4GKKT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4gkkT00
4NXNT 4DR7T 1XMQT 4LF7T 4JI1T 1N33T 4X64T 4DV4T 4DR1T 4K0KT 1IBKT 4DV3T 4LF6T 2UXCT 3T1HT 2UU9T 4DR4T 1J5ET 2UUBT 2F4VT 1N36T 4DV6T 3T1YT 5LMNT 1XMOT 4YY3T 2VQET 2E5LT 4X66T 4JYAT 2HHHT 4LF8T 1I94T 4DR5T 4B3RT 5LMUT 2UXDT 1XNQT 1HNZT 4YHHT 4LFCT 2UUCT 4DV0T 4LFAT 2ZM6T 4OX9T 4JI6T 4DV1T 4NXMT 1HNWT 1HR0T 4LF9T 4DR3T 4LF4T 4JI7T 4DUYT 4B3TT 4GKJT 4LFBT 4LF5T 1FJGT 1N32T 4X62T 4DV7T 4JI4T 4JV5T 4JI3T 3OTOT 4X65T 4DR6T 4JI8T 4DR2T 1HNXT 4DV5T 2VQFT 4B3ST 5IWAT 4GKKT 4KHPT 4DUZT 1IBMT 5BR8T 4JI0T 1N34T 4DV2T 2UXBT 4B3MT 4JI5T 1IBLT 1XNRT 2UUAT 4AQYT 4JI2T
chains in the Genus database with same CATH superfamily
3O9XA 4NIQA 4WNKA 4UELA 4LF7T 4JEHB 4UF0B 4DR1T 4O4IE 1ZP0A 2IC6A 3L3PA 2HPJA 3PV0F 3OYZA 3MA9A 3L8RA 4HGAA 1FIOA 1KNRA 4DV6T 2A9UA 1XZYA 4V1Av 3LFMA 4QKNA 5JDFA 4YY3T 3DJBA 2G0UA 2UXXB 3UU4A 3P8CD 2JQKA 3KBUA 4A98A 1YQ4A 2PFVA 1NEKA 2AXDS 5JDNA 2KINB 1BR0A 3PUZF 3EABA 3Q5XA 3MACA 2YKSA 1B7TA 5FY7A 3ZJ1A 3ZYMA 2C5IT 2M67A 3CPZA 4IL4A 3C50A 3EDUA 2A72A 3EHZA 3ABVA 4HWDA 4N78D 2WZIA 4PK5A 4HWHA 1HG5A 3ZT6A 3ONXA 2NW8A 2VKHA 4E7SA 2PTFA 3PUQA 4G63A 4DV5T 4UV9B 3JCFA 3N9NA 1Z8UA 4X1YE 3AXJB 1SUMB 2B1EA 3A7MA 5HEOA 5AQIB 4TWHA 1W09A 2CXLA 1YKHB 2LSIA 4H9RC 5AQJB 4YSYA 4NUVA 3O4XE 3MXZA 2ZM0A 4AI6A 3Q5EA 2JMKA 3K3OA 3CIRA 3AE1A 5EK3A 3TLTA 2F4VT 1FEWA 1N36T 2X0LB 5HEHA 1U5PA 4X66T 2KSRA 3UT5E 3ZYKA 3RKGA 2KNDA 4CQIA 5LHIB 5LP6E 3SS1A 3T8OA 4QWNB 1HNZT 4UR9A 4YLHA 5FP3A 4PJLA 4UXNB 1HNWT 4QXHB 3HL6A 5F3JA 1UK5A 2YU1A 4EZ4A 3EUHA 3ZT5A 4X62T 3ZMUB 1MMAA 2IIUA 2X0HA 1U4QA 1T98A 4X65T 4Z91A 3PURA 3RYCE 5C3JA 4U7IA 2Y48B 4ZI2C 2VL8A 1XWMA 3UU5A 3PDYA 3RQUA 1OEDE 1YXRA 2CM0A 2CXDA 3KVBA 4JI5T 3J9X1 3K3QC 5LOVE 4EEBA 4TNVA 2LRKA 2LOPA 3RLFF 2N9DA 4DV4T 3X1DA 3PU3A 3AA6B 3AE3A 3RC8A 4ZI2D 2PJQA 4K0UA 2MOZA 5AQQB 5LNKA 3MJXA 2Y6XA 3ANWA 4L9IA 2ES0A 2WS3A 3SFEA 2BKNA 3I0QA 4AXPA 3UQ4A 4OYJA 4YHHT 2IDOB 3AXJA 1OEDC 3F31A 2FUPA 3VHLA 5AQGB 4P0BA 5LG3A 3AEFA 4U7YA 3GWHA 2J47A 2YDQA 1FJGT 4DV7T 3RIAA 1LVFA 4JI3T 4O4JE 3UQ7A 3LBXB 2C0SA 1HF8A 2VASA 4AKRB 1FMVA 3P7IA 3CQCB 2XSBA 1L0VA 2IAKA 4DUZT 5HXHA 3ZMSB 3QB5K 2W00A 2YK0A 4ZEYA 3C64A 2CXFA 1WRDA 4MHCA 2ACXA 3GN5B 4JBWF 3H3AA 2XAGB 3RGLA 4AQFC 3HKCE 4DVDA 3T1HT 4ILBA 3F57A 3DTOA 3VKGA 2X9YA 2LOSA 2UXNB 4Q25A 5C8YE 2IC9A 5FMNA 2D9DA 3NBXX 3CK6A 5HXEA 3N2KE 3CX8B 5HCMA 3FZKB 5C2TA 5LJNA 2XAJB 5JDGA 2CWOA 2W67A 4CN1A 1QSDA 2YINA 3PUWF 5JR9B 4C91A 5JH7E 1UX5A 1BR1A 2NR4A 2QRXA 2K5BB 2BKOA 4IE0A 4GKJT 4CI1B 5EZYE 3VR9A 5L4EA 2W66A 2NP9A 4PK4A 2X51A 5FXXA 3MKDA 3KV6A 4M1PA 1T72A 5LHHB 4KHPT 3Q5DA 2CRBA 3OJAA 1N34T 3N9OA 4CI2B 3H3MA 3WAJA 4PAGA 3N5LA 2K9AA 1CUNA 2VKJA 3NKZA 5E0OA 1LVKA 4DBQA 3AVSA 2V7KA 4X20E 4J2CA 3NWIA 1QLBA 3AE6A 4ADZA 3BQIA 2M6BA 5AQMB 2V6XA 5LG4A 2E9XC 2VQET 4QH5A 2BDEA 2HHHT 3HKDE 2XJ7A 2JPFA 3ZC0A 1YW0A 5H6QB 1KFYA 1MMGA 2I6HA 2JMHA 2HN2A 2W4XA 2IUBA 4AKGA 5L47A 1MIWA 1W0AA 3FZFB 1HTJF 