4DV3T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv3T00
3T1YT 4LF4T 4JI6T 4JI5T 4B3MT 5BR8T 1I94T 3T1HT 4JI0T 4DV0T 4JI7T 4DV7T 4LF7T 4LF8T 4YY3T 1XNQT 4LFCT 4DUZT 4JV5T 4B3ST 1HNWT 4JI2T 1XMQT 1IBLT 4B3RT 4NXMT 4K0KT 4GKKT 4DUYT 4JI4T 4X62T 4LFAT 3OTOT 2E5LT 1N36T 2VQFT 1XNRT 4DV5T 1N32T 4X64T 4B3TT 4DV1T 2VQET 4DV3T 4DR3T 2UUBT 4DR1T 2F4VT 4DR5T 4DR7T 4OX9T 4X66T 4LF9T 5LMUT 4GKJT 4AQYT 2UU9T 1HNXT 5IWAT 4JI1T 2UXDT 4LF6T 1HNZT 2UXCT 5LMNT 4DR6T 4DR2T 4JI8T 1IBKT 4KHPT 2ZM6T 1N34T 1FJGT 4DV6T 1XMOT 2UUCT 4NXNT 4JYAT 2HHHT 1IBMT 4X65T 4DV4T 1J5ET 2UUAT 1N33T 1HR0T 4JI3T 4LF5T 2UXBT 4YHHT 4DR4T 4LFBT 4DV2T
chains in the Genus database with same CATH superfamily
4AQGA 4B3MT 3HI2A 5JDFA 2ODVA 2IW5B 2BBHA 3T1HT 4ZHQE 2FJEA 2I0MA 5J2TE 3AE5A 3C4ZA 5CFBA 4WBNE 2WU2A 4I50E 3Q5EA 3FZFB 1MIVA 2LLYA 2LHNA 5HCMA 4HFVA 5JR9C 1IJ6A 1YQ4A 3MZKB 4X62T 2LRKA 5FY0A 3ZYLA 2A2FX 1N36T 5ABEA 3ZJ2A 5ABGA 5LBMA 1N32T 3SS1A 3IF8B 4UV8B 2I6HA 5JREA 2WAUA 3CX7B 4UF0A 2V1DB 2XQ5A 4ISTA 3ZCJA 4GKJT 2XAJB 5C2TA 3ZSSA 5ABFB 2Q9QB 2ACXA 2NW8A 5L3GB 1XDPA 5LXTE 4AKGA 5H6QB 1IBKT 3CX6B 2OV9A 4JYAT 4UEMA 2L9QA 3AA0B 4BAYB 2WQYA 2FBWA 3ZMSB 4ZS3A 4A5XA 3CKDA 3LSVA 3T1YT 5L3BB 1NWMX 4HKAA 3ANWA 4F8HA 3PJAJ 5HEOA 3KINB 4EOZB 3EABA 2SPCA 1YQ3A 3ZJ1A 4LF7T 1J1JA 5FY7A 5J0ZA 4HFCA 2RA1A 4CQIA 2H3RA 3FZKB 3A8YC 2K9AA 4DBQA 2M6IA 2V26A 4B3RT 2VKDA 5FL1A 2ZM8A 3KV5A 4ERRA 3KVAA 5AQRB 5AQKB 1J5WA 2K5BB 2WWUA 2XASB 5F3JA 4IGUA 4M1PA 2E9XB 3N2OA 2MAWA 1M62A 1D0YA 3HKCE 4DR7T 3RYIE 1UCUA 2A3DA 3L39A 4YSXA 4MBQA 3UT5E 3O9XA 3RQUA 2NOXA 1HNXT 4DIDB 5LNKA 2C5IT 4AXPA 3UTKA 1L0VA 1FMWA 3I9WA 1WR0A 4OYJA 2BVMA 4YTNA 1VRBA 2JQHA 3UU6A 4PW8A 4X65T 2V6YB 4HWIB 4IE0A 1SHZC 3W15B 2J62A 2A72A 5JDLA 3LBXB 4JI3T 4PNIA 3J7Yq 4EGWA 4DV2T 3L8RA 4O2AE 5F5WA 2WDRA 2JRKA 2DHRA 3RIUA 5FXWA 3N9OA 5HXCA 3LJCA 3ONJA 4H9SE 5LBQB 2A9UA 4BJNA 5AQVB 3AE8A 2KSRA 4IDNA 1XNQT 4QX8B 2PG8A 5DABA 5CA1E 4B3ST 4YT0A 3ZPOA 4UR9A 4UVBB 1G73A 2D0TA 3KV4A 4IL9A 1O3XA 3P4PA 4UVAB 2IC6A 4G63A 5JDHA 2XAHB 3JAFA 3RX6A 3ZC0A 4GIWA 2E2AA 3RIAA 2LSYA 2NR4A 4FI5A 3WAJA 2FJDA 2ES0A 4HFBA 1KK7A 5FY1A 4AQYT 4PFOA 4WW0A 4U7YA 4JI1T 2V7MA 5IHYA 2CXDA 3PU3A 4JLEA 4I55E 4DR2T 3IBPA 3RC8A 3FB2A 5LGTB 2WS3A 1BR4A 2YKSA 3CVRA 1G8XA 2VKJA 3ZC1A 3ZT6A 5L3DB 3SRZA 4GYSA 2XQYA 4ZI2C 2BG9B 3M3ZB 1LVFA 4ILBA 3AEAA 5EK3A 2PBIA 2C0SA 1BR2A 3C50A 3I9YA 4U33A 5FXXA 2VL8A 5L47A 3N9PA 3G06A 4JI7T 3ZMVB 3B13A 2ZMAA 3AE2A 3ETVA 2UXXB 4YY3T 3D0TA 3V5SA 5HWXA 1JNZA 1Z0PA 2IUBA 2CEAA 3PUSA 3ZT5A 2WDVA 1HNWT 3PE0A 2VL0A 1M7KA 3T8OA 5HXEA 3MXZA 3P8CD 4ZI3C 3N9LA 3TLWA 2JPFA 5A1LA 2L3LA 4UIGA 4TWFA 2CM0A 3UQ4A 1MMNA 3O1IA 2AXDS 3AA1B 2EHOD 5FNVE 1ZEEA 2X9WA 3TLUA 5L3FB 2CBJA 4DR6T 2WSSV 1SE7A 4HFEA 3TKLB 3AE9A 3AEBA 1Z8UA 4O4JE 5HWYA 4U31A 4HWCA 4CN4A 2ODUA 1IBMT 4GYRA 2C5JA 1N33T 2XAGB 1KEYA 3GWHA 5LJNA 1MNEA 1Y64B 4P0AA 2BKPA 3RI5A 3VR9A 4IREA 5HXHA 3JCFA 4PJMA 4ZS2A 2X0LB 4WYVA 3P4SA 2CCQA 4QH4A 2CHOA 4QXCB 