1YKHB

Structure of the mediator med7/med21 (med7/srb7) subcomplex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
114
Chain Sequence
b'TDRMTQLQICLDQMTEQFCATLNYIDKNHGFEVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLMRHVDSMIEDFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II mediator complex protein MED7
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 46
structure length 114
sequence length 129
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykhB00
1YKHB 1YKEB
chains in the Genus database with same CATH superfamily
4GKKT 2OA5A 2EHOB 3N5LA 4GYSA 3IBPA 1XNQT 3SOLA 2BBHA 4FJOA 2XAHB 2XQ5A 4ISTA 4JLEA 4ZS2A 3AAAB 4QWNB 4YTNA 4H9SE 3SWHA 2CE7A 2K3WA 2NW9A 2LHNA 3AE2A 3ZMTB 3IHRA 3M65A 5IHYA 2BG9C 3LFMA 4X1KE 5J0ZA 1X79A 1WLXA 1D1AA 2ZM2A 3RKOA 2W00A 2EHOC 3RIAA 3VHLA 2XAJB 1J5ET 3PUAA 5HEJA 2XAFB 3O1IA 4O2AE 4NXMT 5C3JA 1QLBA 3KV6A 3ZCIA 2W61A 4X5TA 4UR9A 3B13A 4P0BA 5HEOA 1WR6A 4AIUA 3AEEA 4A97A 1VRBA 3JCFA 3A7MA 2MBGA 1S35A 5LMUT 3UU3A 3WAJA 3PUVF 2RA1A 3OVUA 4HFIA 1J1JA 1KF6A 3TLTA 3T1YT 4A5XA 4AQFC 2MPKA 2IC6A 3RQUA 1X9BA 2UXDT 4H9NC 3ESLA 5DQVA 5F5WA 4EYYR 3FZKB 1D1CA 3N2GE 4H63H 3ZT5A 4YJ3E 4ILAA 1XDOA 2C5IT 2K48A 3AECA 4HWFA 3ZLIA 4O4LE 4JYAT 3IEEA 2YK0A 3PTRB 3HKEE 2CBIA 2K5BB 1XWMA 1JNZA 3KBTA 1SE7A 5JDFA 2MTQA 3UT5E 2P9BA 2CA5A 3I1AA 2BBJA 4FI5A 2CM0A 5LBQB 2LM9A 2WS3A 2E9XD 4V1Av 4EEDA 2YOEA 3FBZA 4KHPT 3ETVA 2CRBA 4HFVA 2LSJA 4UIGA 3N9PA 4QHOA 2UU9T 1H7CA 3N9QA 5HWYA 5HCMA 2LJLA 4HWCA 4YXDA 2YDQA 3VRAA 5CB4E 3EUHA 4I4TE 1B7TA 2E2AA 1I6ZA 2ZM8A 2VKJA 4CI3B 2L3LA 2KLQA 1NAFA 1WYBA 1T98A 4I0UA 2DI4A 2BS4A 4MBQA 3O9XA 3AE7A 2BZBA 3QUJA 2AE9A 5EK3A 3H37A 2UUBT 2I0MA 5A1LA 2ZMAA 2GK9A 3MKDA 4I43B 3VKHA 4OK0A 4U33A 1YKHB 1KEYA 4E7ZA 5AQRB 3B57A 2W4XA 4IE7A 4ZZCA 2Q9QA 2L8KA 1N33T 3C51A 2X0LB 2MAWA 4DUYT 3C4XA 3EABA 4MFRA 1W09A 3FZMB 3VR9A 2LRLA 3RIUA 2ACXA 2XSAA 5IYZE 3GMIA 3KVBA 4NUUA 5EK2A 4X20E 3GWHA 2CMRA 3KV9A 2NWBA 4WBOA 4KI0F 2ES0A 3LK42 5LGTB 4CXWA 3ONJA 1G8XA 4PJMA 1T72A 4CN6A 2FJBA 2H88A 2HPJA 2WWVA 5ABEA 2WM9A 5L4HA 4DV3T 3O1HA 2V1DB 2VK9A 3N9NA 2WBLA 1MIVA 5AQFB 1FJGT 5L3FB 1LRZA 2F4VT 2V6YA 4E7SA 4B3MT 3KINB 4JUYA 2LT3A 3GN5B 5AQGB 4X1YE 3RQWA 1IJ6A 5JQGE 1N32T 3RRCA 4MALA 3EHZA 3ONLC 2MOZA 2JQHA 2YDSA 3Q5DA 5LYJE 4LF5T 3P7IA 4JEHB 1D0XA 2JQQA 3P8CD 4DMWA 5JRCB 4YT0A 3CX6B 4ERRA 3AE9A 3AA1B 1WR0A 4ZZBA 3K3NA 4LF7T 2JRKA 5JREA 5H6QB 2NW8A 1LVKA 5LJNA 3ABVA 3RIFA 2H3RA 1SA0E 2VVSA 4H9RC 3P4WA 2XM2A 3UULA 1XMOT 2UXCT 3K8PC 3AXJA 1Z0PA 4JI1T 2X0HA 3OYZA 4IE5A 2XQ8A 2Y6XA 2E5LT 1IBMT 2XSBA 2IC9A 3AA7B 4DNDA 4UF0A 3P4PA 4DR7T 1OEDA 3AEAA 4C91A 2JMKA 4HFDA 5AQMB 3D0TA 3Q5EA 2WDRA 2WQYA 1VCSA 4HWIB 3QC9A 3PUYF 1BR1A 4K0UA 4Z8XA 2KINB 4DIDB 5JDMA 3LDQB 3UU8A 2E8IA 2W67A 5FVLA 4B3TT 4EIWA 5CFBA 2CXLA 4LF8T 2IAKA 3FB2A 4DV2T 2M67A 2B1EA 3ZKRA 5DQWA 3PU8A 5L47A 4ZI2C 2VURA 2LRKA 1CUNA 2DCFA 5AQIB 1KK7A 4KX6A 2BKNA 2YEVC 2XQAA 3H3AA 2J62A 3W15B 1BR4A 2WP9A 1UK5A 1UURA 4AI6A 3MXZA 5LCYA 2LHRA 4H9PC 3Q9DA 2YN6A 3EDVA 3QB5A 5L4EA 1T8BA 4PJJA 2X9YA 4ZI2D 3SS1A 3GA8A 3UTKA 4AQYT 4BJMA 4IL4A 3PUXF 3NKZA 4AISA 4AKHA 3L3PA 1SUMB 1M7KA 2WY2A 4JI4T 2H7OA 3ZC0A 3T8OA 3PUWF 1MNEA 3P4QA 5KXJA 5FXWA 2XQ9A 2UXXB 1N36T 4EZ4A 4HFHA 3N9OA 4IHJE 2V7JA 3QOFA 1UUSA 5AQLB 5FL0A 5ABGA 3AA0B 1CHUA 3ZJ2A 2I59A 2VQET 3RKGA 3OTOT 3NZQA 3I9YA 4H9QC 5J2UE 3EI0A 1O3XA 4O8SA 1LVFA 5JR9A 1IZNB 1OWAA 4DV7T 2MYSA 2E5VA 4NUVA 4L0RA 1MMDA 2ZM0A 2XM1A 3UU6A 1XZYA 4WZXA 2V7MA 1W0AA 2XQ7A 4AQGA 1DU2A 1YQ3A 3SFEA 2V5CA 4UV9B 2N2NA 4CN1A 4U74A 5LBMA 3AEGA 2E9XB 4QH1A 3O4XE 1MIYA 1HR0T 3R6NA 1V9DA 4AKLA 4HTEA 2M6BA 3RLFF 2CBJA 4TWFA 1FMVA 2XQ6A 4BA9A 2X68A 3E22E 3ANWB 2JQ9A 2JMHA 3U78A 1YXRA 3ZYLA 3HKBE 2AXDS 5AQVB 3RYCE 4TV9E 2E9XC 4CI1B 4ZOLE 4I50E 2FUPA 3MJXA 2YKSA 3NRYA 3V5UA 4QH4A 2BKPA 3TLWA 2D9DA 3CPZA 3CVRA 3VKGA 1S94A 1IBLT 3ZN0B 2NP9A 3AE6A 4A98A 2DHRA 3TKLB 3OBVE 4CXYA 4KBMB 4ADZA 1HTJF 1W0BA 1NWMX 3ZT6A 4IT4A 3FZHB 3FBLA 3RGLA 2IUBA 3PUZF 4XBFB 5L2LA 4GIWA 5FY7A 3PURA 3CK6A 5L3CB 2X9WA 2XY8B 2XQYA 4L9IA 1HX8A 4DBQA 2CPTA 2XUEA 1IJ5A 2A72A 2JJ9A 4B3ST 5LJMA 3IA3A 5HXRA 4EV6A 3AEDA 5FY1A 4HKAA 4U3CA 4WBNE 2XZEA 3QK6A 4DV0T 4ZS3A 5L3BB 3N2KE 2NTXA 2J47A 1HNXT 1D0YA 