1IBMT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibmT00
2E5LT 2UUCT 4JI0T 1N32T 4JYAT 4AQYT 4LF4T 4DR3T 4B3RT 5BR8T 4JI4T 1XMOT 1IBKT 1XNRT 4JI5T 1N33T 4LF9T 4DV2T 1HNWT 4GKJT 4NXMT 1IBMT 4DR7T 1HNXT 4DV5T 4JI7T 4DV0T 4YHHT 4DR5T 4LFAT 1I94T 4JI2T 1XNQT 4LFBT 4B3TT 4LF7T 4DV4T 4DV3T 4DUYT 4DR6T 4DR1T 1HR0T 4B3MT 2ZM6T 4X62T 3OTOT 5IWAT 4DV1T 2UUBT 2F4VT 4B3ST 4DV6T 1IBLT 4GKKT 4DR4T 4LF8T 2UUAT 1FJGT 4X64T 4DUZT 1N36T 2VQET 4YY3T 4NXNT 2UXDT 4X66T 2UXBT 5LMNT 3T1YT 4K0KT 4JI8T 4JI3T 4LF6T 2UXCT 4DV7T 2UU9T 4KHPT 1J5ET 4JV5T 4OX9T 4X65T 5LMUT 1N34T 2VQFT 1XMQT 4LFCT 3T1HT 1HNZT 4JI6T 4DR2T 4JI1T 2HHHT 4LF5T
chains in the Genus database with same CATH superfamily
4UELA 2WU2A 3TLSA 1XZYA 1H7CA 2YINA 4B3RT 2WU5A 3VKGA 1IJ5A 2WMNA 2M67A 4Z90A 3I0OA 4WYVA 5AQIB 4PK6A 5LBMA 1SE7A 1HNWT 3QB5K 2Q9QC 1S94A 3UQ4A 4AISA 2CLYB 4HFEA 5EK4A 4DV0T 5FL0A 4U33A 4U3CA 3KV4A 1XNQT 4ZZBA 2KT9A 3Q2MA 3H3AA 1UGOA 3ZN1B 2XAQB 3EAMA 5LG4A 3CPZA 2FJBA 4IT4A 2K48A 1G73A 2CMRA 3N9MA 2A3DA 3ZKRA 2XQ5A 5HEJA 3I9YA 2UXDT 3FBLA 4JUYA 3D0TA 3P50A 4IDQA 2NOXA 2N1GA 4BAYB 5JVDE 3PTRB 4ZZCA 2I0MA 2YEVC 2NTYA 2ES0A 2VQFT 2VL0A 2CXDA 4O8SA 1UX5A 1XDOA 5HXRA 1T7SA 2LRKA 3ZYLA 5ETWA 4BA9A 2BG9A 4U74A 5J2UE 5FVLA 2N9DA 1MIWA 4CN4A 3NKZA 2BVMA 3RIFA 1G8XA 4HFCA 2D9DA 4TX5A 4EV6A 5L3BB 3UU4A 4AI6A 5JDMA 5LP6E 4AKIA 3Q9DA 5LHHB 1T72A 2XSAA 3QK6A 1WCRA 4L0RA 5EK2A 3VKHA 4L5GA 3RH3A 3OVUA 3QC9A 1LVKA 2W61A 3IHRA 3RC3A 5AQHB 3CX6B 5J2TE 3S4UA 4EXTA 4DIDB 3AE8A 4C91A 3TLWA 1D1BA 3OKQA 3I0QA 3AEEA 4HWHA 4LMKA 3QB5A 4X65T 5AQRB 3KVAA 1LRZA 4TV8E 3N2GE 4CXXA 4JI0T 2K9AA 3SOLA 4NUVA 1HX8A 3DTOA 2MPKA 2XQ9A 2Y6XA 2ACXA 3NWIA 3ZCIA 5ABGA 2DI4A 3AE3A 3SFDA 3WI3A 1OEDC 1D0ZA 2GK9A 3V5UA 1HS7A 3MK7C 1W0BA 3FZKB 3RQWA 4CN1A 2VASA 1WLXA 4B3TT 4A97A 1NEKA 1D1AA 4I43B 4X62T 2H88A 2CBIA 5LG3A 3N9PA 2XZEA 4EYUA 4NPPA 3C98B 3SFEA 3ZT7A 3LG7A 4U7IA 4YY3T 3JAEA 2P9BA 4JEUB 1YD8G 4HKAA 2W67A 4ILBA 1MIVA 2NW9A 1VRBA 2KXPB 2JMKA 1KFYA 4O4HE 2LT3A 4A56A 5CGMA 4ILCA 1FMVA 4EEBA 3ZSTA 3AB3B 3RF1A 2PJQA 3A8YC 3AEGA 5LHIB 2IMLA 2JQQA 3AE6A 2KSRA 2IHR1 2L3LA 3PUQA 4FJOA 3O1HA 3M65A 3NZQA 3UU3A 2W2UA 4QX7B 2UXXB 3AAEB 2WZIA 1VCTA 1SUMB 2XTLA 3J9X1 3RLFF 3R6NA 3EUHA 1Z8UA 5LGUB 3PUVF 3ZC0A 3CK6A 5M4YA 2CPTA 3KV6A 1YKHB 4YTMA 5H6QB 3SWHA 3OBVE 2CXLA 5FL1A 5HXEA 3AEFA 5AFUL 4LFAT 3B13A 4UV9B 3I9WA 4P09A 3PU8A 2Y48B 3H3MA 2MBGA 5L3FB 1WRDA 2JIWA 2E2AA 4AKLA 1R8IA 5JTGA 4QH4A 2L9QA 3UU8A 3RC8A 4GKKT 3NRXA 3BQKA 2DWGA 3VHLA 1D0XA 5F8PA 5LMNT 3Q5EA 2LJLA 5HYAA 1ZP0A 2ACZA 1OWAA 2OV9A 2VKJA 1E1HB 2X51A 1E7PA 3C4ZA 2RA1A 1W9RA 4X20E 1US7B 5A1LA 4NIQA 2LSGA 1E2AA 2V8SV 1UX4A 5JH7E 3LBXA 4IE7A 5LCYA 2Q9QB 3BK9A 3CX7B 2CHNA 2WQYA 5LYJE 4BJNA 3RI5A 2BG9C 2YDSA 2NP9A 2BKNA 2XSBA 2WZHA 4ZEYA 2XUEA 3ZT5A 4CXWA 1Y64B 5L2LA 2WDVA 2LM2A 3LK42 5AQKB 2D2SA 3RKGA 4DV3T 2WS3A 2CCQA 2XQ3A 3HKBE 3ANWA 5IWAT 3RX6A 1ZHCA 2UUBT 2WM9A 4I50E 4HGAA 3V5SA 1WFDA 1WYBA 4HWDA 3DJBA 3VRBA 2XAJB 4AKHA 