2QYWA 3OJAA 2VASA 3H3MA 2D2SA 3AA6B 2IMLA 2W61A 5LOVE 5JRCB 3P4RA 3UUNA 5AQGB 4IDQA 1IBLT 3RYFE 4U72A 3O4XE 4ILAA 3QNUA 1W0BA 3DTOA 2VQFT 2CBIA 5ADXL 5EZYE 1KNZA 1OEDB 3OBVE 1HG5A 2UXNB 4H9RC 4Z8XA 2LKGA 2CA5A 3ONLC 4JUYA 4O8SA 2MOZA 3UU4A 2Q9QC 3F57A 2HN1A 2G0UA 2UXCT 4L0RA 2WZIA 2ZM6T 4YFSA 4DV6T 2XQ8A 4FJOA 2EHOA 2IC9A 5AQMB 1VCTA 4EB6E 2DWGA 3PUWF 2YU2A 1Y01A 4CI2B 2JMKA 2WM9A 3RIFA 4LF4T 1T72A 4QXBB 2M67A 3VRAA 4JI0T 5HEHA 3KBUA 2V7IA 4O4IE 3RKOA 3NWIA 3AEFA 3OKQA 2X9YA 2X51A 4ZOLE 5HAXA 3ZT7A 2X68A 5KDMC 2V6XA 5CB4E 4DO0A 2BZBA 4L9IA 1W0AA 4NXMT 4TNWA 1T8BA 2YDSA 2VVNA 3I0QA 3QK6A 4WBOA 4TX5A 3LDQB 4KUMB 3U78A 2DCFA 3AAAB 2KMFA 2E9XC 4COFA 4CXWA 2UUBT 3RQWA 2CWOA 3K1SA 3P50A 3PTRB 3PUXF 2BKNA 2QA7A 5L4HA 4EXTA 2Y48B 2XQ7A 2K24A 1WLXA 4A97A 1HNZT 4EEBA 1E7PA 4KX6A 3RF1A 4H9QC 1ZP0A 1U5PA 3FXDB 4DMWA 2OLTA 2KT9A 2E9XA 3UU8A 1IAPA 4ISSA 4TN7B 4PJJA 5JTGA 4IHJE 2MTQA 2MYSA 5JR9A 2CHNA 1YKHB 3E08A 2I59A 5AQNB 3F2EA 2WZHA 2W0GA 3OVUA 4HGAA 4EYYR 4IDOA 3C4XA 3AXJB 4K0UA 3QB5K 1NEKA 2V7KA 1LKXA 2V6YA 5HXSA 4MFRA 1QLBA 4ANJA 4QHOA 3UU3A 2ACZA 3AEEA 5AQPB 2KWIB 1DU2A 1FMVA 2J4GA 2MPKA 3AEDA 3UUBA 4BA9A 4X64T 1W9RA 3VR8A 2QRXA 1LVKA 3K8PC 2DNXA 5LHHB 4LF9T 5LMUT 1WR6A 3Q9DA 1NENA 3RYHE 3AVRA 4UXNB 2V8SV 2H88A 3ZEFB 2BDEA 2W66A 2LE8A 2BG9C 3ZSTA 4LFBT 5CGMA 3JC6C 1VCSA 4YXDA 4AKIA 3LK3B 1T98A 5L4EA 2PFVA 5KX5E 1R8IA 3EUHA 5HEJA 4CI1B 2LM9A 5FMNA 4BJMA 4CXXA 2XQ3A 1ZOYA 3MA9A 1XWMA 5KXJA 5DJQC 2JQKA 2XM1A 3ANWB 4TWDA 4O4LE 4I0UA 4YTPA 2KLQA 3N9MA 4LFAT 2BG9A 2WB5A 4ZI2D 3QB5A 1D1AA 3UUMA 4B3TT 4DV3T 4HWDA 1MMGA 5AQQB 2LHRA 1ZKEA 4I43B 4AQFC 3IA3A 3HKDE 3DP7A 4TV8E 1SUMB 5LMNT 1YXRA 3EI0A 2V5CA 2WDQA 3AE4A 4U3CA 5HEUA 3A7MA 4YHHT 3UU5A 4ZI3D 4KBMB 2XY8B 3PJAA 3RC3A 4JI6T 1ZHCA 1D1BA 5BR8T 3QC9A 4P0BA 2BS4A 2VK9A 4Q25A 2DLRA 2DL1A 4H63H 3H37A 5FXZA 2PTFA 3AE3A 1S94A 5HCJA 1SA0E 3RH3A 2YINA 2N9DA 3UUXB 5AFUL 2KINB 4TUYE 1UK5A 3A5XA 2V7JA 5LYJE 5HXRA 4JI4T 2CLYB 3J9X1 5AQUB 3OTOT 2X66A 1HFAA 3Q5XA 2H7VC 1XDOA 4EYUA 2WCAA 4DV5T 4EAHA 5JH7E 4U2YA 1T7SA 1OEDC 2JQQA 4OX9T 4YSYA 4GOUA 4PK6A 2DWKA 4QWNB 2Y8DA 1GQEA 4H63V 2UU9T 2UXDT 2RPAA 5JDNA 5JRCA 1HG2A 4JI8T 4KHPT 4P09A 1XMOT 2FUPA 3C4WA 3PU8A 3OYZA 4YJ2E 4IT4A 4QKNA 3AE7A 4NPPA 3ZN0B 3N2KE 3NVOA 2JMHA 2XSAA 4Z91A 1QSDA 3KBTA 3OPCA 5JDGA 2W62A 5AQTB 4A98A 2NTXA 3F31A 2LEHA 5HYAA 4LF8T 3K3OA 4ZXLA 2Q9QD 2W00A 2R6GF 4MLKA 4DUZT 3GN5A 4IDPA 3AA7B 3R84B 1XMQT 4K0KT 3PUVF 4DUYT 5L3EB 4CXYA 3V5UA 3SFDA 5LA6E 5L2LA 3PV0F 5AQJB 3P7IA 2BKOA 4DNDA 5L3CB 3FHNA 5IYZE 4JEUB 4OFZA 2IDOB 3EDVA 3QOFA 3NRXA 1X9BA 3RGLA 1UX4A 2J1DG 2CMRA 4EV6A 2VB6A 3C51A 2BG9E 4ASKA 4UVCB 4YHJA 5CA0E 1YW0A 3FBZA 4F6RC 2HN2A 2YDQA 5LB7B 3R6NA 4H9OC 4XZCA 2E9XD 1B7TA 4LMLA 4CZZB 4C90A 3TLTA 3N9NA 3PDYA 4DV7T 3L09A 3CMLA 4O4HE 4AIUA 4A56A 2KZ7B 3KV6A 1US7B 2LOSA 3AECA 3N5LA 4U2ZA 2XJ7A 4ZEYA 5EK2A 3CPZA 5ABFA 2Q9QA 2BS2A 3BK9A 3HR0A 5JQGE 1ZV4X 2KWHA 4DMVA 4N78D 3RYCE 2D0UA 2FJBA 1LRZA 4HN9A 3SOLA 