4DV3T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv3T00
5IWAT 1HR0T 4JI8T 4JI7T 3OTOT 4YHHT 4X65T 4DR4T 4B3MT 1XNRT 1XNQT 4LF7T 4DV7T 4X62T 1HNXT 1N34T 1J5ET 5LMUT 5LMNT 4DV5T 4LFBT 2UXCT 4LFCT 4DUZT 4DV1T 1XMQT 1N36T 4JI4T 3T1HT 4DR6T 4GKKT 4DR1T 4JI5T 1FJGT 4DV4T 2UUBT 4JV5T 4JI0T 4B3TT 4LF4T 2VQET 1HNWT 4GKJT 4NXMT 2F4VT 4DR3T 1N33T 4LF8T 4X64T 4DUYT 4NXNT 2UXDT 1IBMT 2UUCT 4JI6T 4JYAT 2ZM6T 4DR2T 4KHPT 4B3RT 5BR8T 4X66T 4DR5T 1IBKT 2VQFT 2UU9T 4B3ST 4DR7T 4DV2T 2HHHT 4DV0T 4YY3T 4LF5T 2UUAT 4DV3T 3T1YT 4LF9T 4JI3T 1N32T 4JI1T 1HNZT 1XMOT 2E5LT 4LF6T 2UXBT 4AQYT 1I94T 1IBLT 4K0KT 4DV6T 4JI2T 4LFAT 4OX9T
chains in the Genus database with same CATH superfamily
5FYMA 2FBWA 1NENA 2WBLA 5EK2A 4AISA 2WMOA 4OHFA 4U72A 5HXEA 2UXNB 2BG9C 2HN2A 4JI7T 2LSIA 1D1CA 2XAHB 4JEUB 3JAEA 1XDPA 1T98A 1W9RA 1JNRA 5LBQB 3RIUA 3MACA 5JDGA 4CXXA 1D0XA 5ABGA 3ZMZB 1XNQT 4LF7T 2C0SA 2OA5A 3RIFA 3Q5DA 3QB5A 3ESLA 1ZV4X 2LSYA 4WNKA 5EZYE 3NZQA 1UGOA 2VKJA 3RKOA 4X62T 2WAUA 4GIWA 2L9QA 4KUMB 4IE4A 2XQ7A 3AE4A 3O1HA 5AQIB 4A5XA 4AQFC 4H63H 2H7VC 1MMNA 2JQHA 3SFDA 3UUXB 1Y01A 5JR9A 1LKXA 4IREA 3FZKB 4BA9A 4HTEA 4Q25A 4EYUA 5LBMA 2V6YB 4C90A 3I1AA 1WR0A 2QA7A 2BG9E 2N9DA 4IE5A 2UXCT 2XSAA 5A1LA 4LFBT 2NTYA 3O1JA 4YTPA 3AA1B 1M62A 1BR1A 2X0HA 4DMWA 4DUZT 3RIUC 5KDMC 2YEVC 2XQ9A 1UX4A 4FJOA 5CB4E 2RA1A 2W62A 2MAWA 4PJJA 1LVKA 3OJAA 5ABFA 3ZKRA 4DR1T 3UUMA 3KVAA 4IIJE 4QX7B 2UUBT 2NW7A 2DL1A 5FY1A 4JI0T 2HPLA 3VR9A 4HFHA 5CFBA 4UVCB 4DBRA 2VQET 3IHRA 5FXVA 1QLBA 1WLXA 3HKDE 4GKJT 3O4XE 2Y6XA 3SWHA 5L3FB 1IJ6A 2Y8DA 2X9YA 2VL0A 2XAGB 2YDQA 1CUNA 3N9LA 4DVDA 1NEKA 4ZI7E 2X51A 4DR3T 4IE0A 3QNUA 3J9X1 4NUUA 5TAOA 3Q5EA 2QVAA 3AE6A 3PE0A 5HXSA 4X64T 4YHHT 3AE1A 3E0ZA 2CEAA 3HR0A 1FIOA 1IBMT 5JDQA 3GA8A 2MBGA 5C2TA 4IL4A 1E7PA 3KV4A 3S4UA 2NOXA 4UEMA 3P4QA 4M1PA 2NW9A 3OYZA 4ZEYA 1VCTA 3RGLA 4DBQA 2BDEA 3A7MA 4TV8E 3CMLA 3N9OA 2PFVA 2VKOA 2X68A 1UUSA 2ZM0A 3AECA 3CX8B 3NWIA 4HN9A 4I4TE 3A8YC 4HFIA 4ZI3D 4OYJA 1WRDA 2K3WA 4KHPT 3RF1A 5LXTE 2Q9QD 2BVMA 4CN6A 1QSDA 5JDHA 3ONXA 3J7Yq 4O4IE 4V1Av 4OK0A 2KMFA 3MK7C 3TLSA 3UULA 4HWFA 1HCIA 1XZYA 3PUQA 5F3JA 5HXCA 3ZC0A 1VRBA 1ZEEA 5L47A 2DLRA 2KWIB 2WWVA 2UU9T 3PDYA 2BG9A 4EIWA 1ZP0A 3A5XA 3RYIE 5CJ5A 3AXJA 3V5SA 3C51A 2HHHT 1E1HB 4DV0T 3JC6D 2E5VA 3KDSE 2LHRA 3UU5A 1SA0E 5IHYA 3ZC1A 2LM2A 3AE9A 2LRKA 3D0TA 5H6QB 2XZEA 2LSJA 5M4YA 4LF5T 3ZLIA 2K24A 2UUAT 4E7SA 2D5UA 4HGAA 4BJMA 5L4HA 4U7YA 2X9WA 4YJ3E 3ZCJA 1MMAA 5FMNA 4DV3T 1MIVA 2ACXA 4LF9T 2C5IT 3ZT7A 4ZZBA 2KWHA 5JQGE 2MOZA 2LRLA 3SOLA 3PUYF 3RKGA 1HNZT 1XMOT 3QOFA 2KSRA 5F8PA 2IW5B 3PJAA 5AQUB 3AA7B 5L3EB 4X1KE 4HFBA 3AE3A 4LF6T 1KF6A 4HWCA 2XY8B 3TLUA 4DUYT 1D0YA 3R6NA 5FXZA 2OLTA 3AE2A 4QX8B 3B57A 3AEEA 2YK0A 3AA0B 3PUGA 4LMKA 2MTQA 1MIYA 2ACZA 2UXXB 1IBLT 3AAAB 4U7IA 1HF8A 5HCJA 4CN4A 5LHHB 2HH7A 3AE7A 3FBZA 4ZHQE 4LFAT 2XJ7A 3LFMA 2NR4A 4CI1B 1VCSA 2V7LA 1HR0T 2LLYA 2NWBA 1XDOA 4O4LE 1JNZA 3KBUA 4NUVA 5E0OA 4QXBB 2V7KA 2D0TA 