5DJQC 3Q5XA 4QXHB 2E9XA 5KX5E 4TZ4C 2V7JA 3AE1A 1HFAA 2ZM0A 2JMHA 4EYYR 3ZYKA 3PUGA 2QYWA 3UU5A 4ISTA 4LF6T 3ETUA 2DWKA 4DV7T 1EZ3A 2CA5A 1MMDA 2A72A 4P1NA 2W4XA 2JJ9A 1CUNA 4C90A 4AKGA 3X1DA 1UURA 2HHHT 2HPLA 3FZMB 3AXJA 1X79A 3H37A 2AXDS 3ZJ1A 1N32T 4H9QC 4IGUA 2BBJA 4KHZF 5AQJB 5BR8T 4DR3T 1MNEA 2V7MA 2FJAA 5AQGB 1HG5A 3ONXA 1N33T 5C2TA 4HFDA 2D5UA 4J2CA 2G0UA 4X1YE 5F3JA 1HNXT 4ZHQE 4YTNA 1FIOA 2QA7A 4YHHT 5ABFB 3HKDE 4UF0B 2FJDA 3UUXB 3EDUA 3PJAJ 2JQKA 2I59A 3WAKA 3PV0F 3SRZA 3ZLIA 4KP3C 2MOZA 4PK4A 5L3DB 2D0TA 3MACA 2J1DG 4O4JE 3HKCE 4E7SA 4AQFA 4IE5A 1N36T 3AVRA 1QLBA 5HWXA 5IUXA 3FZFB 3VU7H 2UXBT 4PAGA 1UCUA 5CA0E 3T1YT 4CI3B 2A2FX 4HWIB 4EOZB 4KHPT 1UK5A 4CXYA 3ONJA 3OPCA 4UVAB 1N34T 4QX8B 3RRCA 2ZM2A 4UV8B 2K24A 4ADZA 3QUJA 5AQFB 3UUMA 1HTJF 3ONLC 3Q5DA 4TNVA 3ZMUB 1KNPA 5HEHA 5HCJA 2ZLYA 1KK7A 1OEDB 4U2ZA 3GN5A 1D1CA 3PUSA 1YQ3A 1IAPA 3K8PC 2OLTA 4QKNA 1X9BA 2JPFA 2YN6A 4DV5T 3P8CD 3UQ7A 4HWCA 1JNZA 2LHRA 2NW8A 4DV4T 3IA3A 5HXHA 2Y8DA 4CI1B 2VURA 3HA4A 5JRCB 2VVSA 4H9OC 3HR0A 2I6HA 1SHZC 1I6ZA 4PNIA 4PW8A 5AQVB 3ZMVB 3SS1A 5CJ5A 3K3OA 1ZEEA 4ERRA 2VL8A 1QSDA 3Q5WA 1VCSA 2LOPA 3RYFE 4OK0A 3EI0A 2YDQA 2RPAA 4V1Av 2C5IT 2CWYA 2XPKA 4JV5T 4U72A 3R84B 4ASKA 3WAJA 2YKSA 3AAAB 2VKOA 3NRYA 3RIUC 1YW0A 3AA7B 2WAUA 1Y01A 4PJMA 4YSZA 3VR9A 4LF4T 2VVNA 4IL4A 2DCFA 3C51A 2PG8A 4JI5T 4LF9T 3G06A 1Z0PA 5HCMA 2WBLA 3K3NA 2WP9A 5JDNA 3E08A 1J1JA 2EHOA 2IW5B 3LSVA 4I4TE 3B5MA 1I94T 3ZCJA 1MIYA 4IDZA 2X9HA 5FXWA 4HFVA 3FHNA 3EVYA 3K3QC 4DR1T 4ZS2A 2CEAA 1OEDE 2M6IA 2V6YA 5CFBA 4B6XA 4ZOLE 5LJNA 4XZCA 4WBOA 3O1JA 2E9XC 3CVRA 3NZPA 2VQET 2Z6EA 2XY8B 2WWVA 1WR6A 2ZM8A 5AQPB 5FY0A 4JI8T 2UXCT 3T8OA 3NVOA 4O2BE 4O4IE 3UULA 5AQOB 3DP7A 3OYZA 2H7OA 4IHJE 3GWHA 2X67A 3P4RA 4JI1T 2BG9B 2MYSA 5FYMA 2LHNA 1BR2A 3CIRA 2CE7A 4HTEA 2X9XA 3J7Yq 2HN2A 2V26A 4JBWF 3FZHB 2W66A 1XMOT 1HX1B 2W0GA 3AEDA 4IL9A 4TWHA 5FMNA 4MBQA 5F5WA 4YTPA 4NXMT 3O1IA 3F31A 4HWFA 5DQVA 5EZYE 3N9OA 2FJEA 4JI7T 5JDLA 3ZMSB 2BS4A 3RQUA 1M7KA 5JR9A 1T8BA 5H6RB 2DHRA 3P4SA 3JC6D 1W09A 1AJ3A 5LNKA 3FXEB 2LKHA 3KV5A 2KLQA 5JDFA 2HH7A 4DV6T 1OXZA 3AE7A 2HPJA 2E5VA 4QXCB 4X1IE 4H63H 2LSYA 4NXNT 4DNDA 5L3CB 5JDGA 4UEMA 5JDQA 2BKPA 3PURA 1D0YA 2EHOD 4JI3T 1KNRA 4EB6E 4G63A 3KBUA 4A98A 3CQGB 3AEAA 3LJCA 5AQSB 1LKXA 1UUSA 4YJ2E 3RRWA 1M62A 4JI6T 4DR2T 1HG2A 5CA1E 1SA0E 4EGWA 2IAKA 4L9IA 4NUUA 5DQWA 5EK3A 4GK0E 5LBQB 3ZEFB 5AQQB 2C5JA 2KWHA 4K0UA 4GKJT 2PFVA 3EHZA 2V6XA 5J1GA 4EEDA 3HL6A 2C5KT 2IIUA 3N9QA 2PTFA 3AE4A 3A7MA 2BG9E 1HF8A 4ZXLA 1FEWA 4JI2T 3C4XA 4LF7T 2W00A 4EAHA 4BJMA 4EZHA 4B3MT 1BR0A 1VOMA 3QNUA 3QOFA 2F4VT 1O3XA 3FXDB 1T98A 4LMJA 3UUBA 2BS3A 3JADA 3OJAA 2UUAT 2AE9A 5LOVE 1QUUA 5FXZA 2MAWA 3PU3A 2ODUA 4QH5A 5HWYA 3LDQB 4Z91A 1CHUA 5LHGB 4HFIA 4UVBB 4EIWA 4P0AA 1MMAA 1V9DA 3T1HT 2IUBA 4UVCB 3MJXA 4KMCA 4H9PC 3RYHE 2NW7A 3JC6C 2IDOB 4X1KE 2V7IA 1ZV4X 4YFSA 3C64A 5FNVE 3IF8B 1XNRT 4MFRA 4PK5A 3C4WA 4ZI3D 3W15B 1MMGA 4X5TA 5AQMB 4DR7T 4YSXA 3TKLB 