4YJ3E 2XTLA 2WU5A 4X66T 4CN1A 5CJ5A 5AQSB 3PUAA 2XQ6A 1FIOA 4G2AA 4UV9B 4CI3B 3KVBA 2YOEA 3ONXA 2XM2A 3BQLA 5KMGP 2YDRA 4QH1A 5LGNB 2VURA 3VHLA 3C98B 4OYKA 4IE4A 2CXFA 1WCRA 3HKBE 3ZMTB 2X9HA 2WMOA 4LF5T 1QUUA 2JQ9A 5TAOA 4HEAA 2QGSA 4WNKA 4PJLA 3OYXA 3QUJA 4JI5T 2JJ9A 2LOPA 2LSGA 1I94T 5J1GA 4YTMA 2EHOB 4HTEA 2K48A 4DV0T 3LK42 4HWFA 2JIWA 2XQ9A 1MIYA 3CX8B 3E0ZA 2AE9A 5FVKA 4AKLA 2B76A 2IAKA 3KDSE 4U7IA 2CWYA 2WWVA 3Q2MA 1WYBA 3LK2B 3P4QA 1MMDA 3RRCA 4DBRA 3O1JA 4MHCA 1OEDE 5JDQA 5FVLA 3ESLA 3KV9A 1EZ3A 5FL0A 1XNRT 3C64A 4ZZCA 1HX1B 4OHFA 3JC6D 2ZM0A 4X1KE 3RPUA 3B57A 1MNDA 3P4WA 4PJNA 3LBXA 3L3PA 2LJLA 3CWZB 4U74A 4IDZA 5M4YA 3NZPA 4EZHA 3NBXX 5FKYA 2IHR1 2WBLA 2W2UA 2QVAA 4NUUA 3AE6A 2RP4A 2XPKA 2NWBA 4AKHA 4TNVA 2XAQB 5JDMA 1UX5A 3S4UA 1W09A 3B5MA 1OXZA 4TV9E 1D0ZA 3PUGA 3HA4A 3ZMUB 5C3JA 3AAIA 3I0OA 5C8YE 2V7LA 2Y6XA 2VKOA 3UFEA 2XSBA 1CHUA 2XHEB 4UF0B 3NKZA 3M65A 3H3AA 1UUSA 2ZLYA 3JAEA 4IL4A 5ETWA 2N2NA 3MJXA 4GK0E 2H7OA 2VKHA 2VWAA 1E1HB 1KNPA 5JR9B 1BR1A 3CIRA 4GKKT 4DVDA 3RIUC 2CLYC 4X1IE 1VOMA 4ILCA 1HCIA 3GA8A 3MK7C 1FEWA 4X20E 4DR1T 4EIWA 4HE8A 3Q5DA 2CE7A 3EDUA 2HH7A 4YLHA 4X5TA 2P9BA 2OA5A 1WYCA 3ZLIA 4C91A 2VVSA 5E0OA 4EZ4A 3FZMB 2W63A 2BVLA 3AEGA 1WFDA 4MALA 4GK5E 4JEHB 5F8PA 4KMCA 5J2UE 1U4QA 2HPJA 2B1EA 2WY2A 3U3IA 5FP3A 3IHRA 2CPTA 3E22E 3FZHB 2E8IA 5AQHB 2KXPB 5AQOB 2XAFB 4IE6A 1IZNB 4TZ4C 3AB3B 3WI3A 4EEDA 5FXVA 1KFYA 3K3NA 3NZQA 1HF8A 3TLVA 3PURA 1BR0A 2GK9A 4PK4A 1OWAA 4LFCT 3PUZF 3PUQA 2Z6EA 3ZKRA 3VU7H 4AQFA 3N2GE 2LM2A 4LMKA 1CUNA 1AJ3A 3UFGA 2C5KT 2YU1A 3NRYA 4DV1T 4DR3T 1H7CA 3ZMZB 3EVYA 4DR5T 2YK0A 3AAEB 4H9NC 5AQFB 1D0XA 2ZM2A 2PJQA 5ABHA 3X1DA 3MKDA 2KNDA 4NUVA 4WZXA 4HFIA 5IWAT 5BMVE 1X79A 5LGUB 2W67A 2XQ4A 3UULA 1E2AA 5DQVA 2FJAA 5FYMA 2V5DA 4DV4T 2L8KA 4X1YE 2X67A 3WAKA 4CN6A 3KFWX 1UGOA 2X0HA 4B6XA 3HKEE 1D1CA 3VRBA 2D9DA 4DR4T 1MMAA 2WP9A 2J47A 3I1AA 1YKEB 3RKGA 5AQIB 1UURA 1KF6A 3ZCIA 2LSKA 5LHIB 5DQWA 5H6RB 1OEDA 2IIUA 5IUXA 5JVDE 2BBJA 4XAXB 4ADZA 4JV5T 4JBWF 1YD8G 5LG3A 4IE7A 4H9PC 4P1NA 4JI2T 3FXEB 2LSIA 2M6BA 4HFDA 4L5GA 4LMJA 3O1HA 2LKHA 2NW9A 3UQ7A 2D5UA 3LG7A 5AQLB 3CK6A 4IE5A 2W4XA 1HS7A 4YSZA 4AKRB 2E5LT 4I4TE 3CQCB 3GMIA 3ZYKA 1NAFA 3RLFF 3ZN1B 3AE1A 1WRDA 2VQET 3CQGB 1KNRA 4KHZF 2F4VT 2X0YA 3SFEA 4IIJE 3VKHA 3TLSA 2BS3A 3PUYF 2LT3A 5LHGB 4NIQA 1IJ5A 1XZYA 3MACA 5GONE 4LF6T 4HFHA 3ETUA 4PFPA 2N1GA 4OK0A 2NTYA 3BQIA 4NXNT 1HTJF 4Z90A 2HHHT 4XBFB 5LJMA 1J5ET 3JADA 4ZZBA 3FZLB 2XZEA 2CRBA 5EK4A 5LG4A 2UXBT 4E7SA 3VKGA 5LP6E 3N9QA 1HX8A 2NP9A 4AI6A 4AISA 3RHWA 4ZI7E 4QH5A 2EHOC 3SWHA 2K3WA 2H89A 4HWHA 3FBLA 3ABVA 3ZYMA 2HPLA 2NW7A 3RRWA 3DJBA 2WMNA 2YEVC 5HEGA 1JNRA 4E7ZA 4ILUA 2LRLA 4PAGA 2E5VA 2YN6A 4KI0F 4KP3C 1MIWA 2MBGA 4V1Av 4O2BE 3K3QC 4QXHB 1V9DA 2XQAA 1S35A 3GN5B 2XUEA 3Q5WA 4PK5A 3EHZA 3EAMA 3LFMA 4UELA 3BQKA 4TWHA 4QX7B 2DI4A 3AVSA 1N34T 1FJGT 2UUCT 2LSJA 3CQXC 4J2CA 2UUAT 5LCYA 1I6ZA 3IEEA 2CXLA 1HR0T 2X9XA 3AXJA 3HL6A
