4DUZ T;  4JV5 T;  4HE8 A;  2E9X B;  3N9M A;  3UUL A;  1I6Z A;  2ZM8 A;  2WU5 A;  5J0Z A;  2LHR A;  2V6Y A;  1V9D A;  2LM9 A;  3AE9 A;  4I0U A;  4GK0 E;  2EHO D;  2QYW A;  4ASK A;  2LOP A;  2C0S A;  5CFB A;  3AE6 A;  2VAS A;  3L39 A;  4DND A;  2CEA A;  2WZI A;  2X67 A;  2NW7 A;  2XAS B;  2NTY A;  5AQO B;  3AEA A;  4PK4 A;  2H3R A;  3OJA A;  4L9I A;  1VCT A;  3LK4 2;  3Q2M A;  3RC8 A;  1T7S A;  2E5V A;  2BVL A;  2QA7 A;  3W15 B;  4QX7 B;  3PTR B;  3AEG A;  2M67 A;  3EUH A;  3RKG A;  3ONL C;  5HXC A;  2XQ7 A;  5AQL B;  2XSA A;  5FVK A;  4XBF B;  2V5D A;  3UU5 A;  3B13 A;  3O4X E;  2BS3 A;  4HWI B;  2OA5 A;  2XQ8 A;  4HFI A;  3UTK A;  4EXT A;  3H3A A;  4ZOL E;  4ZZB A;  2LKH A;  2P9B A;  1HG5 A;  4UV8 B;  2JMH A;  3AE5 A;  2OV9 A;  2E9X C;  4IDZ A;  4HFB A;  3CQX C;  2V26 A;  2IDO B;  3OBV E;  3SFE A;  2MOZ A;  2WB5 A;  2HN1 A;  4L5G A;  4UVA B;  3KV5 A;  4TWF A;  3OTO T;  2C5J A;  3N5L A;  2LKG A;  1ZKE A;  4BJN A;  3CK6 A;  3AA0 B;  4PAG A;  2WAU A;  5H6R B;  4LF5 T;  2AE9 A;  2CLY B;  5HCJ A;  2I6H A;  3PUY F;  5LBM A;  3AE4 A;  4UR9 A;  2VKJ A;  3NBX X;  2X9H A;  4JBW F;  3K3O A;  4AKI A;  5LHH B;  3MK7 C;  4DR4 T;  3E08 A;  3WAJ A;  4NPP A;  5JDQ A;  4TV9 E;  5KX5 E;  3MKD A;  4GIW A;  3ZCI A;  4QXC B;  2KWI B;  5LCY A;  2FUP A;  1O3X A;  3CIR A;  2XM1 A;  1OED B;  1XNQ T;  5FY0 A;  2UXX B;  3KDS E;  4YFS A;  2HH7 A;  2BKP A;  5LXT E;  5ABE A;  5M4Y A;  4YSY A;  3N9Q A;  2YIN A;  1X9B A;  3RC3 A;  2WWU A;  4K0K T;  4BAY B;  4EYU A;  2FJB A;  4DBQ A;  1UUS A;  3VKH A;  4LMK A;  3IHR A;  3BQL A;  3TLS A;  3F2E A;  3RYH E;  3P4Q A;  1B7T A;  4YTP A;  2UUB T;  2CA5 A;  2IUB A;  5L4H A;  2AXD S;  3Q9D A;  4C91 A;  2CLY C;  3FZH B;  2VWA A;  1T8B A;  1NEN A;  4A56 A;  3ZYL A;  2ZM6 T;  5DQV A;  3T8O A;  2XHE B;  2Y6X A;  5AQJ B;  3O1I A;  3CX8 B;  3IA3 A;  4AXP A;  5ABF B;  4EOZ B;  1WR6 A;  5HEJ A;  1HF8 A;  4PJN A;  4M1P A;  2BBH A;  3WI3 A;  2VB6 A;  3PUA A;  4P09 A;  5F3J A;  2Q9Q D;  1OXZ A;  3L09 A;  5LOV