1IBMT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibmT00
1N34T 1IBMT 4JI4T 4GKKT 2E5LT 4DV0T 4JI2T 4X64T 5BR8T 4LF6T 4JI3T 1N32T 2HHHT 1J5ET 2UUAT 2UXDT 1XMOT 4DV1T 4DR6T 2VQET 4JI7T 4DV4T 4DR4T 1N33T 4JI1T 4B3MT 1HNZT 3T1YT 4DR7T 4DV5T 4DR5T 4JI8T 4LFCT 1IBLT 4DV3T 4DV6T 4LF8T 4K0KT 1N36T 4DR1T 2ZM6T 2F4VT 1XMQT 4JV5T 4LF9T 2UXBT 4DUZT 4DR2T 4LFAT 4B3TT 4DV2T 4LFBT 2UU9T 4YY3T 4NXNT 1FJGT 4JYAT 1HNWT 4X66T 2UUBT 3T1HT 4B3RT 1XNRT 4DUYT 5LMNT 4LF4T 4JI5T 4X65T 2VQFT 2UUCT 4YHHT 1I94T 1HR0T 4NXMT 1XNQT 1HNXT 4LF7T 4KHPT 5IWAT 1IBKT 5LMUT 4B3ST 4OX9T 3OTOT 4X62T 4AQYT 4DR3T 2UXCT 4JI0T 4LF5T 4GKJT 4JI6T 4DV7T
chains in the Genus database with same CATH superfamily
3RYCE 3ZSTA 1QLBA 4I4TE 3ZPOA 3EDUA 5M4YA 1OXZA 1MIVA 2Z6EA 2XM2A 5HYAA 2HHHT 1XZYA 4EYYR 2J1DG 2UXDT 5FXXA 4U74A 5HWXA 3B5MA 4IE4A 1E1HB 2V6YB 3JADA 4DV5T 5AQKB 4WNKA 4ZXLA 2QGSA 2XQ9A 2IUBA 1IBLT 2M67A 5AQLB 4CN6A 2KINB 1CHUA 4YTMA 4CN1A 2VVNA 1R8IA 4LF9T 4OHFA 3ZYKA 2UXBT 4LFAT 3LBXA 3RRCA 2QA7A 2UU9T 1FEWA 2CXDA 3UQ7A 4U7IA 1HNWT 2IC9A 1XDPA 2WY2A 2WDQA 2WM9A 3JC6D 3ANWA 4KBMB 2FJEA 1NEKA 5LA6E 3BQLA 5IWAT 2W62A 5LBQB 2YU2A 1ZOYA 2DL1A 1AJ3A 4GOUA 4QH1A 3ZKRA 2EHOB 3NKZA 5AQJB 3RYIE 2E5LT 4DV0T 4JI2T 3VKGA 2WB5A 4O8SA 2JMHA 3Q5DA 1G73A 4YHJA 2PTFA 5LGTB 3RF1A 2MBGA 1ZHCA 4QXCB 3HR0A 4UVBB 3NBXX 3A7MA 3CK6A 4ZI2C 4CI3B 3ZT7A 2ODUA 1J1JA 2HPJA 3SFEA 4HFHA 3ZMTB 3ONLC 2ZM2A 4DO0A 2W67A 1YW0A 3LK3B 4QX8B 3WAKA 1V9DA 3AECA 5LMNT 5FVKA 2VQFT 4WBNE 3CX8B 2J62A 4LMKA 1I94T 3P4PA 3H37A 1Y64B 3CMLA 2V7KA 3R6NA 3PUZF 1FMVA 5L4HA 2LSKA 3N9MA 5HWYA 4YT0A 4OFZA 2LRLA 3RH3A 4HFDA 2JQQA 2Q9QC 1BR2A 2NWBA 3EDVA 3AVSA 3RGLA 2E5VA 4IREA 1MMAA 3JCFA 4ZZBA 5IHYA 4BJNA 5ABFA 4CZZB 1WCRA 4ZHQE 4LF6T 5FMNA 4G2AA 4P09A 4EIWA 5J2UE 2WSSV 3TLTA 3K8PC 3G06A 4DR6T 3FXEB 4B6XA 2VKJA 2K48A 5FL1A 1U5PA 4ILBA 5JH7E 4UV8B 3UUNA 5AQFB 2YK0A 3HA4A 3F2EA 4LMLA 4DV6T 2XAQB 3RKGA 4HWCA 3RIAA 1OEDE 2H7VC 4EYUA 2DWGA 2XPKA 3N9LA 3R84B 1DU2A 2E8IA 1IZNB 1MNEA 4X1KE 5L3EB 3L3PA 5F5WA 2BZBA 3O9XA 4X65T 1OEDB 3AA6B 4ASKA 2X0HA 2K24A 3ZYMA 3FZLB 3AE8A 4ILCA 2CM0A 4NIQA 4TN7B 4IE5A 2X51A 3BQKA 3FXDB 4J2CA 2EHOC 4X20E 2CRBA 2JJ9A 4IDQA 4BAYB 4DV7T 3K3NA 4GKKT 5LJNA 2R6GF 2LEHA 2EHOD 4HFBA 4UV9B 2N9DA 5EK3A 4I55E 1OWAA 5FXWA 2W61A 5LB7B 3H3AA 1UGOA 2BS4A 4Z8XA 2LE8A 5HEGA 4WBOA 4DV4T 3LK2B 3I9YA 2XQ7A 4UIGA 3T1YT 4DR7T 2JQ9A 1YQ4A 2XTLA 3X1DA 1S94A 2XQ3A 3B57A 4TNWA 4XZCA 4JV5T 3MZKB 1QSDA 2YOEA 3OYZA 1HF8A 4DV2T 3V5UA 1FJGT 2ZM0A 3PJAA 2LKHA 3N2KE 3J7Yq 3AE5A 4QXHB 3RIUA 4ADZA 4LF7T 1BR4A 2XQ6A 2CLYC 3FBZA 4L9IA 2NR4A 3KINB 2WDRA 1W0AA 2HH7A 1WYBA 1G8XA 3QOFA 4O4LE 4PK5A 1VCTA 2LSJA 3L39A 3HKEE 4CXYA 2DNXA 3AEAA 5AQPB 4A56A 2AXDS 4TUYE 3P7IA 2WBLA 2X68A 2KSRA 2W63A 3E08A 3FZFB 4FI5A 5AQIB 3PV0F 3MJXA 1J5ET 3KFWX 4HN9A 2ZLYA 2BG9A 3SFDA 3B13A 2D0TA 3PU8A 1MMGA 2H88A 4AISA 2WZHA 3RIFA 3ABVA 1M7KA 1KNZA 4X1YE 2XAFB 3LG7A 2L8KA 3Q9DA 2V7IA 5LXTE 3U78A 3CIRA 5C8YE 3SS1A 1XMQT 1SA0E 