1IBMT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibmT00
4DR7T 5LMNT 4JI0T 2E5LT 4DR1T 2UXDT 4X62T 4DR6T 4DV7T 4OX9T 2UUAT 2UXBT 2HHHT 4JV5T 4GKKT 2UUCT 4B3ST 5IWAT 4DV0T 4JI4T 4X65T 4DR5T 4LF8T 3T1YT 4K0KT 4DUYT 4NXMT 4X64T 4YY3T 2VQET 4DR2T 1XNQT 1IBKT 4DV4T 4DR4T 1N32T 4JI2T 1J5ET 5BR8T 1N34T 4DUZT 2UUBT 4JI7T 1HNWT 4DR3T 1FJGT 2VQFT 1I94T 1HR0T 4B3RT 4JI5T 4DV3T 4LF4T 2ZM6T 4JI8T 3OTOT 4LF9T 4DV6T 2F4VT 1XMOT 1HNZT 4LF5T 1XMQT 4NXNT 4B3MT 4LFCT 5LMUT 4LF6T 4B3TT 4LFBT 4YHHT 4DV2T 1HNXT 4KHPT 4LF7T 3T1HT 4JYAT 4DV1T 2UXCT 1N33T 4JI1T 1N36T 4DV5T 2UU9T 4AQYT 4GKJT 4JI3T 4X66T 1IBMT 4LFAT 1XNRT 1IBLT 4JI6T
chains in the Genus database with same CATH superfamily
2FJAA 2XQ4A 5LMNT 4HFVA 4COFA 4KBMB 1KNZA 3PTRB 3EVYA 2E9XB 3L8RA 3RGLA 4DNDA 4I4TE 4ZI2C 3E0ZA 1D0XA 3CMLA 2Q9QD 2DI4A 5L4EA 4L9IA 2CWYA 2VKHA 5IUXA 2CWOA 2V26A 3T1YT 2CE7A 3R6NA 5F3JA 4YSZA 3DJBA 4PK4A 4PJMA 4IT4A 4IREA 2VWAA 3AE8A 4KI0F 2D0UA 5FYMA 2WY2A 2K48A 3EABA 2EHOD 2W00A 5FL1A 2VASA 4H9QC 2XUEA 3JC6D 4BA9A 3PUXF 3F31A 3QUJA 5JR9C 4AQGA 4O4JE 1FIOA 3ZMUB 3CX8B 1U5PA 2PBIA 3AVRA 1BR0A 2BKPA 3P8CD 2HN2A 2J1DG 1N33T 2DWKA 4ZI2D 4DV5T 4PK5A 2YK0A 1V9DA 4ZOLE 1OWAA 2V6XA 1IBLT 2CXDA 3RKOA 5FVLA 4A97A 4UELA 2J4GA 3AA7B 4AQFC 1D0YA 2RPAA 1FEWA 3FZHB 3UQ7A 1FMVA 4GK5E 2HN1A 3RIUC 3MACA 4QH4A 1YKHB 1YKEB 1YW0A 5L3GB 3D0TA 4UV9B 2WB5A 4CI2B 3AE7A 4O2AE 5ABFA 5LJMA 2BVLA 2NTYA 1M62A 4B3ST 1AJ3A 2BG9B 3AEFA 5IWAT 4HEAA 2BS4A 3ZMTB 5EZYE 4YJ2E 5LG4A 2ES0A 4DUYT 1MMAA 3MXZA 3Q5XA 3P4QA 2NR4A 2WZIA 3H3MA 3N9QA 3QB5K 1N32T 5L47A 3CQXC 2LSKA 3NZQA 1HNWT 4X5TA 2QGSA 3O1JA 4UV8B 2XAQB 3DTOA 4B3RT 4I50E 2ZM6T 2X51A 3ONJA 4B6XA 3NRYA 4LF5T 2CCQA 5FXVA 1UX4A 2CBJA 2WU5A 3IA3A 3ZT6A 3W15B 3FZFB 4EV6A 5FY0A 2QVAA 3K3QC 4DV1T 5FXZA 4CXWA 5FY7A 3ZMZB 5JDHA 2A2FX 4HWCA 5HXCA 3ZMSB 4EGWA 5E0OA 4JI0T 3K3NA 4ZEYA 2DL1A 4Z8XA 3RQWA 2E5LT 3PV0F 1T98A 4UEMA 5L3EB 3UULA 5FL0A 1IAPA 2W62A 3PDYA 1JNZA 3LJCA 4EEBA 4YJ3E 4U7YA 2W63A 4MALA 3RYCE 3AEDA 1WRDA 5IYZE 2CHOA 2CXLA 2CLYB 3CIRA 3GMIA 4ASKA 3JADA 5HWXA 2M6BA 3AEBA 1KEYA 5HYAA 1HG5A 4X64T 4KMCA 4H9PC 1HX1B 2D0TA 3OKQA 3LBXA 1NWMX 1H7CA 2LLYA 2XY8B 1QLBA 4YHJA 1YQ4A 2LSYA 1OXZA 2KNDA 2Q9QA 3FB2A 3UFEA 4AKRB 2XSAA 5J1GA 5ABFB 2CPTA 3LSVA 3GN5A 3OYXA 1UGOA 2Z6EA 3UUNA 4QWNB 3CQGB 2XQ6A 3FZMB 3AECA 5J2UE 3RX6A 3JAEA 2EHOA 2X0HA 4EB6E 5ABHA 2ZM0A 3H3AA 1Y01A 1HCIA 4JI6T 5DQVA 3UQ4A 2YN6A 4A5XA 5DQWA 3SFDA 3KV9A 1X79A 5FXWA 2UUAT 1MIVA 3O1IA 5AQGB 3FBLA 5LCYA 2MBGA 3PUWF 4Z91A 4XAXB 2XQAA 4L0RA 1IZNB 4O8SA 3HKCE 5GONE 4NXMT 3UUXB 5AQKB 5EK4A 3NWIA 3N9LA 2UXXB 4I43B 2PJQA 1KNPA 1WYBA 2XASB 5BR8T 1IJ6A 2ZM8A 3TLTA 4X1KE 2NOXA 2RA1A 5LP6E 5LJNA 4UVAB 3R84B 2D2SA 3ZYKA 4GYSA 3CWZB 1HNZT 3ONLC 3I0OA 5JR9A 2XPKA 5HAXA 3ZKRA 2X68A 2DHRA 1ZKEA 4TWFA 4YTNA 4GOUA 1X9BA 2PTFA 2A9UA 3ZN1B 4HFIA 3I1AA 3Q5WA 2B1EA 4JEHB 4AQFA 4HE8A 4DBQA 4IDPA 3PUSA 1XWMA 3RIUA 3VU7H 3KVAA 1XDOA 5HEHA 3GN5B 2UXBT 4TNVA 4IDQA 2IUBA 4U2YA 1CHUA 