chains in the Genus database with same CATH topology
3T1YT 4LF4T 4JI6T 4JI5T 4B3MT 5BR8T 1I94T 3T1HT 4JI0T 4DV0T 4JI7T 4DV7T 4LF7T 4LF8T 4YY3T 1XNQT 4LFCT 4DUZT 4JV5T 4B3ST 1HNWT 4JI2T 1XMQT 1IBLT 4B3RT 4NXMT 4K0KT 4GKKT 4DUYT 4JI4T 4X62T 4LFAT 3OTOT 2E5LT 1N36T 2VQFT 1XNRT 4DV5T 1N32T 4X64T 4B3TT 4DV1T 2VQET 4DV3T 4DR3T 2UUBT 4DR1T 2F4VT 4DR5T 4DR7T 4OX9T 4X66T 4LF9T 5LMUT 4GKJT 4AQYT 2UU9T 1HNXT 5IWAT 4JI1T 2UXDT 4LF6T 1HNZT 2UXCT 5LMNT 4DR6T 4DR2T 4JI8T 1IBKT 4KHPT 2ZM6T 1N34T 1FJGT 4DV6T 1XMOT 2UUCT 4NXNT 4JYAT 2HHHT 1IBMT 4X65T 4DV4T 1J5ET 2UUAT 1N33T 1HR0T 4JI3T 4LF5T 2UXBT 4YHHT 4DR4T 4LFBT 4DV2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y T;  4LF4 T;  4JI6 T;  4JI5 T;  4B3M T;  5BR8 T;  1I94 T;  3T1H T;  4JI0 T;  4DV0 T;  4JI7 T;  4DV7 T;  4LF7 T;  4LF8 T;  4YY3 T;  1XNQ T;  4LFC T;  4DUZ T;  4JV5 T;  4B3S T;  1HNW T;  4JI2 T;  1XMQ T;  1IBL T;  4B3R T;  4NXM T;  4K0K T;  4GKK T;  4DUY T;  4JI4 T;  4X62 T;  4LFA T;  3OTO T;  2E5L T;  1N36 T;  2VQF T;  1XNR T;  4DV5 T;  1N32 T;  4X64 T;  4B3T T;  4DV1 T;  2VQE T;  4DV3 T;  4DR3 T;  2UUB T;  4DR1 T;  2F4V T;  4DR5 T;  4DR7 T;  4OX9 T;  4X66 T;  4LF9 T;  5LMU T;  4GKJ T;  4AQY T;  2UU9 T;  1HNX T;  5IWA T;  4JI1 T;  2UXD T;  4LF6 T;  1HNZ T;  2UXC T;  5LMN T;  4DR6 T;  4DR2 T;  4JI8 T;  1IBK T;  4KHP T;  2ZM6 T;  1N34 T;  1FJG T;  4DV6 T;  1XMO T;  2UUC T;  4NXN T;  4JYA T;  2HHH T;  1IBM T;  4X65 T;  4DV4 T;  1J5E T;  2UUA T;  1N33 T;  1HR0 T;  4JI3 T;  4LF5 T;  2UXB T;  4YHH T;  4DR4 T;  4LFB T;  4DV2 T; 
#chains in the Genus database with same CATH topology
 4AQG A;  4B3M T;  3HI2 A;  5JDF A;  2ODV A;  2IW5 B;  2BBH A;  3T1H T;  4ZHQ E;  2FJE A;  2I0M A;  5J2T E;  3AE5 A;  3C4Z A;  5CFB A;  4WBN E;  2WU2 A;  4I50 E;  3Q5E A;  3FZF B;  1MIV A;  2LLY A;  2LHN A;  5HCM A;  4HFV A;  5JR9 C;  1IJ6 A;  1YQ4 A;  3MZK B;  4X62 T;  2LRK A;  5FY0 A;  3ZYL A;  2A2F X;  1N36 T;  5ABE A;  3ZJ2 A;  5ABG A;  5LBM A;  1N32 T;  3SS1 A;  3IF8 B;  4UV8 B;  2I6H A;  5JRE A;  2WAU A;  3CX7 B;  4UF0 A;  2V1D B;  2XQ5 A;  4IST A;  3ZCJ A;  4GKJ T;  2XAJ B;  5C2T A;  3ZSS A;  5ABF B;  2Q9Q B;  2ACX A;  2NW8 A;  5L3G B;  1XDP A;  5LXT E;  4AKG A;  5H6Q B;  1IBK T;  3CX6 B;  2OV9 A;  4JYA T;  4UEM A;  2L9Q A;  3AA0 B;  4BAY B;  2WQY A;  2FBW A;  3ZMS B;  4ZS3 A;  4A5X A;  3CKD A;  3LSV A;  3T1Y T;  5L3B B;  1NWM X;  4HKA A;  3ANW A;  4F8H A;  3PJA J;  5HEO A;  3KIN B;  4EOZ B;  3EAB A;  2SPC A;  1YQ3 A;  3ZJ1 A;  4LF7 T;  1J1J A;  5FY7 A;  5J0Z A;  4HFC A;  2RA1 A;  4CQI A;  2H3R A;  3FZK B;  3A8Y C;  2K9A A;  4DBQ A;  2M6I A;  2V26 A;  4B3R T;  2VKD A;  5FL1 A;  2ZM8 A;  3KV5 A;  4ERR A;  3KVA A;  5AQR B;  5AQK B;  1J5W A;  2K5B B;  2WWU A;  2XAS B;  5F3J A;  4IGU A;  4M1P A;  2E9X B;  3N2O A;  2MAW A;  1M62 A;  1D0Y A;  3HKC E;  4DR7 T;  3RYI E;  1UCU A;  2A3D A;  3L39 A;  4YSX A;  4MBQ A;  3UT5 E;  3O9X A;  3RQU A;  2NOX A;  1HNX T;  4DID B;  5LNK A;  2C5I T;  4AXP A;  3UTK