2X9HA 3ETVA 2IC6A 1UK5A 3AEAA 2V26A 3RRCA 4ZOLE 2VASA 2PTFA 4G2AA 2KXPB 4MLKA 2WM9A 5J1GA 4B3MT 1XNRT 1ZKEA 1YD8G 2QGSA 1N36T 4DV7T 4JI4T 1NWMX 3FZLB 4IDNA 2A9UA 5L4EA 3C64A 2C5KT 4WYVA 2FJAA 2WB5A 1HNXT 3ZEFB 3ZJ2A 3ZSSA 1J5ET 3IF8B 5HEUA 3K8PC 2W00A 2D9DA 3OBVE 2Z6EA 4X1YE 2W61A 5LMNT 2AE9A 3KV5A 4KX6A 3UT5E 3ANWB 3N2KE 3IBPA 4H9PC 2YN6A 4QWNB 2WDQA 3SS1A 2V8SV 4H9RC 5FXWA 3EABA 2A3DA 2E8IA 1WFDA 2VKHA 3AVRA 4O2BE 3UUNA 2H7OA 4KHZF 2N2NA 4JLEA 5JTGA 1W0BA 4ISTA 3HKBE 1IAPA 3X1DA 3O9XA 4DIDB 2BS2A 4F6RC 4YT0A 3CKDA 4DV1T 3VR8A 1OEDC 1G8XA 5ABHA 3P7IA 2KLQA 3LK42 1W09A 3CIRA 3N9MA 4TWDA 4WBNE 4DR6T 4GKKT 2ODUA 2B76A 1T72A 1S94A 2Q9QC 1FJGT 5FY0A 2LJLA 3CX6B 1BR4A 2M6IA 3IA3A 3P4WA 2CBJA 2DWKA 2LOPA 4PK5A 5FVLA 3ZJ1A 3ZMTB 4EOZB 5HEJA 4LF4T 3E08A 4NXMT 2SPCA 4YHJA 3UQ7A 1UX5A 2L3LA 2YOEA 3KV9A 3LK3B 2J47A 1BR2A 2V6XA 3RRWA 2PBIA 3I9YA 4IDQA 1U4QA 2DNXA 2FJEA 4HFCA 5C8YE 2LEHA 3G06A 3WAJA 4P0AA 2M67A 4NXNT 2E9XC 2IHR1 2AXDS 2PG8A 1B7TA 2MYSA 3FHNA 3JC6C 4HKAA 5LG4A 3AEDA 2R6GF 2ZM2A 2PJQA 2X67A 2XASB 2B1EA 4IE6A 4KBMB 4HWDA 1MMDA 3M3ZB 4PFPA 2BZBA 2LE8A 5DQWA 4UR9A 2XUEA 4L0RA 5FXXA 5CA1E 4EEBA 3K1SA 2VVNA 5LP6E 4PNIA 5JH7E 1HFAA 4QH4A 3RYCE 3SRZA 4LMLA 3PU3A 4EB6E 4ZI2D 5BR8T 1IJ5A 5AQVB 2BKNA 3OYXA 4AKIA 1Z0PA 5JR9C 5IUXA 2NW8A 3N9NA 3PUWF 3CQXC 4DR5T 5IYZE 2WZHA 5AQHB 2XPKA 2Q9QB 3HL6A 1VOMA 5AQLB 5JR9B 4Z91A 1UCUA 4B3ST 5LJMA 3LJCA 4DR7T 4HFVA 1MNDA 3AEFA 1HG2A 3DP7A 4TUYE 3RLFF 2H88A 4UF0A 3AEGA 4CZZB 5L3CB 4CXWA 5LGNB 2YKSA 4YJ2E 3C98B 5L2LA 4QXCB 2KZ7B 3OPCA 3UFGA 1IZNB 1OWAA 1S35A 3FB2A 4YSYA 4O8SA 1WYBA 3MA9A 3VKGA 3LG7A 3T1YT 3AAEB 3C4ZA 5FKYA 4YTNA 2P9BA 5HWXA 2CXDA 4HFDA 1J5WA 1D0ZA 3LBXA 4HEAA 5ABFB 3F31A 4JI3T 3FXEB 4LMJA 4JI1T 3LSVA 2V1DB 2BBJA 2H3RA 3GN5A 2HPJA 4MHCA 3PURA 2EHOB 4IT4A 3PV0F 4B3RT 3OKQA 4PK4A 2VB6A 4DMVA 2JQ9A 5ETWA 2BBHA 5FY7A 5LJNA 1YQ4A 2EHOC 3GN5B 3BQKA 4HFEA 5FL0A 2XAQB 1XMQT 3ZSTA 5LHIB 3HA4A 4C91A 4TV9E 4ZXLA 3PJAJ 1OXZA 2CLYB 3JAFA 4O4JE 3RQWA 4OX9T 2Q9QA 4XBFB 2ZMAA 2LM9A 4JI8T 5JRCB 1KNZA 4GK0E 3MJXA 2CPTA 3OTOT 2IAKA 2ZLYA 2E9XB 4UF0B 3WAKA 3ZN0B 1ZOYA 3H3AA 3ZPOA 4A56A 4QXHB 4COFA 5LHGB 4JUYA 4TWFA 4YLHA 5AQNB 5HYAA 4GYSA 1UURA 4KMCA 3L3PA 5AQRB 3WI3A 3P4SA 2IDOB 4UVAB 4ANJA 3NRYA 1I6ZA 3KINB 4A98A 4GYRA 5HEOA 4IDZA 4DNDA 2CXFA 1FEWA 4EZHA 3BK9A 1N34T 4TWHA 3N9PA 4X5TA 4UV8B 5LMUT 2XQ8A 2XM1A 3PUSA 4MBQA 5BMVE 2V7JA 4Z90A 2NP9A 3PTRB 2H89A 4TN7B 4PJLA 3KBTA 4U2YA 5AQSB 4U74A 5AQGB 4WW0A 1OEDB 2BS3A 5HEHA 5JVDE 4CQIA 4HWIB 2V7MA 4AXPA 2IC9A 4DO0A 4LFCT 2I59A 2XQ3A 4IHJE 3UTKA 4BJNA 3N2GE 3GMIA 3RC3A 3RC8A 3W15B 2WP9A 1OEDA 2CLYC 2XQ4A 3C4WA 3CQGB 3QUJA 3UUBA 3RIAA 3ZN1B 4TNWA 4OFZA 2WZIA 4O2AE 5J2UE 3EUHA 2CXLA 2DCFA 1X9BA 2ODVA 4IL9A 4ZI2C 4I50E 5LCYA 2NTXA 4ISSA 5KMGP 3T8OA 1X79A 1E2AA 4TNVA 3AEBA 1LRZA 2LSKA 2WY2A 2F4VT 3AVSA 3RPUA 3U3IA 4CI2B 2JMHA 3VHLA 2CWYA 4XZCA 2L8KA 1YQ3A 4LF8T 3ONLC 3ZCIA 4ERRA 2UXDT 2XSBA 1ZHCA 4EGWA 2WU2A 1YXRA 3H37A 3NKZA 1D1BA 