4GKKT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4gkkT00
5BR8T 1HNWT 4DR5T 4DV3T 2E5LT 1J5ET 2UUCT 2UXCT 1N32T 5IWAT 1XNRT 4YY3T 2VQFT 4JI6T 4DR3T 2UUAT 3OTOT 2UU9T 4LFAT 4B3TT 4LF8T 4DV2T 1HR0T 4JI0T 4LF7T 4B3MT 4DR7T 4DUYT 4LFCT 2VQET 4NXNT 4JYAT 4DV6T 1N33T 4JI7T 1IBLT 4YHHT 4AQYT 1HNZT 4JI4T 4LF6T 4X65T 4DR2T 4JI3T 4X64T 4DR1T 4B3ST 4DR6T 4LFBT 5LMNT 1N36T 2ZM6T 4DV5T 4JI2T 4JI5T 5LMUT 4LF5T 1FJGT 4DV4T 4GKKT 4DV0T 1N34T 4K0KT 2UXDT 4X66T 2UUBT 4NXMT 1HNXT 1IBKT 4LF4T 4DV7T 4JI1T 4DUZT 2F4VT 4X62T 3T1HT 4KHPT 1XMOT 4DV1T 4OX9T 4DR4T 4JI8T 1XNQT 1IBMT 4B3RT 2HHHT 1XMQT 2UXBT 1I94T 4LF9T 3T1YT 4GKJT 4JV5T
chains in the Genus database with same CATH superfamily
4BA9A 3RYHE 2BS3A 2Z6EA 5JR9A 3VKGA 2JJ9A 4UXNB 3P8CD 3W15B 3AEBA 2WCAA 3EVYA 2CM0A 2VQFT 1WRDA 4TUYE 3Q2MA 3TLTA 1B7TA 3NVOA 5IUXA 1W0AA 5IYZE 1OWAA 3Q5EA 5FL1A 3AE6A 3CQCB 3H3MA 4DMVA 2MAWA 3NKZA 5FXWA 3WAKA 4JI4T 1YW0A 2D0UA 3I9WA 1M7KA 3R84B 3RIAA 2D9DA 5LMUT 1OEDB 4IE0A 3P7IA 4IDNA 3MZKB 5CFBA 2MTQA 2X67A 1XMOT 4G2AA 4BAYB 3PJAA 4H9OC 4O2AE 2MPKA 3RH3A 2XQAA 3ZMZB 4U72A 5ABGA 2UXBT 3OJAA 4QXCB 2C5JA 1ZKEA 2N2NA 5FVLA 2CXFA 2WDQA 3ABVA 3RC3A 5ABEA 2A2FX 1IJ5A 3BQIA 4ISTA 1OXZA 3AE5A 3RQWA 2WS3A 1IZNB 3LK42 4XAXB 1XZYA 4TZ4C 4ZOLE 4DUYT 2WWUA 4NXNT 4WYVA 2E5VA 4WW0A 4YHJA 5JH7E 3J7Yq 1YD8G 4O4JE 3UFGA 4X65T 5HEGA 4IL9A 4ZEYA 3NZQA 5HEUA 2LJLA 3RPUA 2IUBA 4EZ4A 3K1SA 4A97A 3CMLA 2WMOA 3AA0B 2VK9A 2HN2A 2F4VT 4KP3C 4X62T 3NRYA 2PTFA 2YOEA 4I50E 3LFMA 1W09A 3UU6A 3UULA 4YJ2E 4HTEA 5AQHB 4B3RT 3N9MA 4ASKA 2XAFB 4QXBB 4QX7B 2ODUA 4QX8B 1UUSA 1L0VA 1YXRA 3ZN0B 4UV8B 4HWCA 2FJBA 2UXCT 4B6XA 3IBPA 3AAAB 5JDFA 3F57A 2ACXA 5LJNA 4AKHA 4OYKA 5J0ZA 3JADA 2LOSA 2LSJA 4EV6A 5HCMA 2C0SA 2V8SV 3E08A 4FI5A 5J2UE 5JDNA 3AVRA 3UQ4A 4IDPA 5DQWA 4LF6T 3WAJA 2B76A 4DR2T 3CPZA 2E9XD 3K8PC 4ZXLA 2LRKA 2PBIA 5HEHA 1EZ3A 3RIFA 1UX4A 5FVKA 4TNWA 2WBLA 2XQ3A 4CN4A 2NW7A 2X9WA 2CA5A 2QGSA 3K3NA 4EAHA 3PUVF 2V7IA 2LSGA 4LF4T 1FMVA 4HWFA 3N2OA 4CXWA 4DR4T 5E0OA 4EEDA 4EYYR 3HKBE 2LT3A 3QK6A 3ZN1B 3ANWA 4WBNE 2NOXA 2SPCA 4XBFB 2N9DA 1W0BA 3P4QA 3MKDA 2XAJB 2NW8A 2XAGB 3AE3A 2V26A 4OFZA 5LBQB 5JRCA 2I59A 4TN7B 1ZV4X 3PDYA 2VB6A 2LKGA 2Q9QC 4HGAA 4AQFC 1YQ4A 2CLYC 4MBQA 3ZMVB 5HWXA 5LNKA 4PK4A 2CWOA 4HE8A 2V6YA 5JDHA 1HFAA 5LG3A 3N9NA 5CJ5A 1D0XA 2EHOA 2FBWA 2Q9QB 4CI2B 3GMIA 3AE4A 4X64T 3HKEE 3LBXA 3RGLA 2JIWA 4LFBT 1N36T 2Y48B 3KV6A 2W63A 3CVRA 2CLYB 5FYMA 4DV5T 2FJEA 4JI5T 3RRCA 2K5BB 4GKKT 5LGNB 2YKSA 3ZCIA 4DMWA 2WMNA 5ADXL 1XWMA 1D0YA 1SA0E 2YU1A 3DTOA 4O8SA 3AA1B 5LGUB 2BG9C 1CUNA 4I0UA 2NR4A 3RYIE 3V5SA 3O9XA 4AIUA 3ETUA 4CXYA 3ZT5A 4GOUA 4DNDA 3VHLA 2XTLA 3P4WA 3KV4A 4Q25A 4BJNA 3ZC0A 3H3AA 4MALA 1QLBA 1HG2A 1NEKA 3EABA 3LG7A 4DIDB 5EK2A 5CA1E 1MMGA 3FB2A 4JI0T 4B3MT 1WR6A 3KDSE 4AKGA 5L47A 2VQET 2XSBA 3N9OA 3OPCA 3ZCJA 2JQ9A 2DLRA 4U2ZA 4U2YA 5AQSB 5JREA 5ABHA 2VL8A 1NENA 2XQYA 3FBLA 4DV0T 2NTYA 3LK2B 3IHRA 1XDPA 4ADZA 2C5IT 2YDSA 5EK3A 2YU2A 3LDQB 2HHHT 