3N9LA 5HWYA 3JC6C 5TAOA 2VURA 2BBHA 3Q9DA 4TV8E 4F8HA 1WCRA 4HFHA 3C98B 2E9XD 4GK5E 4G2AA 2XZEA 2X67A 5LCYA 4TWFA 3J7Yq 5A1LA 3AEBA 4JI4T 2XQ9A 4CN4A 1BR4A 3RRCA 3WI3A 2CLYC 2XQAA 2CWYA 3JC6D 4DR2T 1E2AA 1NAFA 2CHNA 2XQ3A 3I1AA 5AQTB 3E22E 3ZJ2A 4I50E 2E5VA 4XAXB 3RIFA 4B3MT 1XNRT 2UUAT 4O8SA 2V5CA 4JEUB 5ETWA 1E7PA 1XMQT 2XM2A 4ZHQE 3UTKA 4ERRA 4CZZB 2DWGA 3IEEA 2V7IA 2P9BA 4YTNA 5JR9A 3RQWA 2LSGA 1W0BA 3KV4A 4LF6T 2LKHA 4L0RA 4YTPA 4LMKA 4HFBA 5AQKB 3PUAA 2JQQA 4A56A 1I94T 3S4UA 5AQVB 4H9PC 2FJBA 5FY1A 4COFA 3MZKB 5ABEA 4UEMA 2XQ5A 3LJCA 2D0UA 2WWUA 2WM9A 4X5TA 4DR3T 3W15B 2NTYA 3AE8A 3M3ZB 5AQFB 3HKEE 2LLYA 5FXVA 4B3TT 3BQLA 2WP9A 5LBQB 4ISTA 2C5KT 3L09A 3RF1A 4EZHA 3NVOA 2FJEA 3ZC1A 3AEDA 2A3DA 4EOZB 4EIWA 5L3GB 4GKKT 2H3RA 3UUXB 2LSYA 3HI2A 3B57A 5KXJA 3ANWB 4QHOA 2WMNA 4JI1T 3PUSA 3VKHA 3CMLA 2WZHA 2Q9QC 1H7CA 4WZXA 5FL1A 2WB5A 2BS3A 3RX6A 4DMVA 2V7LA 2Q9QA 3LK3B 2E8IA 4U33A 4HFIA 2V6YA 1OEDB 1T7SA 1IAPA 2YEVC 5LMNT 1DU2A 4UVAB 4LF8T 1ZEEA 5GONE 2IW5B 2Q9QD 4B3RT 3EDVA 1R8IA 1LKXA 3A5XA 3OYXA 1XNQT 4Z90A 4LFCT 2DLRA 4AIUA 3AA1B 2KXPB 2LHRA 4B6XA 3B5MA 2H7OA 1MMNA 4O2AE 2IHR1 4EGWA 1HS7A 4ISSA 4EEDA 3IBPA 2NOXA 4PFOA 3C4ZA 3ZPOA 2PG8A 4DR6T 2WDRA 3G06A 3KBTA 2LRLA 5IHYA 2EHOC 3DP7A 5FY0A 4AKHA 3TLWA 4AQYT 2KT9A 1HX1B 3I9WA 4H9OC 4DR7T 3KVAA 3QC9A 5LB7B 2FJDA 4PNIA 2K24A 2BS4A 3VU7H 2H7VC 4PJMA 2MYSA 3O1IA 2EHOD 4JUYA 2MBGA 1O3XA 2DHRA 3QB5A 5HAXA 4ZOLE 3T1YT 2J4GA 2WU5A 5JTGA 2LSJA 3KINB 5KMGP 3BQKA 1E1HB 3K3NA 5LMUT 3RPUA 4C90A 4YXDA 3AA0B 2H88A 2CPTA 3KV5A 2J62A 2UUCT 2ZM6T 3P50A 1J1JA 2D5UA 2W62A 1UGOA 5CFBA 2LSKA 4IDPA 4DBRA 5J2UE 3R6NA 3U78A 4HWFA 1GQEA 4IGUA 4QH1A 3UU8A 3FB2A 4B3ST 3OPCA 3NZQA 3GA8A 4L5GA 5L3CB 1OEDA 1WYCA 5L3BB 5J1GA 2N1GA 2YDRA 5BR8T 4JI0T 2HPLA 4DIDB 1D0ZA 1ZV4X 4EYUA 4YHJA 4PK6A 4NPPA 2CCQA 2LKGA 3RI5A 1N33T 2E9XB 2BVMA 3A8YC 4HWCA 5AQHB 4LMJA 4TX5A 4I43B 3JAEA 1IBKT 2UXCT 2L9QA 2L3LA 4KMCA 3LDQB 1KNPA 3OBVE 5FKYA 5ABFA 4U31A 5AQRB 5L3DB 3IHRA 2SPCA 4KX6A 2HH7A 2LE8A 3TLUA 2C5JA 1I6ZA 3GMIA 5HEUA 4KI0F 3KDSE 2WCAA 4ZXLA 5LGTB 2X9XA 1JNZA 1CHUA 3UUBA 2CLYB 4AQFA 4QXBB 3UFGA 3AAEB 4CI3B 4DUYT 2XQ4A 2WMOA 4CXYA 3C4XA 2NW9A 4LF5T 5ABGA 5EK4A 4UIGA 4IHJE 4KBMB 2MAWA 4WBOA 2R6GF 2KWHA 1XDOA 5AFUL 2CA5A 4X1IE 4JI8T 5FL0A 4O2BE 5L4HA 4ILAA 4OFZA 2WQYA 1VCSA 4YT0A 1IBMT 4IE7A 4YJ2E 3CX6B 5LJMA 3HR0A 2CBIA 2J1DG 4HN9A 1YQ3A 2MTQA 5LA6E 4YFSA 3RKOA 4NUUA 3ZMVB 4MFRA 5JRCB 4IL9A 1VOMA 1D1BA 4U72A 2JIWA 5L3EB 4QXCB 5HCJA 4X1KE 4DR4T 3FHNA 3QUJA 3PUYF 4MALA 3VRBA 2E5LT 5JDQA 5AQSB 4QX7B 5CA1E 2A2FX 3FXEB 5AQUB 4AISA 2BBJA 4MLKA 5FXZA 4YTMA 4DV0T 2OA5A 3P4SA 4JI6T 2E2AA 4LMLA 3V5SA 2H89A 2XQYA 3RYIE 2JQ9A 3UFEA 2LHNA 3ZLIA 3ZMZB 1FMWA 4WBNE 2YU2A 5KDMC 2B76A 1LRZA 2E9XA 2CBJA 3AE9A 2QYWA 2WDVA 3PUVF 1MIVA 3AAAB 3R84B 2BG9E 4I55E 2W63A 3ZN1B 4YSZA 4WYVA 4GOUA 3FZHB 2Q9QB 1X79A 3PTRB 3AE2A 4IE6A 2V6YB 4XBFB 4I0UA 3E0ZA 1SA0E 3EAMA 5LHGB 5L3FB 5JDMA 3AE4A 3ZKRA 1OWAA 2DNXA 2XPKA 