4DV3T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv3T00
1IBMT 1HNZT 1XMOT 5IWAT 4JI8T 3T1HT 2E5LT 2HHHT 4JI4T 1N33T 2UUAT 4DR5T 4DV6T 1IBLT 4JI5T 4B3MT 4K0KT 4LF4T 4X62T 4DR6T 4JI6T 4DV0T 5LMUT 4X66T 1J5ET 4LF7T 4B3ST 4YY3T 4AQYT 4GKKT 1I94T 4JI2T 4LF8T 4JI7T 1N36T 4LFAT 4B3RT 4JYAT 4DR2T 2VQET 4DV4T 4DR3T 4JV5T 4DV1T 2UUCT 4LFBT 4YHHT 1HNWT 4X65T 1XNQT 1HNXT 1N34T 4KHPT 4DV7T 4DUZT 2UUBT 4DV2T 4X64T 4DV3T 3T1YT 4LFCT 4JI0T 2UXBT 2F4VT 5LMNT 3OTOT 4GKJT 4LF9T 1XMQT 1IBKT 4NXNT 2ZM6T 4LF5T 2VQFT 1FJGT 4DR4T 4NXMT 2UXCT 4DUYT 4OX9T 4LF6T 1N32T 5BR8T 4DR7T 4DR1T 4JI3T 1HR0T 4JI1T 4B3TT 1XNRT 2UU9T 2UXDT 4DV5T
chains in the Genus database with same CATH superfamily
3K3QC 2V7IA 5LJNA 2CHOA 5J2TE 3NBXX 3EDVA 1KEYA 4PNIA 5AQJB 4AKRB 2CWOA 3LK42 3ZT5A 1SHZC 1WYCA 3KVBA 2CLYC 5ABEA 3PJAA 2DNXA 2LHNA 3UUXB 3TLTA 2YDQA 4H9QC 2AE9A 1OEDC 3L09A 4PJNA 1ZKEA 3ANWA 4EGWA 2YEVC 3R6NA 5FMNA 2ZM8A 3CX8B 3V5SA 2KWIB 5FY1A 3PUXF 3HKBE 2DWGA 3FBZA 1Y01A 2I6HA 2XM1A 3RQWA 4EOZB 4EEDA 4DUZT 2WSSV 3P50A 5HYAA 4DV3T 3RIFA 4UIGA 2K48A 3N9MA 3TLSA 3LBXA 2WCAA 4NXNT 3EUHA 1E1HB 1HS7A 4ZS2A 4Z91A 1MMNA 4CZZB 4QXCB 2QA7A 4HTEA 4U72A 2D5UA 1N32T 4ILBA 4ZHQE 5IHYA 2WY2A 5LCYA 4ILAA 3CQCB 3N2GE 2HH7A 5CA1E 3NWIA 3UU3A 3PV0F 4DNDA 5IWAT 2ES0A 3L3PA 3RRCA 2W63A 4WW0A 3VKHA 2C5IT 1SUMB 5LBQB 3CIRA 4PAGA 3K3NA 3QB5A 4AKHA 2CA5A 5FXVA 2MPKA 5DQVA 2X0LB 3NZPA 4QX8B 3P4SA 4A98A 3DP7A 1E7PA 2JQQA 5FNVE 4HFIA 1U5PA 1M7KA 4H9NC 4QH4A 2C5JA 2KNDA 4DR3T 2EHOB 1Z8UA 3FZFB 4HFHA 4KBMB 1J1JA 5ABHA 1D0XA 2E9XD 2M6BA 3TLVA 2BBHA 5DABA 2CWYA 3V5UA 2JJ9A 4MBQA 1S35A 3ZMUB 4HE8A 3VRBA 5JR9B 2IMLA 2ZM6T 2ODVA 4IIJE 2X0HA 3ZYMA 3QOFA 2UXCT 3UTKA 5KXJA 2V5DA 3FXDB 2LSYA 5LOVE 5JDHA 4LMKA 3AE2A 3I9YA 5ABFB 2N9DA 3ZCJA 1XNRT 2V7MA 5JDNA 2WQYA 1HFAA 2L3LA 3ONXA 5AQRB 3C64A 1ZOYA 3EI0A 2H89A 2E5LT 2J1DG 3HKEE 2FJDA 3N2KE 2RA1A 2C5KT 3OBVE 3ABVA 3VKGA 4O8SA 4JUYA 2V26A 2CLYB 1D1BA 1J5ET 1T7SA 5L2LA 3OPCA 3O9XA 3H37A 2VURA 2XAGB 3SWHA 2MBGA 4UVCB 2KSRA 2A9UA 3GMIA 5JREA 3RYHE 4H9OC 2VQET 3PUGA 4DV4T 1KK7A 2X9YA 4X65T 3RRWA 1LVKA 2CE7A 4U7YA 1ZV4X 5AQIB 4LFCT 4EV6A 2XSBA 1MIWA 1OEDE 3PURA 5L3GB 2R6GF 3PU8A 3EHZA 4HFEA 3M65A 5FYMA 1KFYA 2MYSA 2LHRA 4WBOA 2B1EA 3ESLA 3OJAA 2JQKA 2YDSA 4UF0B 3IBPA 5J2UE 3T8OA 2XAJB 3PUYF 2QVAA 2VKDA 5HXCA 2UXXB 4HWCA 3ZMZB 2JQHA 4IDQA 2X9WA 3LFMA 1M62A 4ZZBA 2VKOA 3WAJA 5L3BB 1WR6A 1X79A 2PJQA 4LF7T 4YT0A 4EYYR 3CKDA 3J7Yq 3O1HA 5FL0A 4QX7B 3ONJA 5HAXA 5AQTB 4JYAT 3NRXA 1MNDA 4DV1T 2NW8A 2XQ5A 3RF1A 5J0ZA 3LJCA 1D0YA 4HGAA 4DV7T 4QH5A 5C8YE 2LT3A 3PUQA 1XDPA 4H63V 3SS1A 4F8HA 3VU7H 2BS4A 3ZCIA 2YK0A 4CXXA 5A1LA 3HKCE 4H63H 4PK5A 4JEHB 2NWBA 2XSAA 4NXMT 4DUYT 5JDLA 4TN7B 5LGUB 2E9XB 2MOZA 3ZC1A 4P0AA 3CPZA 4OYJA 2CEAA 2FUPA 3PUWF 4TWDA 3EDUA 4U7IA 4ADZA 4UEMA 4U74A 4QXHB 3WAKA 4WBNE 2ZM2A 1YKHB 2NOXA 2W00A 3OYZA 3I9WA 4DR5T 3R84B 2PBIA 3UUMA 3ZT7A 3AE6A 2M6IA 4JEUB 2XAQB 1YW0A 3RPUA 2Q9QD 2WZHA 5CA0E 4IDZA 5FL1A 4HWFA 3P4PA 