1YKHB

Structure of the mediator med7/med21 (med7/srb7) subcomplex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
114
Chain Sequence
TDRMTQLQICLDQMTEQFCATLNYIDKNHGFEVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLMRHVDSMIEDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II mediator complex protein MED7
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 46
structure length 114
sequence length 129
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykhB00
1YKEB 1YKHB
chains in the Genus database with same CATH superfamily
4KI0F 4JLEA 1DU2A 3M65A 2KLQA 3C4WA 4AIUA 3C51A 1W0AA 5LCYA 2CA5A 4OHFA 3ZMVB 2VK9A 3VRBA 2X0LB 3FZKB 2V7MA 3QUJA 1EZ3A 5HEUA 3S4UA 5KMGP 1OEDA 5EZYE 3AA1B 4I4TE 1BR4A 3L8RA 4EYYR 4U2YA 4GYSA 3SFDA 3NZPA 2Y48B 4JI5T 2LLYA 4A98A 1XNQT 2ODVA 3QNUA 1Z8UA 3UU8A 2WBLA 4H9RC 3PUWF 4HEAA 1W09A 5LB7B 5LBQB 5AQKB 1OEDE 4O4IE 4N78D 5BMVE 4DR1T 2JIWA 4TWHA 4H9QC 3CWZB 4JI7T 3LBXB 1SUMB 3LDQB 1V9DA 2Q9QA 4OYKA 4DVDA 5ABEA 2BZBA 5KXJA 4HWCA 3HA4A 2CRBA 3AXJB 2E5LT 4PFPA 2W62A 3DP7A 2XJ7A 2XAGB 4HWFA 4YSYA 3UTKA 1MMGA 4GK5E 3J7Yq 2N1GA 4DBRA 4WNKA 3ZN0B 4DV0T 3UFGA 4YSXA 3CVRA 3IA3A 4H9OC 4DR7T 2QA7A 4JBWF 1O3XA 4HFIA 5JR9B 2JQQA 4IDQA 3MKDA 2IHR1 4A56A 3VRAA 4IL4A 1ZHCA 3TKLB 1YQ3A 5C3JA 4P1NA 4X66T 1D1BA 1S35A 2H88A 4JUYA 5FXWA 4O4JE 4K0KT 1N34T 3Q5WA 4HFDA 5GONE 2X0HA 2RPAA 5CJ5A 2WMNA 2NW8A 3PUAA 5LHIB 3ZMTB 3I0QA 1LKXA 1NWMX 2XQ8A 3SWHA 3VHLA 2XQ5A 3P8CD 5HEOA 2XQAA 3IF8B 2YU2A 2CCQA 3OYXA 3IBPA 4QHOA 2XY8B 3OJAA 4AQGA 2VL0A 2XM1A 4EOZB 1G8XA 3AE5A 3SS1A 3EHZA 5EK3A 4F8HA 3N5LA 4DUYT 2XSAA 4I43B 1KF6A 3RIFA 3H3AA 3UUNA 4ZOLE 3QB5K 3RYHE 5LGUB 3ZMUB 3PJAA 2XAJB 2MPKA 2H89A 1OWAA 3AEEA 4PFOA 2BBJA 3C50A 4LF5T 3AVSA 3TLSA 4HWIB 2JMKA 2HPJA 1IJ5A 3FZFB 2MTQA 3A8YC 3UQ7A 2WY2A 5JDFA 2BG9A 3MK7C 5FVKA 2PTFA 4BA9A 5JDGA 4C91A 5KX5E 4UVCB 4QXCB 1WR0A 3CQXC 5H6QB 4DR6T 1YXRA 4GOUA 2YKSA 3BQLA 2QVAA 1QUUA 5JDLA 4U7IA 2BG9E 5AFUL 2V8SV 4X62T 4ZI7E 1HNZT 2JQ9A 4AXPA 5LJNA 3B5MA 1M62A 3MZKB 2IC6A 3ZCIA 4LF7T 1HTJF 3QC9A 3QK6A 2YEVC 4AKIA 2CPTA 3FXEB 1SA0E 4LF6T 3ZSTA 4QX8B 5TAOA 2JJ9A 4LFBT 2H3RA 1UX4A 2NOXA 5HXEA 2C5KT 2CLYC 2V7KA 5BR8T 2LSJA 3RHWA 2V6XA 2BS3A 5J2TE 4UEMA 5L3EB 2AXDS 4A97A 3RF1A 5LNKA 4TV8E 1E7PA 4TX5A 3ZLIA 3ZC1A 2C5IT 2WU2A 2A72A 1YQ4A 2UXNB 4Z90A 4HFBA 3KFWX 2XSBA 1T72A 5IYZE 3RC8A 4IREA 3ZYMA 3RKGA 2XAFB 2LRLA 2VVSA 2KINB 2NP9A 4NIQA 4UV9B 3UU4A 2QRXA 3E0ZA 5HWXA 2W66A 2I0MA 1HNWT 5FXZA 2WWVA 1VOMA 4KHZF 5M4YA 2N9DA 4U74A 3LK2B 4JYAT 3JCFA 4H9PC 1HFAA 4B6XA 4CQIA 3RH3A 5HXSA 2XQ6A 1T98A 5FL0A 4P09A 4CXXA 1N36T 1IBKT 4I0UA 3VKHA 2DWKA 2KT9A 1Z0PA 3N9NA 3EABA 3BQKA 4OYJA 2LOPA 3B13A 2NW9A 4X64T 4YT0A 2LSGA 5ABFB 5HXRA 3LBXA 1W9RA 1WYCA 5JTGA 3KV6A 4U7YA 3X1DA 2YDRA 2UUCT 4AQFA 2MAWA 3PJAJ 1ZP0A 5FYMA 4DNDA 1G73A 3RYCE 3G06A 2CLYB 1AJ3A 4QH1A 3AAIA 4C90A 3HKCE 4KUMB 3CMLA 4EXTA 3K1SA 4BAYB 2WAUA 4I50E 2E9XD 4EZ4A 3RQWA 3PTRB 4MLKA 3WAKA 3ANWB 3MACA 2X51A 5AQHB 1D1CA 5JDMA 4MBQA 2CBIA 3KDSE 4IT4A 3UQ4A 4X65T 1YKEB 3C64A 2LJLA 5L47A 3CK6A 2XHEB 5FP3A 2UXDT 3C4XA 1VRBA 2WWUA 3L39A 3P50A 3O9XA 3ONJA 1UCUA 2J4GA 3RX6A 1LRZA 3UUMA 4DV3T 1MIWA 5DJQC 3UUXB 3BQIA 1R8IA 3K3QC 4X1IE 2E9XC 2W00A 2VKDA 2F4VT 3J9X1 4HWHA 5EK4A 2YN6A 3F2EA 4Z8XA 2LM9A 2V6YB 4OX9T 3RIUA 3P4SA 3ZMSB 5H6RB 4UVAB 5E0OA 1ZEEA 2ZM6T 1J5ET 3AE2A 1B7TA 2CXFA 2DHRA 3KVAA 2KWIB 2DNXA 1MNDA 1BR2A 3PU8A 1FIOA 3GN5B 4DV4T 2J1DG 3TLWA 4JI3T 5JRCA 4AKRB 4IL9A 4DMVA 5LGTB 4KBMB 2NTXA 3RQUA 4DR3T 4UF0B 5HCJA 3DTOA 4X5TA 1OEDC 5LP6E 2ES0A 4ZS2A 5FVLA 4WBOA 4EB6E 4AKLA 4GK0E 1XWMA 2BS4A 5LGNB 2YK0A 4CI2B 4BJMA 3KV4A 3D0TA 4IIJE 2LE8A 4YHHT 2DWGA 5CA1E 3LK3B 5JDHA 3OVUA 4JI1T 4NXNT 3PUYF 2KXPB 1LVFA 2CM0A 4Q25A 4IE7A 3LG7A 3N9OA 2A3DA 3AEGA 4ILCA 3EVYA 3K3NA 3AECA 1JNZA 3FXDB 3I9YA 4U33A 4M1PA 4HTEA 2V5DA 4QH4A 4KMCA 2E8IA 2P9BA 2Z6EA 2AE9A 3NVOA 3O1JA 2BS2A 3AB3B 4CI1B 3ZMZB 1D0XA 2IC9A 3OYZA 4HN9A 4DV6T 3EUHA 4P0AA 2E9XB 5J2UE 2FUPA 2XZEA 4IDOA 2UXBT 5F3JA 3RRWA 3LK42 2YDSA 2M6IA 3ETUA 2UXCT 3T8OA 3AA6B 4QKNA 2CWYA 3FZMB 3MXZA 5FXVA 5LHGB 4YTNA 3RYIE 3NRYA 3SFEA 1UX5A 4AI6A 2CWOA 4ILAA 5L3DB 1IAPA 4DV5T 2EHOA 5AQNB 3KINB 4A5XA 3ZEFB 3R6NA 3H3MA 1N33T 2W0GA 4PNIA 5HCMA 1OEDB 3PUXF 