1YKHB

Structure of the mediator med7/med21 (med7/srb7) subcomplex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
114
Chain Sequence
TDRMTQLQICLDQMTEQFCATLNYIDKNHGFEVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLMRHVDSMIEDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords RNA polymerase II mediator complex protein MED7
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 46
structure length 114
sequence length 129
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykhB00
1YKEB 1YKHB
chains in the Genus database with same CATH superfamily
3CQGB 2K24A 2V1DB 3P4PA 4GYSA 4IDPA 4QH1A 2BKNA 3KBTA 3N9MA 2JJ9A 2ZLYA 2QRXA 5JDLA 2ODVA 2X0HA 3SS1A 2HPJA 3ESLA 4QHOA 4YSXA 2HHHT 2BZBA 1IBMT 2C5JA 1N33T 2XQ3A 3ZJ2A 5LCYA 5KMGP 3FZKB 1V9DA 3VHLA 2V6YA 4X66T 3L39A 4U7IA 2DI4A 4O4JE 3PUZF 2AE9A 4OX9T 2I6HA 3F2EA 4H63V 3PU8A 3PUXF 4O4IE 4IGUA 5AQFB 3RYCE 2YU2A 4AKGA 3QK6A 3IBPA 2XPKA 2WBLA 5LHIB 4DMVA 3LK2B 3Q5WA 2X9YA 3P4QA 4BAYB 4I50E 4H9PC 3ZT5A 4I4TE 3PU3A 5LMUT 1SE7A 5F3JA 3L3PA 2OLTA 2YEVC 3KVBA 2XAHB 1NEKA 3PUSA 1MIWA 3P4SA 4L0RA 3A7MA 2KMFA 3JAEA 4K0UA 5HXSA 2KZ7B 1ZV4X 3RYFE 2FJAA 2LJLA 1MMGA 3UT5E 1OEDC 4JEHB 3ZC0A 4OYKA 1MIVA 2L3LA 3RPUA 2WQYA 4CI2B 4YFSA 4X62T 3O1JA 5JDHA 1KNPA 3ANWA 4YSYA 2G0UA 5L4HA 1QSDA 4E7SA 5JVDE 3ABVA 3C64A 3PUVF 3ZMVB 3AEBA 1J1JA 2YDRA 2XQ4A 5L4EA 5JDFA 2A3DA 3CQXC 3KDSE 1YQ4A 1SA0E 5AQJB 4LF7T 2XY8B 3FZHB 4JI8T 4KX6A 5FXZA 4HFHA 3RQWA 4LF9T 3CK6A 4DO0A 4CI3B 4UIGA 2PBIA 3FBLA 4DV4T 3TLTA 2Q9QD 2CWOA 3RF1A 3E0ZA 1XNRT 1BR4A 3IF8B 3P4RA 1UCUA 3KV9A 2NTYA 3ZCIA 3ZYKA 4DR2T 2K9AA 4HWCA 3CX8B 3AEDA 1VCTA 2E9XC 2K3WA 2V26A 3GN5A 3TLWA 4LF6T 5AQLB 5JH7E 3RRCA 3SOLA 4JUYA 4IDZA 2LSYA 5IYZE 4ZXLA 3ZSTA 5AQHB 4DV2T 2DWKA 2DLRA 2YDSA 4TWDA 1ZP0A 5HXCA 3S4UA 5ADXL 2MBGA 4YTMA 4CI1B 2JIWA 1UK5A 2H7OA 2XQ6A 3AECA 1IJ5A 1HX1B 5FMNA 3H3AA 1I6ZA 4AIUA 3SWHA 5E0OA 4I55E 2JQ9A 1WCRA 4DV7T 5L47A 3BQLA 4PJMA 3ONXA 5HXHA 2DL1A 4EZHA 5LP6E 5CA1E 4PFOA 4ILAA 1JNRA 4XZCA 2V7LA 1T98A 1FEWA 3ZT6A 2NP9A 3RI5A 5JR9C 2CLYB 2RA1A 3A5XA 3UUBA 3KVAA 5IUXA 3VU7H 4F8HA 3UQ7A 2X9WA 3WAJA 3MACA 3K3NA 2DCFA 4DNDA 5L3DB 4HE8A 1HR0T 4EYYR 4X5TA 2B1EA 3F57A 5JDGA 4IE5A 1E7PA 3ZYLA 4IE0A 4GOUA 5LOVE 1HG5A 2VURA 3GA8A 3KBUA 1FJGT 2V7IA 3AEAA 3T8OA 4ZS2A 2K5BB 4TV8E 3QNUA 2WDVA 5EZYE 4KI0F 1QLBA 4PJNA 4V1Av 3CPZA 3OYXA 4BJNA 4YHHT 5LMNT 4EEBA 1IJ6A 2LKGA 3LDQB 3UQ4A 2H88A 1BR0A 4H9RC 4KHZF 2XQ8A 4JI5T 4AISA 2CBJA 3NRXA 3VRAA 4QXCB 1O3XA 3GMIA 2EHOD 3MKDA 3ETVA 2W0GA 1WR0A 2JMHA 4DR1T 1XMOT 2XTLA 4EYUA 4WW0A 2X51A 3QB5A 2Y6XA 1D0ZA 4PFPA 3HKCE 5HCJA 4UVAB 3RIFA 2C5KT 3P7IA 2P9BA 4OK0A 4IT4A 1MNDA 1UUSA 2EHOC 2Y8DA 4YTPA 4KMCA 4CN1A 3OYZA 4JV5T 5LHGB 3UU3A 1G73A 5L3BB 2BBHA 2JQKA 4F6RC 4AI6A 3O4XE 3ZMSB 4TZ4C 2LM2A 5L3EB 3J7Yq 3K1SA 2XQ9A 4NUVA 5AQRB 5KDMC 4CXWA 4PAGA 2UUCT 2UXBT 4YT0A 3CX6B 3ZYMA 1M7KA 4TNWA 4UR9A 5FVKA 4PJJA 3PJAA 5AQIB 3N9LA 1MMAA 1HTJF 4UVCB 3WAKA 4DBQA 3PUGA 4AQGA 1BR2A 4B6XA 3TLSA 1NENA 4DUZT 1XZYA 2JQHA 1XWMA 1ZEEA 4JI0T 2MPKA 1YW0A 3AE4A 2V5DA 3EABA 3RH3A 5AQOB 2CMRA 4GK0E 2E5VA 2WWVA 1S94A 2NR4A 4TV9E 2X9HA 2D0UA 4U2ZA 3HI2A 2NTXA 3UU8A 2NWBA 1SUMB 2XM1A 2WU2A 3Q5DA 2OV9A 3IEEA 1Y01A 3D0TA 2LSJA 4AKIA 4PK4A 3EDVA 2N2NA 2XASB 3LG7A 4DR5T 3RKGA 3AB3B 4QXHB 4HFBA 4A97A 4ILCA 2VK9A 1S35A 3I0OA 3RKOA 3JC6D 3FBZA 2CXFA 5H6RB 1B7TA 1ZHCA 3HR0A 2WZHA 5JRCA 5DQVA 4I0UA 2CXLA 3UUNA 2WB5A 5J1GA 1W0BA 4NIQA 4IHJE 1AJ3A 4JYAT 1YXRA 1D0XA 2BG9C 2W63A 3N2OA 4CN4A 4X64T 4AQFA 4PK5A 4EEDA 4KHPT 2M67A 3ZCJA 1IBKT 3QOFA 2H3RA 5FXWA 5LNKA 2VKOA 3N9PA 3B5MA 2VWAA 4NPPA 2XZEA 2JMKA 3CQCB 3HKDE 4X1YE 2XQYA 2HPLA 3F31A 5LBMA 3PUWF 5BMVE 2W62A 2XUEA 5LB7B 4O4HE 4Z8XA 2ODUA 3PUQA 5DABA 5FNVE 3ZLIA 2IMLA 5AQMB 5ETWA 4HWIB 4H9SE 2N1GA 2EHOB 4EOZB 2B76A 1WR6A 1T72A 5AQQB 1OXZA 4ZI2D 4A98A 4YJ2E 2E5LT 4TWFA 2CLYC 2SPCA 1OEDA 3UUXB 4IIJE 1Z0PA 3AVRA 3JAFA 2I0MA 5LHHB 5CB4E 3C4XA 4G2AA 4ZEYA 3EI0A 3GWHA 4U33A 3VR8A 4ISSA 4C91A 4YY3T 2ZM8A 3KV4A 4EZ4A 2X0YA 4ZI2C 2LM9A 2XAGB 3ZSSA 5CFBA 3BK9A 2LRKA 2LE8A 2XSBA 1OEDE 3OBVE 5LBQB 2IAKA 4LMJA 3RHWA 4WBNE 4LF8T 1R8IA 4YXDA 1US7B 3ZN0B 2WS3A 3OPCA 1N32T 4XBFB 4HWFA 4DR7T 1HS7A 4UV8B 2WDQA 4O4LE 2DHRA 2VVSA 5FXVA 4KP3C 1VRBA 5HAXA 