2DHRA 4TNWA 4HEAA 3EABA 3LSVA 5DJQC 4L0RA 3W15B 3KV9A 5FXZA 3A5XA 3AAAB 4X5TA 4A56A 4I50E 5E0OA 3T1YT 2X66A 4Z8XA 1E2AA 1XZYA 2VVSA 5F3JA 3JC6C 2X9XA 3KBTA 3N9PA 2V5CA 4DO0A 5AQVB 2A72A 4EIWA 4XAXB 3B13A 3VHLA 4DR7T 4FJOA 2XQ3A 5JR9C 4LMJA 1HR0T 4NIQA 1VRBA 2H88A 2V7LA 5FXWA 4I4TE 2WP9A 1VOMA 2YU2A 2XAFB 4QH1A 4QKNA 3FXEB 1IJ6A 4JI8T 5EK2A 1UURA 3UU5A 3FZKB 3ZMSB 3Q2MA 1LKXA 4HFCA 3WI3A 3K8PC 4IT4A 2XQ6A 5M4YA 4DBQA 4DR6T 4YTMA 2XQYA 2LSJA 5BMVE 2BG9A 4AQYT 3I0OA 1I94T 5HWXA 1W09A 3A8YC 5JDMA 5LXTE 4CXYA 3I0QA 1WLXA 4AQFA 3RX6A 3UT5E 4IE4A 1HNWT 3PUAA 4IE6A 3CQGB 2I59A 2Y48B 5LG3A 2OA5A 2YOEA 2NW9A 3U78A 3IF8B 1D0ZA 3K3OA 4JI0T 3AEBA 3OTOT 1BR1A 4BA9A 4LF9T 1H7CA 3RIUC 2LSKA 5L3CB 2XM2A 3L8RA 3ZN0B 4PJMA 5LNKA 5BR8T 2QRXA 1YQ3A 2IC6A 3UUNA 3FBLA 2L8KA 2KXPB 1WR0A 2Q9QA 5EK3A 2XY8B 5LP6E 2UXDT 2VVNA 2V7JA 1V9DA 2BG9E 3Q9DA 1XMOT 3RC3A 4IE7A 4KP3C 3F57A 5AQHB 5FVLA 2XAHB 3ETUA 3VR8A 2CXDA 3CMLA 2QGSA 5AQMB 2W4XA 3ANWB 2J47A 5L3FB 2EHOA 4YHJA 2BS2A 4AKIA 4DBRA 2JMKA 2K9AA 2A3DA 4P1NA 2G0UA 1YKEB 4ZS3A 5LHHB 3E08A 4JV5T 2UUCT 4LFBT 4YHHT 3JADA 4BJNA 2HPJA 4U31A 4AKGA 2IAKA 1N34T 2HN2A 3UFEA 2W62A 5AQLB 3X1DA 4O4IE 3J9X1 3ETVA 2JQ9A 5LMNT 4OK0A 4U2YA 3QB5K 3JAFA 3JCFA 3Q5EA 1R8IA 4LF6T 3O1JA 4O4JE 3CK6A 2E8IA 2VB6A 3F2EA 2CBJA 4YFSA 2X68A 1OWAA 3TKLB 2BKOA 4PJJA 2BS3A 5AQGB 3N9LA 2E9XC 2VWAA 3AE1A 2FBWA 4O2AE 2JMHA 3BQKA 2HHHT 2M67A 1SE7A 1WFDA 3CX6B 2CRBA 4K0UA 4A97A 4DV6T 4ILUA 3AE5A 5FY7A 2C0SA 1OEDA 2XQ8A 4MALA 3SFDA 4YTNA 4B3ST 3PDYA 3P7IA 3QNUA 2ACZA 3HI2A 2CCQA 2GK9A 4Q25A 4P0BA 2BKPA 4ERRA 1BR2A 5JRCB 4TV8E 3EAMA 2D2SA 3VRAA 4DMWA 3AXJA 3Q5WA 2XQ9A 2BBJA 4CN6A 3P4RA 5ADXL 2NTYA 2LKGA 4YLHA 1UX4A 3UFGA 2BVMA 1XMQT 3AA1B 1ZP0A 3ZN1B 3RKOA 3RGLA 3SFEA 1W9RA 4EZHA 1B7TA 5LGNB 2I0MA 2V6YA 3CX7B 2RPAA 1MNEA 3I1AA 3AE4A 5C2TA 4HKAA 4KI0F 1HNZT 1HX1B 4YJ3E 4B6XA 3T1HT 1L0VA 1NAFA 2N2NA 4JI4T 5CGMA 2ZMAA 2UUAT 3O1IA 1VCSA 1IBLT 3ZJ2A 3S4UA 4DVDA 2HPLA 3MACA 4LF4T 4ASKA 5JDGA 1HX8A 2KT9A 1ZEEA 2IC9A 1YQ4A 5LJMA 5LA6E 4PJLA 3NRYA 5TAOA 3AECA 2WDQA 3N9QA 2Z6EA 2YINA 4JI7T 3HKDE 3Q5XA 3B5MA 5L3EB 4YSXA 1SA0E 2CXLA 4CXWA 5L4HA 1HNXT 3LDQB 4HN9A 2DL1A 2FJAA 4E7ZA 4WYVA 3IEEA 5FVKA 2XASB 4GKJT 2WMNA 1LVFA 1UGOA 2KZ7B 3AB3B 5EK4A 2LM2A 1FEWA 4AI6A 4IE0A 5IYZE 1JNRA 5LYJE 3RC8A 2FJEA 1GQEA 2ACXA 4UR9A 1HCIA 4BAYB 1HG5A 1AJ3A 3ZKRA 1WYBA 4AISA 2HN1A 3OYXA 4TV9E 3B57A 3NKZA 2BVLA 3RYFE 1IAPA 1IBMT 2BZBA 5LGTB 5LG4A 2VKJA 4COFA 1Z0PA 3L39A 3UU8A 4G2AA 3AEEA 5CJ5A 1HTJF 3ZSTA 1BR4A 1CHUA 4HWDA 4ZZCA 4DMVA 4L5GA 5L3DB 2CXFA 4KHZF 4UVAB 5KDMC 2SPCA 4G63A 2XUEA 5GONE 3AVRA 2NTXA 3O4XE 4GKKT 4GK0E 3AA6B 4ISTA 2XTLA 2FJBA 3HR0A 1U4QA 4CN4A 4DR2T 4KMCA 2K5BB 2WWUA 3PUVF 4C91A 4GYSA 4M1PA 4DV2T 2XHEB 2UXBT 3UUBA 4NUVA 5HXRA 1W0BA 3TLUA 2VL0A 5JDQA 3GN5A 4Z90A 2CM0A 5F5WA 5AQFB 4AQGA 1WCRA 2D0UA 3IA3A 3SOLA 3ZT6A 4FI5A 1XDOA 4JLEA 4A5XA 3MJXA 3LG7A 2IDOB 2WWVA 2EHOD 1O3XA 3LK3B 3IHRA 4U2ZA 2D0TA 2WMOA 3PJAJ 2H3RA 1FMVA 3N9OA 