4JI2T 3KBTA 1HNXT 5DQWA 4ERRA 4ZZCA 4NUUA 2KZ7B 5IUXA 4ZI2D 4PW8A 5L4EA 3RPUA 1LVKA 4O2AE 4JI8T 4EGWA 2BBHA 2LRKA 3KVBA 1MNEA 3FHNA 2IIUA 2V7IA 3N2OA 5L3CB 3E22E 2C5JA 4H63H 2N2NA 2WU5A 2E2AA 4KP3C 5FY0A 3T1HT 1VCTA 4L5GA 5ABFA 4DR4T 2FJBA 3PV0F 1J5WA 5ADXL 1J1JA 2BG9C 4IDPA 3DJBA 4CN6A 4DO0A 3L3PA 4EYUA 2A9UA 1XDPA 1CHUA 1D0YA 3T1YT 3HKEE 3MA9A 5AQPB 4ZI2C 3HL6A 5LG3A 5LMUT 2JPFA 3F31A 2LM2A 2X0YA 2IMLA 2W63A 2KMFA 3E08A 4WW0A 2JRKA 1I94T 1VCSA 2PFVA 4Z91A 4H9SE 3F57A 2VKOA 3WAJA 1WRDA 3ANWA 5L3FB 1KFYA 4HFCA 4DV2T 5LYJE 2K9AA 2MYSA 1T7SA 2L9QA 3EDUA 2WCAA 1BR0A 2WB5A 2X66A 1WFDA 4IE4A 4HKAA 4EEDA 4X20E 4TZ4C 2H7OA 4ILBA 3AE8A 3CX8B 3AE9A 3CX7B 4I55E 4B3ST 4F6RC 4UV8B 4ZEYA 4HE8A 4JEUB 4ZI3D 1HX1B 2OA5A 1HG2A 5FY7A 4O4LE 5CB4E 3GWHA 1UUSA 4YJ3E 4XZCA 2YDQA 5JREA 2CE7A 1YW0A 4TN7B 2V6YA 3PUGA 4DIDB 3JAEA 4G2AA 1US7B 3P4WA 1CUNA 5EK2A 1UURA 4B3TT 1MIYA 2C0SA 4KHPT 3EDVA 2HN2A 1WYBA 4O8SA 1IBMT 5AQLB 3PURA 4B3MT 3UULA 2BKNA 4JV5T 2NWBA 2LT3A 2UU9T 4AQYT 3O1HA 1KNZA 4ZI3C 1MIVA 3V5UA 4MALA 4WBNE 1XNRT 4DR5T 4DMWA 2BG9B 4EIWA 4P0BA 4GYRA 2SPCA 4IE5A 3PUZF 4MHCA 2BVMA 1HX8A 1IZNB 5AQSB 1KNPA 3AXJA 3ZC0A 4PJMA 4U2ZA 2VB6A 4AKHA 5HEHA 2Y8DA 4HWDA 1WLXA 1ZKEA 3P4QA 4DV1T 5FKYA 1BR1A 3CQCB 4XAXB 2K24A 3KBUA 4CI3B 5HXHA 3OBVE 3ZJ1A 3CKDA 4YSZA 5ABHA 4J2CA 4QWNB 3AEFA 3LSVA 3SRZA 2ODUA 4X1YE 3HKBE 1JNRA 2MBGA 3SOLA 4IGUA 3UFEA 5JR9A 5HXCA 2ZM8A 2LSIA 4CZZB 4YTPA 2B1EA 5C8YE 4AQFC 4LMLA 2FJAA 2IAKA 2WZHA 2LHRA 2CXLA 5LA6E 4NXMT 2D0UA 2BDEA 2WSSV 5JDNA 2KNDA 2QYWA 2LEHA 5AQJB 2CHNA 2VL8A 2RP4A 4FJOA 3W15B 4HGAA 2V1DB 2WM9A 2MOZA 2E9XA 2W67A 3N9LA 1U5PA 2WP9A 4PJLA 3BK9A 2CMRA 3ZPOA 3AE7A 3PUQA 4ZHQE 2UXXB 2K48A 2VVNA 3ZT6A 2XQYA 1MMDA 2IW5B 1S94A 1M7KA 3N2GE 4XBFB 4YFSA 3U78A 2Y6XA 3AEBA 4IDNA 3NBXX 3CIRA 3LJCA 1I6ZA 2PJQA 2ZMAA 4JEHB 3OTOT 3I9WA 4GKKT 1U4QA 2ACZA 3JADA 3AA7B 4TV9E 5LXTE 2W4XA 4DBQA 4PK4A 1ZV4X 3RIUC 2X68A 2K5BB 2UUBT 2V26A 2Q9QD 3GA8A 4YY3T 3Q2MA 5AQGB 5HEJA 2HHHT 4QH5A 5IWAT 2X9XA 2WS3A 1YKHB 3CX6B 1E2AA 3V5SA 4ISTA 3A5XA 2VURA 3FZHB 1HS7A 5JDQA 4OK0A 4V1Av 4CN4A 2M6BA 4U72A 1FMWA 4ZXLA 3U3IA 2DCFA 4H63V 5L2LA 4E7ZA 5LOVE 2ZLYA 3K8PC 4NPPA 5AQMB 2BKOA 2D2SA 2D0TA 4YTMA 3QB5A 4JI0T 2Q9QC 5LJMA 3ZKRA 2VKJA 2CBJA 3Q5DA 3N9QA 2CEAA 5FL1A 2XQ9A 4WYVA 4UXNB 4EAHA 4BJNA 3RC3A 4O4HE 1YD8G 4EEBA 3FBZA 1IBLT 1L0VA 3PE0A 5AQIB 5AQVB 2XAQB 3FZLB 3EI0A 3HI2A 1FMVA 2GK9A 1FJGT 4WZXA 4YXDA 4LF9T 2NR4A 3ETVA 4ASKA 3AAEB 2FJDA 1UK5A 3GMIA 4QX7B 3EAMA 2W2UA 1N32T 5HWYA 5JVDE 5LBMA 4UIGA 4PK6A 5HYAA 2QGSA 2XM2A 4LMKA 4AISA 2WDRA 1NAFA 2EHOD 1Y01A 2WDQA 4PAGA 4PJJA 1OXZA 4ADZA 3CQGB 1GQEA 2A2FX 3Q9DA 5JQGE 2LSYA 3P4PA 1XZYA 2V5CA 4GIWA 2D9DA 2YINA 2W61A 3RKOA 2JMHA 3UUBA 5DABA 5ETWA 1NEKA 5F5WA 5AQQB 2LSKA 4L0RA 3ZN1B 3ZT5A 3O1IA 3KV9A 2IUBA 3CPZA 4ISSA 3Q5XA 2BKPA 3Q5EA 4ILUA 3NZQA 4K0UA 3IEEA 4GKJT 1HF8A 3QOFA 3H37A 2OV9A 4ZS3A 1MMNA 2XQ7A 4QXBB 3FB2A 3AEAA 4TNWA 5JRCB 2EHOC 2JQHA 4IE6A 4MFRA 5LHHB 3ZT7A 2WZIA 5LMNT 3TLVA 2M67A 2J47A 3OKQA 2HN1A 4JI6T 2K3WA 4COFA 4HFVA 3JC6D 4UELA 3M3ZB 4YLHA 2Q9QB 3WI3A 2PG8A 3ONLC 4FI5A 1E1HB 1T8BA 2E5VA 2KSRA 3RLFF 4CN1A 1WR6A 3VU7H 2J62A 4NUVA 2VQET 3ZSSA 4CXWA 1KK7A 4H9NC 5AQUB 2FJEA 5FMNA 3RIAA 3ZYKA 2B76A 5AQRB 1KNRA 4LFCT 3I0OA 2HPLA 3AAAB 4LMJA 3L09A 2ZM2A 3K3OA 3RYFE 4B3RT 2XASB 1D1AA 1HCIA 5J0ZA 2YU1A 3N2KE 1IJ6A 1X79A 5FXXA 5CFBA 3JC6C 2NW7A 3C98B 5DQVA 2X67A 4OFZA 4IHJE 3HKDE 4TNVA 5KDMC 4ANJA 2CXDA 5CA0E 4TWDA 5L3BB 5FY1A 4ZZBA 3VKGA 3PUVF 3ESLA 2LOSA 2LHNA 1SHZC 2BVLA 4E7SA 4IE0A 4KX6A 5JH7E 5AQOB 1H7CA 3VR8A 5ABGA 3ZYLA 2DL1A 4EZHA 3AA0B 1SE7A 2VKHA 2L8KA 1ZOYA 1WCRA 3C4ZA 4HFHA 4O2BE 3B57A 1D0ZA 2L3LA 2WDVA 3ZJ2A 2RA1A 3JAFA 2X9HA 2WQYA 4QXHB 2VQFT 4DV7T 2WMOA 3PDYA 2V7LA 5C2TA 2XQ4A 2G0UA 2H7VC 2YOEA 2UUAT 4LF4T 3R84B 4YHJA 3AE6A 3A7MA 2EHOB 3HR0A 4PJNA 4AKGA 4UVBB 3N9MA 4LFAT 4HFEA 3OPCA 4TUYE 5AQFB 3GN5A 3AE4A 5CGMA 1XMQT 1NENA 1KEYA 2ACXA 2DLRA 2XPKA 5FNVE 3TLUA 4CXYA 4JI4T 2XTLA 2JQKA 3P4RA 4UF0A 5J1GA 3IHRA 4UR9A 3PUSA 3AE3A 3RGLA 3KV5A 2FBWA 3ONXA 1X9BA 2NTYA 4L9IA 5HAXA 3O4XE 3AEDA 2VWAA 3AVRA 1QLBA 3I1AA 4IDZA 1XMOT 2ZM0A 2V7JA 4PK5A 3N9PA 3UU5A 1XDOA 5F8PA 4G63A 3LFMA 3UT5E 3AE1A 3UU6A 2I6HA 3ZCJA 3VR9A 5L4HA 2VASA 4DR2T 2HH7A 4U3CA 5LG4A 3NKZA 1QSDA 5HEGA 4EV6A 4X1KE 1W0BA 1MMAA 3NRXA 2IDOB 2XAHB 2OLTA 3NWIA 4DUZT 3ABVA 5IHYA 1Y64B 5L3GB 3UU3A 2D5UA 2XQ3A 3P7IA 2LKHA 3PU3A 3TLTA 5A1LA 4TWFA 3RI5A 1FEWA 5JR9C 2I59A 3MJXA 2X9WA 3FBLA 5AQTB 2PBIA 2R6GF 2LKGA 4YJ2E 2CHOA 4U31A 1HR0T 2KWHA 2XUEA 3RRCA 2X9YA 1UGOA 1HG5A 2DI4A 4LF8T
