1YKHB

Structure of the mediator med7/med21 (med7/srb7) subcomplex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
114
Chain Sequence
TDRMTQLQICLDQMTEQFCATLNYIDKNHGFEVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLMRHVDSMIEDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords RNA polymerase II mediator complex protein MED7
total genus 46
structure length 114
sequence length 129
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykhB00
1YKHB 1YKEB
chains in the Genus database with same CATH superfamily
1JNZA 3C64A 2X9HA 3PJAJ 4O2AE 3SRZA 4KHPT 2XQ5A 1HCIA 2LSGA 3AAIA 2OA5A 4IE4A 1L0VA 3RIFA 5BMVE 5HXEA 2XSAA 2XAQB 1LVKA 3JAFA 1XZYA 3PUWF 2LSIA 2Q9QB 3O1IA 4IL4A 2NW9A 5ABGA 1Z0PA 3GN5A 3HKEE 4DIDB 2WSSV 1NENA 2VKOA 2IDOB 2Y6XA 3N9QA 3RQWA 4AQGA 4ANJA 5LJMA 2XAJB 3ZMVB 5JH7E 3KV4A 3J7Yq 2XJ7A 2ZM2A 1FEWA 2C5KT 4OYJA 2XQ9A 2KWHA 2VK9A 4V1Av 4CN6A 3Q5WA 4WZXA 3B13A 4DV5T 3P8CD 3AEGA 3BQKA 4H63H 4DBRA 3R6NA 4JUYA 4Q25A 4O8SA 2D0UA 5L3DB 4OHFA 4HFCA 4HWDA 2VB6A 4DR2T 4O4HE 3ZYLA 4AXPA 4UF0A 2V5CA 2J47A 2XQYA 1S94A 3V5SA 2UXCT 2MOZA 3RLFF 3K3OA 4XAXB 2WZHA 5CB4E 3PJAA 3F2EA 3KFWX 4IE6A 4DUYT 5JR9B 5L2LA 3SWHA 4HWFA 3EVYA 1XMQT 2XASB 4H9OC 3L39A 2V6YB 4PFPA 4TWDA 3RIAA 3PUGA 5JDNA 4H9NC 1N33T 1BR4A 2BS4A 2MPKA 5JREA 2WZIA 4AQFA 5HXSA 4JV5T 4WW0A 4HFHA 4LF7T 1CUNA 1T98A 5FY1A 3U3IA 4YFSA 2XY8B 2BG9E 3I9WA 1HX1B 3CQGB 3KBUA 3UULA 5DQVA 1E1HB 4XZCA 3AVRA 4HTEA 5LGUB 5HEGA 2CLYC 3BK9A 1G73A 3PUYF 5HAXA 2M6BA 2MTQA 2VKHA 3ZMSB 4U72A 3P4WA 2LM9A 3AE3A 3MA9A 3JC6C 5ABFB 4LF9T 4DO0A 4DMVA 1YQ4A 5LNKA 3HI2A 1S35A 3WI3A 2UUBT 3AA0B 1HFAA 4P1NA 4JEUB 2Y8DA 2N9DA 3UU6A 2DWGA 4TWHA 4YHJA 5HEOA 5LBMA 3UQ4A 3RKOA 2ODVA 1HNXT 2X0HA 4ADZA 3KV6A 1KF6A 4HKAA 4ZOLE 3RGLA 5HEJA 5L4EA 2X67A 2WAUA 2XM2A 4U2ZA 4WNKA 3UT5E 3QB5K 3AE7A 2CRBA 5C2TA 4QXBB 2QGSA 2LOPA 2W67A 4CXYA 4X65T 5C8YE 5CA0E 2CMRA 4TNVA 2WWUA 2FJBA 2XM1A 1VCTA 3ONLC 1I94T 3RI5A 3ZPOA 2Z6EA 2V7IA 3IA3A 4Z8XA 5C3JA 2QYWA 3TLWA 3ANWB 5FXXA 2KZ7B 3N2KE 3ABVA 4PK5A 4ZI2D 3OTOT 5HWYA 2CXFA 2LHNA 2VKDA 2A3DA 2XQ4A 3CQCB 1X79A 1H7CA 2B1EA 3FZFB 4PK4A 2VL0A 2IC9A 3PURA 4UEMA 3ZMUB 4IDQA 2LHRA 4UVCB 4AKRB 3ZT6A 4B6XA 2VQFT 3UUNA 1KNRA 5AQPB 3T1YT 2LSJA 3UU4A 2X66A 4ERRA 1OEDB 1WYCA 2XQ6A 2VQET 2L3LA 3CPZA 4H63V 4LF4T 4MBQA 2D9DA 2WU2A 3AE1A 5JDFA 2IC6A 3HKCE 4IHJE 3SS1A 4DR6T 4O4LE 2WWVA 1OEDE 4CZZB 3Q5DA 3EAMA 4O4JE 5LXTE 4L5GA 4ZI3D 1KFYA 4YTMA 3ETUA 5J0ZA 3AEAA 3UU5A 3EHZA 4EEDA 4EZHA 3E0ZA 2CA5A 4TX5A 3UUXB 3CIRA 3Q2MA 4B3RT 4ZXLA 4O4IE 5BR8T 5JDQA 2E5VA 2Q9QD 4X1KE 2KSRA 2XUEA 4EAHA 3GMIA 2V7MA 3ZN0B 5KXJA 2QRXA 3UUMA 4I55E 2YDQA 3FZHB 4FJOA 4H9PC 3MKDA 5L3CB 2BG9C 3ONXA 3AB3B 1ZKEA 2LLYA 4K0UA 3RYFE 2XAHB 1BR0A 2HH7A 1NEKA 3ETVA 3D0TA 3F57A 4XBFB 1YQ3A 2JMKA 4GKKT 4PNIA 1MNDA 3TLVA 1YD8G 2M6IA 1BR2A 2CE7A 3L3PA 3AEFA 4EXTA 3CX8B 3JCFA 4YSZA 5L47A 5LGTB 1HX8A 3AA7B 2EHOC 1MMDA 4UVBB 5GONE 5JR9C 4P0BA 4LFBT 4JI1T 4NPPA 5JRCA 4EYUA 2A72A 4AKIA 3CMLA 3AE5A 1UGOA 5LYJE 1X9BA 4Z90A 5JVDE 4ZS2A 3UU3A 4AKLA 5J2UE 5JRCB 4QX8B 2D5UA 3M65A 3AA6B 3PUAA 4PJJA 4DV1T 3VRBA 4LFCT 2JQQA 2V7JA 3PUQA 2H3RA 1IZNB 1MMNA 2NW8A 2QVAA 3EI0A 3RKGA 5ETWA 5IUXA 2CXLA 5AQSB 1UCUA 2CBJA 3FXDB 2BVMA 4EIWA 4O2BE 5JTGA 2UU9T 4LFAT 3MZKB 4E7SA 3O4XE 5JQGE 4X64T 4JEHB 5ADXL 3E22E 3I0QA 2G0UA 5F5WA 1V9DA 1ZP0A 2ACXA 4GK0E 2E2AA 4MLKA 2AE9A 4B3ST 1KNPA 1LVFA 3A5XA 3ANWA 3JC6D 3KV9A 3FZLB 4ASKA 4C91A 4ZS3A 5LP6E 1HNZT 5LG4A 1G8XA 4U7IA 2XQ8A 3UU8A 1E2AA 3ZLIA 2H7OA 2UXDT 2XHEB 2KT9A 5F3JA 4QH5A 3HKBE 3RIUC 1IBLT 4AQYT 5CJ5A 2IMLA 2WDQA 4IE5A 4KMCA 4DR4T 1NAFA 2I6HA 1N36T 1N32T 3AECA 3E08A 2DI4A 4IREA 2X0LB 2A2FX 1D1AA 4EV6A 3AE4A 3AE9A 3CQXC 5FKYA 1IJ6A 4QX7B 3AA1B 2UUAT 1T8BA 5AQMB 2XTLA 3LK42 4IDNA 3ZCIA 5ABHA 3ESLA 1ZV4X 5IWAT 3RRWA 4L0RA 1O3XA 4TUYE 4WBOA 4UELA 2ZMAA 3FBZA 3K1SA 4K0KT 3FZKB 4ZZBA 3HR0A 4IGUA 3AXJA 1E7PA 2YOEA 3RQUA 3HKDE 3QK6A 3S4UA 3ZT5A 3RC3A 2W66A 2W00A 2PTFA 4ILAA 4YSYA 4C90A 5KX5E 3G06A 2FJDA 1ZOYA 3RX6A 5AQVB 2VURA 3AAEB 4DV2T 2DHRA 2WCAA 1LRZA 2P9BA 4MHCA 2WMOA 2NTYA 5FVLA 1AJ3A 4KBMB 3K3NA 2B76A 3I9YA 2YDSA 3H37A 3LK2B 4HEAA 4HGAA 4UV9B 3LJCA 1IAPA 1MIWA 2FJEA 3N5LA 4X1IE 5J1GA 3TLSA 5LOVE 4HFIA 1WYBA 5HXCA 4YY3T 2YDRA 