2XQAA 2LSYA 2IMLA 2I0MA 4UF0B 3EVYA 1ZEEA 3PUVF 1OEDC 3M3ZB 2V5CA 1D1BA 3QUJA 3ZJ2A 2C0SA 3PUGA 1KF6A 3PJAJ 5AQNB 4O4IE 2VWAA 1B7TA 3AEDA 5ABEA 2WMOA 1KNPA 2LSIA 4KMCA 4YTPA 2KWHA 5KXJA 5ABHA 4LF5T 2QYWA 5AQMB 5JR9C 2KZ7B 3BK9A 1UX4A 2W2UA 3LFMA 2XZEA 3CQXC 5CA1E 4IE6A 3RQWA 2CHOA 3OPCA 1YD8G 3VHLA 4JI3T 3ZN0B 5LNKA 1HG2A 1ZKEA 4MFRA 5L3FB 3SOLA 2VQET 2Q9QB 2B76A 3UU6A 5HXRA 2V8SV 2NW8A 1KEYA 4HWDA 5DABA 1W0BA 4UVCB 3VR8A 4JLEA 1BR1A 4MBQA 2YEVC 4EXTA 3KVBA 4JI8T 1MNDA 1NAFA 3EABA 4ILAA 5DJQC 3VRBA 5AQSB 5LGNB 4AKLA 3JAEA 4AIUA 3KV4A 1O3XA 2FJDA 3IA3A 2X0LB 4F6RC 3QNUA 2XUEA 2H89A 2AE9A 2LM9A 2V7LA 1HX1B 5DQVA 2DI4A 5HXSA 4IT4A 2X9YA 1LKXA 2JQHA 4UXNB 2LM2A 4DIDB 2LJLA 4MHCA 4E7ZA 1M62A 4IHJE 5F8PA 1D1AA 2WMNA 3AA1B 5J2TE 5KX5E 1LRZA 3ZT5A 2CWYA 2DLRA 3E22E 1WR6A 4KX6A 2VK9A 3V5SA 3ONJA 2CMRA 4IE7A 2C5JA 1MMNA 3ETVA 1W9RA 5H6QB 4JI6T 4KHZF 1IJ6A 2DWKA 2NP9A 3TKLB 2MOZA 3RPUA 4U2YA 3NZPA 3AEBA 5HEOA 2UXNB 3FZHB 2UUAT 4HE8A 2VKOA 1T72A 4DV1T 2OLTA 2WU2A 2OV9A 1N33T 4AKRB 3RRWA 4TV9E 3ZCJA 5C2TA 1QUUA 3AE1A 2ZM8A 2JQKA 3LJCA 4O4HE 3RC3A 1FMWA 4EEDA 4CXWA 4LF8T 3ZN1B 1YKHB 1YKEB 4C91A 4AXPA 3ONXA 4PFPA 2LHRA 5JRCA 5AQQB 2D5UA 4HFCA 4YY3T 4YTNA 4CI2B 4AQFA 2YDQA 3PU3A 4PK4A 5FXZA 3GMIA 3IEEA 5JVDE 2G0UA 5JDMA 4TX5A 4ZI3C 4YJ2E 2UUCT 4NUVA 4A98A 3CWZB 4YSYA 2Y8DA 5J0ZA 1WRDA 4ZI2D 1T98A 3FZKB 5LBMA 4OX9T 3AEGA 3BQIA 4ZI3D 4Z90A 3ESLA 4AKHA 4QHOA 2BKOA 4JI0T 3L8RA 3ZYLA 2X67A 4A5XA 1IBMT 2KMFA 2D2SA 2CLYB 2X9HA 2K9AA 3UFEA 4XBFB 4PJJA 3AEEA 4H9OC 3JAFA 2NTYA 2NOXA 2CE7A 5CA0E 3AB3B 3AAAB 5L3DB 2Q9QD 3CKDA 5HCJA 5FY1A 4ZZCA 4K0UA 3OBVE 2ZM6T 4TNVA 3CX6B 1EZ3A 2CEAA 2ZMAA 2J4GA 4MLKA 4F8HA 3PTRB 4CI1B 5HEUA 3KV5A 3S4UA 2GK9A 2HPLA 2E9XC 2BBJA 2PFVA 4HEAA 1T7SA 3PUQA 4A97A 3K1SA 2A72A 2VASA 4TV8E 4HWFA 2H7OA 3N9OA 5ABGA 4FJOA 3UTKA 5HEJA 3RX6A 4Z91A 1HS7A 4GKJT 2Y6XA 2ACXA 5FP3A 3QB5K 4OYKA 5JDHA 3U3IA 1D0XA 3W15B 2ODVA 5L2LA 1D0ZA 2YINA 3UULA 5A1LA 5C3JA 2CCQA 5JR9B 1HNZT 4ZEYA 2QVAA 4QWNB 4P1NA 2WWVA 4AKIA 4HFEA 3Q5WA 4I50E 3Q5XA 2W0GA 4LFCT 1N36T 4L5GA 5L47A 2WU5A 3AA0B 2JRKA 1WYCA 5L4EA 2BS2A 2YN6A 4ERRA 3WAJA 4NPPA 3PUAA 4JYAT 1MMDA 5FL0A 2V7MA 2MAWA 4H63V 2SPCA 4PJNA 3K3OA 1XNQT 1Z0PA 1HNXT 1D0YA 2VB6A 4GK0E 5ETWA 5ABFB 4CQIA 2XQ4A 4AQGA 2IHR1 2RP4A 5HXCA 2XAJB 4BA9A 4O2AE 2XSAA 4EB6E 1N34T 1Y01A 4L0RA 5DQWA 3IF8B 2B1EA 3VKHA 5AFUL 3CX7B 1N32T 3GWHA 2MTQA 1FIOA 4U72A 2NW7A 2WDVA 2V7JA 3AAIA 2Q9QA 3SWHA 1UX5A 1UUSA 4HFVA 2RPAA 4MALA 2RA1A 2BS3A 3ZEFB 4DMVA 4IE0A 3VR9A 1X79A 4UR9A 1KK7A 3N5LA 4UELA 2LHNA 4YSXA 2XM1A 2LSGA 3C98B 5IUXA 4ANJA 3D0TA 2A3DA 4DR2T 4JEHB 5TAOA 3UT5E 2V6YA 5FKYA 2WAUA 2XAGB 3QK6A 3T1HT 3P4QA 4U33A 1SE7A 4Q25A 3GN5B 1IJ5A 2VL8A 2X9XA 4PNIA 4ZOLE 4ISSA 3C4ZA 3GA8A 2YDSA 3ZMZB 4P0BA 3PUYF 3ZC0A 4EV6A 3O1JA 3PDYA 3J9X1 2DHRA 4QX7B 1KNRA 3OKQA 2K5BB 4JI4T 2K3WA 2CPTA 3P4RA 3KV9A 3AE6A 3C4XA 4M1PA 3H3MA 5JDFA 5J1GA 2IC6A 5HAXA 3ZJ1A 4KI0F 5BR8T 2ES0A 3LK42 3HKBE 5LJMA 1XDOA 2A2FX 