chains in the Genus database with same CATH topology
3DJBA 4JLEA 4P09A 3L3PA 4DO0A 4EYUA 4CXXA 3ETVA 4ASKA 3M65A 3VKHA 2DWKA 3AAEB 1D0YA 3HKEE 3MA9A 2KLQA 3C4WA 2KT9A 1Z0PA 3GMIA 3N9NA 4ZI2C 3C51A 3HL6A 4QX7B 3BQKA 5LCYA 2CA5A 2JPFA 4OHFA 5HWYA 4OYJA 2LOPA 3B13A 5JVDE 5LBMA 3F31A 4UIGA 3ZMVB 2NW9A 2VK9A 2W63A 4PK6A 2KMFA 5HYAA 2X0LB 3E08A 4WW0A 2QGSA 2JRKA 2V7MA 3QUJA 1EZ3A 2LSGA 3S4UA 5KMGP 5EZYE 5HXRA 3LBXA 2PFVA 1WYCA 4H9SE 3F57A 2VKOA 3AA1B 1BR4A 4I4TE 3WAJA 1WRDA 3ANWA 1NAFA 4EYYR 5L3FB 2EHOD 3KV6A 4GYSA 4PAGA 5LYJE 3NZPA 2K9AA 2Y48B 2MYSA 4PJJA 1OXZA 4ADZA 4AQFA 3CQGB 2A2FX 3Q9DA 2L9QA 5JQGE 5FYMA 2ODVA 3EDUA 2LSYA 4DNDA 1BR0A 4GIWA 2YINA 2W61A 2WBLA 3RKOA 2X66A 4IE4A 2JMHA 1G73A 4H9RC 3RYCE 4HKAA 2CLYB 1AJ3A 4HEAA 4X20E 4TZ4C 5DABA 2H7OA 3AAIA 4C90A 5LBQB 5ETWA 3HKCE 4KUMB 4O4IE 4N78D 3CMLA 3CX8B 2LSKA 4EXTA 4L0RA 3ZN1B 5BMVE 4BAYB 2WAUA 3O1IA 3KV9A 4H9QC 4I50E 2E9XD 3CWZB 3CX7B 4EZ4A 3CPZA 3LBXB 3PTRB 4ISSA 4MLKA 3Q5XA 3WAKA 1V9DA 2Q9QA 4OYKA 4DVDA 2BZBA 3HA4A 3ANWB 3NZQA 4I55E 4ILUA 4F6RC 4UV8B 4HE8A 4K0UA 4JEUB 3IEEA 3MACA 4ZI3D 2OA5A 2X51A 1HG2A 5FY7A 4PFPA 2W62A 1HF8A 3DP7A 4O4LE 3H37A 1D1CA 4ZS3A 1MMNA 2XAGB 4QXBB 5CB4E 5JDMA 3GWHA 4MBQA 3FB2A 3UTKA 1MMGA 4GK5E 3KDSE 4YJ3E 4XZCA 5JRCB 5JREA 2EHOC 4IE6A 4MFRA 5LHHB 3J7Yq 1YKEB 2CE7A 3C64A 1YW0A 4TN7B 2LJLA 3PUGA 2XHEB 5FP3A 2N1GA 4G2AA 4DBRA 4WNKA 3C4XA 1US7B 3ZN0B 1VRBA 2WWUA 1CUNA 5EK2A 2M67A 3CVRA 3OKQA 3O9XA 1MIYA 2C0SA 4H9OC 1UCUA 3EDVA 4HFVA 2QA7A 3RX6A 1O3XA 1WYBA 3JC6D 4O8SA 4UELA 4YLHA 5JR9B 1LRZA 2JQQA 2Q9QB 3WI3A 2PG8A 3MKDA 3UUMA 4A56A 3PURA 4FI5A 1MIWA 5DJQC 3UULA 1E1HB 2NWBA 3UUXB 1ZHCA 2LT3A 3BQIA 3K3QC 4X1IE 3TKLB 2E9XC 2W00A 2VKDA 3O1HA 1WR6A 3J9X1 3VU7H 1D1BA 4NUVA 1KNZA 5EK4A 4CXWA 1S35A 3F2EA 4ZI3C 1KK7A 4JUYA 4H9NC 4Z8XA 2LM9A 1MIVA 5FXWA 4O4JE 5FMNA 3V5UA 4MALA 3ZYKA 3Q5WA 4WBNE 3ZMSB 5GONE 3I0OA 5H6RB 4UVAB 4DMWA 2WMNA 2NW8A 5E0OA 2HPLA 3AAAB 1ZEEA 3PUAA 4P0BA 4GYRA 4EIWA 5LHIB 2SPCA 3ZMTB 3L09A 2ZM2A 1LKXA 1NWMX 3I0QA 3SWHA 3VHLA 4IE5A 3P8CD 4MHCA 3K3OA 2BVMA 3RYFE 3IF8B 1HX8A 1IZNB 2YU2A 2CCQA 1B7TA 2CXFA 1D1AA 2XASB 1HCIA 2DHRA 2YU1A 3N2KE 1IJ6A 1X79A 3OYXA 3ZC0A 3IBPA 4QHOA 4PJMA 2VB6A 5FXXA 3KVAA 4AKHA 2KWIB 2DNXA 3JC6C 2NW7A 1MNDA 1BR2A 3OJAA 2Y8DA 3C98B 5DQVA 2X67A 4OFZA 4IHJE 1WLXA 3PU8A 1FIOA 3HKDE 3GN5B 1ZKEA 5KDMC 2J1DG 4ANJA 5JRCA 2CXDA 4AQGA 4AKRB 1BR1A 5CA0E 3CQCB 4XAXB 2K24A 3KBUA 4CI3B 1G8XA 4EOZB 5L3BB 4DMVA 5FY1A 5HXHA 3SS1A 3OBVE 5LGTB 4KBMB 2NTXA 3VKGA 5EK3A 3CKDA 3ZJ1A 4UF0B 3ESLA 3N5LA 4J2CA 4QWNB 2LOSA 2LHNA 3DTOA 1SHZC 2BVLA 4I43B 3SRZA 4E7SA 2ODUA 4IE0A 3H3AA 4X1YE 3UUNA 4ZOLE 5LP6E 3HKBE 2ES0A 4ZS2A 3RYHE 2MBGA 5JH7E 4WBOA 3SOLA 4IGUA 3UFEA 5JR9A 5LGUB 1H7CA 5HXCA 2ZM8A 3ZMUB 4EB6E 2LSIA 4AKLA 2XAJB 4GK0E 4CZZB 3ZYLA 2B1EA 4PFOA 1OWAA 5C8YE 4AQFC 3C50A 4EZHA 3AA0B 2IAKA 5LGNB 2VKHA 2YK0A 4CI2B 2L8KA 3AVSA 2LHRA 4BJMA 2CXLA 3C4ZA 3KV4A 3D0TA 4IIJE 2LE8A 5LA6E 2D0UA 3B57A 4O2BE 1D0ZA 2L3LA 2DWGA 2BDEA 2RA1A 3ZJ2A 5CA1E 3LK3B 2WSSV 5JDNA 2KNDA 5JDHA 2JMKA 2X9HA 2LEHA 2HPJA 1IJ5A 4QXHB 2MTQA 2KXPB 2WMOA 2VL8A 3PDYA 5JDFA 2V7LA 2RP4A 1LVFA 2CM0A 4FJOA 3W15B 2G0UA 4HGAA 2V1DB 3MK7C 4IE7A 3LG7A 2WM9A 2MOZA 2E9XA 3N9OA 4BA9A 2A3DA 2H7VC 3N9LA 3EVYA 5JDGA 3R84B 3K3NA 4YHJA 1U5PA 4PJLA 3FXDB 4C91A 5KX5E 4UVCB 3BK9A 2EHOB 3HR0A 4PJNA 4AKGA 4UVBB 3I9YA 3N9MA 2CMRA 4QXCB 3CQXC 4M1PA 3ZPOA 4HTEA 3PUQA 4ZHQE 5H6QB 2UXXB 4TUYE 4KMCA 3GN5A 4GOUA 2K48A 2E8IA 2XQYA 1MMDA 3BQLA 2ACXA 2DLRA 2P9BA 1QUUA 2Z6EA 2IW5B 5JDLA 5FNVE 4CXYA 1S94A 5AFUL 2XTLA 3N2GE 4XBFB 4YFSA 3O1JA 4ZI7E 3AB3B 4UF0A 3U78A 2Y6XA 5J1GA 3IHRA 4CI1B 4AXPA 5LJNA 3NBXX 3PUSA 3ZMZB 1D0XA 3MZKB 2IC6A 2IC9A 3ZCIA 3OYZA 3LJCA 4HN9A 1HTJF 3EUHA 4P0AA 2E9XB 2PJQA 2ZMAA 4JEHB 5J2UE 3I9WA 3QC9A 3KV5A 3ONXA 3QK6A 2YEVC 4AKIA 1U4QA 2NTYA 3FXEB 1SA0E 3AA7B 5F3JA 4TV9E 5LXTE 4L9IA 5HAXA 4QX8B 3O4XE 4DBQA 