5CJ5A 5FVLA 2GK9A 3SFEA 2XSAA 3K3OA 3QB5K 3LSVA 4QKNA 4JI6T 2UXXB 5J2UE 2E9XA 2X0LB 5FP3A 2Z6EA 3MXZA 1KNZA 5L3CB 5F5WA 4QH4A 2A9UA 3FXEB 2LEHA 3LK3B 3AXJB 4DV5T 3T1YT 5HWXA 3AA1B 3AVSA 5AQUB 1U4QA 2Q9QC 3UU5A 3RGLA 3VKHA 2A72A 4U2YA 4TWHA 5FY7A 2BG9B 4X65T 3OJAA 3AA7B 2K48A 4DV6T 3E08A 3AA6B 5LXTE 3N9NA 3RC3A 3I9WA 2OA5A 1MMNA 4CQIA 3OKQA 5CGMA 1JNZA 2IW5B 4U74A 2W00A 2YN6A 4B3RT 5TAOA 4U3CA 1N34T 4COFA 4EIWA 1HFAA 1KK7A 3MA9A 2WU5A 5ABEA 1HNZT 2FJEA 2H89A 5HXEA 3RIUA 4JLEA 5JR9A 4HGAA 3BQIA 2FJBA 2BDEA 4HFVA 4O8SA 3WI3A 3C4ZA 2C5IT 2XQAA 4QH5A 5L3FB 2JRKA 3O1IA 4ASKA 1KNRA 2CXDA 2V6YB 2NW9A 2W2UA 3QUJA 1UURA 3C98B 4G63A 3ZT7A 2PTFA 2BS2A 3BQKA 3JCFA 3K3QC 1UX5A 4YTNA 3I0QA 3RYIE 1YKHB 3NKZA 2KT9A 2LSGA 4MALA 4MFRA 1SHZC 1MNEA 3RIAA 2CEAA 2ACXA 2ZM6T 3Q9DA 4HN9A 3ZN1B 2J1DG 4EGWA 4WYVA 3CIRA 4TX5A 4DR3T 4HEAA 4AXPA 1N36T 3C50A 3L8RA 3FB2A 2VVNA 5ABFB 3AEEA 3PURA 2IHR1 3L09A 1UGOA 2MTQA 4IE4A 4Z91A 3ONLC 5JDQA 3ANWB 4MHCA 1H7CA 1Y64B 1UX4A 2C0SA 3ZMZB 3NBXX 4GKJT 4UVBB 2MAWA 2M6IA 2YINA 5AQSB 2WZIA 4P0AA 3MZKB 3FZMB 4QXBB 3UUMA 4PW8A 1KF6A 2VL8A 1XDOA 5C3JA 4YHJA 2Q9QB 2QGSA 3EDUA 2ZM2A 3FXDB 4TNVA 3R84B 5HWYA 2HN1A 3LBXB 4H9NC 4OHFA 2CRBA 4PJLA 4HFDA 1W09A 5JDNA 1CHUA 3ZMTB 3O9XA 3N2GE 4IDOA 3H3MA 4EB6E 3ZJ1A 3W15B 2ACZA 5JQGE 2D9DA 3AE9A 2MOZA 5A1LA 3NZQA 2KINB 3Q5XA 3T1HT 3EUHA 4EAHA 2A2FX 2WSSV 3ZPOA 1T8BA 3AAEB 2NOXA 1M62A 2NW7A 5IWAT 4IL9A 5FL0A 3A8YC 4AQYT 5LJMA 3N5LA 2PFVA 4MBQA 4ANJA 2YU1A 1LVKA 2XAFB 3HA4A 2LKHA 2R6GF 3K8PC 3PV0F 1YKEB 3CKDA 4GIWA 1D1BA 2WDRA 5LG3A 4ZZCA 2NW8A 1KEYA 5ABHA 3R6NA 2W61A 3AEFA 2X66A 3RLFF 2LLYA 4B3TT 5HEUA 5EK4A 3VKGA 3I9YA 3ZC1A 3LFMA 4JEUB 2KWIB 3AE5A 5J0ZA 2YKSA 3KINB 5FXXA 2BS3A 4Q25A 5C2TA 4JI1T 1QUUA 2X67A 2CHOA 1Z8UA 3TLUA 2BVLA 3U78A 4DBRA 5HEHA 4DR6T 5LA6E 5AFUL 4DIDB 3AA0B 3JC6C 4H63H 4HWDA 4FI5A 1DU2A 2BG9E 2YK0A 3SRZA 2PJQA 3HL6A 2QA7A 4GKKT 2VKHA 5LGTB 3RYHE 1GQEA 4P1NA 4I43B 3O1HA 3TLVA 4LFBT 3UU4A 2HN2A 3ZEFB 3J9X1 5GONE 1IAPA 2V7MA 4KBMB 1LVFA 3EVYA 3UFGA 1J5WA 4ZI7E 2ES0A 4ZOLE 4LMLA 2XHEB 3B13A 5IHYA 4UEMA 2IUBA 2XQ5A 2PG8A 2M6BA 4AQFC 4TUYE 3OTOT 2FJDA 4HTEA 2LHNA 4H9OC 2BS4A 1X79A 2RP4A 5DJQC 1CUNA 3RQUA 4PK6A 3AE6A 2XAJB 5KX5E 2IDOB 4IDNA 2J62A 4DUYT 4AKLA 2UXCT 3B57A 3MJXA 3P50A 5JTGA 2CM0A 1D1CA 2CBIA 2UU9T 2X68A 2W66A 4HWHA 2CHNA 5AQTB 2DNXA 4A56A 3CVRA 4M1PA 2W67A 2UUBT 5HEJA 3PUYF 4U31A 3N9QA 1VCSA 3RX6A 2XM2A 3RC8A 3KFWX 1WYBA 5ABFA 3LK42 4CXXA 4AKRB 3FHNA 4IE7A 4P0BA 4A5XA 4X1KE 2BKPA 1IZNB 4IREA 1WYCA 4ILUA 3VRBA 2V5CA 4ADZA 4ILBA 2JQQA 1J5ET 4YSZA 2BVMA 2D2SA 1WLXA 2XQ7A 3MK7C 5HEOA 4Z90A 4QWNB 4B3ST 4LF5T 2VKDA 2LRLA 3V5SA 3FZLB 3CX7B 4L9IA 2CPTA 2KSRA 3AE2A 3X1DA 4O2AE 2MYSA 1W9RA 2J47A 3UULA 4U7YA 2YOEA 2Q9QA 4DMWA 3PUAA 4N78D 2UXDT 2E9XD 1XNQT 3HKEE 4IL4A 4CZZB 4ZHQE 4NXMT 4QX7B 2V6XA 3KV6A 3LBXA 2I59A 3Q5EA 1KFYA 2VASA 4UF0B 1VOMA 5LG4A 4E7ZA 2KNDA 5LYJE 5J2TE 3AE3A 3DP7A 5FKYA 2WM9A 5H6QB 5AQVB 1MMDA 2WP9A 4ZI3D 2D0TA 4HFIA 3N2KE 4LF4T 2AXDS 1XMQT 4EXTA 4WZXA 3LJCA 4ERRA 4CN6A 4UV9B 2IIUA 3FZFB 5JRCB 4ZS3A 3OVUA 4JBWF 5ABGA 2QVAA 2VQFT 4ZI3C 2N9DA 2XAQB 2F4VT 2XJ7A 3NRYA 2LSIA 2IC6A 4JI7T 3JADA 4WNKA 4DV0T 3CWZB 4LFAT 2YDQA 3AEGA 2CWYA 4DR4T 3UFEA 1L0VA 3M65A 4XAXB 2RPAA 3G06A 4GK5E 2FBWA 1HCIA 4EV6A 2JPFA 3DTOA 5LGUB 2CCQA 4B3MT 2IC9A 1HNWT 1FIOA 5HYAA 1E2AA 3ETUA 4O2BE 1FMVA 4DV1T 5DQWA 4HFEA 4MLKA 3C4WA 2KXPB 3RIUC 4LMKA 1HG2A 5FY0A 2L8KA 3QC9A 3RRWA 2VL0A 4LFCT 2VB6A 1NAFA 3ONJA 4FJOA 1OEDB 2LOPA 4L5GA 5C8YE 2VKJA 2VQET 4QX8B 1HF8A 4H9QC 4PNIA 3KV5A 2WMNA 3UU6A 3PE0A 2D5UA 3CMLA 5BR8T 4J2CA 5FY1A 4ISTA 4UELA 2WY2A 3AE1A 3PJAJ 3DJBA 4BA9A 4OFZA 3N9OA 1BR1A 3NZPA 3U3IA 1YD8G 5EK2A 1WRDA 2CA5A 1LKXA 2H7VC 2LT3A 2WAUA 5L3GB 4X1IE 3NVOA 5AQPB 2WCAA 3TKLB 2HH7A 5HEGA 3AE7A 4JI4T 2LHRA 3VR9A 2WWUA 2EHOA 3ZMUB 2UXNB 1MIYA 5EK3A 2WMOA 1T7SA 5F8PA 3AAAB 5M4YA 5AQKB 2CE7A 2X9XA 3M3ZB 3HKBE 2KWHA 1NWMX 2E9XB 2FUPA 5JREA 4P09A 5AQGB 3IHRA 5HCMA 4YLHA 2KLQA 1U5PA 1HNXT 3PDYA 3GN5B 4U72A 4WBOA 4NXNT 5CA0E 3IA3A 1XDPA 2W4XA 2ZMAA 3C51A 4KUMB 4UXNB 4ZZBA 4NUUA 2J4GA 2LOSA 4IDQA 1D0YA 4DVDA 2E8IA 5L2LA 2E2AA 4DV3T 2BBJA 3EAMA 1ZKEA 1OWAA 2BKOA 3V5UA 1W0AA 5LGNB 4IE6A 3SFDA 3AAIA 5HXRA 3P4WA 5KXJA 4HKAA 2DWGA 5FYMA 3Q2MA 3AE8A 1WFDA 2LSKA 2UUAT 4X20E 4TN7B 2V8SV 3E22E 3P8CD 2Y48B 5LJNA 1G8XA 5FL1A 4AKHA 1I94T 3AXJA 4HFCA 4BJMA 3NWIA 4JI2T 1LRZA 1D1AA 1FMWA 1X9BA 5JR9B 4JI3T 2V7KA 1YQ3A 4UF0A 4YJ3E 1IBLT 4CXYA 1HX8A 5JDMA 3EHZA 3UTKA 1EZ3A 3PTRB 4OYJA 4C90A 3H37A 4GYRA 2ZM0A 4K0KT 2BG9A 1E1HB 3ZKRA 5AQNB 2L9QA 3I1AA 1ZOYA 2V7JA 2QYWA