1N34T 3NWIA 1BR2A 4ISSA 3AA6B 5ABFA 5ABHA 3AE1A 5DABA 2V6XA 1AJ3A 3S4UA 4PW8A 4KUMB 2XPKA 1Y01A 2IIUA 2DLRA 1I94T 5L3GB 4ILUA 5EK4A 1W9RA 4MLKA 1US7B 4GYRA 1M62A 5HXSA 4COFA 3AE8A 4IDOA 3J7Yq 2CHNA 2WZHA 4IE4A 1ZEEA 4DV4T 5AFUL 3LK3B 1LKXA 3EVYA 3CQXC 4JI0T 2H89A 3TLSA 4PFOA 3I0OA 5AQUB 2XASB 3H3MA 5ADXL 4TV8E 5LGUB 1HCIA 3AVSA 3LBXA 4OHFA 3P50A 1SHZC 4UVAB 4IL9A 2KWIB 2YDRA 4GK0E 4TNVA 3J9X1 4LMKA 4DUZT 2VL0A 4JEUB 5AQSB 3RF1A 5FVKA 5KDMC 1ZHCA 4EOZB 2W63A 5IWAT 2BG9A 1MMAA 2KT9A 2FJAA 3V5SA 2G0UA 5CA0E 2NR4A 2EHOA 4P0AA 2PFVA 3EAMA 2DWGA 2N9DA 5FXVA 3KVAA 5HXCA 3CWZB 3CMLA 3UQ7A 3ZPOA 2WCAA 2WDQA 2B76A 2D0TA 1J5WA 2PJQA 2VKHA 2W2UA 3N2OA 5FMNA 4X66T 2R6GF 3PUSA 5KMGP 2WZIA 2H7VC 3ETUA 4TWHA 5F3JA 1D1BA 4KHZF 4DR1T 4PK4A 5LG4A 5HEGA 2Y48B 3HI2A 4YSXA 2VKDA 5AQTB 3Q2MA 5BMVE 2Y8DA 3JAFA 1WRDA 4AQFA 1KNRA 5LHGB 4PAGA 4BJNA 4ZI3C 5FYMA 2HPLA 5BR8T 3C64A 1OEDE 4XZCA 4IE0A 3G06A 2DNXA 5LMNT 4CI2B 2UUCT 2PBIA 4EYUA 2BS3A 3LG7A 5LNKA 5AQJB 2HN2A 4LMLA 2ODVA 2JIWA 3CX8B 3PU3A 2VWAA 2XAGB 3PJAA 5HEUA 3A8YC 3L8RA 3OJAA 3ONXA 4AKIA 3RPUA 4ZI3D 1VOMA 5L3EB 4GK5E 3FXEB 3FZFB 3AE3A 2VQFT 3UQ4A 5AQKB 2LEHA 4UV8B 2BVLA 4O2BE 1R8IA 5ETWA 4O4JE 4DO0A 1KFYA 3I0QA 4TX5A 3JC6C 4U72A 3ZMZB 2CHOA 1XNRT 2X9HA 4U31A 4YFSA 4BAYB 4DR2T 3PJAJ 5FNVE 2D0UA 3VR8A 1HG5A 1EZ3A 2W62A 2XAQB 5LHIB 4U2ZA 5HWXA 4TWDA 4HFEA 4TNWA 2BDEA 2IDOB 2C5KT 3K3OA 5H6RB 1G73A 2IMLA 3LSVA 1NEKA 4JV5T 2SPCA 3F31A 1ZOYA 3JC6D 5C2TA 4AKRB 3O1JA 4J2CA 4IDZA 3Q5XA 1MIWA 3HA4A 4EZHA 2Q9QB 4YJ2E 4YTPA 1HS7A 3BQIA 4WW0A 5J1GA 3HR0A 3ZMSB 3NZPA 4IDPA 5LXTE 4DV1T 2K9AA 5AQHB 4PJNA 4PK6A 3RYIE 4PK5A 5M4YA 3LK2B 4B6XA 3LJCA 3SRZA 4LFAT 2DL1A 3RYHE 1FMWA 3OKQA 5HEHA 3ZMVB 3RX6A 4X1IE 3E0ZA 4YHJA 4N78D 2XJ7A 4EEBA 5KX5E 2UXBT 2C5JA 4Z90A 3RIUC 2WB5A 3DP7A 1OXZA 1FIOA 2A9UA 2QYWA 3SFDA 2KXPB 5J2TE 5C8YE 2WU2A 2Q9QD 4HEAA 4QXCB 1MMNA 4KMCA 1HNZT 4YTMA 2YINA 3CX7B 4F8HA 2V6YB 3HL6A 2V26A 1KNZA 2WU5A 2CXDA 3AEBA 2WSSV 3FHNA 5FY0A 1QUUA 4DR6T 5FP3A 5JH7E 2LKHA 2X51A 3RHWA 3AVRA 4X65T 2PTFA 5HAXA 2JQKA 4JI6T 1Z8UA 1T7SA 4UELA 2A2FX 4HWDA 3KV5A 4EGWA 3ZSTA 4IIJE 3CQGB 4QX7B 5LGNB 3PUQA 4YSYA 2CWYA 2M6IA 1IAPA 4PNIA 4DV6T 3CIRA 3PUGA 3C98B 3PDYA 2LE8A 4P09A 4DV5T 1HNWT 2NOXA 2EHOD 5E0OA 3ZN1B 4EB6E 4NPPA 4JI8T 3AXJB 1HX1B 1U5PA 4JI5T 3K1SA 3Q5WA 5L3DB 4TN7B 3GN5A 2X0YA 1D0ZA 1UX5A 4KP3C 3PE0A 5LB7B 2VB6A 2YU1A 2VASA 2WAUA 4UF0B 1KNPA 3ZMUB 4F6RC 1OEDB 5AQNB 1E1HB 5FL1A 2BS2A 2VVNA 4OFZA 3FXDB 4YSZA 4ILCA 2CEAA 1GQEA 3HKDE 3RC8A 5JDGA 4GOUA 2XTLA 3JAEA 4I55E 5JDLA 5JRCA 4O4HE 2LSGA 3E08A 4DBRA 3IF8B 5TAOA 1VCTA 2NW7A 4ZI7E 5JVDE 1OEDC 2D5UA 3X1DA 4QXBB 3AE5A 2IW5B 4CXXA 3UUMA 2ZM6T 2FBWA 4C90A 3KV4A 1UGOA 3PV0F 4ZEYA 4UVCB 1ZV4X 3RRWA 2UXNB 2WMNA 1E7PA 3UFGA 3ZSSA 3MA9A 4OYJA 3M3ZB 2X66A 4M1PA 3UUXB 1WFDA 3HKCE 2BKOA 1IBKT 3N9LA 4OX9T 2XHEB 4EAHA 4TZ4C 2LOPA 4HGAA 3QB5K 4UXNB 3KBUA 2LKGA 4CQIA 2FJDA 4G2AA 2V5DA 1UCUA 3AEFA 2FJEA 5LG3A 4GKJT 3BQLA 2LSKA 2HN1A 2BG9E 1L0VA 3ZJ1A 2J4GA 3BQKA 1XMQT 3OYXA 3EDUA 1NENA 5FXZA 2XQ3A 2YU2A 5FKYA 4DR5T 1JNRA 4HFBA 3VRBA 1U4QA 3DJBA 3ZC1A 5JR9B 4JBWF 5HCJA 2UUAT 2KMFA 4AXPA 5AQPB 2LM2A 2IHR1 2A3DA 2V7IA 5EZYE 5CA1E 5JTGA 5HXEA 2KNDA 2VL8A 4L5GA 4ILBA 2CLYB 5F8PA 3RH3A 2NTYA 4CZZB 3KFWX 1E2AA 2CXFA 3C4ZA 3MZKB 4U2YA 5JR9C 4AKGA 3I9WA 4UVBB 1MNDA 1WCRA 2PG8A 2J1DG 5GONE 4IE6A 2QVAA 1QSDA 2KZ7B 3F57A 4LF4T 4ZHQE 2CLYC 2BVMA 3AAIA 2X9XA 1HG2A 2D2SA 3NVOA 3F2EA 2DWKA 3B5MA 3U3IA 4LF6T 1XDPA 4QX8B 3FZLB 4K0KT 5HXHA 2LSIA 2W66A 2RPAA 4YY3T 3P4SA 3ZYKA 1UX4A 3MK7C 2ACZA 5LP6E 4A56A 1ZP0A 3NBXX 4DVDA 2LOSA 2RP4A 4G63A 4ZXLA 4LF9T 5AQOB 1BR0A 4JI7T 3QNUA 4DR4T 3A5XA 2CWOA 3UUBA 1ZKEA 2JPFA 5LA6E 2E9XA 3TLVA 4X62T 1MMGA 2Z6EA 3K3QC 3AAEB 1WYCA 3DTOA 5CGMA 2QGSA 1YKEB 2V7KA 2OLTA 2KWHA 5LHHB 4YHHT 4CN4A 3C4WA 4QKNA 3ANWA 4JI2T 2WDVA 5JDNA 3L09A 3ZYMA 4YLHA 4LMJA 2W0GA 2QA7A 4X64T 4O4IE 4NXNT 2N1GA 3C50A 4XAXB 4NIQA 3RYFE 4IGUA 4HWHA 4P1NA 4WNKA 3UU4A 4WYVA 2LLYA 3ZEFB 3AE4A 2KSRA 3P4RA 4MHCA 5AQQB 3RI5A 3NRXA 5ABFB 3WAKA 5JDQA 2V8SV 2X67A 3WI3A 1YD8G 3RC3A 4PJLA 4Q25A 4H63V 4HE8A 3MACA 3VU7H 1HFAA 2ODUA 4TUYE 2HH7A 3L39A 5LOVE 2VKOA 2I6HA 2LSYA 1Y64B 2ZLYA 3ZT7A 1FEWA 5IUXA 4PFPA 1YW0A 2XQ4A 3AB3B 5DJQC 4HN9A 4DR3T 3BK9A 3CKDA 4H9OC 2CCQA 3R84B 2WWUA 2L9QA 3UFEA 4U7YA 1YQ4A 2HHHT 2V7LA 4LFCT 4JI3T 4IDNA 3CQCB 4ANJA 3UU5A 4IDQA 3KDSE 4LFBT 4HFCA 2QRXA 4UEMA 4Z91A 4OYKA 2Q9QC 3LBXB 3ZCJA 1HF8A 4DMVA 4QXHB 2OV9A 3OPCA 2WMOA 5CJ5A 3TLUA 3N9MA 5FXXA 4ASKA 4IREA 4EXTA 2C0SA 2K24A 5JDHA 3T1HT 3UUNA 4QH5A 2BG9B 5HYAA 4U7IA 4B3RT 3JADA