5TAOA 3RRWA 2JJ9A 2H3RA 1UX4A 2NOXA 2VWAA 3AVRA 4PK4A 5HXEA 2C5KT 1ZV4X 3I1AA 3LK42 2CLYC 2X68A 2K5BB 4IDZA 2ZM0A 2V7JA 4PK5A 2V26A 2V7KA 3N9PA 2Q9QD 2LSJA 3ETUA 3T8OA 5F8PA 3GA8A 4G63A 3AA6B 3LFMA 4QKNA 3UT5E 4UEMA 5J2TE 2CWYA 3Q2MA 3MXZA 5FXVA 5L3EB 5LHGB 3ZCJA 2X9XA 3RYIE 3NRYA 2VASA 1YKHB 5LNKA 2HH7A 1UX5A 4TV8E 5LG4A 4AI6A 2CWOA 1QSDA 5L3DB 4TX5A 3CX6B 3V5SA 1IAPA 3ZLIA 4X1KE 3ZC1A 2C5IT 4ISTA 2EHOA 1MMAA 3A5XA 3NRXA 2A72A 2UXNB 3KINB 1HS7A 3KFWX 5JDQA 5IYZE 3ZEFB 2XAHB 4OK0A 3RC8A 4V1Av 4U72A 3R6NA 1FMWA 5IHYA 3ZYMA 3U3IA 1Y64B 5L3GB 2DCFA 2W0GA 4PNIA 2D5UA 3P7IA 4H63V 3PU3A 2XAFB 5L2LA 3KBTA 5DQWA 4ERRA 4E7ZA 5A1LA 4NUUA 5LOVE 2ZLYA 2KZ7B 3K8PC 2D2SA 2D0TA 2KINB 4ZI2D 4PW8A 2NP9A 1FEWA 4UV9B 5JR9C 3RPUA 3E0ZA 2Q9QC 1LVKA 5LJMA 4O2AE 2I59A 2VKJA 3MJXA 5HWXA 2X9WA 3KVBA 1MNEA 3FBLA 2PBIA 3N9QA 3FHNA 2CEAA 2V7IA 4UXNB 3N2OA 4EAHA 5L3CB 3E22E 4BJNA 2C5JA 4H63H 3RC3A 5FXZA 2N2NA 4O4HE 4KP3C 1YD8G 5FY0A 1VOMA 4YJ2E 2KWHA 5M4YA 2XUEA 2N9DA 4L5GA 3FBZA 3RRCA 3PE0A 4U74A 3LK2B 2XAQB 2X9YA 4H9PC 5ADXL 3HI2A 1HFAA 4B6XA 4CQIA 3RH3A 1HG5A 2DI4A 5HXSA 1FMVA 2GK9A 1T98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKE B;  1YKH B; 
#chains in the Genus database with same CATH topology
 4KI0 F;  4JLE A;  1DU2 A;  3M65 A;  2KLQ A;  3C4W A;  4AIU A;  3C51 A;  1W0A A;  5LCY A;  2CA5 A;  4OHF A;  3ZMV B;  2VK9 A;  3VRB A;  2X0L B;  3FZK B;  2V7M A;  3QUJ A;  1EZ3 A;  5HEU A;  3S4U A;  5KMG P;  1OED A;  5EZY E;  3AA1 B;  4I4T E;  1BR4 A;  3L8R A;  4EYY R;  4U2Y A;  4GYS A;  3SFD A;  3NZP A;  2Y48 B;  4JI5 T;  2LLY A;  4A98 A;  1XNQ T;  2ODV A;  3QNU A;  1Z8U A;  3UU8 A;  2WBL A;  4H9R C;  3PUW F;  4HEA A;  1W09 A;  5LB7 B;  5LBQ B;  5AQK B;  1OED E;  4O4I E;  4N78 D;  5BMV E;  4DR1 T;  2JIW A;  4TWH A;  4H9Q C;  3CWZ B;  4JI7 T;  3LBX B;  1SUM B;  3LDQ B;  1V9D A;  2Q9Q A;  4OYK A;  4DVD A;  5ABE A;  2BZB A;  5KXJ A;  4HWC A;  3HA4 A;  2CRB A;  3AXJ B;  2E5L T;  4PFP A;  2W62 A;  3DP7 A;  2XJ7 A;  2XAG B;  4HWF A;  4YSY A;  3UTK A;  1MMG A;  4GK5 E;  3J7Y q;  2N1G A;  4DBR A;  4WNK A;  3ZN0 B;  4DV0 T;  3UFG A;  4YSX A;  3CVR A;  3IA3 A;  4H9O C;  4DR7 T;  2QA7 A;  4JBW F;  1O3X A;  4HFI A;  5JR9 B;  2JQQ A;  4IDQ A;  3MKD A;  2IHR 1;  4A56 A;  3VRA A;  4IL4 A;  1ZHC A;  3TKL B;  1YQ3 A;  5C3J A;  4P1N A;  4X66 T;  1D1B A;  1S35 A;  2H88 A;  4JUY A;  5FXW A;  4O4J E;  4K0K T;  1N34 T;  3Q5W A;  4HFD A;  5GON E;  2X0H A;  2RPA A;  5CJ5 A;  2WMN A;  2NW8 A;  3PUA A;  5LHI B;  3ZMT B;  3I0Q A;  1LKX A;  1NWM X;  2XQ8 A;  3SWH A;  3VHL A;  2XQ5 A;  3P8C D;  5HEO A;  2XQA A;  3IF8 B;  2YU2 A;  2CCQ A;  3OYX A;  3IBP A;  4QHO A;  2XY8 B;  3OJA A;  4AQG A;  2VL0 A;  2XM1 A;  4EOZ B;  1G8X A;  3AE5 A;  3SS1 A;  3EHZ A;  5EK3 A;  4F8H A;  3N5L A;  4DUY T;  2XSA A;  4I43 B;  1KF6 A;  3RIF A;  3H3A A;  3UUN A;  4ZOL E;  3QB5 K;  3RYH E;  5LGU B;  3ZMU B;  3PJA A;  2XAJ B;  2MPK A;  2H89 A;  1OWA A;  3AEE A;  4PFO A;  2BBJ A;  3C50 A;  4LF5 T;  3AVS A;  3TLS A;  4HWI B;  2JMK A;  2HPJ A;  1IJ5 A;  3FZF B;  2MTQ A;  3A8Y C;  3UQ7 A;  2WY2 A;  5JDF A;  2BG9 A;  3MK7 C;  5FVK A;  2PTF A;  4BA9 A;  5JDG A;  4C91 A;  5KX5 E;  4UVC B;  4QXC B;  1WR0 A;  3CQX C;  5H6Q B;  4DR6 T;  1YXR A;  4GOU A;  2YKS A;  3BQL A;  2QVA A;  1QUU A;  5JDL A;  4U7I A;  2BG9 E;  5AFU L;  2V8S V;  4X62 T;  4ZI7 E;  1HNZ T;  2JQ9 A;  4AXP A;  5LJN A;  3B5M A;  1M62 A;  3MZK B;  2IC6 A;  3ZCI A;  4LF7 T;  1HTJ F;  3QC9 A;  3QK6 A;  2YEV C;  4AKI A;  2CPT A;  3FXE B;  1SA0 E;  4LF6 T;  3ZST A;  4QX8 B;  5TAO A;  2JJ9 A;  4LFB T;  2H3R A;  1UX4 A;  2NOX A;  5HXE A;  2C5K T;  2CLY C;  2V7K A;  5BR8 T;  2LSJ A;  3RHW A;  2V6X A;  2BS3 A;  5J2T E;  4UEM A;  5L3E B;  2AXD S;  4A97 A;  3RF1 A;  5LNK A;  4TV8 E;  1E7P A;  4TX5 A;  3ZLI A;  3ZC1 A;  2C5I T;  2WU2 A;  2A72 A;  1YQ4 A;  2UXN B;  4Z90 A;  4HFB A;  3KFW X;  2XSB A;  1T72 A;  5IYZ E;  3RC8 A;  4IRE A;  3ZYM A;  3RKG A;  2XAF B;  2LRL A;  2VVS A;  2KIN B;  2NP9 A;  4NIQ A;  4UV9 B;  3UU4 A;  2QRX A;  3E0Z A;  5HWX A;  2W66 A;  2I0M A;  1HNW T;  5FXZ A;  2WWV A;  1VOM A;  4KHZ F;  5M4Y A;  2N9D A;  4U74 A;  3LK2 B;  4JYA T;  3JCF A;  4H9P C;  1HFA A;  4B6X A;  4CQI