4DV3T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv3T00
2ZM6T 4DV3T 4JI2T 4X62T 2HHHT 1HNWT 4DV4T 3OTOT 4JYAT 4LF6T 2E5LT 4DR2T 4NXMT 1XNQT 4LF7T 4X65T 4B3TT 4JI3T 1IBMT 4KHPT 4DR5T 4OX9T 4NXNT 4DR6T 2UUAT 4JI0T 4DUYT 1HNZT 4LFCT 4LF8T 4DR3T 4LF9T 4X64T 4YY3T 1N36T 2UU9T 4DV1T 4DV5T 2UUCT 1I94T 1XMQT 1IBKT 1XMOT 4B3ST 4B3MT 4JI1T 1N34T 4LFAT 4JV5T 4X66T 4DR4T 2UXCT 2F4VT 4K0KT 1HR0T 1N32T 4DUZT 2UXBT 4YHHT 4LF4T 1HNXT 1IBLT 4AQYT 4JI5T 5LMNT 4LFBT 3T1YT 3T1HT 1J5ET 4JI4T 2UUBT 4DV6T 1FJGT 5LMUT 5IWAT 1XNRT 1N33T 4DV2T 4DR1T 4DV0T 4B3RT 4GKKT 4DV7T 4JI6T 4GKJT 2VQFT 4JI7T 5BR8T 4DR7T 2UXDT 4JI8T 2VQET 4LF5T
chains in the Genus database with same CATH superfamily
2ZM6T 3C98B 2LM2A 3AVSA 2IW5B 5HXHA 2LM9A 3C4ZA 4TNWA 4MFRA 1QSDA 2LJLA 4AKRB 5LGTB 4X64T 4BA9A 3NRXA 2UUCT 4HFVA 5ABFA 2AE9A 1UCUA 2FUPA 4EXTA 1VRBA 3P7IA 4PW8A 3W15B 2JRKA 3Q5DA 2CRBA 2NWBA 1OEDB 2X0LB 3CX6B 4U7YA 5AQQB 2XM2A 5JREA 5FP3A 3N2GE 3ONXA 2V1DB 3CPZA 5AQSB 4HKAA 4P0BA 3ZKRA 2JMKA 4U7IA 3PJAJ 2V7MA 2MPKA 2V7KA 1WRDA 3N9MA 4NUVA 4DR1T 2DLRA 2BDEA 3KINB 3MA9A 2LRLA 1D0ZA 4PK4A 4X1YE 3H3MA 4IDNA 3H3AA 4GOUA 4ILUA 5KDMC 4HWHA 4AXPA 3HI2A 1IAPA 2WU5A 2HHHT 1WR0A 3ZC0A 2HPLA 5AQHB 2QRXA 1T72A 2KZ7B 5HXCA 3JCFA 4JUYA 5JTGA 1W0BA 2CE7A 2X0YA 4JEUB 4TWFA 3RX6A 5IUXA 4OYJA 5LB7B 5L3DB 5AQOB 2BS2A 2X67A 2H7VC 3RQUA 2UU9T 3A8YC 1V9DA 1QLBA 3RHWA 4IE4A 4JI1T 5HWYA 5TAOA 2BS4A 3LJCA 3E0ZA 2FJEA 1UK5A 2DCFA 3AXJA 3TKLB 4TV9E 1E7PA 2UXNB 2IDOB 5L47A 3IA3A 2RA1A 2H7OA 3ZPOA 2EHOA 4QXCB 1MMAA 3L09A 3PUYF 2KXPB 3UULA 4ASKA 2BZBA 5IWAT 4UIGA 5HXRA 5HEOA 3Q5WA 4O2AE 2Q9QD 5HYAA 3HKCE 4Q25A 3F2EA 2XQ5A 4QXHB 5HEGA 2EHOC 4AISA 4E7SA 2XUEA 3NRYA 4DMVA 2Z6EA 2I59A 2E9XA 1KNZA 3UU3A 3K3QC 3TLVA 3CX8B 2VB6A 3RI5A 3VKHA 5AQGB 4YFSA 4CN6A 1FMVA 4YHJA 2JIWA 5JDLA 3FZKB 2LSKA 2FJDA 2XJ7A 2LOSA 4PK6A 5FKYA 2LE8A 2HPJA 5L3FB 4DO0A 2LKHA 2YK0A 3N2OA 2E9XC 3AA6B 5DABA 3LFMA 4UF0B 3ZMVB 4JEHB 2C0SA 1XDOA 4U31A 4I43B 4L9IA 2YOEA 3IF8B 2J1DG 3QOFA 2CM0A 4X5TA 1WFDA 1FMWA 2X66A 4M1PA 3QB5A 1HNXT 2YDRA 4IDPA 3KBUA 3CMLA 3RKGA 3QC9A 3RH3A 4O4HE 2C5KT 3AA1B 3KDSE 3RKOA 2V26A 2VQFT 4EYUA 3CQXC 1D1AA 3EDUA 5KXJA 3N9QA 2UXDT 4ILCA 2XPKA 4ILBA 3OVUA 4OYKA 5E0OA 3KV9A 4F8HA 1U5PA 4HTEA 3L8RA 2WS3A 3U78A 5AQTB 1ZOYA 1XNQT 4X65T 2VURA 3JC6D 3EDVA 4IT4A 1MMDA 2L8KA 2A2FX 4ZS3A 4HFIA 4PNIA 5LGNB 4I50E 4NIQA 4ZXLA 2W66A 3EHZA 2CHNA 3ONJA 5H6QB 1SUMB 1WCRA 2MYSA 4YTPA 3TLSA 4O2BE 2VASA 3P4QA 4IE6A 4O4LE 3ZMZB 3K3OA 3RYIE 4B3MT 2V6YB 4EZHA 2V7LA 1OEDE 3UT5E 5JQGE 2PFVA 2JMHA 1LKXA 2X9YA 1JNRA 5FXWA 3P4WA 4CI3B 4TN7B 3P4SA 3KV5A 4DNDA 1NAFA 3CQGB 3IEEA 2IC6A 5JR9B 1ZEEA 3UU5A 3AAIA 3QUJA 2DWGA 2UXBT 3K8PC 5J0ZA 4YHHT 4I4TE 5JDFA 5L3BB 3L39A 2CHOA 4JI4T 2X68A 4YXDA 2Y8DA 1KFYA 3KV4A 3ZT7A 2XQ6A 1SE7A 2LOPA 2MBGA 5LGUB 4WYVA 2W62A 1JNZA 3VRBA 2XQAA 4DR7T 3AE1A 2ZM0A 2ACXA 3ZCIA 3VR8A 4CXYA 2RPAA 2L9QA 4JI2T 4ZEYA 3AA7B 3RQWA 1IBMT 3FZHB 4HWCA 1AJ3A 3FZFB 5AQLB 3ANWA 1YXRA 5FY7A 