1YKHB

Structure of the mediator med7/med21 (med7/srb7) subcomplex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
114
Chain Sequence
TDRMTQLQICLDQMTEQFCATLNYIDKNHGFEVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLMRHVDSMIEDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords RNA polymerase II mediator complex protein MED7
total genus 46
structure length 114
sequence length 129
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykhB00
1YKHB 1YKEB
chains in the Genus database with same CATH superfamily
3E22E 2JMHA 3PUZF 5HXSA 4PJJA 1XNQT 4DV2T 3PUGA 3PUAA 5DABA 4AQYT 1FIOA 2IMLA 2J1DG 2W63A 4N78D 1HFAA 3O4XE 1ZHCA 3CQCB 4O2AE 5ABFA 2YKSA 4WZXA 1N36T 3UUMA 2LM2A 4U7IA 1JNRA 3A5XA 4TWHA 1HF8A 2W61A 1HCIA 4WNKA 2BG9A 4AQGA 4DIDB 4HFDA 4E7SA 5J2TE 2CWYA 4LFBT 2MAWA 1J1JA 4JV5T 2CPTA 1HNWT 5L3CB 4DNDA 2JQHA 2XQ4A 5CA1E 3C51A 1SUMB 3KINB 1KEYA 2LOSA 1BR4A 3CK6A 3ZT7A 4AKRB 2Q9QA 3FB2A 4EIWA 1HR0T 3P4RA 2YK0A 3AA0B 4HN9A 2I0MA 3J9X1 3ZMSB 2CRBA 4JI6T 4FJOA 2V1DB 5F8PA 3HKEE 2K3WA 4EGWA 4DUZT 4ADZA 4QH4A 1D0ZA 2B1EA 4IE6A 2H7VC 2LM9A 3I1AA 5JDMA 4MALA 3CX8B 2UU9T 2CCQA 3OYXA 3PUSA 2HPLA 2IAKA 2LEHA 3LK3B 4TNVA 4QH5A 3ZN1B 1T72A 4CXWA 2JMKA 1KK7A 2D0UA 5ETWA 1KNPA 3WI3A 4U72A 4QWNB 4K0KT 3PURA 2KNDA 2LOPA 3FZKB 1IAPA 2LSGA 3ONXA 4KHZF 4U33A 1L0VA 3LDQB 5HXCA 3PJAJ 3S4UA 4H63V 1R8IA 2C5JA 3TLWA 1VCSA 4KX6A 4DVDA 3ANWA 5FL1A 4ZI3C 3FBLA 5L3GB 2E8IA 2H7OA 2X66A 3ZJ1A 2BG9E 2E9XD 4UV8B 2ACXA 3HKBE 4O4LE 3AVSA 4U31A 2N2NA 3I0OA 3ZYMA 1QSDA 4AISA 2V7MA 1IZNB 3JADA 5J2UE 1KF6A 2XPKA 4HWDA 4XAXB 2XHEB 3NRXA 3CPZA 2Q9QD 3RQWA 3UU3A 1KFYA 2OLTA 3PTRB 4NPPA 2X0LB 4AXPA 2F4VT 4H9OC 2ZM2A 2H88A 2Q9QC 3TLSA 2JPFA 2NR4A 1D1AA 1XMOT 2IHR1 2VKJA 4HEAA 5AQSB 5L3BB 2BVMA 3AEDA 3C50A 4JI8T 2WWUA 2QGSA 4YY3T 3LFMA 4DV1T 3NZQA 3ZN0B 5LB7B 4CI1B 2WBLA 5DQVA 5JDFA 3KDSE 5F5WA 4IHJE 5CB4E 5ABFB 1OWAA 2WZIA 3AEBA 2IDOB 3HA4A 2V5CA 3AE3A 5JRCB 1IJ5A 4YJ2E 2MBGA 2HN2A 2V7LA 1QLBA 5L47A 3RYFE 4IL4A 2CEAA 5H6QB 4DR5T 3ZYLA 2A3DA 2NW7A 3ZMTB 5JDHA 4IGUA 3BQLA 3NBXX 2XQAA 4Q25A 4ZOLE 4EYYR 4ISSA 3P4SA 3C98B 4YTMA 3I9YA 2W67A 3RRCA 4BJNA 4GKJT 5JH7E 3RIUA 1MMAA 1MNDA 1DU2A 5HCJA 1IBMT 4JI7T 4UVBB 2QYWA 2I59A 2K5BB 1N34T 1J5WA 2IIUA 5E0OA 2XY8B 2LKGA 5AQVB 1S94A 1UK5A 3UU6A 4I55E 3IEEA 4DO0A 4XBFB 3F57A 4ZI2C 4O4IE 3JAFA 2KXPB 4CN6A 3P7IA 4OK0A 2VURA 2PBIA 3AE7A 5FY1A 3N9NA 4UF0A 3VHLA 1XMQT 2DL1A 3ZSSA 2RP4A 3SS1A 3FZMB 3KV5A 4EZHA 2YOEA 3Q5EA 4X20E 1KNZA 5FXXA 3QK6A 5HXHA 3QUJA 2X9HA 4LF8T 1UURA 2AE9A 4EXTA 4EAHA 2NP9A 4HFVA 4TUYE 3K3QC 4G2AA 1HX8A 2ES0A 4JUYA 4LF9T 4LMJA 3ZYKA 3J7Yq 5H6RB 4ASKA 2BG9C 2J4GA 2YDSA 4H9RC 2XASB 4JI5T 2JQKA 2FBWA 5FMNA 3VRAA 4EYUA 4ZEYA 4O4HE 2CM0A 3MKDA 4CQIA 1WLXA 2J62A 3C4XA 4YLHA 4CN4A 2NOXA 1HNZT 4WW0A 3MJXA 2BKPA 2WAUA 4HKAA 1FJGT 3OTOT 4U3CA 1D1BA 2LE8A 2LSIA 3RRWA 4DUYT 4JI4T 3MXZA 1D0XA 2RPAA 1E1HB 1SA0E 2K24A 3LK2B 4HWIB 4DMVA 1N32T 3WAKA 3AA1B 1B7TA 2QA7A 1BR1A 3AE6A 3UTKA 3VR9A 4COFA 1J5ET 4B3TT 2V26A 2M6BA 1EZ3A 2DWKA 4L0RA 4LF5T 1Y01A 3AECA 4PW8A 4ZZBA 4P0BA 2CLYC 5AQOB 3H37A 3K1SA 4P09A 1G73A 1MMGA 2CXDA 2XAJB 3PUWF 2BKNA 3AEAA 1ZP0A 4Z91A 4CI3B 4MLKA 2XAQB 3O1IA 3B13A 2C0SA 2LRKA 2XQ5A 3NKZA 4NUVA 2BS3A 3AEEA 3AXJB 2NWBA 3O1HA 4OFZA 5HEGA 5CGMA 2WCAA 1Y64B 1WYBA 3CX6B 3PJAA 4G63A 4A56A 5LG3A 4KHPT 1CHUA 2K48A 3IA3A 2L8KA 4L9IA 4JLEA 5FY7A 3QB5K 5AQLB 3RIAA 3F31A 4X1KE 4L5GA 4U74A 5IYZE 2P9BA 1YQ4A 1SE7A 3N2KE 5FXVA 2X0YA 4A5XA 1HTJF 5L2LA 5IWAT 3ZCJA 5AQJB 3RLFF 3RYIE 5LGUB 2ZM0A 2JQ9A 2CE7A 4PK5A 2BBJA 2XJ7A 4GYSA 5LOVE 3UQ7A 3N2OA 2LT3A 3PE0A 1M7KA 2ODVA 2V6YA 3Q5WA 4WBOA 3RHWA 4H9PC 3ZCIA 4ZHQE 4EZ4A 2IC9A 1MMDA 3DP7A 5AQRB 4ILUA 5HEHA 4C90A 5LGTB 3P4QA 4NXMT 4TNWA 4HE8A 5AQPB 3RQUA 3N9QA 3NZPA 2FJEA 3N5LA 2UUCT 4YSZA 4TWFA 1ZOYA 3AA6B 3PDYA 3RH3A 2WWVA 3MK7C 1N33T 3RPUA 3LBXA 3ZLIA 2AXDS 3H3MA 2WY2A 2JIWA 5EK3A 2LJLA 3Q5DA 5HEUA 3ZC0A 4AIUA 1NENA 2X51A 5L3FB 4JI2T 1U5PA 2KZ7B 2VL8A 4IDNA 3D0TA 1T98A 4X1YE 3T8OA 4ZI2D 3E08A 4KBMB 4CZZB 1SHZC 2WU5A 3X1DA 3CX7B 1U4QA 1XWMA 4M1PA 5FKYA 1IBLT 2R6GF 4DR7T 3P4PA 5AQMB 2CXLA 2CBJA 3AE4A 3EUHA 3Q5XA 4UV9B 5AQKB 4O4JE 3AAIA 3N9LA 4IE4A 1XDPA 1GQEA 2PTFA 3PU3A 3VU7H 4EB6E 4B3MT 3VKGA 3EABA 5FVLA 