3C4WA 2JQHA 4GYSA 3QNUA 2NWBA 3H3MA 5AQJB 2J62A 3V5UA 5FYMA 3VU7H 4AKHA 3NWIA 4HWHA 1WR0A 4PJNA 4YHHT 4QXCB 5FP3A 4PJLA 1M7KA 3PE0A 4ISSA 1UX4A 2BVLA 3PV0F 4U3CA 5HEUA 2KWIB 3KVAA 4IT4A 3ZC1A 3N9NA 3NRXA 2JRKA 1OXZA 2XQ3A 3VHLA 4AIUA 4BAYB 3WAKA 3HA4A 4M1PA 2XQAA 2YU2A 3AAAB 3C4ZA 3DP7A 4DNDA 1T72A 4COFA 1LKXA 4Z91A 4BJMA 1SE7A 1XDPA 4UVAB 5AQKB 2L9QA 4DR7T 3BQLA 1M62A 3LK3B 3LDQB 3TLUA 5LHIB 2IW5B 5AQQB 1WFDA 2CHOA 2WQYA 3JADA 3P50A 4IIJE 2JMHA 3Q5XA 4UF0B 3QUJA 5FL0A 4HFVA 2K5BB 3KDSE 4TN7B 2XAGB 3RYCE 3JAEA 1HG5A 4DV0T 4JI6T 4I50E 2ZLYA 3ZMZB 3C98B 4DVDA 2VL8A 1MIVA 4PFOA 4X20E 3AE8A 2LKGA 3NBXX 4HFEA 3P4QA 3HL6A 3PUZF 3I1AA 1HR0T 1MIYA 2RPAA 5JR9A 3FB2A 2EHOA 4CXXA 2UUCT 5AQHB 3SFDA 4CI1B 5LMUT 3EDVA 4HFDA 3C51A 3QOFA 2AXDS 2XZEA 3AVSA 3IHRA 2L8KA 4X66T 4OX9T 5L3EB 1OEDA 2HPLA 1HTJF 2X9WA 4HE8A 2HPJA 4EGWA 1QSDA 2E5LT 3VKHA 5LBQB 4YT0A 1SA0E 4B3TT 2BG9A 5EK4A 3VR9A 4PK6A 3ZSSA 2UXNB 2Q9QC 3N9MA 5E0OA 3ZYKA 1D1BA 4GYRA 2BKPA 3L09A 4WBNE 2RA1A 2HN2A 3N9OA 3O1JA 2CWYA 3IBPA 3ZC0A 4GK5E 4KI0F 3O9XA 1W09A 2KLQA 2Y48B 5EK2A 3PTRB 2A9UA 2JJ9A 3R84B 2XAFB 2ZM8A 2H89A 3UUBA 2X0YA 3VRAA 4CI2B 4GOUA 4U74A 1U4QA 2IHR1 2DL1A 1SHZC 1D0YA 3GN5B 4EOZB 2CBIA 5LB7B 2OV9A 2V26A 3N2GE 4GIWA 5CFBA 4EEBA 2CCQA 4DV3T 2IIUA 5L4HA 2XQ7A 4KX6A 4IDZA 2YINA 4ZEYA 5ABEA 3AE2A 4P09A 2LSKA 1XDOA 3A7MA 4OYKA 2LRKA 5AQNB 4LF6T 3DTOA 1FIOA 1U5PA 1YXRA 2KINB 2ODUA 3EABA 3OPCA 3Q5EA 2YU1A 1WLXA 4OFZA 2BZBA 2CHNA 3P4RA 2X9YA 2GK9A 4OK0A 3IEEA 3IF8B 4UV8B 3N9LA 2X68A 5FXZA 2LM2A 3RPUA 3RYHE 4CI3B 2PBIA 5L3BB 3NVOA 2QA7A 4PJMA 2VASA 3RYIE 5KMGP 4DMWA 3ZEFB 3UQ7A 5DJQC 5LCYA 2HHHT 2V1DB 5DQWA 3VR8A 2SPCA 3ZYMA 1MMAA 2NR4A 3UFGA 2BS2A 2ES0A 4G2AA 4H9QC 4DR3T 4DR5T 3AE6A 1HS7A 3MACA 4DUZT 2X51A 2UXXB 3PDYA 2W61A 3ZT7A 3AEDA 4IE0A 2DCFA 2DLRA 3KINB 2E9XC 2YN6A 3OBVE 2N2NA 3RRCA 3TKLB 5HXRA 2E8IA 2VVSA 4YJ2E 3M3ZB 4DBQA 4JI2T 4UIGA 3BQIA 3RIUA 4TNWA 5JDGA 3ZJ1A 3AEEA 3CK6A 3KVBA 1ZHCA 3EDUA 2CLYB 2Q9QA 3FBLA 3OYXA 5AQUB 5CGMA 4HN9A 3MJXA 4LF5T 1KEYA 3CX6B 4JBWF 4QH4A 5DABA 5AQRB 2WU5A 2E9XA 2FUPA 4HWIB 4EB6E 4AKGA 2BDEA 2JPFA 4L9IA 2OLTA 5L3FB 2JQ9A 3ZSTA 4I43B 3A8YC 3CX7B 5EZYE 5LG3A 4MFRA 4DR1T 3PU8A 1XNRT 2LOSA 3P4PA 4IL9A 3C4XA 4H9RC 2BG9B 1HF8A 1UX5A 4WYVA 5LMNT 2KNDA 3NZPA 1VOMA 2ZM0A 3RF1A 4JI0T 4AQFC 2BKNA 4TWFA 1WRDA 3KV5A 2WP9A 4U7YA 5AQIB 1NWMX 2H88A 5IYZE 2LKHA 3T8OA 1WR6A 2EHOB 2C0SA 1VCSA 4AISA 4IE7A 1YKEB 3ZCJA 4A98A 2BS3A 3T1HT 4UR9A 4EYYR 3DJBA 2M67A 2W63A 3NRYA 3LFMA 4KHZF 2J4GA 2CPTA 2CWOA 4GKJT 3SOLA 2HN1A 4NXNT 2D0TA 3LBXA 1Z8UA 5AFUL 2XPKA 2PFVA 4FI5A 4NUVA 4A56A 5HWXA 3PU3A 2WM9A 2H7VC 1HG2A 2LJLA 3O1HA 3LSVA 4NUUA 1US7B 1FMWA 1ZEEA 1OEDC 5FY0A 5JDMA 1MNEA 2F4VT 2JQKA 4U31A 1VRBA 2LEHA 2KMFA 4QKNA 2WDRA 2YK0A 3QC9A 3SFEA 4LMKA 3GWHA 2W4XA 3PUXF 4YTPA 3CVRA 4TZ4C 4ZZCA 5AQTB 5LJNA 4TV9E 3ZN1B 2N1GA 2VKJA 5HCJA 3ONJA 3H3AA 4YJ3E 2DWKA 2BKOA 3MXZA 3X1DA 5JDHA 4DV7T 1J5ET 4A97A 3OVUA 5A1LA 4JI3T 4JI8T 4ILBA 2YEVC 2K24A 2CXDA 4B3MT 1OWAA 3LBXB 3UFEA 2R6GF 4KP3C 5FL1A 4A5XA 5H6QB 4BA9A 2C5IT 4PW8A 1IBKT 5HCMA 2NTXA 3B5MA 4X62T 3OYZA 1DU2A 3RC8A 3FXEB 1W0AA 5AQFB 4DV6T 2V7LA 4ILUA 1D1CA 4G63A 4F8HA 2DNXA 4QH1A 2RP4A 4JI7T 1I6ZA 2ZM6T 2W62A 3N2OA 5TAOA 1KNZA 4IDOA 1FMVA 3K8PC 1XWMA 5HEHA 1T7SA 4HFBA 3Q9DA 2LSYA 5KDMC 2JIWA 5JDLA 1J1JA 3B57A 4JLEA 2WS3A 2W2UA 4DV4T 4ISTA 3RH3A 3VKGA 2WB5A 1CHUA 3PUVF 2LT3A 5F8PA 4ZI2C 4QWNB 4CQIA 3OJAA 1QUUA 2V6XA 1XMOT 1W0BA 3UTKA 2V8SV 2WMNA 1UURA 5FVKA 2X9XA 3AEBA 2FBWA 2E9XD 3K3QC 3LG7A 5IHYA 1N34T 2LRLA 2PG8A 2I59A 4I4TE 4YXDA 5M4YA 4AI6A 3CWZB 4JYAT 4NIQA 4I0UA 2V7KA 4U33A 1IJ5A 3FHNA 4H9SE 4LMLA 4PAGA 4E7ZA 3L8RA 5FNVE 1MMGA 4X1YE 1GQEA 2I0MA 5LA6E 3W15B 4IDPA 4KUMB 4MALA 3TLTA 3CKDA 2NW7A 4YSXA 2NOXA 3FZMB 2V6YA 2MBGA 2V5DA 5FXWA 5HYAA 2CEAA 4NXMT 5L3GB 1J5WA 3P7IA 4X5TA 4JI5T 2C5JA 4LMJA 5AQOB 2IUBA 4ILCA 2BBHA 2D2SA 1R8IA 1EZ3A 1JNRA 1YKHB 2VVNA 3AXJB 3F31A 1UK5A 4LF8T 3RHWA 3ZKRA 3ZMTB 1B7TA 2BBJA 3EUHA 1XNQT 4BJNA 2WBLA 1UUSA 4ZI3C 2NP9A 3OKQA 2WY2A 2XSBA 3NZQA 4U2YA 4ZI7E 4ZHQE 5LGNB 2EHOD 4UXNB 3P4SA 1Y01A 1KK7A 2CM0A 2KXPB 4TV8E 2ACZA 4JI4T 2LE8A 3N9PA 3GA8A 3J9X1 5CA1E 4P0AA 1D0ZA 3QB5A 4YLHA 3PUSA 3ZJ2A 4QXHB 5ABFA 2UXBT 2WDVA 2E9XB 2PJQA 3NKZA 4J2CA 5FY7A 4F6RC 1D0XA 2K3WA 3I0OA 5AQGB 1FJGT 1BR1A 1W9RA 1IBMT 3KBTA 4CN1A 1HNWT 4QHOA 2MAWA 2IAKA 2K9AA 5EK3A 1QLBA 2J1DG 5FMNA 5LHGB 4CN4A 3MK7C 2MYSA 5HXHA 5J2TE 5H6RB 2FJAA 2W0GA 5LHHB 1SUMB 2VWAA 5AQLB 3U78A 4N78D 2K48A 1Y64B 3C50A 2YKSA 4HWCA 3WAJA 1WCRA 4CXWA 5FXVA 1YW0A 4YTNA 4EZ4A