A;  3RH3 A;  5HXS A;  2XQ6 A;  1T98 A;  5FL0 A;  4P09 A;  4CXX A;  1N36 T;  1IBK T;  4I0U A;  3VKH A;  2DWK A;  2KT9 A;  1Z0P A;  3N9N A;  3EAB A;  3BQK A;  4OYJ A;  2LOP A;  3B13 A;  2NW9 A;  4X64 T;  4YT0 A;  2LSG A;  5ABF B;  5HXR A;  3LBX A;  1W9R A;  1WYC A;  5JTG A;  3KV6 A;  4U7Y A;  3X1D A;  2YDR A;  2UUC T;  4AQF A;  2MAW A;  3PJA J;  1ZP0 A;  5FYM A;  4DND A;  1G73 A;  3RYC E;  3G06 A;  2CLY B;  1AJ3 A;  4QH1 A;  3AAI A;  4C90 A;  3HKC E;  4KUM B;  3CML A;  4EXT A;  3K1S A;  4BAY B;  2WAU A;  4I50 E;  2E9X D;  4EZ4 A;  3RQW A;  3PTR B;  4MLK A;  3WAK A;  3ANW B;  3MAC A;  2X51 A;  5AQH B;  1D1C A;  5JDM A;  4MBQ A;  2CBI A;  3KDS E;  4IT4 A;  3UQ4 A;  4X65 T;  1YKE B;  3C64 A;  2LJL A;  5L47 A;  3CK6 A;  2XHE B;  5FP3 A;  2UXD T;  3C4X A;  1VRB A;  2WWU A;  3L39 A;  3P50 A;  3O9X A;  3ONJ A;  1UCU A;  2J4G A;  3RX6 A;  1LRZ A;  3UUM A;  4DV3 T;  1MIW A;  5DJQ C;  3UUX B;  3BQI A;  1R8I A;  3K3Q C;  4X1I E;  2E9X C;  2W00 A;  2VKD A;  2F4V T;  3J9X 1;  4HWH A;  5EK4 A;  2YN6 A;  3F2E A;  4Z8X A;  2LM9 A;  2V6Y B;  4OX9 T;  3RIU A;  3P4S A;  3ZMS B;  5H6R B;  4UVA B;  5E0O A;  1ZEE A;  2ZM6 T;  1J5E T;  3AE2 A;  1B7T A;  2CXF A;  2DHR A;  3KVA A;  2KWI B;  2DNX A;  1MND A;  1BR2 A;  3PU8 A;  1FIO A;  3GN5 B;  4DV4 T;  2J1D G;  3TLW A;  4JI3 T;  5JRC A;  4AKR B;  4IL9 A;  4DMV A;  5LGT B;  4KBM B;  2NTX A;  3RQU A;  4DR3 T;  4UF0 B;  5HCJ A;  3DTO A;  4X5T A;  1OED C;  5LP6 E;  2ES0 A;  4ZS2 A;  5FVL A;  4WBO A;  4EB6 E;  4AKL A;  4GK0 E;  1XWM A;  2BS4 A;  5LGN B;  2YK0 A;  4CI2 B;  4BJM A;  3KV4 A;  3D0T A;  4IIJ E;  2LE8 A;  4YHH T;  2DWG A;  5CA1 E;  3LK3 B;  5JDH A;  3OVU A;  4JI1 T;  4NXN T;  3PUY F;  2KXP B;  1LVF A;  2CM0 A;  4Q25 A;  4IE7 A;  3LG7 A;  3N9O A;  2A3D A;  3AEG A;  4ILC A;  3EVY A;  3K3N A;  3AEC A;  1JNZ A;  3FXD B;  3I9Y A;  4U33 A;  4M1P A;  4HTE A;  2V5D A;  4QH4 A;  4KMC A;  2E8I A;  2P9B A;  2Z6E A;  2AE9 A;  3NVO A;  3O1J A;  2BS2 A;  3AB3 B;  4CI1 B;  3ZMZ B;  1D0X A;  2IC9 A;  3OYZ A;  4HN9 A;  4DV6 T;  3EUH A;  4P0A A;  2E9X B;  5J2U E;  2FUP A;  2XZE A;  4IDO A;  2UXB T;  5F3J A;  3RRW A;  3LK4 2;  2YDS A;  2M6I A;  3ETU A;  2UXC T;  3T8O A;  3AA6 B;  4QKN A;  2CWY A;  3FZM B;  3MXZ A;  5FXV A;  5LHG B;  4YTN A;  3RYI E;  3NRY A;  3SFE A;  1UX5 A;  4AI6 A;  2CWO A;  4ILA A;  5L3D B;  1IAP A;  4DV5 T;  2EHO A;  5AQN B;  3KIN B;  4A5X A;  3ZEF B;  3R6N A;  3H3M A;  1N33 T;  2W0G A;  4PNI A;  5HCM A;  1OED B;  3PUX F;  4JI2 T;  3KBT A;  1HNX T;  5DQW A;  4ERR A;  4ZZC A;  4NUU A;  2KZ7 B;  5IUX A;  4ZI2 D;  4PW8 A;  5L4E A;  3RPU A;  1LVK A;  4O2A E;  4JI8 T;  4EGW A;  2BBH A;  2LRK A;  3KVB A;  1MNE A;  3FHN A;  2IIU A;  2V7I A;  3N2O A;  5L3C B;  3E22 E;  2C5J A;  4H63 H;  2N2N A;  2WU5 A;  2E2A A;  4KP3 C;  5FY0 A;  3T1H T;  1VCT A;  4L5G A;  5ABF A;  4DR4 T;  2FJB A;  3PV0 F;  1J5W A;  5ADX L;  1J1J A;  2BG9 C;  4IDP A;  3DJB A;  4CN6 A;  4DO0 A;  3L3P A;  4EYU A;  2A9U A;  1XDP A;  1CHU A;  1D0Y A;  3T1Y T;  3HKE E;  3MA9 A;  5AQP B;  4ZI2 C;  3HL6 A;  5LG3 A;  5LMU T;  2JPF A;  3F31 A;  2LM2 A;  2X0Y A;  2IML A;  2W63 A;  2KMF A;  3E08 A;  4WW0 A;  2JRK A;  1I94 T;  1VCS A;  2PFV A;  4Z91 A;  4H9S E;  3F57 A;  2VKO A;  3WAJ A;  1WRD A;  3ANW A;  5L3F B;  1KFY A;  4HFC A;  4DV2 T;  5LYJ E;  2K9A A;  2MYS A;  1T7S A;  2L9Q A;  3EDU A;  2WCA A;  1BR0 A;  2WB5 A;  2X66 A;  1WFD A;  4IE4 A;  4HKA A;  4EED A;  4X20 E;  4TZ4 C;  2H7O A;  4ILB A;  3AE8 A;  3CX8 B;  3AE9 A;  3CX7 B;  4I55 E;  4B3S T;  4F6R C;  4UV8 B;  4ZEY A;  4HE8 A;  4JEU B;  4ZI3 D;  1HX1 B;  2OA5 A;  1HG2 A;  5FY7 A;  4O4L E;  5CB4 E;  3GWH A;  1UUS A;  4YJ3 E;  4XZC A;  2YDQ A;  5JRE A;  2CE7 A;  1YW0 A;  4TN7 B;  2V6Y A;  3PUG A;  4DID B;  3JAE A;  4G2A A;  1US7 B;  3P4W A;  1CUN A;  5EK2 A;  1UUR A;  4B3T T;  1MIY A;  2C0S A;  4KHP T;  3EDV A;  2HN2 A;  1WYB A;  4O8S A;  1IBM T;  5AQL B;  3PUR A;  4B3M T;  3UUL A;  2BKN A;  4JV5 T;  2NWB A;  2LT3 A;  2UU9 T;  4AQY T;  3O1H A;  1KNZ A;  4ZI3 C;  1MIV A;  3V5U A;  4MAL A;  4WBN E;  1XNR T;  4DR5 T;  4DMW A;  2BG9 B;  4EIW A;  4P0B A;  4GYR A;  2SPC A;  4IE5 A;  3PUZ F;  4MHC A;  2BVM A;  1HX8 A;  1IZN B;  5AQS