chains in the Genus database with same CATH topology
3HKCE 5JR9A 4HGAA 3BQIA 1WYCA 3CQGB 4ILUA 4UVAB 2C5KT 4ADZA 2K24A 2JQQA 2V1DB 2BDEA 2BVMA 3P7IA 2P9BA 4HFVA 4O8SA 1MNDA 2D2SA 3C4ZA 4OK0A 3WI3A 2C5IT 1WLXA 4GYSA 5L3FB 3MK7C 2EHOC 2JRKA 2Y8DA 3O1IA 4ASKA 4KMCA 4QWNB 2CXDA 3KBTA 3N9MA 3OYZA 2JJ9A 5LHGB 2NW9A 2VKDA 1G73A 2ZLYA 3V5SA 5L3BB 3QUJA 3C98B 3CX7B 4F6RC 4G63A 4AI6A 4L9IA 5JDLA 3O4XE 3ZMSB 2ODVA 4O2AE 2MYSA 3BQKA 4TZ4C 3SS1A 2HPJA 3ESLA 4QHOA 3K3QC 1UX5A 5L3EB 3J7Yq 3UULA 3I0QA 2BZBA 3RYIE 1YKHB 2Q9QA 4DMWA 2KT9A 2LSGA 3PUAA 4MALA 4MFRA 1SHZC 4N78D 2C5JA 4NUVA 5KDMC 4CXWA 3ZJ2A 4PAGA 1MNEA 2E9XD 5LCYA 5KMGP 2CEAA 3HKEE 4CZZB 4ZHQE 2ACXA 1V9DA 4QX7B 3CX6B 3KV6A 3LBXA 2I59A 3ZYMA 3VHLA 3Q9DA 4HN9A 4PJJA 3N9LA 2VASA 1MMAA 4UF0B 3ZN1B 1VOMA 5LG4A 1HTJF 2DI4A 4O4JE 2J1DG 4E7ZA 2KNDA 4UVCB 3WAKA 5LYJE 5J2TE 4DBQA 3F2EA 3DP7A 3PUGA 4AQGA 4H63V 3PU8A 1BR2A 4B6XA 4TX5A 2WM9A 4HEAA 4AXPA 5H6QB 4O4IE 4IGUA 1MMDA 3C50A 3RYCE 2YU2A 1ZEEA 4AKGA 3FB2A 1YW0A 3RH3A 3QK6A 3IBPA 2WBLA 4ZI3D 2CMRA 3PURA 2D0TA 4GK0E 5LHIB 4DMVA 3LK2B 3L09A 3N2KE 3Q5WA 2X9YA 4BAYB 1S94A 4I50E 4H9PC 2MTQA 4EXTA 4TV9E 4I4TE 2X9HA 2D0UA 3PU3A 3HI2A 4IE4A 5F3JA 3L3PA 2NTXA 3LJCA 4ERRA 2NWBA 5JDQA 4UV9B 3ANWB 2YEVC 4MHCA 1H7CA 1Y64B 2XAHB 3KVBA 5JRCB 1UX4A 2C0SA 4ZS3A 3ZMZB 3NBXX 3PUSA 1MIWA 4UVBB 4ZI3C 4L0RA 2KMFA 2YINA 4K0UA 5HXSA 2KZ7B 3IEEA 1ZV4X 2N9DA 2XAQB 3D0TA 2LSJA 4AKIA 4PK4A 4P0AA 3RYFE 3MZKB 3EDVA 2N2NA 2LJLA 3NRYA 2LSIA 2XASB 1MMGA 3LG7A 3UT5E 2IC6A 4QXBB 3AB3B 4QXHB 4JEHB 3ZC0A 4OYKA 4WNKA 3UUMA 2VK9A 4PW8A 2VL8A 1MIVA 3CWZB 2L3LA 3RPUA 4CI2B 2CWYA 4YHJA 4YFSA 1S35A 3I0OA 2Q9QB 3RKOA 2QGSA 3O1JA 3EDUA 5JDHA 3JC6D 3UFEA 3FBZA 2CXFA 2ZM2A 5H6RB 3ANWA 2G0UA 1B7TA 3M65A 3FXDB 1ZHCA 3HR0A 1QSDA 5JRCA 4XAXB 5DQVA 3R84B 4E7SA 2CXLA 5JVDE 5HWYA 3UUNA 3C64A 3LBXB 4GK5E 1HCIA 5J1GA 4H9NC 4IHJE 1AJ3A 2JPFA 3ZMVB 3DTOA 5LGUB 4OHFA 4PJLA 2CCQA 1D0XA 2IC9A 5JDNA 5JDFA 1FIOA 3ZMTB 2A3DA 3CQXC 3O9XA 2W63A 3KDSE 3N2GE 5HYAA 3ETUA 3N2OA 1SA0E 4O2BE 4EB6E 1FMVA 4AQFA 5DQWA 3ZJ1A 3W15B 4PK5A 5JQGE 4MLKA 3C4WA 2KXPB 2M67A 3ZCJA 1HG2A 2H3RA 5FXWA 5FXZA 5LNKA 2MOZA 5A1LA 3NZQA 5FY0A 2KINB 2VKOA 4DO0A 4CI3B 4UIGA 2PBIA 3N9PA 3FBLA 3Q5XA 2Q9QD 2L8KA 2VWAA 2CWOA 3QC9A 3EUHA 4EAHA 3E0ZA 2JMKA 2A2FX 3CQCB 3RRWA 3HKDE 2VB6A 1NAFA 2WSSV 1BR4A 4X1YE 4FJOA 3ZPOA 3AAEB 2XQYA 3IF8B 2NOXA 2LOPA 2NW7A 2HPLA 3F31A 4L5GA 5LBMA 1UCUA 5BMVE 2W62A 5C8YE 2XUEA 3KV9A 2VKJA 2NTYA 3ZCIA 3ZYKA 5LJMA 3N5LA 2K9AA 4O4HE 2ODUA 2PFVA 4MBQA 1HF8A 4QX8B 4Z8XA 3CX8B 4ANJA 3PUQA 2V26A 2E9XC 1LVKA 2YU1A 3GN5A 4H9QC 2XAFB 4PNIA 3HA4A 5JH7E 3KV5A 3RRCA 5DABA 2WMNA 3K8PC 3PE0A 5FNVE 3SOLA 3ZLIA 1YKEB 3CKDA 5ETWA 2D5UA 3CMLA 4H9SE 2N1GA 2EHOB 4J2CA 4GIWA 1D1BA 5FY1A 4JUYA 4EOZB 4IDZA 2LSYA 1WR6A 4ISTA 4UELA 2NW8A 3DJBA 1OXZA 4BA9A 4OFZA 5IYZE 4ZI2D 3R6NA 4YJ2E 3N9OA 2W61A 1BR1A 3NZPA 2CLYC 2X66A 2SPCA 3UUXB 2DWKA 3U3IA 1YD8G 2DLRA 4IIJE 5EK4A 5EK2A 1WRDA 2CA5A 1LKXA 2H7VC 1Z0PA 3VKGA 2LT3A 3AVRA 2WAUA 5HXCA 3S4UA 3I9YA 2MBGA 5ADXL 5L3GB 4X1IE 5LHHB 3ZC1A 4CI1B 3LFMA 5CB4E 3C4XA 4G2AA 3TKLB 3GWHA 2HH7A 2H7OA 4JEUB 4ISSA 2LHRA 2KWIB 2WWUA 4C91A 1IJ5A 2EHOA 2ZM8A 3KV4A 3ZMUB 4EZ4A 2UXNB 4ZI2C 5FMNA 2LM9A 2XAGB 3H3AA 1MIYA 3BK9A 3KINB 5EK3A 2LE8A 5FXXA 3SWHA 3OBVE 5LBQB 5E0OA 2IAKA 4I55E 2WMOA 5F8PA 4WBNE 3AAAB 5M4YA 2CE7A 1QUUA 2X67A 2X9XA 3BQLA 4PJMA 3HKBE 1US7B 3ONXA 2KWHA 3ZN0B 5HXHA 1NWMX 2E9XB 4XBFB 5JREA 4EZHA 5LP6E 4P09A 2BVLA 3U78A 5CA1E 4DBRA 1HS7A 4PFOA 5LA6E 4UV8B 4O4LE 5AFUL 2DHRA 3IHRA 4XZCA 4KP3C 5FXVA 1VRBA 4YLHA 2V7LA 1T98A 5HAXA 2KLQA 3AA0B 1FEWA 3JC6C 4H63H 1U5PA 4FI5A 3PDYA 2NP9A 2YK0A 3GN5B 2PJQA 3HL6A 3SRZA 2QA7A 4U72A 2VKHA 4WBOA 2GK9A 5JR9C 5LGTB 2CLYB 2RA1A 3RYHE 3A5XA 5CA0E 4I43B 3O1HA 3K3OA 3KVAA 3VU7H 2X9WA 4QKNA 3WAJA 3MACA 3K3NA 2ZMAA 2DCFA 3C51A 4KUMB 2UXXB 5J2UE 2E9XA 2X0LB 4UXNB 3ZEFB 4NUUA 