4LMLA 4NUVA 1WR0A 3P4PA 2VVNA 1ZEEA 4M1PA 4U31A 3ZT7A 4DR4T 3AA1B 3AE5A 5L2LA 3JAFA 2MTQA 4EAHA 2Y8DA 3RIAA 5ADXL 1G8XA 2X9HA 4DR3T 1FJGT 1NEKA 4K0UA 3UU4A 1HR0T 4DV3T 4JI8T 4JEUB 3RH3A 3F2EA 3V5SA 4DIDB 2VL0A 3HKBE 4U33A 4IL9A 4ZI3C 3MA9A 4QH5A 3RYIE 2LSJA 2V7JA 1W09A 5CA0E 2W4XA 3FZLB 4ZS2A 1VCSA 3EDVA 1D0ZA 4CN4A 2N9DA 1IBMT 4FI5A 2WQYA 1Z8UA 3HKEE 2FJEA 5H6RB 3PUAA 2W61A 3NVOA 1WR6A 2LOSA 3PURA 1U4QA 4C91A 1HF8A 3LDQB 3O4XE 3WAJA 1T7SA 5FVKA 3Q5EA 4L5GA 1MNDA 2M6IA 3ZT5A 4AKGA 1MMNA 2ACZA 2DNXA 2HPJA 2OLTA 4TN7B 1Y64B 4YSYA 4DR2T 1ZP0A 3RYHE 1SUMB 4ZI3D 3IEEA 3ONXA 4QH1A 2YEVC 1ZV4X 1I94T 5FP3A 3ETUA 4JI5T 4E7SA 3CVRA 4EYUA 1MNEA 3ZYMA 2V7LA 5HXHA 4QX8B 1E1HB 2VL8A 3FXEB 3V5UA 4UR9A 2L9QA 2W2UA 5DABA 3FHNA 3AE2A 4PK6A 4JYAT 3ZMVB 5AQIB 3DP7A 4E7ZA 4U2ZA 5M4YA 1NAFA 3C51A 4J2CA 3AEEA 4P09A 3QNUA 4ADZA 5FMNA 2LRKA 4H9RC 3HA4A 1KK7A 2FJBA 4DV7T 3KBTA 3UU3A 1B7TA 2LRLA 2W0GA 2LE8A 4U7IA 4BAYB 1WFDA 1FMWA 1ZHCA 4HN9A 2NTXA 4EZHA 2WWVA 3AE3A 2CM0A 5HXEA 3A5XA 3EUHA 3K3OA 3PJAJ 5EK3A 3P4SA 2M67A 1CUNA 3P50A 2IC6A 4Z90A 3TLUA 2LKHA 3ESLA 5IHYA 2XAJB 3AAAB 1SHZC 2E2AA 2IMLA 5HCMA 4GK0E 2I59A 4QKNA 4O4LE 4HFCA 4ILAA 4AI6A 3KFWX 4PW8A 3CK6A 1XMQT 4CN6A 3FBZA 4HWDA 3C4XA 4CZZB 5CJ5A 1BR2A 2XZEA 3KBUA 1HS7A 4GKJT 4EOZB 4JI3T 5LHIB 5FNVE 5JDQA 2B76A 2XQYA 3CKDA 2V6YB 3PU8A 1VCTA 3UUBA 2BS3A 3KV4A 4ILCA 4ERRA 1OEDC 2I6HA 1KNRA 5EK2A 4HWHA 3ZCIA 3N9PA 4DVDA 3PU3A 3P7IA 4P1NA 3KVBA 4HTEA 2HHHT 4AIUA 2ZMAA 3PUVF 2X0YA 4AKHA 3N5LA 3N9NA 4XZCA 3ETVA 2J47A 4U72A 3GWHA 1OEDE 3IF8B 1HTJF 2C0SA 4C90A 3BQIA 4EEDA 2XHEB 3C98B 4TNWA 4H9OC 2ZM2A 2XAHB 4BJNA 3VR9A 2LT3A 4DUZT 2QA7A 3K1SA 2CA5A 3Q5DA 3PUGA 3VR8A 3UUMA 3VRBA 3UU5A 5L3BB 3U3IA 4NXNT 2DWGA 4LF6T 5C3JA 3PUQA 5JVDE 3MZKB 4TX5A 4LF7T 3T1HT 5HXRA 2BS2A 5HXSA 2X0LB 5DJQC 3OPCA 2JQQA 2X9YA 5AQHB 4IE7A 2BKOA 4ZZBA 2WWUA 3BK9A 4PFOA 2KWHA 1MIYA 4ZS3A 2JIWA 5LBQB 2LEHA 4IDOA 3TLSA 3SS1A 4DR5T 3AE4A 2JJ9A 3UU8A 4K0KT 1SE7A 4X20E 4XBFB 2VURA 5FY1A 1XNQT 2H89A 2YDRA 4U3CA 3QB5A 4JI2T 5LB7B 5HCJA 1N34T 2UUBT 2E8IA 2LSIA 3ABVA 4N78D 5CA1E 2VB6A 5L4HA 2LJLA 4QXCB 1O3XA 3U78A 4LF4T 2FJDA 3N2GE 4YTPA 3I9YA 1W0AA 4I0UA 5KX5E 4CXXA 4X1YE 5AQTB 5FXXA 1XMOT 4UIGA 2WU2A 4WW0A 2HPLA 1BR4A 3WI3A 2KSRA 3HI2A 4MFRA 5KDMC 2J62A 4WBOA 2YINA 2WM9A 1T72A 2JMHA 1R8IA 4PJLA 1D1CA 4H9SE 1YD8G 2V1DB 2NW7A 4IE4A 4JUYA 4TV9E 4QX7B 4AXPA 4DMWA 4TZ4C 4IE5A 3O9XA 2WMOA 4JBWF 5JQGE 3OBVE 2AE9A 2V5CA 3ZJ1A 2VVSA 2WZHA 4ISTA 4F8HA 2KZ7B 5LA6E 4ILUA 4Q25A 3AXJB 4YFSA 3ANWB 2KWIB 3J9X1 1NENA 4EZ4A 4HFEA 1YQ3A 3SWHA 2X9WA 3OYZA 3NKZA 5J2TE 1DU2A 2LHNA 4HFDA 4DBRA 3RLFF 2XM2A 4KP3C 3B5MA 1QUUA 5LXTE 1Z0PA 2JPFA 1S94A 2NP9A 5LBMA 4JI1T 4DMVA 2V7KA 4PFPA 1OEDA 5AQJB 1W9RA 2WBLA 3N9MA 4DR1T 3C4ZA 3ZC0A 1UUSA 5F8PA 4OX9T 4HFHA 3EAMA 1XZYA 2HH7A 2GK9A 2XQ8A 3N9OA 2NW9A 3T8OA 4CXYA 3SFEA 2CRBA 2XAGB 5FKYA 5ABGA 4HFBA 3TLVA 2BBHA 4EIWA 1I6ZA 3ZSTA 2XM1A 2LM2A 1YXRA 1US7B 5ABEA 2I0MA 4CQIA 5AFUL 4YY3T 2VQET 