chains in the Genus database with same CATH topology
2OA5A 2LSGA 2XASB 5ADXL 2EHOB 4TV8E 5LGUB 3N5LA 3E08A 4GYSA 3IBPA 4DBRA 3OYZA 1HCIA 3AVSA 3SOLA 3LBXA 4IE5A 4FJOA 4OHFA 2XAHB 3IF8B 4ISTA 4JLEA 4ZS2A 5TAOA 1SHZC 3AAAB 2Y6XA 2NW7A 4UVAB 4QWNB 2KWIB 4ZI7E 5JVDE 4H9SE 3SWHA 2CE7A 4GK0E 2NW9A 2D5UA 2IC9A 3AA7B 2LHNA 4DNDA 4UF0A 4QXBB 3J9X1 3ZMTB 2IW5B 3IHRA 4CXXA 3UUMA 4JEUB 3M65A 4C91A 2JMKA 5IHYA 3LFMA 3D0TA 4X1KE 1X79A 4C90A 1WLXA 3KV4A 5KDMC 1ZHCA 4EOZB 2W63A 1D1AA 1MMAA 2ZM2A 4UVCB 2KT9A 3QC9A 1BR1A 3RKOA 4K0UA 4Z8XA 2W00A 2KINB 5JDMA 1ZV4X 2EHOC 3VHLA 2E8IA 2XAJB 3V5SA 2G0UA 5CA0E 3PUAA 2XAFB 3O1IA 2EHOA 4P0AA 3RRWA 2UXNB 4O2AE 2WMNA 2PFVA 4EIWA 3KV6A 2DWGA 2N9DA 3ZCIA 2W61A 2CXLA 5FXVA 3KVAA 5HXCA 3CWZB 3CMLA 3MA9A 2IAKA 3FB2A 4OYJA 2M67A 3B13A 4P0BA 2B1EA 3ZPOA 1WR6A 2X66A 2D0TA 2PJQA 1VRBA 2VKHA 5DQWA 3PU8A 4M1PA 3UUXB 3N2OA 5FMNA 4ZI2C 3HKCE 3PUSA 5KMGP 3N9LA 1CUNA 2H7VC 2XHEB 2DCFA 1KK7A 3ETUA 2YEVC 3H3AA 4EAHA 5F3JA 1D1BA 2MBGA 1S35A 4PK4A 4TZ4C 3W15B 5LG4A 2LOPA 1BR4A 3WAJA 4HGAA 4UXNB 4AI6A 3MXZA 3KBUA 2RA1A 5LCYA 2Y48B 3HI2A 2LHRA 4H9PC 2VKDA 3Q9DA 3Q2MA 5BMVE 2Y8DA 3EDVA 4AQFC 1WRDA 2IC6A 4AQFA 4CQIA 5LHGB 4PJJA 4PAGA 2X9YA 4BJNA 4ZI2D 4ZI3C 5FYMA 4G2AA 2HPLA 4H9NC 3SS1A 3C64A 3ESLA 3GA8A 5DQVA 3UTKA 4XZCA 1UCUA 4EYYR 4IE0A 1D1CA 3N2GE 4BJMA 2DNXA 4H63H 4CI2B 4YJ3E 3BQLA 2LSKA 2PBIA 4AKHA 3L3PA 4EYUA 2C5IT 3LG7A 2K48A 5LNKA 3ZJ1A 3ZLIA 3BQKA 4O4LE 3OYXA 3IEEA 2YK0A 3PTRB 2H7OA 2ODVA 3HKEE 3CX8B 3ZC0A 2K5BB 3EDUA 3PU3A 3T8OA 1MNEA 5FXZA 2VWAA 2YU2A 2XAGB 3KBTA 3OJAA 3ONXA 4AKIA 3RPUA 1U4QA 3DJBA 3ZC1A 5JDFA 5JR9B 2MTQA 4ZI3D 5FXWA 1VOMA 3UT5E 5L3EB 2KMFA 2P9BA 2UXXB 4GK5E 4AXPA 2CA5A 3FXEB 3I1AA 4EZ4A 4FI5A 2A3DA 2CM0A 2V7IA 3N9OA 4IHJE 2V7JA 5LBQB 5EZYE 5CA1E 2LEHA 4UV8B 5HXEA 2LM9A 2KNDA 2BVLA 2VL8A 4L5GA 2E9XD 4V1Av 2CLYB 3FBZA 4O2BE 3ETVA 5F8PA 3RH3A 5ETWA 3AA0B 4HFVA 4O4JE 4DO0A 2NTYA 3ZJ2A 2I59A 2LSJA 4CZZB 3KFWX 3I0QA 4TX5A 3JC6C 4U72A 3NZQA 4UIGA 3ZMZB 3N9PA 3I9YA 4QHOA 2X9HA 4YFSA 4H9QC 1H7CA 2CXFA 4BAYB 3C4ZA 3MZKB 5JR9C 5J2UE 4AKGA 3N9QA 3I9WA 1O3XA 4O8SA 5HWYA 4UVBB 5FNVE 2D0UA 1LVFA 5JR9A 1MNDA 2W62A 1HG5A 2XAQB 1EZ3A 1IZNB 1OWAA 5LHIB 2PG8A 2J1DG 5HWXA 2MYSA 5GONE 2LJLA 4IE6A 4NUVA 2BDEA 4L0RA 1MMDA 1QSDA 2KZ7B 3F57A 2C5KT 2ZM0A 4ZHQE 2CLYC 3K3OA 5H6RB 2BVMA 5CB4E 3AAIA 2X9XA 3EUHA 4I4TE 1G73A 1HG2A 1B7TA 2D2SA 2SPCA 2V7MA 3F31A 3F2EA 3JC6D 2ZM8A 2DWKA 3U3IA 2VKJA 4CI3B 4AKRB 4AQGA 3O1JA 2L3LA 2KLQA 4J2CA 4IDZA 1NAFA 1WYBA 3Q5XA 1MIWA 1T98A 4QX8B 2N2NA 4UV9B 5HXHA 4U74A 5LBMA 3HA4A 2DI4A 2LSIA 2E9XB 4EZHA 3O4XE 4MBQA 2Q9QB 4YJ2E 1HS7A 1MIYA 3ZYKA 3O9XA 1UX4A 3R6NA 3MK7C 1V9DA 4AKLA 2BZBA 3BQIA 4WW0A 5J1GA 3HR0A 4HTEA 5LP6E 4A56A 3QUJA 3ZMSB 3NZPA 1FMVA 3NBXX 5EK3A 5LXTE 3H37A 2K9AA 4BA9A 2X68A 3E22E 4PJNA 2ZMAA 3ANWB 4PK6A 5A1LA 3RYIE 2GK9A 4DVDA 2LOSA 3MKDA 4I43B 2JMHA 2RP4A 4G63A 4PK5A 3VKHA 4OK0A 5M4YA 3U78A 1YKHB 1BR0A 3ZYLA 3HKBE 3LK2B 4E7ZA 3RYCE 4TV9E 3A5XA 4B6XA 3LJCA 3B57A 3SRZA 2E9XC 2CWOA 4CI1B 4ZOLE 4I50E 4IE7A 1ZKEA 2JPFA 5LA6E 2E9XA 3RYHE 2Q9QA 1FMWA 3MJXA 3OKQA 1MMGA 3NRYA 3V5UA 2L8KA 2Z6EA 3K3QC 3AAEB 3RX6A 3C51A 3ZMVB 4X1IE 3E0ZA 4YHJA 4N78D 1WYCA 3CPZA 3DTOA 2X0LB 3CVRA 3VKGA 5KX5E 2C5JA 1S94A 2QGSA 1YKEB 2V7KA 3C4XA 2KWHA 3DP7A 4MFRA 3ZN0B 5LHHB 1OXZA 2NP9A 1FIOA 3C4WA 2DHRA 3TKLB 2ACXA 3OBVE 4QKNA 4CXYA 4KBMB 3ANWA 5IYZE 3GMIA 4ADZA 5JDNA 1HTJF 3L09A 1NWMX 2KXPB 3KVBA 3ZYMA 5J2TE 5C8YE 4YLHA 4NUUA 5EK2A 4X20E 3GWHA 2CMRA 3KV9A 2NWBA 2W0GA 2QA7A 4WBOA 3FBLA 4O4IE 2Q9QD 4HEAA 4QXCB 2ES0A 1MMNA 4KMCA 3LK42 2YINA 3CX7B 2N1GA 5LGTB 3C50A 5L2LA 4XBFB 3HL6A 4XAXB 2V26A 1KNZA 4GIWA 4CXWA 2CXDA 5FY7A 2WSSV 3FHNA 1G8XA 3RYFE 3PURA 4PJMA 5L3CB 4IGUA 5FY0A 1QUUA 2X9WA 4WNKA 5FP3A 5JH7E 3ZEFB 2X51A 2XQYA 4MHCA 4L9IA 3AVRA 2HPJA 1HX8A 5HAXA 4DBQA 2WM9A 3NRXA 3WAKA 2XUEA 1IJ5A 2A72A 2JJ9A 5JDQA 3O1HA 2V1DB 2VK9A 2X67A 