chains in the Genus database with same CATH topology
3C64A 2X9HA 4O2AE 3SRZA 1HCIA 2LSGA 3AAIA 2OA5A 4IE4A 5BMVE 5HXEA 2XAQB 1LVKA 2LSIA 2Q9QB 3O1IA 2NW9A 1Z0PA 3GN5A 3HKEE 2WSSV 2VKOA 2Y6XA 3N9QA 4AQGA 4ANJA 5LJMA 2XAJB 3ZMVB 5JH7E 3KV4A 3J7Yq 2ZM2A 1FEWA 2C5KT 4OYJA 2KWHA 2VK9A 4V1Av 3Q5WA 3B13A 3P8CD 3BQKA 4H63H 4DBRA 4JUYA 4O8SA 2D0UA 5L3DB 4OHFA 2VB6A 4O4HE 3ZYLA 4AXPA 4UF0A 2XQYA 1S94A 3V5SA 2MOZA 3K3OA 4XAXB 5CB4E 3F2EA 3KFWX 4IE6A 5JR9B 5L2LA 3SWHA 3EVYA 2XASB 4H9OC 4PFPA 5JDNA 3PUGA 4H9NC 1BR4A 5JREA 4AQFA 5HXSA 4WW0A 1CUNA 1T98A 5FY1A 3U3IA 4YFSA 3I9WA 3KBUA 3UULA 3CQGB 5DQVA 1E1HB 4XZCA 3AVRA 4HTEA 5LGUB 2CLYC 3BK9A 1G73A 5HAXA 2MTQA 2VKHA 3ZMSB 4U72A 2LM9A 3MA9A 3JC6C 4DO0A 4DMVA 5LNKA 3HI2A 1S35A 3WI3A 3AA0B 1HFAA 4JEUB 2Y8DA 2N9DA 2DWGA 4YHJA 5LBMA 3RKOA 2ODVA 4ADZA 3KV6A 4HKAA 4ZOLE 2X67A 2WAUA 4WNKA 3UT5E 4QXBB 2QGSA 2LOPA 4CXYA 5C8YE 5CA0E 2CMRA 2WWUA 3ZPOA 2Z6EA 2V7IA 4Z8XA 3ANWB 5FXXA 2KZ7B 3N2KE 4PK5A 4ZI2D 5HWYA 2CXFA 2LHNA 2VKDA 3CQCB 2A3DA 4PK4A 1X79A 1H7CA 2B1EA 4UEMA 3PURA 2IC9A 3ZMUB 4AKRB 4B6XA 2LHRA 4UVCB 3UUNA 2LSJA 2X66A 4ERRA 1WYCA 2L3LA 3CPZA 4H63V 4MBQA 5JDFA 2IC6A 3HKCE 4IHJE 3SS1A 4O4LE 4CZZB 4O4JE 5LXTE 4L5GA 4ZI3D 3ETUA 3VKHA 4EZHA 3E0ZA 2CA5A 4TX5A 3UUXB 3Q2MA 4O4IE 5JDQA 2Q9QD 4X1KE 4EAHA 2XUEA 3GMIA 2V7MA 3ZN0B 3UUMA 4I55E 4FJOA 4H9PC 3MKDA 5L3CB 3ONXA 3AB3B 1ZKEA 1BR0A 4K0UA 3RYFE 2XAHB 2HH7A 3ETVA 4XBFB 3D0TA 3F57A 2JMKA 4PNIA 1MNDA 1YD8G 1BR2A 2CE7A 3L3PA 5LGTB 4EXTA 3CX8B 1HX8A 3AA7B 2EHOC 1MMDA 4UVBB 5GONE 5JR9C 4P0BA 5JRCA 4EYUA 2A72A 4AKIA 3CMLA 5LYJE 4AKLA 5JVDE 4ZS2A 5JRCB 5J2UE 4QX8B 2D5UA 3M65A 3AA6B 3PUAA 4PJJA 2JQQA 2V7JA 3PUQA 2H3RA 1IZNB 1MMNA 2NW8A 5ETWA 2CXLA 1UCUA 3FXDB 2BVMA 4EIWA 4O2BE 3MZKB 4E7SA 3O4XE 5JQGE 4JEHB 5ADXL 3E22E 3I0QA 2G0UA 1V9DA 2ACXA 4GK0E 4MLKA 1LVFA 3A5XA 3ANWA 3JC6D 3KV9A 4ASKA 5LP6E 4ZS3A 5LG4A 1G8XA 3ZLIA 2H7OA 2XHEB 2KT9A 5F3JA 3HKBE 4IE5A 4KMCA 1NAFA 3E08A 2DI4A 2X0LB 2A2FX 1D1AA 3CQXC 1IJ6A 4QX7B 3AA1B 2XTLA 3LK42 3ZCIA 3ESLA 1ZV4X 3RRWA 4L0RA 1O3XA 4TUYE 4WBOA 4UELA 2ZMAA 3FBZA 3HR0A 4IGUA 3S4UA 3HKDE 3QK6A 3RC3A 2W00A 5KX5E 4C90A 3RX6A 3AAEB 2DHRA 1LRZA 2P9BA 4MHCA 2WMOA 2NTYA 1AJ3A 4KBMB 3K3NA 4HGAA 3I9YA 4HEAA 3H37A 3LK2B 4UV9B 3LJCA 1IAPA 1MIWA 3N5LA 5J1GA 4X1IE 5LOVE 5HXCA 1WYBA 4WBNE 3C4WA 4GYSA 3V5UA 2NWBA 5FYMA 3VU7H 4AKHA 4PJNA 4QXCB 5FP3A 4PJLA 3PE0A 4ISSA 1UX4A 2BVLA 2KWIB 3KVAA 3ZC1A 3N9NA 3NRXA 2JRKA 1OXZA 3VHLA 4BAYB 3WAKA 3HA4A 4M1PA 2YU2A 3DP7A 3AAAB 3C4ZA 4DNDA 1LKXA 4BJMA 4UVAB 2L9QA 3BQLA 3LK3B 5LHIB 2IW5B 4IIJE 2JMHA 3Q5XA 4UF0B 3QUJA 4HFVA 2K5BB 3KDSE 4TN7B 2XAGB 3RYCE 1HG5A 4I50E 2ZLYA 3ZMZB 3C98B 4DVDA 2VL8A 1MIVA 4PFOA 4X20E 3NBXX 3HL6A 3I1AA 1MIYA 5JR9A 4CXXA 3FB2A 2EHOA 4CI1B 3EDVA 3C51A 3AVSA 3IHRA 2L8KA 5L3EB 2HPLA 1HTJF 2X9WA 4HE8A 2HPJA 1QSDA 5LBQB 1SA0E 5EK4A 4PK6A 2UXNB 2Q9QC 3N9MA 5E0OA 3ZYKA 1D1BA 4GYRA 3L09A 2RA1A 3N9OA 3O1JA 2CWYA 3IBPA 3ZC0A 4GK5E 3O9XA 2KLQA 2Y48B 5EK2A 3PTRB 2JJ9A 3R84B 2XAFB 2ZM8A 4CI2B 4GOUA 4U74A 1U4QA 3GN5B 1SHZC 1D0YA 4EOZB 2V26A 3N2GE 4GIWA 2CCQA 4IDZA 2YINA 4P09A 2LSKA 4OYKA 3DTOA 1FIOA 1U5PA 2KINB 2ODUA 3R6NA 4OFZA 4C91A 2YU1A 1WLXA 2BZBA 5LJNA 2X9YA 2GK9A 4OK0A 3IEEA 3IF8B 4UV8B 3N9LA 2X68A 5FXZA 3RPUA 3RYHE 4CI3B 2PBIA 5L3BB 2QA7A 4PJMA 2VASA 3RYIE 5KMGP 4DMWA 3ZEFB 5DJQC 5LCYA 2V1DB 5DQWA 3ZYMA 2SPCA 1MMAA 4G2AA 2ES0A 4H9QC 1HS7A 3MACA 2X51A 2UXXB 3PDYA 2W61A 4IE0A 2DCFA 2DLRA 3KINB 2E9XC 3OBVE 2N2NA 3RRCA 3TKLB 5HXRA 2E8IA 4YJ2E 4DBQA 4UIGA 3BQIA 5JDGA 3ZJ1A 3KVBA 1ZHCA 3EDUA 2CLYB 2Q9QA 3FBLA 3OYXA 4HN9A 3MJXA 3CX6B 5DABA 2E9XA 4EB6E 4AKGA 2BDEA 2JPFA 4L9IA 5L3FB 4I43B 3CX7B 5EZYE 4MFRA 3PU8A 2LOSA 3C4XA 4H9RC 1HF8A 1UX5A 2KNDA 3NZPA 1VOMA 2ZM0A 4AQFC 1WRDA 3KV5A 1NWMX 5IYZE 3T8OA 1WR6A 2EHOB 2C0SA 4IE7A 1YKEB 3ZCJA 4EYYR 3DJBA 2M67A 2W63A 3NRYA 3LFMA 2CWOA 3SOLA 2D0TA 3LBXA 5AFUL 4NUVA 2PFVA 4FI5A 4A56A 5HWXA 3PU3A 