1E7PA 5CGMA 3EI0A 4H9SE 5LYJE 2PG8A 3KDSE 2EHOA 2UXXB 1LVFA 3UQ4A 2XY8B 1HCIA 3AXJB 3MXZA 3ZLIA 3TLUA 3CPZA 1WFDA 4OK0A 4DR1T 3N9PA 3AEFA 2E2AA 3DP7A 1KFYA 4PK6A 2V6XA 4H9QC 5HCMA 3PUSA 2FJBA 3A8YC 2WS3A 4UEMA 3N2GE 2VVSA 3RI5A 4GYRA 4CN4A 3WI3A 5F3JA 1XNRT 2CXFA 1UURA 1HTJF 2BG9E 2LLYA 4IL4A 1HR0T 3OYXA 4KHPT 5JQGE 3ZT6A 5JDLA 1VCSA 3KV6A 3L09A 1HG5A 3P4SA 2BVMA 3I9WA 4TWFA 2MYSA 3PUXF 1YXRA 4HWIB 4AQYT 4IDNA 3NWIA 3P50A 4IGUA 1WLXA 4DMWA 2BG9B 3UU3A 2PJQA 5FXVA 3HI2A 1MIWA 2BDEA 5JREA 2E9XB 2JIWA 4COFA 3AE3A 4QXBB 4X64T 3UU5A 5EK2A 1WR0A 4H63H 4V1Av 4PW8A 4BJMA 2HN1A 4LMJA 5HXEA 2XSBA 1SUMB 3JC6C 4QKNA 1HFAA 3VRAA 3MKDA 3FB2A 3N9NA 3ZMVB 4DR5T 2V5DA 5LHGB 4HGAA 3ZMUB 4YJ3E 3ZMSB 2CHNA 3OVUA 5L3BB 4IDOA 2F4VT 3ZSSA 2WP9A 3RYFE 2PBIA 2ACZA 4UVAB 3KVAA 3FHNA 4C90A 4X66T 2V1DB 2XQ8A 3UFGA 4LF4T 4AI6A 1ZP0A 5LP6E 3A5XA 2BKNA 5JDQA 1IBKT 4H9RC 1LVKA 5LOVE 2XASB 4H9PC 3EHZA 2Y48B 3C4WA 5L3GB 1Z8UA 5KDMC 3O1HA 4PAGA 1OEDA 4U3CA 4TWHA 4YLHA 5JDGA 4HTEA 2FJAA 4DBRA 2CBIA 1U4QA 5LCYA 3AE7A 3TLWA 5AQHB 5FVLA 3RYHE 5JR9A 4PJLA 2LRKA 3EUHA 2H3RA 1NWMX 3RIUC 3AE4A 4DV3T 1IAPA 1ZV4X 2YKSA 5AQUB 5FNVE 3P4WA 3N9QA 3LBXB 4JBWF 5LG3A 2CA5A 3TLSA 3EAMA 4TWDA 4DUZT 3HKDE 3VU7H 3T8OA 3MK7C 2M6IA 2XJ7A 4LFBT 2NW9A 3ANWB 4B3RT 1CUNA 2KT9A 2OA5A 1H7CA 5ADXL 3LSVA 5FY0A 2X9WA 4DBQA 2D0UA 1SHZC 3CQGB 4ZS3A 3OTOT 2KWIB 4KUMB 4X1IE 4X62T 3LDQB 4JUYA 2BG9C 4GK5E 2NTXA 3CQCB 3KBUA 3KBTA 4U31A 3PUWF 2VKDA 3CVRA 5LHIB 2C5KT 3NRYA 3I1AA 5JTGA 2WCAA 4EOZB 4DNDA 2CXLA 3O1IA 5EZYE 1D1CA 3FZMB 2E9XD 3HKCE 1XMOT 2W00A 5JRCB 4JI1T 1XWMA 3I0OA 5CB4E 5CFBA 2WWUA 2VURA 1X9BA 3NRXA 3UU4A 3RC8A 1VOMA 2X0YA 4GYSA 4WZXA 4WYVA 4XAXB 4X5TA 5JDNA 3ETUA 2JPFA 2FUPA 3F57A 3SRZA 4P0AA 3E0ZA 4ZI7E 4B3TT 2P9BA 1W09A 4NXNT 2IDOB 3I0QA 2KLQA 2UUBT 4NUUA 5H6RB 2N2NA 4E7SA 4GIWA 3MACA 4QH4A 2HN2A 4YHHT 1E2AA 3PE0A 2VKHA 4IDZA 1JNRA 2X66A 5LMUT 4B3ST 1I6ZA 3AA7B 3GN5A 3TLVA 2BKPA 2V26A 4I43B 3Q5EA 4DR3T 4O4JE 4UF0A 3AE2A 2W4XA 2LKGA 5KMGP 3NVOA 2IIUA 3UUMA 3C51A 3K3QC 4H9NC 2I6HA 4I0UA 1GQEA 4PFOA 4KP3C 5AQTB 2L3LA 3RQUA 5AQVB 2XQ5A 4AKGA 2N1GA 5FY7A 4U7YA 4EGWA 1BR0A 1S35A 3FBLA 3N2OA 4HKAA 4O2BE 4JI7T 4U2ZA 5HXHA 3AVRA 2W66A 2IW5B 2I59A 1UCUA 2LOPA 2DCFA 1US7B 3RHWA 2BVLA 3AXJA 3UUXB 1UK5A 4EZHA 2XHEB 4EZ4A 3C50A 2CWOA 4QH5A 1MIYA 3DJBA 5AQGB 5AQOB 4YSZA 3DTOA 2MPKA 2M6BA 4IDPA 3ZCIA 2A9UA 2VL0A 5HEHA 4NXMT 1VRBA 5EK4A 5CJ5A 3F31A 2XAHB 1J5WA 1HX8A 5IYZE 2IAKA 3ZC1A 3P8CD 4EAHA 2BBHA 4PJMA 2XQYA 2KXPB 3M65A 4IL9A 3QB5A 4YXDA 2JMKA 2CBJA 2YDRA 1L0VA 4HFIA 3RKOA 2E9XA 2YU1A 3O4XE 2FBWA 5L3CB 5LHHB 2L9QA 4DR4T 4AQFC 3Q2MA 4B3MT 4EEBA 4TZ4C 3MA9A 5GONE 3UU8A 1YQ3A 3AAEB 2D9DA 1T8BA 4K0KT 2WQYA 3PURA 4DVDA 4IIJE 4ISTA 5BMVE 3NZQA 5AQRB 4CXXA 2C5IT 3OJAA 3AE9A 2LOSA 5FYMA 2LT3A 5LG4A 2WZIA 1NENA 3IHRA 3RLFF 4DUYT 4JI5T 1JNZA 3UUBA 3HL6A 4ZS2A 4N78D 4ILUA 3IBPA 5E0OA 2QRXA 3QC9A 4WW0A 4JEUB 4YFSA 4G63A 5LGUB 3C64A 2UXCT 2J47A 4HWHA 2KNDA 4OYJA