5AQOB 5IUXA 2FBWA 2DL1A 5M4YA 2X0YA 4ZZBA 2UUBT 3N2GE 3ZMTB 1S94A 2D2SA 1XMOT 2BVLA 2BG9C 2IMLA 3ZEFB 3U3IA 3ZSTA 2LJLA 3C51A 4HE8A 5IYZE 3FZMB 4IE4A 2UXDT 2KLQA 1IJ6A 5LYJE 4CXXA 3RIUC 4WW0A 4TZ4C 4NXMT 3OKQA 5DQWA 1HR0T 2WU2A 3I9YA 3P4RA 2V26A 4F6RC 3K1SA 2XUEA 4OHFA 2V8SV 2ZMAA 1HG2A 3AEGA 2EHOB 4GYSA 5JRCA 2VKOA 4DMWA 3EVYA 2PBIA 1YD8G 3AEEA 3AB3B 1HNXT 2KMFA 3N2OA 2VQFT 2OV9A 4P1NA 1HCIA 1M62A 4HFCA 3JADA 4IDOA 3AE5A 2LM9A 4H9SE 2BKPA 3SOLA 3AVRA 3UUNA 5HWXA 4NXNT 5FXWA 3CKDA 2VL0A 4GYRA 2LT3A 4FI5A 4O4LE 3VR8A 3IF8B 2JJ9A 3LK2B 3WAKA 5HEJA 1QUUA 2UU9T 4ZS2A 4MBQA 3D0TA 3NRYA 3UU3A 2WDQA 3ZT7A 2XAHB 3CX7B 1BR2A 5JDLA 3K8PC 2DCFA 3HA4A 2OLTA 4U3CA 2X9HA 4I4TE 3AA7B 3Q5WA 2XSAA 2ZM8A 4DV1T 3ONLC 5HYAA 3LG7A 4LF9T 4LF4T 2Y8DA 4JI7T 2K48A 4CN6A 4EYYR 4QH4A 1N32T 2CEAA 3BK9A 3ONJA 3OTOT 1T8BA 3TKLB 3SRZA 1S35A 4HFEA 2DI4A 2ACZA 4HWIB 5KX5E 2ZLYA 4IDQA 5F8PA 4IREA 3B13A 1UCUA 5ABFB 4U74A 3FZLB 3RHWA 3FBZA 1JNRA 4XZCA 4JI2T 4JYAT 4ZZCA 4A97A 4HKAA 5DABA 3FXDB 3SWHA 5ADXL 4ZI3C 4HTEA 5BMVE 2XTLA 1D1AA 3AE7A 2W2UA 4DV3T 4FJOA 2M6IA 2XAQB 4AKLA 2EHOA 5J2TE 2YDSA 4AKIA 2W61A 3O1HA 4BJNA 4EV6A 3RYFE 2XY8B 3ZSSA 4ZI3D 1ZKEA 3QNUA 4UF0A 2VKDA 1ZHCA 5JREA 1NWMX 1J5WA 1G73A 3UULA 4ASKA 3ZCIA 3ETUA 4JLEA 1WYBA 1WLXA 2YOEA 4IIJE 3KFWX 4LFBT 1KF6A 2LEHA 3P4QA 2RPAA 2VK9A 3TLVA 2ZM2A 3CVRA 5IWAT 4UVBB 2VVSA 2HN1A 2Z6EA 1MNEA 3QK6A 3P4PA 1IBLT 3AECA 2I0MA 2JRKA 1V9DA 1HX8A 3JAFA 4YJ3E 1M7KA 3H37A 2XHEB 3CQXC 3IA3A 3TLSA 2ODUA 4H63V 3Q2MA 2X66A 3HKBE 5LGUB 1KK7A 4IDNA 5FYMA 4YSXA 1J5ET 1YKEB 3C4WA 1MIYA 3EI0A 3OVUA 4GK0E 3VRAA 5FNVE 3NRXA 4O4HE 1Y01A 4DR5T 2RP4A 5DQVA 2KZ7B 2CHOA 2V5DA 4IE5A 3PJAA 4AQGA 1UX4A 2ODVA 2QA7A 4UVCB 4EB6E 3ZYLA 3RH3A 4E7ZA 1W9RA 2CE7A 2RA1A 4HEAA 5HEGA 1MMDA 3PJAJ 1IZNB 3E08A 3PU8A 1WR0A 4P09A 3ESLA 3PUGA 5JQGE 5JVDE 4HFVA 5LXTE 4TV9E 3LK42 3ZN0B 2K3WA 4IDZA 4DV2T 2UXBT 1AJ3A 4BAYB 4ILUA 2WBLA 3AAIA 4TUYE 4ZI7E 2QGSA 4X64T 1Y64B 5LGNB 2BG9B 3ZCJA 2V7MA 2NW7A 3ETVA 1MNDA 4DO0A 5L2LA 5AQPB 4ZS3A 4PFPA 4DNDA 1HFAA 2FJAA 2V7JA 4H63H 2KWIB 5LBMA 5ABHA 1X9BA 1XDPA 1KEYA 5AQLB 1WFDA 1D1CA 2MPKA 2BZBA 4LFAT 1VRBA 4OYKA 4PW8A 4UV8B 2VWAA 4A5XA 4BA9A 3F2EA 2NTXA 2GK9A 1SHZC 2XQ8A 5AQNB 4IT4A 4JV5T 4TN7B 4P0AA 4ANJA 2AE9A 2QVAA 2XAFB 3FBLA 4H9QC 3NZPA 3RYHE 3UU6A 2WY2A 2JQHA 4KHZF 2XQ6A 1UUSA 4ILCA 4TWDA 2I59A 2V1DB 4OK0A 3UUMA 5H6RB 3P4WA 2WAUA 3I0OA 1UURA 2YN6A 5JDHA 5HXRA 1EZ3A 3PE0A 4EAHA 5FVKA 5EK2A 3QOFA 3O1JA 4PJJA 3LBXA 2X9WA 3CWZB 4K0KT 3PUXF 2W0GA 2NWBA 1G8XA 4GIWA 4KP3C 2WWVA 4PJNA 4U2YA 3RRWA 1US7B 2XQ7A 1NENA 3M65A 2D0TA 1VCTA 1OXZA 3GN5A 2XASB 4U2ZA 5CA0E 5CB4E 4OX9T 2X68A 3N9PA 4HFDA 1WR6A 1IJ5A 2DWKA 5HXSA 1D0XA 1D0YA 2N2NA 4TNWA 4KUMB 3AEAA 4CXWA 3RC3A 5CGMA 2BG9A 2L8KA 2XM1A 5DJQC 3LSVA 3MK7C 1ZOYA 5CJ5A 5JR9C 4QX8B 2WSSV 5F5WA 2VVNA 3SFDA 4BJMA 3N9MA 1Z0PA 2CMRA 2LM2A 3CQGB 1KNZA 3RIUA 5HXCA 5J0ZA 2BS2A 1SE7A 3KV9A 5FVLA 4Z8XA 3V5UA 4H9NC 3N9QA 2VB6A 4EXTA 3L39A
