4GKKT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4gkkT00
2UU9T 4DUYT 4X66T 4JI7T 2VQFT 4DV3T 4NXMT 4DR2T 1IBMT 4LFAT 2F4VT 2UUAT 2ZM6T 4DR3T 3T1YT 4DR1T 1FJGT 2HHHT 2UUCT 4JI0T 4LF9T 4X64T 4X62T 3T1HT 1N32T 4B3RT 4LF4T 1XNRT 2UUBT 4DR6T 5LMNT 4LF5T 2UXBT 1N36T 1IBKT 4JI3T 2E5LT 2UXDT 4B3MT 4LFBT 4JI1T 4DV6T 1I94T 4DR4T 4DV5T 4LFCT 4LF7T 1HNZT 1J5ET 4YY3T 4JI8T 4YHHT 4JI2T 4DUZT 4DV1T 4X65T 4LF8T 4B3ST 4LF6T 1N34T 4JI6T 1XMQT 1IBLT 4DV0T 4GKKT 3OTOT 4AQYT 4OX9T 4DV7T 4JI4T 4DV4T 4DR5T 2UXCT 4NXNT 4K0KT 5LMUT 4KHPT 1N33T 4GKJT 1HR0T 4DR7T 5BR8T 2VQET 4JYAT 1XNQT 4JI5T 1HNXT 4B3TT 4JV5T 1XMOT 5IWAT 1HNWT 4DV2T
chains in the Genus database with same CATH superfamily
5ABGA 4I55E 4X66T 4JI7T 2IIUA 4HGAA 4BAYB 4ZZCA 2CHNA 1IBMT 3FBLA 2UUAT 4CI1B 4DR3T 2IHR1 3RRWA 3FZKB 3ZPOA 3VKHA 4OFZA 2UUCT 1D1CA 5JDFA 4ANJA 3ZJ2A 3VRAA 4JI0T 4E7SA 3ZT7A 2KNDA 4UV8B 2WM9A 1T8BA 3X1DA 4CN6A 3OKQA 3P50A 3AEGA 5AQVB 4DV6T 3IEEA 3HR0A 4G2AA 4LFCT 4YY3T 1X9BA 1Z0PA 4DV1T 2XJ7A 3NZPA 4AXPA 3O4XE 4X1YE 5HWYA 4GKKT 3ZKRA 2YU1A 4UR9A 2QVAA 4IDPA 3FB2A 5BMVE 2D9DA 1N33T 2QA7A 2MYSA 3PUVF 4CQIA 2LJLA 4P0BA 4K0UA 3LJCA 1IZNB 3KVBA 2A3DA 2B76A 3P7IA 1S94A 4CXWA 3NBXX 4BA9A 2L8KA 5JDLA 3RRCA 4AKLA 5LNKA 2BG9E 3RIAA 3Q5WA 4EAHA 3QB5K 2EHOC 3FHNA 4JBWF 2WQYA 4TZ4C 4WNKA 3Q5EA 4ZI3D 5J2TE 4PK6A 2CE7A 2V7LA 3PTRB 2YINA 1YXRA 3H37A 4MHCA 2FJBA 4O4JE 2XUEA 3N9PA 5LBMA 2LM2A 2UXBT 4HN9A 4NPPA 4Z91A 3CIRA 4DIDB 2GK9A 4IREA 3OJAA 2DNXA 2UXXB 4DV5T 3N2OA 2JQ9A 2W00A 4EZ4A 3RHWA 2N2NA 5H6QB 4B3ST 4EGWA 4LF6T 4EYUA 3I9YA 5AQJB 3RYCE 3O1JA 1YKEB 1BR2A 4ZS2A 3I0OA 3JC6C 5JDMA 3AE4A 4H63H 4DR5T 1T72A 3ZLIA 4AQFC 2LM9A 3AEDA 2H3RA 3E08A 1HNXT 2X0YA 5LGNB 2YDRA 2AE9A 3UFGA 2AXDS 2WY2A 2N9DA 3V5SA 3N9LA 4DUYT 2NWBA 3AVSA 4LFAT 4HWDA 4F6RC 2K5BB 1UUSA 3UFEA 4V1Av 1G8XA 5JRCA 2HH7A 3MKDA 4MALA 4XBFB 1YQ4A 4X62T 1N32T 5A1LA 1WFDA 5CA1E 2K9AA 5C3JA 5J1GA 4CXYA 3P4SA 2C5JA 4GK5E 2IAKA 4HEAA 4EEDA 3KV9A 3TLUA 2Q9QA 4TNVA 2C5IT 1CHUA 3ZSTA 4QX8B 3UTKA 5DQVA 3PDYA 2XAHB 2Y48B 4TWHA 4AKGA 4OK0A 3TKLB 2LEHA 3PU8A 4AQYT 2SPCA 4DV4T 1LVKA 5LOVE 5EK3A 3VR8A 4LMJA 1QSDA 4OYJA 2KT9A 4BJMA 3ZYKA 4ZI2D 4ISTA 4HFHA 5CGMA 3C51A 2VURA 1R8IA 2CBIA 3RKGA 3JAEA 5JRCB 2H7OA 4GIWA 2MPKA 3LK42 2WDRA 5AFUL 4OHFA 2LSKA 2ES0A 4PFPA 3TLTA 2W61A 3CMLA 3CQCB 3ZMTB 3ONXA 3UUBA 2V8SV 3PUZF 3GMIA 1EZ3A 1WRDA 2PBIA 2C5KT 1HS7A 3LBXA 5HEGA 5FL1A 1DU2A 2X66A 4CZZB 3J7Yq 2X0LB 2MBGA 2NR4A 3B57A 1UGOA 3ZC1A 2XQAA 1YKHB 4PFOA 4IE4A 5HCMA 3K3OA 2D0UA 4QH1A 2QRXA 5HEUA 1IBLT 4XZCA 4A98A 3PUSA 2E8IA 2MOZA 3H3MA 1FMWA 4HE8A 2DWKA 3PJAA 4JEHB 2LSGA 2HPJA 2L3LA 3Q5DA 1UX4A 4IE5A 4GYSA 5F5WA 4ILCA 2V7IA 5L3CB 2P9BA 1XMOT 5C8YE 5CFBA 3CQXC 3I1AA 1U5PA 3Q2MA 1KFYA 4YJ2E 3LBXB 1MIVA 3EI0A 5AQPB 3HKCE 1NENA 2VL0A 2KZ7B 3U78A 5CB4E 4XAXB 4ILAA 3ONJA 5JDHA 4EYYR 4DR1T 4JEUB 3B5MA 5HYAA 5FXZA 3NKZA 2WP9A 2DI4A 2H89A 3VKGA 2WB5A 2JMHA 2V7JA 3MA9A 2XTLA 4X64T 4L0RA 1KNZA 4UXNB 2XAGB 1M7KA 2ACZA 3F57A 