2JRKA 2EHOC 5AQLB 2XHEB 4DR5T 3PUYF 3RYCE 4I0UA 1S35A 2XJ7A 4JEHB 4LFBT 2XASB 3BQLA 5J0ZA 5AQTB 4I55E 3KV9A 1HR0T 2KMFA 4Z8XA 4OFZA 3N9NA 5FP3A 5KMGP 2SPCA 2YOEA 5JQGE 1ZKEA 3P4QA 2V7LA 4DO0A 5L3EB 2M6BA 4IDOA 2LE8A 2CHOA 2V5CA 4K0KT 3GMIA 4HE8A 3RHWA 2J47A 2CWOA 2UU9T 3E22E 3LBXB 5LJMA 3EDVA 4OX9T 5L47A 2XAHB 4PJJA 2OA5A 3LK3B 3N2KE 3UT5E 4YT0A 2QVAA 3RKOA 1B7TA 2WSSV 5LA6E 2X0LB 4AQYT 2NR4A 4DBQA 2LKGA 3AVSA 2LSKA 5KXJA 4IE0A 3FZLB 2V5DA 3LFMA 4CQIA 4QHOA 2K3WA 2DLRA 3ANWB 1KNZA 3PDYA 3MZKB 2E9XD 2VKHA 3ABVA 2WCAA 2XQ8A 2J62A 1BR1A 3C50A 5JR9C 3I1AA 4HFHA 4OYKA 4DUYT 2H7VC 2XQAA 4TWFA 2E9XB 3JCFA 4ZI2D 3CMLA 3B57A 4DMWA 4GK5E 2LEHA 4KUMB 2WDRA 2W63A 3VRAA 4LF8T 3AE2A 3PJAA 4EZ4A 1MMNA 4P0BA 4H9SE 3CQXC 4ZI3C 4HEAA 2CXFA 2RP4A 4H9RC 5ABEA 2BVLA 5IYZE 3PUXF 5FY1A 5E0OA 3F57A 3ZC1A 5LMUT 3K1SA 3ZT6A 3AXJB 3TLVA 4GYSA 4O2AE 3PUWF 4LFCT 1ZOYA 2BDEA 3ZN0B 3TLUA 3UTKA 4OHFA 4F8HA 3GA8A 4OYJA 1HCIA 3HKEE 3MKDA 1U4QA 4XBFB 2BKOA 2UXNB 3A5XA 3AAIA 3CQCB 5BMVE 3KFWX 3KVBA 3RGLA 3N9LA 3RPUA 4QH1A 4IIJE 4PJNA 4TUYE 3PE0A 3AA6B 2PBIA 2CLYC 3ZJ2A 4WW0A 1NWMX 3EABA 3VR8A 4B3ST 2LRLA 2XQ7A 5GONE 3ZYMA 1FJGT 2VK9A 3RYIE 2XQYA 2C0SA 1KEYA 4X66T 2BZBA 2ZMAA 5FXXA 1WR0A 4JLEA 3U78A 2V1DB 1U5PA 2WY2A 4IREA 2CRBA 2CM0A 2MTQA 2XAGB 3ZMZB 3ZPOA 4AIUA 2NWBA 4PJLA 2ODVA 2X0YA 1MNDA 3GN5B 4CZZB 4WNKA 3ZSSA 2KZ7B 3P4WA 2UUCT 3LK2B 3KDSE 3FB2A 5JREA 4ZI2C 3F2EA 2WB5A 4WBNE 2YDRA 3MXZA 3P4PA 4A5XA 5C8YE 2JQ9A 4UR9A 3TLTA 3AA1B 2DNXA 4HFBA 2Q9QA 4TN7B 2DL1A 3IEEA 5FVKA 4M1PA 4IDPA 5CB4E 4AKRB 1J5WA 5AQNB 1W0AA 3MA9A 1BR4A 3CWZB 3AEBA 2L8KA 4ANJA 2ZM6T 5ABHA 2X9YA 5L4HA 1LVFA 4YSYA 3KBTA 5L4EA 3RIAA 4G2AA 2N2NA 2D0UA 4X64T 2YU1A 5LGTB 3IBPA 4AQGA 3KINB 4GIWA 1FMWA 5HXSA 3UFGA 5C3JA 3E0ZA 1IJ6A 4PFOA 5HEOA 4TNWA 5TAOA 2J4GA 2XQ4A 2YK0A 2YU2A 3P7IA 4AXPA 4WZXA 4AQFC 4YHJA 4H9NC 2H3RA 4LF5T 2LOSA 2IC6A 2XM2A 5HAXA 2WWUA 4COFA 2X68A 5L3GB 4QWNB 2XQ6A 2K5BB 2JQHA 5LGNB 4ILAA 3L09A 1IZNB 2EHOB 2WDQA 3AECA 5FXVA 1IBKT 2E8IA 3AA0B 4ZI7E 1GQEA 3UFEA 1DU2A 3O4XE 2VKDA 4DV2T 4O4LE 2R6GF 4IE4A 3L3PA 4YLHA 3M3ZB 2V6YB 4IDNA 5LB7B 2CBJA 5ABFA 2QGSA 2X0HA 4DV1T 2KWIB 4UF0A 3NBXX 2FBWA 4U2YA 2LM9A 1WYCA 2A9UA 2BS2A 3AE9A 5DABA 3AE5A 4DR4T 4DUZT 2Q9QD 5HXCA 3ESLA 4TV9E 5IHYA 3UUNA 3RIUA 3CX8B 2HN1A 1J5ET 2B1EA 4HN9A 4U31A 4KI0F 1KF6A 4ZS3A 4KX6A 1HNZT 1NENA 3L8RA 2E5LT 2VB6A 2B76A 2XM1A 3PUZF 1NAFA 5KDMC 4YJ3E 1YKEB 4JYAT 3L39A 4QXBB 2NTXA 4CI2B 4JI4T 4Q25A 4GOUA 3O9XA 2X9WA 1XWMA 4U7YA 4IE6A 2BBHA 3BQIA 3HI2A 5JR9B 4XAXB 4UIGA 2WMOA 4MALA 4ILUA 1IBMT 1OEDA 4GYRA 3JAFA 3PUAA 2FUPA 5AQUB 1JNRA 2W62A 5HEUA 3ZMTB 3CKDA 4E7ZA 4DR6T 5HEGA 2XAFB 4TWDA 4MHCA 3OTOT 2LSIA 2H89A 4CN6A 2KINB 4DBRA 5ADXL 1IBLT 4H63V 5JRCA 1L0VA 3N5LA 4KBMB 2IC9A 4DMVA 4F6RC 5JDHA 4UXNB 3N2OA 4YXDA 4FI5A 2VWAA 2LSJA 3U3IA 2V7KA 2X66A 2QRXA 4LMLA 4MLKA 4N78D 5FY7A 4PFPA 2LLYA 3OYXA 1XDPA 3FBZA 3ETVA 4DVDA 3UU6A 4ISSA 1XMQT 1YQ4A 5FKYA 5LXTE 1YXRA 2KNDA