4MFRA 5KXJA 2RA1A 5EK4A 5HEOA 5IHYA 5KDMC 2DWGA 1X79A 2UUAT 1W09A 2WP9A 3N2GE 4JEHB 4KMCA 2V6XA 2NTYA 1T7SA 1W9RA 2WDQA 1FEWA 3RYCE 4YFSA 4OHFA 5AQTB 3ANWB 4GYRA 4QXBB 3LK42 2QRXA 3AXJA 4IT4A 1MIWA 4HWHA 3AE1A 4JEUB 1HNXT 4X64T 3M3ZB 1S35A 4Z8XA 5HWXA 3IHRA 3GN5A 2SPCA 2UXNB 2EHOD 4H9NC 4CN1A 4AQFC 4ZI7E 4NIQA 3TLVA 3N9MA 2V5DA 4LMLA 4V1Av 5LA6E 3BQKA 2WS3A 2YINA 4ZS3A 3ZMVB 5BMVE 4HFIA 2XM2A 3TLUA 4LFCT 5TAOA 2LRLA 5JQGE 3U3IA 4GK5E 5AQGB 4QX8B 3RC8A 2BVLA 2KWHA 4YHJA 3RIUC 5J1GA 2XAFB 2IW5B 2MYSA 2E5VA 1LVFA 2E9XB 3HI2A 2WU2A 2XSAA 3KV4A 4B6XA 5C2TA 3VKHA 2Y48B 3UULA 4WBNE 4BJMA 1US7B 3B5MA 3EDUA 2IUBA 5JDGA 5ABHA 5KX5E 2MPKA 3OVUA 2CLYB 3PUVF 4CXYA 2N1GA 2XQ8A 2HH7A 4U7YA 2JJ9A 3ETVA 4ZI3D 4OX9T 3UU4A 3TLTA 2UXBT 1CUNA 2XQ6A 4LMKA 1OEDC 3K3OA 4QXCB 5JDQA 5AFUL 2BDEA 2CMRA 3C4ZA 5L4HA 3C4WA 4EEDA 5AQFB 4JYAT 4IE7A 3P4WA 3ZMZB 4DBRA 3T1YT 3AE5A 4YXDA 2YDQA 1I6ZA 3AAEB 2H3RA 2X9WA 3BK9A 2A9UA 4UF0B 2E9XA 2C5KT 2EHOA 1YKEB 4EEBA 1KNRA 3VRBA 4LFAT 4IL9A 5LHGB 4X1IE 3C64A 1UX4A 2XQ3A 5LBMA 2VL0A 3HKDE 2NTXA 3P50A 4P1NA 3UUXB 5LMNT 1LKXA 1YXRA 3AB3B 3OJAA 3SFEA 3RGLA 1ZKEA 1NAFA 2BG9B 3UFEA 1LVKA 2FUPA 3M65A 1MMNA 1V9DA 2UXXB 3PV0F 3H3AA 1NWMX 4IREA 3GMIA 5LYJE 2Y6XA 3L39A 2FJDA 1XNRT 2CHNA 1YKHB 3O1JA 4YSYA 3PUXF 3SOLA 2D9DA 4YTPA 4PJNA 2VVSA 4HFBA 2DCFA 3QOFA 3G06A 3FXDB 4AQFA 5DQWA 2XQ9A 3OPCA 4GK0E 3UFGA 1O3XA 5LP6E 3E0ZA 2XTLA 4ZXLA 3WAJA 2GK9A 2IC6A 2CHOA 4NUUA 2M6IA 3UQ4A 2CA5A 3FZLB 5L3EB 3FZHB 4HWFA 2VQFT 4QXHB 2D2SA 4DBQA 1OEDB 3HL6A 4IDZA 4QHOA 5HXRA 3O9XA 4FI5A 2BBHA 3UT5E 2E2AA 2VASA 2VKDA 3LJCA 4PK4A 4TWDA 4UXNB 2V6YB 1D0YA 3EDVA 3RKOA 3SFDA 3VR8A 4WYVA 3LBXB 3I9WA 3L3PA 4X65T 2EHOC 3B57A 3N9PA 3ABVA 1X9BA 2E9XC 3KV9A 2PJQA 4I50E 1WFDA 1ZV4X 5ADXL 3RC3A 5IUXA 2E5LT 4QX7B 1VCTA 1HG2A 1WR6A 2I6HA 4A97A 4ILCA 4ANJA 2WM9A 2X68A 2X9YA 2LSKA 4DV4T 2DLRA 1FMWA 3Q9DA 4TV9E 1OEDA 3RKGA 5LHIB 4PFOA 3EHZA 3JAEA 4A98A 4JI3T 5AQUB 2KSRA 2A72A 2CXFA 3OYZA 1IJ6A 5LBQB 4HFCA 3FXEB 3PU8A 4I0UA 3BQIA 4KI0F 5FL0A 5L4EA 3RF1A 3EI0A 2WDVA 3N9OA 3L8RA 5FXZA 3JC6D 3NRYA 4IE0A 1T8BA 3RYHE 3R6NA 3W15B 3PUQA 2HN1A 2WMNA 4GOUA 3UU8A 4U2YA 1MIYA 4ILAA 2YU2A 3ZKRA 3ETUA 5HCMA 4YSXA 2VQET 2MTQA 1HS7A 2VB6A 3U78A 2KT9A 2XSBA 1UUSA 4XZCA 3UUNA 1IBKT 3FBZA 5EK2A 5JR9B 4P0AA 3CWZB 2Q9QB 2G0UA 4AKLA 4OYKA 3V5UA 2XQYA 4JI0T 1H7CA 4HWCA 2L9QA 3ZPOA 5ABEA 2UXDT 5FVKA 1HG5A 1VOMA 2Y8DA 5AQNB 2WMOA 4B3RT 5HAXA 4MBQA 3GA8A 2FJAA 5LG4A 2PFVA 2XUEA 2X67A 2UUBT 5AQQB 4H63H 5AQIB 3QNUA 3CQGB 3GN5B 3JCFA 1XZYA 2KMFA 2W62A 4HGAA 4IDQA 4JBWF 1UGOA 2OA5A 2YN6A 5FXWA 1MIVA 1I94T 4LF6T 2DNXA 2LHRA 3LG7A 4ILBA 5ABGA 2KWIB 3GWHA 2W0GA 2YU1A 5DJQC 2B76A 5GONE 5LMUT 1OXZA 4PFPA 4YHHT 3TKLB 5FNVE 4UVAB 3KFWX 5JTGA 1XDOA 4AKIA 2C5IT 1M62A 3ZJ2A 3ZMUB 2VWAA 4E7ZA 2V7IA 5HWYA 4AKHA 3T1HT 2W4XA 4ERRA 5BR8T 2W00A 4X66T 2LKHA 3AE2A 4IE5A 3AAAB 3AE8A 4IDPA 3PUYF 4O8SA 4PNIA 4DR1T 2DI4A 2XZEA 2NW8A 4PJMA 4PK6A 4NXNT 3EVYA 2OV9A 5FP3A 3RX6A 3AVRA 5M4YA 3UUBA 4EV6A 3ONLC 2YEVC 4QKNA 4O2BE 1E7PA 3IF8B 4DV6T 4DR3T 3MZKB 1YD8G 4GKKT 5KMGP 3ESLA 4QH1A 2PG8A 5JDLA 2VKHA 3ZEFB 3ZSTA 4AKGA 4TN7B 3V5SA 2H89A 2ZM8A 4UR9A 5JR9C 5CA0E 3K3NA 2FJBA 2QVAA 2VKOA 3ONJA 3QB5A 2D0TA 1WCRA 4CI2B 1G8XA 2LSJA 2X9XA 5EZYE 4I43B 4U2ZA 1BR2A 2LSYA 2WZHA 1W0AA 4UEMA 2KINB 3AEFA 1HX1B 3CVRA 5JR9A 2JQQA 5JVDE 4HFHA 2BS4A 4YJ3E 2CBIA 2WDRA 1W0BA 3DTOA 2A2FX 5FY0A 4C91A 3R84B 3FHNA 4F6RC 3SWHA 4B3ST 2KLQA 4DV7T 4DV0T 1FMVA 3ZC1A 2JRKA 4H9SE 4DV3T 3RI5A 5HXEA 4JI1T 3KVBA 4BAYB 4K0UA 2K9AA 4UIGA 4AI6A 4ZZCA 2X0HA 2WSSV 3AA7B 4I4TE 1D1CA 4GIWA 2ZM6T 4DV5T 2EHOB 4TX5A 2LLYA 4YT0A 3EAMA 4UELA 4X5TA 2M67A 5LNKA 1BR0A 5CJ5A 2V7JA 5FYMA 1Z0PA 3AEGA 5LGNB 3CKDA 3KV6A 1WRDA 2NW9A 5JREA 4IDOA 3FZFB 5CFBA 2DHRA 2ZMAA 3LSVA 5JDNA 2W66A 2HHHT 3KVAA 4PJLA 2J47A 2MOZA 4ISTA 4EOZB 2L3LA 1NEKA 5HYAA 3RIFA 1AJ3A 2XAGB 4LF7T 2D5UA 3NVOA 1JNZA 4TZ4C 4BA9A 2BS2A 2XQ7A 3IBPA 5LXTE 5JRCA 2VK9A 1MNEA 3HKCE 1UCUA 3KBTA 3ZT5A 5LHHB 2V7KA 3P8CD 3KBUA 2UXCT 3JC6C 2ACZA 3UU5A 4IIJE 2ZLYA 2V8SV 5C8YE 2WQYA 4TV8E 1VRBA 4KP3C 5LCYA 1YW0A 1Z8UA 5HEJA 3A8YC 2N9DA 1UX5A 5C3JA 4MHCA 3AE9A 5AQHB 5LJMA 3QC9A 2LHNA 4KUMB 4PAGA 2BZBA 3CQXC 1QUUA 1WYCA 4LF4T 3NWIA 5J0ZA 4X62T 5L3DB 2HPJA 3F2EA 3I0QA 3OBVE 3L09A 4DR4T 4CXXA 4DMWA 3ZT6A 2BKOA 4J2CA 2Z6EA 4UVCB 2W2UA 1OEDE 3CMLA 3CIRA 4HTEA 3K8PC 4YTNA 2XAHB 3Q2MA 2XM1A 5A1LA 2WB5A 2ODUA 4H9QC 1WR0A 4HFEA 2CWOA 1YQ3A 2VVNA 3HR0A 2YDRA 4Z90A 3OKQA 4DR6T 3MACA 4OYJA 3MA9A 3DJBA 1LRZA 3A7MA 4F8HA 5F3JA 3SRZA 4ZS2A 5LJNA 1ZEEA 1E2AA 4DR2T