E;  2RA1 A;  5FL1 A;  3EAM A;  5LP6 E;  2XAG B;  5HAX A;  1EZ3 A;  5L3F B;  1XDO A;  3LK2 B;  3MXZ A;  4U33 A;  3E22 E;  4PJL A;  5J2T E;  3CPZ A;  4PFO A;  4GK5 E;  1QUU A;  2KIN B;  3ZN1 B;  4AKH A;  4HFH A;  1WFD A;  2YU2 A;  3RIU C;  5C2T A;  4OHF A;  1HNX T;  1MIV A;  2D5U A;  2JQH A;  3KVA A;  3GN5 B;  4PK6 A;  4PJM A;  3ZKR A;  3H37 A;  3AEC A;  1YKE B;  4YSX A;  4NUV A;  3NRX A;  3LK3 B;  4DR1 T;  4ZS2 A;  5LBQ B;  5FXV A;  2YU1 A;  1KEY A;  5H6Q B;  2WM9 A;  4DID B;  4EZH A;  5HEO A;  3PU3 A;  2JJ9 A;  3TLW A;  3IF8 B;  4KI0 F;  2UUA T;  3ZMZ B;  3JC6 D;  4DV5 T;  4P0A A;  3Q5X A;  5AQK B;  2XJ7 A;  4KMC A;  3RQW A;  3VKG A;  3A7M A;  3V5U A;  2CXF A;  2VK9 A;  1KFY A;  3AEF A;  4FJO A;  1U5P A;  2XAH B;  3ZJ1 A;  1YXR A;  1VRB A;  3ZC0 A;  1JNR A;  2K3W A;  1S35 A;  1CHU A;  3LBX A;  4AKR B;  2WDV A;  5EK4 A;  4NXM T;  2ZLY A;  1UX4 A;  2K5B B;  1ZV4 X;  5JTG A;  1N33 T;  4DR2 T;  2LM2 A;  1HFA A;  4HWD A;  1N34 T;  4EAH A;  4B3R T;  1FJG T;  2IHR 1;  2UU9 T;  4OYK A;  4P0B A;  3ZMT B;  1D0Y A;  4TV8 E;  2EHO A;  2WDR A;  4YT0 A;  4KUM B;  2K9A A;  1VCS A;  2LSY A;  2KWH A;  4OFZ A;  2FJA A;  4UVC B;  1HCI A;  2ACZ A;  3OYZ A;  4MHC A;  4TX5 A;  3OYX A;  3HR0 A;  1KNZ A;  5GON E;  1XMO T;  2KZ7 B;  5KMG P;  5HXR A;  5J2U E;  2YK0 A;  5ETW A;  2QRX A;  2N2N A;  3L3P A;  4NIQ A;  3AED A;  2IML A;  3WAK A;  4CI3 B;  4H9P C;  3NWI A;  4UV9 B;  1HG2 A;  5HEH A;  5AQS B;  5FXW A;  3MZK B;  3P4W A;  2W00 A;  3HKE E;  2L8K A;  3AA1 B;  5JRC B;  3PV0 F;  3UUB A;  3I1A A;  4X62 T;  4EZ4 A;  4X64 T;  4LF4 T;  3HKB E;  2V8S V;  4AQF C;  4HN9 A;  3RQU A;  4P1N A;  4DMV A;  2XUE A;  5HWY A;  1MNE A;  2NR4 A;  3OVU A;  5L2L A;  4AQY T;  4KHZ F;  4LF8 T;  3KBT A;  1MIY A;  2X68 A;  3VU7 H;  3FBL A;  4TNW A;  2N9D A;  3DJB A;  5TAO A;  4IDP A;  3ZT6 A;  3EDU A;  3ZN0 B;  2WZH A;  2XQA A;  3B57 A;  3RKO A;  2HN2 A;  2A9U A;  3P4S A;  3UU4 A;  4CZZ B;  3TLV A;  4Z8X A;  3ESL A;  3M3Z B;  2A3D A;  3LJC A;  2CBI A;  