chains in the Genus database with same CATH topology
4NXNT 4DR7T 1XMQT 4LF7T 4JI1T 1N33T 4X64T 4DV4T 4DR1T 4K0KT 1IBKT 4DV3T 4LF6T 2UXCT 3T1HT 2UU9T 4DR4T 1J5ET 2UUBT 2F4VT 1N36T 4DV6T 3T1YT 5LMNT 1XMOT 4YY3T 2VQET 2E5LT 4X66T 4JYAT 2HHHT 4LF8T 1I94T 4DR5T 4B3RT 5LMUT 2UXDT 1XNQT 1HNZT 4YHHT 4LFCT 2UUCT 4DV0T 4LFAT 2ZM6T 4OX9T 4JI6T 4DV1T 4NXMT 1HNWT 1HR0T 4LF9T 4DR3T 4LF4T 4JI7T 4DUYT 4B3TT 4GKJT 4LFBT 4LF5T 1FJGT 1N32T 4X62T 4DV7T 4JI4T 4JV5T 4JI3T 3OTOT 4X65T 4DR6T 4JI8T 4DR2T 1HNXT 4DV5T 2VQFT 4B3ST 5IWAT 4GKKT 4KHPT 4DUZT 1IBMT 5BR8T 4JI0T 1N34T 4DV2T 2UXBT 4B3MT 4JI5T 1IBLT 1XNRT 2UUAT 4AQYT 4JI2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN T;  4DR7 T;  1XMQ T;  4LF7 T;  4JI1 T;  1N33 T;  4X64 T;  4DV4 T;  4DR1 T;  4K0K T;  1IBK T;  4DV3 T;  4LF6 T;  2UXC T;  3T1H T;  2UU9 T;  4DR4 T;  1J5E T;  2UUB T;  2F4V T;  1N36 T;  4DV6 T;  3T1Y T;  5LMN T;  1XMO T;  4YY3 T;  2VQE T;  2E5L T;  4X66 T;  4JYA T;  2HHH T;  4LF8 T;  1I94 T;  4DR5 T;  4B3R T;  5LMU T;  2UXD T;  1XNQ T;  1HNZ T;  4YHH T;  4LFC T;  2UUC T;  4DV0 T;  4LFA T;  2ZM6 T;  4OX9 T;  4JI6 T;  4DV1 T;  4NXM T;  1HNW T;  1HR0 T;  4LF9 T;  4DR3 T;  4LF4 T;  4JI7 T;  4DUY T;  4B3T T;  4GKJ T;  4LFB T;  4LF5 T;  1FJG T;  1N32 T;  4X62 T;  4DV7 T;  4JI4 T;  4JV5 T;  4JI3 T;  3OTO T;  4X65 T;  4DR6 T;  4JI8 T;  4DR2 T;  1HNX T;  4DV5 T;  2VQF T;  4B3S T;  5IWA T;  4GKK T;  4KHP T;  4DUZ T;  1IBM T;  5BR8 T;  4JI0 T;  1N34 T;  4DV2 T;  2UXB T;  4B3M T;  4JI5 T;  1IBL T;  1XNR T;  2UUA T;  4AQY T;  4JI2 T; 
#chains in the Genus database with same CATH topology
 3O9X A;  4NIQ A;  4WNK A;  4UEL A;  4LF7 T;  4JEH B;  4UF0 B;  4DR1 T;  4O4I E;  1ZP0 A;  2IC6 A;  3L3P A;  2HPJ A;  3PV0 F;  3OYZ A;  3MA9 A;  3L8R A;  4HGA A;  1FIO A;  1KNR A;  4DV6 T;  2A9U A;  1XZY A;  4V1A v;  3LFM A;  4QKN A;  5JDF A;  4YY3 T;  3DJB A;  2G0U A;  2UXX B;  3UU4 A;  3P8C D;  2JQK A;  3KBU A;  4A98 A;  1YQ4 A;  2PFV A;  1NEK A;  2AXD S;  5JDN A;  2KIN B;  1BR0 A;  3PUZ F;  3EAB A;  3Q5X A;  3MAC A;  2YKS A;  1B7T A;  5FY7 A;  3ZJ1 A;  3ZYM A;  2C5I T;  2M67 A;  3CPZ A;  4IL4 A;  3C50 A;  3EDU A;  2A72 A;  3EHZ A;  3ABV A;  4HWD A;  4N78 D;  2WZI A;  4PK5 A;  4HWH A;  1HG5 A;  3ZT6 A;  3ONX A;  2NW8 A;  2VKH A;  4E7S A;  2PTF A;  3PUQ A;  4G63 A;  4DV5 T;  4UV9 B;  3JCF A;  3N9N A;  1Z8U A;  4X1Y E;  3AXJ B;  1SUM B;  2B1E A;  3A7M A;  5HEO A;  5AQI B;  4TWH A;  1W09 A;  2CXL A;  1YKH B;  2LSI A;  4H9R C;  5AQJ B;  4YSY A;  4NUV A;  3O4X E;  3MXZ A;  2ZM0 A;  4AI6 A;  3Q5E A;  2JMK A;  3K3O A;  3CIR A;  3AE1 A;  5EK3 A;  3TLT A;  2F4V T;  1FEW A;  1N36 T;  2X0L B;  5HEH A;  1U5P A;  4X66 T;  2KSR A;  3UT5 E;  3ZYK A;  3RKG A;  2KND A;  4CQI A;  5LHI B;  5LP6 E;  3SS1 A;  3T8O A;  4QWN B;  1HNZ T;  4UR9 A;  4YLH A;  5FP3 A;  4PJL A;  4UXN B;  1HNW T;  4QXH B;  3HL6 A;  5F3J A;  1UK5 A;  2YU1 A;  4EZ4 A;  3EUH A;  3ZT5 A;  4X62 T;  3ZMU B;  1MMA A;  2IIU A;  2X0H A;  1U4Q A;  1T98 