3WI3A 5LJMA 4UELA 1YD8G 5HXRA 3N9NA 2WBLA 1MIVA 3RC3A 4PJLA 4H63V 4HE8A 3MACA 3VU7H 5L3FB 2A2FX 5FY1A 1LRZA 3KV5A 4HKAA 1HFAA 4IIJE 2ODUA 4WBNE 4E7SA 4TUYE 2HH7A 3KINB 4JUYA 3CQGB 4QX7B 2LT3A 3GN5B 3PUQA 3QK6A 5LOVE 5LGNB 2VKOA 4ZS3A 2LSYA 4X1YE 2CWYA 1Y64B 2ZLYA 5L3BB 3N2KE 1FEWA 2NTXA 1IAPA 4PNIA 4PFPA 1IJ6A 5JQGE 3PUGA 3RRCA 1D0YA 4MALA 3C98B 1YW0A 3AB3B 3PDYA 1BR2A 4ISSA 5DJQC 2LE8A 2MOZA 4HN9A 3AA6B 4P09A 3BK9A 5DABA 1AJ3A 2NOXA 2EHOD 3CKDA 5LYJE 4H9OC 5E0OA 4PW8A 2CCQA 3S4UA 3R84B 3ZN1B 4EB6E 2WWUA 4KUMB 3P7IA 4JEHB 1D0XA 2JQQA 2L9QA 3UFEA 2DLRA 2V7LA 5L3GB 3P8CD 1U5PA 4DMWA 5JRCB 4ILUA 4ANJA 3CQCB 3CX6B 3Q5WA 5EK4A 5L3DB 4TN7B 3KDSE 4MLKA 4ERRA 3GN5A 1US7B 4UEMA 4GYRA 3AA1B 5HXSA 1D0ZA 1UX5A 2Q9QC 4OYKA 4KP3C 3LBXB 3J7Yq 3ZCJA 1HF8A 4DMVA 3K3NA 4IE4A 1ZEEA 2JRKA 5AFUL 5JREA 3PE0A 4QXHB 5H6QB 2VB6A 3LK3B 2YU1A 2NW8A 1LVKA 2VASA 5LJNA 2WMOA 2WAUA 4UF0B 2H3RA 3ZMUB 4F6RC 1LKXA 3N9MA 5FXXA 1SA0E 3EVYA 4ASKA 1E1HB 4H9RC 4EXTA 2C0SA 3UULA 2K24A 4OFZA 5JDHA 3FXDB 3CQXC 2CEAA 3K8PC 3UUNA 3HKDE 1Z0PA 3RC8A 5HYAA 4GOUA 2XTLA 5JDGA 4I55E 5JDLA 5JRCA 4O4HE 4PFOA 3I0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKH B;  1YKE B; 
#chains in the Genus database with same CATH topology
 4GKK T;  2OA5 A;  2EHO B;  3N5L A;  4GYS A;  3IBP A;  1XNQ T;  3SOL A;  2BBH A;  4FJO A;  2XAH B;  2XQ5 A;  4IST A;  4JLE A;  4ZS2 A;  3AAA B;  4QWN B;  4YTN A;  4H9S E;  3SWH A;  2CE7 A;  2K3W A;  2NW9 A;  2LHN A;  3AE2 A;  3ZMT B;  3IHR A;  3M65 A;  5IHY A;  2BG9 C;  3LFM A;  4X1K E;  5J0Z A;  1X79 A;  1WLX A;  1D1A A;  2ZM2 A;  3RKO A;  2W00 A;  2EHO C;  3RIA A;  3VHL A;  2XAJ B;  1J5E T;  3PUA A;  5HEJ A;  2XAF B;  3O1I A;  4O2A E;  4NXM T;  5C3J A;  1QLB A;  3KV6 A;  3ZCI A;  2W61 A;  4X5T A;  4UR9 A;  3B13 A;  4P0B A;  5HEO A;  1WR6 A;  4AIU A;  3AEE A;  4A97 A;  1VRB A;  3JCF A;  3A7M A;  2MBG A;  1S35 A;  5LMU T;  3UU3 A;  3WAJ A;  3PUV F;  2RA1 A;  3OVU A;  4HFI A;  1J1J A;  1KF6 A;  3TLT A;  3T1Y T;  4A5X A;  4AQF C;  2MPK A;  2IC6 A;  3RQU A;  1X9B A;  2UXD T;  4H9N C;  3ESL A;  5DQV A;  5F5W A;  4EYY R;  3FZK B;  1D1C A;  3N2G E;  4H63 H;  3ZT5 A;  4YJ3 E;  4ILA A;  1XDO A;  2C5I T;  2K48 A;  3AEC A;  4HWF A;  3ZLI A;  4O4L E;  4JYA T;  3IEE A;  2YK0 A;  3PTR B;  3HKE E;  2CBI A;  2K5B B;  1XWM A;  1JNZ A;  3KBT A;  1SE7 A;  5JDF A;  2MTQ A;  3UT5 E;  2P9B A;  2CA5 A;  3I1A A;  2BBJ A;  4FI5 A;  2CM0 A;  5LBQ B;  2LM9 A;  2WS3 A;  2E9X D;  4V1A v;  4EED A;  2YOE A;  3FBZ A;  4KHP T;  3ETV A;  2CRB A;  4HFV A;  2LSJ A;  4UIG A;  3N9P A;  4QHO A;  2UU9 T;  1H7C A;  3N9Q A;  5HWY A;  5HCM A;  2LJL A;  4HWC A;  4YXD A;  2YDQ A;  3VRA A;  5CB4 E;  3EUH A;  4I4T E;  1B7T A;  2E2A A;  1I6Z A;  2ZM8 A;  2VKJ A;  4CI3 B;  2L3L A;  2KLQ A;  1NAF A;  1WYB A;  1T98 A;  4I0U A;  2DI4 A;  2BS4 A;  4MBQ A;  3O9X A;  3AE7 A;  2BZB A;  3QUJ A;  2AE9 A;  5EK3 A;  3H37 A;  2UUB T;  2I0M A;  5A1L A;  2ZMA A;  2GK9 A;  3MKD A;  4I43 B;  3VKH A;  4OK0 A;  4U33 A;  1YKH B;  1KEY A;  4E7Z A;  5AQR B;  3B57 A;  2W4X A;  4IE7 A;  4ZZC A;  2Q9Q A;  2L8K A;  1N33 T;  3C51 A;  2X0L B;  2MAW A;  4DUY T;  3C4X A;  3EAB A;  4MFR A;  1W09 A;  3FZM B;  3VR9 A;  2LRL A;  3RIU A;  2ACX A;  2XSA A;  5IYZ E;  3GMI A;  3KVB A;  4NUU A;  5EK2 A;  4X20 E;  3GWH A;  2CMR A;  3KV9 A;  2NWB A;  4WBO A;  4KI0 F;  2ES0 A;  3LK4 2;  5LGT B;  4CXW A;  3ONJ A;  1G8X A;  4PJM A;  1T72 A;  4CN6 A;  2FJB A;  2H88 A;  2HPJ A;  2WWV A;  5ABE A;  2WM9 A;  5L4H A;  4DV3 T;  3O1H A;  2V1D B;  2VK9 A;  3N9N A;  2WBL A;  1MIV A;  5AQF B;  1FJG T;  5L3F B;  1LRZ A;  2F4V T;  2V6Y A;  4E7S A;  4B3M T;  3KIN B;  4JUY A;  2LT3 A;  3GN5 B;  5AQG B;  4X1Y E;  3RQW A;  1IJ6 A;  5JQG E;  1N32 T;  3RRC A;  4MAL A;  3EHZ A;  3ONL C;  2MOZ A;  2JQH A;  2YDS A;  3Q5D A;  5LYJ E;  4LF5 T;  3P7I A;  4JEH B;  1D0X A;  2JQQ A;  3P8C D;  4DMW A;  5JRC B;  4YT0 A;  3CX6 B;  4ERR A;  3AE9 A;  3AA1 B;  1WR0 A;  4ZZB A;  3K3N A;  4LF7 T;  2JRK A;  5JRE A;  5H6Q B;  2NW8 A;  1LVK A;  5LJN A;  3ABV A;  3RIF A;  2H3R A;  1SA0 E;  2VVS A;  4H9R C;  3P4W A;  2XM2 A;  3UUL A;  1XMO T;  2UXC T;  3K8P C;  3AXJ A;  1Z0P A;  4JI1 T;  2X0H A;  3OYZ A;  4IE5 A;  2XQ8 