3PUQ A;  4MBQ A;  3HI2 A;  2NTX A;  4UF0 B;  2E9X D;  1KK7 A;  2BKN A;  5HEG A;  3MA9 A;  3UFE A;  1LRZ A;  3GA8 A;  3ZJ2 A;  2CE7 A;  4ANJ A;  3FB2 A;  2V6Y B;  4N78 D;  1UK5 A;  5AQQ B;  5FXX A;  5JH7 E;  5JR9 A;  4U2Y A;  2WBL A;  5LHG B;  3U78 A;  5CA0 E;  4JI8 T;  3C4Z A;  4ILA A;  4U74 A;  2QVA A;  4JYA T;  1AJ3 A;  1UUR A;  1LVK A;  4DV7 T;  4YSZ A;  3E0Z A;  1MMN A;  1XNR T;  3AE1 A;  4LFA T;  2DL1 A;  2E2A A;  4O4I E;  4H9Q C;  4V1A v;  3AE8 A;  3FZF B;  1L0V A;  2XQ9 A;  2W67 A;  3EI0 A;  3FZL B;  3CQG B;  2KMF A;  2YDQ A; 
#chains in the Genus database with same CATH homology
 1YW0 A;  2MBG A;  3K3Q C;  4ZI3 C;  3DTO A;  2CLY C;  4AQG A;  2X9Y A;  2VWA A;  3K8P C;  3AB3 B;  2SPC A;  4E7S A;  4BJM A;  3ZYM A;  4A56 A;  3ZYL A;  5DQV A;  5LHI B;  4ZS3 A;  5IYZ E;  4I50 E;  2JPF A;  2NWB A;  2BVM A;  3T8O A;  3KV4 A;  2ODV A;  1SHZ C;  2DNX A;  1G8X A;  4CI1 B;  3P8C D;  2XHE B;  2Y6X A;  3O9X A;  4X1I E;  3F57 A;  3O1I A;  4CI2 B;  5CA1 E;  3CX8 B;  3S4U A;  4AXP A;  4EOZ B;  1WR6 A;  1HF8 A;  4PJN A;  5E0O A;  1WYC A;  2A2F X;  4ERR A;  2V7J A;  5ADX L;  4M1P A;  2C5I T;  2JRK A;  3WI3 A;  3BQK A;  2DI4 A;  3J9X 1;  2VB6 A;  1IJ5 A;  1MMA A;  1X79 A;  4ZI2 D;  5JDH A;  3CKD A;  4I4T E;  3PUA A;  4WW0 A;  2D2S A;  4P09 A;  5F3J A;  4I55 E;  4QHO A;  2Q9Q D;  4QX8 B;  2D0U A;  5LYJ E;  3U3I A;  3KV9 A;  1OXZ A;  4H63 H;  2DWK A;  4UXN B;  3RYC E;  3L09 A;  5LOV E;  4IE0 A;  5EK2 A;  2RA1 A;  3KV6 A;  4O4L E;  2DLR A;  4PW8 A;  5J1G A;  3FBZ A;  3UUX B;  5LP6 E;  3PUR A;  2XAG B;  3SOL A;  5BMV E;  4UEL A;  3JC6 C;  2W0G A;  4O4J E;  4JEU B;  1US7 B;  5HAX A;  1EZ3 A;  3IBP A;  3DP7 A;  5L3F B;  5DAB A;  2ZM2 A;  4IE5 A;  2Y48 B;  4GYR A;  1UCU A;  1SA0 E;  3LK2 B;  5C8Y E;  1MIW A;  3MXZ A;  3E22 E;  4TUY E;  2KXP B;  4PJL A;  3AAI A;  5J2T E;  2Q9Q A;  2K48 A;  3CPZ A;  2XTL A;  5JDL A;  2XQY A;  3HKD E;  2LSJ A;  4PFO A;  2WSS V;  4GK5 E;  3KFW X;  1QUU A;  2KIN B;  3ZN1 B;  3C64 A;  4AKH A;  3HKC