A;  4X65 T;  4Z91 A;  3PUR A;  3RYC E;  5C3J A;  4U7I A;  2Y48 B;  4ZI2 C;  2VL8 A;  1XWM A;  3UU5 A;  3PDY A;  3RQU A;  1OED E;  1YXR A;  2CM0 A;  2CXD A;  3KVB A;  4JI5 T;  3J9X 1;  3K3Q C;  5LOV E;  4EEB A;  4TNV A;  2LRK A;  2LOP A;  3RLF F;  2N9D A;  4DV4 T;  3X1D A;  3PU3 A;  3AA6 B;  3AE3 A;  3RC8 A;  4ZI2 D;  2PJQ A;  4K0U A;  2MOZ A;  5AQQ B;  5LNK A;  3MJX A;  2Y6X A;  3ANW A;  4L9I A;  2ES0 A;  2WS3 A;  3SFE A;  2BKN A;  3I0Q A;  4AXP A;  3UQ4 A;  4OYJ A;  4YHH T;  2IDO B;  3AXJ A;  1OED C;  3F31 A;  2FUP A;  3VHL A;  5AQG B;  4P0B A;  5LG3 A;  3AEF A;  4U7Y A;  3GWH A;  2J47 A;  2YDQ A;  1FJG T;  4DV7 T;  3RIA A;  1LVF A;  4JI3 T;  4O4J E;  3UQ7 A;  3LBX B;  2C0S A;  1HF8 A;  2VAS A;  4AKR B;  1FMV A;  3P7I A;  3CQC B;  2XSB A;  1L0V A;  2IAK A;  4DUZ T;  5HXH A;  3ZMS B;  3QB5 K;  2W00 A;  2YK0 A;  4ZEY A;  3C64 A;  2CXF A;  1WRD A;  4MHC A;  2ACX A;  3GN5 B;  4JBW F;  3H3A A;  2XAG B;  3RGL A;  4AQF C;  3HKC E;  4DVD A;  3T1H T;  4ILB A;  3F57 A;  3DTO A;  3VKG A;  2X9Y A;  2LOS A;  2UXN B;  4Q25 A;  5C8Y E;  2IC9 A;  5FMN A;  2D9D A;  3NBX X;  3CK6 A;  5HXE A;  3N2K E;  3CX8 B;  5HCM A;  3FZK B;  5C2T A;  5LJN A;  2XAJ B;  5JDG A;  2CWO A;  2W67 A;  4CN1 A;  1QSD A;  2YIN A;  3PUW F;  5JR9 B;  4C91 A;  5JH7 E;  1UX5 A;  1BR1 A;  2NR4 A;  2QRX A;  2K5B B;  2BKO A;  4IE0 A;  4GKJ T;  4CI1 B;  5EZY E;  3VR9 A;  5L4E A;  2W66 A;  2NP9 A;  4PK4 A;  2X51 A;  5FXX A;  3MKD A;  3KV6 A;  4M1P A;  1T72 A;  5LHH B;  4KHP T;  3Q5D A;  2CRB A;  3OJA A;  1N34 T;  3N9O A;  4CI2 B;  3H3M A;  3WAJ A;  4PAG A;  3N5L A;  2K9A A;  1CUN A;  2VKJ A;  3NKZ A;  5E0O A;  1LVK A;  4DBQ A;  3AVS A;  2V7K A;  4X20 E;  4J2C A;  3NWI A;  1QLB A;  3AE6 A;  4ADZ A;  3BQI A;  2M6B A;  5AQM B;  2V6X A;  5LG4 A;  2E9X C;  2VQE T;  4QH5 A;  2BDE A;  2HHH T;  3HKD E;  2XJ7 A;  2JPF A;  3ZC0 A;  1YW0 A;  5H6Q B;  1KFY A;  1MMG A;  2I6H A;  2JMH A;  2HN2 A;  2W4X A;  2IUB A;  4AKG A;  5L47 A;  1MIW A;  1W0A A;  3FZF B;  1HTJ F;  3N9L A;  5HWY A;  3JC6 C;  5TAO A;  2VUR A;  2BBH A;  3Q9D A;  4TV8 E;  4F8H A;  1WCR A;  4HFH A;  3C98 B;  2E9X D;  4GK5 E;  4G2A A;  2XZE A;  2X67 A;  5LCY A;  4TWF A;  3J7Y q;  5A1L A;  3AEB A;  4JI4 T;  2XQ9 A;  4CN4 A;  1BR4 A;  3RRC A;  3WI3 A;  2CLY C;  2XQA A;  2CWY A;  3JC6 D;  4DR2 T;  1E2A A;  1NAF A;  2CHN A;  2XQ3 A;  3I1A A;  5AQT B;  3E22 E;  3ZJ2 A;  4I50 E;  2E5V A;  4XAX B;  3RIF A;  4B3M T;  1XNR T;  2UUA T;  4O8S A;  2V5C A;  4JEU B;  5ETW A;  1E7P A;  1XMQ T;  2XM2 A;  4ZHQ E;  3UTK A;  4ERR A;  4CZZ B;  2DWG A;  3IEE A;  2V7I A;  2P9B A;  4YTN A;  5JR9 A;  3RQW A;  2LSG A;  1W0B A;  3KV4 A;  4LF6 T;  2LKH A;  4L0R A;  4YTP A;  4LMK A;  4HFB A;  5AQK B;  3PUA A;  2JQQ A;  4A56 A;  1I94 T;  3S4U A;  5AQV B;  4H9P C;  2FJB A;  5FY1 A;  4COF A;  3MZK B;  5ABE A;  4UEM A;  2XQ5 A;  3LJC A;  2D0U A;  2WWU A;  2WM9 A;  4X5T A;  4DR3 T;  3W15 B;  2NTY A;  3AE8 A;  3M3Z B;  5AQF B;  