B;  1KNP A;  3AXJ A;  3ZC0 A;  4PJM A;  4U2Z A;  2VB6 A;  4AKH A;  5HEH A;  2Y8D A;  4HWD A;  1WLX A;  1ZKE A;  3P4Q A;  4DV1 T;  5FKY A;  1BR1 A;  3CQC B;  4XAX B;  2K24 A;  3KBU A;  4CI3 B;  5HXH A;  3OBV E;  3ZJ1 A;  3CKD A;  4YSZ A;  5ABH A;  4J2C A;  4QWN B;  3AEF A;  3LSV A;  3SRZ A;  2ODU A;  4X1Y E;  3HKB E;  1JNR A;  2MBG A;  3SOL A;  4IGU A;  3UFE A;  5JR9 A;  5HXC A;  2ZM8 A;  2LSI A;  4CZZ B;  4YTP A;  2B1E A;  5C8Y E;  4AQF C;  4LML A;  2FJA A;  2IAK A;  2WZH A;  2LHR A;  2CXL A;  5LA6 E;  4NXM T;  2D0U A;  2BDE A;  2WSS V;  5JDN A;  2KND A;  2QYW A;  2LEH A;  5AQJ B;  2CHN A;  2VL8 A;  2RP4 A;  4FJO A;  3W15 B;  4HGA A;  2V1D B;  2WM9 A;  2MOZ A;  2E9X A;  2W67 A;  3N9L A;  1U5P A;  2WP9 A;  4PJL A;  3BK9 A;  2CMR A;  3ZPO A;  3AE7 A;  3PUQ A;  4ZHQ E;  2UXX B;  2K48 A;  2VVN A;  3ZT6 A;  2XQY A;  1MMD A;  2IW5 B;  1S94 A;  1M7K A;  3N2G E;  4XBF B;  4YFS A;  3U78 A;  2Y6X A;  3AEB A;  4IDN A;  3NBX X;  3CIR A;  3LJC A;  1I6Z A;  2PJQ A;  2ZMA A;  4JEH B;  3OTO T;  3I9W A;  4GKK T;  1U4Q A;  2ACZ A;  3JAD A;  3AA7 B;  4TV9 E;  5LXT E;  2W4X A;  4DBQ A;  4PK4 A;  1ZV4 X;  3RIU C;  2X68 A;  2K5B B;  2UUB T;  2V26 A;  2Q9Q D;  3GA8 A;  4YY3 T;  3Q2M A;  5AQG B;  5HEJ A;  2HHH T;  4QH5 A;  5IWA T;  2X9X A;  2WS3 A;  1YKH B;  3CX6 B;  1E2A A;  3V5S A;  4IST A;  3A5X A;  2VUR A;  3FZH B;  1HS7 A;  5JDQ A;  4OK0 A;  4V1A v;  4CN4 A;  2M6B A;  4U72 A;  1FMW A;  4ZXL A;  3U3I A;  2DCF A;  4H63 V;  5L2L A;  4E7Z A;  5LOV E;  2ZLY A;  3K8P C;  4NPP A;  5AQM B;  2BKO A;  2D2S A;  2D0T A;  4YTM A;  3QB5 A;  4JI0 T;  2Q9Q C;  5LJM A;  3ZKR A;  2VKJ A;  2CBJ A;  3Q5D A;  3N9Q A;  2CEA A;  5FL1 A;  2XQ9 A;  4WYV A;  4UXN B;  4EAH A;  4BJN A;  3RC3 A;  4O4H E;  1YD8 G;  4EEB A;  3FBZ A;  1IBL T;  1L0V A;  3PE0 A;  5AQI B;  5AQV B;  2XAQ B;  3FZL B;  3EI0 A;  3HI2 A;  1FMV A;  2GK9 A;  1FJG T;  4WZX A;  4YXD A;  4LF9 T;  2NR4 A;  3ETV A;  4ASK A;  3AAE B;  2FJD A;  1UK5 A;  3GMI A;  4QX7 B;  3EAM A;  2W2U A;  1N32 T;  5HWY A;  5JVD E;  5LBM A;  4UIG A;  4PK6 A;  5HYA A;  2QGS A;  2XM2 A;  4LMK A;  4AIS A;  2WDR A;  1NAF A;  2EHO D;  1Y01 A;  2WDQ A;  4PAG A;  4PJJ A;  1OXZ A;  4ADZ A;  3CQG B;  1GQE A;  2A2F X;  3Q9D A;  5JQG E;  2LSY A;  3P4P A;  1XZY A;  2V5C A;  4GIW A;  2D9D A;  2YIN A;  2W61 A;  3RKO A;  2JMH A;  3UUB A;  5DAB A;  5ETW A;  1NEK A;  5F5W A;  5AQQ B;  2LSK A;  4L0R A;  3ZN1 B;  3ZT5 A;  3O1I A;  3KV9 A;  2IUB A;  3CPZ A;  4ISS A;  3Q5X A;  2BKP A;  3Q5E A;  4ILU A;  3NZQ A;  4K0U A;  3IEE A;  4GKJ T;  1HF8 A;  3QOF A;  3H37 A;  2OV9 A;  4ZS3 A;  1MMN A;  2XQ7 A;  4QXB B;  3FB2 A;  3AEA A;  4TNW A;  5JRC B;  2EHO C;  2JQH A;  4IE6 A;  4MFR A;  5LHH B;  3ZT7 A;  2WZI A;  5LMN T;  3TLV A;  2M67 A;  2J47 A;  3OKQ A;  2HN1 A;  4JI6 T;  2K3W A;  4COF A;  4HFV A;  3JC6 D;  4UEL A;  3M3Z B;  4YLH A;  2Q9Q B;  3WI3 A;  2PG8 A;  3ONL C;  4FI5 A;  1E1H B;  1T8B A;  2E5V A;  2KSR A;  3RLF F;  4CN1 A;  1WR6 A;  3VU7 H;  2J62 A;  4NUV A;  2VQE T;  3ZSS A;  4CXW A;  1KK7 A;  4H9N C;  5AQU B;  2FJE A;  5FMN A;  3RIA A;  3ZYK A;  2B76 A;  5AQR B;  1KNR A;  4LFC T;  3I0O A;  2HPL A;  3AAA B;  4LMJ A;  3L09 A;  2ZM2 A;  3K3O A;  3RYF E;  4B3R T;  2XAS B;  1D1A A;  1HCI A;  5J0Z A;  2YU1 A;  3N2K E;  1IJ6 A;  1X79 A;  5FXX A;  5CFB A;  3JC6 C;  2NW7 A;  3C98 B;  5DQV A;  2X67 A;  4OFZ A;  4IHJ E;  3HKD E;  4TNV A;  5KDM C;  4ANJ A;  2CXD A;  5CA0 E;  4TWD A;  5L3B B;  5FY1 A;  4ZZB A;  3VKG A;  3PUV F;  3ESL A;  2LOS A;  2LHN A;  1SHZ C;  2BVL A;  4E7S A;  4IE0 A;  4KX6 A;  5JH7 E;  5AQO B;  1H7C A;  3VR8 A;  5ABG A;  3ZYL A;  2DL1 A;  4EZH A;  3AA0 B;  1SE7 A;  2VKH A;  2L8K A;  1ZOY A;  1WCR A;  3C4Z A;  4HFH A;  4O2B E;  3B57 A;  1D0Z A;  2L3L A;  2WDV A;  3ZJ2 A;  2RA1 A;  3JAF A;  2X9H A;  2WQY A;  4QXH B;  2VQF T;  4DV7 T;  2WMO A;  3PDY A;  2V7L A;  5C2T A;  2XQ4 A;  2G0U A;  2H7V C;  2YOE A;  2UUA T;  4LF4 T;  3R84 B;  4YHJ A;  3AE6 A;  3A7M A;  2EHO B;  3HR0 A;  4PJN A;  4AKG A;  4UVB B;  3N9M A;  4LFA T;  4HFE A;  3OPC A;  4TUY E;  5AQF B;  3GN5 A;  3AE4 A;  5CGM A;  1XMQ T;  1NEN A;  1KEY A;  2ACX A;  2DLR A;  2XPK A;  5FNV E;  3TLU A;  4CXY A;  4JI4 T;  