2UXDT 3NZQA 4JI1T 3UQ4A 2BBHA 2XAQB 2X9WA 4M1PA 4IL9A 1ZEEA 3B13A 2EHOD 2FJEA 2OLTA 4U7YA 3UT5E 2H7VC 4IHJE 2V6YA 1VCTA 4WBNE 4KI0F 3P8CD 2KWHA 5E0OA 5AQRB 2X68A 3CKDA 2XAJB 3MXZA 4UVAB 1HG5A 2LSJA 1XNQT 4JI5T 4JV5T 2LOPA 4HWCA 5LHIB 2YEVC 1L0VA 3ZYMA 4H9SE 1OWAA 1US7B 3JADA 3C4ZA 4LF8T 3W15B 5LHHB 3HL6A 4N78D 4JLEA 1VOMA 2VWAA 2V6XA 1UCUA 1KNRA 3N9MA 3C98B 3U3IA 3AEEA 1SE7A 2WDQA 4PK4A 2NTXA 3NRYA 4AISA 3CPZA 5LHGB 4L9IA 2C0SA 1KF6A 2BS2A 3AEBA 4U7IA 1N36T 2V6YB 3QNUA 4B3MT 5C2TA 3EUHA 2VKJA 5LYJE 4UVBB 3CK6A 4O4IE 2XPKA 2HN1A 4IE7A 3RC8A 3ZYLA 1BR4A 2JQHA 1HTJF 5FXVA 4ZXLA 1ZP0A 4O2AE 4O4HE 5JDGA 4G63A 1YD8G 4P09A 4ILBA 4JUYA 5BR8T 3AE7A 2JQQA 1HFAA 2XQ6A 3OYXA 1FEWA 3CX7B 2LKHA 5LJMA 1CUNA 2ZMAA 2JQKA 3NVOA 2VQFT 2YDQA 5JR9A 4TUYE 4U2ZA 1E1HB 3J9X1 4MFRA 2EHOB 2D5UA 2WU2A 2YDSA 2HHHT 3DP7A 4O2BE 3SOLA 2XM2A 1H7CA 3AE9A 1E7PA 4HFVA 1SA0E 1SUMB 1LKXA 3RQUA 2WZHA 4JI3T 3ONLC 4L5GA 4IDNA 4EEBA 4DR4T 2IC9A 4EIWA 1WYCA 5AQGB 2KMFA 1J5ET 1OXZA 4AQGA 4IGUA 3FBZA 4YJ3E 1MMGA 4X65T 1Y01A 3PJAJ 4FI5A 4HFCA 3SFDA 3KV6A 4PJLA 3AECA 1MNEA 4ZI7E 2QGSA 3NRXA 2OA5A 4C90A 2D2SA 3S4UA 2Y8DA 4EB6E 3OVUA 3HI2A 2V5CA 2DLRA 5DQWA 2V5DA 3FXEB 4JI4T 3SWHA 1WR0A 2CCQA 4K0KT 3ZN1B 5JR9B 1HG2A 4X1IE 4DR7T 3RLFF 3E0ZA 3L39A 3I9WA 4H9RC 1IJ5A 1FIOA 5HCJA 1Y64B 3SS1A 2ZM8A 5LGTB 4U74A 5L3GB 1XDPA 2VVSA 2XAFB 2X9XA 4DBRA 4TWDA 4HWFA 5JTGA 2YU2A 2HPLA 1UK5A 2BVLA 3AA7B 3RIUA 3F31A 5JDNA 5F3JA 2E2AA 1W0BA 4LF9T 4A97A 1KNPA 3UULA 3LK3B 5EZYE 4DR6T 2X9YA 3KDSE 4QXBB 4H63V 2X0HA 5HAXA 4GOUA 4GK0E 2BKNA 4U72A 5AQLB 2BS4A 4JI2T 4UIGA 4KUMB 2XQ8A 5FP3A 1T98A 1WYBA 2V26A 2JRKA 3AA6B 2LSIA 3CX6B 3M3ZB 3K8PC 5AQMB 1HF8A 2N1GA 3QOFA 4JI6T 4H9NC 3R6NA 3OPCA 2W2UA 3UUXB 3AXJA 5L3FB 4QX7B 1D0ZA 1HX1B 4AKIA 4GKJT 2VQET 3ZCJA 2LSYA 3PU3A 4DVDA 5IYZE 2CM0A 4WBOA 3PURA 3K3NA 2WSSV 4H9OC 3RYHE 2UU9T 2IW5B 3RC3A 3RYFE 2CWOA 3FZFB 5LG4A 3ZT5A 3RYIE 1W0AA 4YTPA 3UU5A 1D0XA 5KMGP 3AEFA 1UURA 2WMOA 2UXNB 3HKDE 1VRBA 3VR9A 4UEMA 3T1HT 4TN7B 3QK6A 5FY1A 2E9XD 4YSXA 2VK9A 3L3PA 3C50A 3AE2A 1OEDA 2Y6XA 5HXSA 3AXJB 5HEJA 4YHHT 2MTQA 4ZI3C 2CLYB 2XQ7A 3BQLA 3C4XA 2WAUA 4I43B 4HKAA 5LP6E 1V9DA 2M6BA 3ZT6A 5AQSB 2WDVA 2CRBA 5HXHA 2A9UA 2YOEA 2LHRA 2XSAA 5LMUT 4KHPT 2BDEA 2KLQA 1IJ6A 3IBPA 1AJ3A 1NEKA 2BG9A 5AQQB 3ESLA 2I59A 5HXCA 2BZBA 3L09A 3RKOA 4DV2T 5IHYA 2Q9QC 3LG7A 4OYKA 5FYMA 3EDUA 4KX6A 4HFIA 2H88A 5LG3A 2MAWA 4IT4A 1M62A 1OEDB 1FJGT 2E9XA 4KBMB 4YTNA 2WWUA 3WI3A 2W67A 3CX8B 3ANWA 2V7MA 3ZC0A 4B3RT 3UU4A 4ISSA 5LJNA 2UUBT 3PUXF 4CXXA 1D1AA 4P1NA 5FXXA 5L47A 3RPUA 4Q25A 5JDQA 3Q5XA 1I94T 1KK7A 2L9QA 3OBVE 4ILUA 3PUQA 4A5XA 2V1DB 3QUJA 4H9QC 2CBJA 2A72A 2LE8A 4HTEA 2V7KA 2BG9B 5CA0E 1U4QA 2YK0A 1XMQT 3UUNA 4EOZB 3PUWF 2PTFA 4IE0A 2XSBA 4DNDA 2UXCT 3CQGB 3SFEA 3TLVA 5FXWA 2M67A 1XWMA 4JYAT 1W9RA 1X79A 3AEAA 2E9XB 2JJ9A 3KBUA 5JH7E 3CVRA 2D0TA 2J1DG 2HN2A 5JQGE 3BQIA 2FJAA 3ANWB 4UV9B 2F4VT 1ZV4X 2LLYA 3ZMVB 4EXTA 4IE6A 3RX6A 1G73A 3NWIA 2BKPA 2J47A 