A;  2Y6X A;  2E5L T;  1IBM T;  2XSB A;  2IC9 A;  3AA7 B;  4DND A;  4UF0 A;  3P4P A;  4DR7 T;  1OED A;  3AEA A;  4C91 A;  2JMK A;  4HFD A;  5AQM B;  3D0T A;  3Q5E A;  2WDR A;  2WQY A;  1VCS A;  4HWI B;  3QC9 A;  3PUY F;  1BR1 A;  4K0U A;  4Z8X A;  2KIN B;  4DID B;  5JDM A;  3LDQ B;  3UU8 A;  2E8I A;  2W67 A;  5FVL A;  4B3T T;  4EIW A;  5CFB A;  2CXL A;  4LF8 T;  2IAK A;  3FB2 A;  4DV2 T;  2M67 A;  2B1E A;  3ZKR A;  5DQW A;  3PU8 A;  5L47 A;  4ZI2 C;  2VUR A;  2LRK A;  1CUN A;  2DCF A;  5AQI B;  1KK7 A;  4KX6 A;  2BKN A;  2YEV C;  2XQA A;  3H3A A;  2J62 A;  3W15 B;  1BR4 A;  2WP9 A;  1UK5 A;  1UUR A;  4AI6 A;  3MXZ A;  5LCY A;  2LHR A;  4H9P C;  3Q9D A;  2YN6 A;  3EDV A;  3QB5 A;  5L4E A;  1T8B A;  4PJJ A;  2X9Y A;  4ZI2 D;  3SS1 A;  3GA8 A;  3UTK A;  4AQY T;  4BJM A;  4IL4 A;  3PUX F;  3NKZ A;  4AIS A;  4AKH A;  3L3P A;  1SUM B;  1M7K A;  2WY2 A;  4JI4 T;  2H7O A;  3ZC0 A;  3T8O A;  3PUW F;  1MNE A;  3P4Q A;  5KXJ A;  5FXW A;  2XQ9 A;  2UXX B;  1N36 T;  4EZ4 A;  4HFH A;  3N9O A;  4IHJ E;  2V7J A;  3QOF A;  1UUS A;  5AQL B;  5FL0 A;  5ABG A;  3AA0 B;  1CHU A;  3ZJ2 A;  2I59 A;  2VQE T;  3RKG A;  3OTO T;  3NZQ A;  3I9Y A;  4H9Q C;  5J2U E;  3EI0 A;  1O3X A;  4O8S A;  1LVF A;  5JR9 A;  1IZN B;  1OWA A;  4DV7 T;  2MYS A;  2E5V A;  4NUV A;  4L0R A;  1MMD A;  2ZM0 A;  2XM1 A;  3UU6 A;  1XZY A;  4WZX A;  2V7M A;  1W0A A;  2XQ7 A;  4AQG A;  1DU2 A;  1YQ3 A;  3SFE A;  2V5C A;  4UV9 B;  2N2N A;  4CN1 A;  4U74 A;  5LBM A;  3AEG A;  2E9X B;  4QH1 A;  3O4X E;  1MIY A;  1HR0 T;  3R6N A;  1V9D A;  4AKL A;  4HTE A;  2M6B A;  3RLF F;  2CBJ A;  4TWF A;  1FMV A;  2XQ6 A;  4BA9 A;  2X68 A;  3E22 E;  3ANW B;  2JQ9 A;  2JMH A;  3U78 A;  1YXR A;  3ZYL A;  3HKB E;  2AXD S;  5AQV B;  3RYC E;  4TV9 E;  2E9X C;  4CI1 B;  4ZOL E;  4I50 E;  2FUP A;  3MJX A;  2YKS A;  3NRY A;  3V5U A;  4QH4 A;  2BKP A;  3TLW A;  2D9D A;  3CPZ A;  3CVR A;  3VKG A;  1S94 A;  1IBL T;  3ZN0 B;  2NP9 A;  3AE6 A;  4A98 A;  2DHR A;  3TKL B;  3OBV E;  4CXY A;  4KBM B;  4ADZ A;  1HTJ F;  1W0B A;  1NWM X;  3ZT6 A;  4IT4 A;  3FZH B;  3FBL A;  3RGL A;  2IUB A;  3PUZ F;  4XBF B;  5L2L A;  4GIW A;  5FY7 A;  3PUR A;  3CK6 A;  5L3C B;  2X9W A;  2XY8 B;  2XQY A;  4L9I A;  1HX8 A;  4DBQ A;  2CPT A;  2XUE A;  1IJ5 A;  2A72 A;  2JJ9 A;  4B3S T;  5LJM A;  3IA3 A;  5HXR A;  4EV6 A;  3AED A;  5FY1 A;  4HKA A;  4U3C A;  4WBN E;  2XZE A;  3QK6 A;  4DV0 T;  4ZS3 A;  5L3B B;  3N2K E;  2NTX A;  2J47 A;  1HNX T;  1D0Y A;  1N34 T;  3NWI A;  1BR2 A;  4ISS A;  3AA6 B;  5ABF A;  5ABH A;  3AE1 A;  5DAB A;  2V6X A;  1AJ3 A;  3S4U A;  4PW8 A;  4KUM B;  2XPK A;  1Y01 A;  2IIU A;  2DLR A;  1I94 T;  5L3G B;  4ILU A;  5EK4 A;  1W9R A;  4MLK A;  1US7 B;  4GYR A;  1M62 A;  5HXS A;  4COF A;  3AE8 A;  4IDO A;  3J7Y q;  2CHN A;  2WZH A;  4IE4 A;  1ZEE A;  4DV4 T;  5AFU L;  3LK3 B;  1LKX A;  3EVY A;  3CQX C;  4JI0 T;  2H89 A;  3TLS A;  4PFO A;  3I0O A;  5AQU B;  2XAS B;  3H3M A;  5ADX L;  4TV8 E;  5LGU B;  1HCI A;  3AVS A;  3LBX A;  4OHF A;  3P50 A;  1SHZ C;  4UVA B;  4IL9 A;  2KWI B;  2YDR A;  4GK0 E;  4TNV A;  3J9X 1;  4LMK A;  4DUZ T;  2VL0 A;  4JEU B;  5AQS B;  3RF1 A;  5FVK A;  5KDM C;  1ZHC A;  4EOZ B;  2W63 A;  5IWA T;  2BG9 A;  1MMA A;  2KT9 A;  2FJA A;  3V5S A;  2G0U A;  5CA0 E;  2NR4 A;  2EHO A;  4P0A A;  2PFV A;  3EAM A;  2DWG A;  2N9D A;  5FXV A;  3KVA A;  5HXC A;  3CWZ B;  3CML A;  3UQ7 A;  3ZPO A;  2WCA A;  2WDQ A;  2B76 A;  2D0T A;  1J5W A;  2PJQ A;  2VKH A;  2W2U A;  3N2O A;  5FMN A;  4X66 T;  2R6G F;  3PUS A;  5KMG P;  2WZI A;  2H7V C;  3ETU A;  4TWH A;  5F3J A;  1D1B A;  4KHZ F;  4DR1 T;  4PK4 A;  5LG4 A;  5HEG A;  2Y48 B;  3HI2 A;  4YSX A;  2VKD A;  5AQT B;  3Q2M A;  5BMV E;  2Y8D A;  3JAF A;  1WRD A;  4AQF A;  1KNR A;  5LHG B;  4PAG A;  4BJN A;  4ZI3 C;  5FYM A;  2HPL A;  5BR8 T;  3C64 A;  1OED E;  4XZC A;  4IE0 A;  3G06 A;  2DNX A;  5LMN T;  4CI2 B;  2UUC T;  2PBI A;  4EYU A;  2BS3 A;  3LG7 A;  5LNK A;  5AQJ B;  2HN2 A;  4LML A;  2ODV A;  2JIW A;  3CX8 B;  3PU3 A;  2VWA A;  2XAG B;  3PJA A;  5HEU A;  3A8Y C;  3L8R A;  3OJA A;  3ONX A;  4AKI A;  3RPU A;  4ZI3 D;  1VOM A;  5L3E B;  4GK5 E;  3FXE B;  3FZF B;  3AE3 A;  2VQF T;  3UQ4 A;  