2VL8A 5JDMA 2Q9QA 4CI2B 5JVDE 4H9QC 4ZI2D 2WY2A 1O3XA 1N36T 4DV5T 2ZM2A 4KHZF 3CVRA 1HTJF 2HN1A 2LEHA 4TZ4C 3AEBA 2LSJA 4H9RC 4UV9B 4AQFA 3PUSA 3D0TA 5JDNA 4O8SA 3B13A 2BG9B 2VWAA 2Q9QC 1KNRA 2FJAA 3FB2A 3QK6A 3CX7B 3L3PA 1Z8UA 1QUUA 2W0GA 3FBLA 1IBLT 2GK9A 3A7MA 2D9DA 1D1CA 2WU2A 3PUGA 2L3LA 4XZCA 3AXJB 4JI6T 2CCQA 4HN9A 3ZT6A 3AEAA 1UUSA 4U3CA 5JRCB 3HL6A 2WQYA 4DV4T 5HEHA 3ZYKA 4J2CA 2Y6XA 5KX5E 2XASB 1CUNA 5HCJA 4LF9T 3J7Yq 2WWVA 3PDYA 3ZYMA 4PFPA 3S4UA 2BVLA 1OXZA 3PV0F 2VVSA 3FXDB 3ZC1A 2V5DA 1B7TA 4LFAT 3Q2MA 3UUBA 2X0HA 3ZN0B 4H9SE 5LA6E 2UXCT 1IJ6A 3ABVA 4Z91A 1HR0T 4QX8B 3AE6A 5LJNA 2CXFA 2C5IT 4OK0A 5LG4A 3AEGA 3R84B 3ZYLA 4LF4T 4IDQA 3PUAA 4AQYT 2LRKA 1J5ET 5FNVE 3JC6C 1G73A 4PJMA 4EV6A 1J1JA 3PUXF 3CK6A 1N33T 3MZKB 3K3NA 1MNEA 2XHEB 2BVMA 1Y01A 5ABHA 1UX5A 5HXEA 3R6NA 4IDOA 3AEEA 2XAQB 5JR9C 2E8IA 4HFDA 1YQ3A 3DTOA 2M6BA 2BKNA 3PURA 3AE4A 5ETWA 3I9YA 2CA5A 2X51A 3O9XA 5AQNB 2FBWA 4IL4A 3VKGA 3SFEA 5FXZA 5L3CB 3GN5B 4DV1T 1I94T 4CI1B 4IDZA 1OWAA 1D1BA 4P1NA 4Z8XA 4JV5T 3I0OA 1NENA 4YJ2E 5IYZE 3K1SA 2XQ3A 5HAXA 3LDQB 2PTFA 1M7KA 3EUHA 2CLYB 1YD8G 4MHCA 3V5UA 2XSAA 4C91A 5L4HA 2WB5A 2CMRA 2W4XA 3T1YT 2KINB 2WP9A 5CJ5A 4WNKA 4TNVA 3UFGA 4YTNA 1XNRT 1VCTA 3C64A 4ADZA 4KX6A 4ZI2C 4X1IE 2BG9C 2ZMAA 2OA5A 3CQCB 2B1EA 3AB3B 4H9PC 2VQET 3I9WA 2CXLA 4X62T 5AQPB 5FL1A 4LMJA 2CEAA 3ONLC 2CXDA 5AQRB 4EEDA 2VL0A 4DR2T 4NXMT 4N78D 3AECA 5J2TE 1Z0PA 5L4EA 4DR5T 2NTXA 1E1HB 1NWMX 2UUAT 4GIWA 3PTRB 4DUYT 2A9UA 2VKDA 4IL9A 4PAGA 3QB5K 4CN4A 4HGAA 5FXXA 2K3WA 4V1Av 1SA0E 2E5VA 4QKNA 4KBMB 3DJBA 1N34T 2LSYA 2A72A 2BG9E 4TX5A 3GMIA 4QHOA 2D0TA 4JLEA 4EOZB 4QWNB 4X66T 1HG2A 3LK2B 2YKSA 4H63V 2DNXA 3H37A 4GYSA 4Z90A 2M6IA 3NBXX 1N32T 5JH7E 4ISSA 2W63A 3RGLA 4DUZT 2BKPA 3UU6A 3GWHA 4KMCA 2IC9A 4I0UA 2YDQA 1UX4A 4JI5T 3RPUA 4AIUA 1D0XA 4DV6T 4IGUA 4PFOA 4U74A 1OEDA 3HKBE 4YSYA 3ESLA 3NKZA 4UXNB 2MTQA 2CWOA 4DV7T 4CXWA 4YJ3E 4WBNE 3O1IA 1S94A 2I6HA 4DV3T 2VKOA 4P09A 3LBXA 1ZV4X 4X1KE 4TUYE 3C50A 1WLXA 3KV6A 5CA1E 4NXNT 3CIRA 1OEDC 3PUWF 2NR4A 4JI0T 2YDSA 4CN1A 2ODVA 4L0RA 5A1LA 2UXXB 2KWHA 3PUQA 2KLQA 5C2TA 3ZMUB 1MMGA 1T7SA 3ZN1B 4L5GA 3P50A 5LYJE 2IHR1 3AAEB 4ZI3D 2XQ4A 4IE5A 4UVCB 1IJ5A 2H89A 3N9LA 3EABA 2FJBA 5J2UE 2CBIA 5FVKA 4YSXA 1NEKA 3RIAA 3FZLB 3KBTA 1BR2A 1LVKA 5BMVE 1D0YA 3O1JA 5LCYA 4ERRA 4EYYR 3BQLA 3MJXA 4JI7T 2DWKA 2WBLA 3F31A 3IHRA 5ABFB 2V5CA 1HNWT 3UQ4A 2JJ9A 4DBQA 5ABEA 2NW9A 2WDQA 4ZOLE 2X9HA 4JI3T 5F8PA 3ZT5A 5GONE 4E7ZA 2YEVC 4DR6T 2WWUA 4IE0A 3B57A 3QNUA 1KEYA 2NW7A 3OPCA 5IHYA 2V7IA 4BAYB 1GQEA 2DI4A 2XQ9A 4P0AA 2W00A 4UR9A 3UU4A 2KT9A 2LHRA 1WYBA 3NZPA 2WMNA 4QH5A 1H7CA 2X9WA 1IZNB 4HWDA 1KF6A 2D5UA 1MIWA 3IBPA 2F4VT 4K0KT 2KMFA 1UURA 3AE8A 4DBRA 3KVAA 3TLWA 3ZMTB 3J9X1 4JBWF 5LG3A 1X79A 5FY1A 3ETVA 4KUMB 5LMNT 2LSGA 3AA0B 2QVAA 2ACZA 4DV2T 4QXBB 2WDRA 3EAMA 4C90A 3NZQA 2IAKA 1CHUA 4IIJE 3RIFA 5LHIB 2JQKA 3OJAA 2H3RA 1WYCA 3WAJA 5HCMA 3FZMB 2MAWA 4XAXB 3OTOT 2V6XA 4LF7T 2PG8A 3MACA 5F5WA 