2WM9A 2H7VC 1HG2A 2LJLA 3O1HA 4NUUA 3ZJ2A 1US7B 1FMWA 1ZEEA 5FY0A 5JDMA 1MNEA 1VRBA 2LEHA 2KMFA 4QKNA 3QC9A 2YK0A 3GWHA 3CVRA 4TZ4C 4TV9E 3ZN1B 2N1GA 2VKJA 3H3AA 4YJ3E 2DWKA 3MXZA 5JDHA 5A1LA 2YEVC 2K24A 2CXDA 1OWAA 3LBXB 3UFEA 4KP3C 5H6QB 4BA9A 2C5IT 4PW8A 2NTXA 3OYZA 3RC8A 3FXEB 2V7LA 4ILUA 1D1CA 4G63A 2DNXA 4AI6A 2RP4A 2W62A 3N2OA 5TAOA 1KNZA 1FMVA 3K8PC 3Q9DA 2LSYA 5KDMC 5JDLA 3B57A 4JLEA 4ISTA 3RH3A 3VKGA 2LT3A 5F8PA 4ZI2C 4QWNB 4CQIA 3OJAA 1QUUA 3UTKA 2WMNA 2X9XA 2E9XD 3K3QC 3LG7A 5IHYA 2PG8A 2I59A 4I4TE 5M4YA 3CWZB 2V7KA 1IJ5A 3FHNA 4H9SE 4PAGA 4E7ZA 5FNVE 1MMGA 4X1YE 5LA6E 3W15B 4KUMB 4MALA 3CKDA 2NW7A 2NOXA 2MBGA 5FXWA 5HYAA 2CEAA 5L3GB 3P7IA 2C5JA 2D2SA 3F31A 1EZ3A 1YKHB 3ZMTB 1B7TA 3EUHA 4BJNA 2WBLA 4ZI3C 2NP9A 3OKQA 3NZQA 4ZI7E 4ZHQE 5LGNB 2EHOD 4UXNB 1KK7A 2CM0A 2KXPB 4TV8E 2LE8A 3N9PA 3GA8A 3J9X1 5CA1E 4P0AA 1D0ZA 4YLHA 3PUSA 4QXHB 2E9XB 2PJQA 5FY7A 4J2CA 4F6RC 1D0XA 3I0OA 1BR1A 3KBTA 4QHOA 2IAKA 2K9AA 5EK3A 5LHGB 2J1DG 5FMNA 3MK7C 2MYSA 5HXHA 5J2TE 5H6RB 2W0GA 5LHHB 2VWAA 3U78A 4N78D 2K48A 1Y64B 3C50A 3WAJA 4CXWA 5FXVA 1YW0A 4EZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKH B;  1YKE B; 
#chains in the Genus database with same CATH topology
 1JNZ A;  3C64 A;  2X9H A;  3PJA J;  4O2A E;  3SRZ A;  4KHP T;  2XQ5 A;  1HCI A;  2LSG A;  3AAI A;  2OA5 A;  4IE4 A;  1L0V A;  3RIF A;  5BMV E;  5HXE A;  2XSA A;  2XAQ B;  1LVK A;  3JAF A;  1XZY A;  3PUW F;  2LSI A;  2Q9Q B;  3O1I A;  4IL4 A;  2NW9 A;  5ABG A;  1Z0P A;  3GN5 A;  3HKE E;  4DID B;  2WSS V;  1NEN A;  2VKO A;  2IDO B;  2Y6X A;  3N9Q A;  3RQW A;  4AQG A;  4ANJ A;  5LJM A;  2XAJ B;  3ZMV B;  5JH7 E;  3KV4 A;  3J7Y q;  2XJ7 A;  2ZM2 A;  1FEW A;  2C5K T;  4OYJ A;  2XQ9 A;  2KWH A;  2VK9 A;  4V1A v;  4CN6 A;  3Q5W A;  4WZX A;  3B13 A;  4DV5 T;  3P8C D;  3AEG A;  3BQK A;  4H63 H;  4DBR A;  3R6N A;  4JUY A;  4Q25 A;  4O8S A;  2D0U A;  5L3D B;  4OHF A;  4HFC A;  4HWD A;  2VB6 A;  4DR2 T;  4O4H E;  3ZYL A;  4AXP A;  4UF0 A;  2V5C A;  2J47 A;  2XQY A;  1S94 A;  3V5S A;  2UXC T;  2MOZ A;  3RLF F;  3K3O A;  4XAX B;  2WZH A;  5CB4 E;  3PJA A;  3F2E A;  3KFW X;  4IE6 A;  4DUY T;  5JR9 B;  5L2L A;  3SWH A;  4HWF A;  3EVY A;  1XMQ T;  2XAS B;  4H9O C;  3L39 A;  2V6Y B;  4PFP A;  4TWD A;  3RIA A;  3PUG A;  5JDN A;  4H9N C;  1N33 T;  1BR4 A;  2BS4 A;  2MPK A;  5JRE A;  2WZI A;  4AQF A;  5HXS A;  4JV5 T;  4WW0 A;  4HFH A;  4LF7 T;  1CUN A;  1T98 A;  5FY1 A;  3U3I A;  4YFS A;  2XY8 B;  2BG9 E;  3I9W A;  1HX1 B;  3CQG B;  3KBU A;  3UUL A;  5DQV A;  1E1H B;  4XZC A;  3AVR A;  4HTE A;  5LGU B;  5HEG A;  2CLY C;  3BK9 A;  1G73 A;  3PUY F;  5HAX A;  2M6B A;  2MTQ A;  2VKH A;  3ZMS B;  4U72 A;  3P4W A;  2LM9 A;  3AE3 A;  3MA9 A;  3JC6 C;  5ABF B;  4LF9 T;  4DO0 A;  4DMV A;  1YQ4 A;  5LNK A;  3HI2 A;  1S35 A;  3WI3 A;  2UUB T;  3AA0 B;  1HFA A;  4P1N A;  4JEU B;  2Y8D A;  2N9D A;  3UU6 A;  2DWG A;  4TWH A;  4YHJ A;  5HEO A;  5LBM A;  3UQ4 A;  3RKO A;  2ODV A;  1HNX T;  2X0H A;  4ADZ A;  3KV6 A;  1KF6 A;  4HKA A;  4ZOL E;  3RGL A;  5HEJ A;  5L4E A;  2X67 A;  2WAU A;  2XM2 A;  4U2Z A;  4WNK A;  3UT5 E;  3QB5 K;  3AE7 A;  2CRB A;  5C2T A;  4QXB B;  2QGS A;  2LOP A;  2W67 A;  4CXY A;  4X65 T;  5C8Y E;  5CA0 E;  2CMR A;  4TNV A;  2WWU A;  2FJB A;  2XM1 A;  1VCT A;  3ONL C;  1I94 T;  3RI5 A;  3ZPO A;  2Z6E A;  2V7I A;  3IA3 A;  4Z8X A;  5C3J A;  2QYW A;  3TLW A;  3ANW B;  5FXX A;  2KZ7 B;  3N2K E;  3ABV A;  4PK5 A;  4ZI2 D;  3OTO T;  5HWY A;  2CXF A;  2LHN A;  2VKD A;  2A3D A;  2XQ4 A;  3CQC B;  1X79 A;  1H7C A;  2B1E A;  3FZF B;  4PK4 A;  2VL0 A;  2IC9 A;  3PUR A;  4UEM A;  3ZMU B;  4IDQ A;  2LHR A;  4UVC B;  4AKR B;  3ZT6 A;  4B6X A;  2VQF T;  3UUN A;  1KNR A;  5AQP B;  3T1Y T;  2LSJ A;  3UU4 A;  2X66 A;  4ERR A;  1OED B;  1WYC A;  2XQ6 A;  2VQE T;  2L3L A;  3CPZ A;  4H63 V;  4LF4 T;  4MBQ A;  2D9D A;  2WU2 A;  3AE1 A;  5JDF A;  2IC6 A;  3HKC E;  4IHJ E;  3SS1 A;  4DR6 T;  4O4L E;  2WWV A;  1OED E;  4CZZ B;  3Q5D A;  3EAM A;  4O4J E;  5LXT E;  4L5G A;  4ZI3 D;  1KFY A;  4YTM A;  3ETU A;  5J0Z A;  3AEA A;  3UU5 A;  3EHZ A;  4EED A;  4EZH A;  3E0Z A;  2CA5 A;  4TX5 A;  3UUX B;  3CIR A;  3Q2M A;  4B3R T;  4ZXL A;  4O4I