chains in the Genus database with same CATH topology
3E22E 2JMHA 5HXSA 4PJJA 3PUGA 3PUAA 5DABA 1FIOA 2J1DG 2W63A 4N78D 3RYFE 1HFAA 3O4XE 1ZHCA 3CQCB 4O2AE 3UUMA 3A5XA 1HF8A 2W61A 1HCIA 4WNKA 4AQGA 5J2TE 4E7SA 2CWYA 5L3CB 4DNDA 5CA1E 3C51A 3KINB 2LOSA 1BR4A 4AKRB 2Q9QA 3FB2A 4EIWA 2YK0A 3AA0B 4HN9A 3J9X1 3ZMSB 4FJOA 2V1DB 5F8PA 3HKEE 4ADZA 1D0ZA 2B1EA 4IE6A 2H7VC 2LM9A 3I1AA 5JDMA 4MALA 3CX8B 2CCQA 3OYXA 3PUSA 2HPLA 2IAKA 2LEHA 3LK3B 3ZN1B 4CXWA 2JMKA 1KK7A 2D0UA 5ETWA 3WI3A 4U72A 4QWNB 3PURA 2KNDA 2LOPA 1IAPA 2LSGA 3ONXA 3S4UA 5HXCA 4H63V 2C5JA 4DVDA 5L3GB 3ANWA 4ZI3C 3FBLA 2E8IA 2H7OA 2X66A 3ZJ1A 2E9XD 3ZYMA 4UV8B 2ACXA 3HKBE 4O4LE 3AVSA 2N2NA 3I0OA 1QSDA 2V7MA 1IZNB 5J2UE 4XAXB 2XHEB 3NRXA 3CPZA 2Q9QD 5HYAA 3PTRB 4AXPA 2X0LB 4H9OC 2ZM2A 2Q9QC 2JPFA 1D1AA 2VKJA 4HEAA 5L3BB 2BVMA 3C50A 2WWUA 2QGSA 3LFMA 3NZQA 3ZN0B 4CI1B 2WBLA 5DQVA 5JDFA 3KDSE 4IHJE 5CB4E 1OWAA 3HA4A 5JRCB 1IJ5A 4YJ2E 2MBGA 2V7LA 5H6QB 2CEAA 3ZYLA 2A3DA 2NW7A 3ZMTB 5JDHA 4IGUA 3BQLA 3NBXX 4ZOLE 4EYYR 4ISSA 3C98B 4BJNA 3I9YA 3RRCA 5JH7E 1MMAA 1MNDA 4UVBB 2I59A 2K5BB 5E0OA 4XBFB 1S94A 4I55E 3IEEA 4DO0A 3F57A 4ZI2C 4O4IE 2KXPB 3P7IA 4OK0A 2PBIA 5FY1A 3N9NA 4UF0A 3VHLA 2RP4A 3SS1A 3KV5A 4EZHA 4X20E 1KNZA 5FXXA 3QK6A 5HXHA 3QUJA 2X9HA 4EXTA 4EAHA 2NP9A 4HFVA 4TUYE 3K3QC 4G2AA 1HX8A 2ES0A 4JUYA 3ZYKA 3J7Yq 5H6RB 4ASKA 4H9RC 2XASB 5FMNA 4EYUA 4O4HE 2CM0A 3MKDA 4CQIA 1WLXA 3C4XA 4YLHA 2NOXA 4WW0A 3MJXA 2WAUA 4HKAA 1D1BA 2LE8A 2LSIA 3RRWA 3MXZA 1D0XA 1E1HB 1SA0E 2K24A 3LK2B 4DMVA 3WAKA 3AA1B 1B7TA 2QA7A 1BR1A 3UTKA 2V26A 1EZ3A 2DWKA 4L0RA 4PW8A 4P0BA 2CLYC 3H37A 4P09A 1G73A 1MMGA 2CXDA 2XAJB 4CI3B 4MLKA 2XAQB 3O1IA 3B13A 2C0SA 4NUVA 3O1HA 2NWBA 4OFZA 4A56A 1Y64B 1WYBA 3CX6B 4G63A 4L9IA 2K48A 5ADXL 2L8KA 5FY7A 4JLEA 3F31A 4X1KE 4L5GA 4U74A 5IYZE 2P9BA 3N2KE 5FXVA 1HTJF 5L2LA 3ZCJA 3RYIE 5LGUB 2ZM0A 2CE7A 4PK5A 5LOVE 4GYSA 3N2OA 2LT3A 3PE0A 2ODVA 3Q5WA 4WBOA 4ZHQE 4H9PC 3ZCIA 2IC9A 1MMDA 3DP7A 4ILUA 4C90A 5LGTB 4HE8A 3N9QA 3NZPA 3N5LA 3PDYA 3AA6B 3RH3A 3MK7C 3RPUA 3LBXA 3ZLIA 5EK3A 2LJLA 2X51A 5L3FB 1U5PA 2KZ7B 2VL8A 4X1YE 3D0TA 1T98A 3T8OA 4ZI2D 3E08A 4KBMB 4CZZB 1SHZC 3CX7B 1U4QA 4M1PA 2CXLA 3Q5XA 3EUHA 4UV9B 4O4JE 3AAIA 3N9LA 4IE4A 3VU7H 4EB6E 3PU3A 3VKGA 4MFRA 2RA1A 5EK4A 5IHYA 5KDMC 2DWGA 1X79A 3N2GE 4JEHB 4KMCA 2NTYA 1FEWA 3RYCE 4YFSA 4OHFA 3ANWB 4GYRA 4QXBB 3LK42 1MIWA 4JEUB 1S35A 4Z8XA 5HWXA 3IHRA 3GN5A 2SPCA 2UXNB 2EHOD 4H9NC 4ZI7E 4AQFC 3N9MA 4V1Av 5LA6E 3BQKA 2YINA 4ZS3A 3ZMVB 5BMVE 5TAOA 5JQGE 3U3IA 4GK5E 4QX8B 3RC8A 2BVLA 2KWHA 4YHJA 5J1GA 2XAFB 2IW5B 3HI2A 2MYSA 1LVFA 2E9XB 3KV4A 4B6XA 3VKHA 2Y48B 3UULA 4WBNE 4BJMA 1US7B 3EDUA 5JDGA 5KX5E 4CXYA 2CLYB 2N1GA 4ZI3D 2HH7A 2JJ9A 3ETVA 1CUNA 3K3OA 4QXCB 5JDQA 5AFUL 2BDEA 2CMRA 3C4ZA 3C4WA 4IE7A 4DBRA 3ZMZB 3AAEB 2H3RA 2X9WA 3BK9A 4UF0B 2E9XA 2C5KT 2EHOA 1YKEB 5LHGB 4X1IE 3C64A 1UX4A 5LBMA 3UUXB 3HKDE 2NTXA 1LKXA 3AB3B 3OJAA 1ZKEA 1NAFA 3UFEA 1LVKA 3M65A 1MMNA 1V9DA 2UXXB 3H3AA 1NWMX 3GMIA 5LYJE 2Y6XA 3O1JA 1YKHB 3SOLA 4PJNA 2DCFA 3FXDB 4AQFA 5DQWA 4GK0E 1O3XA 5LP6E 3E0ZA 2XTLA 3WAJA 2GK9A 2IC6A 4NUUA 5L3EB 4AI6A 2CA5A 4QXHB 2D2SA 4DBQA 3HL6A 4IDZA 4QHOA 5HXRA 3O9XA 4FI5A 3UT5E 2VASA 3RKOA 2VKDA 3LJCA 4PK4A 4AKHA 4UXNB 1D0YA 3EDVA 3LBXB 3I9WA 3L3PA 2EHOC 3B57A 3N9PA 2E9XC 3KV9A 2PJQA 4I50E 1ZV4X 3RC3A 4QX7B 1HG2A 1WR6A 4ANJA 2WM9A 2X68A 2X9YA 2LSKA 2DLRA 1FMWA 3Q9DA 4TV9E 5LHIB 4PFOA 2A72A 2CXFA 3OYZA 1IJ6A 5LBQB 3FXEB 3PU8A 3BQIA 5FXZA 3N9OA 3JC6D 3NRYA 4IE0A 3RYHE 3R6NA 3W15B 3PUQA 4GOUA 2WMNA 3ZPOA 4EZ4A 3ZC0A 1MIYA 2YU2A 1HS7A 3ETUA 2MTQA 2VB6A 3U78A 2KT9A 4XZCA 3UUNA 3FBZA 5EK2A 5JR9B 4P0AA 3CWZB 2Q9QB 2G0UA 4AKLA 4OYKA 3V5UA 2XQYA 1H7CA 2L9QA 1HG5A 1VOMA 2Y8DA 2WMOA 5HAXA 4MBQA 3GA8A 5LG4A 2PFVA 2XUEA 2X67A 4H63H 3CQGB 3GN5B 4HGAA 2KMFA 2W62A 2OA5A 5FXWA 1MIVA 2DNXA 2LHRA 3LG7A 2KWIB 3GWHA 2W0GA 2YU1A 5DJQC 5GONE 1OXZA 4PFPA 3TKLB 5FNVE 4UVAB 3KFWX 