chains in the Genus database with same CATH topology
1N34T 1IBMT 4JI4T 4GKKT 2E5LT 4DV0T 4JI2T 4X64T 5BR8T 4LF6T 4JI3T 1N32T 2HHHT 1J5ET 2UUAT 2UXDT 1XMOT 4DV1T 4DR6T 2VQET 4JI7T 4DV4T 4DR4T 1N33T 4JI1T 4B3MT 1HNZT 3T1YT 4DR7T 4DV5T 4DR5T 4JI8T 4LFCT 1IBLT 4DV3T 4DV6T 4LF8T 4K0KT 1N36T 4DR1T 2ZM6T 2F4VT 1XMQT 4JV5T 4LF9T 2UXBT 4DUZT 4DR2T 4LFAT 4B3TT 4DV2T 4LFBT 2UU9T 4YY3T 4NXNT 1FJGT 4JYAT 1HNWT 4X66T 2UUBT 3T1HT 4B3RT 1XNRT 4DUYT 5LMNT 4LF4T 4JI5T 4X65T 2VQFT 2UUCT 4YHHT 1I94T 1HR0T 4NXMT 1XNQT 1HNXT 4LF7T 4KHPT 5IWAT 1IBKT 5LMUT 4B3ST 4OX9T 3OTOT 4X62T 4AQYT 4DR3T 2UXCT 4JI0T 4LF5T 4GKJT 4JI6T 4DV7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 T;  1IBM T;  4JI4 T;  4GKK T;  2E5L T;  4DV0 T;  4JI2 T;  4X64 T;  5BR8 T;  4LF6 T;  4JI3 T;  1N32 T;  2HHH T;  1J5E T;  2UUA T;  2UXD T;  1XMO T;  4DV1 T;  4DR6 T;  2VQE T;  4JI7 T;  4DV4 T;  4DR4 T;  1N33 T;  4JI1 T;  4B3M T;  1HNZ T;  3T1Y T;  4DR7 T;  4DV5 T;  4DR5 T;  4JI8 T;  4LFC T;  1IBL T;  4DV3 T;  4DV6 T;  4LF8 T;  4K0K T;  1N36 T;  4DR1 T;  2ZM6 T;  2F4V T;  1XMQ T;  4JV5 T;  4LF9 T;  2UXB T;  4DUZ T;  4DR2 T;  4LFA T;  4B3T T;  4DV2 T;  4LFB T;  2UU9 T;  4YY3 T;  4NXN T;  1FJG T;  4JYA T;  1HNW T;  4X66 T;  2UUB T;  3T1H T;  4B3R T;  1XNR T;  4DUY T;  5LMN T;  4LF4 T;  4JI5 T;  4X65 T;  2VQF T;  2UUC T;  4YHH T;  1I94 T;  1HR0 T;  4NXM T;  1XNQ T;  1HNX T;  4LF7 T;  4KHP T;  5IWA T;  1IBK T;  5LMU T;  4B3S T;  4OX9 T;  3OTO T;  4X62 T;  4AQY T;  4DR3 T;  2UXC T;  4JI0 T;  4LF5 T;  4GKJ T;  4JI6 T;  4DV7 T; 
#chains in the Genus database with same CATH topology
 3RYC E;  3ZST A;  1QLB A;  4I4T E;  3ZPO A;  3EDU A;  5M4Y A;  1OXZ A;  1MIV A;  2Z6E A;  2XM2 A;  5HYA A;  2HHH T;  1XZY A;  4EYY R;  2J1D G;  2UXD T;  5FXX A;  4U74 A;  5HWX A;  3B5M A;  4IE4 A;  1E1H B;  2V6Y B;  3JAD A;  4DV5 T;  5AQK B;  4WNK A;  4ZXL A;  2QGS A;  2XQ9 A;  2IUB A;  1IBL T;  2M67 A;  5AQL B;  4CN6 A;  2KIN B;  1CHU A;  4YTM A;  4CN1 A;  2VVN A;  1R8I A;  4LF9 T;  4OHF A;  3ZYK A;  2UXB T;  4LFA T;  3LBX A;  3RRC A;  2QA7 A;  2UU9 T;  1FEW A;  2CXD A;  3UQ7 A;  4U7I A;  1HNW T;  2IC9 A;  1XDP A;  2WY2 A;  2WDQ A;  2WM9 A;  3JC6 D;  3ANW A;  4KBM B;  2FJE A;  1NEK A;  5LA6 E;  3BQL A;  5IWA T;  2W62 A;  5LBQ B;  2YU2 A;  1ZOY A;  2DL1 A;  1AJ3 A;  4GOU A;  4QH1 A;  3ZKR A;  2EHO B;  3NKZ A;  5AQJ B;  3RYI E;  2E5L T;  4DV0 T;  4JI2 T;  3VKG A;  2WB5 A;  4O8S A;  2JMH A;  3Q5D A;  1G73 A;  4YHJ A;  2PTF A;  5LGT B;  3RF1 A;  2MBG A;  1ZHC A;  4QXC B;  3HR0 A;  4UVB B;  3NBX X;  3A7M A;  3CK6 A;  4ZI2 C;  4CI3 B;  3ZT7 A;  2ODU A;  1J1J A;  2HPJ A;  3SFE A;  4HFH A;  3ZMT B;  3ONL C;  2ZM2 A;  4DO0 A;  2W67 A;  1YW0 A;  3LK3 B;  4QX8 B;  3WAK A;  1V9D A;  3AEC A;  5LMN T;  5FVK A;  2VQF T;  4WBN E;  3CX8 B;  2J62 A;  4LMK A;  1I94 T;  3P4P A;  3H37 A;  1Y64 B;  3CML A;  2V7K A;  3R6N A;  3PUZ F;  1FMV A;  5L4H A;  2LSK A;  3N9M A;  5HWY A;  4YT0 A;  4OFZ A;  2LRL A;  3RH3 A;  4HFD