chains in the Genus database with same CATH topology
2E5LT 2UUCT 4JI0T 1N32T 4JYAT 4AQYT 4LF4T 4DR3T 4B3RT 5BR8T 4JI4T 1XMOT 1IBKT 1XNRT 4JI5T 1N33T 4LF9T 4DV2T 1HNWT 4GKJT 4NXMT 1IBMT 4DR7T 1HNXT 4DV5T 4JI7T 4DV0T 4YHHT 4DR5T 4LFAT 1I94T 4JI2T 1XNQT 4LFBT 4B3TT 4LF7T 4DV4T 4DV3T 4DUYT 4DR6T 4DR1T 1HR0T 4B3MT 2ZM6T 4X62T 3OTOT 5IWAT 4DV1T 2UUBT 2F4VT 4B3ST 4DV6T 1IBLT 4GKKT 4DR4T 4LF8T 2UUAT 1FJGT 4X64T 4DUZT 1N36T 2VQET 4YY3T 4NXNT 2UXDT 4X66T 2UXBT 5LMNT 3T1YT 4K0KT 4JI8T 4JI3T 4LF6T 2UXCT 4DV7T 2UU9T 4KHPT 1J5ET 4JV5T 4OX9T 4X65T 5LMUT 1N34T 2VQFT 1XMQT 4LFCT 3T1HT 1HNZT 4JI6T 4DR2T 4JI1T 2HHHT 4LF5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L T;  2UUC T;  4JI0 T;  1N32 T;  4JYA T;  4AQY T;  4LF4 T;  4DR3 T;  4B3R T;  5BR8 T;  4JI4 T;  1XMO T;  1IBK T;  1XNR T;  4JI5 T;  1N33 T;  4LF9 T;  4DV2 T;  1HNW T;  4GKJ T;  4NXM T;  1IBM T;  4DR7 T;  1HNX T;  4DV5 T;  4JI7 T;  4DV0 T;  4YHH T;  4DR5 T;  4LFA T;  1I94 T;  4JI2 T;  1XNQ T;  4LFB T;  4B3T T;  4LF7 T;  4DV4 T;  4DV3 T;  4DUY T;  4DR6 T;  4DR1 T;  1HR0 T;  4B3M T;  2ZM6 T;  4X62 T;  3OTO T;  5IWA T;  4DV1 T;  2UUB T;  2F4V T;  4B3S T;  4DV6 T;  1IBL T;  4GKK T;  4DR4 T;  4LF8 T;  2UUA T;  1FJG T;  4X64 T;  4DUZ T;  1N36 T;  2VQE T;  4YY3 T;  4NXN T;  2UXD T;  4X66 T;  2UXB T;  5LMN T;  3T1Y T;  4K0K T;  4JI8 T;  4JI3 T;  4LF6 T;  2UXC T;  4DV7 T;  2UU9 T;  4KHP T;  1J5E T;  4JV5 T;  4OX9 T;  4X65 T;  5LMU T;  1N34 T;  2VQF T;  1XMQ T;  4LFC T;  3T1H T;  1HNZ T;  4JI6 T;  4DR2 T;  4JI1 T;  2HHH T;  4LF5 T; 
#chains in the Genus database with same CATH topology
 4UEL A;  2WU2 A;  3TLS A;  1XZY A;  1H7C A;  2YIN A;  4B3R T;  2WU5 A;  3VKG A;  1IJ5 A;  2WMN A;  2M67 A;  4Z90 A;  3I0O A;  4WYV A;  5AQI B;  4PK6 A;  5LBM A;  1SE7 A;  1HNW T;  3QB5 K;  2Q9Q C;  1S94 A;  3UQ4 A;  4AIS A;  2CLY B;  4HFE A;  5EK4 A;  4DV0 T;  5FL0 A;  4U33 A;  4U3C A;  3KV4 A;  1XNQ T;  4ZZB A;  2KT9 A;  3Q2M A;  3H3A A;  1UGO A;  3ZN1 B;  2XAQ B;  3EAM A;  5LG4 A;  3CPZ A;  2FJB A;  4IT4 A;  2K48 A;  1G73 A;  2CMR A;  3N9M A;  2A3D A;  3ZKR A;  2XQ5 A;  5HEJ A;  3I9Y A;  2UXD T;  3FBL A;  4JUY A;  3D0T A;  3P50 A;  4IDQ A;  2NOX A;  2N1G A;  4BAY B;  5JVD E;  3PTR B;  4ZZC A;  2I0M A;  2YEV C;  2NTY A;  2ES0 A;  2VQF T;  2VL0 A;  2CXD A;  4O8S A;  1UX5 A;  1XDO A;  5HXR A;  1T7S A;  2LRK A;  3ZYL A;  5ETW A;  4BA9 A;  2BG9 A;  4U74 A;  5J2U E;  5FVL A;  2N9D A;  1MIW A;  4CN4 A;  3NKZ A;  2BVM A;  3RIF A;  1G8X A;  4HFC A;  2D9D A;  4TX5 A;  4EV6 A;  5L3B B;  3UU4 A;  4AI6 A;  5JDM A;  5LP6 E;  4AKI A;  3Q9D A;  5LHH B;  1T72 A;  2XSA A;  3QK6 A;  1WCR A;  4L0R A;  5EK2 A;  3VKH A;  4L5G A;  3RH3 A;  3OVU A;  3QC9 A;  1LVK A;  2W61 A;  3IHR A;  3RC3 A;  5AQH B;  3CX6 B;  5J2T E;  3S4U A;  4EXT A;  4DID B;  3AE8 A;  4C91 A;  3TLW A;  1D1B A;  3OKQ A;  3I0Q A;  3AEE A;  4HWH A;  4LMK A;  3QB5 A;  4X65 T;  5AQR B;  3KVA A;  1LRZ A;  4TV8 E;  3N2G E;  4CXX A;  4JI0 T;  2K9A A;  3SOL