4P0BA 5LYJE 5L3BB 3FZFB 2UUCT 3Q2MA 3CPZA 1G73A 2WCAA 4ILAA 4JYAT 3BQIA 2CA5A 4ZI3C 2EHOA 1H7CA 3FZMB 2KNDA 2DI4A 1O3XA 1BR0A 3C50A 4PK6A 2CBIA 4EZ4A 3DTOA 3L8RA 1KNPA 2VKDA 2WQYA 3EAMA 3MKDA 5CA0E 4PFOA 5HXHA 5KXJA 3PUVF 2J4GA 4L9IA 5AQOB 2V7IA 2D2SA 2JPFA 4ILBA 2G0UA 5J2TE 2WSSV 1WCRA 4PAGA 2XQYA 2C5JA 2W67A 3I0OA 2WDRA 4CN1A 3RYFE 2XAFB 3JCFA 4ZS3A 3RYHE 3EDVA 2X9XA 2XHEB 5LB7B 4TX5A 4YY3T 5DQVA 2I0MA 4GK5E 4QHOA 2E9XA 3NZPA 5C3JA 2K9AA 3H3MA 3V5UA 2YU2A 3TLWA 2K48A 4UIGA 4AKHA 3ZYLA 1KEYA 2W4XA 3FXDB 5CGMA 3AA6B 4PW8A 2YINA 3CWZB 3ZMVB 2BKOA 2EHOD 2J62A 4QH1A 3TLVA 1R8IA 2VK9A 3LDQB 4EXTA 1AJ3A 1HX8A 1YKHB 3I9WA 3OVUA 2XTLA 3GWHA 5AQPB 1T8BA 2CHOA 2E5LT 4TZ4C 5JDMA 2J1DG 2VVSA 4NIQA 2VURA 2V5DA 1XWMA 2FJBA 4IDOA 2IMLA 1QUUA 2E2AA 2XQ6A 4H63V 4H9SE 3RHWA 4AQYT 2UXBT 4KP3C 1HG5A 1Y64B 3CVRA 2XQ5A 3KFWX 3QC9A 3HKCE 2DHRA 4O4HE 4Z8XA 2JQQA 3AXJB 3HKEE 5EK3A 2CMRA 3AE8A 3HI2A 2QYWA 4AKRB 1OEDE 2QRXA 3MZKB 2BS4A 3F57A 1KFYA 3UU6A 5JREA 1V9DA 2VWAA 5HEGA 5IWAT 1W0AA 2BKPA 1J1JA 2WMNA 3I0QA 4U33A 3EDUA 4I43B 3ZT6A 2LOSA 1HS7A 4PJMA 4MALA 4CXYA 3PUAA 3N5LA 1EZ3A 4QKNA 2W66A 5LA6E 4BAYB 5ADXL 4X65T 4DR4T 3VKHA 2LKHA 2X0LB 1LVFA 3ZYKA 2LHNA 4YSXA 4EYYR 3UQ4A 4AQFA 3K3NA 4ILUA 2BVLA 2W2UA 2X0YA 4U3CA 4YXDA 5J0ZA 4IE7A 3P4RA 3ETUA 4HE8A 3N2OA 3L39A 2D0UA 3K3QC 3VRBA 4ILCA 4YFSA 2IIUA 3CK6A 3VU7H 3MXZA 4AIUA 4EAHA 3PUXF 4ZZCA 5KX5E 4NPPA 5L3DB 3DJBA 5AQJB 4JEHB 5H6RB 2W0GA 3EI0A 4YTMA 4ADZA 5LG3A 4ZS2A 4DV5T 3K3OA 2XQAA 5AQKB 4GOUA 2CE7A 1SHZC 5JDFA 1NAFA 1SUMB 2JIWA 1WR6A 2W63A 3BQLA 3R84B 2N1GA 4E7ZA 2A2FX 1HTJF 4WZXA 5L3GB 4HWHA 2YDSA 4EEDA 3T1HT 4JI5T 5JDLA 4KI0F 3ANWA 4DV4T 4JV5T 1KNRA 2CCQA 3Q5XA 4B3TT 5AQMB 2WWUA 3ZYMA 4ASKA 3FBLA 1HNWT 1FMWA 3N9QA 5DJQC 3VRAA 3FZHB 1SE7A 5FL1A 4U2ZA 4AKLA 2K5BB 2X66A 3ABVA 2A72A 3NVOA 3P4PA 4I55E 3NBXX 5AFUL 3Q9DA 1M7KA 2YDRA 4P09A 1T7SA 2M6BA 4WBOA 1N33T 2Y48B 1YW0A 2ZM8A 5FNVE 2LKGA 5FVKA 3IEEA 3UU8A 4L5GA 4YSZA 1MNEA 5AQFB 4H9NC 4AI6A 3NRXA 4XAXB 3RI5A 5HCMA 3B13A 2GK9A 4UV9B 5DABA 3RQUA 2JMKA 1L0VA 4JBWF 3F2EA 3P50A 2CRBA 3JADA 3KV6A 1MIWA 3QK6A 2ZM6T 4DR2T 3RX6A 2LSGA 2CM0A 2I6HA 1HX1B 1U5PA 3ZMUB 2KT9A 2WS3A 3CX7B 4U31A 4JI6T 3O1IA 3TKLB 3UFEA 3QB5K 4F8HA 5GONE 4I0UA 2RPAA 2FJDA 4UELA 2XM2A 3ZMSB 4CI3B 1GQEA 3ONJA 3P8CD 3UU4A 3PU8A 1IBKT 2WDVA 2CWOA 3EHZA 2VQFT 3Q5WA 1DU2A 5HAXA 1WYCA 4K0UA 2JQKA 3M65A 3TLTA 2JRKA 2MPKA 4A97A 4DV2T 4UXNB 4X1IE 5EK4A 2JJ9A 3AB3B 4G63A 3CQCB 3LK2B 2IUBA 1FMVA 1KK7A 2YU1A 5F5WA 5AQTB 5JRCA 2XAJB 1CHUA 2LT3A 1Z8UA 4AKGA 2WU5A 3ZT5A 1D1AA 1YKEB 2VL8A 4H9OC 4J2CA 4QH5A 2CHNA 2V6YA 5HXRA 2RP4A 5JDNA 4IDPA 3U78A 5LNKA 4X66T 1N32T 4P1NA 5AQQB 4AQGA 4MFRA 4FI5A 4N78D 2E9XD 3AAIA 3L09A 5FP3A 3AE5A 4H9QC 3UU3A 4EV6A 2KINB 3EVYA 3PUZF 4UVBB 1MMGA 4OYKA 2OV9A 2ES0A 2V5CA 4IGUA 5HWYA 3B5MA 5LGUB 3E22E 4PJNA 2HN1A 2DWGA 2FUPA 4X20E 5LGTB 1I94T 1US7B 3C4XA 3LBXB 3RH3A 4K0KT 4DV6T 5LOVE 4JI2T 3KVBA 3SFEA 4B6XA 2BG9B 5ABEA