3HKE E;  2LLY A;  5FXV A;  4B3T T;  3BQL A;  2WP9 A;  5LBQ B;  4IST A;  2C5K T;  3L09 A;  3RF1 A;  4EZH A;  3NVO A;  2FJE A;  3ZC1 A;  3AED A;  2A3D A;  4EOZ B;  4EIW A;  5L3G B;  4GKK T;  2H3R A;  3UUX B;  2LSY A;  3HI2 A;  3B57 A;  5KXJ A;  3ANW B;  4QHO A;  2WMN A;  4JI1 T;  3PUS A;  3VKH A;  3CML A;  2WZH A;  2Q9Q C;  1H7C A;  4WZX A;  5FL1 A;  2WB5 A;  2BS3 A;  3RX6 A;  4DMV A;  2V7L A;  2Q9Q A;  3LK3 B;  2E8I A;  4U33 A;  4HFI A;  2V6Y A;  1OED B;  1T7S A;  1IAP A;  2YEV C;  5LMN T;  1DU2 A;  4UVA B;  4LF8 T;  1ZEE A;  5GON E;  2IW5 B;  2Q9Q D;  4B3R T;  3EDV A;  1R8I A;  1LKX A;  3A5X A;  3OYX A;  1XNQ T;  4Z90 A;  4LFC T;  2DLR A;  4AIU A;  3AA1 B;  2KXP B;  2LHR A;  4B6X A;  3B5M A;  2H7O A;  1MMN A;  4O2A E;  2IHR 1;  4EGW A;  1HS7 A;  4ISS A;  4EED A;  3IBP A;  2NOX A;  4PFO A;  3C4Z A;  3ZPO A;  2PG8 A;  4DR6 T;  2WDR A;  3G06 A;  3KBT A;  2LRL A;  5IHY A;  2EHO C;  3DP7 A;  5FY0 A;  4AKH A;  3TLW A;  4AQY T;  2KT9 A;  1HX1 B;  3I9W A;  4H9O C;  4DR7 T;  3KVA A;  3QC9 A;  5LB7 B;  2FJD A;  4PNI A;  2K24 A;  2BS4 A;  3VU7 H;  2H7V C;  4PJM A;  2MYS A;  3O1I A;  2EHO D;  4JUY A;  2MBG A;  1O3X A;  2DHR A;  3QB5 A;  5HAX A;  4ZOL E;  3T1Y T;  2J4G A;  2WU5 A;  5JTG A;  2LSJ A;  3KIN B;  5KMG P;  3BQK A;  1E1H B;  3K3N A;  5LMU T;  3RPU A;  4C90 A;  4YXD A;  3AA0 B;  2H88 A;  2CPT A;  3KV5 A;  2J62 A;  2UUC T;  2ZM6 T;  3P50 A;  1J1J A;  2D5U A;  2W62 A;  1UGO A;  5CFB A;  2LSK A;  4IDP A;  4DBR A;  5J2U E;  3R6N A;  3U78 A;  4HWF A;  1GQE A;  4IGU A;  4QH1 A;  3UU8 A;  3FB2 A;  4B3S T;  3OPC A;  3NZQ A;  3GA8 A;  4L5G A;  5L3C B;  1OED A;  1WYC A;  5L3B B;  5J1G A;  2N1G A;  2YDR A;  5BR8 T;  4JI0 T;  2HPL A;  4DID B;  1D0Z A;  1ZV4 X;  4EYU A;  4YHJ A;  4PK6 A;  4NPP A;  2CCQ A;  2LKG A;  3RI5 A;  1N33 T;  2E9X B;  2BVM A;  3A8Y C;  4HWC A;  5AQH B;  4LMJ A;  4TX5 A;  4I43 B;  3JAE A;  1IBK T;  2UXC T;  2L9Q A;  2L3L A;  4KMC A;  3LDQ B;  1KNP A;  3OBV E;  5FKY A;  5ABF A;  4U31 A;  5AQR B;  5L3D B;  3IHR A;  2SPC A;  4KX6 A;  2HH7 A;  2LE8 A;  3TLU A;  2C5J A;  1I6Z A;  3GMI A;  5HEU A;  4KI0 F;  3KDS E;  2WCA A;  4ZXL A;  5LGT B;  2X9X A;  1JNZ A;  1CHU A;  3UUB A;  2CLY B;  4AQF A;  4QXB B;  3UFG A;  3AAE B;  4CI3 B;  4DUY T;  2XQ4 A;  2WMO A;  4CXY A;  3C4X A;  2NW9 A;  4LF5 T;  5ABG A;  5EK4 A;  4UIG A;  4IHJ E;  4KBM B;  2MAW A;  4WBO A;  2R6G F;  2KWH A;  1XDO A;  5AFU L;  2CA5 A;  4X1I E;  4JI8 T;  5FL0 A;  4O2B E;  5L4H A;  4ILA A;  4OFZ A;  2WQY A;  1VCS A;  4YT0 A;  1IBM T;  4IE7 A;  4YJ2 E;  3CX6 B;  5LJM A;  3HR0 A;  2CBI A;  2J1D G;  4HN9 A;  1YQ3 A;  2MTQ A;  5LA6 E;  4YFS A;  3RKO A;  4NUU A;  3ZMV B;  4MFR A;  5JRC B;  4IL9 A;  1VOM A;  1D1B A;  4U72 A;  2JIW A;  5L3E B;  4QXC B;  5HCJ A;  4X1K E;  4DR4 T;  3FHN A;  3QUJ A;  3PUY F;  4MAL A;  3VRB A;  2E5L T;  5JDQ A;  5AQS B;  4QX7 B;  5CA1 E;  2A2F X;  3FXE B;  5AQU B;  4AIS A;  2BBJ A;  4MLK A;  5FXZ A;  4YTM A;  4DV0 