2Y6XA 2AXDS 2PFVA 4KHZF 2CMRA 3NZPA 3ZLIA 3C50A 4JI7T 4OYKA 2VQFT 3AA6B 2YDSA 2ODUA 4G63A 3AEAA 4JLEA 1S35A 3OTOT 2QRXA 3G06A 1MMGA 3JCFA 1UCUA 2LKGA 2G0UA 4ZXLA 4O2BE 1UX5A 2CEAA 2WAUA 1LRZA 2V6YA 5LHHB 4LFBT 3ZSSA 4DV2T 2YU1A 4KUMB 2SPCA 2XAFB 2CHNA 1JNRA 2H88A 4WYVA 4TWDA 3F57A 3UTKA 2X9XA 2YU2A 3LK2B 4TUYE 1LKXA 4DR7T 1HX8A 5L3DB 4HKAA 5J0ZA 2FBWA 5CFBA 5HWYA 2YDQA 5ETWA 2RP4A 2JRKA 3RIFA 5JDMA 4FJOA 1EZ3A 4DR6T 2JQ9A 4CN1A 4EXTA 2BVMA 2IHR1 5JDNA 4V1Av 3X1DA 5AQRB 2DCFA 3A7MA 3ZN0B 3UFGA 3UT5E 4YLHA 4A56A 2LOPA 4HGAA 1OEDB 1GQEA 1SA0E 4AISA 3B13A 4LMKA 2X66A 1IBKT 3AE1A 1WYCA 2MAWA 5C2TA 5HEOA 4HWIB 4UF0A 5CB4E 3C4WA 2ODVA 2MPKA 5H6QB 3TKLB 2E9XC 2OA5A 3EHZA 1WCRA 2OV9A 5LMUT 2K3WA 3RPUA 3QOFA 5TAOA 5JRCA 4WNKA 3RC3A 3EDUA 3RQUA 3E22E 3PUYF 2L8KA 4CI1B 2UU9T 3KV6A 2BZBA 1XNRT 3AB3B 2BKNA 2NWBA 3N2OA 4P0BA 2P9BA 3P4RA 1QSDA 1J5WA 5AQVB 5LGUB 4YXDA 4IL4A 4I55E 1IJ5A 3PUZF 1L0VA 4U74A 3MK7C 3Q2MA 4JI4T 5LGTB 2ZLYA 4X65T 3TLWA 5JREA 3KV5A 4X1IE 2E9XD 1WLXA 1E7PA 2K5BB 5HEUA 2YKSA 3BQLA 1J1JA 3AE6A 4PAGA 3LK42 2KMFA 4MBQA 4KX6A 1D1AA 4ILBA 1BR1A 5AQUB 5L3CB 2N2NA 3RI5A 4LF9T 1HFAA 3ZPOA 2V7MA 5JTGA 3ZEFB 4DV6T 4MHCA 2C5JA 2IDOB 5CGMA 4GIWA 4PJNA 3NBXX 2VKDA 4LFCT 3N2KE 2LSGA 4G2AA 2D9DA 2H7VC 1HG2A 2D5UA 3CQCB 4IIJE 2UXCT 2V7IA 3CX6B 3P4WA 2BG9C 2R6GF 3L39A 3AA0B 4O4IE 3AAEB 3MJXA 4UF0B 4X66T 2JQHA 5BMVE 4ISSA 2VKOA 3AEGA 4X62T 3RRCA 3NRXA 3L3PA 1UURA 3PJAA 4OYJA 4NIQA 3OJAA 2JMKA 4TWHA 5AQQB 2ACXA 2BG9E 5A1LA 4AKIA 2FUPA 2DLRA 4YSXA 1KF6A 3L09A 3LFMA 2IC9A 5JRCB 5HEJA 4GKKT 2WS3A 3RC8A 2KXPB 5KMGP 2XQ7A 3AVSA 1ZOYA 3AXJA 2NW8A 3IHRA 4NPPA 3ANWA 3O1HA 4YTMA 3Q9DA 2A72A 5HEGA 2YOEA 5LOVE 4TV8E 2WSSV 2JQKA 2X67A 5JH7E 4EYYR 2WDRA 5AQNB 4WZXA 4P0AA 4GYRA 1MMDA 2IAKA 2V8SV 4O4HE 5AQSB 2H7OA 2WP9A 3CPZA 2UXNB 5AQOB 2W66A 4KHPT 3M65A 5KXJA 2VKJA 2CLYC 5L3FB 4LFAT 3RHWA 3QC9A 3RRWA 3ZJ2A 2UXDT 4LMJA 3C64A 4NUUA 5JDFA 3ZCJA 2C5IT 2W67A 3UU6A 2K9AA 2XTLA 3RKGA 4JV5T 3FXDB 4MLKA 4HWFA 3E08A 2UUCT 1W0BA 3M3ZB 4DV0T 2KT9A 3AAIA 4A98A 4LF8T 2WCAA 5JDGA 5F5WA 4DV4T 3BQKA 4IDZA 4WBNE 2IIUA 3HL6A 2Y48B 2KLQA 2WDVA 1E2AA 5LYJE 3OVUA 5LHGB 3CX7B 1T8BA 3LBXB 2VK9A 4ZI7E 1KFYA 1LVFA 2XQ3A 2XSBA 2E9XA 2Q9QB 3EI0A 3I9WA 1M7KA 3K8PC 3ZYLA 4YT0A 4B3MT 3HR0A 5LNKA 3SOLA 2H3RA 1G73A 5LG3A 1HNXT 2CBIA 3J7Yq 4H9NC 1N36T 4F6RC 4H63V 2XQ5A 3I0QA 2C5KT 3KDSE 2BBJA 2E5VA 3KINB 5JDLA 4UVCB 3VKGA 3QK6A 1D1BA 4DO0A 3MKDA 2EHOB 2MYSA 4ZHQE 4AKLA 2WMNA 4IDNA 3VHLA 1LVKA 3LG7A 3VKHA 4QHOA 2MOZA 2LHRA 4OK0A 4IE6A 2XJ7A 3VRAA 5LGNB 2KINB 3AE9A 3PE0A 3IBPA 3LK3B 4PJJA 1UK5A 3RF1A 2CXFA 5AQLB 3HKDE 4UVBB 4QXHB 3H37A 2V5DA 1J5ET 4IGUA 3A8YC 4UXNB 4IHJE 2Q9QC 4PNIA 2LM9A 5AQMB 3SRZA 4ZZCA 2PG8A 4CI3B 2WDQA 2XQ9A 2BDEA 4QXBB 2QYWA 4OFZA 2F4VT 2IW5B 2L3LA 2N1GA 2A3DA 3WAKA 1MIWA 3S4UA 3FZKB 1VRBA 4H63H 4BJMA 4B3TT 4ANJA 4YHHT 2K24A 2BG9A 1XDPA 5C8YE 4AQYT 5AQPB 5JR9B 2EHOC 5AQFB 4OHFA 4IE0A 3B57A 3ZC1A 3RYFE 3GA8A 3JC6C 1VOMA