5FP3A 3J9X1 2Z6EA 5GONE 1IAPA 2V7MA 3MXZA 4DNDA 5L3DB 2LOSA 4KBMB 1D0YA 4DVDA 4HE8A 1KNZA 2E8IA 4EYYR 1LVFA 3EVYA 5L3CB 2B1EA 2ES0A 4ZOLE 4ZI7E 5L2LA 3FXEB 3F57A 2LEHA 5JDGA 2XHEB 3LK3B 3B13A 5IHYA 4IE5A 4UEMA 5HWXA 3ZYLA 4IE0A 2PG8A 4GOUA 5LOVE 1ZKEA 3AA1B 4TUYE 4AQFC 1OWAA 3V5UA 3AVSA 1HG5A 4HTEA 3GA8A 1U4QA 5LGNB 2LHNA 2Q9QC 4H9OC 4IE6A 1X79A 3AAIA 3KBUA 5HXRA 4HKAA 2RP4A 5DJQC 2V7IA 1CUNA 2A72A 2DWGA 5FYMA 4PK6A 3VKHA 3Q2MA 3T8OA 4ZS2A 2K5BB 2XAJB 5KX5E 4AKLA 2LSKA 4TV8E 4X20E 3B57A 4TN7B 3MJXA 5EZYE 3E22E 5FY7A 3P8CD 2Y48B 3OJAA 2CM0A 1G8XA 5LJNA 1D1CA 3AA7B 4PJNA 2K48A 4AKHA 2X68A 4V1Av 3E08A 3AA6B 3CPZA 3OYXA 5LXTE 2DNXA 3N9NA 4BJMA 4A56A 4BJNA 3RC3A 1LRZA 3I9WA 1D1AA 3CVRA 2OA5A 1IJ6A 1FMWA 1MMNA 4M1PA 4CQIA 3OKQA 5JR9B 2V7KA 4UF0A 4YJ3E 1BR0A 4CXYA 1HX8A 5JDMA 4H9RC 2IW5B 3UTKA 4U74A 2W00A 3N9QA 5TAOA 3RX6A 1EZ3A 3RC8A 3NRXA 3PTRB 4OYJA 3KFWX 4QXCB 1WYBA 1O3XA 3GMIA 2EHOD 3MKDA 4C90A 3ETVA 4EIWA 3H37A 4GYRA 3LK42 4CXXA 4AKRB 2ZM0A 1HFAA 3FHNA 1KK7A 2W0GA 1E1HB 3MA9A 4IE7A 4P0BA 2JMHA 4X1KE 2L9QA 3I1AA 2XTLA 5HXEA 2V7JA 4EYUA 4WW0A 1IZNB 2X51A 2Y6XA 1D0ZA 4JLEA 4PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKE B;  1YKH B; 
#chains in the Genus database with same CATH topology
 3CQG B;  2K24 A;  2V1D B;  3P4P A;  4GYS A;  4IDP A;  4QH1 A;  2BKN A;  3KBT A;  3N9M A;  2JJ9 A;  2ZLY A;  2QRX A;  5JDL A;  2ODV A;  2X0H A;  3SS1 A;  2HPJ A;  3ESL A;  4QHO A;  4YSX A;  2HHH T;  2BZB A;  1IBM T;  2C5J A;  1N33 T;  2XQ3 A;  3ZJ2 A;  5LCY A;  5KMG P;  3FZK B;  1V9D A;  3VHL A;  2V6Y A;  4X66 T;  3L39 A;  4U7I A;  2DI4 A;  4O4J E;  3PUZ F;  2AE9 A;  4OX9 T;  2I6H A;  3F2E A;  4H63 V;  3PU8 A;  3PUX F;  4O4I E;  4IGU A;  5AQF B;  3RYC E;  2YU2 A;  4AKG A;  3QK6 A;  3IBP A;  2XPK A;  2WBL A;  5LHI B;  4DMV A;  3LK2 B;  3Q5W A;  2X9Y A;  3P4Q A;  4BAY B;  4I50 E;  4H9P C;  3ZT5 A;  4I4T E;  3PU3 A;  5LMU T;  1SE7 A;  5F3J A;  3L3P A;  2OLT A;  2YEV C;  3KVB A;  2XAH B;  1NEK A;  3PUS A;  1MIW A;  3P4S A;  4L0R A;  3A7M A;  2KMF A;  3JAE A;  4K0U A;  5HXS A;  2KZ7 B;  1ZV4 X;  3RYF E;  2FJA A;  2LJL A;  1MMG A;  3UT5 E;  1OED C;  4JEH B;  3ZC0 A;  4OYK A;  1MIV A;  2L3L A;  3RPU A;  2WQY A;  4CI2 B;  4YFS A;  4X62 T;  3O1J A;  5JDH A;  1KNP A;  3ANW A;  4YSY A;  2G0U A;  5L4H A;  1QSD A;  4E7S A;  5JVD E;  3ABV A;  3C64 A;  3PUV F;  3ZMV B;  3AEB A;  1J1J A;  2YDR A;  2XQ4 A;  5L4E A;  5JDF A;  2A3D A;  3CQX C;  3KDS E;  1YQ4 A;  1SA0 E;  5AQJ B;  4LF7 T;  2XY8 B;  3FZH B;  4JI8 T;  4KX6 A;  5FXZ A;  4HFH A;  3RQW A;  4LF9 T;  3CK6 A;  4DO0 A;  4CI3 B;  4UIG A;  2PBI A;  3FBL A;  4DV4 T;  3TLT A;  2Q9Q D;  2CWO A;  3RF1 A;  3E0Z A;  1XNR T;  1BR4 A;  3IF8 B;  3P4R A;  1UCU A;  3KV9 A;  2NTY A;  3ZCI A;  3ZYK A;  4DR2 T;  2K9A A;  4HWC A;  3CX8 B;  3AED A;  1VCT A;  2E9X C;  2K3W A;  2V26 A;  3GN5 A;  3TLW A;  4LF6 T;  5AQL B;  5JH7 E;  3RRC A;  3SOL A;  4JUY A;  4IDZ A;  2LSY A;  5IYZ E;  4ZXL A;  3ZST A;  5AQH B;  4DV2 T;  2DWK A;  2DLR A;  2YDS A;  4TWD A;  1ZP0 A;  5HXC A;  3S4U A;  5ADX L;  2MBG A;  4YTM A;  4CI1 B;  2JIW A;  1UK5 A;  2H7O A;  2XQ6 A;  3AEC A;  1IJ5 A;  1HX1 B;  5FMN A;  3H3A A;  1I6Z A;  4AIU A;  3SWH A;  5E0O A;  4I55 E;  2JQ9 A;  1WCR A;  4DV7 T;  5L47 A;  3BQL A;  4PJM A;  3ONX A;  5HXH A;  2DL1 A;  4EZH A;  5LP6 E;  5CA1 E;  4PFO A;  4ILA A;  1JNR A;  4XZC A;  2V7L A;  1T98 A;  1FEW A;  3ZT6 A;  2NP9 A;  3RI5 A;  5JR9 C;  2CLY B;  2RA1 A;  3A5X A;  3UUB A;  3KVA A;  5IUX A;  3VU7 H;  4F8H A;  3UQ7 A;  2X9W A;  3WAJ A;  3MAC A;  3K3N A;  2DCF A;  4DND A;  5L3D B;  4HE8 A;  1HR0 T;  4EYY R;  4X5T A;  2B1E A;  3F57 A;  5JDG A;  4IE5 A;  1E7P A;  3ZYL A;  4IE0 A;  4GOU A;  5LOV E;  1HG5 A;  2VUR A;  3GA8 A;  3KBU A;  1FJG T;  2V7I A;  3AEA A;  3T8O A;  4ZS2 A;  2K5B B;  4TV8 E;  3QNU A;  2WDV A;  5EZY E;  4KI0 F;  1QLB A;  4PJN A;  4V1A v;  3CPZ A;  3OYX A;  4BJN A;  4YHH T;  5LMN T;  4EEB A;  1IJ6 A;  2LKG A;  3LDQ B;  3UQ4 A;  2H88 A;  1BR0 A;  4H9R C;  4KHZ F;  2XQ8 A;  4JI5 T;  4AIS A;  2CBJ A;  3NRX A;  3VRA A;  4QXC B;  1O3X A;  3GMI A;  2EHO D;  3MKD A;  3ETV A;  2W0G A;  1WR0 A;  2JMH A;  4DR1 T;  1XMO T;  2XTL A;  4EYU A;  4WW0 A;  2X51 