5LBMA 5EK3A 1HNZT 3RRWA 2W2UA 3RYHE 4QH1A 2XSBA 5L3GB 1HG5A 4IE7A 4ANJA 1ZHCA 4NUUA 3LSVA 2EHOB 2JQ9A 4HE8A 3TLUA 2HN2A 2OLTA 2QYWA 4UELA 3SOLA 2WZHA 2WAUA 3AAAB 3T1HT 5L2LA 2N2NA 4AKLA 1XZYA 5LJMA 2E9XB 4OHFA 4CXXA 5CFBA 3WAKA 4MLKA 2H88A 1E2AA 2JQQA 4O4IE 5LBQB 3NWIA 4QX7B 3RIUC 5JR9A 4HWFA 2VK9A 2WSSV 4ZI7E 1MIYA 4ZZBA 2LSIA 3MXZA 3ZLIA 5KMGP 3NVOA 5C3JA 3ZSSA 2LKGA 3O1HA 3C51A 2K9AA 4DIDB 4MBQA 4EGWA 4ZI3C 1YW0A 4WZXA 3AE3A 1U4QA 4AKIA 5LP6E 3T8OA 3F57A 2XQYA 2QGSA 2G0UA 2I0MA 4U2ZA 3ZJ1A 4AKHA 1HFAA 2CWYA 1HS7A 4HFCA 1J5WA 2Y48B 5EK4A 2J47A 3C4WA 2KWIB 2J4GA 2P9BA 2V7JA 3P8CD 3LBXB 1EZ3A 3LK3B 2A3DA 3CKDA 3CWZB 2MOZA 2XAGB 3HKDE 3SFDA 5AQKB 4XBFB 2BS3A 2YU1A 3ZSTA 5HWXA 4H9OC 2XQ7A 2BG9A 5DJQC 2WMOA 2CBJA 2IUBA 4AQGA 4WBOA 3PUZF 4O4JE 4U2YA 4COFA 3B5MA 3OKQA 5BR8T 5AQVB 4CZZB 3E22E 2W61A 4ZHQE 4DMWA 3N2KE 4ZZCA 4AI6A 3P4RA 3OYXA 4TWHA 4F6RC 3MK7C 5HEUA 1I6ZA 4FI5A 1ZP0A 4K0UA 5JDQA 2IMLA 4YY3T 1VCSA 2WDVA 5DQVA 2QA7A 2D2SA 1XMQT 4HFHA 4PJJA 4EZ4A 4B3ST 5JRCA 1HX1B 4FJOA 2DL1A 2XZEA 1MIVA 3RLFF 3PU8A 3Q5XA 1SHZC 2M67A 2ODUA 3WI3A 3Q9DA 3N9PA 1XDPA 1W09A 3VR9A 3E08A 3I1AA 2YU2A 5HEJA 3MKDA 2IIUA 1BR1A 4UVBB 4ILAA 1YKEB 2LLYA 4PK5A 4YT0A 3ZMSB 5AQFB 1US7B 4OFZA 5H6RB 2BKOA 5LNKA 3PE0A 2ES0A 1WR6A 1XWMA 2NP9A 3N9OA 3BQKA 3PJAA 3UUMA 5J1GA 4HFBA 5CB4E 1Y64B 3AE7A 5AQJB 3UUNA 1DU2A 3PUVF 4U33A 1T8BA 2WCAA 3ANWB 4HEAA 2OV9A 5L3EB 2Q9QB 2LHNA 4MALA 4LMKA 3EI0A 4H63H 4HWIB 2WZIA 4KP3C 3G06A 5C8YE 4KI0F 5LXTE 4JYAT 2KSRA 4EIWA 4B3TT 4OX9T 2DHRA 4EEBA 1HX8A 4LFCT 1M62A 2K5BB 4YSZA 1X9BA 2YN6A 3LG7A 1IBKT 1YQ4A 5JDGA 1XMOT 2VVNA 3BK9A 2XAJB 2V8SV 1HCIA 2HH7A 4TWDA 4BJMA 5LHHB 3N9NA 2R6GF 4YLHA 5EZYE 1FEWA 4WW0A 2N1GA 1KNPA 2X9XA 2NW8A 3V5SA 3GN5A 4DVDA 3SWHA 3JAEA 3HA4A 3FBZA 1LVFA 3AE9A 3KFWX 3RC3A 1S35A 2UUBT 2SPCA 3JADA 5F3JA 3AE2A 5LMUT 2N9DA 2XTLA 3HKEE 4B3RT 1W9RA 3C4XA 2E2AA 4QH4A 5FL0A 3FXEB 4YTMA 3UU8A 5LHGB 4U72A 3X1DA 2AXDS 3TLTA 3UTKA 5FY0A 3UUXB 4LF5T 4GK5E 4X20E 3ZJ2A 1FIOA 2XAFB 4NPPA 5AQUB 3SRZA 4KHPT 2XQ8A 5FYMA 4G63A 2ZLYA 3AEFA 3P4PA 4LF8T 4DR3T 2CLYC 5LOVE 2JQHA 3UQ7A 5FXVA 5AQMB 3ZCJA 4AKGA 2CPTA 3M65A 3Q5EA 3RYFE 2BBHA 5HXSA 4CQIA 2B76A 2K48A 3N5LA 5FVLA 4UV8B 3LK42 4LMLA 5ADXL 1LRZA 3ZEFB 5JDHA 2KNDA 1R8IA 1L0VA 2XAHB 3KVBA 3EVYA 1FJGT 1YKHB 2NTYA 4GK0E 4ISTA 3PU3A 4DV0T 4BJNA 1UGOA 2VKHA 4GKJT 5EK2A 2ZM8A 1T98A 3SS1A 3OBVE 4GYRA 4IHJE 2LT3A 4PJNA 2XM1A 2J62A 5FMNA 3RYCE 4JI8T 3AEDA 2W67A 5M4YA 1W0AA 3BQIA 3FHNA 4HFEA 4UF0A 3I0QA 3AE5A 2VKJA 1BR0A 3A5XA 1MNDA 1VOMA 2XY8B 4LF6T 2E5LT 1G8XA 2YINA 2PJQA 4EB6E 4H9NC 2WM9A 1ZKEA 3OYZA 4PJLA 5DQWA 3DP7A 1MMNA 3JAFA 3O4XE 5AQIB 4I55E 2PBIA 2NOXA 2BBJA 2EHOD 4G2AA 4A5XA 4B6XA 2D0UA 1BR4A 3AVRA 3M3ZB 3HR0A 4DR4T 3UFEA 4AQFC 2K24A 5CGMA 4A98A 3U3IA 5CA0E 3VU7H 4ZS2A 4IREA 4A56A 1HF8A 3VRAA 4TV8E 3RRCA 4LFBT 5AFUL 1KK7A 3RC8A 2RP4A 2C5JA 2JPFA 3RF1A 2E9XD 5ABGA 3RIUA 4GKKT 2V6YA 4A97A 3VHLA 4UEMA 4EAHA 3GA8A 4UVAB 3ETUA