chains in the Genus database with same CATH topology
4DR7T 5LMNT 4JI0T 2E5LT 4DR1T 2UXDT 4X62T 4DR6T 4DV7T 4OX9T 2UUAT 2UXBT 2HHHT 4JV5T 4GKKT 2UUCT 4B3ST 5IWAT 4DV0T 4JI4T 4X65T 4DR5T 4LF8T 3T1YT 4K0KT 4DUYT 4NXMT 4X64T 4YY3T 2VQET 4DR2T 1XNQT 1IBKT 4DV4T 4DR4T 1N32T 4JI2T 1J5ET 5BR8T 1N34T 4DUZT 2UUBT 4JI7T 1HNWT 4DR3T 1FJGT 2VQFT 1I94T 1HR0T 4B3RT 4JI5T 4DV3T 4LF4T 2ZM6T 4JI8T 3OTOT 4LF9T 4DV6T 2F4VT 1XMOT 1HNZT 4LF5T 1XMQT 4NXNT 4B3MT 4LFCT 5LMUT 4LF6T 4B3TT 4LFBT 4YHHT 4DV2T 1HNXT 4KHPT 4LF7T 3T1HT 4JYAT 4DV1T 2UXCT 1N33T 4JI1T 1N36T 4DV5T 2UU9T 4AQYT 4GKJT 4JI3T 4X66T 1IBMT 4LFAT 1XNRT 1IBLT 4JI6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 T;  5LMN T;  4JI0 T;  2E5L T;  4DR1 T;  2UXD T;  4X62 T;  4DR6 T;  4DV7 T;  4OX9 T;  2UUA T;  2UXB T;  2HHH T;  4JV5 T;  4GKK T;  2UUC T;  4B3S T;  5IWA T;  4DV0 T;  4JI4 T;  4X65 T;  4DR5 T;  4LF8 T;  3T1Y T;  4K0K T;  4DUY T;  4NXM T;  4X64 T;  4YY3 T;  2VQE T;  4DR2 T;  1XNQ T;  1IBK T;  4DV4 T;  4DR4 T;  1N32 T;  4JI2 T;  1J5E T;  5BR8 T;  1N34 T;  4DUZ T;  2UUB T;  4JI7 T;  1HNW T;  4DR3 T;  1FJG T;  2VQF T;  1I94 T;  1HR0 T;  4B3R T;  4JI5 T;  4DV3 T;  4LF4 T;  2ZM6 T;  4JI8 T;  3OTO T;  4LF9 T;  4DV6 T;  2F4V T;  1XMO T;  1HNZ T;  4LF5 T;  1XMQ T;  4NXN T;  4B3M T;  4LFC T;  5LMU T;  4LF6 T;  4B3T T;  4LFB T;  4YHH T;  4DV2 T;  1HNX T;  4KHP T;  4LF7 T;  3T1H T;  4JYA T;  4DV1 T;  2UXC T;  1N33 T;  4JI1 T;  1N36 T;  4DV5 T;  2UU9 T;  4AQY T;  4GKJ T;  4JI3 T;  4X66 T;  1IBM T;  4LFA T;  1XNR T;  1IBL T;  4JI6 T; 
#chains in the Genus database with same CATH topology
 2FJA A;  2XQ4 A;  5LMN T;  4HFV A;  4COF A;  4KBM B;  1KNZ A;  3PTR B;  3EVY A;  2E9X B;  3L8R A;  3RGL A;  4DND A;  4I4T E;  4ZI2 C;  3E0Z A;  1D0X A;  3CML A;  2Q9Q D;  2DI4 A;  5L4E A;  4L9I A;  2CWY A;  2VKH A;  5IUX A;  2CWO A;  2V26 A;  3T1Y T;  2CE7 A;  3R6N A;  5F3J A;  4YSZ A;  3DJB A;  4PK4 A;  4PJM A;  4IT4 A;  4IRE A;  2VWA A;  3AE8 A;  4KI0 F;  2D0U A;  5FYM A;  2WY2 A;  2K48 A;  3EAB A;  2EHO D;  2W00 A;  5FL1 A;  2VAS A;  4H9Q C;  2XUE A;  3JC6 D;  4BA9 A;  3PUX F;  3F31 A;  3QUJ A;  5JR9 C;  4AQG A;  4O4J E;  1FIO A;  3ZMU B;  3CX8 B;  1U5P A;  2PBI A;  3AVR A;  1BR0 A;  2BKP A;  3P8C D;  2HN2 A;  2J1D G;  1N33 T;  2DWK A;  4ZI2 D;  4DV5 T;  4PK5 A;  2YK0 A;  1V9D A;  4ZOL E;  1OWA A;  2V6X A;  1IBL T;  2CXD A;  3RKO A;  5FVL A;  4A97 A;  4UEL A;  2J4G A;  3AA7 B;  4AQF C;  1D0Y A;  2RPA A;  1FEW A;  3FZH B;  3UQ7 A;  1FMV A;  4GK5 E;  2HN1 A;  3RIU C;  3MAC A;  4QH4 A;  1YKH B;  1YKE B;  1YW0 A;  5L3G B;  3D0T A;  4UV9 B;  2WB5 A;  4CI2 B;  3AE7 A;  4O2A E;  5ABF A;  5LJM A;  2BVL A;  2NTY A;  1M62 A;  4B3S T;  1AJ3 A;  2BG9 B;  3AEF A;  5IWA T;  4HEA A;  2BS4 A;  3ZMT B;  5EZY E;  4YJ2 E;  5LG4 A;  2ES0 A;  4DUY T;  1MMA A;  3MXZ A;  3Q5X A;  3P4Q A;  2NR4 A;  2WZI A;  3H3M A;  3N9Q A;  3QB5 K;  1N32 T;  5L47 A;  3CQX C;  2LSK A;  3NZQ A;  1HNW T;  4X5T A;  2QGS A;  3O1J A;  4UV8 