5AQK B;  2LEH A;  4UV8 B;  2BVL A;  4O2B E;  1R8I A;  5ETW A;  4O4J E;  4DO0 A;  1KFY A;  3I0Q A;  4TX5 A;  3JC6 C;  4U72 A;  3ZMZ B;  2CHO A;  1XNR T;  2X9H A;  4U31 A;  4YFS A;  4BAY B;  4DR2 T;  3PJA J;  5FNV E;  2D0U A;  3VR8 A;  1HG5 A;  1EZ3 A;  2W62 A;  2XAQ B;  5LHI B;  4U2Z A;  5HWX A;  4TWD A;  4HFE A;  4TNW A;  2BDE A;  2IDO B;  2C5K T;  3K3O A;  5H6R B;  1G73 A;  2IML A;  3LSV A;  1NEK A;  4JV5 T;  2SPC A;  3F31 A;  1ZOY A;  3JC6 D;  5C2T A;  4AKR B;  3O1J A;  4J2C A;  4IDZ A;  3Q5X A;  1MIW A;  3HA4 A;  4EZH A;  2Q9Q B;  4YJ2 E;  4YTP A;  1HS7 A;  3BQI A;  4WW0 A;  5J1G A;  3HR0 A;  3ZMS B;  3NZP A;  4IDP A;  5LXT E;  4DV1 T;  2K9A A;  5AQH B;  4PJN A;  4PK6 A;  3RYI E;  4PK5 A;  5M4Y A;  3LK2 B;  4B6X A;  3LJC A;  3SRZ A;  4LFA T;  2DL1 A;  3RYH E;  1FMW A;  3OKQ A;  5HEH A;  3ZMV B;  3RX6 A;  4X1I E;  3E0Z A;  4YHJ A;  4N78 D;  2XJ7 A;  4EEB A;  5KX5 E;  2UXB T;  2C5J A;  4Z90 A;  3RIU C;  2WB5 A;  3DP7 A;  1OXZ A;  1FIO A;  2A9U A;  2QYW A;  3SFD A;  2KXP B;  5J2T E;  5C8Y E;  2WU2 A;  2Q9Q D;  4HEA A;  4QXC B;  1MMN A;  4KMC A;  1HNZ T;  4YTM A;  2YIN A;  3CX7 B;  4F8H A;  2V6Y B;  3HL6 A;  2V26 A;  1KNZ A;  2WU5 A;  2CXD A;  3AEB A;  2WSS V;  3FHN A;  5FY0 A;  1QUU A;  4DR6 T;  5FP3 A;  5JH7 E;  2LKH A;  2X51 A;  3RHW A;  3AVR A;  4X65 T;  2PTF A;  5HAX A;  2JQK A;  4JI6 T;  1Z8U A;  1T7S A;  4UEL A;  2A2F X;  4HWD A;  3KV5 A;  4EGW A;  3ZST A;  4IIJ E;  3CQG B;  4QX7 B;  5LGN B;  3PUQ A;  4YSY A;  2CWY A;  2M6I A;  1IAP A;  4PNI A;  4DV6 T;  3CIR A;  3PUG A;  3C98 B;  3PDY A;  2LE8 A;  4P09 A;  4DV5 T;  1HNW T;  2NOX A;  2EHO D;  5E0O A;  3ZN1 B;  4EB6 E;  4NPP A;  4JI8 T;  3AXJ B;  1HX1 B;  1U5P A;  4JI5 T;  3K1S A;  3Q5W A;  5L3D B;  4TN7 B;  3GN5 A;  2X0Y A;  1D0Z A;  1UX5 A;  4KP3 C;  3PE0 A;  5LB7 B;  2VB6 A;  2YU1 A;  2VAS A;  2WAU A;  4UF0 B;  1KNP A;  3ZMU B;  4F6R C;  1OED B;  5AQN B;  1E1H B;  5FL1 A;  2BS2 A;  2VVN A;  4OFZ A;  3FXD B;  4YSZ A;  4ILC A;  2CEA A;  1GQE A;  3HKD E;  3RC8 A;  5JDG A;  4GOU A;  2XTL A;  3JAE A;  4I55 E;  5JDL A;  5JRC A;  4O4H E;  2LSG A;  3E08 A;  4DBR A;  3IF8 B;  5TAO A;  1VCT A;  2NW7 A;  4ZI7 E;  5JVD E;  1OED C;  2D5U A;  3X1D A;  4QXB B;  3AE5 A;  2IW5 B;  4CXX A;  3UUM A;  2ZM6 T;  2FBW A;  4C90 A;  3KV4 A;  1UGO A;  3PV0 F;  4ZEY A;  4UVC B;  1ZV4 X;  3RRW A;  2UXN B;  2WMN A;  1E7P A;  3UFG A;  3ZSS A;  3MA9 A;  4OYJ A;  3M3Z B;  2X66 A;  4M1P A;  3UUX B;  1WFD A;  3HKC E;  2BKO A;  1IBK T;  3N9L A;  4OX9 T;  2XHE B;  4EAH A;  4TZ4 C;  2LOP A;  4HGA A;  3QB5 K;  4UXN B;  3KBU A;  2LKG A;  4CQI A;  2FJD A;  4G2A A;  2V5D A;  1UCU A;  3AEF A;  2FJE A;  5LG3 A;  4GKJ T;  3BQL A;  2LSK A;  2HN1 A;  2BG9 E;  1L0V A;  3ZJ1 A;  2J4G A;  3BQK A;  1XMQ T;  3OYX A;  3EDU A;  1NEN A;  5FXZ A;  2XQ3 A;  2YU2 A;  5FKY A;  4DR5 T;  1JNR A;  4HFB A;  3VRB A;  1U4Q A;  3DJB A;  3ZC1 A;  5JR9 B;  4JBW F;  5HCJ A;  2UUA T;  2KMF A;  4AXP A;  5AQP B;  2LM2 A;  2IHR 1;  2A3D A;  2V7I A;  5EZY E;  5CA1 E;  5JTG A;  5HXE A;  2KND A;  2VL8 A;  4L5G A;  4ILB A;  2CLY B;  5F8P A;  3RH3 A;  2NTY A;  4CZZ B;  3KFW X;  1E2A A;  2CXF A;  3C4Z A;  3MZK B;  4U2Y A;  5JR9 C;  4AKG A;  3I9W A;  4UVB B;  1MND A;  1WCR A;  2PG8 A;  2J1D G;  5GON E;  4IE6 A;  2QVA A;  1QSD A;  2KZ7 B;  3F57 A;  4LF4 T;  4ZHQ E;  2CLY C;  2BVM A;  3AAI A;  2X9X A;  1HG2 A;  2D2S A;  3NVO A;  3F2E A;  2DWK A;  3B5M A;  3U3I A;  4LF6 T;  1XDP A;  4QX8 B;  3FZL B;  4K0K T;  5HXH A;  2LSI A;  2W66 A;  2RPA A;  4YY3 T;  3P4S A;  3ZYK A;  1UX4 A;  3MK7 C;  2ACZ A;  5LP6 E;  4A56 A;  1ZP0 A;  3NBX X;  4DVD A;  2LOS A;  2RP4 A;  4G63 A;  4ZXL A;  4LF9 T;  5AQO B;  1BR0 A;  4JI7 T;  3QNU A;  4DR4 T;  3A5X A;  2CWO A;  3UUB A;  1ZKE A;  2JPF A;  5LA6 E;  2E9X A;  3TLV A;  4X62 T;  1MMG A;  2Z6E A;  3K3Q C;  3AAE B;  1WYC A;  3DTO A;  5CGM A;  2QGS A;  1YKE B;  2V7K A;  2OLT A;  2KWH A;  5LHH B;  4YHH T;  4CN4 A;  3C4W A;  4QKN A;  3ANW A;  4JI2 T;  2WDV A;  5JDN A;  3L09 A;  3ZYM A;  4YLH A;  4LMJ A;  2W0G A;  2QA7 A;  4X64 T;  4O4I E;  4NXN T;  2N1G A;  3C50 A;  4XAX B;  4NIQ A;  3RYF E;  4IGU A;  4HWH A;  4P1N A;  4WNK A;  3UU4 A;  4WYV A;  2LLY A;  3ZEF B;  