E;  3AAE B;  4GOU A;  3R6N A;  3P7I A;  4AKL A;  4EIW A;  4WBO A;  3ZPO A;  2CMR A;  2PG8 A;  4DO0 A;  3A5X A;  5JRC A;  1BR1 A;  3MAC A;  3ZMV B;  5HYA A;  1YD8 G;  3PU8 A;  2YU2 A;  3ZLI A;  4H9O C;  4ZI3 D;  4ILU A;  2WMO A;  5DQW A;  3V5S A;  5LGN B;  3LBX B;  4O2B E;  4JUY A;  4OHF A;  2XAJ B;  3I0Q A;  4QKN A;  4QXB B;  1HX8 A;  3HA4 A;  4YJ2 E;  1MIV A;  2CCQ A;  1HTJ F;  5L3E B;  4TZ4 C;  2D5U A;  5JQG E;  3I0O A;  1H7C A;  3AA6 B;  3AVR A;  2EHO C;  2IAK A;  4KBM B;  1BR0 A;  1Z0P A;  3KVA A;  4QWN B;  3CWZ B;  3GN5 B;  4H9R C;  4PK6 A;  4PJM A;  4ADZ A;  3N9O A;  1NAF A;  3RH3 A;  3H37 A;  4MFR A;  4IE7 A;  1YKE B;  3HL6 A;  2E8I A;  4NUV A;  3NRX A;  3C50 A;  3LK3 B;  4ZS2 A;  2LOS A;  5LBQ B;  2EHO B;  3UUM A;  3OKQ A;  5FXV A;  2YU1 A;  4HFV A;  1FIO A;  2H7O A;  2CWO A;  4IIJ E;  5H6Q B;  5AFU L;  2WM9 A;  1VOM A;  3VHL A;  2NW8 A;  3N9P A;  4EZH A;  4JLE A;  3CX7 B;  3UT5 E;  1D0Z A;  3PU3 A;  3ANW A;  2HPL A;  3UUN A;  2LEH A;  2V7K A;  2JJ9 A;  3CQC B;  2W61 A;  3IF8 B;  5L3D B;  4IHJ E;  4TN7 B;  3ZMZ B;  3RRC A;  3JC6 D;  2CXL A;  5LGU B;  3IEE A;  2BZB A;  1UX5 A;  2CXD A;  3KVB A;  5DJQ C;  4OYJ A;  3GMI A;  4P0A A;  3Q5X A;  3NZQ A;  2W62 A;  4KMC A;  2WMN A;  2PJQ A;  2PFV A;  4C90 A;  2KLQ A;  4UEM A;  4H9S E;  4AKG A;  3VKG A;  5A1L A;  4E7Z A;  3FHN A;  3V5U A;  2BDE A;  2CXF A;  4UF0 A;  2VK9 A;  4WBN E;  2MTQ A;  5JR9 B;  4FJO A;  4HE8 A;  2V1D B;  2E9X B;  3N9M A;  3UUL A;  1U5P A;  2XAH B;  3ZJ1 A;  5LA6 E;  5L3G B;  2X9X A;  2Y8D A;  2KND A;  5LG4 A;  3ETU A;  2ZM8 A;  4BA9 A;  1VRB A;  3ZC0 A;  1E1H B;  2LHR A;  3CX6 B;  1V9D A;  2CWY A;  1S35 A;  2LM9 A;  1CUN A;  5LGT B;  3LBX A;  2LE8 A;  3F31 A;  3I9W A;  4AKR B;  4HTE A;  5EK4 A;  1T98 A;  2ZLY A;  1UX4 A;  4GK0 E;  2EHO D;  5JRE A;  1LVF A;  4ASK A;  2LOP A;  2K5B B;  2C0S A;  4DBR A;  1IZN B;  2IC6 A;  1ZV4 X;  2DHR A;  3PUG A;  2VL8 A;  2VAS A;  2LT3 A;  3PDY A;  5L3C B;  3RPU A;  5HXS A;  4I43 B;  3GN5 A;  4DND A;  1NWM