B;  2XAQ B;  3DTO A;  4B3R T;  4I50 E;  2ZM6 T;  2X51 A;  3ONJ A;  4B6X A;  3NRY A;  4LF5 T;  2CCQ A;  5FXV A;  1UX4 A;  2CBJ A;  2WU5 A;  3IA3 A;  3ZT6 A;  3W15 B;  3FZF B;  4EV6 A;  5FY0 A;  2QVA A;  3K3Q C;  4DV1 T;  5FXZ A;  4CXW A;  5FY7 A;  3ZMZ B;  5JDH A;  2A2F X;  4HWC A;  5HXC A;  3ZMS B;  4EGW A;  5E0O A;  4JI0 T;  3K3N A;  4ZEY A;  2DL1 A;  4Z8X A;  3RQW A;  2E5L T;  3PV0 F;  1T98 A;  4UEM A;  5L3E B;  3UUL A;  5FL0 A;  1IAP A;  2W62 A;  3PDY A;  1JNZ A;  3LJC A;  4EEB A;  4YJ3 E;  4U7Y A;  2W63 A;  4MAL A;  3RYC E;  3AED A;  1WRD A;  5IYZ E;  2CHO A;  2CXL A;  2CLY B;  3CIR A;  3GMI A;  4ASK A;  3JAD A;  5HWX A;  2M6B A;  3AEB A;  1KEY A;  5HYA A;  1HG5 A;  4X64 T;  4KMC A;  4H9P C;  1HX1 B;  2D0T A;  3OKQ A;  3LBX A;  1NWM X;  1H7C A;  2LLY A;  2XY8 B;  1QLB A;  4YHJ A;  1YQ4 A;  2LSY A;  1OXZ A;  2KND A;  2Q9Q A;  3FB2 A;  3UFE A;  4AKR B;  2XSA A;  5J1G A;  5ABF B;  2CPT A;  3LSV A;  3GN5 A;  3OYX A;  1UGO A;  2Z6E A;  3UUN A;  4QWN B;  3CQG B;  2XQ6 A;  3FZM B;  3AEC A;  5J2U E;  3RX6 A;  3JAE A;  2EHO A;  2X0H A;  4EB6 E;  5ABH A;  2ZM0 A;  3H3A A;  1Y01 A;  1HCI A;  4JI6 T;  5DQV A;  3UQ4 A;  2YN6 A;  4A5X A;  5DQW A;  3SFD A;  3KV9 A;  1X79 A;  5FXW A;  2UUA T;  1MIV A;  3O1I A;  5AQG B;  3FBL A;  5LCY A;  2MBG A;  3PUW F;  4Z91 A;  4XAX B;  2XQA A;  4L0R A;  1IZN B;  4O8S A;  3HKC E;  5GON E;  4NXM T;  3UUX B;  5AQK B;  5EK4 A;  3NWI A;  3N9L A;  2UXX B;  4I43 B;  2PJQ A;  1KNP A;  1WYB A;  2XAS B;  5BR8 T;  1IJ6 A;  2ZM8 A;  3TLT A;  4X1K E;  2NOX A;  2RA1 A;  5LP6 E;  5LJN A;  4UVA B;  3R84 B;  2D2S A;  3ZYK A;  4GYS A;  3CWZ B;  1HNZ T;  3ONL C;  3I0O A;  5JR9 A;  2XPK A;  5HAX A;  3ZKR A;  2X68 A;  2DHR A;  1ZKE A;  4TWF A;  4YTN A;  4GOU A;  1X9B A;  2PTF A;  2A9U A;  3ZN1 B;  4HFI A;  3I1A A;  3Q5W A;  2B1E A;  4JEH B;  4AQF A;  4HE8 A;  4DBQ A;  4IDP A;  3PUS A;  1XWM A;  3RIU A;  3VU7 H;  3KVA A;  1XDO A;  5HEH A;  3GN5 B;  2UXB T;  4TNV A;  4IDQ A;  2IUB A;  4U2Y A;  1CHU A;  4LML A;  4NUV A;  1WR0 A;  3P4P A;  2VVN A;  1ZEE A;  4M1P A;  4U31 A;  3ZT7 A;  4DR4 T;  3AA1 B;  3AE5 A;  5L2L A;  3JAF A;  2MTQ A;  4EAH A;  2Y8D A;  3RIA A;  5ADX L;  1G8X A;  2X9H A;  4DR3 T;  1FJG T;  1NEK A;  4K0U A;  3UU4 A;  1HR0 T;  4DV3 T;  4JI8 T;  4JEU B;  3RH3 A;  3F2E A;  3V5S A;  4DID B;  2VL0 A;  3HKB E;  4U33 A;  4IL9 A;  4ZI3 C;  3MA9 A;  4QH5 A;  3RYI E;  2LSJ A;  2V7J A;  1W09 A;  5CA0 E;  2W4X A;  3FZL B;  4ZS2 A;  1VCS A;  3EDV A;  1D0Z A;  4CN4 A;  2N9D A;  1IBM T;  4FI5 A;  2WQY A;  1Z8U A;  3HKE E;  2FJE A;  5H6R B;  3PUA A;  2W61 A;  3NVO A;  1WR6 A;  2LOS A;  3PUR A;  1U4Q A;  4C91 A;  1HF8 A;  3LDQ B;  3O4X E;  3WAJ A;  1T7S A;  5FVK A;  3Q5E A;  4L5G A;  1MND A;  2M6I A;  3ZT5 A;  4AKG A;  1MMN A;  2ACZ A;  2DNX A;  2HPJ A;  2OLT A;  4TN7 B;  1Y64 B;  4YSY A;  4DR2 T;  1ZP0 A;  3RYH E;  1SUM B;  4ZI3 D;  3IEE A;  3ONX A;  4QH1 A;  2YEV C;  1ZV4 X;  1I94 T;  5FP3 A;  