A;  2JQQ A;  2Q9Q C;  1BR2 A;  2NWB A;  3EDV A;  3AVS A;  3RGL A;  2E5V A;  4IRE A;  1MMA A;  3JCF A;  4ZZB A;  5IHY A;  4BJN A;  5ABF A;  4CZZ B;  1WCR A;  4ZHQ E;  4LF6 T;  5FMN A;  4G2A A;  4P09 A;  4EIW A;  5J2U E;  2WSS V;  3TLT A;  3K8P C;  3G06 A;  4DR6 T;  3FXE B;  4B6X A;  2VKJ A;  2K48 A;  5FL1 A;  1U5P A;  4ILB A;  5JH7 E;  4UV8 B;  3UUN A;  5AQF B;  2YK0 A;  3HA4 A;  3F2E A;  4LML A;  4DV6 T;  2XAQ B;  3RKG A;  4HWC A;  3RIA A;  1OED E;  2H7V C;  4EYU A;  2DWG A;  2XPK A;  3N9L A;  3R84 B;  1DU2 A;  2E8I A;  1IZN B;  1MNE A;  4X1K E;  5L3E B;  3L3P A;  5F5W A;  2BZB A;  3O9X A;  4X65 T;  1OED B;  3AA6 B;  4ASK A;  2X0H A;  2K24 A;  3ZYM A;  3FZL B;  3AE8 A;  4ILC A;  2CM0 A;  4NIQ A;  4TN7 B;  4IE5 A;  2X51 A;  3BQK A;  3FXD B;  4J2C A;  2EHO C;  4X20 E;  2CRB A;  2JJ9 A;  4IDQ A;  4BAY B;  4DV7 T;  3K3N A;  4GKK T;  5LJN A;  2R6G F;  2LEH A;  2EHO D;  4HFB A;  4UV9 B;  2N9D A;  5EK3 A;  4I55 E;  1OWA A;  5FXW A;  2W61 A;  5LB7 B;  3H3A A;  1UGO A;  2BS4 A;  4Z8X A;  2LE8 A;  5HEG A;  4WBO A;  4DV4 T;  3LK2 B;  3I9Y A;  2XQ7 A;  4UIG A;  3T1Y T;  4DR7 T;  2JQ9 A;  1YQ4 A;  2XTL A;  3X1D A;  1S94 A;  2XQ3 A;  3B57 A;  4TNW A;  4XZC A;  4JV5 T;  3MZK B;  1QSD A;  2YOE A;  3OYZ A;  1HF8 A;  4DV2 T;  3V5U A;  1FJG T;  2ZM0 A;  3PJA A;  2LKH A;  3N2K E;  3J7Y q;  3AE5 A;  4QXH B;  3RIU A;  4ADZ A;  4LF7 T;  1BR4 A;  2XQ6 A;  2CLY C;  3FBZ A;  4L9I A;  2NR4 A;  3KIN B;  2WDR A;  1W0A A;  2HH7 A;  1WYB A;  1G8X A;  3QOF A;  4O4L E;  4PK5 A;  1VCT A;  2LSJ A;  3L39 A;  3HKE E;  4CXY A;  2DNX A;  3AEA A;  5AQP B;  4A56 A;  2AXD S;  4TUY E;  3P7I A;  2WBL A;  2X68 A;  2KSR A;  2W63 A;  3E08 A;  3FZF B;  4FI5 A;  5AQI B;  3PV0 F;  3MJX A;  1J5E T;  3KFW X;  4HN9 A;  2ZLY A;  2BG9 A;  3SFD A;  3B13 A;  2D0T A;  3PU8 A;  1MMG A;  2H88 A;  4AIS A;  2WZH A;  3RIF A;  3ABV A;  1M7K A;  1KNZ A;  4X1Y E;  2XAF B;  3LG7 A;  2L8K A;  3Q9D A;  2V7I A;  5LXT E;  3U78 A;  3CIR A;  5C8Y E;  3SS1 A;  1XMQ T;  1SA0 E;  2XQA A;  2LSY A;  2IML A;  2I0M A;  4UF0 B;  3EVY A;  1ZEE A;  3PUV F;  1OED C;  3M3Z B;  2V5C A;  1D1B A;  3QUJ A;  3ZJ2 A;  2C0S A;  3PUG A;  1KF6 A;  3PJA J;  5AQN B;  4O4I E;  2VWA A;  1B7T A;  3AED A;  5ABE A;  2WMO A;  1KNP A;  2LSI A;  4KMC A;  4YTP A;  2KWH A;  5KXJ A;  5ABH A;  4LF5 T;  2QYW A;  5AQM B;  5JR9 C;  2KZ7 B;  3BK9 A;  1UX4 A;  2W2U A;  3LFM A;  2XZE A;  3CQX C;  5CA1 E;  4IE6 A;  3RQW A;  2CHO A;  3OPC A;  1YD8 G;  3VHL A;  4JI3 T;  3ZN0 B;  5LNK A;  1HG2 A;  1ZKE A;  4MFR A;  5L3F B;  3SOL A;  2VQE T;  2Q9Q B;  2B76 A;  3UU6 A;  5HXR A;  2V8S V;  2NW8 A;  1KEY A;  4HWD A;  5DAB A;  1W0B A;  4UVC B;  3VR8 A;  4JLE A;  1BR1 A;  4MBQ A;  2YEV C;  4EXT A;  3KVB A;  4JI8 T;  1MND A;  1NAF A;  3EAB A;  4ILA A;  5DJQ C;  3VRB A;  5AQS B;  5LGN B;  4AKL A;  3JAE A;  4AIU A;  3KV4 A;  1O3X A;  2FJD A;  3IA3 A;  2X0L B;  4F6R C;  3QNU A;  2XUE A;  2H89 A;  2AE9 A;  2LM9 A;  2V7L A;  