T;  2OA5 A;  3P4S A;  4JI6 T;  2E2A A;  4LML A;  3V5S A;  2H89 A;  2XQY A;  3RYI E;  2JQ9 A;  3UFE A;  2LHN A;  3ZLI A;  3ZMZ B;  1FMW A;  4WBN E;  2YU2 A;  5KDM C;  2B76 A;  1LRZ A;  2E9X A;  2CBJ A;  3AE9 A;  2QYW A;  2WDV A;  3PUV F;  1MIV A;  3AAA B;  3R84 B;  2BG9 E;  4I55 E;  2W63 A;  3ZN1 B;  4YSZ A;  4WYV A;  4GOU A;  3FZH B;  2Q9Q B;  1X79 A;  3PTR B;  3AE2 A;  4IE6 A;  2V6Y B;  4XBF B;  4I0U A;  3E0Z A;  1SA0 E;  3EAM A;  5LHG B;  5L3F B;  5JDM A;  3AE4 A;  3ZKR A;  1OWA A;  2DNX A;  2XPK A;  5AQO B;  5IUX A;  2FBW A;  2DL1 A;  5M4Y A;  2X0Y A;  4ZZB A;  2UUB T;  3N2G E;  3ZMT B;  1S94 A;  2D2S A;  1XMO T;  2BVL A;  2BG9 C;  2IML A;  3ZEF B;  3U3I A;  3ZST A;  2LJL A;  3C51 A;  4HE8 A;  5IYZ E;  3FZM B;  4IE4 A;  2UXD T;  2KLQ A;  1IJ6 A;  5LYJ E;  4CXX A;  3RIU C;  4WW0 A;  4TZ4 C;  4NXM T;  3OKQ A;  5DQW A;  1HR0 T;  2WU2 A;  3I9Y A;  3P4R A;  2V26 A;  4F6R C;  3K1S A;  2XUE A;  4OHF A;  2V8S V;  2ZMA A;  1HG2 A;  3AEG A;  2EHO B;  4GYS A;  5JRC A;  2VKO A;  4DMW A;  3EVY A;  2PBI A;  1YD8 G;  3AEE A;  3AB3 B;  1HNX T;  2KMF A;  3N2O A;  2VQF T;  2OV9 A;  4P1N A;  1HCI A;  1M62 A;  4HFC A;  3JAD A;  4IDO A;  3AE5 A;  2LM9 A;  4H9S E;  2BKP A;  3SOL A;  3AVR A;  3UUN A;  5HWX A;  4NXN T;  5FXW A;  3CKD A;  2VL0 A;  4GYR A;  2LT3 A;  4FI5 A;  4O4L E;  3VR8 A;  3IF8 B;  2JJ9 A;  3LK2 B;  3WAK A;  5HEJ A;  1QUU A;  2UU9 T;  4ZS2 A;  4MBQ A;  3D0T A;  3NRY A;  3UU3 A;  2WDQ A;  3ZT7 A;  2XAH B;  3CX7 B;  1BR2 A;  5JDL A;  3K8P C;  2DCF A;  3HA4 A;  2OLT A;  4U3C A;  2X9H A;  4I4T E;  3AA7 B;  3Q5W A;  2XSA A;  2ZM8 A;  4DV1 T;  3ONL C;  5HYA A;  3LG7 A;  4LF9 T;  4LF4 T;  2Y8D A;  4JI7 T;  2K48 A;  4CN6 A;  4EYY R;  4QH4 A;  1N32 T;  2CEA A;  3BK9 A;  3ONJ A;  3OTO T;  1T8B A;  3TKL B;  3SRZ A;  1S35 A;  4HFE A;  2DI4 A;  2ACZ A;  4HWI B;  5KX5 E;  2ZLY A;  4IDQ A;  5F8P A;  4IRE A;  3B13 A;  1UCU A;  5ABF B;  4U74 A;  3FZL B;  3RHW A;  3FBZ A;  1JNR A;  4XZC A;  4JI2 T;  4JYA T;  4ZZC A;  4A97 A;  4HKA A;  5DAB A;  3FXD B;  3SWH A;  5ADX L;  4ZI3 C;  4HTE A;  5BMV E;  2XTL A;  1D1A A;  3AE7 A;  2W2U A;  4DV3 T;  4FJO A;  2M6I A;  2XAQ B;  4AKL A;  2EHO A;  5J2T E;  2YDS A;  4AKI A;  2W61 A;  3O1H A;  4BJN A;  4EV6 A;  3RYF E;  2XY8 B;  3ZSS A;  4ZI3 D;  1ZKE A;  3QNU A;  4UF0 A;  2VKD A;  1ZHC A;  5JRE A;  1NWM X;  1J5W A;  1G73 A;  3UUL A;  4ASK A;  3ZCI A;  3ETU A;  4JLE A;  1WYB A;  1WLX A;  2YOE A;  4IIJ E;  3KFW X;  4LFB T;  1KF6 A;  2LEH A;  3P4Q A;  2RPA A;  2VK9 A;  3TLV A;  2ZM2 A;  3CVR A;  5IWA T;  4UVB B;  2VVS A;  2HN1 A;  2Z6E A;  1MNE A;  3QK6 A;  3P4P A;  1IBL T;  3AEC A;  2I0M A;  2JRK A;  1V9D A;  1HX8 A;  3JAF A;  4YJ3 E;  1M7K A;  3H37 A;  2XHE B;  3CQX C;  3IA3 A;  3TLS A;  2ODU A;  4H63 V;  3Q2M A;  2X66 A;  3HKB E;  5LGU B;  1KK7 A;  4IDN A;  5FYM A;  4YSX A;  1J5E T;  1YKE B;  3C4W A;  1MIY A;  3EI0 A;  3OVU A;  4GK0 E;  3VRA A;  5FNV E;  3NRX A;  4O4H E;  1Y01 A;  