X;  2CEA A;  2RP4 A;  2DWG A;  4IE6 A;  1WLX A;  1HFA A;  2NOX A;  3O1J A;  2X67 A;  2I59 A;  4EAH A;  2NW7 A;  2JMK A;  2NTY A;  2XAS B;  3N9N A;  4PK4 A;  2H3R A;  3OJA A;  3N2K E;  3KIN B;  4OYK A;  4P0B A;  2A72 A;  4L0R A;  3ZMT B;  1D0Y A;  4TV8 E;  4L9I A;  1WRD A;  2EHO A;  3LK4 2;  3Q2M A;  3RC8 A;  2BVL A;  3C98 B;  4PNI A;  2VKD A;  2QA7 A;  3W15 B;  4PJJ A;  4KUM B;  4QX7 B;  3AA7 B;  3ZEF B;  2K9A A;  3PUS A;  3PTR B;  2LSY A;  2M67 A;  3LFM A;  2KWH A;  2X51 A;  4OFZ A;  2PBI A;  5FYM A;  3EUH A;  4CXW A;  5F8P A;  4UVC B;  1HCI A;  5HXC A;  3OYZ A;  1D1C A;  4MHC A;  5LJN A;  1MND A;  5JDF A;  2Z6E A;  4G2A A;  4K0U A;  3ZC1 A;  2LJL A;  1FMV A;  4H9N C;  4TX5 A;  3NRY A;  2VKH A;  3OYX A;  4X1K E;  4XBF B;  3B13 A;  4O2A E;  3HR0 A;  1KNZ A;  3O4X E;  5GON E;  1G73 A;  3AAA B;  2KZ7 B;  2V7M A;  5KMG P;  4OK0 A;  2LSI A;  4ZHQ E;  2N1G A;  1FMW A;  5HXR A;  2OA5 A;  3ZYK A;  4FI5 A;  5J2U E;  3C51 A;  1Y64 B;  2YK0 A;  5ETW A;  3UTK A;  4EXT A;  3FXE B;  3H3A A;  4ZOL E;  2N2N A;  2MYS A;  3L3P A;  2X9W A;  3C4X A;  5JVD E;  3SS1 A;  2C5K T;  2P9B A;  3D0T A;  4J2C A;  1D0X A;  3N2G E;  1HG5 A;  2J1D G;  4IGU A;  3WAK A;  4CI3 B;  4H9P C;  4UV9 B;  4UV8 B;  3KBU A;  5FP3 A;  3ETV A;  2JMH A;  2Q9Q B;  2QGS A;  5JR9 C;  1HG2 A;  2X0L B;  5FNV E;  2E9X C;  4H63 V;  3RYF E;  4IDZ A;  2H7V C;  4CXX A;  5FXW A;  2ZMA A;  3CQX C;  3MZK B;  3QK6 A;  2V26 A;  3OBV E;  2W00 A;  1HS7 A;  3HKE E;  4X20 E;  2L8K A;  3AA1 B;  3N2O A;  5JRC B;  2MOZ A;  2JQQ A;  3I1A A;  2DCF A;  4EZ4 A;  4L5G A;  3TKL B;  1IJ6 A;  2X66 A;  4O8S A;  3HKB E;  1FEW A;  5CB4 E;  3Q5W A;  4AQF C;  4HN9 A;  3FXD B;  3LG7 A;  4UVA B;  2LHN A;  1ZEE A;  2ES0 A;  3KV5 A;  4YJ3 E;  4CXY A;  4DMV A;  1MMD A;  5JDN A;  2XUE A;  2IC9 A;  2K24 A;  5HWY A;  1YKH B;  2D0T A;  2C5J A;  3N5L A;  4MAL A;  4G63 A;  3GWH A;  2XAF B;  3K3N A;  1ZKE A;  3ZMU B;  1MNE A;  4BJN A;  4DMW A;  3AA0 B;  4PAG A;  4EYY R;  2WAU A;  5H6R B;  2CM0 A;  