E;  5BR8 T;  5JDQ A;  2E5V A;  2Q9Q D;  4X1K E;  2KSR A;  2XUE A;  4EAH A;  3GMI A;  2V7M A;  3ZN0 B;  5KXJ A;  2QRX A;  3UUM A;  4I55 E;  2YDQ A;  3FZH B;  4FJO A;  4H9P C;  3MKD A;  5L3C B;  2BG9 C;  3ONX A;  3AB3 B;  1ZKE A;  2LLY A;  4K0U A;  3RYF E;  2XAH B;  1BR0 A;  2HH7 A;  1NEK A;  3ETV A;  3D0T A;  3F57 A;  4XBF B;  1YQ3 A;  2JMK A;  4GKK T;  4PNI A;  1MND A;  3TLV A;  1YD8 G;  2M6I A;  1BR2 A;  2CE7 A;  3L3P A;  3AEF A;  4EXT A;  3CX8 B;  3JCF A;  4YSZ A;  5L47 A;  5LGT B;  1HX8 A;  3AA7 B;  2EHO C;  1MMD A;  4UVB B;  5GON E;  5JR9 C;  4P0B A;  4LFB T;  4JI1 T;  4NPP A;  5JRC A;  4EYU A;  2A72 A;  4AKI A;  3CML A;  3AE5 A;  1UGO A;  5LYJ E;  1X9B A;  4Z90 A;  5JVD E;  4ZS2 A;  3UU3 A;  4AKL A;  5J2U E;  5JRC B;  4QX8 B;  2D5U A;  3M65 A;  3AA6 B;  3PUA A;  4PJJ A;  4DV1 T;  3VRB A;  4LFC T;  2JQQ A;  2V7J A;  3PUQ A;  2H3R A;  1IZN B;  1MMN A;  2NW8 A;  2QVA A;  3EI0 A;  3RKG A;  5ETW A;  5IUX A;  2CXL A;  5AQS B;  1UCU A;  2CBJ A;  3FXD B;  2BVM A;  4EIW A;  4O2B E;  5JTG A;  2UU9 T;  4LFA T;  3MZK B;  4E7S A;  3O4X E;  5JQG E;  4X64 T;  4JEH B;  5ADX L;  3E22 E;  3I0Q A;  2G0U A;  5F5W A;  1V9D A;  1ZP0 A;  2ACX A;  4GK0 E;  2E2A A;  4MLK A;  2AE9 A;  4B3S T;  1KNP A;  1LVF A;  3A5X A;  3ANW A;  3JC6 D;  3KV9 A;  3FZL B;  4ASK A;  4C91 A;  4ZS3 A;  5LP6 E;  1HNZ T;  5LG4 A;  1G8X A;  4U7I A;  2XQ8 A;  3UU8 A;  1E2A A;  3ZLI A;  2H7O A;  2UXD T;  2XHE B;  2KT9 A;  5F3J A;  4QH5 A;  3HKB E;  3RIU C;  1IBL T;  4AQY T;  5CJ5 A;  2IML A;  2WDQ A;  4IE5 A;  4KMC A;  4DR4 T;  1NAF A;  2I6H A;  1N36 T;  1N32 T;  3AEC A;  3E08 A;  2DI4 A;  4IRE A;  2X0L B;  2A2F X;  1D1A A;  4EV6 A;  3AE4 A;  3AE9 A;  3CQX C;  5FKY A;  1IJ6 A;  4QX7 B;  3AA1 B;  2UUA T;  1T8B A;  5AQM B;  2XTL A;  3LK4 2;  4IDN A;  3ZCI A;  5ABH A;  3ESL A;  1ZV4 X;  5IWA T;  3RRW A;  4L0R A;  1O3X A;  4TUY E;  4WBO A;  4UEL A;  2ZMA A;  3FBZ A;  3K1S A;  4K0K T;  3FZK B;  4ZZB A;  3HR0 A;  4IGU A;  3AXJ A;  1E7P A;  2YOE A;  3RQU A;  3HKD E;  3QK6 A;  3S4U A;  3ZT5 A;  3RC3 A;  2W66 A;  2W00 A;  2PTF A;  4ILA A;  4YSY A;  4C90 A;  5KX5 E;  3G06 A;  2FJD A;  1ZOY A;  3RX6 A;  5AQV B;  2VUR A;  3AAE B;  4DV2 T;  2DHR A;  2WCA A;  1LRZ A;  2P9B A;  4MHC A;  2WMO A;  2NTY A;  5FVL A;  1AJ3 A;  4KBM B;  3K3N A;  2B76 A;  3I9Y A;  2YDS A;  3H37 A;  3LK2 B;  4HEA A;  4HGA A;  4UV9 B;  3LJC A;  1IAP A;  1MIW A;  2FJE A;  3N5L A;  4X1I E;  5J1G A;  3TLS A;  5LOV E;  4HFI A;  1WYB A;  5HXC A;  4YY3 T;  2YDR A;  3C4W A;  2JQH A;  4GYS A;  3QNU A;  2NWB A;  3H3M A;  5AQJ B;  2J62 A;  3V5U A;  5FYM A;  3VU7 H;  4AKH A;  3NWI A;  4HWH A;  1WR0 A;  4PJN A;  4YHH T;  4QXC B;  5FP3 A;  4PJL A;  1M7K A;  3PE0 A;  4ISS A;  1UX4 A;  2BVL A;  3PV0 F;  4U3C A;  5HEU A;  2KWI B;  3KVA A;  4IT4 A;  3ZC1 A;  3N9N A;  3NRX A;  2JRK A;  1OXZ A;  2XQ3 A;  3VHL A;  4AIU A;  4BAY B;  3WAK A;  3HA4 A;  4M1P A;  2XQA A;  2YU2 A;  3AAA B;  3C4Z A;  3DP7 A;  4DND A;  1T72 A;  4COF A;  1LKX A;  4Z91 A;  4BJM A;  1SE7 A;  1XDP A;  4UVA B;  5AQK B;  2L9Q A;  4DR7 T;  3BQL A;  1M62 A;  3LK3 B;  3LDQ B;  3TLU A;  5LHI B;  2IW5 B;  5AQQ B;  1WFD A;  2CHO A;  2WQY A;  3JAD A;  3P50 A;  4IIJ E;  2JMH A;  3Q5X A;  4UF0 B;  3QUJ A;  5FL0 A;  4HFV A;  2K5B B;  3KDS E;  4TN7 B;  2XAG B;  3RYC E;  3JAE A;  1HG5 A;  4DV0 T;  4JI6 T;  4I50 E;  2ZLY A;  3ZMZ B;  3C98 B;  4DVD A;  2VL8 A;  1MIV A;  4PFO A;  4X20 E;  3AE8 A;  2LKG A;  3NBX X;  4HFE A;  3P4Q A;  3HL6 A;  3PUZ F;  3I1A A;  1HR0 T;  1MIY A;  2RPA A;  5JR9 A;  3FB2 A;  2EHO A;  4CXX A;  2UUC T;  5AQH B;  3SFD A;  4CI1 B;  5LMU T;  3EDV A;  4HFD A;  3C51 A;  3QOF A;  2AXD S;  2XZE A;  3AVS A;  3IHR A;  2L8K A;  4X66 T;  4OX9 T;  5L3E B;  1OED A;  2HPL A;  1HTJ F;  2X9W A;  4HE8 A;  2HPJ A;  4EGW A;  1QSD A;  2E5L T;  3VKH A;  5LBQ B;  4YT0 A;  1SA0 E;  4B3T T;  2BG9 A;  5EK4 A;  3VR9 A;  4PK6 A;  3ZSS A;  2UXN B;  2Q9Q C;  3N9M A;  5E0O A;  3ZYK A;  1D1B A;  4GYR A;  2BKP A;  3L09 A;  4WBN E;  2RA1 A;  2HN2 A;  3N9O A;  3O1J A;  2CWY A;  3IBP A;  3ZC0 A;  4GK5 E;  4KI0 F;  3O9X A;  1W09 A;  2KLQ A;  2Y48 B;  5EK2 A;  3PTR B;  2A9U A;  2JJ9 A;  3R84 B;  2XAF B;  2ZM8 A;  2H89 A;  