chains in the Genus database with same CATH topology
5IWAT 1HR0T 4JI8T 4JI7T 3OTOT 4YHHT 4X65T 4DR4T 4B3MT 1XNRT 1XNQT 4LF7T 4DV7T 4X62T 1HNXT 1N34T 1J5ET 5LMUT 5LMNT 4DV5T 4LFBT 2UXCT 4LFCT 4DUZT 4DV1T 1XMQT 1N36T 4JI4T 3T1HT 4DR6T 4GKKT 4DR1T 4JI5T 1FJGT 4DV4T 2UUBT 4JV5T 4JI0T 4B3TT 4LF4T 2VQET 1HNWT 4GKJT 4NXMT 2F4VT 4DR3T 1N33T 4LF8T 4X64T 4DUYT 4NXNT 2UXDT 1IBMT 2UUCT 4JI6T 4JYAT 2ZM6T 4DR2T 4KHPT 4B3RT 5BR8T 4X66T 4DR5T 1IBKT 2VQFT 2UU9T 4B3ST 4DR7T 4DV2T 2HHHT 4DV0T 4YY3T 4LF5T 2UUAT 4DV3T 3T1YT 4LF9T 4JI3T 1N32T 4JI1T 1HNZT 1XMOT 2E5LT 4LF6T 2UXBT 4AQYT 1I94T 1IBLT 4K0KT 4DV6T 4JI2T 4LFAT 4OX9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA T;  1HR0 T;  4JI8 T;  4JI7 T;  3OTO T;  4YHH T;  4X65 T;  4DR4 T;  4B3M T;  1XNR T;  1XNQ T;  4LF7 T;  4DV7 T;  4X62 T;  1HNX T;  1N34 T;  1J5E T;  5LMU T;  5LMN T;  4DV5 T;  4LFB T;  2UXC T;  4LFC T;  4DUZ T;  4DV1 T;  1XMQ T;  1N36 T;  4JI4 T;  3T1H T;  4DR6 T;  4GKK T;  4DR1 T;  4JI5 T;  1FJG T;  4DV4 T;  2UUB T;  4JV5 T;  4JI0 T;  4B3T T;  4LF4 T;  2VQE T;  1HNW T;  4GKJ T;  4NXM T;  2F4V T;  4DR3 T;  1N33 T;  4LF8 T;  4X64 T;  4DUY T;  4NXN T;  2UXD T;  1IBM T;  2UUC T;  4JI6 T;  4JYA T;  2ZM6 T;  4DR2 T;  4KHP T;  4B3R T;  5BR8 T;  4X66 T;  4DR5 T;  1IBK T;  2VQF T;  2UU9 T;  4B3S T;  4DR7 T;  4DV2 T;  2HHH T;  4DV0 T;  4YY3 T;  4LF5 T;  2UUA T;  4DV3 T;  3T1Y T;  4LF9 T;  4JI3 T;  1N32 T;  4JI1 T;  1HNZ T;  1XMO T;  2E5L T;  4LF6 T;  2UXB T;  4AQY T;  1I94 T;  1IBL T;  4K0K T;  4DV6 T;  4JI2 T;  4LFA T;  4OX9 T; 
#chains in the Genus database with same CATH topology
 5FYM A;  2FBW A;  1NEN A;  2WBL A;  5EK2 A;  4AIS A;  2WMO A;  4OHF A;  4U72 A;  5HXE A;  2UXN B;  2BG9 C;  2HN2 A;  4JI7 T;  2LSI A;  1D1C A;  2XAH B;  4JEU B;  3JAE A;  1XDP A;  1T98 A;  1W9R A;  1JNR A;  5LBQ B;  3RIU A;  3MAC A;  5JDG A;  4CXX A;  1D0X A;  5ABG A;  3ZMZ B;  1XNQ T;  4LF7 T;  2C0S A;  2OA5 A;  3RIF A;  3Q5D A;  3QB5 A;  3ESL A;  1ZV4 X;  2LSY A;  4WNK A;  5EZY E;  3NZQ A;  1UGO A;  2VKJ A;  3RKO A;  4X62 T;  2WAU A;  4GIW A;  2L9Q A;  4KUM B;  4IE4 A;  2XQ7 A;  3AE4 A;  3O1H A;  5AQI B;  4A5X A;  4AQF C;  4H63 H;  2H7V C;  1MMN A;  2JQH A;  3SFD A;  3UUX B;  1Y01 A;  5JR9 A;  1LKX A;  4IRE A;  3FZK B;  4BA9 A;  4HTE A;  4Q25 A;  4EYU A;  5LBM A;  2V6Y B;  4C90 A;  3I1A A;  1WR0 A;  2QA7 A;  2BG9 E;  2N9D A;  4IE5 A;  2UXC T;  2XSA A;  5A1L A;  4LFB T;  2NTY A;  3O1J A;  4YTP A;  3AA1 B;  1M62 A;  1BR1 A;  2X0H A;  4DMW A;  4DUZ T;  3RIU C;  5KDM C;  2YEV C;  2XQ9 A;  1UX4 A;  4FJO A;  5CB4 E;  2RA1 A;  2W62 A;  2MAW A;  4PJJ A;  1LVK A;  3OJA A;  5ABF A;  3ZKR A;  4DR1 T;  3UUM A;  3KVA A;  4IIJ E;  4QX7 B;  2UUB T;  2NW7 A;  2DL1 A;  5FY1 A;  4JI0 T;  2HPL A;  3VR9 A;  4HFH A;  5CFB A;  4UVC B;  4DBR A;  2VQE T;  3IHR A;  5FXV A;  1QLB A;  1WLX A;  3HKD E;  4GKJ T;  3O4X E;  2Y6X A;  3SWH A;  5L3F B;  1IJ6 A;  2Y8D A;  2X9Y A;  2VL0 A;  2XAG B;  2YDQ A;  1CUN A;  3N9L A;  4DVD