5L2L A;  5JDG A;  2CLY B;  3SWH A;  3KBT A;  1MIY A;  1U4Q A;  1D1A A;  3BQI A;  5EZY E;  3EVY A;  5LBM A;  2V7L A;  2X68 A;  3M65 A;  3VU7 H;  3QC9 A;  3FBL A;  5EK3 A;  2VKJ A;  2N9D A;  5HXH A;  3DJB A;  3NBX X;  5TAO A;  3C4W A;  3QUJ A;  2X9H A;  4IE4 A;  1S94 A;  3EDU A;  4XAX B;  3K3O A;  4UVB B;  3ZN0 B;  4AKI A;  4PK5 A;  1D1B A;  3B57 A;  3MK7 C;  2B1E A;  3E08 A;  3NZP A;  4MLK A;  3RKO A;  5LHH B;  3ANW B;  3WAJ A;  4EB6 E;  3CVR A;  5JDQ A;  4TV9 E;  5HWX A;  4CZZ B;  5KX5 E;  2VKO A;  3MKD A;  4GIW A;  3ZCI A;  1BR2 A;  4HEA A;  4QXC B;  2LSG A;  4QXH B;  5FXZ A;  1WYB A;  2KWI B;  5LCY A;  2XAQ B;  4Z8X A;  3ESL A;  2A3D A;  4U72 A;  4WNK A;  4AI6 A;  5LNK A;  1O3X A;  3LJC A;  3PUQ A;  4NUU A;  5JDM A;  4MBQ A;  3HI2 A;  2NTX A;  2KT9 A;  4YHJ A;  2NW9 A;  4CQI A;  5FY0 A;  3ZMS B;  1MMG A;  2HPJ A;  1ZHC A;  4UF0 B;  2E9X D;  1KK7 A;  2UXX B;  3PE0 A;  3KDS E;  3RRW A;  2YEV C;  3MJX A;  3J7Y q;  3MA9 A;  2HH7 A;  4YFS A;  3UFE A;  1LRZ A;  5FMN A;  5LXT E;  3GA8 A;  3ZJ2 A;  2V7I A;  4KP3 C;  5M4Y A;  4YLH A;  2CE7 A;  3N9L A;  3AVS A;  4ANJ A;  4JEH B;  3FB2 A;  4GYS A;  3N9Q A;  5FY7 A;  2YIN A;  3R84 B;  4ZI2 C;  2IW5 B;  3RC3 A;  2LSK A;  2UXN B;  4F6R C;  2WWU A;  4N78 D;  5IHY A;  4BAY B;  3I9Y A;  2Q9Q C;  4EYU A;  5FXX A;  5JH7 E;  5LJM A;  5JR9 A;  2WBL A;  3CML A;  5LHG B;  2E9X A;  4DBQ A;  3U78 A;  5CA0 E;  5KDM C;  1LKX A;  3C4Z A;  4X1Y E;  4U74 A;  4B6X A;  2G0U A;  3O1H A;  1AJ3 A;  1BR4 A;  3EDV A;  3ZCJ A;  1QSD A;  1LVK A;  2L3L A;  4O4H E;  2W63 A;  3VKH A;  5HXE A;  1OWA A;  2ZM0 A;  4ISS A;  4DVD A;  3E0Z A;  4UIG A;  3RX6 A;  3SRZ A;  1MMN A;  3IHR A;  3BQL A;  2ACX A;  2NP9 A;  3ONX A;  3RYI E;  4XZC A;  4AQF A;  5L3B B;  3F2E A;  4O4I E;  4HGA A;  4IST A;  4ZI7 E;  3RYH E;  4H9Q C;  4V1A v;  1B7T A;  2ODU A;  2L9Q A;  2CA5 A;  4HKA A;  3BK9 A;  1IAP A;  3CQG B;  2KMF A;  2GK9 A;  3Q9D A;  4PFP A;  5FY1 A;  4C91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...