4U7IA 2VKDA 2CBIA 4UF0B 3CKDA 5HAXA 4LF9T 4H9RC 3AEEA 5FP3A 3DJBA 3EDVA 4JV5T 2UXXB 2VKOA 3KFWX 1VCSA 2QA7A 4DV3T 3HA4A 2KLQA 5JDQA 3H37A 3Q9DA 2WSSV 3ETVA 2WP9A 2OV9A 5HXEA 4AISA 3MXZA 3PTRB 3RIUC 2J1DG 3HR0A 2UU9T 4LFAT 1E7PA 4PJJA 2BBJA 3RQUA 2P9BA 3EI0A 5GONE 4ANJA 3O1HA 4EZHA 2RPAA 3C50A 5LYJE 4PK5A 3D0TA 3ZMSB 3TLSA 3UQ7A 5AQKB 3AA6B 4COFA 2JPFA 2K24A 1OEDE 1T8BA 3UUMA 1D1CA 2ZM6T 3ZMUB 2AXDS 4KBMB 2J62A 1OEDA 4X1IE 4JI2T 4LF5T 4IDOA 1WLXA 4OYJA 4GK5E 5JDLA 5KDMC 3AEAA 3Q5XA 3RYFE 4DUZT 2E9XC 3FXEB 3TLUA 4EB6E 4EYUA 5FY7A 4KMCA 1W9RA 2XM1A 3ZSTA 3UU8A 4IREA 3T1YT 3QC9A 4P0AA 5L3BB 2ZMAA 5BR8T 5FY1A 2Y8DA 4UVBB 4ZI2D 4ZI7E 4P0BA 3KVBA 2E9XB 3P4SA 4I43B 3FXDB 3OTOT 3LJCA 4V1Av 1LRZA 1NWMX 3M65A 4BJMA 4H9SE 5HWYA 3O1IA 3OYXA 2IC6A 4AQGA 1MMNA 3PUAA 3HKDE 3CQGB 2OA5A 1S35A 4H9PC 3SFDA 2XQ9A 4HWHA 1HG5A 5L3GB 2CXLA 1US7B 4P09A 5AQJB 4PJNA 5C8YE 4PFPA 3FZFB 2W0GA 5AFUL 3NWIA 3BQLA 3AAEB 5EK4A 4WNKA 3BK9A 3M3ZB 1LVFA 1KNRA 2QVAA 2IHR1 2XAQB 4PK6A 3LSVA 3PUZF 2W2UA 3OBVE 3N9LA 4DBQA 5HXSA 5HEOA 3PUSA 3K3QC 4DO0A 3FZMB 3KBUA 2YEVC 3DP7A 3HKCE 4IHJE 4TWDA 2KSRA 2KZ7B 3SS1A 1MIVA 4X5TA 4X1KE 1HF8A 3PV0F 4U3CA 5BMVE 3FBZA 3KINB 4HFBA 4TV9E 4YY3T 2W4XA 5C2TA 2CCQA 2FUPA 2J4GA 3PU8A 5AQGB 2H7OA 4L5GA 2BVLA 4PFOA 2X51A 1KFYA 1UX5A 5L3EB 3PURA 1HR0T 4P1NA 3FZHB 1YQ3A 3MK7C 4A5XA 3PUGA 4L0RA 4KUMB 1MMAA 3ZT7A 4PAGA 5KXJA 1WCRA 1ZEEA 2L3LA 3ZKRA 4O4LE 3A8YC 2X9HA 1UGOA 2H89A 2DCFA 5J2TE 3O4XE 1MNDA 2WDRA 4DV4T 3PUWF 3ZLIA 3MJXA 2NW9A 2KNDA 2XSAA 2CXDA 5LB7B 4DV7T 2NP9A 4CN6A 4NPPA 4GYSA 2CRBA 1SHZC 1ZOYA 3RKOA 1HX1B 3CX7B 1XMQT 1MMDA 4MLKA 3CIRA 1IAPA 3OKQA 1BR4A 3LK3B 3OVUA 1J5WA 4ERRA 1HNWT 4HWIB 4ILCA 4DR5T 3P4RA 1MIWA 2UUCT 4PW8A 4IGUA 2E2AA 5LCYA 1VOMA 1UCUA 3PE0A 4H9NC 4QXHB 5LA6E 3T8OA 4UELA 1Y01A 4LF7T 1BR0A 1FIOA 5J1GA 3L3PA 3IF8B 3PUYF 5JDGA 4IDQA 2IW5B 4LMKA 3SFEA 4KHZF 2IIUA 2UXNB 2A9UA 3GWHA 3ZJ1A 2KWIB 5L2LA 2Q9QA 5ABFB 4AQFA 4ZS2A 4QKNA 2CBJA 3QB5K 2LKHA 4IT4A 4ILAA 2X0YA 3B57A 2FJAA 4IIJE 4JEUB 2MOZA 2ZM0A 2WZHA 2XHEB 1R8IA 2KXPB 4NXMT 3NBXX 3AECA 2CEAA 1HCIA 2PG8A 3OYZA 2JQQA 2E8IA 3ESLA 4KHPT 4J2CA 3CX6B 5L3FB 3CQXC 1O3XA 3AE1A 2B1EA 3AXJA 3PUQA 4EOZB 1G73A 5AQTB 2W00A 2JRKA 4YXDA 3VKHA 2ODVA 1WR0A 4M1PA 2A72A 2WZIA 4CXXA 1JNRA 1SE7A 2RA1A 1S94A 4ZI3D 2E5LT 1CHUA 5IWAT 2NTXA 4DR3T 1WYCA 2IMLA 3CX8B 3I0OA 5LP6E 4KX6A 5LXTE 1MIYA 3RF1A 3LBXB 4ILUA 3C4WA 5L4HA 3KV9A 3AAIA 4C90A 4ZI2C 2BG9B 1KF6A 5DQVA 2XQ8A 1V9DA 2H7VC 2VL0A 3SOLA 4UR9A 3G06A 2R6GF 1MNEA 5DJQC 2G0UA 4PJLA 4HFDA 4CI1B 3C51A 4WBOA 2XQ7A 4IE4A 5HEJA 3Q5WA 2W66A 4K0KT 4LMJA 2H88A 3GN5B 4UEMA 3MACA 3AE9A 5DABA 3E22E 2KT9A 4E7ZA 2ES0A 2W61A 1UK5A 3IA3A 2DWGA 1XNQT 2X9XA 1IBMT 2HPJA 4DBRA 2GK9A 2LHRA 3PJAJ 5JDMA 1I6ZA 4H63V 5L3CB 2H3RA 3I9YA 1BR2A 2HN1A 4O2BE 2PFVA 2ZM8A 2VWAA 2WU2A 2V7JA 4YTMA 4HN9A 4I55E 1J5ET 4AKIA 4HFEA 3ZSSA 4JI6T 1T7SA 3ZYKA 2UUAT 3QOFA 2XM2A 5JVDE 4YSZA 2LM2A 5CA0E 2VKJA 3R6NA 4IL4A 4DR7T 4OK0A 5JTGA 3RHWA 