3N5LA 5KXJA 4KMCA 5FY0A 4ZI2C 3D0TA 2X51A 2W63A 1VCSA 4HWIB 5GONE 4AKHA 2BS3A 5FMNA 2XQ5A 4U33A 3JC6D 5LMNT 4COFA 2CMRA 4YSZA 2NW7A 2E5LT 4DMWA 4LFBT 4QXHB 1LRZA 3RH3A 4HFDA 2JMKA 3EVYA 2W62A 5AQOB 2DWGA 5FKYA 5FY7A 3PE0A 2J4GA 1N34T 3KV5A 1FMVA 2EHOA 3AE5A 3AVRA 3RQWA 4QH4A 3AAAB 3P4WA 5DABA 4NUUA 1D0YA 3AE6A 3N9NA 3E22E 4GYRA 3FZLB 2WZIA 2VB6A 5IWAT 1NWMX 2RP4A 5LB7B 4I0UA 3ABVA 1I6ZA 3AA1B 4CI3B 2CWYA 4E7ZA 2G0UA 2ZM6T 3AAEB 2WCAA 4PNIA 3A7MA 4ZS3A 3T1YT 5AQNB 2XASB 3WAKA 5LGUB 4ZZBA 4IDZA 4QH5A 3SRZA 4MLKA 1MMAA 2ZM2A 4AQFA 3GN5A 1LVFA 3AE8A 5AQHB 1YW0A 2ACXA 4UVCB 4HWHA 2XM1A 4WZXA 1YQ3A 1GQEA 2NP9A 4PJJA 5IUXA 1IBKT 3N9QA 1OEDE 3RF1A 3RGLA 2NTYA 2I0MA 1HNZT 3LDQB 4IDOA 5J0ZA 3AAIA 4ADZA 4AKRB 3ETUA 4DUZT 4U3CA 3EABA 2RPAA 3M65A 3KFWX 5JREA 4PJNA 3UU3A 5ABHA 2CA5A 2ZLYA 4TV8E 2KINB 3N2GE 4PJMA 2CHOA 4OX9T 3JAFA 1T7SA 1QUUA 4DV7T 2QYWA 3UU6A 3ZEFB 2IUBA 5L4HA 1BR0A 4TV9E 1HR0T 5CJ5A 3VU7H 4WW0A 3DJBA 2YKSA 4UELA 4YLHA 4Z90A 1NAFA 3AE1A 1HNWT 3EHZA 1S35A 3IHRA 3GN5B 3KVAA 3AB3B 2VKDA 4NXMT 5KX5E 5AQKB 1O3XA 1W09A 1XZYA 2J62A 1UX5A 2PFVA 4KP3C 3C4WA 2FBWA 3QB5A 4I50E 4BJNA 2XQ4A 1MNDA 3WAJA 5EK2A 4QKNA 5AQTB 2M6IA 3MJXA 3VRBA 2I6HA 2VASA 5ABFA 4EZHA 2W66A 4DMVA 2K3WA 3L8RA 2Q9QD 3HKBE 5TAOA 3DTOA 3K1SA 4P0AA 3O1HA 3OYZA 4JI8T 5L3EB 2WS3A 2IC6A 5JR9C 3A5XA 2NOXA 2E5VA 2BVMA 3GWHA 2PG8A 1IAPA 3KV4A 2JPFA 3OTOT 2YN6A 3KINB 3ZMSB 2OV9A 4NXNT 3PUYF 3K3QC 2CXFA 4EV6A 3HA4A 4B3TT 5HXRA 2B1EA 2FUPA 4AIUA 4F8HA 2NW9A 2KXPB 3BQKA 3VHLA 2VVNA 4J2CA 2ODUA 3TLSA 2IMLA 4PAGA 5ABFB 2CXDA 2PJQA 4O8SA 3TLWA 5ETWA 4NIQA 2DCFA 3A8YC 2X9HA 3PUGA 4NUVA 5LCYA 1WCRA 3O1IA 1WLXA 1XNRT 2XZEA 5HXEA 3UQ7A 1ZHCA 4LF5T 5ABEA 2LT3A 4IL4A 3R84B 4HFBA 1QLBA 5FVLA 2WWVA 3UUMA 4LMLA 3F2EA 4ZOLE 1HCIA 3KBTA 4YFSA 4QXCB 2BKOA 3AE3A 4HFEA 2XQ3A 3MACA 4Z8XA 3RIUC 3T8OA 5JVDE 3UU8A 5EK4A 4X20E 5ADXL 2XHEB 2LOSA 2KSRA 1WR6A 2WU5A 3LFMA 2X67A 4QWNB 5AQIB 3AA0B 3ZCIA 4ASKA 2CPTA 3LSVA 4CI2B 3H3AA 1XDOA 2Q9QB 4FJOA 3QC9A 4O4LE 4YTMA 5J2UE 3RI5A 3ETVA 4DV3T 4WYVA 2ODVA 4YSYA 5AQFB 5FL0A 2NW8A 3I0QA 3GA8A 2VKOA 2VKHA 4U31A 5DJQC 3HKEE 3N9OA 3ZMZB 3IA3A 4AI6A 5LA6E 5H6RB 4C91A 5FVKA 3PUAA 3P4QA 3JCFA 4CN1A 2CLYC 2FJDA 4TX5A 4B6XA 4UF0A 3MZKB 4TWFA 3ZSSA 2CXLA 4DBQA 5L2LA 2RA1A 4X1KE 2LRKA 5F8PA 3CWZB 3ZN0B 4ZHQE 5AQUB 1JNZA 2K48A 1MIWA 1JNRA 5M4YA 4QHOA 3MK7C 4H9PC 1MMDA 3LK2B 4LMKA 3Q9DA 4CN4A 4DV0T 4PK5A 3BK9A 4YXDA 1HX8A 1ZKEA 3RIFA 4A56A 3V5UA 2VL8A 3O9XA 2LHNA 2KWIB 2XY8B 5L4EA 4KHZF 4IIJE 4IDQA 1MMNA 4U2YA 5LBQB 4ERRA 4YHJA 2Z6EA 2LRLA 3FZHB 5HEHA 1OEDC 1B7TA 2ZM0A 5KDMC 2BBJA 4X5TA 3IF8B 2R6GF 2XQ9A 4PW8A 4DR2T 4TNWA 5L3DB 3EDVA 4UF0B 1KEYA 2DL1A 2WBLA 5L3BB 4MBQA 1BR1A 4ZEYA 4LF4T 2W0GA 2XQYA 2JIWA 2BG9C 5HEOA 3ZJ1A 4DO0A 3G06A 1SHZC 3PV0F 4LF7T 1ZOYA 3FXDB 1Z8UA 3C64A 2CEAA 1J5WA 2DHRA 2A2FX 1MIYA 1E2AA 5LXTE 1D1BA 2E9XC 2LKGA 3FZMB 2W4XA 2K24A 3N2KE 4YT0A 2WMNA 5FNVE 2IDOB 4I4TE 3P4RA 3ZMUB 1J1JA 3P4PA 3EAMA 5HWXA