3AE4 A;  2KSR A;  3P4R A;  4MHC A;  5AQQ B;  3RI5 A;  3NRX A;  5ABF B;  3WAK A;  5JDQ A;  2V8S V;  2X67 A;  3WI3 A;  1YD8 G;  3RC3 A;  4PJL A;  4Q25 A;  4H63 V;  4HE8 A;  3MAC A;  3VU7 H;  1HFA A;  2ODU A;  4TUY E;  2HH7 A;  3L39 A;  5LOV E;  2VKO A;  2I6H A;  2LSY A;  1Y64 B;  2ZLY A;  3ZT7 A;  1FEW A;  5IUX A;  4PFP A;  1YW0 A;  2XQ4 A;  3AB3 B;  5DJQ C;  4HN9 A;  4DR3 T;  3BK9 A;  3CKD A;  4H9O C;  2CCQ A;  3R84 B;  2WWU A;  2L9Q A;  3UFE A;  4U7Y A;  1YQ4 A;  2HHH T;  2V7L A;  4LFC T;  4JI3 T;  4IDN A;  3CQC B;  4ANJ A;  3UU5 A;  4IDQ A;  3KDS E;  4LFB T;  4HFC A;  2QRX A;  4UEM A;  4Z91 A;  4OYK A;  2Q9Q C;  3LBX B;  3ZCJ A;  1HF8 A;  4DMV A;  4QXH B;  2OV9 A;  3OPC A;  2WMO A;  5CJ5 A;  3TLU A;  3N9M A;  5FXX A;  4ASK A;  4IRE A;  4EXT A;  2C0S A;  2K24 A;  5JDH A;  3T1H T;  3UUN A;  4QH5 A;  2BG9 B;  5HYA A;  4U7I A;  4B3R T;  3JAD A; 
#chains in the Genus database with same CATH homology
 2OA5 A;  2LSG A;  2XAS B;  5ADX L;  2EHO B;  4TV8 E;  5LGU B;  3N5L A;  3E08 A;  4GYS A;  3IBP A;  4DBR A;  3OYZ A;  1HCI A;  3AVS A;  3SOL A;  3LBX A;  4IE5 A;  4FJO A;  4OHF A;  2XAH B;  3IF8 B;  4IST A;  4JLE A;  4ZS2 A;  5TAO A;  1SHZ C;  3AAA B;  2Y6X A;  2NW7 A;  4UVA B;  4QWN B;  2KWI B;  4ZI7 E;  5JVD E;  4H9S E;  3SWH A;  2CE7 A;  4GK0 E;  2NW9 A;  2D5U A;  2IC9 A;  3AA7 B;  2LHN A;  4DND A;  4UF0 A;  4QXB B;  3J9X 1;  3ZMT B;  2IW5 B;  3IHR A;  4CXX A;  3UUM A;  4JEU B;  3M65 A;  4C91 A;  2JMK A;  5IHY A;  3LFM A;  3D0T A;  4X1K E;  1X79 A;  4C90 A;  1WLX A;  3KV4 A;  5KDM C;  1ZHC A;  4EOZ B;  2W63 A;  1D1A A;  1MMA A;  2ZM2 A;  4UVC B;  2KT9 A;  3QC9 A;  1BR1 A;  3RKO A;  4K0U A;  4Z8X A;  2W00 A;  2KIN B;  5JDM A;  1ZV4 X;  2EHO C;  3VHL A;  2E8I A;  2XAJ B;  3V5S A;  2G0U A;  5CA0 E;  3PUA A;  2XAF B;  3O1I A;  2EHO A;  4P0A A;  3RRW A;  2UXN B;  4O2A E;  2WMN A;  2PFV A;  4EIW A;  3KV6 A;  2DWG A;  2N9D A;  3ZCI A;  2W61 A;  2CXL A;  5FXV A;  3KVA A;  5HXC A;  3CWZ B;  3CML A;  3MA9 A;  2IAK A;  3FB2 A;  4OYJ A;  2M67 A;  3B13 A;  4P0B A;  2B1E A;  3ZPO A;  1WR6 A;  2X66 A;  2D0T A;  2PJQ A;  1VRB A;  2VKH A;  5DQW A;  3PU8 A;  4M1P A;  3UUX B;  3N2O A;  5FMN A;  4ZI2 C;  3HKC E;  3PUS A;  5KMG P;  3N9L A;  1CUN A;  2H7V C;  2XHE B;  2DCF A;  1KK7 A;  3ETU A;  2YEV C;  3H3A A;  4EAH A;  5F3J A;  1D1B A;  2MBG A;  1S35 A;  4PK4 A;  4TZ4 C;  3W15 B;  5LG4 A;  2LOP A;  1BR4 A;  3WAJ A;  4HGA A;  4UXN B;  4AI6 A;  3MXZ A;  3KBU A;  2RA1 A;  5LCY A;  2Y48 B;  3HI2 A;  2LHR A;  4H9P C;  2VKD A;  3Q9D A;  3Q2M A;  5BMV E;  2Y8D A;  3EDV A;  4AQF C;  1WRD A;  2IC6 A;  4AQF A;  4CQI A;  5LHG B;  4PJJ A;  4PAG A;  2X9Y A;  4BJN A;  4ZI2 D;  4ZI3 C;  5FYM A;  4G2A A;  2HPL A;  4H9N C;  3SS1 A;  3C64 A;  3ESL A;  3GA8 A;  5DQV A;  3UTK A;  4XZC A;  1UCU A;  4EYY R;  4IE0 A;  1D1C A;  3N2G E;  4BJM A;  2DNX A;  4H63 H;  4CI2 B;  4YJ3 E;  3BQL A;  2LSK A;  2PBI A;  4AKH A;  3L3P A;  4EYU A;  2C5I T;  3LG7 A;  2K48 A;  5LNK A;  3ZJ1 A;  3ZLI A;  3BQK A;  4O4L E;  3OYX A;  3IEE A;  2YK0 A;  3PTR B;  2H7O A;  2ODV A;  3HKE E;  3CX8 B;  3ZC0 A;  2K5B B;  3EDU A;  3PU3 A;  3T8O A;  1MNE A;  5FXZ A;  2VWA A;  2YU2 A;  2XAG B;  3KBT A;  3OJA A;  3ONX A;  4AKI A;  3RPU A;  1U4Q A;  3DJB A;  3ZC1 A;  5JDF A;  5JR9 B;  2MTQ A;  4ZI3 D;  5FXW A;  1VOM A;  3UT5 E;  5L3E B;  2KMF A;  2P9B A;  2UXX B;  4GK5 E;  4AXP A;  2CA5 A;  3FXE B;  3I1A A;  4EZ4 A;  4FI5 A;  2A3D A;  2CM0 A;  2V7I A;  3N9O A;  4IHJ E;  2V7J A;  5LBQ B;  5EZY E;  5CA1 E;  2LEH A;  4UV8 B;  5HXE A;  2LM9 A;  2KND A;  2BVL A;  2VL8 A;  4L5G A;  2E9X D;  4V1A v;  2CLY B;  3FBZ A;  4O2B E;  3ETV A;  5F8P A;  3RH3 A;  5ETW A;  3AA0 B;  4HFV A;  4O4J E;  4DO0 A;  2NTY A;  3ZJ2 A;  2I59 A;  2LSJ A;  4CZZ B;  3KFW X;  3I0Q A;  4TX5 A;  3JC6 C;  4U72 A;  3NZQ A;  4UIG A;  3ZMZ B;  3N9P A;  3I9Y A;  4QHO A;  2X9H A;  4YFS A;  4H9Q C;  1H7C A;  2CXF A;  4BAY B;  3C4Z A;  3MZK B;  5JR9 C;  5J2U E;  4AKG A;  3N9Q A;  3I9W A;  1O3X A;  4O8S A;  5HWY A;  4UVB B;  5FNV E;  2D0U A;  1LVF A;  5JR9 A;  1MND A;  2W62 A;  1HG5 A;  2XAQ B;  1EZ3 A;  1IZN B;  1OWA A;  5LHI B;  2PG8 A;  2J1D G;  5HWX A;  2MYS A;  5GON E;  2LJL A;  4IE6 