3S4UA 3RI5A 4ZS3A 5JQGE 2IDOB 1J1JA 2X68A 4JUYA 2YK0A 4AXPA 3C64A 2V7KA 4B3ST 1FMWA 5LMNT 5IHYA 5AQFB 4TWHA 3ZPOA 2FJDA 4CQIA 1HX8A 4NIQA 2LRLA 2WQYA 1M62A 2CHNA 2M6BA 2LLYA 3AB3B 3BQKA 4CN1A 2BZBA 3N2GE 4X66T 5JR9C 2YDRA 4HFCA 2HPLA 3UFEA 3UUNA 4YT0A 3NRXA 4DV1T 2CE7A 2EHOD 2WWVA 2RP4A 5AQPB 3F2EA 3L39A 2ACZA 4DVDA 2M6IA 5LHGB 2BVMA 3ZYLA 3UUBA 2XUEA 5AQRB 5AQMB 3P50A 5LJMA 2HH7A 4IDZA 4UIGA 1OEDC 4X1YE 5JR9B 2E9XA 3KV5A 5CGMA 1N32T 4U31A 4XZCA 4TNVA 4YFSA 3RC8A 4YTPA 2KMFA 2ZLYA 2WU5A 4Z90A 3AVSA 3UT5E 1JNZA 1Y64B 3AEFA 3C98B 1LVKA 4JI7T 4YHHT 4AKLA 1SUMB 4AI6A 2QYWA 1YKEB 2DNXA 5HXCA 2WM9A 2Y6XA 1HTJF 2DL1A 3VU7H 5FL0A 2XASB 3V5UA 5FKYA 1LKXA 4JLEA 4Z8XA 4K0UA 3IEEA 3A5XA 3EHZA 5AQIB 1VRBA 2VURA 2BBHA 3HI2A 4JBWF 2QRXA 2NWBA 3AE7A 2J47A 4C91A 2MYSA 4U74A 4IE5A 2XQ4A 4ZZCA 3ZJ2A 2X0HA 3Q5DA 5FXVA 2LSYA 2JQHA 3TLVA 2PJQA 3KBTA 2M67A 4EXTA 5M4YA 1WYBA 1U4QA 2XJ7A 1VCTA 2BS4A 2WB5A 4B3TT 4LF8T 2XZEA 2I6HA 2XAHB 5AQVB 1D0ZA 1WFDA 3PUXF 3VRBA 3B13A 3ZMTB 1G8XA 4ZI3C 4EIWA 4DV6T 5F5WA 3U3IA 3RX6A 2V6XA 1IBLT 3UTKA 2JMKA 3HL6A 4QWNB 2WAUA 3JC6C 5AQUB 2V5DA 4ILBA 1E1HB 5H6QB 2WDVA 1FJGT 2LOPA 3CWZB 4E7SA 5A1LA 2X9YA 3A7MA 3UUXB 2BDEA 2X66A 2LHNA 2CHOA 1HNXT 4F8HA 4PJMA 3EUHA 1ZHCA 5LOVE 4L9IA 5AQOB 2BKNA 2A3DA 1D1BA 5EZYE 2AE9A 2BKPA 4OX9T 3JAEA 1U5PA 2ZM2A 3ONJA 4QH4A 5FXZA 3X1DA 4JEHB 3VRAA 5KMGP 4KI0F 4WZXA 3I1AA 2K3WA 4A56A 4HFHA 2JMHA 1Z8UA 5H6RB 1YKHB 4HWDA 5FNVE 1QUUA 3AE8A 3WI3A 1X79A 4HFIA 3F31A 5F3JA 5F8PA 4G63A 4HKAA 3ZT6A 2WY2A 4F6RC 4TX5A 2VKHA 3ZC1A 1IJ6A 4AKRB 5LHIB 4JYAT 3GA8A 2MBGA 5LBMA 5ABFA 2YDQA 1KNPA 5ETWA 3ONLC 1KEYA 4EGWA 1Z0PA 2IAKA 3AE2A 4MFRA 2LE8A 4U33A 4UV9B 4GIWA 4YSYA 4QH1A 4CZZB 2L8KA 3FHNA 2C5KT 4LMLA 5LHHB 1BR1A 3E0ZA 1H7CA 3C4XA 1GQEA 1N34T 2UXDT 5LGTB 4IE7A 2DHRA 2BS2A 3RKGA 2D2SA 5HCJA 4UVCB 5AQLB 5KX5E 3EDUA 3NZPA 1X9BA 3AA7B 4U7YA 2XQ5A 1D1AA 3L8RA 2I0MA 3O1JA 4EEBA 4HEAA 3N9PA 4I4TE 3ANWB 2V7LA 3P4PA 3TLWA 2LSIA 4ZZBA 3QNUA 3TKLB 5JRCB 2VASA 4ZHQE 2VVNA 3RRWA 4NUVA 5TAOA 1XNRT 2CPTA 2EHOC 4O4HE 5CB4E 2LSKA 3VR8A 5FXXA 2XY8B 2BKOA 5HXHA 4YSXA 4Z91A 3AEGA 4TWFA 2YINA 4QH5A 2CWYA 2BG9E 2DWKA 4LFCT 5FY0A 5HXRA 4OHFA 2BG9A 1FEWA 5C3JA 4X20E 2V6YB 3RYCE 2K48A 5FMNA 1N33T 2V5CA 4AQYT 4N78D 3EAMA 3K3OA 5LG4A 3JC6D 2EHOB 3N9QA 4JI3T 4DR1T 2JQKA 3JCFA 2K9AA 4HFVA 4O4IE 2D5UA 4FJOA 3AXJB 3FZLB 3GN5A 3MA9A 5AQQB 2UUBT 5L4EA 3UU3A 1QSDA 3QUJA 4CI3B 4JI1T 1UURA 4NUUA 4PNIA 3T1HT 3JAFA 1ZP0A 3AEDA 4H63H 4JI8T 2CMRA 3I0QA 1I94T 3J9X1 2W67A 4GKJT 3ZYMA 3ONXA 3KVAA 2LEHA 3C4ZA 3U78A 4UF0A 5HYAA 1AJ3A 2OLTA 3RLFF 4DV2T 2XQ6A 3SRZA 3FZKB 2V1DB 2X0LB 1KK7A 4IE6A 2IC9A 2N1GA 4GK0E 3L09A 1HNZT 1T98A 2VVSA 1NAFA 1T72A 3UU4A 4GYRA 4YLHA 4DR6T 2XPKA 4MHCA 2L9QA 4ISSA 4QHOA 4A98A 3CK6A 3UU5A 2V7MA 1E2AA 4TV8E 4H9QC 3RIUA 3N2KE 1IBKT 5AQNB 3QB5A 2W62A 1XDOA 2DI4A 4YJ3E 2KWHA 1DU2A 3N5LA 2Q9QD 4YTNA 2D0TA 2KINB 4UVAB 1KNZA 3ZEFB 5L3DB 1HS7A 3B5MA 3PU3A 3SWHA 2YN6A 3VR9A 2LM9A