4EEBA 2JIWA 2V6XA 3P4WA 1BR0A 1KNRA 2LE8A 3KV5A 2K3WA 3BK9A 5ETWA 2CHNA 4QHOA 1T72A 1UX5A 1I6ZA 3H3AA 3OVUA 4ISSA 5HCJA 3HL6A 5FY0A 3QK6A 3KBUA 4ZI3D 4YY3T 3C4WA 5CB4E 4YXDA 4LF8T 2UXNB 2Y8DA 3CWZB 4V1Av 5HEJA 4O4HE 1QUUA 2PFVA 4NPPA 2JRKA 4ZI2C 2Y6XA 3C4ZA 5ABGA 3ZJ1A 3RIAA 5HXHA 2DWKA 4GK5E 1QSDA 2DCFA 4CI2B 5LHIB 4L9IA 1YD8G 1MMGA 5J1GA 3ONLC 5HCMA 2QYWA 3G06A 3AA7B 4CQIA 4DR4T 4ZOLE 4PK4A 4IL9A 1UK5A 1G8XA 2LKHA 4HFVA 3RQUA 4TZ4C 1MMDA 2V1DB 2WU5A 2IHR1 3NVOA 2NW7A 2LLYA 3UULA 3KV6A 3C50A 3RHWA 4HFBA 3OKQA 3RKGA 4EZ4A 2LJLA 2NR4A 4IDOA 5JH7E 2XQAA 3LK2B 3SRZA 4OFZA 3M3ZB 3AE9A 3CVRA 2BG9B 2CMRA 1WRDA 5LMUT 4OYKA 4H9SE 1J5WA 1NWMX 2VK9A 3F31A 2JPFA 5LHGB 2VASA 2W67A 3QC9A 4P09A 4UV9B 4MLKA 4KHPT 3HA4A 3AEAA 2RP4A 4TX5A 3AE8A 4ZEYA 3UQ4A 4NUUA 3FZLB 5AQUB 2VQFT 3ZYKA 1X9BA 1NENA 3AA0B 4OHFA 1UUSA 3LBXB 4DIDB 5JR9A 2Q9QB 5AFUL 2DI4A 4DR1T 3C98B 3NZQA 2XPKA 1T98A 2N1GA 4QWNB 3C51A 4B3TT 2KLQA 2UU9T 4DV5T 4YSZA 2PTFA 3AEDA 3C4XA 5ABFA 3CQXC 3K1SA 2LSIA 4PW8A 2BKNA 5IUXA 4PFOA 2BDEA 4O4LE 4X1IE 4B3MT 5CFBA 4EB6E 4CI1B 3A7MA 4AKLA 4JI6T 2XQ7A 5JRCA 2ZM0A 4X66T 4QXBB 4UV8B 1ZHCA 2V8SV 2YU1A 4HFDA 2J4GA 4JI2T 5FP3A 3KINB 4I55E 4MHCA 2W61A 5AQQB 2IIUA 2MTQA 4IHJE 2H7OA 3ZMVB 5AQNB 3FHNA 3MZKB 4UELA 4J2CA 2DLRA 2PG8A 2J62A 4H9PC 5FKYA 2W0GA 3RIUA 2OV9A 2XJ7A 3E22E 4HWIB 4U3CA 2XZEA 1NEKA 1EZ3A 4EYUA 2X67A 5HEGA 1MIYA 4YTPA 3KV4A 2LSGA 3TLWA 4YJ2E 3N2OA 3VR9A 4I0UA 3MKDA 3GWHA 1N33T 3AEGA 2E2AA 3EVYA 2E5VA 4UF0A 1OEDB 3MXZA 3PU3A 3UU4A 4LMLA 3RI5A 4F6RC 4TNVA 4WZXA 5AQKB 1G73A 3D0TA 5AQOB 1Y64B 3GA8A 4UVBB 4DV0T 3DJBA 4MFRA 4O2BE 3ZPOA 2WAUA 2D9DA 2XQ4A 4X1KE 2X0YA 4X20E 3AXJB 3KVAA 2LRKA 5L47A 5AQSB 3RLFF 4PFPA 1XNQT 1VCTA 2LRLA 1KNPA 4IE5A 4N78D 2UUBT 4X64T 1MIVA 3RYIE 2WBLA 2LOPA 1D1AA 5JVDE 1D1CA 3FZHB 2IW5B 4I43B 2VKHA 4PK6A 4ZXLA 5HXEA 2L9QA 2V6YB 2VL8A 3FZMB 3ZC0A 4XZCA 3ZEFB 1DU2A 2A2FX 5H6RB 4JI3T 4GYRA 4X1YE 2IUBA 1IZNB 2E9XA 3UU6A 2YKSA 3MA9A 1S94A 3AEFA 2X9HA 4UXNB 1UCUA 2ZLYA 3BQIA 5AQPB 4JBWF 4TUYE 3PUSA 4GOUA 4K0KT 4X62T 4IDPA 2X51A 4AIUA 4CI3B 5HEOA 5C3JA 3RH3A 2CBIA 2WDRA 3U3IA 3AVSA 3ZLIA 3KFWX 1KNZA 2BG9C 2H7VC 3AE7A 4LFAT 4CN1A 4B3RT 4ANJA 4AXPA 5HEUA 1OXZA 4YSYA 4AQFC 5KX5E 4H9RC 3DTOA 4KX6A 2YDRA 2F4VT 3AAIA 4GIWA 3N9NA 3FB2A 1IBKT 2K24A 2WU2A 1QLBA 4IGUA 4LF5T 1LRZA 4BJMA 1FJGT 3P8CD 5DQWA 3Q5DA 4OX9T 5HXSA 1FMWA 3BQLA 4TWFA 2CPTA 1US7B 2KINB 1HF8A 2NP9A 4EAHA 4WNKA 4KUMB 1KF6A 4IREA 2Q9QC 1FIOA 5JTGA 1MMAA 2LM9A 5H6QB 4IDNA 2ODUA 3JAEA 5EZYE 5LBMA 4JI5T 2KMFA 2WB5A 2WS3A 2WZIA 3PE0A 5HWYA 4HWHA 3JC6D 3MK7C 2WDVA 3E0ZA 1XWMA 5F8PA 2EHOC 4ILCA 4ZI7E 3N5LA 5KMGP 1N36T 2W2UA 3RYCE 2OLTA 1YXRA 4E7SA 3ZMTB 2AXDS 3QUJA 2LEHA 5L4EA 1W0AA 2YN6A 2WM9A 1T8BA 4U33A 3GN5B 3P4QA 4IL4A 3PTRB 3KDSE 2V7KA 4EXTA 5JDFA 2KWHA 5JQGE 4XBFB 2MAWA 3AE3A 3ZYLA 1JNZA 4ZI2D 1HG2A 4ZI3C 3AAEB 5LB7B 5FXXA 3UQ7A 1IJ5A 2LOSA 1CUNA 3H3MA 2W66A 4TWHA 5HEHA 4JI1T 2P9BA 3ZSSA 4C90A 2B76A 3PUZF