A;  4NUV A;  2BDE A;  4L0R A;  1MMD A;  1QSD A;  2KZ7 B;  3F57 A;  2C5K T;  2ZM0 A;  4ZHQ E;  2CLY C;  3K3O A;  5H6R B;  2BVM A;  5CB4 E;  3AAI A;  2X9X A;  3EUH A;  4I4T E;  1G73 A;  1HG2 A;  1B7T A;  2D2S A;  2SPC A;  2V7M A;  3F31 A;  3F2E A;  3JC6 D;  2ZM8 A;  2DWK A;  3U3I A;  2VKJ A;  4CI3 B;  4AKR B;  4AQG A;  3O1J A;  2L3L A;  2KLQ A;  4J2C A;  4IDZ A;  1NAF A;  1WYB A;  3Q5X A;  1MIW A;  1T98 A;  4QX8 B;  2N2N A;  4UV9 B;  5HXH A;  4U74 A;  5LBM A;  3HA4 A;  2DI4 A;  2LSI A;  2E9X B;  4EZH A;  3O4X E;  4MBQ A;  2Q9Q B;  4YJ2 E;  1HS7 A;  1MIY A;  3ZYK A;  3O9X A;  1UX4 A;  3R6N A;  3MK7 C;  1V9D A;  4AKL A;  2BZB A;  3BQI A;  4WW0 A;  5J1G A;  3HR0 A;  4HTE A;  5LP6 E;  4A56 A;  3QUJ A;  3ZMS B;  3NZP A;  1FMV A;  3NBX X;  5EK3 A;  5LXT E;  3H37 A;  2K9A A;  4BA9 A;  2X68 A;  3E22 E;  4PJN A;  2ZMA A;  3ANW B;  4PK6 A;  5A1L A;  3RYI E;  2GK9 A;  4DVD A;  2LOS A;  3MKD A;  4I43 B;  2JMH A;  2RP4 A;  4G63 A;  4PK5 A;  3VKH A;  4OK0 A;  5M4Y A;  3U78 A;  1YKH B;  1BR0 A;  3ZYL A;  3HKB E;  3LK2 B;  4E7Z A;  3RYC E;  4TV9 E;  3A5X A;  4B6X A;  3LJC A;  3B57 A;  3SRZ A;  2E9X C;  2CWO A;  4CI1 B;  4ZOL E;  4I50 E;  4IE7 A;  1ZKE A;  2JPF A;  5LA6 E;  2E9X A;  3RYH E;  2Q9Q A;  1FMW A;  3MJX A;  3OKQ A;  1MMG A;  3NRY A;  3V5U A;  2L8K A;  2Z6E A;  3K3Q C;  3AAE B;  3RX6 A;  3C51 A;  3ZMV B;  4X1I E;  3E0Z A;  4YHJ A;  4N78 D;  1WYC A;  3CPZ A;  3DTO A;  2X0L B;  3CVR A;  3VKG A;  5KX5 E;  2C5J A;  1S94 A;  2QGS A;  1YKE B;  2V7K A;  3C4X A;  2KWH A;  3DP7 A;  4MFR A;  3ZN0 B;  5LHH B;  1OXZ A;  2NP9 A;  1FIO A;  3C4W A;  2DHR A;  3TKL B;  2ACX A;  3OBV E;  4QKN A;  4CXY A;  4KBM B;  3ANW A;  5IYZ E;  3GMI A;  4ADZ A;  5JDN A;  1HTJ F;  3L09 A;  1NWM X;  2KXP B;  3KVB A;  3ZYM A;  5J2T E;  5C8Y E;  4YLH A;  4NUU A;  5EK2 A;  4X20 E;  3GWH A;  2CMR A;  3KV9 A;  2NWB A;  2W0G A;  2QA7 A;  4WBO A;  3FBL A;  4O4I E;  2Q9Q D;  4HEA A;  4QXC B;  2ES0 A;  1MMN A;  4KMC A;  3LK4 2;  2YIN A;  3CX7 B;  2N1G A;  5LGT B;  3C50 A;  5L2L A;  4XBF B;  3HL6 A;  4XAX B;  2V26 A;  1KNZ A;  4GIW A;  4CXW A;  2CXD A;  5FY7 A;  2WSS V;  3FHN A;  1G8X A;  3RYF E;  3PUR A;  4PJM A;  5L3C B;  4IGU A;  5FY0 A;  1QUU A;  2X9W A;  4WNK A;  5FP3 A;  5JH7 E;  3ZEF B;  2X51 A;  2XQY A;  4MHC A;  4L9I A;  3AVR A;  2HPJ A;  1HX8 A;  5HAX A;  4DBQ A;  2WM9 A;  3NRX A;  3WAK A;  2XUE A;  1IJ5 A;  2A72 A;  2JJ9 A;  5JDQ A;  3O1H A;  2V1D B;  2VK9 A;  2X67 A;  3WI3 A;  5LJM A;  4UEL A;  1YD8 G;  5HXR A;  3N9N A;  2WBL A;  1MIV A;  3RC3 A;  4PJL A;  4H63 V;  4HE8 A;  3MAC A;  3VU7 H;  5L3F B;  2A2F X;  5FY1 A;  1LRZ A;  3KV5 A;  4HKA A;  1HFA A;  4IIJ E;  2ODU A;  4WBN E;  4E7S A;  4TUY E;  2HH7 A;  3KIN B;  4JUY A;  3CQG B;  4QX7 B;  2LT3 A;  3GN5 B;  3PUQ A;  3QK6 A;  5LOV E;  5LGN B;  2VKO A;  4ZS3 A;  2LSY A;  4X1Y E;  2CWY A;  1Y64 B;  2ZLY A;  5L3B B;  3N2K E;  1FEW A;  2NTX A;  1IAP A;  4PNI A;  4PFP A;  1IJ6 A;  5JQG E;  3PUG A;  3RRC A;  1D0Y A;  4MAL A;  3C98 B;  1YW0 A;  3AB3 B;  3PDY A;  1BR2 A;  4ISS A;  5DJQ C;  2LE8 A;  2MOZ A;  4HN9 A;  3AA6 B;  4P09 A;  3BK9 A;  5DAB A;  1AJ3 A;  2NOX A;  2EHO D;  3CKD A;  5LYJ E;  4H9O C;  5E0O A;  4PW8 A;  2CCQ A;  3S4U A;  3R84 B;  3ZN1 B;  4EB6 E;  2WWU A;  4KUM B;  3P7I A;  4JEH B;  1D0X A;  2JQQ A;  2L9Q A;  3UFE A;  2DLR A;  2V7L A;  5L3G B;  3P8C D;  1U5P A;  4DMW A;  5JRC B;  4ILU A;  4ANJ A;  3CQC B;  3CX6 B;  3Q5W A;  5EK4 A;  5L3D B;  4TN7 B;  3KDS E;  4MLK A;  4ERR A;  3GN5 A;  1US7 B;  4UEM A;  4GYR A;  3AA1 B;  5HXS A;  1D0Z A;  1UX5 A;  2Q9Q C;  4OYK A;  4KP3 C;  3LBX B;  3J7Y q;  3ZCJ A;  1HF8 A;  4DMV A;  3K3N A;  4IE4 A;  1ZEE A;  2JRK A;  5AFU L;  5JRE A;  3PE0 A;  4QXH B;  5H6Q B;  2VB6 A;  3LK3 B;  2YU1 A;  2NW8 A;  1LVK A;  2VAS A;  5LJN A;  2WMO A;  2WAU A;  4UF0 B;  2H3R A;  3ZMU B;  4F6R C;  1LKX A;  3N9M A;  5FXX A;  1SA0 E;  3EVY A;  4ASK A;  1E1H B;  4H9R C;  4EXT A;  2C0S A;  3UUL A;  2K24 A;  4OFZ A;  5JDH A;  3FXD B;  3CQX C;  2CEA A;  3K8P C;  3UUN A;  3HKD E;  1Z0P A;  3RC8 A;  5HYA A;  4GOU A;  2XTL A;  5JDG A;  4I55 E;  5JDL A;  5JRC A;  4O4H E;  4PFO A;  3I0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...