chains in the Genus database with same CATH topology
5BR8T 1HNWT 4DR5T 4DV3T 2E5LT 1J5ET 2UUCT 2UXCT 1N32T 5IWAT 1XNRT 4YY3T 2VQFT 4JI6T 4DR3T 2UUAT 3OTOT 2UU9T 4LFAT 4B3TT 4LF8T 4DV2T 1HR0T 4JI0T 4LF7T 4B3MT 4DR7T 4DUYT 4LFCT 2VQET 4NXNT 4JYAT 4DV6T 1N33T 4JI7T 1IBLT 4YHHT 4AQYT 1HNZT 4JI4T 4LF6T 4X65T 4DR2T 4JI3T 4X64T 4DR1T 4B3ST 4DR6T 4LFBT 5LMNT 1N36T 2ZM6T 4DV5T 4JI2T 4JI5T 5LMUT 4LF5T 1FJGT 4DV4T 4GKKT 4DV0T 1N34T 4K0KT 2UXDT 4X66T 2UUBT 4NXMT 1HNXT 1IBKT 4LF4T 4DV7T 4JI1T 4DUZT 2F4VT 4X62T 3T1HT 4KHPT 1XMOT 4DV1T 4OX9T 4DR4T 4JI8T 1XNQT 1IBMT 4B3RT 2HHHT 1XMQT 2UXBT 1I94T 4LF9T 3T1YT 4GKJT 4JV5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 T;  1HNW T;  4DR5 T;  4DV3 T;  2E5L T;  1J5E T;  2UUC T;  2UXC T;  1N32 T;  5IWA T;  1XNR T;  4YY3 T;  2VQF T;  4JI6 T;  4DR3 T;  2UUA T;  3OTO T;  2UU9 T;  4LFA T;  4B3T T;  4LF8 T;  4DV2 T;  1HR0 T;  4JI0 T;  4LF7 T;  4B3M T;  4DR7 T;  4DUY T;  4LFC T;  2VQE T;  4NXN T;  4JYA T;  4DV6 T;  1N33 T;  4JI7 T;  1IBL T;  4YHH T;  4AQY T;  1HNZ T;  4JI4 T;  4LF6 T;  4X65 T;  4DR2 T;  4JI3 T;  4X64 T;  4DR1 T;  4B3S T;  4DR6 T;  4LFB T;  5LMN T;  1N36 T;  2ZM6 T;  4DV5 T;  4JI2 T;  4JI5 T;  5LMU T;  4LF5 T;  1FJG T;  4DV4 T;  4GKK T;  4DV0 T;  1N34 T;  4K0K T;  2UXD T;  4X66 T;  2UUB T;  4NXM T;  1HNX T;  1IBK T;  4LF4 T;  4DV7 T;  4JI1 T;  4DUZ T;  2F4V T;  4X62 T;  3T1H T;  4KHP T;  1XMO T;  4DV1 T;  4OX9 T;  4DR4 T;  4JI8 T;  1XNQ T;  1IBM T;  4B3R T;  2HHH T;  1XMQ T;  2UXB T;  1I94 T;  4LF9 T;  3T1Y T;  4GKJ T;  4JV5 T; 
#chains in the Genus database with same CATH topology
 4BA9 A;  3RYH E;  2BS3 A;  2Z6E A;  5JR9 A;  3VKG A;  2JJ9 A;  4UXN B;  3P8C D;  3W15 B;  3AEB A;  2WCA A;  3EVY A;  2CM0 A;  2VQF T;  1WRD A;  4TUY E;  3Q2M A;  3TLT A;  1B7T A;  3NVO A;  5IUX A;  1W0A A;  5IYZ E;  1OWA A;  3Q5E A;  5FL1 A;  3AE6 A;  3CQC B;  3H3M A;  4DMV A;  2MAW A;  3NKZ A;  5FXW A;  3WAK A;  4JI4 T;  1YW0 A;  2D0U A;  3I9W A;  1M7K A;  3R84 B;  3RIA A;  2D9D A;  5LMU T;  1OED B;  4IE0 A;  3P7I A;  4IDN A;  3MZK B;  5CFB A;  2MTQ A;  2X67 A;  1XMO T;  4G2A A;  4BAY B;  3PJA A;  4H9O C;  4O2A E;  2MPK A;  3RH3 A;  2XQA A;  3ZMZ B;  4U72 A;  5ABG A;  2UXB T;  3OJA A;  4QXC B;  2C5J A;  1ZKE A;  2N2N A;  5FVL A;  2CXF A;  2WDQ A;  3ABV A;  3RC3 A;  5ABE A;  2A2F X;  1IJ5 A;  3BQI A;  4IST A;  1OXZ A;  3AE5 A;  3RQW A;  2WS3 A;  1IZN B;  3LK4 2;  4XAX B;  1XZY A;  4TZ4 C;  4ZOL E;  4DUY T;  2WWU A;  4NXN T;  4WYV A;  2E5V A;  4WW0 A;  4YHJ A;  5JH7 E;  3J7Y q;  1YD8 G;  4O4J E;  3UFG A;  4X65 T;  5HEG A;  4IL9 A;  4ZEY A;  3NZQ A;  5HEU A;  2LJL A;  3RPU A;  2IUB A;  4EZ4 A;  3K1S A;  4A97 A;  3CML A;  2WMO A;  3AA0 B;  2VK9 A;  2HN2 A;  2F4V T;  4KP3 C;  4X62 T;  3NRY A;  2PTF A;  2YOE A;  4I50 E;  3LFM A;  1W09 A;  3UU6 A;  3UUL A;  4YJ2 E;  4HTE A;  5AQH B;  4B3R T;  3N9M A;  4ASK A;  2XAF B;  4QXB B;  4QX7 B;  2ODU A;  4QX8 B;  1UUS A;  1L0V A;  1YXR A;  3ZN0 B;  4UV8 B;  4HWC