chains in the Genus database with same CATH topology
2UU9T 4DUYT 4X66T 4JI7T 2VQFT 4DV3T 4NXMT 4DR2T 1IBMT 4LFAT 2F4VT 2UUAT 2ZM6T 4DR3T 3T1YT 4DR1T 1FJGT 2HHHT 2UUCT 4JI0T 4LF9T 4X64T 4X62T 3T1HT 1N32T 4B3RT 4LF4T 1XNRT 2UUBT 4DR6T 5LMNT 4LF5T 2UXBT 1N36T 1IBKT 4JI3T 2E5LT 2UXDT 4B3MT 4LFBT 4JI1T 4DV6T 1I94T 4DR4T 4DV5T 4LFCT 4LF7T 1HNZT 1J5ET 4YY3T 4JI8T 4YHHT 4JI2T 4DUZT 4DV1T 4X65T 4LF8T 4B3ST 4LF6T 1N34T 4JI6T 1XMQT 1IBLT 4DV0T 4GKKT 3OTOT 4AQYT 4OX9T 4DV7T 4JI4T 4DV4T 4DR5T 2UXCT 4NXNT 4K0KT 5LMUT 4KHPT 1N33T 4GKJT 1HR0T 4DR7T 5BR8T 2VQET 4JYAT 1XNQT 4JI5T 1HNXT 4B3TT 4JV5T 1XMOT 5IWAT 1HNWT 4DV2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 T;  4DUY T;  4X66 T;  4JI7 T;  2VQF T;  4DV3 T;  4NXM T;  4DR2 T;  1IBM T;  4LFA T;  2F4V T;  2UUA T;  2ZM6 T;  4DR3 T;  3T1Y T;  4DR1 T;  1FJG T;  2HHH T;  2UUC T;  4JI0 T;  4LF9 T;  4X64 T;  4X62 T;  3T1H T;  1N32 T;  4B3R T;  4LF4 T;  1XNR T;  2UUB T;  4DR6 T;  5LMN T;  4LF5 T;  2UXB T;  1N36 T;  1IBK T;  4JI3 T;  2E5L T;  2UXD T;  4B3M T;  4LFB T;  4JI1 T;  4DV6 T;  1I94 T;  4DR4 T;  4DV5 T;  4LFC T;  4LF7 T;  1HNZ T;  1J5E T;  4YY3 T;  4JI8 T;  4YHH T;  4JI2 T;  4DUZ T;  4DV1 T;  4X65 T;  4LF8 T;  4B3S T;  4LF6 T;  1N34 T;  4JI6 T;  1XMQ T;  1IBL T;  4DV0 T;  4GKK T;  3OTO T;  4AQY T;  4OX9 T;  4DV7 T;  4JI4 T;  4DV4 T;  4DR5 T;  2UXC T;  4NXN T;  4K0K T;  5LMU T;  4KHP T;  1N33 T;  4GKJ T;  1HR0 T;  4DR7 T;  5BR8 T;  2VQE T;  4JYA T;  1XNQ T;  4JI5 T;  1HNX T;  4B3T T;  4JV5 T;  1XMO T;  5IWA T;  1HNW T;  4DV2 T; 
#chains in the Genus database with same CATH topology
 5ABG A;  4I55 E;  4X66 T;  4JI7 T;  2IIU A;  4HGA A;  4BAY B;  4ZZC A;  2CHN A;  1IBM T;  3FBL A;  2UUA T;  4CI1 B;  4DR3 T;  2IHR 1;  3RRW A;  3FZK B;  3ZPO A;  3VKH A;  4OFZ A;  2UUC T;  1D1C A;  5JDF A;  4ANJ A;  3ZJ2 A;  3VRA A;  4JI0 T;  4E7S A;  3ZT7 A;  2KND A;  4UV8 B;  2WM9 A;  1T8B A;  3X1D A;  4CN6 A;  3OKQ A;  3P50 A;  3AEG A;  5AQV B;  4DV6 T;  3IEE A;  3HR0 A;  4G2A A;  4LFC T;  4YY3 T;  1X9B A;  1Z0P A;  4DV1 T;  2XJ7 A;  3NZP A;  4AXP A;  3O4X E;  4X1Y E;  5HWY A;  4GKK T;  3ZKR A;  2YU1 A;  4UR9 A;  2QVA A;  4IDP A;  3FB2 A;  5BMV E;  2D9D A;  1N33 T;  2QA7 A;  2MYS A;  3PUV F;  4CQI A;  2LJL A;  4P0B A;  4K0U A;  3LJC A;  1IZN B;  3KVB A;  2A3D A;  2B76 A;  3P7I A;  1S94 A;  4CXW A;  3NBX X;  4BA9 A;  2L8K A;  5JDL A;  3RRC A;  4AKL A;  5LNK A;  2BG9 E;  3RIA A;  3Q5W A;  4EAH A;  3QB5 K;  2EHO C;  3FHN A;  4JBW F;  2WQY A;  4TZ4 C;  4WNK A;  3Q5E A;  4ZI3 D;  5J2T E;  4PK6 A;  2CE7 A;  2V7L A;  3PTR B;  2YIN A;  1YXR A;  3H37 A;  4MHC A;  2FJB A;  4O4J E;  2XUE A;  3N9P A;  5LBM A;  2LM2 A;  2UXB T;  4HN9 A;  4NPP A;  4Z91 A;  3CIR A;  4DID B;  2GK9 A;  4IRE A;  3OJA A;  2DNX A;  2UXX B;  4DV5 T;  3N2O A;  2JQ9 A;  2W00 A;  4EZ4 A;  3RHW A;  2N2N A;  5H6Q B;  4B3S T;  4EGW A;  4LF6 T;  4EYU A;  3I9Y A;  5AQJ B;  3RYC E;  3O1J A;  1YKE B;  1BR2 A;  4ZS2 A;  3I0O A;  3JC6 C;  5JDM