A;  1L0V A;  1FMW A;  3I9W A;  1WR0 A;  4OYJ A;  2BVM A;  4YTN A;  1VRB A;  2JQH A;  3UU6 A;  4PW8 A;  4X65 T;  2V6Y B;  4HWI B;  4IE0 A;  1SHZ C;  3W15 B;  2J62 A;  2A72 A;  5JDL A;  3LBX B;  4JI3 T;  4PNI A;  3J7Y q;  4EGW A;  4DV2 T;  3L8R A;  4O2A E;  5F5W A;  2WDR A;  2JRK A;  2DHR A;  3RIU A;  5FXW A;  3N9O A;  5HXC A;  3LJC A;  3ONJ A;  4H9S E;  5LBQ B;  2A9U A;  4BJN A;  5AQV B;  3AE8 A;  2KSR A;  4IDN A;  1XNQ T;  4QX8 B;  2PG8 A;  5DAB A;  5CA1 E;  4B3S T;  4YT0 A;  3ZPO A;  4UR9 A;  4UVB B;  1G73 A;  2D0T A;  3KV4 A;  4IL9 A;  1O3X A;  3P4P A;  4UVA B;  2IC6 A;  4G63 A;  5JDH A;  2XAH B;  3JAF A;  3RX6 A;  3ZC0 A;  4GIW A;  2E2A A;  3RIA A;  2LSY A;  2NR4 A;  4FI5 A;  3WAJ A;  2FJD A;  2ES0 A;  4HFB A;  1KK7 A;  5FY1 A;  4AQY T;  4PFO A;  4WW0 A;  4U7Y A;  4JI1 T;  2V7M A;  5IHY A;  2CXD A;  3PU3 A;  4JLE A;  4I55 E;  4DR2 T;  3IBP A;  3RC8 A;  3FB2 A;  5LGT B;  2WS3 A;  1BR4 A;  2YKS A;  3CVR A;  1G8X A;  2VKJ A;  3ZC1 A;  3ZT6 A;  5L3D B;  3SRZ A;  4GYS A;  2XQY A;  4ZI2 C;  2BG9 B;  3M3Z B;  1LVF A;  4ILB A;  3AEA A;  5EK3 A;  2PBI A;  2C0S A;  1BR2 A;  3C50 A;  3I9Y A;  4U33 A;  5FXX A;  2VL8 A;  5L47 A;  3N9P A;  3G06 A;  4JI7 T;  3ZMV B;  3B13 A;  2ZMA A;  3AE2 A;  3ETV A;  2UXX B;  4YY3 T;  3D0T A;  3V5S A;  5HWX A;  1JNZ A;  1Z0P A;  2IUB A;  2CEA A;  3PUS A;  3ZT5 A;  2WDV A;  1HNW T;  3PE0 A;  2VL0 A;  1M7K A;  3T8O A;  5HXE A;  3MXZ A;  3P8C D;  4ZI3 C;  3N9L A;  3TLW A;  2JPF A;  5A1L A;  2L3L A;  4UIG A;  4TWF A;  2CM0 A;  3UQ4 A;  1MMN A;  3O1I A;  2AXD S;  3AA1 B;  2EHO D;  5FNV E;  1ZEE A;  2X9W A;  3TLU A;  5L3F B;  2CBJ A;  4DR6 T;  2WSS V;  1SE7 A;  4HFE A;  3TKL B;  3AE9 A;  3AEB A;  1Z8U A;  4O4J E;  5HWY A;  4U31 A;  4HWC A;  4CN4 A;  2ODU A;  1IBM T;  4GYR A;  2C5J A;  1N33 T;  2XAG B;  1KEY A;  3GWH A;  5LJN A;  1MNE A;  1Y64 B;  4P0A A;  2BKP A;  3RI5 A;  3VR9 A;  4IRE A;  5HXH A;  3JCF A;  4PJM A;  4ZS2 A;  2X0L B;  4WYV A;  3P4S A;  2CCQ A;  4QH4 A;  2CHO A;  4QXC B;  2QYW A;  3OJA A;  2VAS A;  3H3M A;  2D2S A;  3AA6 B;  2IML A;  2W61 A;  5LOV E;  5JRC B;  3P4R A;  3UUN A;  5AQG B;  4IDQ A;  1IBL T;  3RYF E;  4U72 A;  3O4X E;  4ILA A;  3QNU A;  1W0B A;  3DTO A;  2VQF T;  2CBI A;  5ADX L;  5EZY E;  1KNZ A;  1OED B;  3OBV E;  1HG5 A;  2UXN B;  4H9R C;  4Z8X A;  2LKG A;  2CA5 A;  3ONL C;  4JUY A;  4O8S A;  2MOZ A;  3UU4 A;  2Q9Q C;  3F57 A;  2HN1 A;  2G0U A;  2UXC T;  4L0R A;  2WZI A;  2ZM6 T;  4YFS A;  4DV6 T;  2XQ8 A;  4FJO A;  2EHO A;  2IC9 A;  5AQM B;  1VCT A;  4EB6 E;  2DWG A;  3PUW F;  2YU2 A;  1Y01 A;  4CI2 B;  2JMK A;  2WM9 A;  3RIF A;  4LF4 T;  1T72 A;  4QXB B;  2M67 A;  3VRA A;  4JI0 T;  5HEH A;  3KBU A;  2V7I A;  4O4I E;  3RKO A;  3NWI A;  3AEF A;  3OKQ A;  2X9Y A;  2X51 A;  4ZOL E;  5HAX A;  3ZT7 A;  2X68 A;  5KDM C;  2V6X A;  5CB4 E;  4DO0 A;  2BZB A;  4L9I A;  1W0A A;  4NXM T;  4TNW A;  1T8B A;  2YDS A;  2VVN A;  3I0Q A;  3QK6 A;  4WBO A;  4TX5 A;  