A;  1NEK A;  4ZI7 E;  2X51 A;  4DR3 T;  4IE0 A;  3QNU A;  3J9X 1;  4NUU A;  5TAO A;  3Q5E A;  2QVA A;  3AE6 A;  3PE0 A;  5HXS A;  4X64 T;  4YHH T;  3AE1 A;  3E0Z A;  2CEA A;  3HR0 A;  1FIO A;  1IBM T;  5JDQ A;  3GA8 A;  2MBG A;  5C2T A;  4IL4 A;  1E7P A;  3KV4 A;  3S4U A;  2NOX A;  4UEM A;  3P4Q A;  4M1P A;  2NW9 A;  3OYZ A;  4ZEY A;  1VCT A;  3RGL A;  4DBQ A;  2BDE A;  3A7M A;  4TV8 E;  3CML A;  3N9O A;  2PFV A;  2VKO A;  2X68 A;  1UUS A;  2ZM0 A;  3AEC A;  3CX8 B;  3NWI A;  4HN9 A;  4I4T E;  3A8Y C;  4HFI A;  4ZI3 D;  4OYJ A;  1WRD A;  2K3W A;  4KHP T;  3RF1 A;  5LXT E;  2Q9Q D;  2BVM A;  4CN6 A;  1QSD A;  5JDH A;  3ONX A;  3J7Y q;  4O4I E;  4V1A v;  4OK0 A;  2KMF A;  3MK7 C;  3TLS A;  3UUL A;  4HWF A;  1HCI A;  1XZY A;  3PUQ A;  5F3J A;  5HXC A;  3ZC0 A;  1VRB A;  1ZEE A;  5L47 A;  2DLR A;  2KWI B;  2WWV A;  2UU9 T;  3PDY A;  2BG9 A;  4EIW A;  1ZP0 A;  3A5X A;  3RYI E;  5CJ5 A;  3AXJ A;  3V5S A;  3C51 A;  2HHH T;  1E1H B;  4DV0 T;  3JC6 D;  2E5V A;  3KDS E;  2LHR A;  3UU5 A;  1SA0 E;  5IHY A;  3ZC1 A;  2LM2 A;  3AE9 A;  2LRK A;  3D0T A;  5H6Q B;  2XZE A;  2LSJ A;  5M4Y A;  4LF5 T;  3ZLI A;  2K24 A;  2UUA T;  4E7S A;  2D5U A;  4HGA A;  4BJM A;  5L4H A;  4U7Y A;  2X9W A;  4YJ3 E;  3ZCJ A;  1MMA A;  5FMN A;  4DV3 T;  1MIV A;  2ACX A;  4LF9 T;  2C5I T;  3ZT7 A;  4ZZB A;  2KWH A;  5JQG E;  2MOZ A;  2LRL A;  3SOL A;  3PUY F;  3RKG A;  1HNZ T;  1XMO T;  3QOF A;  2KSR A;  5F8P A;  2IW5 B;  3PJA A;  5AQU B;  3AA7 B;  5L3E B;  4X1K E;  4HFB A;  3AE3 A;  4LF6 T;  1KF6 A;  4HWC A;  2XY8 B;  3TLU A;  4DUY T;  1D0Y A;  3R6N A;  5FXZ A;  2OLT A;  3AE2 A;  4QX8 B;  3B57 A;  3AEE A;  2YK0 A;  3AA0 B;  3PUG A;  4LMK A;  2MTQ A;  1MIY A;  2ACZ A;  2UXX B;  1IBL T;  3AAA B;  4U7I A;  1HF8 A;  5HCJ A;  4CN4 A;  5LHH B;  2HH7 A;  3AE7 A;  3FBZ A;  4ZHQ E;  4LFA T;  2XJ7 A;  3LFM A;  2NR4 A;  4CI1 B;  1VCS A;  2V7L A;  1HR0 T;  2LLY A;  2NWB A;  1XDO A;  4O4L E;  1JNZ A;  3KBU A;  4NUV A;  5E0O A;  4QXB B;  2V7K A;  2D0T A;  2X9H A;  3ETV A;  2IC6 A;  1UK5 A;  3AEA A;  2V26 A;  3RRC A;  4ZOL E;  2VAS A;  2PTF A;  4G2A A;  2KXP B;  4MLK A;  2WM9 A;  5J1G A;  4B3M T;  1XNR T;  1ZKE A;  1YD8 G;  2QGS A;  1N36 T;  4DV7 T;  4JI4 T;  1NWM X;  3FZL B;  4IDN A;  2A9U A;  5L4E A;  3C64 A;  2C5K T;  4WYV A;  2FJA A;  2WB5 A;  1HNX T;  3ZEF B;  3ZJ2 A;  3ZSS A;  1J5E T;  3IF8 B;  5HEU A;  3K8P C;  2W00 A;  2D9D A;  3OBV E;  2Z6E A;  4X1Y E;  2W61 A;  5LMN T;  2AE9 A;  3KV5 A;  4KX6 A;  3UT5 E;  3ANW B;  3N2K E;  3IBP A;  4H9P C;  2YN6 A;  4QWN B;  2WDQ A;  3SS1 A;  2V8S V;  4H9R C;  5FXW A;  3EAB A;  2A3D A;  2E8I A;  1WFD A;  2VKH A;  3AVR A;  4O2B E;  3UUN A;  2H7O A;  4KHZ F;  2N2N A;  4JLE A;  5JTG A;  1W0B A;  4IST A;  3HKB E;  1IAP A;  3X1D A;  3O9X A;  4DID B;  2BS2 A;  4F6R C;  4YT0 A;  3CKD A;  4DV1 T;  3VR8 A;  1OED C;  1G8X A;  5ABH A;  3P7I A;  2KLQ A;  3LK4 2;  1W09 A;  3CIR A;  3N9M A;  4TWD A;  4WBN E;  4DR6 T;  