3UUB A;  2X0Y A;  3VRA A;  4CI2 B;  4GOU A;  4U74 A;  1U4Q A;  2IHR 1;  2DL1 A;  1SHZ C;  1D0Y A;  3GN5 B;  4EOZ B;  2CBI A;  5LB7 B;  2OV9 A;  2V26 A;  3N2G E;  4GIW A;  5CFB A;  4EEB A;  2CCQ A;  4DV3 T;  2IIU A;  5L4H A;  2XQ7 A;  4KX6 A;  4IDZ A;  2YIN A;  4ZEY A;  5ABE A;  3AE2 A;  4P09 A;  2LSK A;  1XDO A;  3A7M A;  4OYK A;  2LRK A;  5AQN B;  4LF6 T;  3DTO A;  1FIO A;  1U5P A;  1YXR A;  2KIN B;  2ODU A;  3EAB A;  3OPC A;  3Q5E A;  2YU1 A;  1WLX A;  4OFZ A;  2BZB A;  2CHN A;  3P4R A;  2X9Y A;  2GK9 A;  4OK0 A;  3IEE A;  3IF8 B;  4UV8 B;  3N9L A;  2X68 A;  5FXZ A;  2LM2 A;  3RPU A;  3RYH E;  4CI3 B;  2PBI A;  5L3B B;  3NVO A;  2QA7 A;  4PJM A;  2VAS A;  3RYI E;  5KMG P;  4DMW A;  3ZEF B;  3UQ7 A;  5DJQ C;  5LCY A;  2HHH T;  2V1D B;  5DQW A;  3VR8 A;  2SPC A;  3ZYM A;  1MMA A;  2NR4 A;  3UFG A;  2BS2 A;  2ES0 A;  4G2A A;  4H9Q C;  4DR3 T;  4DR5 T;  3AE6 A;  1HS7 A;  3MAC A;  4DUZ T;  2X51 A;  2UXX B;  3PDY A;  2W61 A;  3ZT7 A;  3AED A;  4IE0 A;  2DCF A;  2DLR A;  3KIN B;  2E9X C;  2YN6 A;  3OBV E;  2N2N A;  3RRC A;  3TKL B;  5HXR A;  2E8I A;  2VVS A;  4YJ2 E;  3M3Z B;  4DBQ A;  4JI2 T;  4UIG A;  3BQI A;  3RIU A;  4TNW A;  5JDG A;  3ZJ1 A;  3AEE A;  3CK6 A;  3KVB A;  1ZHC A;  3EDU A;  2CLY B;  2Q9Q A;  3FBL A;  3OYX A;  5AQU B;  5CGM A;  4HN9 A;  3MJX A;  4LF5 T;  1KEY A;  3CX6 B;  4JBW F;  4QH4 A;  5DAB A;  5AQR B;  2WU5 A;  2E9X A;  2FUP A;  4HWI B;  4EB6 E;  4AKG A;  2BDE A;  2JPF A;  4L9I A;  2OLT A;  5L3F B;  2JQ9 A;  3ZST A;  4I43 B;  3A8Y C;  3CX7 B;  5EZY E;  5LG3 A;  4MFR A;  4DR1 T;  3PU8 A;  1XNR T;  2LOS A;  3P4P A;  4IL9 A;  3C4X A;  4H9R C;  2BG9 B;  1HF8 A;  1UX5 A;  4WYV A;  5LMN T;  2KND A;  3NZP A;  1VOM A;  2ZM0 A;  3RF1 A;  4JI0 T;  4AQF C;  2BKN A;  4TWF A;  1WRD A;  3KV5 A;  2WP9 A;  4U7Y A;  5AQI B;  1NWM X;  2H88 A;  5IYZ E;  2LKH A;  3T8O A;  1WR6 A;  2EHO B;  2C0S A;  1VCS A;  4AIS A;  4IE7 A;  1YKE B;  3ZCJ A;  4A98 A;  2BS3 A;  3T1H T;  4UR9 A;  4EYY R;  3DJB A;  2M67 A;  2W63 A;  3NRY A;  3LFM A;  4KHZ F;  2J4G A;  2CPT A;  2CWO A;  4GKJ T;  3SOL A;  2HN1 A;  4NXN T;  2D0T A;  3LBX A;  1Z8U A;  5AFU L;  2XPK A;  2PFV A;  4FI5 A;  4NUV A;  4A56 A;  5HWX A;  3PU3 A;  2WM9 A;  2H7V C;  1HG2 A;  2LJL A;  3O1H A;  3LSV A;  4NUU A;  1US7 B;  1FMW A;  1ZEE A;  1OED C;  5FY0 A;  5JDM A;  1MNE A;  2F4V T;  2JQK A;  4U31 A;  1VRB A;  2LEH A;  2KMF A;  4QKN A;  2WDR A;  2YK0 A;  3QC9 A;  3SFE A;  4LMK A;  3GWH A;  2W4X A;  3PUX F;  4YTP A;  3CVR A;  4TZ4 C;  4ZZC A;  5AQT B;  5LJN A;  4TV9 E;  3ZN1 B;  2N1G A;  2VKJ A;  5HCJ A;  3ONJ A;  3H3A A;  4YJ3 E;  2DWK A;  2BKO A;  3MXZ A;  3X1D A;  5JDH A;  4DV7 T;  1J5E T;  4A97 A;  3OVU A;  5A1L A;  4JI3 T;  4JI8 T;  4ILB A;  2YEV C;  2K24 A;  2CXD A;  4B3M T;  1OWA A;  3LBX B;  3UFE A;  2R6G F;  4KP3 C;  5FL1 A;  4A5X A;  5H6Q B;  4BA9 A;  2C5I T;  4PW8 A;  1IBK T;  5HCM A;  2NTX A;  3B5M A;  4X62 T;  3OYZ A;  1DU2 A;  3RC8 A;  3FXE B;  1W0A A;  5AQF B;  4DV6 T;  2V7L A;  4ILU A;  1D1C A;  4G63 A;  4F8H A;  2DNX A;  4QH1 A;  2RP4 A;  4JI7 T;  1I6Z A;  2ZM6 T;  2W62 A;  3N2O A;  5TAO A;  1KNZ A;  4IDO A;  1FMV A;  3K8P C;  1XWM A;  5HEH A;  1T7S A;  4HFB A;  3Q9D A;  2LSY A;  5KDM C;  2JIW A;  5JDL A;  1J1J A;  3B57 A;  4JLE A;  2WS3 A;  2W2U A;  4DV4 T;  4IST A;  3RH3 A;  3VKG A;  2WB5 A;  1CHU A;  3PUV F;  2LT3 A;  5F8P A;  4ZI2 C;  4QWN B;  4CQI A;  3OJA A;  1QUU A;  2V6X A;  1XMO T;  1W0B A;  3UTK A;  2V8S V;  2WMN A;  1UUR A;  5FVK A;  2X9X A;  3AEB A;  2FBW A;  2E9X D;  3K3Q C;  3LG7 A;  5IHY A;  1N34 T;  2LRL A;  2PG8 A;  2I59 A;  4I4T E;  4YXD A;  5M4Y A;  4AI6 A;  3CWZ B;  4JYA T;  4NIQ A;  4I0U A;  2V7K A;  4U33 A;  1IJ5 A;  3FHN A;  4H9S E;  4LML A;  4PAG A;  4E7Z A;  3L8R A;  5FNV E;  1MMG A;  4X1Y E;  1GQE A;  2I0M A;  5LA6 E;  3W15 B;  4IDP A;  4KUM B;  4MAL A;  3TLT A;  3CKD A;  2NW7 A;  4YSX A;  2NOX A;  3FZM B;  2V6Y A;  2MBG A;  2V5D A;  5FXW A;  5HYA A;  2CEA A;  4NXM T;  5L3G B;  1J5W A;  3P7I A;  4X5T A;  4JI5 T;  2C5J A;  4LMJ A;  5AQO B;  2IUB A;  4ILC A;  2BBH A;  2D2S A;  1R8I A;  1EZ3 A;  1JNR A;  1YKH B;  2VVN A;  3AXJ B;  3F31 A;  1UK5 A;  4LF8 T;  3RHW A;  3ZKR A;  3ZMT