4AKIA 2C5IT 3ZJ2A 3ZMUB 2VWAA 4E7ZA 2V7IA 5HWYA 4ERRA 2W00A 4IE5A 3AAAB 4PNIA 4O8SA 2DI4A 2NW8A 4PJMA 4PK6A 3EVYA 5FP3A 3RX6A 3AVRA 5M4YA 2YEVC 4QKNA 4O2BE 3IF8B 3MZKB 1YD8G 5KMGP 3ESLA 2PG8A 5JDLA 2VKHA 3ZEFB 4AKGA 4TN7B 3V5SA 2ZM8A 5JR9C 5CA0E 3K3NA 2VKOA 2D0TA 4CI2B 1G8XA 2LSJA 2X9XA 5EZYE 4I43B 1BR2A 2LSYA 4UEMA 2KINB 3CVRA 5JR9A 2JQQA 5JVDE 4YJ3E 4C91A 3DTOA 5FY0A 2A2FX 3R84B 3FHNA 4F6RC 3SWHA 2KLQA 1FMVA 3ZC1A 2JRKA 4H9SE 5HXEA 3KVBA 4BAYB 4K0UA 2K9AA 4UIGA 2WSSV 3AA7B 4I4TE 1D1CA 4GIWA 2EHOB 4TX5A 4UELA 2M67A 5LNKA 1BR0A 2V7JA 5FYMA 1Z0PA 5LGNB 3CKDA 3KV6A 1WRDA 2NW9A 5JREA 5JDNA 2DHRA 2ZMAA 3KVAA 4PJLA 2MOZA 4ISTA 4EOZB 2L3LA 1AJ3A 2XAGB 2D5UA 4TZ4C 4BA9A 3IBPA 5LXTE 5JRCA 2VK9A 1MNEA 3HKCE 1UCUA 3KBTA 5LHHB 2V7KA 3P8CD 3KBUA 3JC6C 4IIJE 2ZLYA 5C8YE 4TV8E 1VRBA 4KP3C 5LCYA 1YW0A 2N9DA 1UX5A 4MHCA 5LJMA 3QC9A 2LHNA 4KUMB 4PAGA 2BZBA 3CQXC 1QUUA 1WYCA 5L3DB 2HPJA 3F2EA 3I0QA 3OBVE 3L09A 4CXXA 4DMWA 4J2CA 2Z6EA 4UVCB 3CMLA 4HTEA 3K8PC 2XAHB 3Q2MA 5A1LA 2ODUA 4H9QC 2CWOA 3HR0A 3OKQA 3MACA 4OYJA 3MA9A 3DJBA 1LRZA 5F3JA 3SRZA 4ZS2A 5LJNA 1ZEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKH B;  1YKE B; 
#chains in the Genus database with same CATH topology
 3E22 E;  2JMH A;  3PUZ F;  5HXS A;  4PJJ A;  1XNQ T;  4DV2 T;  3PUG A;  3PUA A;  5DAB A;  4AQY T;  1FIO A;  2IML A;  2J1D G;  2W63 A;  4N78 D;  1HFA A;  3O4X E;  1ZHC A;  3CQC B;  4O2A E;  5ABF A;  2YKS A;  4WZX A;  1N36 T;  3UUM A;  2LM2 A;  4U7I A;  1JNR A;  3A5X A;  4TWH A;  1HF8 A;  2W61 A;  1HCI A;  4WNK A;  2BG9 A;  4AQG A;  4DID B;  4HFD A;  4E7S A;  5J2T E;  2CWY A;  4LFB T;  2MAW A;  1J1J A;  4JV5 T;  2CPT A;  1HNW T;  5L3C B;  4DND A;  2JQH A;  2XQ4 A;  5CA1 E;  3C51 A;  1SUM B;  3KIN B;  1KEY A;  2LOS A;  1BR4 A;  3CK6 A;  3ZT7 A;  4AKR B;  2Q9Q A;  3FB2 A;  4EIW A;  1HR0 T;  3P4R A;  2YK0 A;  3AA0 B;  4HN9 A;  2I0M A;  3J9X 1;  3ZMS B;  2CRB A;  4JI6 T;  4FJO A;  2V1D B;  5F8P A;  3HKE E;  2K3W A;  4EGW A;  4DUZ T;  4ADZ A;  4QH4 A;  1D0Z A;  2B1E A;  4IE6 A;  2H7V C;  2LM9 A;  3I1A A;  5JDM A;  4MAL A;  3CX8 B;  2UU9 T;  2CCQ A;  3OYX A;  3PUS A;  2HPL A;  2IAK A;  2LEH A;  3LK3 B;  4TNV A;  4QH5 A;  3ZN1 B;  1T72 A;  4CXW A;  2JMK A;  1KK7 A;  2D0U A;  5ETW A;  1KNP A;  3WI3 A;  4U72 A;  4QWN B;  4K0K T;  3PUR A;  2KND A;  2LOP A;  3FZK B;  1IAP A;  2LSG A;  3ONX A;  4KHZ F;  4U33 A;  1L0V A;  3LDQ B;  5HXC A;  3PJA J;  3S4U A;  4H63 V;  1R8I A;  2C5J A;  3TLW A;  1VCS A;  4KX6 A;  4DVD A;  3ANW A;  5FL1 A;  4ZI3 C;  3FBL A;  5L3G B;  2E8I A;  2H7O A;  2X66 A;  3ZJ1 A;  2BG9 E;  2E9X D;  4UV8 B;  2ACX A;  3HKB E;  4O4L E;  3AVS A;  4U31 A;  2N2N A;  3I0O A;  3ZYM A;  1QSD A;  4AIS A;  2V7M A;  1IZN B;  3JAD A;  5J2U E;  1KF6 A;  2XPK A;  4HWD A;  4XAX B;  2XHE B;  3NRX A;  3CPZ A;  2Q9Q D;  3RQW A;  3UU3 A;  1KFY A;  2OLT A;  3PTR B;  4NPP A;  2X0L B;  4AXP A;  2F4V T;  4H9O C;  2ZM2 A;  2H88 A;  2Q9Q C;  3TLS A;  2JPF A;  2NR4 A;  1D1A A;  1XMO T;  2IHR 1;  2VKJ A;  4HEA A;  5AQS B;  5L3B B;  2BVM A;  3AED A;  3C50 A;  4JI8 T;  2WWU A;  2QGS A;  4YY3 T;  3LFM A;  4DV1 T;  3NZQ A;  3ZN0 B;  5LB7 B;  4CI1 B;  2WBL A;  5DQV A;  5JDF A;  3KDS E;  5F5W A;  4IHJ E;  5CB4 E;  5ABF B;  1OWA A;  2WZI A;  3AEB A;  2IDO B;  3HA4 A;  2V5C A;  3AE3 A;  5JRC B;  1IJ5 A;  4YJ2 E;  2MBG A;  2HN2 A;  2V7L A;  1QLB A;  5L47 A;  3RYF E;  4IL4 A;  2CEA A;  5H6Q B;  4DR5 T;  3ZYL A;  2A3D A;  2NW7 A;  3ZMT B;  5JDH A;  4IGU A;  3BQL A;  3NBX X;  2XQA A;  4Q25 A;  4ZOL E;  4EYY R;  4ISS A;  3P4S A;  3C98 B;  4YTM A;  3I9Y A;  2W67 A;  3RRC A;  4BJN A;  4GKJ T;  5JH7 E;  3RIU A;  1MMA A;  1MND A;  1DU2 A;  5HCJ A;  1IBM T;  4JI7 T;  4UVB B;  2QYW A;  2I59 A;  2K5B B;  1N34 T;  1J5W A;  2IIU A;  5E0O A;  2XY8 B;  2LKG A;  5AQV B;  1S94 A;  1UK5 A;  3UU6 A;  4I55 E;  3IEE A;  4DO0 A;  4XBF B;  3F57 A;  4ZI2 C;  4O4I E;  3JAF A;  2KXP B;  4CN6 A;  3P7I A;  4OK0 A;  2VUR A;  2PBI A;  3AE7 A;  5FY1 A;  3N9N A;  4UF0 A;  3VHL A;  1XMQ T;  2DL1 A;  3ZSS A;  2RP4 A;  3SS1 A;  3FZM B;  3KV5 A;  4EZH A;  2YOE A;  3Q5E A;  4X20 E;  1KNZ A;  5FXX A;  3QK6 A;  5HXH A;  3QUJ A;  2X9H A;  4LF8 T;  1UUR A;  2AE9 A;  4EXT