4GKK T;  2ODU A;  2B76 A;  1T72 A;  1S94 A;  2Q9Q C;  1FJG T;  5FY0 A;  2LJL A;  3CX6 B;  1BR4 A;  2M6I A;  3IA3 A;  3P4W A;  2CBJ A;  2DWK A;  2LOP A;  4PK5 A;  5FVL A;  3ZJ1 A;  3ZMT B;  4EOZ B;  5HEJ A;  4LF4 T;  3E08 A;  4NXM T;  2SPC A;  4YHJ A;  3UQ7 A;  1UX5 A;  2L3L A;  2YOE A;  3KV9 A;  3LK3 B;  2J47 A;  1BR2 A;  2V6X A;  3RRW A;  2PBI A;  3I9Y A;  4IDQ A;  1U4Q A;  2DNX A;  2FJE A;  4HFC A;  5C8Y E;  2LEH A;  3G06 A;  3WAJ A;  4P0A A;  2M67 A;  4NXN T;  2E9X C;  2IHR 1;  2AXD S;  2PG8 A;  1B7T A;  2MYS A;  3FHN A;  3JC6 C;  4HKA A;  5LG4 A;  3AED A;  2R6G F;  2ZM2 A;  2PJQ A;  2X67 A;  2XAS B;  2B1E A;  4IE6 A;  4KBM B;  4HWD A;  1MMD A;  3M3Z B;  4PFP A;  2BZB A;  2LE8 A;  5DQW A;  4UR9 A;  2XUE A;  4L0R A;  5FXX A;  5CA1 E;  4EEB A;  3K1S A;  2VVN A;  5LP6 E;  4PNI A;  5JH7 E;  1HFA A;  4QH4 A;  3RYC E;  3SRZ A;  4LML A;  3PU3 A;  4EB6 E;  4ZI2 D;  5BR8 T;  1IJ5 A;  5AQV B;  2BKN A;  3OYX A;  4AKI A;  1Z0P A;  5JR9 C;  5IUX A;  2NW8 A;  3N9N A;  3PUW F;  3CQX C;  4DR5 T;  5IYZ E;  2WZH A;  5AQH B;  2XPK A;  2Q9Q B;  3HL6 A;  1VOM A;  5AQL B;  5JR9 B;  4Z91 A;  1UCU A;  4B3S T;  5LJM A;  3LJC A;  4DR7 T;  4HFV A;  1MND A;  3AEF A;  1HG2 A;  3DP7 A;  4TUY E;  3RLF F;  2H88 A;  4UF0 A;  3AEG A;  4CZZ B;  5L3C B;  4CXW A;  5LGN B;  2YKS A;  4YJ2 E;  3C98 B;  5L2L A;  4QXC B;  2KZ7 B;  3OPC A;  3UFG A;  1IZN B;  1OWA A;  1S35 A;  3FB2 A;  4YSY A;  4O8S A;  1WYB A;  3MA9 A;  3VKG A;  3LG7 A;  3T1Y T;  3AAE B;  3C4Z A;  5FKY A;  4YTN A;  2P9B A;  5HWX A;  2CXD A;  4HFD A;  1J5W A;  1D0Z A;  3LBX A;  4HEA A;  5ABF B;  3F31 A;  4JI3 T;  3FXE B;  4LMJ A;  4JI1 T;  3LSV A;  2V1D B;  2BBJ A;  2H3R A;  3GN5 A;  2HPJ A;  4MHC A;  3PUR A;  2EHO B;  4IT4 A;  3PV0 F;  4B3R T;  3OKQ A;  4PK4 A;  2VB6 A;  4DMV A;  2JQ9 A;  5ETW A;  2BBH A;  5FY7 A;  5LJN A;  1YQ4 A;  2EHO C;  3GN5 B;  3BQK A;  4HFE A;  5FL0 A;  2XAQ B;  1XMQ T;  3ZST A;  5LHI B;  3HA4 A;  4C91 A;  4TV9 E;  4ZXL A;  3PJA J;  1OXZ A;  2CLY B;  3JAF A;  4O4J E;  3RQW A;  4OX9 T;  2Q9Q A;  4XBF B;  2ZMA A;  2LM9 A;  4JI8 T;  5JRC B;  1KNZ A;  4GK0 E;  3MJX A;  2CPT A;  3OTO T;  2IAK A;  2ZLY A;  2E9X B;  4UF0 B;  3WAK A;  3ZN0 B;  1ZOY A;  3H3A A;  3ZPO A;  4A56 A;  4QXH B;  4COF A;  5LHG B;  4JUY A;  4TWF A;  4YLH A;  5AQN B;  5HYA A;  4GYS A;  1UUR A;  4KMC A;  3L3P A;  5AQR B;  3WI3 A;  3P4S A;  2IDO B;  4UVA B;  4ANJ A;  3NRY A;  1I6Z A;  3KIN B;  4A98 A;  4GYR A;  5HEO A;  4IDZ A;  4DND A;  2CXF A;  1FEW A;  4EZH A;  3BK9 A;  1N34 T;  4TWH A;  3N9P A;  4X5T A;  4UV8 B;  5LMU T;  2XQ8 A;  2XM1 A;  3PUS A;  4MBQ A;  5BMV E;  2V7J A;  4Z90 A;  2NP9 A;  3PTR B;  2H89 A;  4TN7 B;  4PJL A;  3KBT A;  4U2Y A;  5AQS B;  4U74 A;  5AQG B;  4WW0 A;  1OED B;  2BS3 A;  5HEH A;  5JVD E;  4CQI A;  4HWI B;  2V7M A;  4AXP A;  2IC9 A;  4DO0 A;  4LFC T;  2I59 A;  2XQ3 A;  4IHJ E;  3UTK A;  4BJN A;  3N2G E;  3GMI A;  3RC3 A;  3RC8 A;  3W15 B;  2WP9 A;  1OED