A;  4NUV A;  1HX8 A;  3DTO A;  2MPK A;  2XQ9 A;  2Y6X A;  2ACX A;  3NWI A;  3ZCI A;  5ABG A;  2DI4 A;  3AE3 A;  3SFD A;  3WI3 A;  1OED C;  1D0Z A;  2GK9 A;  3V5U A;  1HS7 A;  3MK7 C;  1W0B A;  3FZK B;  3RQW A;  4CN1 A;  2VAS A;  1WLX A;  4B3T T;  4A97 A;  1NEK A;  1D1A A;  4I43 B;  4X62 T;  2H88 A;  2CBI A;  5LG3 A;  3N9P A;  2XZE A;  4EYU A;  4NPP A;  3C98 B;  3SFE A;  3ZT7 A;  3LG7 A;  4U7I A;  4YY3 T;  3JAE A;  2P9B A;  4JEU B;  1YD8 G;  4HKA A;  2W67 A;  4ILB A;  1MIV A;  2NW9 A;  1VRB A;  2KXP B;  2JMK A;  1KFY A;  4O4H E;  2LT3 A;  4A56 A;  5CGM A;  4ILC A;  1FMV A;  4EEB A;  3ZST A;  3AB3 B;  3RF1 A;  2PJQ A;  3A8Y C;  3AEG A;  5LHI B;  2IML A;  2JQQ A;  3AE6 A;  2KSR A;  2IHR 1;  2L3L A;  3PUQ A;  4FJO A;  3O1H A;  3M65 A;  3NZQ A;  3UU3 A;  2W2U A;  4QX7 B;  2UXX B;  3AAE B;  2WZI A;  1VCT A;  1SUM B;  2XTL A;  3J9X 1;  3RLF F;  3R6N A;  3EUH A;  1Z8U A;  5LGU B;  3PUV F;  3ZC0 A;  3CK6 A;  5M4Y A;  2CPT A;  3KV6 A;  1YKH B;  4YTM A;  5H6Q B;  3SWH A;  3OBV E;  2CXL A;  5FL1 A;  5HXE A;  3AEF A;  5AFU L;  4LFA T;  3B13 A;  4UV9 B;  3I9W A;  4P09 A;  3PU8 A;  2Y48 B;  3H3M A;  2MBG A;  5L3F B;  1WRD A;  2JIW A;  2E2A A;  4AKL A;  1R8I A;  5JTG A;  4QH4 A;  2L9Q A;  3UU8 A;  3RC8 A;  4GKK T;  3NRX A;  3BQK A;  2DWG A;  3VHL A;  1D0X A;  5F8P A;  5LMN T;  3Q5E A;  2LJL A;  5HYA A;  1ZP0 A;  2ACZ A;  1OWA A;  2OV9 A;  2VKJ A;  1E1H B;  2X51 A;  1E7P A;  3C4Z A;  2RA1 A;  1W9R A;  4X20 E;  1US7 B;  5A1L A;  4NIQ A;  2LSG A;  1E2A A;  2V8S V;  1UX4 A;  5JH7 E;  3LBX A;  4IE7 A;  5LCY A;  2Q9Q B;  3BK9 A;  3CX7 B;  2CHN A;  2WQY A;  5LYJ E;  4BJN A;  3RI5 A;  2BG9 C;  2YDS A;  2NP9 A;  2BKN A;  2XSB A;  2WZH A;  4ZEY A;  2XUE A;  3ZT5 A;  4CXW A;  1Y64 B;  5L2L A;  2WDV A;  2LM2 A;  3LK4 2;  5AQK B;  2D2S A;  3RKG A;  4DV3 T;  2WS3 A;  2CCQ A;  2XQ3 A;  3HKB E;  3ANW A;  5IWA T;  3RX6 A;  1ZHC A;  2UUB T;  2WM9 A;  4I50 E;  4HGA A;  3V5S A;  1WFD A;  1WYB A;  4HWD A;  3DJB A;  3VRB A;  2XAJ B;  4AKH A;  5DJQ C;  3Q5X A;  4QXH B;  2E9X A;  5KX5 E;  4TZ4 C;  2V7J A;  3AE1 A;  1HFA A;  2ZM0 A;  2JMH A;  4EYY R;  3ZYK A;  3PUG A;  2QYW A;  3UU5 A;  4IST A;  4LF6 T;  3ETU A;  2DWK A;  4DV7 T;  1EZ3 A;  2CA5 A;  1MMD A;  2A72 A;  4P1N A;  2W4X A;  2JJ9 A;  1CUN A;  4C90 A;  4AKG A;  3X1D A;  1UUR A;  2HHH T;  2HPL A;  3FZM B;  3AXJ A;  1X79 A;  3H37 A;  2AXD S;  3ZJ1 A;  1N32 T;  4H9Q C;  4IGU A;  2BBJ A;  4KHZ F;  5AQJ B;  5BR8 T;  4DR3 T;  1MNE A;  2V7M A;  2FJA A;  5AQG B;  1HG5 A;  3ONX A;  1N33 T;  5C2T A;  4HFD A;  2D5U A;  4J2C A;  2G0U A;  4X1Y E;  5F3J A;  1HNX T;  4ZHQ E;  4YTN A;  1FIO A;  2QA7 A;  4YHH T;  5ABF B;  3HKD E;  4UF0 B;  2FJD A;  3UUX B;  3EDU A;  3PJA J;  2JQK A;  2I59 A;  3WAK A;  3PV0 F;  3SRZ A;  3ZLI A;  4KP3 C;  2MOZ A;  4PK4 A;  5L3D B;  2D0T A;  3MAC A;  2J1D G;  4O4J E;  3HKC E;  4E7S A;  4AQF A;  4IE5 A;  1N36 T;  3AVR A;  1QLB A;  5HWX A;  5IUX A;  3FZF B;  3VU7 H;  