A;  4EAH A;  2NP9 A;  4HFV A;  4TUY E;  3K3Q C;  4G2A A;  1HX8 A;  2ES0 A;  4JUY A;  4LF9 T;  4LMJ A;  3ZYK A;  3J7Y q;  5H6R B;  4ASK A;  2BG9 C;  2J4G A;  2YDS A;  4H9R C;  2XAS B;  4JI5 T;  2JQK A;  2FBW A;  5FMN A;  3VRA A;  4EYU A;  4ZEY A;  4O4H E;  2CM0 A;  3MKD A;  4CQI A;  1WLX A;  2J62 A;  3C4X A;  4YLH A;  4CN4 A;  2NOX A;  1HNZ T;  4WW0 A;  3MJX A;  2BKP A;  2WAU A;  4HKA A;  1FJG T;  3OTO T;  4U3C A;  1D1B A;  2LE8 A;  2LSI A;  3RRW A;  4DUY T;  4JI4 T;  3MXZ A;  1D0X A;  2RPA A;  1E1H B;  1SA0 E;  2K24 A;  3LK2 B;  4HWI B;  4DMV A;  1N32 T;  3WAK A;  3AA1 B;  1B7T A;  2QA7 A;  1BR1 A;  3AE6 A;  3UTK A;  3VR9 A;  4COF A;  1J5E T;  4B3T T;  2V26 A;  2M6B A;  1EZ3 A;  2DWK A;  4L0R A;  4LF5 T;  1Y01 A;  3AEC A;  4PW8 A;  4ZZB A;  4P0B A;  2CLY C;  5AQO B;  3H37 A;  3K1S A;  4P09 A;  1G73 A;  1MMG A;  2CXD A;  2XAJ B;  3PUW F;  2BKN A;  3AEA A;  1ZP0 A;  4Z91 A;  4CI3 B;  4MLK A;  2XAQ B;  3O1I A;  3B13 A;  2C0S A;  2LRK A;  2XQ5 A;  3NKZ A;  4NUV A;  2BS3 A;  3AEE A;  3AXJ B;  2NWB A;  3O1H A;  4OFZ A;  5HEG A;  5CGM A;  2WCA A;  1Y64 B;  1WYB A;  3CX6 B;  3PJA A;  4G63 A;  4A56 A;  5LG3 A;  4KHP T;  1CHU A;  2K48 A;  3IA3 A;  2L8K A;  4L9I A;  4JLE A;  5FY7 A;  3QB5 K;  5AQL B;  3RIA A;  3F31 A;  4X1K E;  4L5G A;  4U74 A;  5IYZ E;  2P9B A;  1YQ4 A;  1SE7 A;  3N2K E;  5FXV A;  2X0Y A;  4A5X A;  1HTJ F;  5L2L A;  5IWA T;  3ZCJ A;  5AQJ B;  3RLF F;  3RYI E;  5LGU B;  2ZM0 A;  2JQ9 A;  2CE7 A;  4PK5 A;  2BBJ A;  2XJ7 A;  4GYS A;  5LOV E;  3UQ7 A;  3N2O A;  2LT3 A;  3PE0 A;  1M7K A;  2ODV A;  2V6Y A;  3Q5W A;  4WBO A;  3RHW A;  4H9P C;  3ZCI A;  4ZHQ E;  4EZ4 A;  2IC9 A;  1MMD A;  3DP7 A;  5AQR B;  4ILU A;  5HEH A;  4C90 A;  5LGT B;  3P4Q A;  4NXM T;  4TNW A;  4HE8 A;  5AQP B;  3RQU A;  3N9Q A;  3NZP A;  2FJE A;  3N5L A;  2UUC T;  4YSZ A;  4TWF A;  1ZOY A;  3AA6 B;  3PDY A;  3RH3 A;  2WWV A;  3MK7 C;  1N33 T;  3RPU A;  3LBX A;  3ZLI A;  2AXD S;  3H3M A;  2WY2 A;  2JIW A;  5EK3 A;  2LJL A;  3Q5D A;  5HEU A;  3ZC0 A;  4AIU A;  1NEN A;  2X51 A;  5L3F B;  4JI2 T;  1U5P A;  2KZ7 B;  2VL8 A;  4IDN A;  3D0T A;  1T98 A;  4X1Y E;  3T8O A;  4ZI2 D;  3E08 A;  4KBM B;  4CZZ B;  1SHZ C;  2WU5 A;  3X1D A;  3CX7 B;  1U4Q A;  1XWM A;  4M1P A;  5FKY A;  1IBL T;  2R6G F;  4DR7 T;  3P4P A;  5AQM B;  2CXL A;  2CBJ A;  3AE4 A;  3EUH A;  3Q5X A;  4UV9 B;  5AQK B;  4O4J E;  3AAI A;  3N9L A;  4IE4 A;  1XDP A;  1GQE A;  2PTF A;  3PU3 A;  3VU7 H;  4EB6 E;  4B3M T;  3VKG A;  3EAB A;  5FVL A;  4MFR A;  5KXJ A;  2RA1 A;  5EK4 A;  5HEO A;  5IHY A;  5KDM C;  2DWG A;  1X79 A;  2UUA T;  1W09 A;  2WP9 A;  3N2G E;  4JEH B;  4KMC A;  2V6X A;  2NTY A;  1T7S A;  1W9R A;  2WDQ A;  1FEW A;  3RYC E;  4YFS A;  4OHF A;  5AQT B;  3ANW B;  4GYR A;  4QXB B;  3LK4 2;  2QRX A;  3AXJ A;  4IT4 A;  1MIW A;  4HWH A;  3AE1 A;  4JEU B;  1HNX T;  4X64 T;  3M3Z B;  1S35 A;  4Z8X A;  5HWX A;  3IHR A;  3GN5 A;  2SPC A;  2UXN B;  2EHO D;  4H9N C;  4CN1 A;  4AQF C;  4ZI7 E;  4NIQ A;  3TLV A;  3N9M A;  2V5D A;  4LML A;  4V1A v;  5LA6 E;  3BQK A;  2WS3 A;  2YIN A;  4ZS3 A;  3ZMV B;  5BMV E;  4HFI A;  2XM2 A;  3TLU A;  4LFC T;  5TAO A;  2LRL A;  5JQG E;  3U3I A;  4GK5 E;  5AQG B;  4QX8 B;  3RC8 A;  2BVL A;  2KWH A;  4YHJ A;  3RIU C;  5J1G A;  2XAF B;  2IW5 B;  2MYS A;  2E5V A;  1LVF A;  2E9X B;  3HI2 A;  2WU2 A;  2XSA A;  3KV4 A;  4B6X A;  5C2T A;  3VKH A;  2Y48 B;  3UUL A;  4WBN E;  4BJM A;  1US7 B;  3B5M A;  3EDU A;  2IUB A;  5JDG A;  5ABH A;  5KX5 E;  2MPK A;  3OVU A;  2CLY B;  3PUV F;  4CXY A;  2N1G A;  2XQ8 A;  2HH7 A;  4U7Y A;  2JJ9 A;  3ETV A;  4ZI3 D;  4OX9 T;  3UU4 A;  3TLT A;  2UXB T;  1CUN A;  2XQ6 A;  4LMK A;  1OED C;  3K3O A;  4QXC B;  5JDQ A;  5AFU L;  2BDE A;  2CMR A;  3C4Z A;  5L4H A;  3C4W A;  4EED A;  5AQF B;  4JYA T;  4IE7 A;  3P4W A;  3ZMZ B;  4DBR A;  3T1Y T;  3AE5 A;  4YXD A;  2YDQ A;  1I6Z A;  3AAE B;  2H3R A;  2X9W A;  3BK9 A;  2A9U A;  4UF0 B;  2E9X A;  2C5K T;  2EHO A;  1YKE B;  4EEB A;  1KNR A;  3VRB A;  4LFA T;  4IL9 A;  5LHG B;  4X1I E;  3C64 A;  1UX4 A;  2XQ3 A;  5LBM A;  2VL0 A;  3HKD E;  2NTX A;  3P50 A;  4P1N A;  3UUX B;  5LMN T;  1LKX A;  1YXR A;  3AB3 B;  3OJA A;  3SFE A;  3RGL A;  