1HX1 B;  5DQV A;  2DI4 A;  5HXS A;  4IT4 A;  2X9Y A;  1LKX A;  2JQH A;  4UXN B;  2LM2 A;  4DID B;  2LJL A;  4MHC A;  4E7Z A;  1M62 A;  4IHJ E;  5F8P A;  1D1A A;  2WMN A;  3AA1 B;  5J2T E;  5KX5 E;  1LRZ A;  3ZT5 A;  2CWY A;  2DLR A;  3E22 E;  1WR6 A;  4KX6 A;  2VK9 A;  3V5S A;  3ONJ A;  2CMR A;  4IE7 A;  2C5J A;  1MMN A;  3ETV A;  1W9R A;  5H6Q B;  4JI6 T;  4KHZ F;  1IJ6 A;  2DWK A;  2NP9 A;  3TKL B;  2MOZ A;  3RPU A;  4U2Y A;  3NZP A;  3AEB A;  5HEO A;  2UXN B;  3FZH B;  2UUA T;  4HE8 A;  2VKO A;  1T72 A;  4DV1 T;  2OLT A;  2WU2 A;  2OV9 A;  1N33 T;  4AKR B;  3RRW A;  4TV9 E;  3ZCJ A;  5C2T A;  1QUU A;  3AE1 A;  2ZM8 A;  2JQK A;  3LJC A;  4O4H E;  3RC3 A;  1FMW A;  4EED A;  4CXW A;  4LF8 T;  3ZN1 B;  1YKH B;  1YKE B;  4C91 A;  4AXP A;  3ONX A;  4PFP A;  2LHR A;  5JRC A;  5AQQ B;  2D5U A;  4HFC A;  4YY3 T;  4YTN A;  4CI2 B;  4AQF A;  2YDQ A;  3PU3 A;  4PK4 A;  5FXZ A;  3GMI A;  3IEE A;  5JVD E;  2G0U A;  5JDM A;  4TX5 A;  4ZI3 C;  4YJ2 E;  2UUC T;  4NUV A;  4A98 A;  3CWZ B;  4YSY A;  2Y8D A;  5J0Z A;  1WRD A;  4ZI2 D;  1T98 A;  3FZK B;  5LBM A;  4OX9 T;  3AEG A;  3BQI A;  4ZI3 D;  4Z90 A;  3ESL A;  4AKH A;  4QHO A;  2BKO A;  4JI0 T;  3L8R A;  3ZYL A;  2X67 A;  4A5X A;  1IBM T;  2KMF A;  2D2S A;  2CLY B;  2X9H A;  2K9A A;  3UFE A;  4XBF B;  4PJJ A;  3AEE A;  4H9O C;  3JAF A;  2NTY A;  2NOX A;  2CE7 A;  5CA0 E;  3AB3 B;  3AAA B;  5L3D B;  2Q9Q D;  3CKD A;  5HCJ A;  5FY1 A;  4ZZC A;  4K0U A;  3OBV E;  2ZM6 T;  4TNV A;  3CX6 B;  1EZ3 A;  2CEA A;  2ZMA A;  2J4G A;  4MLK A;  4F8H A;  3PTR B;  4CI1 B;  5HEU A;  3KV5 A;  3S4U A;  2GK9 A;  2HPL A;  2E9X C;  2BBJ A;  2PFV A;  4HEA A;  1T7S A;  3PUQ A;  4A97 A;  3K1S A;  2A72 A;  2VAS A;  4TV8 E;  4HWF A;  2H7O A;  3N9O A;  5ABG A;  4FJO A;  3UTK A;  5HEJ A;  3RX6 A;  4Z91 A;  1HS7 A;  4GKJ T;  2Y6X A;  2ACX A;  5FP3 A;  3QB5 K;  4OYK A;  5JDH A;  3U3I A;  1D0X A;  3W15 B;  2ODV A;  5L2L A;  1D0Z A;  2YIN A;  3UUL A;  5A1L A;  5C3J A;  2CCQ A;  5JR9 B;  1HNZ T;  4ZEY A;  2QVA A;  4QWN B;  4P1N A;  2WWV A;  4AKI A;  4HFE A;  3Q5W A;  4I50 E;  3Q5X A;  2W0G A;  4LFC T;  1N36 T;  4L5G A;  5L47 A;  2WU5 A;  3AA0 B;  2JRK A;  1WYC A;  5L4E A;  2BS2 A;  2YN6 A;  4ERR A;  3WAJ A;  4NPP A;  3PUA A;  4JYA T;  1MMD A;  5FL0 A;  2V7M A;  2MAW A;  4H63 V;  2SPC A;  4PJN A;  3K3O A;  1XNQ T;  1Z0P A;  1HNX T;  1D0Y A;  2VB6 A;  4GK0 E;  5ETW A;  5ABF B;  4CQI A;  2XQ4 A;  4AQG A;  2IHR 1;  2RP4 A;  5HXC A;  2XAJ B;  4BA9 A;  4O2A E;  2XSA A;  4EB6 E;  1N34 T;  1Y01 A;  4L0R A;  5DQW A;  3IF8 B;  2B1E A;  3VKH A;  5AFU L;  3CX7 B;  1N32 T;  3GWH A;  2MTQ A;  1FIO A;  4U72 A;  2NW7 A;  2WDV A;  2V7J A;  3AAI A;  2Q9Q A;  3SWH A;  1UX5 A;  1UUS A;  4HFV A;  2RPA A;  4MAL A;  2RA1 A;  2BS3 A;  3ZEF B;  4DMV A;  4IE0 A;  3VR9 A;  1X79 A;  4UR9 A;  1KK7 A;  3N5L A;  4UEL A;  2LHN A;  4YSX A;  2XM1 A;  2LSG A;  3C98 B;  5IUX A;  4ANJ A;  3D0T A;  2A3D A;  4DR2 T;  4JEH B;  5TAO