chains in the Genus database with same CATH topology
2ZM6T 4DV3T 4JI2T 4X62T 2HHHT 1HNWT 4DV4T 3OTOT 4JYAT 4LF6T 2E5LT 4DR2T 4NXMT 1XNQT 4LF7T 4X65T 4B3TT 4JI3T 1IBMT 4KHPT 4DR5T 4OX9T 4NXNT 4DR6T 2UUAT 4JI0T 4DUYT 1HNZT 4LFCT 4LF8T 4DR3T 4LF9T 4X64T 4YY3T 1N36T 2UU9T 4DV1T 4DV5T 2UUCT 1I94T 1XMQT 1IBKT 1XMOT 4B3ST 4B3MT 4JI1T 1N34T 4LFAT 4JV5T 4X66T 4DR4T 2UXCT 2F4VT 4K0KT 1HR0T 1N32T 4DUZT 2UXBT 4YHHT 4LF4T 1HNXT 1IBLT 4AQYT 4JI5T 5LMNT 4LFBT 3T1YT 3T1HT 1J5ET 4JI4T 2UUBT 4DV6T 1FJGT 5LMUT 5IWAT 1XNRT 1N33T 4DV2T 4DR1T 4DV0T 4B3RT 4GKKT 4DV7T 4JI6T 4GKJT 2VQFT 4JI7T 5BR8T 4DR7T 2UXDT 4JI8T 2VQET 4LF5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 T;  4DV3 T;  4JI2 T;  4X62 T;  2HHH T;  1HNW T;  4DV4 T;  3OTO T;  4JYA T;  4LF6 T;  2E5L T;  4DR2 T;  4NXM T;  1XNQ T;  4LF7 T;  4X65 T;  4B3T T;  4JI3 T;  1IBM T;  4KHP T;  4DR5 T;  4OX9 T;  4NXN T;  4DR6 T;  2UUA T;  4JI0 T;  4DUY T;  1HNZ T;  4LFC T;  4LF8 T;  4DR3 T;  4LF9 T;  4X64 T;  4YY3 T;  1N36 T;  2UU9 T;  4DV1 T;  4DV5 T;  2UUC T;  1I94 T;  1XMQ T;  1IBK T;  1XMO T;  4B3S T;  4B3M T;  4JI1 T;  1N34 T;  4LFA T;  4JV5 T;  4X66 T;  4DR4 T;  2UXC T;  2F4V T;  4K0K T;  1HR0 T;  1N32 T;  4DUZ T;  2UXB T;  4YHH T;  4LF4 T;  1HNX T;  1IBL T;  4AQY T;  4JI5 T;  5LMN T;  4LFB T;  3T1Y T;  3T1H T;  1J5E T;  4JI4 T;  2UUB T;  4DV6 T;  1FJG T;  5LMU T;  5IWA T;  1XNR T;  1N33 T;  4DV2 T;  4DR1 T;  4DV0 T;  4B3R T;  4GKK T;  4DV7 T;  4JI6 T;  4GKJ T;  2VQF T;  4JI7 T;  5BR8 T;  4DR7 T;  2UXD T;  4JI8 T;  2VQE T;  4LF5 T; 
#chains in the Genus database with same CATH topology
 2ZM6 T;  3C98 B;  2LM2 A;  3AVS A;  2IW5 B;  5HXH A;  2LM9 A;  3C4Z A;  4TNW A;  4MFR A;  1QSD A;  2LJL A;  4AKR B;  5LGT B;  4X64 T;  4BA9 A;  3NRX A;  2UUC T;  4HFV A;  5ABF A;  2AE9 A;  1UCU A;  2FUP A;  4EXT A;  1VRB A;  3P7I A;  4PW8 A;  3W15 B;  2JRK A;  3Q5D A;  2CRB A;  2NWB A;  1OED B;  2X0L B;  3CX6 B;  4U7Y A;  5AQQ B;  2XM2 A;  5JRE A;  5FP3 A;  3N2G E;  3ONX A;  2V1D B;  3CPZ A;  5AQS B;  4HKA A;  4P0B A;  3ZKR A;  2JMK A;  4U7I A;  3PJA J;  2V7M A;  2MPK A;  2V7K A;  1WRD A;  3N9M A;  4NUV A;  4DR1 T;  2DLR A;  2BDE A;  3KIN B;  3MA9 A;  2LRL A;  1D0Z A;  4PK4 A;  4X1Y E;  3H3M A;  4IDN A;  3H3A A;  4GOU A;  4ILU A;  5KDM C;  4HWH A;  4AXP A;  3HI2 A;  1IAP A;  2WU5 A;  2HHH T;  1WR0 A;  3ZC0 A;  2HPL A;  5AQH B;  2QRX A;  1T72 A;  2KZ7 B;  5HXC A;  3JCF A;  4JUY A;  5JTG A;  1W0B A;  2CE7 A;  2X0Y A;  4JEU B;  4TWF A;  3RX6 A;  5IUX A;  4OYJ A;  5LB7 B;  5L3D B;  5AQO B;  2BS2 A;  2X67 A;  2H7V C;  3RQU A;  2UU9 T;  3A8Y C;  1V9D A;  1QLB A;  3RHW A;  4IE4 A;  4JI1 T;  5HWY A;  5TAO A;  2BS4 A;  3LJC A;  3E0Z A;  2FJE A;  1UK5 A;  2DCF A;  3AXJ A;  3TKL B;  4TV9 E;  1E7P A;  2UXN B;  2IDO B;  5L47 A;  3IA3 A;  2RA1 A;  2H7O A;  3ZPO A;  2EHO A;  4QXC B;  1MMA A;  3L09 A;  3PUY F;  2KXP B;  3UUL A;  4ASK A;  2BZB A;  5IWA T;  4UIG A;  5HXR A;  5HEO A;  3Q5W A;  4O2A E;  2Q9Q D;  5HYA