A;  2CLY C;  2XQ4 A;  3C4W A;  3CQG B;  3QUJ A;  3UUB A;  3RIA A;  3ZN1 B;  4TNW A;  4OFZ A;  2WZI A;  4O2A E;  5J2U E;  3EUH A;  2CXL A;  2DCF A;  1X9B A;  2ODV A;  4IL9 A;  4ZI2 C;  4I50 E;  5LCY A;  2NTX A;  4ISS A;  5KMG P;  3T8O A;  1X79 A;  1E2A A;  4TNV A;  3AEB A;  1LRZ A;  2LSK A;  2WY2 A;  2F4V T;  3AVS A;  3RPU A;  3U3I A;  4CI2 B;  2JMH A;  3VHL A;  2CWY A;  4XZC A;  2L8K A;  1YQ3 A;  4LF8 T;  3ONL C;  3ZCI A;  4ERR A;  2UXD T;  2XSB A;  1ZHC A;  4EGW A;  2WU2 A;  1YXR A;  3H37 A;  3NKZ A;  1D1B A;  4P0B A;  5LYJ E;  5L3B B;  3FZF B;  2UUC T;  3Q2M A;  3CPZ A;  1G73 A;  2WCA A;  4ILA A;  4JYA T;  3BQI A;  2CA5 A;  4ZI3 C;  2EHO A;  1H7C A;  3FZM B;  2KND A;  2DI4 A;  1O3X A;  1BR0 A;  3C50 A;  4PK6 A;  2CBI A;  4EZ4 A;  3DTO A;  3L8R A;  1KNP A;  2VKD A;  2WQY A;  3EAM A;  3MKD A;  5CA0 E;  4PFO A;  5HXH A;  5KXJ A;  3PUV F;  2J4G A;  4L9I A;  5AQO B;  2V7I A;  2D2S A;  2JPF A;  4ILB A;  2G0U A;  5J2T E;  2WSS V;  1WCR A;  4PAG A;  2XQY A;  2C5J A;  2W67 A;  3I0O A;  2WDR A;  4CN1 A;  3RYF E;  2XAF B;  3JCF A;  4ZS3 A;  3RYH E;  3EDV A;  2X9X A;  2XHE B;  5LB7 B;  4TX5 A;  4YY3 T;  5DQV A;  2I0M A;  4GK5 E;  4QHO A;  2E9X A;  3NZP A;  5C3J A;  2K9A A;  3H3M A;  3V5U A;  2YU2 A;  3TLW A;  2K48 A;  4UIG A;  4AKH A;  3ZYL A;  1KEY A;  2W4X A;  3FXD B;  5CGM A;  3AA6 B;  4PW8 A;  2YIN A;  3CWZ B;  3ZMV B;  2BKO A;  2EHO D;  2J62 A;  4QH1 A;  3TLV A;  1R8I A;  2VK9 A;  3LDQ B;  4EXT A;  1AJ3 A;  1HX8 A;  1YKH B;  3I9W A;  3OVU A;  2XTL A;  3GWH A;  5AQP B;  1T8B A;  2CHO A;  2E5L T;  4TZ4 C;  5JDM A;  2J1D G;  2VVS A;  4NIQ A;  2VUR A;  2V5D A;  1XWM A;  2FJB A;  4IDO A;  2IML A;  1QUU A;  2E2A A;  2XQ6 A;  4H63 V;  4H9S E;  3RHW A;  4AQY T;  2UXB T;  4KP3 C;  1HG5 A;  1Y64 B;  3CVR A;  2XQ5 A;  3KFW X;  3QC9 A;  3HKC E;  2DHR A;  4O4H E;  4Z8X A;  2JQQ A;  3AXJ B;  3HKE E;  5EK3 A;  2CMR A;  3AE8 A;  3HI2 A;  2QYW A;  4AKR B;  1OED E;  2QRX A;  3MZK B;  2BS4 A;  3F57 A;  1KFY A;  3UU6 A;  5JRE A;  1V9D A;  2VWA A;  5HEG A;  5IWA T;  1W0A A;  2BKP A;  1J1J A;  2WMN A;  3I0Q A;  4U33 A;  3EDU A;  4I43 B;  3ZT6 A;  2LOS A;  1HS7 A;  4PJM A;  4MAL A;  4CXY A;  3PUA A;  3N5L A;  1EZ3 A;  4QKN A;  2W66 A;  5LA6 E;  4BAY B;  5ADX L;  4X65 T;  4DR4 T;  3VKH A;  2LKH A;  2X0L B;  1LVF A;  3ZYK A;  2LHN A;  4YSX A;  4EYY R;  3UQ4 A;  4AQF A;  3K3N A;  4ILU A;  2BVL A;  2W2U A;  2X0Y A;  4U3C A;  4YXD A;  5J0Z A;  4IE7 A;  3P4R A;  3ETU A;  4HE8 A;  3N2O A;  3L39 A;  2D0U A;  3K3Q C;  3VRB A;  4ILC A;  4YFS A;  2IIU A;  3CK6 A;  3VU7 H;  3MXZ A;  4AIU A;  4EAH A;  3PUX F;  4ZZC A;  5KX5 E;  4NPP A;  5L3D B;  3DJB A;  5AQJ B;  4JEH B;  5H6R B;  2W0G A;  3EI0 A;  4YTM A;  4ADZ A;  5LG3 A;  4ZS2 A;  4DV5 T;  3K3O A;  2XQA A;  5AQK B;  4GOU A;  2CE7 A;  1SHZ C;  5JDF A;  1NAF A;  1SUM B;  2JIW A;  1WR6 A;  2W63 A;  3BQL A;  3R84 B;  2N1G A;  4E7Z A;  2A2F X;  1HTJ F;  4WZX A;  5L3G B;  4HWH A;  2YDS A;  