2XTL A;  2JQK A;  3P4R A;  4UF0 A;  5J1G A;  3IHR A;  4UR9 A;  3PUS A;  3AE3 A;  3RGL A;  3KV5 A;  2FBW A;  3ONX A;  1X9B A;  2NTY A;  4L9I A;  5HAX A;  3O4X E;  3AED A;  2VWA A;  3AVR A;  1QLB A;  3I1A A;  4IDZ A;  1XMO T;  2ZM0 A;  2V7J A;  4PK5 A;  3N9P A;  3UU5 A;  1XDO A;  5F8P A;  4G63 A;  3LFM A;  3UT5 E;  3AE1 A;  3UU6 A;  2I6H A;  3ZCJ A;  3VR9 A;  5L4H A;  2VAS A;  4DR2 T;  2HH7 A;  4U3C A;  5LG4 A;  3NKZ A;  1QSD A;  5HEG A;  4EV6 A;  4X1K E;  1W0B A;  1MMA A;  3NRX A;  2IDO B;  2XAH B;  2OLT A;  3NWI A;  4DUZ T;  3ABV A;  5IHY A;  1Y64 B;  5L3G B;  3UU3 A;  2D5U A;  2XQ3 A;  3P7I A;  2LKH A;  3PU3 A;  3TLT A;  5A1L A;  4TWF A;  3RI5 A;  1FEW A;  5JR9 C;  2I59 A;  3MJX A;  2X9W A;  3FBL A;  5AQT B;  2PBI A;  2R6G F;  2LKG A;  4YJ2 E;  2CHO A;  4U31 A;  1HR0 T;  2KWH A;  2XUE A;  3RRC A;  2X9Y A;  1UGO A;  1HG5 A;  2DI4 A;  4LF8 T; 
#chains in the Genus database with same CATH homology
 3DJB A;  4JLE A;  4P09 A;  3L3P A;  4DO0 A;  4EYU A;  4CXX A;  3ETV A;  4ASK A;  3M65 A;  3VKH A;  2DWK A;  3AAE B;  1D0Y A;  3HKE E;  3MA9 A;  2KLQ A;  3C4W A;  2KT9 A;  1Z0P A;  3GMI A;  3N9N A;  4ZI2 C;  3C51 A;  3HL6 A;  4QX7 B;  3BQK A;  5LCY A;  2CA5 A;  2JPF A;  4OHF A;  5HWY A;  4OYJ A;  2LOP A;  3B13 A;  5JVD E;  5LBM A;  3F31 A;  4UIG A;  3ZMV B;  2NW9 A;  2VK9 A;  2W63 A;  4PK6 A;  2KMF A;  5HYA A;  2X0L B;  3E08 A;  4WW0 A;  2QGS A;  2JRK A;  2V7M A;  3QUJ A;  1EZ3 A;  2LSG A;  3S4U A;  5KMG P;  5EZY E;  5HXR A;  3LBX A;  2PFV A;  1WYC A;  4H9S E;  3F57 A;  2VKO A;  3AA1 B;  1BR4 A;  4I4T E;  3WAJ A;  1WRD A;  3ANW A;  1NAF A;  4EYY R;  5L3F B;  2EHO D;  3KV6 A;  4GYS A;  4PAG A;  5LYJ E;  3NZP A;  2K9A A;  2Y48 B;  2MYS A;  4PJJ A;  1OXZ A;  4ADZ A;  4AQF A;  3CQG B;  2A2F X;  3Q9D A;  2L9Q A;  5JQG E;  5FYM A;  2ODV A;  3EDU A;  2LSY A;  4DND A;  1BR0 A;  4GIW A;  2YIN A;  2W61 A;  2WBL A;  3RKO A;  2X66 A;  4IE4 A;  2JMH A;  1G73 A;  4H9R C;  3RYC E;  4HKA A;  2CLY B;  1AJ3 A;  4HEA A;  4X20 E;  4TZ4 C;  5DAB A;  2H7O A;  3AAI A;  4C90 A;  5LBQ B;  5ETW A;  3HKC E;  4KUM B;  4O4I E;  4N78 D;  3CML A;  3CX8 B;  2LSK A;  4EXT A;  4L0R A;  3ZN1 B;  5BMV E;  4BAY B;  2WAU A;  3O1I A;  3KV9 A;  4H9Q C;  4I50 E;  2E9X D;  3CWZ B;  3CX7 B;  4EZ4 A;  3CPZ A;  3LBX B;  3PTR B;  4ISS A;  4MLK A;  3Q5X A;  3WAK A;  1V9D A;  2Q9Q A;  4OYK A;  4DVD A;  2BZB A;  3HA4 A;  3ANW B;  3NZQ A;  4I55 E;  4ILU A;  4F6R C;  4UV8 B;  4HE8 A;  4K0U A;  4JEU B;  3IEE A;  3MAC A;  4ZI3 D;  2OA5 A;  2X51 A;  1HG2 A;  5FY7 A;  4PFP A;  2W62 A;  1HF8 A;  3DP7 A;  4O4L E;  3H37 A;  1D1C A;  4ZS3 A;  1MMN A;  2XAG B;  4QXB B;  5CB4 E;  5JDM A;  3GWH A;  4MBQ A;  3FB2 A;  3UTK A;  1MMG A;  4GK5 E;  3KDS E;  4YJ3 E;  4XZC A;  5JRC B;  5JRE A;  2EHO C;  4IE6 A;  4MFR A;  5LHH B;  3J7Y q;  1YKE B;  2CE7 A;  3C64 A;  1YW0 A;  4TN7 B;  2LJL A;  3PUG A;  2XHE B;  5FP3 A;  2N1G A;  4G2A A;  4DBR A;  4WNK A;  3C4X A;  1US7 B;  3ZN0 B;  1VRB A;  2WWU A;  1CUN A;  5EK2 A;  2M67 A;  3CVR A;  3OKQ A;  3O9X A;  1MIY A;  2C0S A;  4H9O C;  1UCU A;  3EDV A;  4HFV A;  2QA7 A;  3RX6 A;  1O3X A;  1WYB A;  3JC6 D;  4O8S A;  4UEL A;  4YLH A;  5JR9 B;  1LRZ A;  2JQQ A;  2Q9Q B;  3WI3 A;  2PG8 A;  3MKD A;  3UUM A;  4A56 A;  3PUR A;  4FI5 A;  1MIW A;  5DJQ C;  3UUL A;  1E1H B;  2NWB A;  3UUX B;  1ZHC A;  2LT3 A;  3BQI A;  3K3Q C;  4X1I E;  3TKL B;  2E9X C;  2W00 A;  2VKD A;  3O1H A;  1WR6 A;  3J9X 1;  3VU7 H;  1D1B A;  4NUV A;  1KNZ A;  5EK4 A;  4CXW A;  1S35 A;  3F2E A;  4ZI3 C;  1KK7 A;  4JUY A;  4H9N C;  4Z8X A;  2LM9 A;  1MIV A;  5FXW A;  4O4J E;  5FMN A;  3V5U A;  4MAL A;  3ZYK A;  3Q5W A;  4WBN E;  3ZMS B;  5GON E;  3I0O A;  5H6R B;  4UVA B;  4DMW A;  2WMN A;  2NW8 A;  5E0O A;  2HPL A;  3AAA B;  1ZEE A;  3PUA A;  4P0B A;  4GYR A;  4EIW A;  5LHI B;  2SPC A;  3ZMT B;  3L09 A;  2ZM2 A;  1LKX A;  1NWM X;  3I0Q A;  3SWH A;  3VHL A;  4IE5 A;  3P8C D;  4MHC A;  3K3O A;  2BVM A;  3RYF E;  3IF8 B;  1HX8 A;  1IZN B;  2YU2 A;  2CCQ A;  1B7T A;  2CXF A;  1D1A A;  2XAS B;  1HCI A;  2DHR A;  2YU1 A;  3N2K E;  1IJ6 A;  1X79 A;  3OYX A;  3ZC0 A;  3IBP A;  4QHO A;  4PJM A;  2VB6 A;  5FXX A;  3KVA A;  4AKH A;  2KWI B;  2DNX A;  