3ETU A;  4JI5 T;  4E7S A;  3CVR A;  4EYU A;  1MNE A;  3ZYM A;  2V7L A;  5HXH A;  4QX8 B;  1E1H B;  2VL8 A;  3FXE B;  3V5U A;  4UR9 A;  2L9Q A;  2W2U A;  5DAB A;  3FHN A;  3AE2 A;  4PK6 A;  4JYA T;  3ZMV B;  5AQI B;  3DP7 A;  4E7Z A;  4U2Z A;  5M4Y A;  1NAF A;  3C51 A;  4J2C A;  3AEE A;  4P09 A;  3QNU A;  4ADZ A;  5FMN A;  2LRK A;  4H9R C;  3HA4 A;  1KK7 A;  2FJB A;  4DV7 T;  3KBT A;  3UU3 A;  1B7T A;  2LRL A;  2W0G A;  2LE8 A;  4U7I A;  4BAY B;  1WFD A;  1FMW A;  1ZHC A;  4HN9 A;  2NTX A;  4EZH A;  2WWV A;  3AE3 A;  2CM0 A;  5HXE A;  3A5X A;  3EUH A;  3K3O A;  3PJA J;  5EK3 A;  3P4S A;  2M67 A;  1CUN A;  3P50 A;  2IC6 A;  4Z90 A;  3TLU A;  2LKH A;  3ESL A;  5IHY A;  2XAJ B;  3AAA B;  1SHZ C;  2E2A A;  2IML A;  5HCM A;  4GK0 E;  2I59 A;  4QKN A;  4O4L E;  4HFC A;  4ILA A;  4AI6 A;  3KFW X;  4PW8 A;  3CK6 A;  1XMQ T;  4CN6 A;  3FBZ A;  4HWD A;  3C4X A;  4CZZ B;  5CJ5 A;  1BR2 A;  2XZE A;  3KBU A;  1HS7 A;  4GKJ T;  4EOZ B;  4JI3 T;  5LHI B;  5FNV E;  5JDQ A;  2B76 A;  2XQY A;  3CKD A;  2V6Y B;  3PU8 A;  1VCT A;  3UUB A;  2BS3 A;  3KV4 A;  4ILC A;  4ERR A;  1OED C;  2I6H A;  1KNR A;  5EK2 A;  4HWH A;  3ZCI A;  3N9P A;  4DVD A;  3PU3 A;  3P7I A;  4P1N A;  3KVB A;  4HTE A;  2HHH T;  4AIU A;  2ZMA A;  3PUV F;  2X0Y A;  4AKH A;  3N5L A;  3N9N A;  4XZC A;  3ETV A;  2J47 A;  4U72 A;  3GWH A;  1OED E;  3IF8 B;  1HTJ F;  2C0S A;  4C90 A;  3BQI A;  4EED A;  2XHE B;  3C98 B;  4TNW A;  4H9O C;  2ZM2 A;  2XAH B;  4BJN A;  3VR9 A;  2LT3 A;  4DUZ T;  2QA7 A;  3K1S A;  2CA5 A;  3Q5D A;  3PUG A;  3VR8 A;  3UUM A;  3VRB A;  3UU5 A;  5L3B B;  3U3I A;  4NXN T;  2DWG A;  4LF6 T;  5C3J A;  3PUQ A;  5JVD E;  3MZK B;  4TX5 A;  4LF7 T;  3T1H T;  5HXR A;  2BS2 A;  5HXS A;  2X0L B;  5DJQ C;  3OPC A;  2JQQ A;  2X9Y A;  5AQH B;  4IE7 A;  2BKO A;  4ZZB A;  2WWU A;  3BK9 A;  4PFO A;  2KWH A;  1MIY A;  4ZS3 A;  2JIW A;  5LBQ B;  2LEH A;  4IDO A;  3TLS A;  3SS1 A;  4DR5 T;  3AE4 A;  2JJ9 A;  3UU8 A;  4K0K T;  1SE7 A;  4X20 E;  4XBF B;  2VUR A;  5FY1 A;  1XNQ T;  2H89 A;  2YDR A;  4U3C A;  3QB5 A;  4JI2 T;  5LB7 B;  5HCJ A;  1N34 T;  2UUB T;  2E8I A;  2LSI A;  3ABV A;  4N78 D;  5CA1 E;  2VB6 A;  5L4H A;  2LJL A;  4QXC B;  1O3X A;  3U78 A;  4LF4 T;  2FJD A;  3N2G E;  4YTP A;  3I9Y A;  1W0A A;  4I0U A;  5KX5 E;  4CXX A;  4X1Y E;  5AQT B;  5FXX A;  1XMO T;  4UIG A;  2WU2 A;  4WW0 A;  2HPL A;  1BR4 A;  3WI3 A;  2KSR A;  3HI2 A;  4MFR A;  5KDM C;  2J62 A;  4WBO A;  2YIN A;  2WM9 A;  1T72 A;  2JMH A;  1R8I A;  4PJL A;  1D1C A;  4H9S E;  1YD8 G;  2V1D B;  2NW7 A;  4IE4 A;  4JUY A;  4TV9 E;  4QX7 B;  4AXP A;  4DMW A;  4TZ4 C;  4IE5 A;  3O9X A;  2WMO A;  4JBW F;  5JQG E;  3OBV E;  2AE9 A;  2V5C A;  3ZJ1 A;  2VVS A;  2WZH A;  4IST A;  4F8H A;  2KZ7 B;  5LA6 E;  4ILU A;  4Q25 A;  3AXJ B;  4YFS A;  3ANW B;  2KWI B;  3J9X 1;  1NEN A;  4EZ4 A;  4HFE A;  1YQ3 A;  3SWH A;  2X9W A;  3OYZ A;  3NKZ A;  5J2T E;  1DU2 A;  2LHN A;  4HFD A;  4DBR A;  3RLF