3LDQ B;  4KUM B;  3U78 A;  2DCF A;  3AAA B;  2KMF A;  2E9X C;  4COF A;  4CXW A;  2UUB T;  3RQW A;  2CWO A;  3K1S A;  3P50 A;  3PTR B;  3PUX F;  2BKN A;  2QA7 A;  5L4H A;  4EXT A;  2Y48 B;  2XQ7 A;  2K24 A;  1WLX A;  4A97 A;  1HNZ T;  4EEB A;  1E7P A;  4KX6 A;  3RF1 A;  4H9Q C;  1ZP0 A;  1U5P A;  3FXD B;  4DMW A;  2OLT A;  2KT9 A;  2E9X A;  3UU8 A;  1IAP A;  4ISS A;  4TN7 B;  4PJJ A;  5JTG A;  4IHJ E;  2MTQ A;  2MYS A;  5JR9 A;  2CHN A;  1YKH B;  3E08 A;  2I59 A;  5AQN B;  3F2E A;  2WZH A;  2W0G A;  3OVU A;  4HGA A;  4EYY R;  4IDO A;  3C4X A;  3AXJ B;  4K0U A;  3QB5 K;  1NEK A;  2V7K A;  1LKX A;  2V6Y A;  5HXS A;  4MFR A;  1QLB A;  4ANJ A;  4QHO A;  3UU3 A;  2ACZ A;  3AEE A;  5AQP B;  2KWI B;  1DU2 A;  1FMV A;  2J4G A;  2MPK A;  3AED A;  3UUB A;  4BA9 A;  4X64 T;  1W9R A;  3VR8 A;  2QRX A;  1LVK A;  3K8P C;  2DNX A;  5LHH B;  4LF9 T;  5LMU T;  1WR6 A;  3Q9D A;  1NEN A;  3RYH E;  3AVR A;  4UXN B;  2V8S V;  2H88 A;  3ZEF B;  2BDE A;  2W66 A;  2LE8 A;  2BG9 C;  3ZST A;  4LFB T;  5CGM A;  3JC6 C;  1VCS A;  4YXD A;  4AKI A;  3LK3 B;  1T98 A;  5L4E A;  2PFV A;  5KX5 E;  1R8I A;  3EUH A;  5HEJ A;  4CI1 B;  2LM9 A;  5FMN A;  4BJM A;  4CXX A;  2XQ3 A;  1ZOY A;  3MA9 A;  1XWM A;  5KXJ A;  5DJQ C;  2JQK A;  2XM1 A;  3ANW B;  4TWD A;  4O4L E;  4I0U A;  4YTP A;  2KLQ A;  3N9M A;  4LFA T;  2BG9 A;  2WB5 A;  4ZI2 D;  3QB5 A;  1D1A A;  3UUM A;  4B3T T;  4DV3 T;  4HWD A;  1MMG A;  5AQQ B;  2LHR A;  1ZKE A;  4I43 B;  4AQF C;  3IA3 A;  3HKD E;  3DP7 A;  4TV8 E;  1SUM B;  5LMN T;  1YXR A;  3EI0 A;  2V5C A;  2WDQ A;  3AE4 A;  4U3C A;  5HEU A;  3A7M A;  4YHH T;  3UU5 A;  4ZI3 D;  4KBM B;  2XY8 B;  3PJA A;  3RC3 A;  4JI6 T;  1ZHC A;  1D1B A;  5BR8 T;  3QC9 A;  4P0B A;  2BS4 A;  2VK9 A;  4Q25 A;  2DLR A;  2DL1 A;  4H63 H;  3H37 A;  5FXZ A;  2PTF A;  3AE3 A;  1S94 A;  5HCJ A;  1SA0 E;  3RH3 A;  2YIN A;  2N9D A;  3UUX B;  5AFU L;  2KIN B;  4TUY E;  1UK5 A;  3A5X A;  2V7J A;  5LYJ E;  5HXR A;  4JI4 T;  2CLY B;  3J9X 1;  5AQU B;  3OTO T;  2X66 A;  1HFA A;  3Q5X A;  2H7V C;  1XDO A;  4EYU A;  2WCA A;  4DV5 T;  4EAH A;  5JH7 E;  4U2Y A;  1T7S A;  1OED C;  2JQQ A;  4OX9 T;  4YSY A;  4GOU A;  4PK6 A;  2DWK A;  4QWN B;  2Y8D A;  1GQE A;  4H63 V;  2UU9 T;  2UXD T;  2RPA A;  5JDN A;  5JRC A;  1HG2 A;  4JI8 T;  4KHP T;  4P09 A;  1XMO T;  2FUP A;  3C4W A;  3PU8 A;  3OYZ A;  4YJ2 E;  4IT4 A;  4QKN A;  3AE7 A;  4NPP A;  3ZN0 B;  3N2K E;  3NVO A;  2JMH A;  2XSA A;  4Z91 A;  1QSD A;  3KBT A;  3OPC A;  5JDG A;  2W62 A;  5AQT B;  4A98 A;  2NTX A;  3F31 A;  2LEH A;  5HYA A;  4LF8 T;  3K3O A;  4ZXL A;  2Q9Q D;  2W00 A;  2R6G F;  4MLK A;  4DUZ T;  3GN5 A;  4IDP A;  3AA7 B;  3R84 B;  1XMQ T;  4K0K T;  3PUV F;  4DUY T;  5L3E B;  4CXY A;  3V5U A;  3SFD A;  5LA6 E;  5L2L A;  3PV0 F;  5AQJ B;  3P7I A;  2BKO A;  4DND A;  5L3C B;  3FHN A;  5IYZ E;  4JEU B;  4OFZ A;  2IDO B;  3EDV A;  3QOF A;  3NRX A;  1X9B A;  3RGL A;  1UX4 A;  2J1D G;  2CMR A;  4EV6 