3JC6 C;  2NW7 A;  1MND A;  1BR2 A;  3OJA A;  2Y8D A;  3C98 B;  5DQV A;  2X67 A;  4OFZ A;  4IHJ E;  1WLX A;  3PU8 A;  1FIO A;  3HKD E;  3GN5 B;  1ZKE A;  5KDM C;  2J1D G;  4ANJ A;  5JRC A;  2CXD A;  4AQG A;  4AKR B;  1BR1 A;  5CA0 E;  3CQC B;  4XAX B;  2K24 A;  3KBU A;  4CI3 B;  1G8X A;  4EOZ B;  5L3B B;  4DMV A;  5FY1 A;  5HXH A;  3SS1 A;  3OBV E;  5LGT B;  4KBM B;  2NTX A;  3VKG A;  5EK3 A;  3CKD A;  3ZJ1 A;  4UF0 B;  3ESL A;  3N5L A;  4J2C A;  4QWN B;  2LOS A;  2LHN A;  3DTO A;  1SHZ C;  2BVL A;  4I43 B;  3SRZ A;  4E7S A;  2ODU A;  4IE0 A;  3H3A A;  4X1Y E;  3UUN A;  4ZOL E;  5LP6 E;  3HKB E;  2ES0 A;  4ZS2 A;  3RYH E;  2MBG A;  5JH7 E;  4WBO A;  3SOL A;  4IGU A;  3UFE A;  5JR9 A;  5LGU B;  1H7C A;  5HXC A;  2ZM8 A;  3ZMU B;  4EB6 E;  2LSI A;  4AKL A;  2XAJ B;  4GK0 E;  4CZZ B;  3ZYL A;  2B1E A;  4PFO A;  1OWA A;  5C8Y E;  4AQF C;  3C50 A;  4EZH A;  3AA0 B;  2IAK A;  5LGN B;  2VKH A;  2YK0 A;  4CI2 B;  2L8K A;  3AVS A;  2LHR A;  4BJM A;  2CXL A;  3C4Z A;  3KV4 A;  3D0T A;  4IIJ E;  2LE8 A;  5LA6 E;  2D0U A;  3B57 A;  4O2B E;  1D0Z A;  2L3L A;  2DWG A;  2BDE A;  2RA1 A;  3ZJ2 A;  5CA1 E;  3LK3 B;  2WSS V;  5JDN A;  2KND A;  5JDH A;  2JMK A;  2X9H A;  2LEH A;  2HPJ A;  1IJ5 A;  4QXH B;  2MTQ A;  2KXP B;  2WMO A;  2VL8 A;  3PDY A;  5JDF A;  2V7L A;  2RP4 A;  1LVF A;  2CM0 A;  4FJO A;  3W15 B;  2G0U A;  4HGA A;  2V1D B;  3MK7 C;  4IE7 A;  3LG7 A;  2WM9 A;  2MOZ A;  2E9X A;  3N9O A;  4BA9 A;  2A3D A;  2H7V C;  3N9L A;  3EVY A;  5JDG A;  3R84 B;  3K3N A;  4YHJ A;  1U5P A;  4PJL A;  3FXD B;  4C91 A;  5KX5 E;  4UVC B;  3BK9 A;  2EHO B;  3HR0 A;  4PJN A;  4AKG A;  4UVB B;  3I9Y A;  3N9M A;  2CMR A;  4QXC B;  3CQX C;  4M1P A;  3ZPO A;  4HTE A;  3PUQ A;  4ZHQ E;  5H6Q B;  2UXX B;  4TUY E;  4KMC A;  3GN5 A;  4GOU A;  2K48 A;  2E8I A;  2XQY A;  1MMD A;  3BQL A;  2ACX A;  2DLR A;  2P9B A;  1QUU A;  2Z6E A;  2IW5 B;  5JDL A;  5FNV E;  4CXY A;  1S94 A;  5AFU L;  2XTL A;  3N2G E;  4XBF B;  4YFS A;  3O1J A;  4ZI7 E;  3AB3 B;  4UF0 A;  3U78 A;  2Y6X A;  5J1G A;  3IHR A;  4CI1 B;  4AXP A;  5LJN A;  3NBX X;  3PUS A;  3ZMZ B;  1D0X A;  3MZK B;  2IC6 A;  2IC9 A;  3ZCI A;  3OYZ A;  3LJC A;  4HN9 A;  1HTJ F;  3EUH A;  4P0A A;  2E9X B;  2PJQ A;  2ZMA A;  4JEH B;  5J2U E;  3I9W A;  3QC9 A;  3KV5 A;  3ONX A;  3QK6 A;  2YEV C;  4AKI A;  1U4Q A;  2NTY A;  3FXE B;  1SA0 E;  3AA7 B;  5F3J A;  4TV9 E;  5LXT E;  4L9I A;  5HAX A;  4QX8 B;  3O4X E;  4DBQ A;  5TAO A;  3RRW A;  2JJ9 A;  2H3R A;  1UX4 A;  2NOX A;  2VWA A;  3AVR A;  4PK4 A;  5HXE A;  2C5K T;  1ZV4 X;  3I1A A;  3LK4 2;  2CLY C;  2X68 A;  2K5B B;  4IDZ A;  2ZM0 A;  2V7J A;  4PK5 A;  2V26 A;  2V7K A;  3N9P A;  2Q9Q D;  2LSJ A;  3ETU A;  3T8O A;  5F8P A;  3GA8 A;  4G63 A;  3AA6 B;  3LFM A;  4QKN A;  3UT5 E;  4UEM A;  5J2T E;  2CWY A;  3Q2M A;  3MXZ A;  5FXV A;  5L3E B;  5LHG B;  3ZCJ A;  2X9X A;  3RYI E;  3NRY A;  2VAS A;  1YKH B;  5LNK A;  2HH7 A;  1UX5 A;  4TV8 E;  5LG4 A;  4AI6 A;  2CWO A;  1QSD A;  5L3D B;  4TX5 A;  3CX6 B;  3V5S A;  1IAP A;  3ZLI A;  4X1K E;  3ZC1 A;  2C5I T;  4IST A;  2EHO A;  1MMA A;  3A5X A;  3NRX A;  2A72 A;  2UXN B;  3KIN B;  1HS7 A;  3KFW X;  5JDQ A;  5IYZ E;  3ZEF B;  2XAH B;  4OK0 A;  3RC8 A;  4V1A v;  4U72 A;  3R6N A;  1FMW A;  5IHY A;  3ZYM A;  3U3I A;  1Y64 B;  5L3G B;  2DCF A;  2W0G A;  4PNI A;  2D5U A;  3P7I A;  4H63 V;  3PU3 A;  2XAF B;  5L2L A;  3KBT A;  5DQW A;  4ERR A;  4E7Z A;  5A1L A;  4NUU A;  5LOV E;  2ZLY A;  2KZ7 B;  3K8P C;  2D2S A;  2D0T A;  2KIN B;  4ZI2 D;  4PW8 A;  2NP9 A;  1FEW A;  4UV9 B;  5JR9 C;  3RPU A;  3E0Z A;  2Q9Q C;  1LVK A;  5LJM A;  4O2A E;  2I59 A;  2VKJ A;  3MJX A;  5HWX A;  2X9W A;  3KVB A;  1MNE A;  3FBL A;  2PBI A;  3N9Q A;  3FHN A;  2CEA A;  2V7I A;  4UXN B;  3N2O A;  4EAH A;  5L3C B;  3E22 E;  4BJN A;  2C5J A;  4H63 H;  3RC3 A;  5FXZ A;  2N2N A;  4O4H E;  4KP3 C;  1YD8 G;  5FY0 A;  1VOM A;  4YJ2 E;  2KWH A;  5M4Y A;  2XUE A;  2N9D A;  4L5G A;  3FBZ A;  3RRC A;  3PE0 A;  4U74 A;  3LK2 B;  2XAQ B;  2X9Y A;  4H9P C;  5ADX L;  3HI2 A;  1HFA A;  4B6X A;  4CQI A;  3RH3 A;  1HG5 A;  2DI4 A;  5HXS A;  1FMV A;  2GK9 A;  1T98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...