F;  2XM2 A;  4KP3 C;  3B5M A;  1QUU A;  5LXT E;  1Z0P A;  2JPF A;  1S94 A;  2NP9 A;  5LBM A;  4JI1 T;  4DMV A;  2V7K A;  4PFP A;  1OED A;  5AQJ B;  1W9R A;  2WBL A;  3N9M A;  4DR1 T;  3C4Z A;  3ZC0 A;  1UUS A;  5F8P A;  4OX9 T;  4HFH A;  3EAM A;  1XZY A;  2HH7 A;  2GK9 A;  2XQ8 A;  3N9O A;  2NW9 A;  3T8O A;  4CXY A;  3SFE A;  2CRB A;  2XAG B;  5FKY A;  5ABG A;  4HFB A;  3TLV A;  2BBH A;  4EIW A;  1I6Z A;  3ZST A;  2XM1 A;  2LM2 A;  1YXR A;  1US7 B;  5ABE A;  2I0M A;  4CQI A;  5AFU L;  4YY3 T;  2VQE T;  2Y6X A;  2AXD S;  2PFV A;  4KHZ F;  2CMR A;  3NZP A;  3ZLI A;  3C50 A;  4JI7 T;  4OYK A;  2VQF T;  3AA6 B;  2YDS A;  2ODU A;  4G63 A;  3AEA A;  4JLE A;  1S35 A;  3OTO T;  2QRX A;  3G06 A;  1MMG A;  3JCF A;  1UCU A;  2LKG A;  2G0U A;  4ZXL A;  4O2B E;  1UX5 A;  2CEA A;  2WAU A;  1LRZ A;  2V6Y A;  5LHH B;  4LFB T;  3ZSS A;  4DV2 T;  2YU1 A;  4KUM B;  2SPC A;  2XAF B;  2CHN A;  1JNR A;  2H88 A;  4WYV A;  4TWD A;  3F57 A;  3UTK A;  2X9X A;  2YU2 A;  3LK2 B;  4TUY E;  1LKX A;  4DR7 T;  1HX8 A;  5L3D B;  4HKA A;  5J0Z A;  2FBW A;  5CFB A;  5HWY A;  2YDQ A;  5ETW A;  2RP4 A;  2JRK A;  3RIF A;  5JDM A;  4FJO A;  1EZ3 A;  4DR6 T;  2JQ9 A;  4CN1 A;  4EXT A;  2BVM A;  2IHR 1;  5JDN A;  4V1A v;  3X1D A;  5AQR B;  2DCF A;  3A7M A;  3ZN0 B;  3UFG A;  3UT5 E;  4YLH A;  4A56 A;  2LOP A;  4HGA A;  1OED B;  1GQE A;  1SA0 E;  4AIS A;  3B13 A;  4LMK A;  2X66 A;  1IBK T;  3AE1 A;  1WYC A;  2MAW A;  5C2T A;  5HEO A;  4HWI B;  4UF0 A;  5CB4 E;  3C4W A;  2ODV A;  2MPK A;  5H6Q B;  3TKL B;  2E9X C;  2OA5 A;  3EHZ A;  1WCR A;  2OV9 A;  5LMU T;  2K3W A;  3RPU A;  3QOF A;  5TAO A;  5JRC A;  4WNK A;  3RC3 A;  3EDU A;  3RQU A;  3E22 E;  3PUY F;  2L8K A;  4CI1 B;  2UU9 T;  3KV6 A;  2BZB A;  1XNR T;  3AB3 B;  2BKN A;  2NWB A;  3N2O A;  4P0B A;  2P9B A;  3P4R A;  1QSD A;  1J5W A;  5AQV B;  5LGU B;  4YXD A;  4IL4 A;  4I55 E;  1IJ5 A;  3PUZ F;  1L0V A;  4U74 A;  3MK7 C;  3Q2M A;  4JI4 T;  5LGT B;  2ZLY A;  4X65 T;  3TLW A;  5JRE A;  3KV5 A;  4X1I E;  2E9X D;  1WLX A;  1E7P A;  2K5B B;  5HEU A;  2YKS A;  3BQL A;  1J1J A;  3AE6 A;  4PAG A;  3LK4 2;  2KMF A;  4MBQ A;  4KX6 A;  1D1A A;  4ILB A;  1BR1 A;  5AQU B;  5L3C B;  2N2N A;  3RI5 A;  4LF9 T;  1HFA A;  3ZPO A;  2V7M A;  5JTG A;  3ZEF B;  4DV6 T;  4MHC A;  2C5J A;  2IDO B;  5CGM A;  4GIW A;  4PJN A;  3NBX X;  2VKD A;  4LFC T;  3N2K E;  2LSG A;  4G2A A;  2D9D A;  2H7V C;  1HG2 A;  2D5U A;  3CQC B;  4IIJ E;  2UXC T;  2V7I A;  3CX6 B;  3P4W A;  2BG9 C;  2R6G F;  3L39 A;  3AA0 B;  4O4I E;  3AAE B;  3MJX A;  4UF0 B;  4X66 T;  2JQH A;  5BMV E;  4ISS A;  2VKO A;  3AEG A;  4X62 T;  3RRC A;  3NRX A;  3L3P A;  1UUR A;  3PJA A;  4OYJ A;  4NIQ A;  3OJA A;  2JMK A;  4TWH A;  5AQQ B;  2ACX A;  2BG9 E;  5A1L A;  4AKI A;  2FUP A;  2DLR A;  4YSX A;  1KF6 A;  3L09 A;  3LFM A;  2IC9 A;  5JRC B;  5HEJ A;  4GKK T;  2WS3 A;  3RC8 A;  2KXP B;  5KMG P;  2XQ7 A;  3AVS A;  1ZOY A;  3AXJ A;  2NW8 A;  3IHR A;  