4DR5 T;  2RP4 A;  5DQV A;  2KZ7 B;  2CHO A;  2V5D A;  4IE5 A;  3PJA A;  4AQG A;  1UX4 A;  2ODV A;  2QA7 A;  4UVC B;  4EB6 E;  3ZYL A;  3RH3 A;  4E7Z A;  1W9R A;  2CE7 A;  2RA1 A;  4HEA A;  5HEG A;  1MMD A;  3PJA J;  1IZN B;  3E08 A;  3PU8 A;  1WR0 A;  4P09 A;  3ESL A;  3PUG A;  5JQG E;  5JVD E;  4HFV A;  5LXT E;  4TV9 E;  3LK4 2;  3ZN0 B;  2K3W A;  4IDZ A;  4DV2 T;  2UXB T;  1AJ3 A;  4BAY B;  4ILU A;  2WBL A;  3AAI A;  4TUY E;  4ZI7 E;  2QGS A;  4X64 T;  1Y64 B;  5LGN B;  2BG9 B;  3ZCJ A;  2V7M A;  2NW7 A;  3ETV A;  1MND A;  4DO0 A;  5L2L A;  5AQP B;  4ZS3 A;  4PFP A;  4DND A;  1HFA A;  2FJA A;  2V7J A;  4H63 H;  2KWI B;  5LBM A;  5ABH A;  1X9B A;  1XDP A;  1KEY A;  5AQL B;  1WFD A;  1D1C A;  2MPK A;  2BZB A;  4LFA T;  1VRB A;  4OYK A;  4PW8 A;  4UV8 B;  2VWA A;  4A5X A;  4BA9 A;  3F2E A;  2NTX A;  2GK9 A;  1SHZ C;  2XQ8 A;  5AQN B;  4IT4 A;  4JV5 T;  4TN7 B;  4P0A A;  4ANJ A;  2AE9 A;  2QVA A;  2XAF B;  3FBL A;  4H9Q C;  3NZP A;  3RYH E;  3UU6 A;  2WY2 A;  2JQH A;  4KHZ F;  2XQ6 A;  1UUS A;  4ILC A;  4TWD A;  2I59 A;  2V1D B;  4OK0 A;  3UUM A;  5H6R B;  3P4W A;  2WAU A;  3I0O A;  1UUR A;  2YN6 A;  5JDH A;  5HXR A;  1EZ3 A;  3PE0 A;  4EAH A;  5FVK A;  5EK2 A;  3QOF A;  3O1J A;  4PJJ A;  3LBX A;  2X9W A;  3CWZ B;  4K0K T;  3PUX F;  2W0G A;  2NWB A;  1G8X A;  4GIW A;  4KP3 C;  2WWV A;  4PJN A;  4U2Y A;  3RRW A;  1US7 B;  2XQ7 A;  1NEN A;  3M65 A;  2D0T A;  1VCT A;  1OXZ A;  3GN5 A;  2XAS B;  4U2Z A;  5CA0 E;  5CB4 E;  4OX9 T;  2X68 A;  3N9P A;  4HFD A;  1WR6 A;  1IJ5 A;  2DWK A;  5HXS A;  1D0X A;  1D0Y A;  2N2N A;  4TNW A;  4KUM B;  3AEA A;  4CXW A;  3RC3 A;  5CGM A;  2BG9 A;  2L8K A;  2XM1 A;  5DJQ C;  3LSV A;  3MK7 C;  1ZOY A;  5CJ5 A;  5JR9 C;  4QX8 B;  2WSS V;  5F5W A;  2VVN A;  3SFD A;  4BJM A;  3N9M A;  1Z0P A;  2CMR A;  2LM2 A;  3CQG B;  1KNZ A;  3RIU A;  5HXC A;  5J0Z A;  2BS2 A;  1SE7 A;  3KV9 A;  5FVL A;  4Z8X A;  3V5U A;  4H9N C;  3N9Q A;  2VB6 A;  4EXT A;  3L39 A; 
#chains in the Genus database with same CATH homology
 4NXN T;  4DR7 T;  1XMQ T;  4LF7 T;  4JI1 T;  1N33 T;  4X64 T;  4DV4 T;  4DR1 T;  4K0K T;  1IBK T;  4DV3 T;  4LF6 T;  2UXC T;  3T1H T;  2UU9 T;  4DR4 T;  1J5E T;  2UUB T;  2F4V T;  1N36 T;  4DV6 T;  3T1Y T;  5LMN T;  1XMO T;  4YY3 T;  2VQE T;  2E5L T;  4X66 T;  4JYA T;  2HHH T;  4LF8 T;  1I94 T;  4DR5 T;  4B3R T;  5LMU T;  2UXD T;  1XNQ T;  1HNZ T;  4YHH T;  4LFC T;  2UUC T;  4DV0 T;  4LFA T;  2ZM6 T;  4OX9 T;  4JI6 T;  4DV1 T;  4NXM T;  1HNW T;  1HR0 T;  4LF9 T;  4DR3 T;  4LF4 T;  4JI7 T;  4DUY T;  4B3T T;  4GKJ T;  4LFB T;  4LF5 T;  1FJG T;  1N32 T;  4X62 T;  4DV7 T;  4JI4 T;  4JV5 T;  4JI3 T;  3OTO T;  4X65 T;  4DR6 T;  4JI8 T;  4DR2 T;  1HNX T;  4DV5 T;  2VQF T;  4B3S T;  5IWA T;  4GKK T;  4KHP T;  4DUZ T;  1IBM T;  5BR8 T;  4JI0 T;  1N34 T;  4DV2 T;  2UXB T;  4B3M T;  4JI5 T;  1IBL T;  1XNR T;  2UUA T;  4AQY T;  4JI2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...