1ZKE A;  1NAF A;  2BG9 B;  3UFE A;  1LVK A;  2FUP A;  3M65 A;  1MMN A;  1V9D A;  2UXX B;  3PV0 F;  3H3A A;  1NWM X;  4IRE A;  3GMI A;  5LYJ E;  2Y6X A;  3L39 A;  2FJD A;  1XNR T;  2CHN A;  1YKH B;  3O1J A;  4YSY A;  3PUX F;  3SOL A;  2D9D A;  4YTP A;  4PJN A;  2VVS A;  4HFB A;  2DCF A;  3QOF A;  3G06 A;  3FXD B;  4AQF A;  5DQW A;  2XQ9 A;  3OPC A;  4GK0 E;  3UFG A;  1O3X A;  5LP6 E;  3E0Z A;  2XTL A;  4ZXL A;  3WAJ A;  2GK9 A;  2IC6 A;  2CHO A;  4NUU A;  2M6I A;  3UQ4 A;  2CA5 A;  3FZL B;  5L3E B;  3FZH B;  4HWF A;  2VQF T;  4QXH B;  2D2S A;  4DBQ A;  1OED B;  3HL6 A;  4IDZ A;  4QHO A;  5HXR A;  3O9X A;  4FI5 A;  2BBH A;  3UT5 E;  2E2A A;  2VAS A;  2VKD A;  3LJC A;  4PK4 A;  4TWD A;  4UXN B;  2V6Y B;  1D0Y A;  3EDV A;  3RKO A;  3SFD A;  3VR8 A;  4WYV A;  3LBX B;  3I9W A;  3L3P A;  4X65 T;  2EHO C;  3B57 A;  3N9P A;  3ABV A;  1X9B A;  2E9X C;  3KV9 A;  2PJQ A;  4I50 E;  1WFD A;  1ZV4 X;  5ADX L;  3RC3 A;  5IUX A;  2E5L T;  4QX7 B;  1VCT A;  1HG2 A;  1WR6 A;  2I6H A;  4A97 A;  4ILC A;  4ANJ A;  2WM9 A;  2X68 A;  2X9Y A;  2LSK A;  4DV4 T;  2DLR A;  1FMW A;  3Q9D A;  4TV9 E;  1OED A;  3RKG A;  5LHI B;  4PFO A;  3EHZ A;  3JAE A;  4A98 A;  4JI3 T;  5AQU B;  2KSR A;  2A72 A;  2CXF A;  3OYZ A;  1IJ6 A;  5LBQ B;  4HFC A;  3FXE B;  3PU8 A;  4I0U A;  3BQI A;  4KI0 F;  5FL0 A;  5L4E A;  3RF1 A;  3EI0 A;  2WDV A;  3N9O A;  3L8R A;  5FXZ A;  3JC6 D;  3NRY A;  4IE0 A;  1T8B A;  3RYH E;  3R6N A;  3W15 B;  3PUQ A;  2HN1 A;  2WMN A;  4GOU A;  3UU8 A;  4U2Y A;  1MIY A;  4ILA A;  2YU2 A;  3ZKR A;  3ETU A;  5HCM A;  4YSX A;  2VQE T;  2MTQ A;  1HS7 A;  2VB6 A;  3U78 A;  2KT9 A;  2XSB A;  1UUS A;  4XZC A;  3UUN A;  1IBK T;  3FBZ A;  5EK2 A;  5JR9 B;  4P0A A;  3CWZ B;  2Q9Q B;  2G0U A;  4AKL A;  4OYK A;  3V5U A;  2XQY A;  4JI0 T;  1H7C A;  4HWC A;  2L9Q A;  3ZPO A;  5ABE A;  2UXD T;  5FVK A;  1HG5 A;  1VOM A;  2Y8D A;  5AQN B;  2WMO A;  4B3R T;  5HAX A;  4MBQ A;  3GA8 A;  2FJA A;  5LG4 A;  2PFV A;  2XUE A;  2X67 A;  2UUB T;  5AQQ B;  4H63 H;  5AQI B;  3QNU A;  3CQG B;  3GN5 B;  3JCF A;  1XZY A;  2KMF A;  2W62 A;  4HGA A;  4IDQ A;  4JBW F;  1UGO A;  2OA5 A;  2YN6 A;  5FXW A;  1MIV A;  1I94 T;  4LF6 T;  2DNX A;  2LHR A;  3LG7 A;  4ILB A;  5ABG A;  2KWI B;  3GWH A;  2W0G A;  2YU1 A;  5DJQ C;  2B76 A;  5GON E;  5LMU T;  1OXZ A;  4PFP A;  4YHH T;  3TKL B;  5FNV E;  4UVA B;  3KFW X;  5JTG A;  1XDO A;  4AKI A;  2C5I T;  1M62 A;  3ZJ2 A;  3ZMU B;  2VWA A;  4E7Z A;  2V7I A;  5HWY A;  4AKH A;  3T1H T;  2W4X A;  4ERR A;  5BR8 T;  2W00 A;  4X66 T;  2LKH A;  3AE2 A;  4IE5 A;  3AAA B;  3AE8 A;  4IDP A;  3PUY F;  4O8S A;  4PNI A;  4DR1 T;  2DI4 A;  2XZE A;  2NW8 A;  4PJM A;  4PK6 A;  4NXN T;  3EVY A;  2OV9 A;  5FP3 A;  3RX6 A;  3AVR A;  5M4Y A;  3UUB A;  4EV6 A;  3ONL C;  2YEV C;  4QKN A;  4O2B E;  1E7P A;  3IF8 B;  4DV6 T;  4DR3 T;  3MZK B;  1YD8 G;  4GKK T;  5KMG P;  3ESL A;  4QH1 A;  2PG8 A;  5JDL A;  2VKH A;  3ZEF B;  3ZST A;  4AKG A;  4TN7 B;  3V5S A;  2H89 A;  2ZM8 A;  4UR9 A;  5JR9 C;  5CA0 E;  3K3N A;  2FJB A;  2QVA A;  2VKO A;  3ONJ A;  3QB5 A;  2D0T A;  1WCR A;  4CI2 B;  1G8X A;  2LSJ A;  2X9X A;  5EZY E;  4I43 B;  4U2Z A;  1BR2 A;  2LSY A;  2WZH A;  1W0A A;  4UEM A;  2KIN B;  3AEF A;  1HX1 B;  3CVR A;  5JR9 A;  2JQQ A;  5JVD E;  4HFH A;  2BS4 A;  4YJ3 E;  2CBI A;  2WDR A;  1W0B A;  3DTO A;  2A2F X;  5FY0 A;  4C91 A;  3R84 B;  3FHN A;  4F6R C;  3SWH A;  4B3S T;  2KLQ A;  4DV7 T;  4DV0 T;  1FMV A;  3ZC1 A;  2JRK A;  4H9S E;  4DV3 T;  3RI5 A;  5HXE A;  4JI1 T;  3KVB A;  4BAY B;  4K0U A;  2K9A A;  4UIG A;  4AI6 A;  4ZZC A;  2X0H A;  2WSS V;  3AA7 B;  4I4T E;  1D1C A;  4GIW A;  2ZM6 T;  4DV5 T;  2EHO B;  4TX5 A;  2LLY A;  4YT0 A;  3EAM A;  4UEL A;  4X5T A;  2M67 A;  5LNK A;  1BR0 A;  5CJ5 A;  2V7J A;  5FYM A;  1Z0P A;  3AEG A;  5LGN B;  3CKD A;  3KV6 A;  1WRD A;  2NW9 A;  5JRE A;  4IDO A;  3FZF B;  5CFB A;  2DHR A;  2ZMA A;  3LSV A;  5JDN A;  2W66 A;  2HHH T;  3KVA A;  4PJL A;  2J47 A;  2MOZ A;  4IST A;  4EOZ B;  2L3L A;  1NEK A;  5HYA A;  3RIF A;  1AJ3 A;  2XAG B;  4LF7 T;  2D5U A;  3NVO A;  1JNZ A;  4TZ4 C;  4BA9 A;  2BS2 A;  2XQ7 A;  3IBP A;  5LXT E;  5JRC A;  2VK9 A;  1MNE A;  3HKC E;  1UCU