A;  3HKC E;  4Q25 A;  3F2E A;  2XQ5 A;  4QXH B;  5HEG A;  2EHO C;  4AIS A;  4E7S A;  2XUE A;  3NRY A;  4DMV A;  2Z6E A;  2I59 A;  2E9X A;  1KNZ A;  3UU3 A;  3K3Q C;  3TLV A;  3CX8 B;  2VB6 A;  3RI5 A;  3VKH A;  5AQG B;  4YFS A;  4CN6 A;  1FMV A;  4YHJ A;  2JIW A;  5JDL A;  3FZK B;  2LSK A;  2FJD A;  2XJ7 A;  2LOS A;  4PK6 A;  5FKY A;  2LE8 A;  2HPJ A;  5L3F B;  4DO0 A;  2LKH A;  2YK0 A;  3N2O A;  2E9X C;  3AA6 B;  5DAB A;  3LFM A;  4UF0 B;  3ZMV B;  4JEH B;  2C0S A;  1XDO A;  4U31 A;  4I43 B;  4L9I A;  2YOE A;  3IF8 B;  2J1D G;  3QOF A;  2CM0 A;  4X5T A;  1WFD A;  1FMW A;  2X66 A;  4M1P A;  3QB5 A;  1HNX T;  2YDR A;  4IDP A;  3KBU A;  3CML A;  3RKG A;  3QC9 A;  3RH3 A;  4O4H E;  2C5K T;  3AA1 B;  3KDS E;  3RKO A;  2V26 A;  2VQF T;  4EYU A;  3CQX C;  1D1A A;  3EDU A;  5KXJ A;  3N9Q A;  2UXD T;  4ILC A;  2XPK A;  4ILB A;  3OVU A;  4OYK A;  5E0O A;  3KV9 A;  4F8H A;  1U5P A;  4HTE A;  3L8R A;  2WS3 A;  3U78 A;  5AQT B;  1ZOY A;  1XNQ T;  4X65 T;  2VUR A;  3JC6 D;  3EDV A;  4IT4 A;  1MMD A;  2L8K A;  2A2F X;  4ZS3 A;  4HFI A;  4PNI A;  5LGN B;  4I50 E;  4NIQ A;  4ZXL A;  2W66 A;  3EHZ A;  2CHN A;  3ONJ A;  5H6Q B;  1SUM B;  1WCR A;  2MYS A;  4YTP A;  3TLS A;  4O2B E;  2VAS A;  3P4Q A;  4IE6 A;  4O4L E;  3ZMZ B;  3K3O A;  3RYI E;  4B3M T;  2V6Y B;  4EZH A;  2V7L A;  1OED E;  3UT5 E;  5JQG E;  2PFV A;  2JMH A;  1LKX A;  2X9Y A;  1JNR A;  5FXW A;  3P4W A;  4CI3 B;  4TN7 B;  3P4S A;  3KV5 A;  4DND A;  1NAF A;  3CQG B;  3IEE A;  2IC6 A;  5JR9 B;  1ZEE A;  3UU5 A;  3AAI A;  3QUJ A;  2DWG A;  2UXB T;  3K8P C;  5J0Z A;  4YHH T;  4I4T E;  5JDF A;  5L3B B;  3L39 A;  2CHO A;  4JI4 T;  2X68 A;  4YXD A;  2Y8D A;  1KFY A;  3KV4 A;  3ZT7 A;  2XQ6 A;  1SE7 A;  2LOP A;  2MBG A;  5LGU B;  4WYV A;  2W62 A;  1JNZ A;  3VRB A;  2XQA A;  4DR7 T;  3AE1 A;  2ZM0 A;  2ACX A;  3ZCI A;  3VR8 A;  4CXY A;  2RPA A;  2L9Q A;  4JI2 T;  4ZEY A;  3AA7 B;  3RQW A;  1IBM T;  3FZH B;  4HWC A;  1AJ3 A;  3FZF B;  5AQL B;  3ANW A;  1YXR A;  5FY7 A;  2VL8 A;  5JDM A;  2Q9Q A;  4CI2 B;  5JVD E;  4H9Q C;  4ZI2 D;  2WY2 A;  1O3X A;  1N36 T;  4DV5 T;  2ZM2 A;  4KHZ F;  3CVR A;  1HTJ F;  2HN1 A;  2LEH A;  4TZ4 C;  3AEB A;  2LSJ A;  4H9R C;  4UV9 B;  4AQF A;  3PUS A;  3D0T A;  5JDN A;  4O8S A;  3B13 A;  2BG9 B;  2VWA A;  2Q9Q C;  1KNR A;  2FJA A;  3FB2 A;  3QK6 A;  3CX7 B;  3L3P A;  1Z8U A;  1QUU A;  2W0G A;  3FBL A;  1IBL T;  2GK9 A;  3A7M A;  2D9D A;  1D1C A;  2WU2 A;  3PUG A;  2L3L A;  4XZC A;  3AXJ B;  4JI6 T;  2CCQ A;  4HN9 A;  3ZT6 A;  3AEA A;  1UUS A;  4U3C A;  5JRC B;  3HL6 A;  2WQY A;  4DV4 T;  5HEH A;  3ZYK A;  4J2C A;  2Y6X A;  5KX5 E;  2XAS B;  1CUN A;  5HCJ A;  4LF9 T;  3J7Y q;  2WWV A;  3PDY A;  3ZYM A;  4PFP A;  3S4U A;  2BVL A;  1OXZ A;  3PV0 F;  2VVS A;  3FXD B;  3ZC1 A;  2V5D A;  1B7T A;  4LFA T;  3Q2M A;  3UUB A;  2X0H A;  3ZN0 B;  4H9S E;  5LA6 E;  2UXC T;  1IJ6 A;  3ABV A;  4Z91 A;  1HR0 T;  4QX8 B;  3AE6 A;  5LJN A;  2CXF A;  