A;  2VB6 A;  3C51 A;  2BG9 E;  4ASK A;  4UVC B;  4YHJ A;  5CA0 E;  1YW0 A;  3FBZ A;  4F6R C;  2HN2 A;  2YDQ A;  5LB7 B;  3R6N A;  4H9O C;  4XZC A;  2E9X D;  1B7T A;  4LML A;  4CZZ B;  4C90 A;  3TLT A;  3N9N A;  3PDY A;  4DV7 T;  3L09 A;  3CML A;  4O4H E;  4AIU A;  4A56 A;  2KZ7 B;  3KV6 A;  1US7 B;  2LOS A;  3AEC A;  3N5L A;  4U2Z A;  2XJ7 A;  4ZEY A;  5EK2 A;  3CPZ A;  5ABF A;  2Q9Q A;  2BS2 A;  3BK9 A;  3HR0 A;  5JQG E;  1ZV4 X;  2KWH A;  4DMV A;  4N78 D;  3RYC E;  2D0U A;  2FJB A;  1LRZ A;  4HN9 A;  3SOL A;  4YJ3 E;  2XTL A;  2WU5 A;  4X66 T;  4CN1 A;  5CJ5 A;  5AQS B;  3PUA A;  2XQ6 A;  1FIO A;  4G2A A;  4UV9 B;  4CI3 B;  3KVB A;  2YOE A;  3ONX A;  2XM2 A;  3BQL A;  5KMG P;  2YDR A;  4QH1 A;  5LGN B;  2VUR A;  3VHL A;  3C98 B;  4OYK A;  4IE4 A;  2CXF A;  1WCR A;  3HKB E;  3ZMT B;  2X9H A;  2WMO A;  4LF5 T;  1QUU A;  2JQ9 A;  5TAO A;  4HEA A;  2QGS A;  4WNK A;  4PJL A;  3OYX A;  3QUJ A;  4JI5 T;  2JJ9 A;  2LOP A;  2LSG A;  1I94 T;  5J1G A;  4YTM A;  2EHO B;  4HTE A;  2K48 A;  4DV0 T;  3LK4 2;  4HWF A;  2JIW A;  2XQ9 A;  1MIY A;  3CX8 B;  3E0Z A;  2AE9 A;  5FVK A;  4AKL A;  2B76 A;  2IAK A;  3KDS E;  4U7I A;  2CWY A;  2WWV A;  3Q2M A;  1WYB A;  3LK2 B;  3P4Q A;  1MMD A;  3RRC A;  4DBR A;  3O1J A;  4MHC A;  1OED E;  5JDQ A;  5FVL A;  3ESL A;  3KV9 A;  1EZ3 A;  5FL0 A;  1XNR T;  3C64 A;  4ZZC A;  1HX1 B;  4OHF A;  3JC6 D;  2ZM0 A;  4X1K E;  3RPU A;  3B57 A;  1MND A;  3P4W A;  4PJN A;  3LBX A;  3L3P A;  2LJL A;  3CWZ B;  4U74 A;  4IDZ A;  5M4Y A;  3NZP A;  4EZH A;  3NBX X;  5FKY A;  2IHR 1;  2WBL A;  2W2U A;  2QVA A;  4NUU A;  3AE6 A;  2RP4 A;  2XPK A;  2NWB A;  4AKH A;  4TNV A;  2XAQ B;  5JDM A;  1UX5 A;  3S4U A;  1W09 A;  3B5M A;  1OXZ A;  4TV9 E;  1D0Z A;  3PUG A;  3HA4 A;  3ZMU B;  5C3J A;  3AAI A;  3I0O A;  5C8Y E;  2V7L A;  2Y6X A;  2VKO A;  3UFE A;  2XSB A;  1CHU A;  2XHE B;  4UF0 B;  3NKZ A;  3M65 A;  3H3A A;  1UUS A;  2ZLY A;  3JAE A;  4IL4 A;  5ETW A;  2N2N A;  3MJX A;  4GK0 E;  2H7O A;  2VKH A;  2VWA A;  1E1H B;  1KNP A;  5JR9 B;  1BR1 A;  3CIR A;  4GKK T;  4DVD A;  3RIU C;  2CLY C;  4X1I E;  1VOM A;  4ILC A;  1HCI A;  3GA8 A;  3MK7 C;  1FEW A;  4X20 E;  4DR1 T;  4EIW A;  4HE8 A;  3Q5D A;  2CE7 A;  3EDU A;  2HH7 A;  4YLH A;  4X5T A;  2P9B A;  2OA5 A;  1WYC A;  3ZLI A;  4C91 A;  2VVS A;  5E0O A;  4EZ4 A;  3FZM B;  2W63 A;  2BVL A;  3AEG A;  1WFD A;  4MAL A;  4GK5 E;  4JEH B;  5F8P A;  4KMC A;  5J2U E;  1U4Q A;  2HPJ A;  2B1E A;  2WY2 A;  3U3I A;  5FP3 A;  3IHR A;  2CPT A;  3E22 E;  3FZH B;  2E8I A;  5AQH B;  2KXP B;  5AQO B;  2XAF B;  4IE6 A;  1IZN B;  4TZ4 C;  3AB3 B;  3WI3 A;  4EED A;  5FXV A;  1KFY A;  3K3N A;  3NZQ A;  1HF8 A;  3TLV A;  3PUR A;  1BR0 A;  2GK9 A;  4PK4 A;  1OWA A;  4LFC T;  3PUZ F;  3PUQ A;  2Z6E A;  3ZKR A;  3VU7 H;  4AQF A;  3N2G E;  2LM2 A;  4LMK A;  1CUN A;  1AJ3 A;  3UFG A;  2C5K T;  2YU1 A;  3NRY A;  4DV1 T;  4DR3 T;  1H7C A;  3ZMZ B;  3EVY A;  4DR5 T;  2YK0 A;  