B;  1B7T A;  2BBJ A;  3EUH A;  1XNQ T;  4BJN A;  2WBL A;  1UUS A;  4ZI3 C;  2NP9 A;  3OKQ A;  2WY2 A;  2XSB A;  3NZQ A;  4U2Y A;  4ZI7 E;  4ZHQ E;  5LGN B;  2EHO D;  4UXN B;  3P4S A;  1Y01 A;  1KK7 A;  2CM0 A;  2KXP B;  4TV8 E;  2ACZ A;  4JI4 T;  2LE8 A;  3N9P A;  3GA8 A;  3J9X 1;  5CA1 E;  4P0A A;  1D0Z A;  3QB5 A;  4YLH A;  3PUS A;  3ZJ2 A;  4QXH B;  5ABF A;  2UXB T;  2WDV A;  2E9X B;  2PJQ A;  3NKZ A;  4J2C A;  5FY7 A;  4F6R C;  1D0X A;  2K3W A;  3I0O A;  5AQG B;  1FJG T;  1BR1 A;  1W9R A;  1IBM T;  3KBT A;  4CN1 A;  1HNW T;  4QHO A;  2MAW A;  2IAK A;  2K9A A;  5EK3 A;  1QLB A;  2J1D G;  5FMN A;  5LHG B;  4CN4 A;  3MK7 C;  2MYS A;  5HXH A;  5J2T E;  5H6R B;  2FJA A;  2W0G A;  5LHH B;  1SUM B;  2VWA A;  5AQL B;  3U78 A;  4N78 D;  2K48 A;  1Y64 B;  3C50 A;  2YKS A;  4HWC A;  3WAJ A;  1WCR A;  4CXW A;  5FXV A;  1YW0 A;  4YTN A;  4EZ4 A; 
#chains in the Genus database with same CATH homology
 3C64 A;  2X9H A;  4O2A E;  3SRZ A;  1HCI A;  2LSG A;  3AAI A;  2OA5 A;  4IE4 A;  5BMV E;  5HXE A;  2XAQ B;  1LVK A;  2LSI A;  2Q9Q B;  3O1I A;  2NW9 A;  1Z0P A;  3GN5 A;  3HKE E;  2WSS V;  2VKO A;  2Y6X A;  3N9Q A;  4AQG A;  4ANJ A;  5LJM A;  2XAJ B;  3ZMV B;  5JH7 E;  3KV4 A;  3J7Y q;  2ZM2 A;  1FEW A;  2C5K T;  4OYJ A;  2KWH A;  2VK9 A;  4V1A v;  3Q5W A;  3B13 A;  3P8C D;  3BQK A;  4H63 H;  4DBR A;  4JUY A;  4O8S A;  2D0U A;  5L3D B;  4OHF A;  2VB6 A;  4O4H E;  3ZYL A;  4AXP A;  4UF0 A;  2XQY A;  1S94 A;  3V5S A;  2MOZ A;  3K3O A;  4XAX B;  5CB4 E;  3F2E A;  3KFW X;  4IE6 A;  5JR9 B;  5L2L A;  3SWH A;  3EVY A;  2XAS B;  4H9O C;  4PFP A;  5JDN A;  3PUG A;  4H9N C;  1BR4 A;  5JRE A;  4AQF A;  5HXS A;  4WW0 A;  1CUN A;  1T98 A;  5FY1 A;  3U3I A;  4YFS A;  3I9W A;  3KBU A;  3UUL A;  3CQG B;  5DQV A;  1E1H B;  4XZC A;  3AVR A;  4HTE A;  5LGU B;  2CLY C;  3BK9 A;  1G73 A;  5HAX A;  2MTQ A;  2VKH A;  3ZMS B;  4U72 A;  2LM9 A;  3MA9 A;  3JC6 C;  4DO0 A;  4DMV A;  5LNK A;  3HI2 A;  1S35 A;  3WI3 A;  3AA0 B;  1HFA A;  4JEU B;  2Y8D A;  2N9D A;  2DWG A;  4YHJ A;  5LBM A;  3RKO A;  2ODV A;  4ADZ A;  3KV6 A;  4HKA A;  4ZOL E;  2X67 A;  2WAU A;  4WNK A;  3UT5 E;  4QXB B;  2QGS A;  2LOP A;  4CXY A;  5C8Y E;  5CA0 E;  2CMR A;  2WWU A;  3ZPO A;  2Z6E A;  2V7I A;  4Z8X A;  3ANW B;  5FXX A;  2KZ7 B;  3N2K E;  4PK5 A;  4ZI2 D;  5HWY A;  2CXF A;  2LHN A;  2VKD A;  3CQC B;  2A3D A;  4PK4 A;  1X79 A;  1H7C A;  2B1E A;  4UEM A;  3PUR A;  2IC9 A;  3ZMU B;  4AKR B;  4B6X A;  2LHR A;  4UVC B;  3UUN A;  2LSJ A;  2X66 A;  4ERR A;  1WYC A;  2L3L A;  3CPZ A;  4H63 V;  4MBQ A;  5JDF A;  2IC6 A;  3HKC E;  4IHJ E;  3SS1 A;  4O4L E;  4CZZ B;  4O4J E;  5LXT E;  4L5G A;  4ZI3 D;  3ETU A;  3VKH A;  4EZH A;  3E0Z A;  2CA5 A;  4TX5 A;  3UUX B;  3Q2M A;  4O4I E;  5JDQ A;  2Q9Q D;  4X1K E;  4EAH A;  2XUE A;  3GMI A;  2V7M A;  3ZN0 B;  3UUM A;  4I55 E;  4FJO A;  4H9P C;  3MKD A;  5L3C B;  3ONX A;  3AB3 B;  1ZKE A;  1BR0 A;  4K0U A;  3RYF E;  2XAH B;  2HH7 A;  3ETV A;  4XBF B;  3D0T A;  3F57 A;  2JMK A;  4PNI A;  1MND A;  1YD8 G;  1BR2 A;  2CE7 A;  3L3P A;  5LGT B;  4EXT A;  3CX8 B;  1HX8 A;  3AA7 B;  2EHO C;  1MMD A;  4UVB B;  5GON E;  5JR9 C;  4P0B A;  5JRC A;  4EYU A;  2A72 A;  4AKI A;  3CML A;  5LYJ E;  4AKL A;  5JVD E;  4ZS2 A;  5JRC B;  5J2U E;  4QX8 B;  2D5U A;  3M65 A;  3AA6 B;  3PUA A;  4PJJ A;  2JQQ A;  2V7J A;  3PUQ A;  2H3R A;  1IZN B;  1MMN A;  2NW8 A;  5ETW A;  2CXL A;  1UCU A;  3FXD B;  2BVM A;  4EIW A;  4O2B E;  3MZK B;  4E7S A;  3O4X E;  5JQG E;  4JEH B;  5ADX L;  3E22 E;  3I0Q A;  2G0U A;  1V9D A;  2ACX A;  4GK0 E;  4MLK A;  1LVF A;  3A5X A;  3ANW A;  3JC6 D;  3KV9 A;  4ASK A;  5LP6 E;  4ZS3 A;  5LG4 A;  1G8X A;  3ZLI A;  2H7O A;  2XHE B;  2KT9 A;  5F3J A;  3HKB E;  4IE5 A;  4KMC A;  1NAF A;  3E08 A;  2DI4 A;  2X0L B;  2A2F X;  1D1A A;  3CQX C;  1IJ6 A;  4QX7 B;  3AA1 B;  2XTL A;  3LK4 2;  3ZCI A;  3ESL A;  1ZV4 X;  3RRW A;  4L0R A;  1O3X A;  4TUY E;  4WBO A;  4UEL A;  2ZMA A;  3FBZ A;  3HR0 A;  4IGU A;  3S4U A;  3HKD E;  3QK6 A;  3RC3 A;  2W00 A;  5KX5 E;  4C90 A;  3RX6 A;  3AAE B;  2DHR A;  1LRZ A;  2P9B A;  4MHC A;  2WMO A;  2NTY A;  1AJ3 A;  4KBM B;  3K3N A;  4HGA A;  3I9Y A;  4HEA A;  3H37 A;  