A;  2FJB A;  2UXC T;  4B6X A;  3IBP A;  3AAA B;  5JDF A;  3F57 A;  2ACX A;  5LJN A;  4AKH A;  4OYK A;  5J0Z A;  3JAD A;  2LOS A;  2LSJ A;  4EV6 A;  5HCM A;  2C0S A;  2V8S V;  3E08 A;  4FI5 A;  5J2U E;  5JDN A;  3AVR A;  3UQ4 A;  4IDP A;  5DQW A;  4LF6 T;  3WAJ A;  2B76 A;  4DR2 T;  3CPZ A;  2E9X D;  3K8P C;  4ZXL A;  2LRK A;  2PBI A;  5HEH A;  1EZ3 A;  3RIF A;  1UX4 A;  5FVK A;  4TNW A;  2WBL A;  2XQ3 A;  4CN4 A;  2NW7 A;  2X9W A;  2CA5 A;  2QGS A;  3K3N A;  4EAH A;  3PUV F;  2V7I A;  2LSG A;  4LF4 T;  1FMV A;  4HWF A;  3N2O A;  4CXW A;  4DR4 T;  5E0O A;  4EED A;  4EYY R;  3HKB E;  2LT3 A;  3QK6 A;  3ZN1 B;  3ANW A;  4WBN E;  2NOX A;  2SPC A;  4XBF B;  2N9D A;  1W0B A;  3P4Q A;  3MKD A;  2XAJ B;  2NW8 A;  2XAG B;  3AE3 A;  2V26 A;  4OFZ A;  5LBQ B;  5JRC A;  2I59 A;  4TN7 B;  1ZV4 X;  3PDY A;  2VB6 A;  2LKG A;  2Q9Q C;  4HGA A;  4AQF C;  1YQ4 A;  2CLY C;  4MBQ A;  3ZMV B;  5HWX A;  5LNK A;  4PK4 A;  2CWO A;  4HE8 A;  2V6Y A;  5JDH A;  1HFA A;  5LG3 A;  3N9N A;  5CJ5 A;  1D0X A;  2EHO A;  2FBW A;  2Q9Q B;  4CI2 B;  3GMI A;  3AE4 A;  4X64 T;  3HKE E;  3LBX A;  3RGL A;  2JIW A;  4LFB T;  1N36 T;  2Y48 B;  3KV6 A;  2W63 A;  3CVR A;  2CLY B;  5FYM A;  4DV5 T;  2FJE A;  4JI5 T;  3RRC A;  2K5B B;  4GKK T;  5LGN B;  2YKS A;  3ZCI A;  4DMW A;  2WMN A;  5ADX L;  1XWM A;  1D0Y A;  1SA0 E;  2YU1 A;  3DTO A;  4O8S A;  3AA1 B;  5LGU B;  2BG9 C;  1CUN A;  4I0U A;  2NR4 A;  3RYI E;  3V5S A;  3O9X A;  4AIU A;  3ETU A;  4CXY A;  3ZT5 A;  4GOU A;  4DND A;  3VHL A;  2XTL A;  3P4W A;  3KV4 A;  4Q25 A;  4BJN A;  3ZC0 A;  3H3A A;  4MAL A;  1QLB A;  1HG2 A;  1NEK A;  3EAB A;  3LG7 A;  4DID B;  5EK2 A;  5CA1 E;  1MMG A;  3FB2 A;  4JI0 T;  4B3M T;  1WR6 A;  3KDS E;  4AKG A;  5L47 A;  2VQE T;  2XSB A;  3N9O A;  3OPC A;  3ZCJ A;  2JQ9 A;  2DLR A;  4U2Z A;  4U2Y A;  5AQS B;  5JRE A;  5ABH A;  2VL8 A;  1NEN A;  2XQY A;  3FBL A;  4DV0 T;  2NTY A;  3LK2 B;  3IHR A;  1XDP A;  4ADZ A;  2C5I T;  2YDS A;  5EK3 A;  2YU2 A;  3LDQ B;  2HHH T;  4U7I A;  2VKD A;  2CBI A;  4UF0 B;  3CKD A;  5HAX A;  4LF9 T;  4H9R C;  3AEE A;  5FP3 A;  3DJB A;  3EDV A;  4JV5 T;  2UXX B;  2VKO A;  3KFW X;  1VCS A;  2QA7 A;  4DV3 T;  3HA4 A;  2KLQ A;  5JDQ A;  3H37 A;  3Q9D A;  2WSS V;  3ETV A;  2WP9 A;  2OV9 A;  5HXE A;  4AIS A;  3MXZ A;  3PTR B;  3RIU C;  2J1D G;  3HR0 A;  2UU9 T;  4LFA T;  1E7P A;  4PJJ A;  2BBJ A;  3RQU A;  2P9B A;  3EI0 A;  5GON E;  4ANJ A;  3O1H A;  4EZH A;  2RPA A;  3C50 A;  5LYJ E;  4PK5 A;  3D0T A;  3ZMS B;  3TLS A;  3UQ7 A;  5AQK B;  3AA6 B;  4COF A;  2JPF A;  2K24 A;  1OED E;  1T8B A;  3UUM A;  1D1C A;  2ZM6 T;  3ZMU B;  2AXD S;  4KBM B;  2J62 A;  1OED A;  4X1I E;  4JI2 T;  4LF5 T;  4IDO A;  1WLX A;  4OYJ A;  4GK5 E;  5JDL A;  5KDM C;  3AEA A;  3Q5X A;  3RYF E;  4DUZ T;  2E9X C;  3FXE B;  3TLU A;  4EB6 E;  4EYU A;  5FY7 A;  4KMC A;  1W9R A;  2XM1 A;  3ZST A;  3UU8 A;  4IRE A;  3T1Y T;  3QC9 A;  4P0A A;  5L3B B;  2ZMA A;  5BR8 T;  