A;  3KBT A;  3ZT5 A;  5LHH B;  2V7K A;  3P8C D;  3KBU A;  2UXC T;  3JC6 C;  2ACZ A;  3UU5 A;  4IIJ E;  2ZLY A;  2V8S V;  5C8Y E;  2WQY A;  4TV8 E;  1VRB A;  4KP3 C;  5LCY A;  1YW0 A;  1Z8U A;  5HEJ A;  3A8Y C;  2N9D A;  1UX5 A;  5C3J A;  4MHC A;  3AE9 A;  5AQH B;  5LJM A;  3QC9 A;  2LHN A;  4KUM B;  4PAG A;  2BZB A;  3CQX C;  1QUU A;  1WYC A;  4LF4 T;  3NWI A;  5J0Z A;  4X62 T;  5L3D B;  2HPJ A;  3F2E A;  3I0Q A;  3OBV E;  3L09 A;  4DR4 T;  4CXX A;  4DMW A;  3ZT6 A;  2BKO A;  4J2C A;  2Z6E A;  4UVC B;  2W2U A;  1OED E;  3CML A;  3CIR A;  4HTE A;  3K8P C;  4YTN A;  2XAH B;  3Q2M A;  2XM1 A;  5A1L A;  2WB5 A;  2ODU A;  4H9Q C;  1WR0 A;  4HFE A;  2CWO A;  1YQ3 A;  2VVN A;  3HR0 A;  2YDR A;  4Z90 A;  3OKQ A;  4DR6 T;  3MAC A;  4OYJ A;  3MA9 A;  3DJB A;  1LRZ A;  3A7M A;  4F8H A;  5F3J A;  3SRZ A;  4ZS2 A;  5LJN A;  1ZEE A;  1E2A A;  4DR2 T; 
#chains in the Genus database with same CATH homology
 3E22 E;  2JMH A;  5HXS A;  4PJJ A;  3PUG A;  3PUA A;  5DAB A;  1FIO A;  2J1D G;  2W63 A;  4N78 D;  3RYF E;  1HFA A;  3O4X E;  1ZHC A;  3CQC B;  4O2A E;  3UUM A;  3A5X A;  1HF8 A;  2W61 A;  1HCI A;  4WNK A;  4AQG A;  5J2T E;  4E7S A;  2CWY A;  5L3C B;  4DND A;  5CA1 E;  3C51 A;  3KIN B;  2LOS A;  1BR4 A;  4AKR B;  2Q9Q A;  3FB2 A;  4EIW A;  2YK0 A;  3AA0 B;  4HN9 A;  3J9X 1;  3ZMS B;  4FJO A;  2V1D B;  5F8P A;  3HKE E;  4ADZ A;  1D0Z A;  2B1E A;  4IE6 A;  2H7V C;  2LM9 A;  3I1A A;  5JDM A;  4MAL A;  3CX8 B;  2CCQ A;  3OYX A;  3PUS A;  2HPL A;  2IAK A;  2LEH A;  3LK3 B;  3ZN1 B;  4CXW A;  2JMK A;  1KK7 A;  2D0U A;  5ETW A;  3WI3 A;  4U72 A;  4QWN B;  3PUR A;  2KND A;  2LOP A;  1IAP A;  2LSG A;  3ONX A;  3S4U A;  5HXC A;  4H63 V;  2C5J A;  4DVD A;  5L3G B;  3ANW A;  4ZI3 C;  3FBL A;  2E8I A;  2H7O A;  2X66 A;  3ZJ1 A;  2E9X D;  3ZYM A;  4UV8 B;  2ACX A;  3HKB E;  4O4L E;  3AVS A;  2N2N A;  3I0O A;  1QSD A;  2V7M A;  1IZN B;  5J2U E;  4XAX B;  2XHE B;  3NRX A;  3CPZ A;  2Q9Q D;  5HYA A;  3PTR B;  4AXP A;  2X0L B;  4H9O C;  2ZM2 A;  2Q9Q C;  2JPF A;  1D1A A;  2VKJ A;  4HEA A;  5L3B B;  2BVM A;  3C50 A;  2WWU A;  2QGS A;  3LFM A;  3NZQ A;  3ZN0 B;  4CI1 B;  2WBL A;  5DQV A;  5JDF A;  3KDS E;  4IHJ E;  5CB4 E;  1OWA A;  3HA4 A;  5JRC B;  1IJ5 A;  4YJ2 E;  2MBG A;  2V7L A;  5H6Q B;  2CEA A;  3ZYL A;  2A3D A;  2NW7 A;  3ZMT B;  5JDH A;  4IGU A;  3BQL A;  3NBX X;  4ZOL E;  4EYY R;  4ISS A;  3C98 B;  4BJN A;  3I9Y A;  3RRC A;  5JH7 E;  1MMA A;  1MND A;  4UVB B;  2I59 A;  2K5B B;  5E0O A;  4XBF B;  1S94 A;  4I55 E;  3IEE A;  4DO0 A;  3F57 A;  4ZI2 C;  4O4I E;  2KXP B;  3P7I A;  4OK0 A;  2PBI A;  5FY1 A;  3N9N A;  4UF0 A;  3VHL A;  2RP4 A;  3SS1 A;  3KV5 A;  4EZH A;  4X20 E;  1KNZ A;  5FXX A;  3QK6 A;  5HXH A;  3QUJ A;  2X9H A;  4EXT A;  4EAH A;  2NP9 A;  4HFV A;  4TUY E;  3K3Q C;  4G2A A;  1HX8 A;  2ES0 A;  4JUY A;  3ZYK A;  3J7Y q;  5H6R B;  4ASK A;  4H9R C;  2XAS B;  5FMN A;  4EYU A;  4O4H E;  2CM0 A;  3MKD A;  4CQI A;  1WLX A;  3C4X A;  4YLH A;  2NOX A;  4WW0 A;  3MJX A;  2WAU A;  4HKA A;  1D1B A;  2LE8 A;  2LSI A;  3RRW A;  3MXZ A;  1D0X A;  1E1H B;  1SA0 E;  2K24 A;  3LK2 B;  4DMV A;  3WAK A;  3AA1 B;  1B7T A;  2QA7 A;  1BR1 A;  3UTK A;  2V26 A;  1EZ3 A;  2DWK A;  4L0R A;  4PW8 A;  4P0B A;  2CLY C;  3H37 A;  4P09 A;  1G73 A;  1MMG A;  2CXD A;  2XAJ B;  4CI3 B;  4MLK A;  2XAQ B;  3O1I A;  3B13 A;  2C0S A;  4NUV A;  3O1H A;  2NWB A;  4OFZ A;  4A56 A;  1Y64 B;  1WYB A;  3CX6 B;  4G63 A;  4L9I A;  2K48 A;  5ADX L;  2L8K A;  5FY7 A;  4JLE A;  3F31 A;  4X1K E;  4L5G A;  4U74 A;  5IYZ E;  2P9B A;  3N2K E;  5FXV A;  1HTJ F;  5L2L A;  3ZCJ A;  3RYI E;  5LGU B;  2ZM0 A;  2CE7 A;  4PK5 A;  5LOV E;  4GYS A;  3N2O A;  2LT3 A;  3PE0 A;  2ODV A;  3Q5W A;  4WBO A;  4ZHQ E;  4H9P C;  3ZCI A;  2IC9 A;  1MMD A;  3DP7 A;  4ILU A;  4C90 A;  5LGT B;  4HE8 A;  3N9Q A;  3NZP A;  3N5L A;  3PDY A;  3AA6 B;  3RH3 A;  3MK7 C;  3RPU A;  3LBX A;  3ZLI A;  5EK3 A;  2LJL A;  2X51 A;  5L3F B;  1U5P A;  2KZ7 B;  2VL8 A;  4X1Y E;  3D0T A;  1T98 A;  3T8O A;  4ZI2 D;  3E08 A;  4KBM B;  4CZZ B;  1SHZ C;  3CX7 B;  1U4Q A;  4M1P A;  2CXL A;  3Q5X A;  3EUH A;  4UV9 B;  4O4J E;  3AAI A;  3N9L A;  4IE4 A;  3VU7 H;  4EB6 E;  