2UXB T;  4PAG A;  1UCU A;  5CA0 E;  3T1Y T;  4CI3 B;  2A2F X;  4HWI B;  4EOZ B;  4KHP T;  1UK5 A;  4CXY A;  3ONJ A;  3OPC A;  4UVA B;  1N34 T;  4QX8 B;  3RRC A;  2ZM2 A;  4UV8 B;  2K24 A;  4ADZ A;  3QUJ A;  5AQF B;  3UUM A;  1HTJ F;  3ONL C;  3Q5D A;  4TNV A;  3ZMU B;  1KNP A;  5HEH A;  5HCJ A;  2ZLY A;  1KK7 A;  1OED B;  4U2Z A;  3GN5 A;  1D1C A;  3PUS A;  1YQ3 A;  1IAP A;  3K8P C;  2OLT A;  4QKN A;  1X9B A;  2JPF A;  2YN6 A;  4DV5 T;  3P8C D;  3UQ7 A;  4HWC A;  1JNZ A;  2LHR A;  2NW8 A;  4DV4 T;  3IA3 A;  5HXH A;  2Y8D A;  4CI1 B;  2VUR A;  3HA4 A;  5JRC B;  2VVS A;  4H9O C;  3HR0 A;  2I6H A;  1SHZ C;  1I6Z A;  4PNI A;  4PW8 A;  5AQV B;  3ZMV B;  3SS1 A;  5CJ5 A;  3K3O A;  1ZEE A;  4ERR A;  2VL8 A;  1QSD A;  3Q5W A;  1VCS A;  2LOP A;  3RYF E;  4OK0 A;  3EI0 A;  2YDQ A;  2RPA A;  4V1A v;  2C5I T;  2CWY A;  2XPK A;  4JV5 T;  4U72 A;  3R84 B;  4ASK A;  3WAJ A;  2YKS A;  3AAA B;  2VKO A;  3NRY A;  3RIU C;  1YW0 A;  3AA7 B;  2WAU A;  1Y01 A;  4PJM A;  4YSZ A;  3VR9 A;  4LF4 T;  2VVN A;  4IL4 A;  2DCF A;  3C51 A;  2PG8 A;  4JI5 T;  4LF9 T;  3G06 A;  1Z0P A;  5HCM A;  2WBL A;  3K3N A;  2WP9 A;  5JDN A;  3E08 A;  1J1J A;  2EHO A;  2IW5 B;  3LSV A;  4I4T E;  3B5M A;  1I94 T;  3ZCJ A;  1MIY A;  4IDZ A;  2X9H A;  5FXW A;  4HFV A;  3FHN A;  3EVY A;  3K3Q C;  4DR1 T;  4ZS2 A;  2CEA A;  1OED E;  2M6I A;  2V6Y A;  5CFB A;  4B6X A;  4ZOL E;  5LJN A;  4XZC A;  4WBO A;  3O1J A;  2E9X C;  3CVR A;  3NZP A;  2VQE T;  2Z6E A;  2XY8 B;  2WWV A;  1WR6 A;  2ZM8 A;  5AQP B;  5FY0 A;  4JI8 T;  2UXC T;  3T8O A;  3NVO A;  4O2B E;  4O4I E;  3UUL A;  5AQO B;  3DP7 A;  3OYZ A;  2H7O A;  4IHJ E;  3GWH A;  2X67 A;  3P4R A;  4JI1 T;  2BG9 B;  2MYS A;  5FYM A;  2LHN A;  1BR2 A;  3CIR A;  2CE7 A;  4HTE A;  2X9X A;  3J7Y q;  2HN2 A;  2V26 A;  4JBW F;  3FZH B;  2W66 A;  1XMO T;  1HX1 B;  2W0G A;  3AED A;  4IL9 A;  4TWH A;  5FMN A;  4MBQ A;  5F5W A;  4YTP A;  4NXM T;  3O1I A;  3F31 A;  4HWF A;  5DQV A;  5EZY E;  3N9O A;  2FJE A;  4JI7 T;  5JDL A;  3ZMS B;  2BS4 A;  3RQU A;  1M7K A;  5JR9 A;  1T8B A;  5H6R B;  2DHR A;  3P4S A;  3JC6 D;  1W09 A;  1AJ3 A;  5LNK A;  3FXE B;  2LKH A;  3KV5 A;  2KLQ A;  5JDF A;  2HH7 A;  4DV6 T;  1OXZ A;  3AE7 A;  2HPJ A;  2E5V A;  4QXC B;  4X1I E;  4H63 H;  2LSY A;  4NXN T;  4DND A;  5L3C B;  5JDG A;  4UEM A;  5JDQ A;  2BKP A;  3PUR A;  1D0Y A;  2EHO D;  4JI3 T;  1KNR A;  4EB6 E;  4G63 A;  3KBU A;  4A98 A;  3CQG B;  3AEA A;  3LJC A;  5AQS B;  1LKX A;  1UUS A;  4YJ2 E;  3RRW A;  1M62 A;  4JI6 T;  4DR2 T;  1HG2 A;  5CA1 E;  1SA0 E;  4EGW A;  2IAK A;  4L9I A;  4NUU A;  5DQW A;  5EK3 A;  4GK0 E;  5LBQ B;  3ZEF B;  5AQQ B;  2C5J A;  2KWH A;  4K0U A;  4GKJ T;  2PFV A;  3EHZ A;  2V6X A;  5J1G A;  4EED A;  3HL6 A;  2C5K T;  2IIU A;  3N9Q A;  2PTF A;  3AE4 A;  3A7M A;  2BG9 E;  1HF8 A;  4ZXL A;  1FEW A;  4JI2 T;  3C4X A;  4LF7 T;  2W00 A;  4EAH A;  4BJM A;  4EZH A;  4B3M T;  1BR0 A;  1VOM A;  3QNU A;  3QOF A;  2F4V