A;  3UT5 E;  2V6Y A;  5FKY A;  2WAU A;  2XAG B;  3QK6 A;  3T1H T;  3P4Q A;  4U33 A;  1SE7 A;  4Q25 A;  3GN5 B;  1IJ5 A;  2VL8 A;  2X9X A;  4PNI A;  4ZOL E;  4ISS A;  3C4Z A;  3GA8 A;  2YDS A;  3ZMZ B;  4P0B A;  3PUY F;  3ZC0 A;  4EV6 A;  3O1J A;  3PDY A;  3J9X 1;  2DHR A;  4QX7 B;  1KNR A;  3OKQ A;  2K5B B;  4JI4 T;  2K3W A;  2CPT A;  3P4R A;  3KV9 A;  3AE6 A;  3C4X A;  4M1P A;  3H3M A;  5JDF A;  5J1G A;  2IC6 A;  5HAX A;  3ZJ1 A;  4KI0 F;  5BR8 T;  2ES0 A;  3LK4 2;  3HKB E;  5LJM A;  1XDO A;  2A2F X;  1E7P A;  5CGM A;  3EI0 A;  4H9S E;  5LYJ E;  2PG8 A;  3KDS E;  2EHO A;  2UXX B;  1LVF A;  3UQ4 A;  2XY8 B;  1HCI A;  3AXJ B;  3MXZ A;  3ZLI A;  3TLU A;  3CPZ A;  1WFD A;  4OK0 A;  4DR1 T;  3N9P A;  3AEF A;  2E2A A;  3DP7 A;  1KFY A;  4PK6 A;  2V6X A;  4H9Q C;  5HCM A;  3PUS A;  2FJB A;  3A8Y C;  2WS3 A;  4UEM A;  3N2G E;  2VVS A;  3RI5 A;  4GYR A;  4CN4 A;  3WI3 A;  5F3J A;  1XNR T;  2CXF A;  1UUR A;  1HTJ F;  2BG9 E;  2LLY A;  4IL4 A;  1HR0 T;  3OYX A;  4KHP T;  5JQG E;  3ZT6 A;  5JDL A;  1VCS A;  3KV6 A;  3L09 A;  1HG5 A;  3P4S A;  2BVM A;  3I9W A;  4TWF A;  2MYS A;  3PUX F;  1YXR A;  4HWI B;  4AQY T;  4IDN A;  3NWI A;  3P50 A;  4IGU A;  1WLX A;  4DMW A;  2BG9 B;  3UU3 A;  2PJQ A;  5FXV A;  3HI2 A;  1MIW A;  2BDE A;  5JRE A;  2E9X B;  2JIW A;  4COF A;  3AE3 A;  4QXB B;  4X64 T;  3UU5 A;  5EK2 A;  1WR0 A;  4H63 H;  4V1A v;  4PW8 A;  4BJM A;  2HN1 A;  4LMJ A;  5HXE A;  2XSB A;  1SUM B;  3JC6 C;  4QKN A;  1HFA A;  3VRA A;  3MKD A;  3FB2 A;  3N9N A;  3ZMV B;  4DR5 T;  2V5D A;  5LHG B;  4HGA A;  3ZMU B;  4YJ3 E;  3ZMS B;  2CHN A;  3OVU A;  5L3B B;  4IDO A;  2F4V T;  3ZSS A;  2WP9 A;  3RYF E;  2PBI A;  2ACZ A;  4UVA B;  3KVA A;  3FHN A;  4C90 A;  4X66 T;  2V1D B;  2XQ8 A;  3UFG A;  4LF4 T;  4AI6 A;  1ZP0 A;  5LP6 E;  3A5X A;  2BKN A;  5JDQ A;  1IBK T;  4H9R C;  1LVK A;  5LOV E;  2XAS B;  4H9P C;  3EHZ A;  2Y48 B;  3C4W A;  5L3G B;  1Z8U A;  5KDM C;  3O1H A;  4PAG A;  1OED A;  4U3C A;  4TWH A;  4YLH A;  5JDG A;  4HTE A;  2FJA A;  4DBR A;  2CBI A;  1U4Q A;  5LCY A;  3AE7 A;  3TLW A;  5AQH B;  5FVL A;  3RYH E;  5JR9 A;  4PJL A;  2LRK A;  3EUH A;  2H3R A;  1NWM X;  3RIU C;  3AE4 A;  4DV3 T;  1IAP A;  1ZV4 X;  2YKS A;  5AQU B;  5FNV E;  3P4W A;  3N9Q A;  3LBX B;  4JBW F;  5LG3 A;  2CA5 A;  3TLS A;  3EAM A;  4TWD A;  4DUZ T;  3HKD E;  3VU7 H;  3T8O A;  3MK7 C;  2M6I A;  2XJ7 A;  4LFB T;  2NW9 A;  3ANW B;  4B3R T;  1CUN A;  2KT9 A;  2OA5 A;  1H7C A;  5ADX L;  3LSV A;  5FY0 A;  2X9W A;  4DBQ A;  2D0U A;  1SHZ C;  3CQG B;  4ZS3 A;  3OTO T;  2KWI B;  4KUM B;  4X1I E;  4X62 T;  3LDQ B;  4JUY A;  2BG9 C;  4GK5 E;  2NTX A;  3CQC B;  3KBU A;  3KBT A;  4U31 A;  3PUW F;  2VKD A;  3CVR A;  5LHI B;  2C5K T;  3NRY A;  3I1A A;  5JTG A;  2WCA A;  4EOZ B;  4DND A;  2CXL A;  3O1I A;  5EZY E;  1D1C A;  3FZM B;  2E9X D;  3HKC E;  1XMO T;  2W00 A;  5JRC B;  4JI1 T;  1XWM A;  3I0O A;  5CB4 E;  5CFB A;  2WWU A;  2VUR A;  1X9B A;  