5FY1 A;  2Y8D A;  4UVB B;  4ZI2 D;  4ZI7 E;  4P0B A;  3KVB A;  2E9X B;  3P4S A;  4I43 B;  3FXD B;  3OTO T;  3LJC A;  4V1A v;  1LRZ A;  1NWM X;  3M65 A;  4BJM A;  4H9S E;  5HWY A;  3O1I A;  3OYX A;  2IC6 A;  4AQG A;  1MMN A;  3PUA A;  3HKD E;  3CQG B;  2OA5 A;  1S35 A;  4H9P C;  3SFD A;  2XQ9 A;  4HWH A;  1HG5 A;  5L3G B;  2CXL A;  1US7 B;  4P09 A;  5AQJ B;  4PJN A;  5C8Y E;  4PFP A;  3FZF B;  2W0G A;  5AFU L;  3NWI A;  3BQL A;  3AAE B;  5EK4 A;  4WNK A;  3BK9 A;  3M3Z B;  1LVF A;  1KNR A;  2QVA A;  2IHR 1;  2XAQ B;  4PK6 A;  3LSV A;  3PUZ F;  2W2U A;  3OBV E;  3N9L A;  4DBQ A;  5HXS A;  5HEO A;  3PUS A;  3K3Q C;  4DO0 A;  3FZM B;  3KBU A;  2YEV C;  3DP7 A;  3HKC E;  4IHJ E;  4TWD A;  2KSR A;  2KZ7 B;  3SS1 A;  1MIV A;  4X5T A;  4X1K E;  1HF8 A;  3PV0 F;  4U3C A;  5BMV E;  3FBZ A;  3KIN B;  4HFB A;  4TV9 E;  4YY3 T;  2W4X A;  5C2T A;  2CCQ A;  2FUP A;  2J4G A;  3PU8 A;  5AQG B;  2H7O A;  4L5G A;  2BVL A;  4PFO A;  2X51 A;  1KFY A;  1UX5 A;  5L3E B;  3PUR A;  1HR0 T;  4P1N A;  3FZH B;  1YQ3 A;  3MK7 C;  4A5X A;  3PUG A;  4L0R A;  4KUM B;  1MMA A;  3ZT7 A;  4PAG A;  5KXJ A;  1WCR A;  1ZEE A;  2L3L A;  3ZKR A;  4O4L E;  3A8Y C;  2X9H A;  1UGO A;  2H89 A;  2DCF A;  5J2T E;  3O4X E;  1MND A;  2WDR A;  4DV4 T;  3PUW F;  3ZLI A;  3MJX A;  2NW9 A;  2KND A;  2XSA A;  2CXD A;  5LB7 B;  4DV7 T;  2NP9 A;  4CN6 A;  4NPP A;  4GYS A;  2CRB A;  1SHZ C;  1ZOY A;  3RKO A;  1HX1 B;  3CX7 B;  1XMQ T;  1MMD A;  4MLK A;  3CIR A;  1IAP A;  3OKQ A;  1BR4 A;  3LK3 B;  3OVU A;  1J5W A;  4ERR A;  1HNW T;  4HWI B;  4ILC A;  4DR5 T;  3P4R A;  1MIW A;  2UUC T;  4PW8 A;  4IGU A;  2E2A A;  5LCY A;  1VOM A;  1UCU A;  3PE0 A;  4H9N C;  4QXH B;  5LA6 E;  3T8O A;  4UEL A;  1Y01 A;  4LF7 T;  1BR0 A;  1FIO A;  5J1G A;  3L3P A;  3IF8 B;  3PUY F;  5JDG A;  4IDQ A;  2IW5 B;  4LMK A;  3SFE A;  4KHZ F;  2IIU A;  2UXN B;  2A9U A;  3GWH A;  3ZJ1 A;  2KWI B;  5L2L A;  2Q9Q A;  5ABF B;  4AQF A;  4ZS2 A;  4QKN A;  2CBJ A;  3QB5 K;  2LKH A;  4IT4 A;  4ILA A;  2X0Y A;  3B57 A;  2FJA A;  4IIJ E;  4JEU B;  2MOZ A;  2ZM0 A;  2WZH A;  2XHE B;  1R8I A;  2KXP B;  4NXM T;  3NBX X;  3AEC A;  2CEA A;  1HCI A;  2PG8 A;  3OYZ A;  2JQQ A;  2E8I A;  3ESL A;  4KHP T;  4J2C A;  3CX6 B;  5L3F B;  3CQX C;  1O3X A;  3AE1 A;  2B1E A;  3AXJ A;  3PUQ A;  4EOZ B;  1G73 A;  5AQT B;  2W00 A;  2JRK A;  4YXD A;  3VKH A;  2ODV A;  1WR0 A;  4M1P A;  2A72 A;  2WZI A;  4CXX A;  1JNR A;  1SE7 A;  2RA1 A;  1S94 A;  4ZI3 D;  2E5L T;  1CHU A;  5IWA T;  2NTX A;  4DR3 T;  1WYC A;  2IML A;  3CX8 B;  3I0O A;  5LP6 E;  4KX6 A;  5LXT E;  1MIY A;  3RF1 A;  3LBX B;  4ILU A;  3C4W A;  5L4H A;  3KV9 A;  3AAI A;  4C90 A;  4ZI2 C;  2BG9 B;  1KF6 A;  5DQV A;  2XQ8 A;  1V9D A;  2H7V C;  2VL0 A;  3SOL A;  4UR9 A;  3G06 A;  2R6G F;  1MNE A;  5DJQ C;  2G0U A;  4PJL A;  4HFD A;  4CI1 B;  3C51 A;  4WBO A;  2XQ7 A;  4IE4 A;  5HEJ A;  3Q5W A;  2W66 A;  4K0K T;  4LMJ A;  2H88 A;  3GN5 B;  4UEM A;  3MAC