T;  1O3X A;  3FXD B;  1T98 A;  4LMJ A;  3UUB A;  2BS3 A;  3JAD A;  3OJA A;  2UUA T;  2AE9 A;  5LOV E;  1QUU A;  5FXZ A;  2MAW A;  3PU3 A;  2ODU A;  4QH5 A;  5HWY A;  3LDQ B;  4Z91 A;  1CHU A;  5LHG B;  4HFI A;  4UVB B;  4EIW A;  4P0A A;  1MMA A;  1V9D A;  3T1H T;  2IUB A;  4UVC B;  3MJX A;  4KMC A;  4H9P C;  3RYH E;  2NW7 A;  3JC6 C;  2IDO B;  4X1K E;  2V7I A;  1ZV4 X;  4YFS A;  3C64 A;  5FNV E;  3IF8 B;  1XNR T;  4MFR A;  4PK5 A;  3C4W A;  4ZI3 D;  3W15 B;  1MMG A;  4X5T A;  5AQM B;  4DR7 T;  4YSX A;  3TKL B;  2JRK A;  2EHO C;  5AQL B;  2XHE B;  4DR5 T;  3PUY F;  3RYC E;  4I0U A;  1S35 A;  2XJ7 A;  4JEH B;  4LFB T;  2XAS B;  3BQL A;  5J0Z A;  5AQT B;  4I55 E;  3KV9 A;  1HR0 T;  2KMF A;  4Z8X A;  4OFZ A;  3N9N A;  5FP3 A;  5KMG P;  2SPC A;  2YOE A;  5JQG E;  1ZKE A;  3P4Q A;  2V7L A;  4DO0 A;  5L3E B;  2M6B A;  4IDO A;  2LE8 A;  2CHO A;  2V5C A;  4K0K T;  3GMI A;  4HE8 A;  3RHW A;  2J47 A;  2CWO A;  2UU9 T;  3E22 E;  3LBX B;  5LJM A;  3EDV A;  4OX9 T;  5L47 A;  2XAH B;  4PJJ A;  2OA5 A;  3LK3 B;  3N2K E;  3UT5 E;  4YT0 A;  2QVA A;  3RKO A;  1B7T A;  2WSS V;  5LA6 E;  2X0L B;  4AQY T;  2NR4 A;  4DBQ A;  2LKG A;  3AVS A;  2LSK A;  5KXJ A;  4IE0 A;  3FZL B;  2V5D A;  3LFM A;  4CQI A;  4QHO A;  2K3W A;  2DLR A;  3ANW B;  1KNZ A;  3PDY A;  3MZK B;  2E9X D;  2VKH A;  3ABV A;  2WCA A;  2XQ8 A;  2J62 A;  1BR1 A;  3C50 A;  5JR9 C;  3I1A A;  4HFH A;  4OYK A;  4DUY T;  2H7V C;  2XQA A;  4TWF A;  2E9X B;  3JCF A;  4ZI2 D;  3CML A;  3B57 A;  4DMW A;  4GK5 E;  2LEH A;  4KUM B;  2WDR A;  2W63 A;  3VRA A;  4LF8 T;  3AE2 A;  3PJA A;  4EZ4 A;  1MMN A;  4P0B A;  4H9S E;  3CQX C;  4ZI3 C;  4HEA A;  2CXF A;  2RP4 A;  4H9R C;  5ABE A;  2BVL A;  5IYZ E;  3PUX F;  5FY1 A;  5E0O A;  3F57 A;  3ZC1 A;  5LMU T;  3K1S A;  3ZT6 A;  3AXJ B;  3TLV A;  4GYS A;  4O2A E;  3PUW F;  4LFC T;  1ZOY A;  2BDE A;  3ZN0 B;  3TLU A;  3UTK A;  4OHF A;  4F8H A;  3GA8 A;  4OYJ A;  1HCI A;  3HKE E;  3MKD A;  1U4Q A;  4XBF B;  2BKO A;  2UXN B;  3A5X A;  3AAI A;  3CQC B;  5BMV E;  3KFW X;  3KVB A;  3RGL A;  3N9L A;  3RPU A;  4QH1 A;  4IIJ E;  4PJN A;  4TUY E;  3PE0 A;  3AA6 B;  2PBI A;  2CLY C;  3ZJ2 A;  4WW0 A;  1NWM X;  3EAB A;  3VR8 A;  4B3S T;  2LRL A;  2XQ7 A;  5GON E;  3ZYM A;  1FJG T;  2VK9 A;  3RYI E;  2XQY A;  2C0S A;  1KEY A;  4X66 T;  2BZB A;  2ZMA A;  5FXX A;  1WR0 A;  4JLE A;  3U78 A;  2V1D B;  1U5P A;  2WY2 A;  4IRE A;  2CRB A;  2CM0 A;  2MTQ A;  2XAG B;  3ZMZ B;  3ZPO A;  4AIU A;  2NWB A;  4PJL A;  2ODV A;  2X0Y A;  1MND A;  3GN5 B;  4CZZ B;  4WNK A;  3ZSS A;  2KZ7 B;  3P4W A;  2UUC T;  3LK2 B;  3KDS E;  3FB2 A;  5JRE A;  4ZI2 C;  3F2E A;  2WB5 A;  4WBN E;  2YDR A;  3MXZ A;  3P4P A;  4A5X A;  5C8Y E;  2JQ9 A;  4UR9 A;  3TLT A;  3AA1 B;  2DNX A;  4HFB A;  2Q9Q A;  4TN7 B;  2DL1 A;  3IEE A;  5FVK A;  4M1P A;  4IDP A;  5CB4 E;  4AKR B;  1J5W A;  5AQN B;  1W0A A;  3MA9 A;  1BR4 A;  3CWZ B;  3AEB A;  2L8K A;  4ANJ A;  2ZM6 T;  5ABH A;  