chains in the Genus database with same CATH topology
1IBMT 1HNZT 1XMOT 5IWAT 4JI8T 3T1HT 2E5LT 2HHHT 4JI4T 1N33T 2UUAT 4DR5T 4DV6T 1IBLT 4JI5T 4B3MT 4K0KT 4LF4T 4X62T 4DR6T 4JI6T 4DV0T 5LMUT 4X66T 1J5ET 4LF7T 4B3ST 4YY3T 4AQYT 4GKKT 1I94T 4JI2T 4LF8T 4JI7T 1N36T 4LFAT 4B3RT 4JYAT 4DR2T 2VQET 4DV4T 4DR3T 4JV5T 4DV1T 2UUCT 4LFBT 4YHHT 1HNWT 4X65T 1XNQT 1HNXT 1N34T 4KHPT 4DV7T 4DUZT 2UUBT 4DV2T 4X64T 4DV3T 3T1YT 4LFCT 4JI0T 2UXBT 2F4VT 5LMNT 3OTOT 4GKJT 4LF9T 1XMQT 1IBKT 4NXNT 2ZM6T 4LF5T 2VQFT 1FJGT 4DR4T 4NXMT 2UXCT 4DUYT 4OX9T 4LF6T 1N32T 5BR8T 4DR7T 4DR1T 4JI3T 1HR0T 4JI1T 4B3TT 1XNRT 2UU9T 2UXDT 4DV5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM T;  1HNZ T;  1XMO T;  5IWA T;  4JI8 T;  3T1H T;  2E5L T;  2HHH T;  4JI4 T;  1N33 T;  2UUA T;  4DR5 T;  4DV6 T;  1IBL T;  4JI5 T;  4B3M T;  4K0K T;  4LF4 T;  4X62 T;  4DR6 T;  4JI6 T;  4DV0 T;  5LMU T;  4X66 T;  1J5E T;  4LF7 T;  4B3S T;  4YY3 T;  4AQY T;  4GKK T;  1I94 T;  4JI2 T;  4LF8 T;  4JI7 T;  1N36 T;  4LFA T;  4B3R T;  4JYA T;  4DR2 T;  2VQE T;  4DV4 T;  4DR3 T;  4JV5 T;  4DV1 T;  2UUC T;  4LFB T;  4YHH T;  1HNW T;  4X65 T;  1XNQ T;  1HNX T;  1N34 T;  4KHP T;  4DV7 T;  4DUZ T;  2UUB T;  4DV2 T;  4X64 T;  4DV3 T;  3T1Y T;  4LFC T;  4JI0 T;  2UXB T;  2F4V T;  5LMN T;  3OTO T;  4GKJ T;  4LF9 T;  1XMQ T;  1IBK T;  4NXN T;  2ZM6 T;  4LF5 T;  2VQF T;  1FJG T;  4DR4 T;  4NXM T;  2UXC T;  4DUY T;  4OX9 T;  4LF6 T;  1N32 T;  5BR8 T;  4DR7 T;  4DR1 T;  4JI3 T;  1HR0 T;  4JI1 T;  4B3T T;  1XNR T;  2UU9 T;  2UXD T;  4DV5 T; 
#chains in the Genus database with same CATH topology
 3K3Q C;  2V7I A;  5LJN A;  2CHO A;  5J2T E;  3NBX X;  3EDV A;  1KEY A;  4PNI A;  5AQJ B;  4AKR B;  2CWO A;  3LK4 2;  3ZT5 A;  1SHZ C;  1WYC A;  3KVB A;  2CLY C;  5ABE A;  3PJA A;  2DNX A;  2LHN A;  3UUX B;  3TLT A;  2YDQ A;  4H9Q C;  2AE9 A;  1OED C;  3L09 A;  4PJN A;  1ZKE A;  3ANW A;  4EGW A;  2YEV C;  3R6N A;  5FMN A;  2ZM8 A;  3CX8 B;  3V5S A;  2KWI B;  5FY1 A;  3PUX F;  3HKB E;  2DWG A;  3FBZ A;  1Y01 A;  2I6H A;  2XM1 A;  3RQW A;  4EOZ B;  4EED A;  4DUZ T;  2WSS V;  3P50 A;  5HYA A;  4DV3 T;  3RIF A;  4UIG A;  2K48 A;  3N9M A;  3TLS A;  3LBX A;  2WCA A;  4NXN T;  3EUH A;  1E1H B;  1HS7 A;  4ZS2 A;  4Z91 A;  1MMN A;  4CZZ B;  4QXC B;  2QA7 A;  4HTE A;  4U72 A;  2D5U A;  1N32 T;  4ILB A;  4ZHQ E;  5IHY A;  2WY2 A;  5LCY A;  4ILA A;  3CQC B;  3N2G E;  2HH7 A;  5CA1 E;  3NWI A;  3UU3 A;  3PV0 F;  4DND A;  5IWA T;  2ES0 A;  3L3P A;  3RRC A;  2W63 A;  4WW0 A;  3VKH A;  2C5I T;  1SUM B;  5LBQ B;  3CIR A;  4PAG A;  3K3N A;  3QB5 A;  4AKH A;  2CA5 A;  5FXV A;  2MPK A;  5DQV A;  2X0L B;  3NZP A;  4QX8 B;  3P4S A;  4A98 A;  3DP7 A;  1E7P A;  2JQQ A;  5FNV E;  4HFI A;  1U5P A;  1M7K A;  4H9N C;  4QH4 A;  2C5J A;  2KND A;  4DR3 T;  2EHO B;  1Z8U A;  3FZF B;  4HFH A;  4KBM B;  1J1J A;  5ABH A;  1D0X A;  2E9X D;  2M6B A;  3TLV A;  2BBH A;  5DAB A;  2CWY A;  3V5U A;  2JJ9 A;  4MBQ A;  1S35 A;  3ZMU B;  4HE8 