4EED A;  3T1H T;  4JI5 T;  5JDL A;  4KI0 F;  3ANW A;  4DV4 T;  4JV5 T;  1KNR A;  2CCQ A;  3Q5X A;  4B3T T;  5AQM B;  2WWU A;  3ZYM A;  4ASK A;  3FBL A;  1HNW T;  1FMW A;  3N9Q A;  5DJQ C;  3VRA A;  3FZH B;  1SE7 A;  5FL1 A;  4U2Z A;  4AKL A;  2K5B B;  2X66 A;  3ABV A;  2A72 A;  3NVO A;  3P4P A;  4I55 E;  3NBX X;  5AFU L;  3Q9D A;  1M7K A;  2YDR A;  4P09 A;  1T7S A;  2M6B A;  4WBO A;  1N33 T;  2Y48 B;  1YW0 A;  2ZM8 A;  5FNV E;  2LKG A;  5FVK A;  3IEE A;  3UU8 A;  4L5G A;  4YSZ A;  1MNE A;  5AQF B;  4H9N C;  4AI6 A;  3NRX A;  4XAX B;  3RI5 A;  5HCM A;  3B13 A;  2GK9 A;  4UV9 B;  5DAB A;  3RQU A;  2JMK A;  1L0V A;  4JBW F;  3F2E A;  3P50 A;  2CRB A;  3JAD A;  3KV6 A;  1MIW A;  3QK6 A;  2ZM6 T;  4DR2 T;  3RX6 A;  2LSG A;  2CM0 A;  2I6H A;  1HX1 B;  1U5P A;  3ZMU B;  2KT9 A;  2WS3 A;  3CX7 B;  4U31 A;  4JI6 T;  3O1I A;  3TKL B;  3UFE A;  3QB5 K;  4F8H A;  5GON E;  4I0U A;  2RPA A;  2FJD A;  4UEL A;  2XM2 A;  3ZMS B;  4CI3 B;  1GQE A;  3ONJ A;  3P8C D;  3UU4 A;  3PU8 A;  1IBK T;  2WDV A;  2CWO A;  3EHZ A;  2VQF T;  3Q5W A;  1DU2 A;  5HAX A;  1WYC A;  4K0U A;  2JQK A;  3M65 A;  3TLT A;  2JRK A;  2MPK A;  4A97 A;  4DV2 T;  4UXN B;  4X1I E;  5EK4 A;  2JJ9 A;  3AB3 B;  4G63 A;  3CQC B;  3LK2 B;  2IUB A;  1FMV A;  1KK7 A;  2YU1 A;  5F5W A;  5AQT B;  5JRC A;  2XAJ B;  1CHU A;  2LT3 A;  1Z8U A;  4AKG A;  2WU5 A;  3ZT5 A;  1D1A A;  1YKE B;  2VL8 A;  4H9O C;  4J2C A;  4QH5 A;  2CHN A;  2V6Y A;  5HXR A;  2RP4 A;  5JDN A;  4IDP A;  3U78 A;  5LNK A;  4X66 T;  1N32 T;  4P1N A;  5AQQ B;  4AQG A;  4MFR A;  4FI5 A;  4N78 D;  2E9X D;  3AAI A;  3L09 A;  5FP3 A;  3AE5 A;  4H9Q C;  3UU3 A;  4EV6 A;  2KIN B;  3EVY A;  3PUZ F;  4UVB B;  1MMG A;  4OYK A;  2OV9 A;  2ES0 A;  2V5C A;  4IGU A;  5HWY A;  3B5M A;  5LGU B;  3E22 E;  4PJN A;  2HN1 A;  2DWG A;  2FUP A;  4X20 E;  5LGT B;  1I94 T;  1US7 B;  3C4X A;  3LBX B;  3RH3 A;  4K0K T;  4DV6 T;  5LOV E;  4JI2 T;  3KVB A;  3SFE A;  4B6X A;  2BG9 B;  5ABE A; 
#chains in the Genus database with same CATH homology
 5IWA T;  1HR0 T;  4JI8 T;  4JI7 T;  3OTO T;  4YHH T;  4X65 T;  4DR4 T;  4B3M T;  1XNR T;  1XNQ T;  4LF7 T;  4DV7 T;  4X62 T;  1HNX T;  1N34 T;  1J5E T;  5LMU T;  5LMN T;  4DV5 T;  4LFB T;  2UXC T;  4LFC T;  4DUZ T;  4DV1 T;  1XMQ T;  1N36 T;  4JI4 T;  3T1H T;  4DR6 T;  4GKK T;  4DR1 T;  4JI5 T;  1FJG T;  4DV4 T;  2UUB T;  4JV5 T;  4JI0 T;  4B3T T;  4LF4 T;  2VQE T;  1HNW T;  4GKJ T;  4NXM T;  2F4V T;  4DR3 T;  1N33 T;  4LF8 T;  4X64 T;  4DUY T;  4NXN T;  2UXD T;  1IBM T;  2UUC T;  4JI6 T;  4JYA T;  2ZM6 T;  4DR2 T;  4KHP T;  4B3R T;  5BR8 T;  4X66 T;  4DR5 T;  1IBK T;  2VQF T;  2UU9 T;  4B3S T;  4DR7 T;  4DV2 T;  2HHH T;  4DV0 T;  4YY3 T;  4LF5 T;  2UUA T;  4DV3 T;  3T1Y T;  4LF9 T;  4JI3 T;  1N32 T;  4JI1 T;  1HNZ T;  1XMO T;  2E5L T;  4LF6 T;  2UXB T;  4AQY T;  1I94 T;  1IBL T;  4K0K T;  4DV6 T;  4JI2 T;  4LFA T;  4OX9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...