2X9Y A;  5L4H A;  1LVF A;  4YSY A;  3KBT A;  5L4E A;  3RIA A;  4G2A A;  2N2N A;  2D0U A;  4X64 T;  2YU1 A;  5LGT B;  3IBP A;  4AQG A;  3KIN B;  4GIW A;  1FMW A;  5HXS A;  3UFG A;  5C3J A;  3E0Z A;  1IJ6 A;  4PFO A;  5HEO A;  4TNW A;  5TAO A;  2J4G A;  2XQ4 A;  2YK0 A;  2YU2 A;  3P7I A;  4AXP A;  4WZX A;  4AQF C;  4YHJ A;  4H9N C;  2H3R A;  4LF5 T;  2LOS A;  2IC6 A;  2XM2 A;  5HAX A;  2WWU A;  4COF A;  2X68 A;  5L3G B;  4QWN B;  2XQ6 A;  2K5B B;  2JQH A;  5LGN B;  4ILA A;  3L09 A;  1IZN B;  2EHO B;  2WDQ A;  3AEC A;  5FXV A;  1IBK T;  2E8I A;  3AA0 B;  4ZI7 E;  1GQE A;  3UFE A;  1DU2 A;  3O4X E;  2VKD A;  4DV2 T;  4O4L E;  2R6G F;  4IE4 A;  3L3P A;  4YLH A;  3M3Z B;  2V6Y B;  4IDN A;  5LB7 B;  2CBJ A;  5ABF A;  2QGS A;  2X0H A;  4DV1 T;  2KWI B;  4UF0 A;  3NBX X;  2FBW A;  4U2Y A;  2LM9 A;  1WYC A;  2A9U A;  2BS2 A;  3AE9 A;  5DAB A;  3AE5 A;  4DR4 T;  4DUZ T;  2Q9Q D;  5HXC A;  3ESL A;  4TV9 E;  5IHY A;  3UUN A;  3RIU A;  3CX8 B;  2HN1 A;  1J5E T;  2B1E A;  4HN9 A;  4U31 A;  4KI0 F;  1KF6 A;  4ZS3 A;  4KX6 A;  1HNZ T;  1NEN A;  3L8R A;  2E5L T;  2VB6 A;  2B76 A;  2XM1 A;  3PUZ F;  1NAF A;  5KDM C;  4YJ3 E;  1YKE B;  4JYA T;  3L39 A;  4QXB B;  2NTX A;  4CI2 B;  4JI4 T;  4Q25 A;  4GOU A;  3O9X A;  2X9W A;  1XWM A;  4U7Y A;  4IE6 A;  2BBH A;  3BQI A;  3HI2 A;  5JR9 B;  4XAX B;  4UIG A;  2WMO A;  4MAL A;  4ILU A;  1IBM T;  1OED A;  4GYR A;  3JAF A;  3PUA A;  2FUP A;  5AQU B;  1JNR A;  2W62 A;  5HEU A;  3ZMT B;  3CKD A;  4E7Z A;  4DR6 T;  5HEG A;  2XAF B;  4TWD A;  4MHC A;  3OTO T;  2LSI A;  2H89 A;  4CN6 A;  2KIN B;  4DBR A;  5ADX L;  1IBL T;  4H63 V;  5JRC A;  1L0V A;  3N5L A;  4KBM B;  2IC9 A;  4DMV A;  4F6R C;  5JDH A;  4UXN B;  3N2O A;  4YXD A;  4FI5 A;  2VWA A;  2LSJ A;  3U3I A;  2V7K A;  2X66 A;  2QRX A;  4LML A;  4MLK A;  4N78 D;  5FY7 A;  4PFP A;  2LLY A;  3OYX A;  1XDP A;  3FBZ A;  3ETV A;  4DVD A;  3UU6 A;  4ISS A;  1XMQ T;  1YQ4 A;  5FKY A;  5LXT E;  1YXR A;  2KND A; 
#chains in the Genus database with same CATH homology
 2E5L T;  2UUC T;  4JI0 T;  1N32 T;  4JYA T;  4AQY T;  4LF4 T;  4DR3 T;  4B3R T;  5BR8 T;  4JI4 T;  1XMO T;  1IBK T;  1XNR T;  4JI5 T;  1N33 T;  4LF9 T;  4DV2 T;  1HNW T;  4GKJ T;  4NXM T;  1IBM T;  4DR7 T;  1HNX T;  4DV5 T;  4JI7 T;  4DV0 T;  4YHH T;  4DR5 T;  4LFA T;  1I94 T;  4JI2 T;  1XNQ T;  4LFB T;  4B3T T;  4LF7 T;  4DV4 T;  4DV3 T;  4DUY T;  4DR6 T;  4DR1 T;  1HR0 T;  4B3M T;  2ZM6 T;  4X62 T;  3OTO T;  5IWA T;  4DV1 T;  2UUB T;  2F4V T;  4B3S T;  4DV6 T;  1IBL T;  4GKK T;  4DR4 T;  4LF8 T;  2UUA T;  1FJG T;  4X64 T;  4DUZ T;  1N36 T;  2VQE T;  4YY3 T;  4NXN T;  2UXD T;  4X66 T;  2UXB T;  5LMN T;  3T1Y T;  4K0K T;  4JI8 T;  4JI3 T;  4LF6 T;  2UXC T;  4DV7 T;  2UU9 T;  4KHP T;  1J5E T;  4JV5 T;  4OX9 T;  4X65 T;  5LMU T;  1N34 T;  2VQF T;  1XMQ T;  4LFC T;  3T1H T;  1HNZ T;  4JI6 T;  4DR2 T;  4JI1 T;  2HHH T;  4LF5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...