A;  3QB5 A;  2Y6X A;  1D0Z A;  4PFP A;  3HKC E;  5HCJ A;  4UVA B;  3RIF A;  2C5K T;  3P7I A;  2P9B A;  4OK0 A;  4IT4 A;  1MND A;  1UUS A;  2EHO C;  2Y8D A;  4YTP A;  4KMC A;  4CN1 A;  3OYZ A;  4JV5 T;  5LHG B;  3UU3 A;  1G73 A;  5L3B B;  2BBH A;  2JQK A;  4F6R C;  4AI6 A;  3O4X E;  3ZMS B;  4TZ4 C;  2LM2 A;  5L3E B;  3J7Y q;  3K1S A;  2XQ9 A;  4NUV A;  5AQR B;  5KDM C;  4CXW A;  4PAG A;  2UUC T;  2UXB T;  4YT0 A;  3CX6 B;  3ZYM A;  1M7K A;  4TNW A;  4UR9 A;  5FVK A;  4PJJ A;  3PJA A;  5AQI B;  3N9L A;  1MMA A;  1HTJ F;  4UVC B;  3WAK A;  4DBQ A;  3PUG A;  4AQG A;  1BR2 A;  4B6X A;  3TLS A;  1NEN A;  4DUZ T;  1XZY A;  2JQH A;  1XWM A;  1ZEE A;  4JI0 T;  2MPK A;  1YW0 A;  3AE4 A;  2V5D A;  3EAB A;  3RH3 A;  5AQO B;  2CMR A;  4GK0 E;  2E5V A;  2WWV A;  1S94 A;  2NR4 A;  4TV9 E;  2X9H A;  2D0U A;  4U2Z A;  3HI2 A;  2NTX A;  3UU8 A;  2NWB A;  1SUM B;  2XM1 A;  2WU2 A;  3Q5D A;  2OV9 A;  3IEE A;  1Y01 A;  3D0T A;  2LSJ A;  4AKI A;  4PK4 A;  3EDV A;  2N2N A;  2XAS B;  3LG7 A;  4DR5 T;  3RKG A;  3AB3 B;  4QXH B;  4HFB A;  4A97 A;  4ILC A;  2VK9 A;  1S35 A;  3I0O A;  3RKO A;  3JC6 D;  3FBZ A;  2CXF A;  5H6R B;  1B7T A;  1ZHC A;  3HR0 A;  2WZH A;  5JRC A;  5DQV A;  4I0U A;  2CXL A;  3UUN A;  2WB5 A;  5J1G A;  1W0B A;  4NIQ A;  4IHJ E;  1AJ3 A;  4JYA T;  1YXR A;  1D0X A;  2BG9 C;  2W63 A;  3N2O A;  4CN4 A;  4X64 T;  4AQF A;  4PK5 A;  4EED A;  4KHP T;  2M67 A;  3ZCJ A;  1IBK T;  3QOF A;  2H3R A;  5FXW A;  5LNK A;  2VKO A;  3N9P A;  3B5M A;  2VWA A;  4NPP A;  2XZE A;  2JMK A;  3CQC B;  3HKD E;  4X1Y E;  2XQY A;  2HPL A;  3F31 A;  5LBM A;  3PUW F;  5BMV E;  2W62 A;  2XUE A;  5LB7 B;  4O4H E;  4Z8X A;  2ODU A;  3PUQ A;  5DAB A;  5FNV E;  3ZLI A;  2IML A;  5AQM B;  5ETW A;  4HWI B;  4H9S E;  2N1G A;  2EHO B;  4EOZ B;  2B76 A;  1WR6 A;  1T72 A;  5AQQ B;  1OXZ A;  4ZI2 D;  4A98 A;  4YJ2 E;  2E5L T;  4TWF A;  2CLY C;  2SPC A;  1OED A;  3UUX B;  4IIJ E;  1Z0P A;  3AVR A;  3JAF A;  2I0M A;  5LHH B;  5CB4 E;  3C4X A;  4G2A A;  4ZEY A;  3EI0 A;  3GWH A;  4U33 A;  3VR8 A;  4ISS A;  4C91 A;  4YY3 T;  2ZM8 A;  3KV4 A;  4EZ4 A;  2X0Y A;  4ZI2 C;  2LM9 A;  2XAG B;  3ZSS A;  5CFB A;  3BK9 A;  2LRK A;  2LE8 A;  2XSB A;  1OED E;  3OBV E;  5LBQ B;  2IAK A;  4LMJ A;  3RHW A;  4WBN E;  4LF8 T;  1R8I A;  4YXD A;  1US7 B;  3ZN0 B;  2WS3 A;  3OPC A;  1N32 T;  4XBF B;  4HWF A;  4DR7 T;  1HS7 A;  4UV8 B;  2WDQ A;  4O4L E;  2DHR A;  2VVS A;  5FXV A;  4KP3 C;  1VRB A;  5HAX A;  5CJ5 A;  5FVL A;  2GK9 A;  3SFE A;  2XSA A;  3K3O A;  3QB5 K;  3LSV A;  4QKN A;  4JI6 T;  2UXX B;  5J2U E;  2E9X A;  2X0L B;  5FP3 A;  2Z6E A;  3MXZ A;  1KNZ A;  5L3C B;  5F5W A;  4QH4 A;  2A9U A;  3FXE B;  2LEH A;  3LK3 B;  3AXJ B;  4DV5 T;  3T1Y T;  5HWX A;  3AA1 B;  3AVS A;  5AQU B;  1U4Q A;  2Q9Q C;  3UU5 A;  3RGL A;  3VKH A;  2A72 A;  4U2Y A;  4TWH A;  5FY7 A;  2BG9 B;  4X65 T;  3OJA A;  3AA7 B;  2K48 A;  4DV6 T;  3E08 A;  3AA6 B;  5LXT E;  3N9N A;  3RC3 A;  3I9W A;  2OA5 A;  1MMN A;  4CQI A;  3OKQ A;  5CGM A;  1JNZ A;  2IW5 B;  4U74 A;  2W00 A;  2YN6 A;  4B3R T;  5TAO A;  4U3C A;  1N34 T;  4COF A;  4EIW A;  1HFA A;  1KK7 A;  3MA9 A;  2WU5 A;  5ABE A;  1HNZ T;  2FJE A;  2H89 A;  5HXE A;  3RIU A;  4JLE A;  5JR9 A;  4HGA A;  3BQI A;  2FJB A;  2BDE A;  4HFV A;  4O8S A;  3WI3 A;  3C4Z A;  2C5I T;  2XQA A;  4QH5 A;  5L3F B;  2JRK A;  3O1I A;  4ASK A;  1KNR A;  2CXD A;  2V6Y B;  2NW9 A;  2W2U A;  3QUJ A;  1UUR A;  3C98 B;  4G63 A;  3ZT7 A;  2PTF A;  2BS2 A;  3BQK A;  3JCF A;  3K3Q C;  1UX5 A;  4YTN A;  3I0Q A;  3RYI E;  1YKH B;  3NKZ A;  2KT9 A;  2LSG A;  4MAL A;  4MFR A;  1SHZ C;  1MNE A;  3RIA A;  2CEA A;  2ACX A;  2ZM6 T;  3Q9D A;  4HN9 A;  3ZN1 B;  2J1D G;  4EGW A;  4WYV A;  3CIR A;  4TX5 A;  4DR3 T;  4HEA A;  4AXP A;  1N36 T;  3C50 A;  3L8R A;  3FB2 A;  2VVN A;  5ABF B;  3AEE A;  3PUR A;  2IHR 1;  3L09 A;  1UGO A;  2MTQ A;  4IE4 A;  4Z91 A;  3ONL C;  5JDQ A;  3ANW B;  4MHC A;  1H7C A;  1Y64 B;  1UX4 A;  2C0S A;  3ZMZ B;  3NBX X;  4GKJ T;  4UVB B;  2MAW A;  2M6I A;  2YIN A;  5AQS B;  2WZI A;  4P0A A;  3MZK B;  3FZM B;  4QXB B;  3UUM A;  4PW8 A;  1KF6 A;  2VL8 A;  1XDO A;  5C3J A;  4YHJ A;  2Q9Q B;  2QGS A;  3EDU A;  2ZM2 A;  3FXD