3PU3 A;  3VKG A;  4MFR A;  2RA1 A;  5EK4 A;  5IHY A;  5KDM C;  2DWG A;  1X79 A;  3N2G E;  4JEH B;  4KMC A;  2NTY A;  1FEW A;  3RYC E;  4YFS A;  4OHF A;  3ANW B;  4GYR A;  4QXB B;  3LK4 2;  1MIW A;  4JEU B;  1S35 A;  4Z8X A;  5HWX A;  3IHR A;  3GN5 A;  2SPC A;  2UXN B;  2EHO D;  4H9N C;  4ZI7 E;  4AQF C;  3N9M A;  4V1A v;  5LA6 E;  3BQK A;  2YIN A;  4ZS3 A;  3ZMV B;  5BMV E;  5TAO A;  5JQG E;  3U3I A;  4GK5 E;  4QX8 B;  3RC8 A;  2BVL A;  2KWH A;  4YHJ A;  5J1G A;  2XAF B;  2IW5 B;  3HI2 A;  2MYS A;  1LVF A;  2E9X B;  3KV4 A;  4B6X A;  3VKH A;  2Y48 B;  3UUL A;  4WBN E;  4BJM A;  1US7 B;  3EDU A;  5JDG A;  5KX5 E;  4CXY A;  2CLY B;  2N1G A;  4ZI3 D;  2HH7 A;  2JJ9 A;  3ETV A;  1CUN A;  3K3O A;  4QXC B;  5JDQ A;  5AFU L;  2BDE A;  2CMR A;  3C4Z A;  3C4W A;  4IE7 A;  4DBR A;  3ZMZ B;  3AAE B;  2H3R A;  2X9W A;  3BK9 A;  4UF0 B;  2E9X A;  2C5K T;  2EHO A;  1YKE B;  5LHG B;  4X1I E;  3C64 A;  1UX4 A;  5LBM A;  3UUX B;  3HKD E;  2NTX A;  1LKX A;  3AB3 B;  3OJA A;  1ZKE A;  1NAF A;  3UFE A;  1LVK A;  3M65 A;  1MMN A;  1V9D A;  2UXX B;  3H3A A;  1NWM X;  3GMI A;  5LYJ E;  2Y6X A;  3O1J A;  1YKH B;  3SOL A;  4PJN A;  2DCF A;  3FXD B;  4AQF A;  5DQW A;  4GK0 E;  1O3X A;  5LP6 E;  3E0Z A;  2XTL A;  3WAJ A;  2GK9 A;  2IC6 A;  4NUU A;  5L3E B;  4AI6 A;  2CA5 A;  4QXH B;  2D2S A;  4DBQ A;  3HL6 A;  4IDZ A;  4QHO A;  5HXR A;  3O9X A;  4FI5 A;  3UT5 E;  2VAS A;  3RKO A;  2VKD A;  3LJC A;  4PK4 A;  4AKH A;  4UXN B;  1D0Y A;  3EDV A;  3LBX B;  3I9W A;  3L3P A;  2EHO C;  3B57 A;  3N9P A;  2E9X C;  3KV9 A;  2PJQ A;  4I50 E;  1ZV4 X;  3RC3 A;  4QX7 B;  1HG2 A;  1WR6 A;  4ANJ A;  2WM9 A;  2X68 A;  2X9Y A;  2LSK A;  2DLR A;  1FMW A;  3Q9D A;  4TV9 E;  5LHI B;  4PFO A;  2A72 A;  2CXF A;  3OYZ A;  1IJ6 A;  5LBQ B;  3FXE B;  3PU8 A;  3BQI A;  5FXZ A;  3N9O A;  3JC6 D;  3NRY A;  4IE0 A;  3RYH E;  3R6N A;  3W15 B;  3PUQ A;  4GOU A;  2WMN A;  3ZPO A;  4EZ4 A;  3ZC0 A;  1MIY A;  2YU2 A;  1HS7 A;  3ETU A;  2MTQ A;  2VB6 A;  3U78 A;  2KT9 A;  4XZC A;  3UUN A;  3FBZ A;  5EK2 A;  5JR9 B;  4P0A A;  3CWZ B;  2Q9Q B;  2G0U A;  4AKL A;  4OYK A;  3V5U A;  2XQY A;  1H7C A;  2L9Q A;  1HG5 A;  1VOM A;  2Y8D A;  2WMO A;  5HAX A;  4MBQ A;  3GA8 A;  5LG4 A;  2PFV A;  2XUE A;  2X67 A;  4H63 H;  3CQG B;  3GN5 B;  4HGA A;  2KMF A;  2W62 A;  2OA5 A;  5FXW A;  1MIV A;  2DNX A;  2LHR A;  3LG7 A;  2KWI B;  3GWH A;  2W0G A;  2YU1 A;  5DJQ C;  5GON E;  1OXZ A;  4PFP A;  3TKL B;  5FNV E;  4UVA B;  3KFW X;  4AKI A;  2C5I T;  3ZJ2 A;  3ZMU B;  2VWA A;  4E7Z A;  2V7I A;  5HWY A;  4ERR A;  2W00 A;  4IE5 A;  3AAA B;  4PNI A;  4O8S A;  2DI4 A;  2NW8 A;  4PJM A;  4PK6 A;  3EVY A;  5FP3 A;  3RX6 A;  3AVR A;  5M4Y A;  2YEV C;  4QKN A;  4O2B E;  3IF8 B;  3MZK B;  1YD8 G;  5KMG P;  3ESL A;  2PG8 A;  5JDL A;  2VKH A;  3ZEF B;  4AKG A;  4TN7 B;  3V5S A;  2ZM8 A;  5JR9 C;  5CA0 E;  3K3N A;  2VKO A;  2D0T A;  4CI2 B;  1G8X A;  2LSJ A;  2X9X A;  5EZY E;  4I43 B;  1BR2 A;  2LSY A;  4UEM A;  2KIN B;  3CVR A;  5JR9 A;  2JQQ A;  5JVD E;  4YJ3 E;  4C91 A;  3DTO A;  5FY0 A;  2A2F X;  3R84 B;  3FHN A;  4F6R C;  3SWH A;  2KLQ A;  1FMV A;  3ZC1 A;  2JRK A;  4H9S E;  5HXE A;  3KVB A;  4BAY B;  4K0U A;  2K9A A;  4UIG A;  2WSS V;  3AA7 B;  4I4T E;  1D1C A;  4GIW A;  2EHO B;  4TX5 A;  4UEL A;  2M67 A;  5LNK A;  1BR0 A;  2V7J A;  5FYM A;  1Z0P A;  5LGN B;  3CKD A;  3KV6 A;  1WRD A;  2NW9 A;  5JRE A;  5JDN A;  2DHR A;  2ZMA A;  3KVA A;  4PJL A;  2MOZ A;  4IST A;  4EOZ B;  2L3L A;  1AJ3 A;  2XAG B;  2D5U A;  4TZ4 C;  4BA9 A;  3IBP A;  5LXT E;  5JRC A;  2VK9 A;  1MNE A;  3HKC E;  1UCU A;  3KBT A;  5LHH B;  2V7K A;  3P8C D;  3KBU A;  3JC6 C;  4IIJ E;  2ZLY A;  5C8Y E;  4TV8 E;  1VRB A;  4KP3 C;  5LCY A;  1YW0 A;  2N9D A;  1UX5 A;  4MHC A;  5LJM A;  3QC9 A;  2LHN A;  4KUM B;  4PAG A;  2BZB A;  3CQX C;  1QUU A;  1WYC A;  5L3D B;  2HPJ A;  3F2E A;  3I0Q A;  3OBV E;  3L09 A;  4CXX A;  4DMW A;  4J2C A;  2Z6E A;  4UVC B;  3CML A;  4HTE A;  3K8P C;  2XAH B;  3Q2M A;  5A1L A;  2ODU A;  4H9Q C;  2CWO A;  3HR0 A;  3OKQ A;  3MAC A;  4OYJ A;  3MA9 A;  3DJB A;  1LRZ A;  5F3J A;  3SRZ A;  4ZS2 A;  5LJN A;  1ZEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...