2C5I T;  4OK0 A;  5LG4 A;  3AEG A;  3R84 B;  3ZYL A;  4LF4 T;  4IDQ A;  3PUA A;  4AQY T;  2LRK A;  1J5E T;  5FNV E;  3JC6 C;  1G73 A;  4PJM A;  4EV6 A;  1J1J A;  3PUX F;  3CK6 A;  1N33 T;  3MZK B;  3K3N A;  1MNE A;  2XHE B;  2BVM A;  1Y01 A;  5ABH A;  1UX5 A;  5HXE A;  3R6N A;  4IDO A;  3AEE A;  2XAQ B;  5JR9 C;  2E8I A;  4HFD A;  1YQ3 A;  3DTO A;  2M6B A;  2BKN A;  3PUR A;  3AE4 A;  5ETW A;  3I9Y A;  2CA5 A;  2X51 A;  3O9X A;  5AQN B;  2FBW A;  4IL4 A;  3VKG A;  3SFE A;  5FXZ A;  5L3C B;  3GN5 B;  4DV1 T;  1I94 T;  4CI1 B;  4IDZ A;  1OWA A;  1D1B A;  4P1N A;  4Z8X A;  4JV5 T;  3I0O A;  1NEN A;  4YJ2 E;  5IYZ E;  3K1S A;  2XQ3 A;  5HAX A;  3LDQ B;  2PTF A;  1M7K A;  3EUH A;  2CLY B;  1YD8 G;  4MHC A;  3V5U A;  2XSA A;  4C91 A;  5L4H A;  2WB5 A;  2CMR A;  2W4X A;  3T1Y T;  2KIN B;  2WP9 A;  5CJ5 A;  4WNK A;  4TNV A;  3UFG A;  4YTN A;  1XNR T;  1VCT A;  3C64 A;  4ADZ A;  4KX6 A;  4ZI2 C;  4X1I E;  2BG9 C;  2ZMA A;  2OA5 A;  3CQC B;  2B1E A;  3AB3 B;  4H9P C;  2VQE T;  3I9W A;  2CXL A;  4X62 T;  5AQP B;  5FL1 A;  4LMJ A;  2CEA A;  3ONL C;  2CXD A;  5AQR B;  4EED A;  2VL0 A;  4DR2 T;  4NXM T;  4N78 D;  3AEC A;  5J2T E;  1Z0P A;  5L4E A;  4DR5 T;  2NTX A;  1E1H B;  1NWM X;  2UUA T;  4GIW A;  3PTR B;  4DUY T;  2A9U A;  2VKD A;  4IL9 A;  4PAG A;  3QB5 K;  4CN4 A;  4HGA A;  5FXX A;  2K3W A;  4V1A v;  1SA0 E;  2E5V A;  4QKN A;  4KBM B;  3DJB A;  1N34 T;  2LSY A;  2A72 A;  2BG9 E;  4TX5 A;  3GMI A;  4QHO A;  2D0T A;  4JLE A;  4EOZ B;  4QWN B;  4X66 T;  1HG2 A;  3LK2 B;  2YKS A;  4H63 V;  2DNX A;  3H37 A;  4GYS A;  4Z90 A;  2M6I A;  3NBX X;  1N32 T;  5JH7 E;  4ISS A;  2W63 A;  3RGL A;  4DUZ T;  2BKP A;  3UU6 A;  3GWH A;  4KMC A;  2IC9 A;  4I0U A;  2YDQ A;  1UX4 A;  4JI5 T;  3RPU A;  4AIU A;  1D0X A;  4DV6 T;  4IGU A;  4PFO A;  4U74 A;  1OED A;  3HKB E;  4YSY A;  3ESL A;  3NKZ A;  4UXN B;  2MTQ A;  2CWO A;  4DV7 T;  4CXW A;  4YJ3 E;  4WBN E;  3O1I A;  1S94 A;  2I6H A;  4DV3 T;  2VKO A;  4P09 A;  3LBX A;  1ZV4 X;  4X1K E;  4TUY E;  3C50 A;  1WLX A;  3KV6 A;  5CA1 E;  4NXN T;  3CIR A;  1OED C;  3PUW F;  2NR4 A;  4JI0 T;  2YDS A;  4CN1 A;  2ODV A;  4L0R A;  5A1L A;  2UXX B;  2KWH A;  3PUQ A;  2KLQ A;  5C2T A;  3ZMU B;  1MMG A;  1T7S A;  3ZN1 B;  4L5G A;  3P50 A;  5LYJ E;  2IHR 1;  3AAE B;  4ZI3 D;  2XQ4 A;  4IE5 A;  4UVC B;  1IJ5 A;  2H89 A;  3N9L A;  3EAB A;  2FJB A;  5J2U E;  2CBI A;  5FVK A;  4YSX A;  1NEK A;  3RIA A;  3FZL B;  3KBT A;  1BR2 A;  1LVK A;  5BMV E;  1D0Y A;  3O1J A;  5LCY A;  4ERR A;  4EYY R;  3BQL A;  3MJX A;  4JI7 T;  2DWK A;  2WBL A;  3F31 A;  3IHR A;  5ABF B;  2V5C A;  1HNW T;  3UQ4 A;  2JJ9 A;  4DBQ A;  5ABE A;  2NW9 A;  2WDQ A;  4ZOL E;  2X9H A;  4JI3 T;  5F8P A;  3ZT5 A;  5GON E;  4E7Z A;  2YEV C;  4DR6 T;  2WWU A;  4IE0 A;  3B57 A;  3QNU A;  1KEY A;  2NW7 A;  3OPC A;  5IHY A;  2V7I A;  4BAY B;  1GQE A;  2DI4 A;  2XQ9 A;  4P0A A;  2W00 A;  4UR9 A;  3UU4 A;  2KT9 A;  2LHR A;  1WYB A;  3NZP