B;  4TNV A;  3R84 B;  5HWY A;  2HN1 A;  3LBX B;  4H9N C;  4OHF A;  2CRB A;  4PJL A;  4HFD A;  1W09 A;  5JDN A;  1CHU A;  3ZMT B;  3O9X A;  3N2G E;  4IDO A;  3H3M A;  4EB6 E;  3ZJ1 A;  3W15 B;  2ACZ A;  5JQG E;  2D9D A;  3AE9 A;  2MOZ A;  5A1L A;  3NZQ A;  2KIN B;  3Q5X A;  3T1H T;  3EUH A;  4EAH A;  2A2F X;  2WSS V;  3ZPO A;  1T8B A;  3AAE B;  2NOX A;  1M62 A;  2NW7 A;  5IWA T;  4IL9 A;  5FL0 A;  3A8Y C;  4AQY T;  5LJM A;  3N5L A;  2PFV A;  4MBQ A;  4ANJ A;  2YU1 A;  1LVK A;  2XAF B;  3HA4 A;  2LKH A;  2R6G F;  3K8P C;  3PV0 F;  1YKE B;  3CKD A;  4GIW A;  1D1B A;  2WDR A;  5LG3 A;  4ZZC A;  2NW8 A;  1KEY A;  5ABH A;  3R6N A;  2W61 A;  3AEF A;  2X66 A;  3RLF F;  2LLY A;  4B3T T;  5HEU A;  5EK4 A;  3VKG A;  3I9Y A;  3ZC1 A;  3LFM A;  4JEU B;  2KWI B;  3AE5 A;  5J0Z A;  2YKS A;  3KIN B;  5FXX A;  2BS3 A;  4Q25 A;  5C2T A;  4JI1 T;  1QUU A;  2X67 A;  2CHO A;  1Z8U A;  3TLU A;  2BVL A;  3U78 A;  4DBR A;  5HEH A;  4DR6 T;  5LA6 E;  5AFU L;  4DID B;  3AA0 B;  3JC6 C;  4H63 H;  4HWD A;  4FI5 A;  1DU2 A;  2BG9 E;  2YK0 A;  3SRZ A;  2PJQ A;  3HL6 A;  2QA7 A;  4GKK T;  2VKH A;  5LGT B;  3RYH E;  1GQE A;  4P1N A;  4I43 B;  3O1H A;  3TLV A;  4LFB T;  3UU4 A;  2HN2 A;  3ZEF B;  3J9X 1;  5GON E;  1IAP A;  2V7M A;  4KBM B;  1LVF A;  3EVY A;  3UFG A;  1J5W A;  4ZI7 E;  2ES0 A;  4ZOL E;  4LML A;  2XHE B;  3B13 A;  5IHY A;  4UEM A;  2IUB A;  2XQ5 A;  2PG8 A;  2M6B A;  4AQF C;  4TUY E;  3OTO T;  2FJD A;  4HTE A;  2LHN A;  4H9O C;  2BS4 A;  1X79 A;  2RP4 A;  5DJQ C;  1CUN A;  3RQU A;  4PK6 A;  3AE6 A;  2XAJ B;  5KX5 E;  2IDO B;  4IDN A;  2J62 A;  4DUY T;  4AKL A;  2UXC T;  3B57 A;  3MJX A;  3P50 A;  5JTG A;  2CM0 A;  1D1C A;  2CBI A;  2UU9 T;  2X68 A;  2W66 A;  4HWH A;  2CHN A;  5AQT B;  2DNX A;  4A56 A;  3CVR A;  4M1P A;  2W67 A;  2UUB T;  5HEJ A;  3PUY F;  4U31 A;  3N9Q A;  1VCS A;  3RX6 A;  2XM2 A;  3RC8 A;  3KFW X;  1WYB A;  5ABF A;  3LK4 2;  4CXX A;  4AKR B;  3FHN A;  4IE7 A;  4P0B A;  4A5X A;  4X1K E;  2BKP A;  1IZN B;  4IRE A;  1WYC A;  4ILU A;  3VRB A;  2V5C A;  4ADZ A;  4ILB A;  2JQQ A;  1J5E T;  4YSZ A;  2BVM A;  2D2S A;  1WLX A;  2XQ7 A;  3MK7 C;  5HEO A;  4Z90 A;  4QWN B;  4B3S T;  4LF5 T;  2VKD A;  2LRL A;  3V5S A;  3FZL B;  3CX7 B;  4L9I A;  2CPT A;  2KSR A;  3AE2 A;  3X1D A;  4O2A E;  2MYS A;  1W9R A;  2J47 A;  3UUL A;  4U7Y A;  2YOE A;  2Q9Q A;  4DMW A;  3PUA A;  4N78 D;  2UXD T;  2E9X D;  1XNQ T;  3HKE E;  4IL4 A;  4CZZ B;  4ZHQ E;  4NXM T;  4QX7 B;  2V6X A;  3KV6 A;  3LBX A;  2I59 A;  3Q5E A;  1KFY A;  2VAS A;  4UF0 B;  1VOM A;  5LG4 A;  4E7Z A;  2KND A;  5LYJ E;  5J2T E;  3AE3 A;  3DP7 A;  5FKY A;  2WM9 A;  5H6Q B;  5AQV B;  1MMD A;  2WP9 A;  4ZI3 D;  2D0T A;  4HFI A;  3N2K E;  4LF4 T;  2AXD S;  1XMQ T;  4EXT A;  4WZX A;  3LJC A;  4ERR A;  4CN6 A;  4UV9 B;  2IIU A;  3FZF B;  5JRC B;  4ZS3 A;  3OVU A;  4JBW F;  5ABG A;  2QVA A;  2VQF T;  4ZI3 C;  2N9D A;  2XAQ B;  2F4V T;  2XJ7 A;  3NRY A;  2LSI A;  2IC6 A;  4JI7 T;  3JAD A;  4WNK A;  4DV0 T;  3CWZ B;  4LFA T;  2YDQ A;  3AEG A;  2CWY A;  4DR4 T;  3UFE A;  1L0V A;  3M65 A;  4XAX B;  2RPA A;  3G06 A;  4GK5 E;  2FBW A;  1HCI A;  4EV6 A;  2JPF A;  3DTO A;  5LGU B;  2CCQ A;  4B3M T;  2IC9 A;  1HNW T;  1FIO A;  5HYA A;  1E2A A;  3ETU A;  4O2B E;  1FMV A;  4DV1 T;  5DQW A;  4HFE A;  4MLK A;  3C4W A;  2KXP B;  3RIU C;  4LMK A;  1HG2 A;  5FY0 A;  2L8K A;  3QC9 A;  3RRW A;  2VL0 A;  4LFC T;  2VB6 A;  1NAF A;  3ONJ A;  4FJO A;  1OED B;  2LOP A;  4L5G A;  5C8Y E;  2VKJ A;  2VQE T;  4QX8 B;  1HF8 A;  4H9Q C;  4PNI A;  3KV5 A;  2WMN A;  3UU6 A;  3PE0 A;  2D5U A;  3CML A;  5BR8 T;  4J2C A;  5FY1 A;  4IST A;  4UEL A;  2WY2 A;  3AE1 A;  3PJA J;  3DJB A;  4BA9 A;  4OFZ A;  3N9O A;  1BR1 A;  3NZP A;  3U3I A;  1YD8 G;  5EK2 A;  1WRD A;  2CA5 A;  1LKX A;  2H7V C;  2LT3 A;  2WAU A;  5L3G B;  4X1I E;  3NVO A;  5AQP B;  2WCA A;  3TKL B;  2HH7 A;  5HEG A;  3AE7 A;  4JI4 T;  2LHR A;  3VR9 A;  2WWU A;  2EHO A;  3ZMU B;  2UXN B;  1MIY A;  5EK3 A;  2WMO A;  1T7S A;  5F8P A;  3AAA B;  5M4Y A;  5AQK B;  2CE7 A;  2X9X A;  3M3Z B;  3HKB E;  2KWH A;  1NWM X;  2E9X B;  2FUP A;  5JRE A;  4P09 A;  5AQG B;  3IHR A;  5HCM A;  4YLH A;  2KLQ A;  1U5P A;  1HNX