A;  3VRB A;  5JR9 B;  2IML A;  2ZM6 T;  2ODV A;  4IIJ E;  2X0H A;  3ZYM A;  3QOF A;  2UXC T;  3UTK A;  5KXJ A;  2V5D A;  3FXD B;  2LSY A;  5LOV E;  5JDH A;  4LMK A;  3AE2 A;  3I9Y A;  5ABF B;  2N9D A;  3ZCJ A;  1XNR T;  2V7M A;  5JDN A;  2WQY A;  1HFA A;  2L3L A;  3ONX A;  5AQR B;  3C64 A;  1ZOY A;  3EI0 A;  2H89 A;  2E5L T;  2J1D G;  3HKE E;  2FJD A;  3N2K E;  2RA1 A;  2C5K T;  3OBV E;  3ABV A;  3VKG A;  4O8S A;  4JUY A;  2V26 A;  2CLY B;  1D1B A;  1J5E T;  1T7S A;  5L2L A;  3OPC A;  3O9X A;  3H37 A;  2VUR A;  2XAG B;  3SWH A;  2MBG A;  4UVC B;  2KSR A;  2A9U A;  3GMI A;  5JRE A;  3RYH E;  4H9O C;  2VQE T;  3PUG A;  4DV4 T;  1KK7 A;  2X9Y A;  4X65 T;  3RRW A;  1LVK A;  2CE7 A;  4U7Y A;  1ZV4 X;  5AQI B;  4LFC T;  4EV6 A;  2XSB A;  1MIW A;  1OED E;  3PUR A;  5L3G B;  2R6G F;  3PU8 A;  3EHZ A;  4HFE A;  3M65 A;  5FYM A;  1KFY A;  2MYS A;  2LHR A;  4WBO A;  2B1E A;  3ESL A;  3OJA A;  2JQK A;  2YDS A;  4UF0 B;  3IBP A;  5J2U E;  3T8O A;  2XAJ B;  3PUY F;  2QVA A;  2VKD A;  5HXC A;  2UXX B;  4HWC A;  3ZMZ B;  2JQH A;  4IDQ A;  2X9W A;  3LFM A;  1M62 A;  4ZZB A;  2VKO A;  3WAJ A;  5L3B B;  1WR6 A;  1X79 A;  2PJQ A;  4LF7 T;  4YT0 A;  4EYY R;  3CKD A;  3J7Y q;  3O1H A;  5FL0 A;  4QX7 B;  3ONJ A;  5HAX A;  5AQT B;  4JYA T;  3NRX A;  1MND A;  4DV1 T;  2NW8 A;  2XQ5 A;  3RF1 A;  5J0Z A;  3LJC A;  1D0Y A;  4HGA A;  4DV7 T;  4QH5 A;  5C8Y E;  2LT3 A;  3PUQ A;  1XDP A;  4H63 V;  3SS1 A;  4F8H A;  3VU7 H;  2BS4 A;  3ZCI A;  2YK0 A;  4CXX A;  5A1L A;  3HKC E;  4H63 H;  4PK5 A;  4JEH B;  2NWB A;  2XSA A;  4NXM T;  4DUY T;  5JDL A;  4TN7 B;  5LGU B;  2E9X B;  2MOZ A;  3ZC1 A;  4P0A A;  3CPZ A;  4OYJ A;  2CEA A;  2FUP A;  3PUW F;  4TWD A;  3EDU A;  4U7I A;  4ADZ A;  4UEM A;  4U74 A;  4QXH B;  3WAK A;  4WBN E;  2ZM2 A;  1YKH B;  2NOX A;  2W00 A;  3OYZ A;  3I9W A;  4DR5 T;  3R84 B;  2PBI A;  3UUM A;  3ZT7 A;  3AE6 A;  2M6I A;  4JEU B;  2XAQ B;  1YW0 A;  3RPU A;  2Q9Q D;  2WZH A;  5CA0 E;  4IDZ A;  5FL1 A;  4HWF A;  3P4P A;  2DHR A;  4TNW A;  4HEA A;  3EAB A;  3LSV A;  5DJQ C;  4L0R A;  3W15 B;  3KV9 A;  5FXZ A;  3A5X A;  3AAA B;  4X5T A;  4A56 A;  4I50 E;  5E0O A;  3T1Y T;  2X66 A;  4Z8X A;  1E2A A;  1XZY A;  2VVS A;  5F3J A;  3JC6 C;  2X9X A;  3KBT A;  3N9P A;  2V5C A;  4DO0 A;  5AQV B;  2A72 A;  4EIW A;  4XAX B;  3B13 A;  3VHL A;  4DR7 T;  4FJO A;  2XQ3 A;  5JR9 C;  4LMJ A;  1HR0 T;  4NIQ A;  1VRB A;  2H88 A;  2V7L A;  5FXW A;  4I4T E;  2WP9 A;  1VOM A;  2YU2 A;  2XAF B;  4QH1 A;  4QKN A;  3FXE B;  1IJ6 A;  4JI8 T;  5EK2 A;  1UUR A;  3UU5 A;  3FZK B;  3ZMS B;  3Q2M A;  1LKX A;  4HFC A;  3WI3 A;  3K8P C;  4IT4 A;  2XQ6 A;  5M4Y A;  4DBQ A;  4DR6 T;  4YTM A;  2XQY A;  2LSJ A;  5BMV E;  2BG9 A;  4AQY T;  3I0O A;  1I94 T;  5HWX A;  1W09 A;  3A8Y C;  5JDM A;  5LXT E;  4CXY A;  3I0Q A;  1WLX A;  4AQF A;  3RX6 A;  3UT5 E;  4IE4 A;  1HNW T;  3PUA A;  4IE6 A;  3CQG B;  2I59 A;  2Y48 B;  5LG3 A;  2OA5 A;  2YOE A;  2NW9 A;  