A;  3AE9 A;  5DAB A;  3E22 E;  2KT9 A;  4E7Z A;  2ES0 A;  2W61 A;  1UK5 A;  3IA3 A;  2DWG A;  1XNQ T;  2X9X A;  1IBM T;  2HPJ A;  4DBR A;  2GK9 A;  2LHR A;  3PJA J;  5JDM A;  1I6Z A;  4H63 V;  5L3C B;  2H3R A;  3I9Y A;  1BR2 A;  2HN1 A;  4O2B E;  2PFV A;  2ZM8 A;  2VWA A;  2WU2 A;  2V7J A;  4YTM A;  4HN9 A;  4I55 E;  1J5E T;  4AKI A;  4HFE A;  3ZSS A;  4JI6 T;  1T7S A;  3ZYK A;  2UUA T;  3QOF A;  2XM2 A;  5JVD E;  4YSZ A;  2LM2 A;  5CA0 E;  2VKJ A;  3R6N A;  4IL4 A;  4DR7 T;  4OK0 A;  5JTG A;  3RHW A;  3S4U A;  3RI5 A;  4ZS3 A;  5JQG E;  2IDO B;  1J1J A;  2X68 A;  4JUY A;  2YK0 A;  4AXP A;  3C64 A;  2V7K A;  4B3S T;  1FMW A;  5LMN T;  5IHY A;  5AQF B;  4TWH A;  3ZPO A;  2FJD A;  4CQI A;  1HX8 A;  4NIQ A;  2LRL A;  2WQY A;  1M62 A;  2CHN A;  2M6B A;  2LLY A;  3AB3 B;  3BQK A;  4CN1 A;  2BZB A;  3N2G E;  4X66 T;  5JR9 C;  2YDR A;  4HFC A;  2HPL A;  3UFE A;  3UUN A;  4YT0 A;  3NRX A;  4DV1 T;  2CE7 A;  2EHO D;  2WWV A;  2RP4 A;  5AQP B;  3F2E A;  3L39 A;  2ACZ A;  4DVD A;  2M6I A;  5LHG B;  2BVM A;  3ZYL A;  3UUB A;  2XUE A;  5AQR B;  5AQM B;  3P50 A;  5LJM A;  2HH7 A;  4IDZ A;  4UIG A;  1OED C;  4X1Y E;  5JR9 B;  2E9X A;  3KV5 A;  5CGM A;  1N32 T;  4U31 A;  4XZC A;  4TNV A;  4YFS A;  3RC8 A;  4YTP A;  2KMF A;  2ZLY A;  2WU5 A;  4Z90 A;  3AVS A;  3UT5 E;  1JNZ A;  1Y64 B;  3AEF A;  3C98 B;  1LVK A;  4JI7 T;  4YHH T;  4AKL A;  1SUM B;  4AI6 A;  2QYW A;  1YKE B;  2DNX A;  5HXC A;  2WM9 A;  2Y6X A;  1HTJ F;  2DL1 A;  3VU7 H;  5FL0 A;  2XAS B;  3V5U A;  5FKY A;  1LKX A;  4JLE A;  4Z8X A;  4K0U A;  3IEE A;  3A5X A;  3EHZ A;  5AQI B;  1VRB A;  2VUR A;  2BBH A;  3HI2 A;  4JBW F;  2QRX A;  2NWB A;  3AE7 A;  2J47 A;  4C91 A;  2MYS A;  4U74 A;  4IE5 A;  2XQ4 A;  4ZZC A;  3ZJ2 A;  2X0H A;  3Q5D A;  5FXV A;  2LSY A;  2JQH A;  3TLV A;  2PJQ A;  3KBT A;  2M67 A;  4EXT A;  5M4Y A;  1WYB A;  1U4Q A;  2XJ7 A;  1VCT A;  2BS4 A;  2WB5 A;  4B3T T;  4LF8 T;  2XZE A;  2I6H A;  2XAH B;  5AQV B;  1D0Z A;  1WFD A;  3PUX F;  3VRB A;  3B13 A;  3ZMT B;  1G8X A;  4ZI3 C;  4EIW A;  4DV6 T;  5F5W A;  3U3I A;  3RX6 A;  2V6X A;  1IBL T;  3UTK A;  2JMK A;  3HL6 A;  4QWN B;  2WAU A;  3JC6 C;  5AQU B;  2V5D A;  4ILB A;  1E1H B;  5H6Q B;  2WDV A;  1FJG T;  2LOP A;  3CWZ B;  4E7S A;  5A1L A;  2X9Y A;  3A7M A;  3UUX B;  2BDE A;  2X66 A;  2LHN A;  2CHO A;  1HNX T;  4F8H A;  4PJM A;  3EUH A;  1ZHC A;  5LOV E;  4L9I A;  5AQO B;  2BKN A;  2A3D A;  1D1B A;  5EZY E;  2AE9 A;  2BKP A;  4OX9 T;  3JAE A;  1U5P A;  2ZM2 A;  3ONJ A;  4QH4 A;  5FXZ A;  3X1D A;  4JEH B;  3VRA A;  5KMG P;  4KI0 F;  4WZX A;  3I1A A;  2K3W A;  4A56 A;  4HFH A;  2JMH A;  1Z8U A;  5H6R B;  1YKH B;  4HWD A;  5FNV E;  1QUU A;  3AE8 A;  3WI3 A;  1X79 A;  4HFI A;  3F31 A;  5F3J A;  5F8P A;  4G63 A;  4HKA A;  3ZT6 A;  2WY2 A;  4F6R C;  4TX5 A;  2VKH A;  3ZC1 A;  1IJ6 A;  4AKR B;  5LHI B;  4JYA T;  3GA8 A;  2MBG A;  5LBM A;  5ABF A;  2YDQ A;  1KNP A;  5ETW A;  3ONL C;  1KEY A;  