T;  3PDY A;  3GN5 B;  4U72 A;  4WBO A;  4NXN T;  5CA0 E;  3IA3 A;  1XDP A;  2W4X A;  2ZMA A;  3C51 A;  4KUM B;  4UXN B;  4ZZB A;  4NUU A;  2J4G A;  2LOS A;  4IDQ A;  1D0Y A;  4DVD A;  2E8I A;  5L2L A;  2E2A A;  4DV3 T;  2BBJ A;  3EAM A;  1ZKE A;  1OWA A;  2BKO A;  3V5U A;  1W0A A;  5LGN B;  4IE6 A;  3SFD A;  3AAI A;  5HXR A;  3P4W A;  5KXJ A;  4HKA A;  2DWG A;  5FYM A;  3Q2M A;  3AE8 A;  1WFD A;  2LSK A;  2UUA T;  4X20 E;  4TN7 B;  2V8S V;  3E22 E;  3P8C D;  2Y48 B;  5LJN A;  1G8X A;  5FL1 A;  4AKH A;  1I94 T;  3AXJ A;  4HFC A;  4BJM A;  3NWI A;  4JI2 T;  1LRZ A;  1D1A A;  1FMW A;  1X9B A;  5JR9 B;  4JI3 T;  2V7K A;  1YQ3 A;  4UF0 A;  4YJ3 E;  1IBL T;  4CXY A;  1HX8 A;  5JDM A;  3EHZ A;  3UTK A;  1EZ3 A;  3PTR B;  4OYJ A;  4C90 A;  3H37 A;  4GYR A;  2ZM0 A;  4K0K T;  2BG9 A;  1E1H B;  3ZKR A;  5AQN B;  2L9Q A;  3I1A A;  1ZOY A;  2V7J A;  2QYW A; 
#chains in the Genus database with same CATH homology
 3HKC E;  5JR9 A;  4HGA A;  3BQI A;  1WYC A;  3CQG B;  4ILU A;  4UVA B;  2C5K T;  4ADZ A;  2K24 A;  2JQQ A;  2V1D B;  2BDE A;  2BVM A;  3P7I A;  2P9B A;  4HFV A;  4O8S A;  1MND A;  2D2S A;  3C4Z A;  4OK0 A;  3WI3 A;  2C5I T;  1WLX A;  4GYS A;  5L3F B;  3MK7 C;  2EHO C;  2JRK A;  2Y8D A;  3O1I A;  4ASK A;  4KMC A;  4QWN B;  2CXD A;  3KBT A;  3N9M A;  3OYZ A;  2JJ9 A;  5LHG B;  2NW9 A;  2VKD A;  1G73 A;  2ZLY A;  3V5S A;  5L3B B;  3QUJ A;  3C98 B;  3CX7 B;  4F6R C;  4G63 A;  4AI6 A;  4L9I A;  5JDL A;  3O4X E;  3ZMS B;  2ODV A;  4O2A E;  2MYS A;  3BQK A;  4TZ4 C;  3SS1 A;  2HPJ A;  3ESL A;  4QHO A;  3K3Q C;  1UX5 A;  5L3E B;  3J7Y q;  3UUL A;  3I0Q A;  2BZB A;  3RYI E;  1YKH B;  2Q9Q A;  4DMW A;  2KT9 A;  2LSG A;  3PUA A;  4MAL A;  4MFR A;  1SHZ C;  4N78 D;  2C5J A;  4NUV A;  5KDM C;  4CXW A;  3ZJ2 A;  4PAG A;  1MNE A;  2E9X D;  5LCY A;  5KMG P;  2CEA A;  3HKE E;  4CZZ B;  4ZHQ E;  2ACX A;  1V9D A;  4QX7 B;  3CX6 B;  3KV6 A;  3LBX A;  2I59 A;  3ZYM A;  3VHL A;  3Q9D A;  4HN9 A;  4PJJ A;  3N9L A;  2VAS A;  1MMA A;  4UF0 B;  3ZN1 B;  1VOM A;  5LG4 A;  1HTJ F;  2DI4 A;  4O4J E;  2J1D G;  4E7Z A;  2KND A;  4UVC B;  3WAK A;  5LYJ E;  5J2T E;  4DBQ A;  3F2E A;  3DP7 A;  3PUG A;  4AQG A;  4H63 V;  3PU8 A;  1BR2 A;  4B6X A;  4TX5 A;  2WM9 A;  4HEA A;  4AXP A;  5H6Q B;  4O4I E;  4IGU A;  1MMD A;  3C50 A;  3RYC E;  2YU2 A;  1ZEE A;  4AKG A;  3FB2 A;  1YW0 A;  3RH3 A;  3QK6 A;  3IBP A;  2WBL A;  4ZI3 D;  2CMR A;  3PUR A;  2D0T A;  4GK0 E;  5LHI B;  4DMV A;  3LK2 B;  3L09 A;  3N2K E;  3Q5W A;  2X9Y A;  4BAY B;  1S94 A;  4I50 E;  4H9P C;  2MTQ A;  4EXT A;  4TV9 E;  4I4T E;  2X9H A;  2D0U A;  3PU3 A;  3HI2 A;  4IE4 A;  5F3J A;  3L3P A;  2NTX A;  3LJC A;  4ERR A;  2NWB A;  5JDQ A;  4UV9 B;  3ANW B;  2YEV C;  4MHC A;  1H7C A;  1Y64 B;  2XAH B;  3KVB A;  5JRC B;  1UX4 A;  2C0S A;  4ZS3 A;  3ZMZ B;  3NBX X;  3PUS A;  1MIW A;  4UVB B;  4ZI3 C;  4L0R A;  2KMF A;  2YIN A;  4K0U A;  5HXS A;  2KZ7 B;  3IEE A;  1ZV4 X;  2N9D A;  2XAQ B;  3D0T A;  2LSJ A;  4AKI A;  4PK4 A;  4P0A A;  3RYF E;  3MZK B;  3EDV A;  2N2N A;  2LJL A;  3NRY A;  2LSI A;  2XAS B;  1MMG A;  3LG7 A;  3UT5 E;  2IC6 A;  4QXB B;  3AB3 B;  4QXH B;  4JEH B;  3ZC0 A;  4OYK A;  4WNK A;  3UUM A;  2VK9 A;  4PW8 A;  2VL8 A;  1MIV A;  3CWZ B;  2L3L A;  3RPU A;  4CI2 B;  2CWY A;  4YHJ A;  4YFS A;  1S35 A;  3I0O A;  2Q9Q B;  3RKO A;  2QGS A;  3O1J A;  3EDU A;  5JDH A;  3JC6 D;  3UFE A;  3FBZ A;  2CXF A;  2ZM2 A;  5H6R B;  3ANW A;  2G0U A;  1B7T A;  3M65 A;  3FXD B;  1ZHC A;  3HR0 A;  1QSD A;  5JRC A;  4XAX B;  5DQV A;  3R84 B;  4E7S A;  2CXL A;  5JVD E;  5HWY A;  3UUN A;  3C64 A;  3LBX B;  4GK5 E;  1HCI A;  5J1G A;  4H9N C;  4IHJ E;  1AJ3 A;  2JPF A;  3ZMV B;  3DTO A;  5LGU B;  4OHF A;  4PJL A;  2CCQ A;  1D0X A;  2IC9 A;  5JDN A;  5JDF A;  1FIO A;  3ZMT B;  2A3D A;  3CQX C;  3O9X A;  2W63 A;  3KDS E;  3N2G E;  5HYA A;  3ETU A;  3N2O A;  1SA0 E;  4O2B E;  4EB6 E;  1FMV A;  4AQF A;  5DQW A;  3ZJ1 A;  3W15 B;  4PK5 A;  5JQG E;  4MLK A;  3C4W A;  2KXP B;  2M67 A;  3ZCJ A;  1HG2 A;  2H3R A;  5FXW A;  5FXZ A;  5LNK A;  2MOZ A;  5A1L A;  3NZQ A;  5FY0 A;  2KIN B;  2VKO A;  4DO0 A;  4CI3 B;  4UIG A;  2PBI A;  3N9P A;  3FBL A;  3Q5X A;  2Q9Q D;  2L8K