3U78 A;  3IF8 B;  1D0Z A;  3K3O A;  4JI0 T;  3AEB A;  3OTO T;  1BR1 A;  4BA9 A;  4LF9 T;  1H7C A;  3RIU C;  2LSK A;  5L3C B;  2XM2 A;  3L8R A;  3ZN0 B;  4PJM A;  5LNK A;  5BR8 T;  2QRX A;  1YQ3 A;  2IC6 A;  3UUN A;  3FBL A;  2L8K A;  2KXP B;  1WR0 A;  2Q9Q A;  5EK3 A;  2XY8 B;  5LP6 E;  2UXD T;  2VVN A;  2V7J A;  1V9D A;  2BG9 E;  3Q9D A;  1XMO T;  3RC3 A;  4IE7 A;  4KP3 C;  3F57 A;  5AQH B;  5FVL A;  2XAH B;  3ETU A;  3VR8 A;  2CXD A;  3CML A;  2QGS A;  5AQM B;  2W4X A;  3ANW B;  2J47 A;  5L3F B;  2EHO A;  4YHJ A;  2BS2 A;  4AKI A;  4DBR A;  2JMK A;  2K9A A;  2A3D A;  4P1N A;  2G0U A;  1YKE B;  4ZS3 A;  5LHH B;  3E08 A;  4JV5 T;  2UUC T;  4LFB T;  4YHH T;  3JAD A;  4BJN A;  2HPJ A;  4U31 A;  4AKG A;  2IAK A;  1N34 T;  2HN2 A;  3UFE A;  2W62 A;  5AQL B;  3X1D A;  4O4I E;  3J9X 1;  3ETV A;  2JQ9 A;  5LMN T;  4OK0 A;  4U2Y A;  3QB5 K;  3JAF A;  3JCF A;  3Q5E A;  1R8I A;  4LF6 T;  3O1J A;  4O4J E;  3CK6 A;  2E8I A;  2VB6 A;  3F2E A;  2CBJ A;  4YFS A;  2X68 A;  1OWA A;  3TKL B;  2BKO A;  4PJJ A;  2BS3 A;  5AQG B;  3N9L A;  2E9X C;  2VWA A;  3AE1 A;  2FBW A;  4O2A E;  2JMH A;  3BQK A;  2HHH T;  2M67 A;  1SE7 A;  1WFD A;  3CX6 B;  2CRB A;  4K0U A;  4A97 A;  4DV6 T;  4ILU A;  3AE5 A;  5FY7 A;  2C0S A;  1OED A;  2XQ8 A;  4MAL A;  3SFD A;  4YTN A;  4B3S T;  3PDY A;  3P7I A;  3QNU A;  2ACZ A;  3HI2 A;  2CCQ A;  2GK9 A;  4Q25 A;  4P0B A;  2BKP A;  4ERR A;  1BR2 A;  5JRC B;  4TV8 E;  3EAM A;  2D2S A;  3VRA A;  4DMW A;  3AXJ A;  3Q5W A;  2XQ9 A;  2BBJ A;  4CN6 A;  3P4R A;  5ADX L;  2NTY A;  2LKG A;  4YLH A;  1UX4 A;  3UFG A;  2BVM A;  1XMQ T;  3AA1 B;  1ZP0 A;  3ZN1 B;  3RKO A;  3RGL A;  3SFE A;  1W9R A;  4EZH A;  1B7T A;  5LGN B;  2I0M A;  2V6Y A;  3CX7 B;  2RPA A;  1MNE A;  3I1A A;  3AE4 A;  5C2T A;  4HKA A;  4KI0 F;  1HNZ T;  1HX1 B;  4YJ3 E;  4B6X A;  3T1H T;  1L0V A;  1NAF A;  2N2N A;  4JI4 T;  5CGM A;  2ZMA A;  2UUA T;  3O1I A;  1VCS A;  1IBL T;  3ZJ2 A;  3S4U A;  4DVD A;  2HPL A;  3MAC A;  4LF4 T;  4ASK A;  5JDG A;  1HX8 A;  2KT9 A;  1ZEE A;  2IC9 A;  1YQ4 A;  5LJM A;  5LA6 E;  4PJL A;  3NRY A;  5TAO A;  3AEC A;  2WDQ A;  3N9Q A;  2Z6E A;  2YIN A;  4JI7 T;  3HKD E;  3Q5X A;  3B5M A;  5L3E B;  4YSX A;  1SA0 E;  2CXL A;  4CXW A;  5L4H A;  1HNX T;  3LDQ B;  4HN9 A;  2DL1 A;  2FJA A;  4E7Z A;  4WYV A;  3IEE A;  5FVK A;  2XAS B;  4GKJ T;  2WMN A;  1LVF A;  1UGO A;  2KZ7 B;  3AB3 B;  5EK4 A;  2LM2 A;  1FEW A;  4AI6 A;  4IE0 A;  5IYZ E;  1JNR A;  5LYJ E;  3RC8 A;  2FJE A;  1GQE A;  2ACX A;  4UR9 A;  1HCI A;  4BAY B;  1HG5 A;  1AJ3 A;  3ZKR A;  1WYB A;  4AIS A;  2HN1 A;  3OYX A;  4TV9 E;  3B57 A;  3NKZ A;  2BVL A;  3RYF E;  1IAP A;  1IBM T;  2BZB A;  5LGT B;  5LG4 A;  2VKJ A;  4COF A;  1Z0P A;  3L39 A;  3UU8 A;  4G2A A;  3AEE A;  5CJ5 A;  1HTJ F;  3ZST A;  1BR4 A;  1CHU A;  4HWD A;  4ZZC A;  4DMV A;  4L5G A;  5L3D B;  2CXF A;  4KHZ F;  4UVA B;  5KDM C;  2SPC A;  4G63 A;  2XUE A;  5GON E;  3AVR A;  2NTX A;  3O4X E;  4GKK T;  4GK0 E;  3AA6 B;  4IST A;  2XTL A;  2FJB A;  3HR0 A;  1U4Q A;  4CN4 A;  4DR2 T;  4KMC A;  2K5B B;  2WWU A;  3PUV F;  4C91 A;  4GYS A;  4M1P A;  4DV2 T;  2XHE B;  2UXB T;  3UUB A;  4NUV A;  5HXR A;  1W0B A;  3TLU A;  2VL0 A;  5JDQ A;  3GN5 A;  4Z90 A;  2CM0 A;  5F5W A;  5AQF B;  4AQG A;  1WCR A;  2D0U A;  3IA3 A;  3SOL A;  3ZT6 A;  4FI5 A;  1XDO A;  4JLE A;  4A5X A;  3MJX A;  3LG7 A;  2IDO B;  2WWV A;  2EHO D;  1O3X A;  3LK3 B;  3IHR A;  4U2Z A;  2D0T A;  2WMO A;  3PJA J;  2H3R A;  1FMV A;  3N9O A;  4EEB A;  2JIW A;  2V6X A;  3P4W A;  1BR0 A;  1KNR A;  2LE8 A;  3KV5 A;  2K3W A;  3BK9 A;  5ETW A;  2CHN A;  4QHO A;  1T72 A;  1UX5 A;  1I6Z A;  3H3A A;  3OVU A;  4ISS A;  5HCJ A;  3HL6 A;  5FY0 A;  3QK6 A;  3KBU A;  4ZI3 D;  4YY3 T;  3C4W A;  5CB4 E;  4YXD A;  4LF8 T;  2UXN B;  2Y8D A;  3CWZ B;  4V1A v;  5HEJ A;  4O4H E;  1QUU A;  2PFV A;  4NPP A;  2JRK A;  4ZI2 C;  2Y6X A;  3C4Z A;  5ABG A;  3ZJ1 A;  3RIA A;  5HXH A;  2DWK A;  4GK5 E;  1QSD A;  2DCF A;  4CI2 B;  5LHI B;  4L9I A;  1YD8 G;  1MMG A;  5J1G A;  3ONL C;  5HCM A;  2QYW A;  3G06 A;  3AA7 B;  4CQI A;  4DR4 T;  4ZOL E;  4PK4 A;  4IL9 A;  1UK5 A;  1G8X A;  2LKH A;  4HFV A;  3RQU A;  4TZ4 C;  1MMD A;  2V1D B;  2WU5 A;  2IHR 1;  3NVO A;  2NW7 A;  2LLY A;  3UUL A;  3KV6 A;  3C50 A;  3RHW A;  4HFB A;  3OKQ A;  3RKG A;  4EZ4 A;  2LJL A;  2NR4 A;  4IDO A;  5JH7 E;  2XQA A;  3LK2 B;  3SRZ A;  4OFZ A;  3M3Z B;  3AE9 A;  3CVR A;  2BG9 B;  2CMR A;  1WRD A;  5LMU T;  4OYK A;  4H9S E;  1J5W A;  1NWM X;  2VK9 A;  3F31 A;  2JPF A;  5LHG B;  2VAS A;  2W67 A;  3QC9 A;  4P09 A;  4UV9 B;  4MLK A;  4KHP T;  3HA4 A;  3AEA A;  2RP4 A;  4TX5 A;  3AE8 A;  4ZEY A;  3UQ4 A;  4NUU A;  3FZL B;  5AQU B;  2VQF T;  3ZYK A;  1X9B A;  1NEN A;  3AA0 B;  4OHF A;  1UUS A;  3LBX B;  4DID B;  5JR9 A;  2Q9Q B;  5AFU L;  2DI4 A;  4DR1 T;  3C98 B;  3NZQ A;  2XPK A;  1T98 A;  2N1G A;  4QWN B;  3C51 A;  4B3T T;  2KLQ A;  2UU9 T;  4DV5 T;  4YSZ A;  2PTF A;  3AED A;  3C4X A;  5ABF A;  3CQX C;  3K1S A;  2LSI A;  4PW8 A;  2BKN A;  5IUX A;  4PFO A;  2BDE A;  4O4L E;  4X1I E;  4B3M T;  5CFB A;  4EB6 E;  4CI1 B;  3A7M A;  4AKL A;  4JI6 T;  2XQ7 A;  5JRC A;  2ZM0 A;  4X66 T;  4QXB B;  4UV8 B;  1ZHC A;  2V8S V;  2YU1 A;  4HFD A;  2J4G A;  4JI2 T;  5FP3 A;  3KIN B;  4I55 E;  4MHC A;  2W61 A;  5AQQ B;  2IIU A;  2MTQ A;  4IHJ E;  2H7O A;  3ZMV B;  5AQN B;  3FHN A;  3MZK B;  4UEL A;  4J2C A;  2DLR A;  2PG8 A;  2J62 A;  4H9P C;  5FKY A;  2W0G A;  3RIU A;  2OV9 A;  2XJ7 A;  3E22 E;  4HWI B;  4U3C A;  2XZE A;  1NEK A;  1EZ3 A;  4EYU A;  2X67 A;  5HEG A;  1MIY A;  4YTP A;  3KV4 A;  2LSG A;  3TLW A;  4YJ2 E;  3N2O A;  3VR9 A;  4I0U A;  3MKD A;  3GWH A;  1N33 T;  3AEG A;  2E2A A;  3EVY A;  2E5V A;  4UF0 A;  1OED B;  3MXZ A;  3PU3 A;  3UU4 A;  4LML A;  3RI5 A;  4F6R C;  4TNV A;  4WZX A;  5AQK B;  1G73 A;  3D0T A;  5AQO B;  1Y64 B;  3GA8 A;  4UVB B;  4DV0 T;  3DJB A;  4MFR A;  4O2B E;  3ZPO A;  