3AAE B;  4H9N C;  5AQF B;  1D0X A;  2ZM2 A;  2PJQ A;  5ABH A;  3X1D A;  3MKD A;  2KND A;  4NUV A;  4WZX A;  4HFI A;  5IWA T;  5BMV E;  1X79 A;  5LGU B;  2W67 A;  2XQ4 A;  3UUL A;  1E2A A;  5DQV A;  2FJA A;  5FYM A;  2V5D A;  4DV4 T;  2L8K A;  4X1Y E;  2X67 A;  3WAK A;  4CN6 A;  3KFW X;  1UGO A;  2X0H A;  4B6X A;  3HKE E;  1D1C A;  3VRB A;  2D9D A;  4DR4 T;  1MMA A;  2WP9 A;  2J47 A;  3I1A A;  1YKE B;  3RKG A;  5AQI B;  1UUR A;  1KF6 A;  3ZCI A;  2LSK A;  5LHI B;  5DQW A;  5H6R B;  1OED A;  2IIU A;  5IUX A;  5JVD E;  2BBJ A;  4XAX B;  4ADZ A;  4JV5 T;  4JBW F;  1YD8 G;  5LG3 A;  4IE7 A;  4H9P C;  4P1N A;  4JI2 T;  3FXE B;  2LSI A;  2M6B A;  4HFD A;  4L5G A;  4LMJ A;  3O1H A;  2LKH A;  2NW9 A;  3UQ7 A;  2D5U A;  3LG7 A;  5AQL B;  3CK6 A;  4IE5 A;  2W4X A;  1HS7 A;  4YSZ A;  4AKR B;  2E5L T;  4I4T E;  3CQC B;  3GMI A;  3ZYK A;  1NAF A;  3RLF F;  3ZN1 B;  3AE1 A;  1WRD A;  2VQE T;  3CQG B;  1KNR A;  4KHZ F;  2F4V T;  2X0Y A;  3SFE A;  4IIJ E;  3VKH A;  3TLS A;  2BS3 A;  3PUY F;  2LT3 A;  5LHG B;  4NIQ A;  1IJ5 A;  1XZY A;  3MAC A;  5GON E;  4LF6 T;  4HFH A;  3ETU A;  4PFP A;  2N1G A;  4OK0 A;  2NTY A;  3BQI A;  4NXN T;  1HTJ F;  4Z90 A;  2HHH T;  4XBF B;  5LJM A;  1J5E T;  3JAD A;  4ZZB A;  3FZL B;  2XZE A;  2CRB A;  5EK4 A;  5LG4 A;  2UXB T;  4E7S A;  3VKG A;  5LP6 E;  3N9Q A;  1HX8 A;  2NP9 A;  4AI6 A;  4AIS A;  3RHW A;  4ZI7 E;  4QH5 A;  2EHO C;  3SWH A;  2K3W A;  2H89 A;  4HWH A;  3FBL A;  3ABV A;  3ZYM A;  2HPL A;  2NW7 A;  3RRW A;  3DJB A;  2WMN A;  2YEV C;  5HEG A;  1JNR A;  4E7Z A;  4ILU A;  2LRL A;  4PAG A;  2E5V A;  2YN6 A;  4KI0 F;  4KP3 C;  1MIW A;  2MBG A;  4V1A v;  4O2B E;  3K3Q C;  4QXH B;  1V9D A;  2XQA A;  1S35 A;  3GN5 B;  2XUE A;  3Q5W A;  4PK5 A;  3EHZ A;  3EAM A;  3LFM A;  4UEL A;  3BQK A;  4TWH A;  4QX7 B;  2DI4 A;  3AVS A;  1N34 T;  1FJG T;  2UUC T;  2LSJ A;  3CQX C;  4J2C A;  2UUA T;  5LCY A;  1I6Z A;  3IEE A;  2CXL A;  1HR0 T;  2X9X A;  3AXJ A;  3HL6 A; 
#chains in the Genus database with same CATH homology
 3T1Y T;  4LF4 T;  4JI6 T;  4JI5 T;  4B3M T;  5BR8 T;  1I94 T;  3T1H T;  4JI0 T;  4DV0 T;  4JI7 T;  4DV7 T;  4LF7 T;  4LF8 T;  4YY3 T;  1XNQ T;  4LFC T;  4DUZ T;  4JV5 T;  4B3S T;  1HNW T;  4JI2 T;  1XMQ T;  1IBL T;  4B3R T;  4NXM T;  4K0K T;  4GKK T;  4DUY T;  4JI4 T;  4X62 T;  4LFA T;  3OTO T;  2E5L T;  1N36 T;  2VQF T;  1XNR T;  4DV5 T;  1N32 T;  4X64 T;  4B3T T;  4DV1 T;  2VQE T;  4DV3 T;  4DR3 T;  2UUB T;  4DR1 T;  2F4V T;  4DR5 T;  4DR7 T;  4OX9 T;  4X66 T;  4LF9 T;  5LMU T;  4GKJ T;  4AQY T;  2UU9 T;  1HNX T;  5IWA T;  4JI1 T;  2UXD T;  4LF6 T;  1HNZ T;  2UXC T;  5LMN T;  4DR6 T;  4DR2 T;  4JI8 T;  1IBK T;  4KHP T;  2ZM6 T;  1N34 T;  1FJG T;  4DV6 T;  1XMO T;  2UUC T;  4NXN T;  4JYA T;  2HHH T;  1IBM T;  4X65 T;  4DV4 T;  1J5E T;  2UUA T;  1N33 T;  1HR0 T;  4JI3 T;  4LF5 T;  2UXB T;  4YHH T;  4DR4 T;  4LFB T;  4DV2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...