A;  3AE4 A;  4H63 H;  4DR5 T;  1T72 A;  3ZLI A;  4AQF C;  2LM9 A;  3AED A;  2H3R A;  3E08 A;  1HNX T;  2X0Y A;  5LGN B;  2YDR A;  2AE9 A;  3UFG A;  2AXD S;  2WY2 A;  2N9D A;  3V5S A;  3N9L A;  4DUY T;  2NWB A;  3AVS A;  4LFA T;  4HWD A;  4F6R C;  2K5B B;  1UUS A;  3UFE A;  4V1A v;  1G8X A;  5JRC A;  2HH7 A;  3MKD A;  4MAL A;  4XBF B;  1YQ4 A;  4X62 T;  1N32 T;  5A1L A;  1WFD A;  5CA1 E;  2K9A A;  5C3J A;  5J1G A;  4CXY A;  3P4S A;  2C5J A;  4GK5 E;  2IAK A;  4HEA A;  4EED A;  3KV9 A;  3TLU A;  2Q9Q A;  4TNV A;  2C5I T;  1CHU A;  3ZST A;  4QX8 B;  3UTK A;  5DQV A;  3PDY A;  2XAH B;  2Y48 B;  4TWH A;  4AKG A;  4OK0 A;  3TKL B;  2LEH A;  3PU8 A;  4AQY T;  2SPC A;  4DV4 T;  1LVK A;  5LOV E;  5EK3 A;  3VR8 A;  4LMJ A;  1QSD A;  4OYJ A;  2KT9 A;  4BJM A;  3ZYK A;  4ZI2 D;  4IST A;  4HFH A;  5CGM A;  3C51 A;  2VUR A;  1R8I A;  2CBI A;  3RKG A;  3JAE A;  5JRC B;  2H7O A;  4GIW A;  2MPK A;  3LK4 2;  2WDR A;  5AFU L;  4OHF A;  2LSK A;  2ES0 A;  4PFP A;  3TLT A;  2W61 A;  3CML A;  3CQC B;  3ZMT B;  3ONX A;  3UUB A;  2V8S V;  3PUZ F;  3GMI A;  1EZ3 A;  1WRD A;  2PBI A;  2C5K T;  1HS7 A;  3LBX A;  5HEG A;  5FL1 A;  1DU2 A;  2X66 A;  4CZZ B;  3J7Y q;  2X0L B;  2MBG A;  2NR4 A;  3B57 A;  1UGO A;  3ZC1 A;  2XQA A;  1YKH B;  4PFO A;  4IE4 A;  5HCM A;  3K3O A;  2D0U A;  4QH1 A;  2QRX A;  5HEU A;  1IBL T;  4XZC A;  4A98 A;  3PUS A;  2E8I A;  2MOZ A;  3H3M A;  1FMW A;  4HE8 A;  2DWK A;  3PJA A;  4JEH B;  2LSG A;  2HPJ A;  2L3L A;  3Q5D A;  1UX4 A;  4IE5 A;  4GYS A;  5F5W A;  4ILC A;  2V7I A;  5L3C B;  2P9B A;  1XMO T;  5C8Y E;  5CFB A;  3CQX C;  3I1A A;  1U5P A;  3Q2M A;  1KFY A;  4YJ2 E;  3LBX B;  1MIV A;  3EI0 A;  5AQP B;  3HKC E;  1NEN A;  2VL0 A;  2KZ7 B;  3U78 A;  5CB4 E;  4XAX B;  4ILA A;  3ONJ A;  5JDH A;  4EYY R;  4DR1 T;  4JEU B;  3B5M A;  5HYA A;  5FXZ A;  3NKZ A;  2WP9 A;  2DI4 A;  2H89 A;  3VKG A;  2WB5 A;  2JMH A;  2V7J A;  3MA9 A;  2XTL A;  4X64 T;  4L0R A;  1KNZ A;  4UXN B;  2XAG B;  1M7K A;  2ACZ A;  3F57 A;  2UXD T;  3NZQ A;  4JI1 T;  3UQ4 A;  2BBH A;  2XAQ B;  2X9W A;  4M1P A;  4IL9 A;  1ZEE A;  3B13 A;  2EHO D;  2FJE A;  2OLT A;  4U7Y A;  3UT5 E;  2H7V C;  4IHJ E;  2V6Y A;  1VCT A;  4WBN E;  4KI0 F;  3P8C D;  2KWH A;  5E0O A;  5AQR B;  2X68 A;  3CKD A;  2XAJ B;  3MXZ A;  4UVA B;  1HG5 A;  2LSJ A;  1XNQ T;  4JI5 T;  4JV5 T;  2LOP A;  4HWC A;  5LHI B;  2YEV C;  1L0V A;  3ZYM A;  4H9S E;  1OWA A;  1US7 B;  3JAD A;  3C4Z A;  4LF8 T;  3W15 B;  5LHH B;  3HL6 A;  4N78 D;  4JLE A;  1VOM A;  2VWA A;  2V6X A;  1UCU A;  1KNR A;  3N9M A;  3C98 B;  3U3I A;  3AEE A;  1SE7 A;  2WDQ A;  4PK4 A;  2NTX A;  3NRY A;  4AIS A;  3CPZ A;  5LHG B;  4L9I A;  2C0S A;  1KF6 A;  2BS2 A;  3AEB A;  4U7I A;  1N36 T;  2V6Y B;  3QNU A;  4B3M T;  5C2T A;  3EUH A;  2VKJ A;  5LYJ E;  4UVB B;  3CK6 A;  4O4I E;  2XPK A;  2HN1 A;  4IE7 A;  3RC8 A;  3ZYL A;  1BR4 A;  2JQH A;  1HTJ F;  5FXV A;  4ZXL A;  1ZP0 A;  4O2A E;  4O4H E;  5JDG A;  