2WAU A;  2D9D A;  2XQ4 A;  4X1K E;  2X0Y A;  4X20 E;  3AXJ B;  3KVA A;  2LRK A;  5L47 A;  5AQS B;  3RLF F;  4PFP A;  1XNQ T;  1VCT A;  2LRL A;  1KNP A;  4IE5 A;  4N78 D;  2UUB T;  4X64 T;  1MIV A;  3RYI E;  2WBL A;  2LOP A;  1D1A A;  5JVD E;  1D1C A;  3FZH B;  2IW5 B;  4I43 B;  2VKH A;  4PK6 A;  4ZXL A;  5HXE A;  2L9Q A;  2V6Y B;  2VL8 A;  3FZM B;  3ZC0 A;  4XZC A;  3ZEF B;  1DU2 A;  2A2F X;  5H6R B;  4JI3 T;  4GYR A;  4X1Y E;  2IUB A;  1IZN B;  2E9X A;  3UU6 A;  2YKS A;  3MA9 A;  1S94 A;  3AEF A;  2X9H A;  4UXN B;  1UCU A;  2ZLY A;  3BQI A;  5AQP B;  4JBW F;  4TUY E;  3PUS A;  4GOU A;  4K0K T;  4X62 T;  4IDP A;  2X51 A;  4AIU A;  4CI3 B;  5HEO A;  5C3J A;  3RH3 A;  2CBI A;  2WDR A;  3U3I A;  3AVS A;  3ZLI A;  3KFW X;  1KNZ A;  2BG9 C;  2H7V C;  3AE7 A;  4LFA T;  4CN1 A;  4B3R T;  4ANJ A;  4AXP A;  5HEU A;  1OXZ A;  4YSY A;  4AQF C;  5KX5 E;  4H9R C;  3DTO A;  4KX6 A;  2YDR A;  2F4V T;  3AAI A;  4GIW A;  3N9N A;  3FB2 A;  1IBK T;  2K24 A;  2WU2 A;  1QLB A;  4IGU A;  4LF5 T;  1LRZ A;  4BJM A;  1FJG T;  3P8C D;  5DQW A;  3Q5D A;  4OX9 T;  5HXS A;  1FMW A;  3BQL A;  4TWF A;  2CPT A;  1US7 B;  2KIN B;  1HF8 A;  2NP9 A;  4EAH A;  4WNK A;  4KUM B;  1KF6 A;  4IRE A;  2Q9Q C;  1FIO A;  5JTG A;  1MMA A;  2LM9 A;  5H6Q B;  4IDN A;  2ODU A;  3JAE A;  5EZY E;  5LBM A;  4JI5 T;  2KMF A;  2WB5 A;  2WS3 A;  2WZI A;  3PE0 A;  5HWY A;  4HWH A;  3JC6 D;  3MK7 C;  2WDV A;  3E0Z A;  1XWM A;  5F8P A;  2EHO C;  4ILC A;  4ZI7 E;  3N5L A;  5KMG P;  1N36 T;  2W2U A;  3RYC E;  2OLT A;  1YXR A;  4E7S A;  3ZMT B;  2AXD S;  3QUJ A;  2LEH A;  5L4E A;  1W0A A;  2YN6 A;  2WM9 A;  1T8B A;  4U33 A;  3GN5 B;  3P4Q A;  4IL4 A;  3PTR B;  3KDS E;  2V7K A;  4EXT A;  5JDF A;  2KWH A;  5JQG E;  4XBF B;  2MAW A;  3AE3 A;  3ZYL A;  1JNZ A;  4ZI2 D;  1HG2 A;  4ZI3 C;  3AAE B;  5LB7 B;  5FXX A;  3UQ7 A;  1IJ5 A;  2LOS A;  1CUN A;  3H3M A;  2W66 A;  4TWH A;  5HEH A;  4JI1 T;  2P9B A;  3ZSS A;  4C90 A;  2B76 A;  3PUZ F; 
#chains in the Genus database with same CATH homology
 1IBM T;  1HNZ T;  1XMO T;  5IWA T;  4JI8 T;  3T1H T;  2E5L T;  2HHH T;  4JI4 T;  1N33 T;  2UUA T;  4DR5 T;  4DV6 T;  1IBL T;  4JI5 T;  4B3M T;  4K0K T;  4LF4 T;  4X62 T;  4DR6 T;  4JI6 T;  4DV0 T;  5LMU T;  4X66 T;  1J5E T;  4LF7 T;  4B3S T;  4YY3 T;  4AQY T;  4GKK T;  1I94 T;  4JI2 T;  4LF8 T;  4JI7 T;  1N36 T;  4LFA T;  4B3R T;  4JYA T;  4DR2 T;  2VQE T;  4DV4 T;  4DR3 T;  4JV5 T;  4DV1 T;  2UUC T;  4LFB T;  4YHH T;  1HNW T;  4X65 T;  1XNQ T;  1HNX T;  1N34 T;  4KHP T;  4DV7 T;  4DUZ T;  2UUB T;  4DV2 T;  4X64 T;  4DV3 T;  3T1Y T;  4LFC T;  4JI0 T;  2UXB T;  2F4V T;  5LMN T;  3OTO T;  4GKJ T;  4LF9 T;  1XMQ T;  1IBK T;  4NXN T;  2ZM6 T;  4LF5 T;  2VQF T;  1FJG T;  4DR4 T;  4NXM T;  2UXC T;  4DUY T;  4OX9 T;  4LF6 T;  1N32 T;  5BR8 T;  4DR7 T;  4DR1 T;  4JI3 T;  1HR0 T;  4JI1 T;  4B3T T;  1XNR T;  2UU9 T;  2UXD T;  4DV5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...