3LK2 B;  4UV9 B;  3LJC A;  1IAP A;  1MIW A;  3N5L A;  5J1G A;  4X1I E;  5LOV E;  5HXC A;  1WYB A;  4WBN E;  3C4W A;  4GYS A;  3V5U A;  2NWB A;  5FYM A;  3VU7 H;  4AKH A;  4PJN A;  4QXC B;  5FP3 A;  4PJL A;  3PE0 A;  4ISS A;  1UX4 A;  2BVL A;  2KWI B;  3KVA A;  3ZC1 A;  3N9N A;  3NRX A;  2JRK A;  1OXZ A;  3VHL A;  4BAY B;  3WAK A;  3HA4 A;  4M1P A;  2YU2 A;  3DP7 A;  3AAA B;  3C4Z A;  4DND A;  1LKX A;  4BJM A;  4UVA B;  2L9Q A;  3BQL A;  3LK3 B;  5LHI B;  2IW5 B;  4IIJ E;  2JMH A;  3Q5X A;  4UF0 B;  3QUJ A;  4HFV A;  2K5B B;  3KDS E;  4TN7 B;  2XAG B;  3RYC E;  1HG5 A;  4I50 E;  2ZLY A;  3ZMZ B;  3C98 B;  4DVD A;  2VL8 A;  1MIV A;  4PFO A;  4X20 E;  3NBX X;  3HL6 A;  3I1A A;  1MIY A;  5JR9 A;  4CXX A;  3FB2 A;  2EHO A;  4CI1 B;  3EDV A;  3C51 A;  3AVS A;  3IHR A;  2L8K A;  5L3E B;  2HPL A;  1HTJ F;  2X9W A;  4HE8 A;  2HPJ A;  1QSD A;  5LBQ B;  1SA0 E;  5EK4 A;  4PK6 A;  2UXN B;  2Q9Q C;  3N9M A;  5E0O A;  3ZYK A;  1D1B A;  4GYR A;  3L09 A;  2RA1 A;  3N9O A;  3O1J A;  2CWY A;  3IBP A;  3ZC0 A;  4GK5 E;  3O9X A;  2KLQ A;  2Y48 B;  5EK2 A;  3PTR B;  2JJ9 A;  3R84 B;  2XAF B;  2ZM8 A;  4CI2 B;  4GOU A;  4U74 A;  1U4Q A;  3GN5 B;  1SHZ C;  1D0Y A;  4EOZ B;  2V26 A;  3N2G E;  4GIW A;  2CCQ A;  4IDZ A;  2YIN A;  4P09 A;  2LSK A;  4OYK A;  3DTO A;  1FIO A;  1U5P A;  2KIN B;  2ODU A;  3R6N A;  4OFZ A;  4C91 A;  2YU1 A;  1WLX A;  2BZB A;  5LJN A;  2X9Y A;  2GK9 A;  4OK0 A;  3IEE A;  3IF8 B;  4UV8 B;  3N9L A;  2X68 A;  5FXZ A;  3RPU A;  3RYH E;  4CI3 B;  2PBI A;  5L3B B;  2QA7 A;  4PJM A;  2VAS A;  3RYI E;  5KMG P;  4DMW A;  3ZEF B;  5DJQ C;  5LCY A;  2V1D B;  5DQW A;  3ZYM A;  2SPC A;  1MMA A;  4G2A A;  2ES0 A;  4H9Q C;  1HS7 A;  3MAC A;  2X51 A;  2UXX B;  3PDY A;  2W61 A;  4IE0 A;  2DCF A;  2DLR A;  3KIN B;  2E9X C;  3OBV E;  2N2N A;  3RRC A;  3TKL B;  5HXR A;  2E8I A;  4YJ2 E;  4DBQ A;  4UIG A;  3BQI A;  5JDG A;  3ZJ1 A;  3KVB A;  1ZHC A;  3EDU A;  2CLY B;  2Q9Q A;  3FBL A;  3OYX A;  4HN9 A;  3MJX A;  3CX6 B;  5DAB A;  2E9X A;  4EB6 E;  4AKG A;  2BDE A;  2JPF A;  4L9I A;  5L3F B;  4I43 B;  3CX7 B;  5EZY E;  4MFR A;  3PU8 A;  2LOS A;  3C4X A;  4H9R C;  1HF8 A;  1UX5 A;  2KND A;  3NZP A;  1VOM A;  2ZM0 A;  4AQF C;  1WRD A;  3KV5 A;  1NWM X;  5IYZ E;  3T8O A;  1WR6 A;  2EHO B;  2C0S A;  4IE7 A;  1YKE B;  3ZCJ A;  4EYY R;  3DJB A;  2M67 A;  2W63 A;  3NRY A;  3LFM A;  2CWO A;  3SOL A;  2D0T A;  3LBX A;  5AFU L;  4NUV A;  2PFV A;  4FI5 A;  4A56 A;  5HWX A;  3PU3 A;  2WM9 A;  2H7V C;  1HG2 A;  2LJL A;  3O1H A;  4NUU A;  3ZJ2 A;  1US7 B;  1FMW A;  1ZEE A;  5FY0 A;  5JDM A;  1MNE A;  1VRB A;  2LEH A;  2KMF A;  4QKN A;  3QC9 A;  2YK0 A;  3GWH A;  3CVR A;  4TZ4 C;  4TV9 E;  3ZN1 B;  2N1G A;  2VKJ A;  3H3A A;  4YJ3 E;  2DWK A;  3MXZ A;  5JDH A;  5A1L A;  2YEV C;  2K24 A;  2CXD A;  1OWA A;  3LBX B;  3UFE A;  4KP3 C;  5H6Q B;  4BA9 A;  2C5I T;  4PW8 A;  2NTX A;  3OYZ A;  3RC8 A;  3FXE B;  2V7L A;  4ILU A;  1D1C A;  4G63 A;  2DNX A;  4AI6 A;  2RP4 A;  2W62 A;  3N2O A;  5TAO A;  1KNZ A;  1FMV A;  3K8P C;  3Q9D A;  2LSY A;  5KDM C;  5JDL A;  3B57 A;  4JLE A;  4IST A;  3RH3 A;  3VKG A;  2LT3 A;  5F8P A;  4ZI2 C;  4QWN B;  4CQI A;  3OJA A;  1QUU A;  3UTK A;  2WMN A;  2X9X A;  2E9X D;  3K3Q C;  3LG7 A;  5IHY A;  2PG8 A;  2I59 A;  4I4T E;  5M4Y A;  3CWZ B;  2V7K A;  1IJ5 A;  3FHN A;  4H9S E;  4PAG A;  4E7Z A;  5FNV E;  1MMG A;  4X1Y E;  5LA6 E;  3W15 B;  4KUM B;  4MAL A;  3CKD A;  2NW7 A;  2NOX A;  2MBG A;  5FXW A;  5HYA A;  2CEA A;  5L3G B;  3P7I A;  2C5J A;  2D2S A;  3F31 A;  1EZ3 A;  1YKH B;  3ZMT B;  1B7T A;  3EUH A;  4BJN A;  2WBL A;  4ZI3 C;  2NP9 A;  3OKQ A;  3NZQ A;  4ZI7 E;  4ZHQ E;  5LGN B;  2EHO D;  4UXN B;  1KK7 A;  2CM0 A;  2KXP B;  4TV8 E;  2LE8 A;  3N9P A;  3GA8 A;  3J9X 1;  5CA1 E;  4P0A A;  1D0Z A;  4YLH A;  3PUS A;  4QXH B;  2E9X B;  2PJQ A;  5FY7 A;  4J2C A;  4F6R C;  1D0X A;  3I0O A;  1BR1 A;  3KBT A;  4QHO A;  2IAK A;  2K9A A;  5EK3 A;  5LHG B;  2J1D G;  5FMN A;  3MK7 C;  2MYS A;  5HXH A;  5J2T E;  5H6R B;  2W0G A;  5LHH B;  2VWA A;  3U78 A;  4N78 D;  2K48 A;  1Y64 B;  3C50 A;  3WAJ A;  4CXW A;  5FXV A;  1YW0 A;  4EZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...