4G63 A;  1YD8 G;  4P09 A;  4ILB A;  4JUY A;  5BR8 T;  3AE7 A;  2JQQ A;  1HFA A;  2XQ6 A;  3OYX A;  1FEW A;  3CX7 B;  2LKH A;  5LJM A;  1CUN A;  2ZMA A;  2JQK A;  3NVO A;  2VQF T;  2YDQ A;  5JR9 A;  4TUY E;  4U2Z A;  1E1H B;  3J9X 1;  4MFR A;  2EHO B;  2D5U A;  2WU2 A;  2YDS A;  2HHH T;  3DP7 A;  4O2B E;  3SOL A;  2XM2 A;  1H7C A;  3AE9 A;  1E7P A;  4HFV A;  1SA0 E;  1SUM B;  1LKX A;  3RQU A;  2WZH A;  4JI3 T;  3ONL C;  4L5G A;  4IDN A;  4EEB A;  4DR4 T;  2IC9 A;  4EIW A;  1WYC A;  5AQG B;  2KMF A;  1J5E T;  1OXZ A;  4AQG A;  4IGU A;  3FBZ A;  4YJ3 E;  1MMG A;  4X65 T;  1Y01 A;  3PJA J;  4FI5 A;  4HFC A;  3SFD A;  3KV6 A;  4PJL A;  3AEC A;  1MNE A;  4ZI7 E;  2QGS A;  3NRX A;  2OA5 A;  4C90 A;  2D2S A;  3S4U A;  2Y8D A;  4EB6 E;  3OVU A;  3HI2 A;  2V5C A;  2DLR A;  5DQW A;  2V5D A;  3FXE B;  4JI4 T;  3SWH A;  1WR0 A;  2CCQ A;  4K0K T;  3ZN1 B;  5JR9 B;  1HG2 A;  4X1I E;  4DR7 T;  3RLF F;  3E0Z A;  3L39 A;  3I9W A;  4H9R C;  1IJ5 A;  1FIO A;  5HCJ A;  1Y64 B;  3SS1 A;  2ZM8 A;  5LGT B;  4U74 A;  5L3G B;  1XDP A;  2VVS A;  2XAF B;  2X9X A;  4DBR A;  4TWD A;  4HWF A;  5JTG A;  2YU2 A;  2HPL A;  1UK5 A;  2BVL A;  3AA7 B;  3RIU A;  3F31 A;  5JDN A;  5F3J A;  2E2A A;  1W0B A;  4LF9 T;  4A97 A;  1KNP A;  3UUL A;  3LK3 B;  5EZY E;  4DR6 T;  2X9Y A;  3KDS E;  4QXB B;  4H63 V;  2X0H A;  5HAX A;  4GOU A;  4GK0 E;  2BKN A;  4U72 A;  5AQL B;  2BS4 A;  4JI2 T;  4UIG A;  4KUM B;  2XQ8 A;  5FP3 A;  1T98 A;  1WYB A;  2V26 A;  2JRK A;  3AA6 B;  2LSI A;  3CX6 B;  3M3Z B;  3K8P C;  5AQM B;  1HF8 A;  2N1G A;  3QOF A;  4JI6 T;  4H9N C;  3R6N A;  3OPC A;  2W2U A;  3UUX B;  3AXJ A;  5L3F B;  4QX7 B;  1D0Z A;  1HX1 B;  4AKI A;  4GKJ T;  2VQE T;  3ZCJ A;  2LSY A;  3PU3 A;  4DVD A;  5IYZ E;  2CM0 A;  4WBO A;  3PUR A;  3K3N A;  2WSS V;  4H9O C;  3RYH E;  2UU9 T;  2IW5 B;  3RC3 A;  3RYF E;  2CWO A;  3FZF B;  5LG4 A;  3ZT5 A;  3RYI E;  1W0A A;  4YTP A;  3UU5 A;  1D0X A;  5KMG P;  3AEF A;  1UUR A;  2WMO A;  2UXN B;  3HKD E;  1VRB A;  3VR9 A;  4UEM A;  3T1H T;  4TN7 B;  3QK6 A;  5FY1 A;  2E9X D;  4YSX A;  2VK9 A;  3L3P A;  3C50 A;  3AE2 A;  1OED A;  2Y6X A;  5HXS A;  3AXJ B;  5HEJ A;  4YHH T;  2MTQ A;  4ZI3 C;  2CLY B;  2XQ7 A;  3BQL A;  3C4X A;  2WAU A;  4I43 B;  4HKA A;  5LP6 E;  1V9D A;  2M6B A;  3ZT6 A;  5AQS B;  2WDV A;  2CRB A;  5HXH A;  2A9U A;  2YOE A;  2LHR A;  2XSA A;  5LMU T;  4KHP T;  2BDE A;  2KLQ A;  1IJ6 A;  3IBP A;  1AJ3 A;  1NEK A;  2BG9 A;  5AQQ B;  3ESL A;  2I59 A;  5HXC A;  2BZB A;  3L09 A;  3RKO A;  4DV2 T;  5IHY A;  2Q9Q C;  3LG7 A;  4OYK A;  5FYM A;  3EDU A;  4KX6 A;  4HFI A;  2H88 A;  5LG3 A;  2MAW A;  4IT4 A;  1M62 A;  1OED B;  1FJG T;  2E9X A;  4KBM B;  4YTN A;  2WWU A;  3WI3 A;  2W67 A;  3CX8 B;  3ANW A;  2V7M A;  3ZC0 A;  4B3R T;  3UU4 A;  4ISS A;  5LJN A;  2UUB T;  3PUX F;  4CXX A;  1D1A A;  4P1N A;  5FXX A;  5L47 A;  3RPU A;  4Q25 A;  5JDQ A;  3Q5X A;  1I94 T;  1KK7 A;  2L9Q A;  3OBV E;  4ILU A;  3PUQ A;  4A5X A;  2V1D B;  3QUJ A;  4H9Q C;  2CBJ A;  2A72 A;  2LE8 A;  4HTE A;  2V7K A;  2BG9 B;  5CA0 E;  1U4Q A;  2YK0 A;  1XMQ T;  3UUN A;  4EOZ B;  3PUW F;  2PTF A;  4IE0 A;  2XSB A;  4DND A;  2UXC T;  3CQG B;  3SFE A;  3TLV A;  5FXW A;  2M67 A;  1XWM A;  4JYA T;  1W9R A;  1X79 A;  3AEA A;  2E9X B;  2JJ9 A;  3KBU A;  5JH7 E;  3CVR A;  2D0T A;  2J1D G;  2HN2 A;  5JQG E;  3BQI A;  2FJA A;  3ANW B;  4UV9 B;  2F4V T;  1ZV4 X;  2LLY A;  3ZMV B;  4EXT A;  4IE6 A;  3RX6 A;  1G73 A;  3NWI A;  2BKP A;  2J47 A;  3N5L A;  5KXJ A;  4KMC A;  5FY0 A;  4ZI2 C;  3D0T A;  2X51 A;  2W63 A;  1VCS A;  4HWI B;  5GON E;  4AKH A;  2BS3 A;  5FMN A;  2XQ5 A;  4U33 A;  3JC6 D;  5LMN T;  4COF A;  2CMR A;  4YSZ A;  2NW7 A;  2E5L T;  4DMW A;  4LFB T;  4QXH B;  1LRZ A;  3RH3 A;  4HFD A;  2JMK A;  3EVY A;  2W62 A;  5AQO B;  2DWG A;  5FKY A;  5FY7 A;  3PE0 A;  2J4G A;  1N34 T;  3KV5 A;  1FMV A;  2EHO A;  3AE5 A;  3AVR A;  3RQW A;  4QH4 A;  3AAA B;  3P4W A;  5DAB A;  4NUU A;  1D0Y A;  3AE6 A;  3N9N A;  3E22 E;  4GYR A;  3FZL B;  2WZI A;  2VB6 A;  5IWA T;  1NWM X;  2RP4 A;  5LB7 B;  4I0U A;  3ABV A;  1I6Z A;  3AA1 B;  4CI3 B;  2CWY A;  4E7Z A;  2G0U A;  2ZM6 T;  3AAE B;  2WCA A;  4PNI A;  3A7M A;  4ZS3 A;  3T1Y T;  5AQN B;  2XAS B;  3WAK A;  5LGU B;  4ZZB A;  4IDZ A;  4QH5 A;  3SRZ A;  4MLK A;  1MMA A;  2ZM2 A;  4AQF A;  3GN5 A;  1LVF A;  3AE8 A;  5AQH B;  1YW0 A;  2ACX A;  4UVC B;  4HWH A;  2XM1 A;  4WZX A;  1YQ3 A;  1GQE A;  2NP9 A;  4PJJ A;  5IUX A;  1IBK T;  3N9Q A;  1OED E;  3RF1 A;  3RGL A;  2NTY A;  2I0M A;  1HNZ T;  3LDQ B;  4IDO A;  5J0Z A;  3AAI A;  4ADZ A;  4AKR B;  3ETU A;  4DUZ T;  4U3C A;  3EAB A;  2RPA A;  3M65 A;  3KFW X;  5JRE A;  4PJN A;  3UU3 A;  5ABH A;  2CA5 A;  2ZLY A;  4TV8 E;  2KIN B;  3N2G E;  4PJM A;  2CHO A;  4OX9 T;  3JAF A;  1T7S A;  1QUU A;  4DV7 T;  2QYW A;  3UU6 A;  3ZEF B;  2IUB A;  5L4H A;  1BR0 A;  4TV9 E;  1HR0 T;  5CJ5 A;  3VU7 H;  4WW0 A;  3DJB A;  2YKS A;  4UEL A;  4YLH A;  4Z90 A;  1NAF A;  3AE1 A;  1HNW T;  3EHZ A;  1S35 A;  3IHR A;  3GN5 B;  3KVA A;  3AB3 B;  2VKD A;  4NXM T;  5KX5 E;  5AQK B;  1O3X A;  1W09 A;  1XZY A;  2J62 A;  1UX5 A;  2PFV A;  4KP3 C;  3C4W A;  2FBW A;  3QB5 A;  4I50 E;  4BJN A;  2XQ4 A;  1MND A;  3WAJ A;  5EK2 A;  4QKN A;  5AQT B;  2M6I A;  3MJX A;  3VRB A;  2I6H A;  2VAS A;  5ABF A;  4EZH A;  2W66 A;  4DMV A;  2K3W A;  3L8R A;  2Q9Q D;  3HKB E;  5TAO A;  3DTO A;  3K1S A;  4P0A A;  3O1H A;  3OYZ A;  4JI8 T;  5L3E B;  2WS3 A;  2IC6 A;  5JR9 C;  3A5X A;  2NOX A;  2E5V A;  2BVM A;  3GWH A;  2PG8 A;  1IAP A;  3KV4 A;  2JPF A;  3OTO T;  2YN6 A;  3KIN B;  3ZMS B;  2OV9 A;  4NXN T;  3PUY F;  3K3Q C;  2CXF A;  4EV6 A;  3HA4 A;  4B3T T;  5HXR A;  2B1E A;  2FUP A;  4AIU A;  4F8H A;  2NW9 A;  2KXP B;  3BQK A;  3VHL A;  2VVN A;  4J2C A;  2ODU A;  3TLS A;  2IML A;  4PAG A;  5ABF B;  2CXD A;  2PJQ A;  4O8S A;  3TLW A;  5ETW A;  4NIQ A;  2DCF A;  3A8Y C;  2X9H A;  3PUG A;  4NUV A;  