A;  2VWA A;  2CWO A;  3QC9 A;  3EUH A;  4EAH A;  3E0Z A;  2JMK A;  2A2F X;  3CQC B;  3RRW A;  3HKD E;  2VB6 A;  1NAF A;  2WSS V;  1BR4 A;  4X1Y E;  4FJO A;  3ZPO A;  3AAE B;  2XQY A;  3IF8 B;  2NOX A;  2LOP A;  2NW7 A;  2HPL A;  3F31 A;  4L5G A;  5LBM A;  1UCU A;  5BMV E;  2W62 A;  5C8Y E;  2XUE A;  3KV9 A;  2VKJ A;  2NTY A;  3ZCI A;  3ZYK A;  5LJM A;  3N5L A;  2K9A A;  4O4H E;  2ODU A;  2PFV A;  4MBQ A;  1HF8 A;  4QX8 B;  4Z8X A;  3CX8 B;  4ANJ A;  3PUQ A;  2V26 A;  2E9X C;  1LVK A;  2YU1 A;  3GN5 A;  4H9Q C;  2XAF B;  4PNI A;  3HA4 A;  5JH7 E;  3KV5 A;  3RRC A;  5DAB A;  2WMN A;  3K8P C;  3PE0 A;  5FNV E;  3SOL A;  3ZLI A;  1YKE B;  3CKD A;  5ETW A;  2D5U A;  3CML A;  4H9S E;  2N1G A;  2EHO B;  4J2C A;  4GIW A;  1D1B A;  5FY1 A;  4JUY A;  4EOZ B;  4IDZ A;  2LSY A;  1WR6 A;  4IST A;  4UEL A;  2NW8 A;  3DJB A;  1OXZ A;  4BA9 A;  4OFZ A;  5IYZ E;  4ZI2 D;  3R6N A;  4YJ2 E;  3N9O A;  2W61 A;  1BR1 A;  3NZP A;  2CLY C;  2X66 A;  2SPC A;  3UUX B;  2DWK A;  3U3I A;  1YD8 G;  2DLR A;  4IIJ E;  5EK4 A;  5EK2 A;  1WRD A;  2CA5 A;  1LKX A;  2H7V C;  1Z0P A;  3VKG A;  2LT3 A;  3AVR A;  2WAU A;  5HXC A;  3S4U A;  3I9Y A;  2MBG A;  5ADX L;  5L3G B;  4X1I E;  5LHH B;  3ZC1 A;  4CI1 B;  3LFM A;  5CB4 E;  3C4X A;  4G2A A;  3TKL B;  3GWH A;  2HH7 A;  2H7O A;  4JEU B;  4ISS A;  2LHR A;  2KWI B;  2WWU A;  4C91 A;  1IJ5 A;  2EHO A;  2ZM8 A;  3KV4 A;  3ZMU B;  4EZ4 A;  2UXN B;  4ZI2 C;  5FMN A;  2LM9 A;  2XAG B;  3H3A A;  1MIY A;  3BK9 A;  3KIN B;  5EK3 A;  2LE8 A;  5FXX A;  3SWH A;  3OBV E;  5LBQ B;  5E0O A;  2IAK A;  4I55 E;  2WMO A;  5F8P A;  4WBN E;  3AAA B;  5M4Y A;  2CE7 A;  1QUU A;  2X67 A;  2X9X A;  3BQL A;  4PJM A;  3HKB E;  1US7 B;  3ONX A;  2KWH A;  3ZN0 B;  5HXH A;  1NWM X;  2E9X B;  4XBF B;  5JRE A;  4EZH A;  5LP6 E;  4P09 A;  2BVL A;  3U78 A;  5CA1 E;  4DBR A;  1HS7 A;  4PFO A;  5LA6 E;  4UV8 B;  4O4L E;  5AFU L;  2DHR A;  3IHR A;  4XZC A;  4KP3 C;  5FXV A;  1VRB A;  4YLH A;  2V7L A;  1T98 A;  5HAX A;  2KLQ A;  3AA0 B;  1FEW A;  3JC6 C;  4H63 H;  1U5P A;  4FI5 A;  3PDY A;  2NP9 A;  2YK0 A;  3GN5 B;  2PJQ A;  3HL6 A;  3SRZ A;  2QA7 A;  4U72 A;  2VKH A;  4WBO A;  2GK9 A;  5JR9 C;  5LGT B;  2CLY B;  2RA1 A;  3RYH E;  3A5X A;  5CA0 E;  4I43 B;  3O1H A;  3K3O A;  3KVA A;  3VU7 H;  2X9W A;  4QKN A;  3WAJ A;  3MAC A;  3K3N A;  2ZMA A;  2DCF A;  3C51 A;  4KUM B;  2UXX B;  5J2U E;  2E9X A;  2X0L B;  4UXN B;  3ZEF B;  4NUU A;  5FP3 A;  3J9X 1;  2Z6E A;  5GON E;  1IAP A;  2V7M A;  3MXZ A;  4DND A;  5L3D B;  2LOS A;  4KBM B;  1D0Y A;  4DVD A;  4HE8 A;  1KNZ A;  2E8I A;  4EYY R;  1LVF A;  3EVY A;  5L3C B;  2B1E A;  2ES0 A;  4ZOL E;  4ZI7 E;  5L2L A;  3FXE B;  3F57 A;  2LEH A;  5JDG A;  2XHE B;  3LK3 B;  3B13 A;  5IHY A;  4IE5 A;  4UEM A;  5HWX A;  3ZYL A;  4IE0 A;  2PG8 A;  4GOU A;  5LOV E;  1ZKE A;  3AA1 B;  4TUY E;  4AQF C;  1OWA A;  3V5U A;  3AVS A;  1HG5 A;  4HTE A;  3GA8 A;  1U4Q A;  5LGN B;  2LHN A;  2Q9Q C;  4H9O C;  4IE6 A;  1X79 A;  3AAI A;  3KBU A;  5HXR A;  4HKA A;  2RP4 A;  5DJQ C;  2V7I A;  1CUN A;  2A72 A;  2DWG A;  5FYM A;  4PK6 A;  3VKH A;  3Q2M A;  3T8O A;  4ZS2 A;  2K5B B;  2XAJ B;  5KX5 E;  4AKL A;  2LSK A;  4TV8 E;  4X20 E;  3B57 A;  4TN7 B;  3MJX A;  5EZY E;  3E22 E;  5FY7 A;  3P8C D;  2Y48 B;  3OJA A;  2CM0 A;  1G8X A;  5LJN A;  1D1C A;  3AA7 B;  4PJN A;  2K48 A;  4AKH A;  2X68 A;  4V1A v;  3E08 A;  3AA6 B;  3CPZ A;  3OYX A;  5LXT E;  2DNX A;  3N9N A;  4BJM A;  4A56 A;  4BJN A;  3RC3 A;  1LRZ A;  3I9W A;  1D1A A;  3CVR A;  2OA5 A;  1IJ6 A;  1FMW A;  1MMN A;  4M1P A;  4CQI A;  3OKQ A;  5JR9 B;  2V7K A;  4UF0 A;  4YJ3 E;  1BR0 A;  4CXY A;  1HX8 A;  5JDM A;  4H9R C;  2IW5 B;  3UTK A;  4U74 A;  2W00 A;  3N9Q A;  5TAO A;  3RX6 A;  1EZ3 A;  3RC8 A;  3NRX A;  3PTR B;  4OYJ A;  3KFW X;  4QXC B;  1WYB A;  1O3X A;  3GMI A;  2EHO D;  3MKD A;  4C90 A;  3ETV A;  4EIW A;  3H37 A;  4GYR A;  3LK4 2;  4CXX A;  4AKR B;  2ZM0 A;  1HFA A;  3FHN A;  1KK7 A;  2W0G A;  1E1H B;  3MA9 A;  4IE7 A;  4P0B A;  2JMH A;  4X1K E;  2L9Q A;  3I1A A;  2XTL A;  5HXE A;  2V7J A;  4EYU A;  4WW0 A;  1IZN B;  2X51 A;  2Y6X A;  1D0Z A;  4JLE A;  4PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...