4NPP A;  3ANW A;  3O1H A;  4YTM A;  3Q9D A;  2A72 A;  5HEG A;  2YOE A;  5LOV E;  4TV8 E;  2WSS V;  2JQK A;  2X67 A;  5JH7 E;  4EYY R;  2WDR A;  5AQN B;  4WZX A;  4P0A A;  4GYR A;  1MMD A;  2IAK A;  2V8S V;  4O4H E;  5AQS B;  2H7O A;  2WP9 A;  3CPZ A;  2UXN B;  5AQO B;  2W66 A;  4KHP T;  3M65 A;  5KXJ A;  2VKJ A;  2CLY C;  5L3F B;  4LFA T;  3RHW A;  3QC9 A;  3RRW A;  3ZJ2 A;  2UXD T;  4LMJ A;  3C64 A;  4NUU A;  5JDF A;  3ZCJ A;  2C5I T;  2W67 A;  3UU6 A;  2K9A A;  2XTL A;  3RKG A;  4JV5 T;  3FXD B;  4MLK A;  4HWF A;  3E08 A;  2UUC T;  1W0B A;  3M3Z B;  4DV0 T;  2KT9 A;  3AAI A;  4A98 A;  4LF8 T;  2WCA A;  5JDG A;  5F5W A;  4DV4 T;  3BQK A;  4IDZ A;  4WBN E;  2IIU A;  3HL6 A;  2Y48 B;  2KLQ A;  2WDV A;  1E2A A;  5LYJ E;  3OVU A;  5LHG B;  3CX7 B;  1T8B A;  3LBX B;  2VK9 A;  4ZI7 E;  1KFY A;  1LVF A;  2XQ3 A;  2XSB A;  2E9X A;  2Q9Q B;  3EI0 A;  3I9W A;  1M7K A;  3K8P C;  3ZYL A;  4YT0 A;  4B3M T;  3HR0 A;  5LNK A;  3SOL A;  2H3R A;  1G73 A;  5LG3 A;  1HNX T;  2CBI A;  3J7Y q;  4H9N C;  1N36 T;  4F6R C;  4H63 V;  2XQ5 A;  3I0Q A;  2C5K T;  3KDS E;  2BBJ A;  2E5V A;  3KIN B;  5JDL A;  4UVC B;  3VKG A;  3QK6 A;  1D1B A;  4DO0 A;  3MKD A;  2EHO B;  2MYS A;  4ZHQ E;  4AKL A;  2WMN A;  4IDN A;  3VHL A;  1LVK A;  3LG7 A;  3VKH A;  4QHO A;  2MOZ A;  2LHR A;  4OK0 A;  4IE6 A;  2XJ7 A;  3VRA A;  5LGN B;  2KIN B;  3AE9 A;  3PE0 A;  3IBP A;  3LK3 B;  4PJJ A;  1UK5 A;  3RF1 A;  2CXF A;  5AQL B;  3HKD E;  4UVB B;  4QXH B;  3H37 A;  2V5D A;  1J5E T;  4IGU A;  3A8Y C;  4UXN B;  4IHJ E;  2Q9Q C;  4PNI A;  2LM9 A;  5AQM B;  3SRZ A;  4ZZC A;  2PG8 A;  4CI3 B;  2WDQ A;  2XQ9 A;  2BDE A;  4QXB B;  2QYW A;  4OFZ A;  2F4V T;  2IW5 B;  2L3L A;  2N1G A;  2A3D A;  3WAK A;  1MIW A;  3S4U A;  3FZK B;  1VRB A;  4H63 H;  4BJM A;  4B3T T;  4ANJ A;  4YHH T;  2K24 A;  2BG9 A;  1XDP A;  5C8Y E;  4AQY T;  5AQP B;  5JR9 B;  2EHO C;  5AQF B;  4OHF A;  4IE0 A;  3B57 A;  3ZC1 A;  3RYF E;  3GA8 A;  3JC6 C;  1VOM A; 
#chains in the Genus database with same CATH homology
 4DR7 T;  5LMN T;  4JI0 T;  2E5L T;  4DR1 T;  2UXD T;  4X62 T;  4DR6 T;  4DV7 T;  4OX9 T;  2UUA T;  2UXB T;  2HHH T;  4JV5 T;  4GKK T;  2UUC T;  4B3S T;  5IWA T;  4DV0 T;  4JI4 T;  4X65 T;  4DR5 T;  4LF8 T;  3T1Y T;  4K0K T;  4DUY T;  4NXM T;  4X64 T;  4YY3 T;  2VQE T;  4DR2 T;  1XNQ T;  1IBK T;  4DV4 T;  4DR4 T;  1N32 T;  4JI2 T;  1J5E T;  5BR8 T;  1N34 T;  4DUZ T;  2UUB T;  4JI7 T;  1HNW T;  4DR3 T;  1FJG T;  2VQF T;  1I94 T;  1HR0 T;  4B3R T;  4JI5 T;  4DV3 T;  4LF4 T;  2ZM6 T;  4JI8 T;  3OTO T;  4LF9 T;  4DV6 T;  2F4V T;  1XMO T;  1HNZ T;  4LF5 T;  1XMQ T;  4NXN T;  4B3M T;  4LFC T;  5LMU T;  4LF6 T;  4B3T T;  4LFB T;  4YHH T;  4DV2 T;  1HNX T;  4KHP T;  4LF7 T;  3T1H T;  4JYA T;  4DV1 T;  2UXC T;  1N33 T;  4JI1 T;  1N36 T;  4DV5 T;  2UU9 T;  4AQY T;  4GKJ T;  4JI3 T;  4X66 T;  1IBM T;  4LFA T;  1XNR T;  1IBL T;  4JI6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...