5LCY A;  1WCR A;  3O1I A;  1WLX A;  1XNR T;  2XZE A;  5HXE A;  3UQ7 A;  1ZHC A;  4LF5 T;  5ABE A;  2LT3 A;  4IL4 A;  3R84 B;  4HFB A;  1QLB A;  5FVL A;  2WWV A;  3UUM A;  4LML A;  3F2E A;  4ZOL E;  1HCI A;  3KBT A;  4YFS A;  4QXC B;  2BKO A;  3AE3 A;  4HFE A;  2XQ3 A;  3MAC A;  4Z8X A;  3RIU C;  3T8O A;  5JVD E;  3UU8 A;  5EK4 A;  4X20 E;  5ADX L;  2XHE B;  2LOS A;  2KSR A;  1WR6 A;  2WU5 A;  3LFM A;  2X67 A;  4QWN B;  5AQI B;  3AA0 B;  3ZCI A;  4ASK A;  2CPT A;  3LSV A;  4CI2 B;  3H3A A;  1XDO A;  2Q9Q B;  4FJO A;  3QC9 A;  4O4L E;  4YTM A;  5J2U E;  3RI5 A;  3ETV A;  4DV3 T;  4WYV A;  2ODV A;  4YSY A;  5AQF B;  5FL0 A;  2NW8 A;  3I0Q A;  3GA8 A;  2VKO A;  2VKH A;  4U31 A;  5DJQ C;  3HKE E;  3N9O A;  3ZMZ B;  3IA3 A;  4AI6 A;  5LA6 E;  5H6R B;  4C91 A;  5FVK A;  3PUA A;  3P4Q A;  3JCF A;  4CN1 A;  2CLY C;  2FJD A;  4TX5 A;  4B6X A;  4UF0 A;  3MZK B;  4TWF A;  3ZSS A;  2CXL A;  4DBQ A;  5L2L A;  2RA1 A;  4X1K E;  2LRK A;  5F8P A;  3CWZ B;  3ZN0 B;  4ZHQ E;  5AQU B;  1JNZ A;  2K48 A;  1MIW A;  1JNR A;  5M4Y A;  4QHO A;  3MK7 C;  4H9P C;  1MMD A;  3LK2 B;  4LMK A;  3Q9D A;  4CN4 A;  4DV0 T;  4PK5 A;  3BK9 A;  4YXD A;  1HX8 A;  1ZKE A;  3RIF A;  4A56 A;  3V5U A;  2VL8 A;  3O9X A;  2LHN A;  2KWI B;  2XY8 B;  5L4E A;  4KHZ F;  4IIJ E;  4IDQ A;  1MMN A;  4U2Y A;  5LBQ B;  4ERR A;  4YHJ A;  2Z6E A;  2LRL A;  3FZH B;  5HEH A;  1OED C;  1B7T A;  2ZM0 A;  5KDM C;  2BBJ A;  4X5T A;  3IF8 B;  2R6G F;  2XQ9 A;  4PW8 A;  4DR2 T;  4TNW A;  5L3D B;  3EDV A;  4UF0 B;  1KEY A;  2DL1 A;  2WBL A;  5L3B B;  4MBQ A;  1BR1 A;  4ZEY A;  4LF4 T;  2W0G A;  2XQY A;  2JIW A;  2BG9 C;  5HEO A;  3ZJ1 A;  4DO0 A;  3G06 A;  1SHZ C;  3PV0 F;  4LF7 T;  1ZOY A;  3FXD B;  1Z8U A;  3C64 A;  2CEA A;  1J5W A;  2DHR A;  2A2F X;  1MIY A;  1E2A A;  5LXT E;  1D1B A;  2E9X C;  2LKG A;  3FZM B;  2W4X A;  2K24 A;  3N2K E;  4YT0 A;  2WMN A;  5FNV E;  2IDO B;  4I4T E;  3P4R A;  3ZMU B;  1J1J A;  3P4P A;  3EAM A;  5HWX A; 
#chains in the Genus database with same CATH homology
 2UU9 T;  4DUY T;  4X66 T;  4JI7 T;  2VQF T;  4DV3 T;  4NXM T;  4DR2 T;  1IBM T;  4LFA T;  2F4V T;  2UUA T;  2ZM6 T;  4DR3 T;  3T1Y T;  4DR1 T;  1FJG T;  2HHH T;  2UUC T;  4JI0 T;  4LF9 T;  4X64 T;  4X62 T;  3T1H T;  1N32 T;  4B3R T;  4LF4 T;  1XNR T;  2UUB T;  4DR6 T;  5LMN T;  4LF5 T;  2UXB T;  1N36 T;  1IBK T;  4JI3 T;  2E5L T;  2UXD T;  4B3M T;  4LFB T;  4JI1 T;  4DV6 T;  1I94 T;  4DR4 T;  4DV5 T;  4LFC T;  4LF7 T;  1HNZ T;  1J5E T;  4YY3 T;  4JI8 T;  4YHH T;  4JI2 T;  4DUZ T;  4DV1 T;  4X65 T;  4LF8 T;  4B3S T;  4LF6 T;  1N34 T;  4JI6 T;  1XMQ T;  1IBL T;  4DV0 T;  4GKK T;  3OTO T;  4AQY T;  4OX9 T;  4DV7 T;  4JI4 T;  4DV4 T;  4DR5 T;  2UXC T;  4NXN T;  4K0K T;  5LMU T;  4KHP T;  1N33 T;  4GKJ T;  1HR0 T;  4DR7 T;  5BR8 T;  2VQE T;  4JYA T;  1XNQ T;  4JI5 T;  1HNX T;  4B3T T;  4JV5 T;  1XMO T;  5IWA T;  1HNW T;  4DV2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...