A;  2WMN A;  4QH5 A;  1H7C A;  2X9W A;  1IZN B;  4HWD A;  1KF6 A;  2D5U A;  1MIW A;  3IBP A;  2F4V T;  4K0K T;  2KMF A;  1UUR A;  3AE8 A;  4DBR A;  3KVA A;  3TLW A;  3ZMT B;  3J9X 1;  4JBW F;  5LG3 A;  1X79 A;  5FY1 A;  3ETV A;  4KUM B;  5LMN T;  2LSG A;  3AA0 B;  2QVA A;  2ACZ A;  4DV2 T;  4QXB B;  2WDR A;  3EAM A;  4C90 A;  3NZQ A;  2IAK A;  1CHU A;  4IIJ E;  3RIF A;  5LHI B;  2JQK A;  3OJA A;  2H3R A;  1WYC A;  3WAJ A;  5HCM A;  3FZM B;  2MAW A;  4XAX B;  3OTO T;  2V6X A;  4LF7 T;  2PG8 A;  3MAC A;  5F5W A;  5LBM A;  5EK3 A;  1HNZ T;  3RRW A;  2W2U A;  3RYH E;  4QH1 A;  2XSB A;  5L3G B;  1HG5 A;  4IE7 A;  4ANJ A;  1ZHC A;  4NUU A;  3LSV A;  2EHO B;  2JQ9 A;  4HE8 A;  3TLU A;  2HN2 A;  2OLT A;  2QYW A;  4UEL A;  3SOL A;  2WZH A;  2WAU A;  3AAA B;  3T1H T;  5L2L A;  2N2N A;  4AKL A;  1XZY A;  5LJM A;  2E9X B;  4OHF A;  4CXX A;  5CFB A;  3WAK A;  4MLK A;  2H88 A;  1E2A A;  2JQQ A;  4O4I E;  5LBQ B;  3NWI A;  4QX7 B;  3RIU C;  5JR9 A;  4HWF A;  2VK9 A;  2WSS V;  4ZI7 E;  1MIY A;  4ZZB A;  2LSI A;  3MXZ A;  3ZLI A;  5KMG P;  3NVO A;  5C3J A;  3ZSS A;  2LKG A;  3O1H A;  3C51 A;  2K9A A;  4DID B;  4MBQ A;  4EGW A;  4ZI3 C;  1YW0 A;  4WZX A;  3AE3 A;  1U4Q A;  4AKI A;  5LP6 E;  3T8O A;  3F57 A;  2XQY A;  2QGS A;  2G0U A;  2I0M A;  4U2Z A;  3ZJ1 A;  4AKH A;  1HFA A;  2CWY A;  1HS7 A;  4HFC A;  1J5W A;  2Y48 B;  5EK4 A;  2J47 A;  3C4W A;  2KWI B;  2J4G A;  2P9B A;  2V7J A;  3P8C D;  3LBX B;  1EZ3 A;  3LK3 B;  2A3D A;  3CKD A;  3CWZ B;  2MOZ A;  2XAG B;  3HKD E;  3SFD A;  5AQK B;  4XBF B;  2BS3 A;  2YU1 A;  3ZST A;  5HWX A;  4H9O C;  2XQ7 A;  2BG9 A;  5DJQ C;  2WMO A;  2CBJ A;  2IUB A;  4AQG A;  4WBO A;  3PUZ F;  4O4J E;  4U2Y A;  4COF A;  3B5M A;  3OKQ A;  5BR8 T;  5AQV B;  4CZZ B;  3E22 E;  2W61 A;  4ZHQ E;  4DMW A;  3N2K E;  4ZZC A;  4AI6 A;  3P4R A;  3OYX A;  4TWH A;  4F6R C;  3MK7 C;  5HEU A;  1I6Z A;  4FI5 A;  1ZP0 A;  4K0U A;  5JDQ A;  2IML A;  4YY3 T;  1VCS A;  2WDV A;  5DQV A;  2QA7 A;  2D2S A;  1XMQ T;  4HFH A;  4PJJ A;  4EZ4 A;  4B3S T;  5JRC A;  1HX1 B;  4FJO A;  2DL1 A;  2XZE A;  1MIV A;  3RLF F;  3PU8 A;  3Q5X A;  1SHZ C;  2M67 A;  2ODU A;  3WI3 A;  3Q9D A;  3N9P A;  1XDP A;  1W09 A;  3VR9 A;  3E08 A;  3I1A A;  2YU2 A;  5HEJ A;  3MKD A;  2IIU A;  1BR1 A;  4UVB B;  4ILA A;  1YKE B;  2LLY A;  4PK5 A;  4YT0 A;  3ZMS B;  5AQF B;  1US7 B;  4OFZ A;  5H6R B;  2BKO A;  5LNK A;  3PE0 A;  2ES0 A;  1WR6 A;  1XWM A;  2NP9 A;  3N9O A;  3BQK A;  3PJA A;  3UUM A;  5J1G A;  4HFB A;  5CB4 E;  1Y64 B;  3AE7 A;  5AQJ B;  3UUN A;  1DU2 A;  3PUV F;  4U33 A;  1T8B A;  2WCA A;  3ANW B;  4HEA A;  2OV9 A;  5L3E B;  2Q9Q B;  2LHN A;  4MAL A;  4LMK A;  3EI0 A;  4H63 H;  4HWI B;  2WZI A;  4KP3 C;  3G06 A;  5C8Y E;  4KI0 F;  5LXT E;  4JYA T;  2KSR A;  4EIW A;  4B3T T;  4OX9 T;  2DHR A;  4EEB A;  1HX8 A;  4LFC T;  1M62 A;  2K5B B;  4YSZ A;  1X9B A;  2YN6 A;  3LG7 A;  1IBK T;  1YQ4 A;  5JDG A;  1XMO T;  2VVN A;  3BK9 A;  