4EGW A;  1Z0P A;  2IAK A;  3AE2 A;  4MFR A;  2LE8 A;  4U33 A;  4UV9 B;  4GIW A;  4YSY A;  4QH1 A;  4CZZ B;  2L8K A;  3FHN A;  2C5K T;  4LML A;  5LHH B;  1BR1 A;  3E0Z A;  1H7C A;  3C4X A;  1GQE A;  1N34 T;  2UXD T;  5LGT B;  4IE7 A;  2DHR A;  2BS2 A;  3RKG A;  2D2S A;  5HCJ A;  4UVC B;  5AQL B;  5KX5 E;  3EDU A;  3NZP A;  1X9B A;  3AA7 B;  4U7Y A;  2XQ5 A;  1D1A A;  3L8R A;  2I0M A;  3O1J A;  4EEB A;  4HEA A;  3N9P A;  4I4T E;  3ANW B;  2V7L A;  3P4P A;  3TLW A;  2LSI A;  4ZZB A;  3QNU A;  3TKL B;  5JRC B;  2VAS A;  4ZHQ E;  2VVN A;  3RRW A;  4NUV A;  5TAO A;  1XNR T;  2CPT A;  2EHO C;  4O4H E;  5CB4 E;  2LSK A;  3VR8 A;  5FXX A;  2XY8 B;  2BKO A;  5HXH A;  4YSX A;  4Z91 A;  3AEG A;  4TWF A;  2YIN A;  4QH5 A;  2CWY A;  2BG9 E;  2DWK A;  4LFC T;  5FY0 A;  5HXR A;  4OHF A;  2BG9 A;  1FEW A;  5C3J A;  4X20 E;  2V6Y B;  3RYC E;  2K48 A;  5FMN A;  1N33 T;  2V5C A;  4AQY T;  4N78 D;  3EAM A;  3K3O A;  5LG4 A;  3JC6 D;  2EHO B;  3N9Q A;  4JI3 T;  4DR1 T;  2JQK A;  3JCF A;  2K9A A;  4HFV A;  4O4I E;  2D5U A;  4FJO A;  3AXJ B;  3FZL B;  3GN5 A;  3MA9 A;  5AQQ B;  2UUB T;  5L4E A;  3UU3 A;  1QSD A;  3QUJ A;  4CI3 B;  4JI1 T;  1UUR A;  4NUU A;  4PNI A;  3T1H T;  3JAF A;  1ZP0 A;  3AED A;  4H63 H;  4JI8 T;  2CMR A;  3I0Q A;  1I94 T;  3J9X 1;  2W67 A;  4GKJ T;  3ZYM A;  3ONX A;  3KVA A;  2LEH A;  3C4Z A;  3U78 A;  4UF0 A;  5HYA A;  1AJ3 A;  2OLT A;  3RLF F;  4DV2 T;  2XQ6 A;  3SRZ A;  3FZK B;  2V1D B;  2X0L B;  1KK7 A;  4IE6 A;  2IC9 A;  2N1G A;  4GK0 E;  3L09 A;  1HNZ T;  1T98 A;  2VVS A;  1NAF A;  1T72 A;  3UU4 A;  4GYR A;  4YLH A;  4DR6 T;  2XPK A;  4MHC A;  2L9Q A;  4ISS A;  4QHO A;  4A98 A;  3CK6 A;  3UU5 A;  2V7M A;  1E2A A;  4TV8 E;  4H9Q C;  3RIU A;  3N2K E;  1IBK T;  5AQN B;  3QB5 A;  2W62 A;  1XDO A;  2DI4 A;  4YJ3 E;  2KWH A;  1DU2 A;  3N5L A;  2Q9Q D;  4YTN A;  2D0T A;  2KIN B;  4UVA B;  1KNZ A;  3ZEF B;  5L3D B;  1HS7 A;  3B5M A;  3PU3 A;  3SWH A;  2YN6 A;  3VR9 A;  2LM9 A; 
#chains in the Genus database with same CATH homology
 5BR8 T;  1HNW T;  4DR5 T;  4DV3 T;  2E5L T;  1J5E T;  2UUC T;  2UXC T;  1N32 T;  5IWA T;  1XNR T;  4YY3 T;  2VQF T;  4JI6 T;  4DR3 T;  2UUA T;  3OTO T;  2UU9 T;  4LFA T;  4B3T T;  4LF8 T;  4DV2 T;  1HR0 T;  4JI0 T;  4LF7 T;  4B3M T;  4DR7 T;  4DUY T;  4LFC T;  2VQE T;  4NXN T;  4JYA T;  4DV6 T;  1N33 T;  4JI7 T;  1IBL T;  4YHH T;  4AQY T;  1HNZ T;  4JI4 T;  4LF6 T;  4X65 T;  4DR2 T;  4JI3 T;  4X64 T;  4DR1 T;  4B3S T;  4DR6 T;  4LFB T;  5LMN T;  1N36 T;  2ZM6 T;  4DV5 T;  4JI2 T;  4JI5 T;  5LMU T;  4LF5 T;  1FJG T;  4DV4 T;  4GKK T;  4DV0 T;  1N34 T;  4K0K T;  2UXD T;  4X66 T;  2UUB T;  4NXM T;  1HNX T;  1IBK T;  4LF4 T;  4DV7 T;  4JI1 T;  4DUZ T;  2F4V T;  4X62 T;  3T1H T;  4KHP T;  1XMO T;  4DV1 T;  4OX9 T;  4DR4 T;  4JI8 T;  1XNQ T;  1IBM T;  4B3R T;  2HHH T;  1XMQ T;  2UXB T;  1I94 T;  4LF9 T;  3T1Y T;  4GKJ T;  4JV5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...