3NRX A;  3UU4 A;  3RC8 A;  1VOM A;  2X0Y A;  4GYS A;  4WZX A;  4WYV A;  4XAX B;  4X5T A;  5JDN A;  3ETU A;  2JPF A;  2FUP A;  3F57 A;  3SRZ A;  4P0A A;  3E0Z A;  4ZI7 E;  4B3T T;  2P9B A;  1W09 A;  4NXN T;  2IDO B;  3I0Q A;  2KLQ A;  2UUB T;  4NUU A;  5H6R B;  2N2N A;  4E7S A;  4GIW A;  3MAC A;  4QH4 A;  2HN2 A;  4YHH T;  1E2A A;  3PE0 A;  2VKH A;  4IDZ A;  1JNR A;  2X66 A;  5LMU T;  4B3S T;  1I6Z A;  3AA7 B;  3GN5 A;  3TLV A;  2BKP A;  2V26 A;  4I43 B;  3Q5E A;  4DR3 T;  4O4J E;  4UF0 A;  3AE2 A;  2W4X A;  2LKG A;  5KMG P;  3NVO A;  2IIU A;  3UUM A;  3C51 A;  3K3Q C;  4H9N C;  2I6H A;  4I0U A;  1GQE A;  4PFO A;  4KP3 C;  5AQT B;  2L3L A;  3RQU A;  5AQV B;  2XQ5 A;  4AKG A;  2N1G A;  5FY7 A;  4U7Y A;  4EGW A;  1BR0 A;  1S35 A;  3FBL A;  3N2O A;  4HKA A;  4O2B E;  4JI7 T;  4U2Z A;  5HXH A;  3AVR A;  2W66 A;  2IW5 B;  2I59 A;  1UCU A;  2LOP A;  2DCF A;  1US7 B;  3RHW A;  2BVL A;  3AXJ A;  3UUX B;  1UK5 A;  4EZH A;  2XHE B;  4EZ4 A;  3C50 A;  2CWO A;  4QH5 A;  1MIY A;  3DJB A;  5AQG B;  5AQO B;  4YSZ A;  3DTO A;  2MPK A;  2M6B A;  4IDP A;  3ZCI A;  2A9U A;  2VL0 A;  5HEH A;  4NXM T;  1VRB A;  5EK4 A;  5CJ5 A;  3F31 A;  2XAH B;  1J5W A;  1HX8 A;  5IYZ E;  2IAK A;  3ZC1 A;  3P8C D;  4EAH A;  2BBH A;  4PJM A;  2XQY A;  2KXP B;  3M65 A;  4IL9 A;  3QB5 A;  4YXD A;  2JMK A;  2CBJ A;  2YDR A;  1L0V A;  4HFI A;  3RKO A;  2E9X A;  2YU1 A;  3O4X E;  2FBW A;  5L3C B;  5LHH B;  2L9Q A;  4DR4 T;  4AQF C;  3Q2M A;  4B3M T;  4EEB A;  4TZ4 C;  3MA9 A;  5GON E;  3UU8 A;  1YQ3 A;  3AAE B;  2D9D A;  1T8B A;  4K0K T;  2WQY A;  3PUR A;  4DVD A;  4IIJ E;  4IST A;  5BMV E;  3NZQ A;  5AQR B;  4CXX A;  2C5I T;  3OJA A;  3AE9 A;  2LOS A;  5FYM A;  2LT3 A;  5LG4 A;  2WZI A;  1NEN A;  3IHR A;  3RLF F;  4DUY T;  4JI5 T;  1JNZ A;  3UUB A;  3HL6 A;  4ZS2 A;  4N78 D;  4ILU A;  3IBP A;  5E0O A;  2QRX A;  3QC9 A;  4WW0 A;  4JEU B;  4YFS A;  4G63 A;  5LGU B;  3C64 A;  2UXC T;  2J47 A;  4HWH A;  2KND A;  4OYJ A; 
#chains in the Genus database with same CATH homology
 1N34 T;  1IBM T;  4JI4 T;  4GKK T;  2E5L T;  4DV0 T;  4JI2 T;  4X64 T;  5BR8 T;  4LF6 T;  4JI3 T;  1N32 T;  2HHH T;  1J5E T;  2UUA T;  2UXD T;  1XMO T;  4DV1 T;  4DR6 T;  2VQE T;  4JI7 T;  4DV4 T;  4DR4 T;  1N33 T;  4JI1 T;  4B3M T;  1HNZ T;  3T1Y T;  4DR7 T;  4DV5 T;  4DR5 T;  4JI8 T;  4LFC T;  1IBL T;  4DV3 T;  4DV6 T;  4LF8 T;  4K0K T;  1N36 T;  4DR1 T;  2ZM6 T;  2F4V T;  1XMQ T;  4JV5 T;  4LF9 T;  2UXB T;  4DUZ T;  4DR2 T;  4LFA T;  4B3T T;  4DV2 T;  4LFB T;  2UU9 T;  4YY3 T;  4NXN T;  1FJG T;  4JYA T;  1HNW T;  4X66 T;  2UUB T;  3T1H T;  4B3R T;  1XNR T;  4DUY T;  5LMN T;  4LF4 T;  4JI5 T;  4X65 T;  2VQF T;  2UUC T;  4YHH T;  1I94 T;  1HR0 T;  4NXM T;  1XNQ T;  1HNX T;  4LF7 T;  4KHP T;  5IWA T;  1IBK T;  5LMU T;  4B3S T;  4OX9 T;  3OTO T;  4X62 T;  4AQY T;  4DR3 T;  2UXC T;  4JI0 T;  4LF5 T;  4GKJ T;  4JI6 T;  4DV7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...