2XAJ B;  2V8S V;  1HCI A;  2HH7 A;  4TWD A;  4BJM A;  5LHH B;  3N9N A;  2R6G F;  4YLH A;  5EZY E;  1FEW A;  4WW0 A;  2N1G A;  1KNP A;  2X9X A;  2NW8 A;  3V5S A;  3GN5 A;  4DVD A;  3SWH A;  3JAE A;  3HA4 A;  3FBZ A;  1LVF A;  3AE9 A;  3KFW X;  3RC3 A;  1S35 A;  2UUB T;  2SPC A;  3JAD A;  5F3J A;  3AE2 A;  5LMU T;  2N9D A;  2XTL A;  3HKE E;  4B3R T;  1W9R A;  3C4X A;  2E2A A;  4QH4 A;  5FL0 A;  3FXE B;  4YTM A;  3UU8 A;  5LHG B;  4U72 A;  3X1D A;  2AXD S;  3TLT A;  3UTK A;  5FY0 A;  3UUX B;  4LF5 T;  4GK5 E;  4X20 E;  3ZJ2 A;  1FIO A;  2XAF B;  4NPP A;  5AQU B;  3SRZ A;  4KHP T;  2XQ8 A;  5FYM A;  4G63 A;  2ZLY A;  3AEF A;  3P4P A;  4LF8 T;  4DR3 T;  2CLY C;  5LOV E;  2JQH A;  3UQ7 A;  5FXV A;  5AQM B;  3ZCJ A;  4AKG A;  2CPT A;  3M65 A;  3Q5E A;  3RYF E;  2BBH A;  5HXS A;  4CQI A;  2B76 A;  2K48 A;  3N5L A;  5FVL A;  4UV8 B;  3LK4 2;  4LML A;  5ADX L;  1LRZ A;  3ZEF B;  5JDH A;  2KND A;  1R8I A;  1L0V A;  2XAH B;  3KVB A;  3EVY A;  1FJG T;  1YKH B;  2NTY A;  4GK0 E;  4IST A;  3PU3 A;  4DV0 T;  4BJN A;  1UGO A;  2VKH A;  4GKJ T;  5EK2 A;  2ZM8 A;  1T98 A;  3SS1 A;  3OBV E;  4GYR A;  4IHJ E;  2LT3 A;  4PJN A;  2XM1 A;  2J62 A;  5FMN A;  3RYC E;  4JI8 T;  3AED A;  2W67 A;  5M4Y A;  1W0A A;  3BQI A;  3FHN A;  4HFE A;  4UF0 A;  3I0Q A;  3AE5 A;  2VKJ A;  1BR0 A;  3A5X A;  1MND A;  1VOM A;  2XY8 B;  4LF6 T;  2E5L T;  1G8X A;  2YIN A;  2PJQ A;  4EB6 E;  4H9N C;  2WM9 A;  1ZKE A;  3OYZ A;  4PJL A;  5DQW A;  3DP7 A;  1MMN A;  3JAF A;  3O4X E;  5AQI B;  4I55 E;  2PBI A;  2NOX A;  2BBJ A;  2EHO D;  4G2A A;  4A5X A;  4B6X A;  2D0U A;  1BR4 A;  3AVR A;  3M3Z B;  3HR0 A;  4DR4 T;  3UFE A;  4AQF C;  2K24 A;  5CGM A;  4A98 A;  3U3I A;  5CA0 E;  3VU7 H;  4ZS2 A;  4IRE A;  4A56 A;  1HF8 A;  3VRA A;  4TV8 E;  3RRC A;  4LFB T;  5AFU L;  1KK7 A;  3RC8 A;  2RP4 A;  2C5J A;  2JPF A;  3RF1 A;  2E9X D;  5ABG A;  3RIU A;  4GKK T;  2V6Y A;  4A97 A;  3VHL A;  4UEM A;  4EAH A;  3GA8 A;  4UVA B;  3ETU A; 
#chains in the Genus database with same CATH homology
 2ZM6 T;  4DV3 T;  4JI2 T;  4X62 T;  2HHH T;  1HNW T;  4DV4 T;  3OTO T;  4JYA T;  4LF6 T;  2E5L T;  4DR2 T;  4NXM T;  1XNQ T;  4LF7 T;  4X65 T;  4B3T T;  4JI3 T;  1IBM T;  4KHP T;  4DR5 T;  4OX9 T;  4NXN T;  4DR6 T;  2UUA T;  4JI0 T;  4DUY T;  1HNZ T;  4LFC T;  4LF8 T;  4DR3 T;  4LF9 T;  4X64 T;  4YY3 T;  1N36 T;  2UU9 T;  4DV1 T;  4DV5 T;  2UUC T;  1I94 T;  1XMQ T;  1IBK T;  1XMO T;  4B3S T;  4B3M T;  4JI1 T;  1N34 T;  4LFA T;  4JV5 T;  4X66 T;  4DR4 T;  2UXC T;  2F4V T;  4K0K T;  1HR0 T;  1N32 T;  4DUZ T;  2UXB T;  4YHH T;  4LF4 T;  1HNX T;  1IBL T;  4AQY T;  4JI5 T;  5LMN T;  4LFB T;  3T1Y T;  3T1H T;  1J5E T;  4JI4 T;  2UUB T;  4DV6 T;  1FJG T;  5LMU T;  5IWA T;  1XNR T;  1N33 T;  4DV2 T;  4DR1 T;  4DV0 T;  4B3R T;  4GKK T;  4DV7 T;  4JI6 T;  4GKJ T;  2VQF T;  4JI7 T;  5BR8 T;  4DR7 T;  2UXD T;  4JI8 T;  2VQE T;  4LF5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...