4GKKT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4gkkT00
4X62T 1XNRT 1N34T 2UU9T 4LF5T 4YHHT 5LMNT 4DV0T 4B3RT 4JI5T 4JV5T 2UUCT 4LF6T 4B3MT 4DR3T 2VQFT 4JI8T 4X66T 1I94T 4JI0T 2ZM6T 4JI7T 3T1HT 4JI6T 2UUAT 4B3TT 4DV5T 4DUZT 4DR2T 4LF9T 4GKJT 2UUBT 4DV6T 4YY3T 4NXNT 4JI3T 3T1YT 1N32T 4LF8T 5IWAT 1XMOT 4LFCT 4JI2T 1J5ET 4DUYT 3OTOT 1IBMT 4LFBT 4DV7T 4JI1T 1IBLT 1XMQT 2VQET 4DV4T 1FJGT 1HR0T 4AQYT 2F4VT 4DV1T 4B3ST 4JI4T 4DR6T 4DR1T 4GKKT 1HNWT 1HNXT 1N33T 2HHHT 2E5LT 4X65T 4DR4T 4OX9T 4X64T 4KHPT 1XNQT 4DR7T 4JYAT 2UXDT 1IBKT 1HNZT 4DR5T 4NXMT 4LFAT 4DV2T 4DV3T 5LMUT 1N36T 4K0KT 4LF4T 2UXBT 2UXCT 4LF7T 5BR8T
chains in the Genus database with same CATH superfamily
2ODVA 3ZLIA 2MYSA 4IGUA 4JBWF 3UUBA 3N2GE 2Y48B 1M62A 3UUNA 1ZOYA 3ABVA 2BKOA 5LBMA 5C3JA 2V8SV 1LVKA 3CQCB 4IT4A 2KXPB 3FZHB 4O4IE 4EYYR 4ZI3D 3UQ7A 3H3MA 2BKNA 2WDQA 4X1YE 5JVDE 4UEMA 5FP3A 3UULA 5FY1A 3LK2B 3SFEA 2XAJB 2NP9A 2WZIA 3AA7B 3PUZF 3AE6A 3PUQA 4UR9A 3VR8A 4U33A 4P0BA 1FMVA 2CLYC 2PG8A 4DMWA 1H7CA 2BKPA 3AE2A 4ILUA 5JQGE 4B3RT 4JV5T 2VB6A 3EVYA 3KVAA 1XZYA 4TNWA 5KDMC 2NTYA 1QSDA 5ABEA 4IE6A 5HCJA 3N9LA 5LCYA 5CA0E 1O3XA 2WM9A 3ZT5A 2CEAA 1VOMA 5ABFB 2CXDA 4H9OC 2BG9A 4JI7T 2DL1A 4ZEYA 3L39A 3T1HT 2V7LA 2W66A 2HN1A 2YDQA 3AEEA 4ZXLA 3Q5XA 4IDPA 2DI4A 2V6YA 5L47A 4BA9A 1HTJF 5HXHA 2XSAA 3OYXA 2X9HA 2KWHA 3N2KE 5JRCA 1IAPA 2X67A 3L09A 3I0OA 5HXEA 3P4QA 3TLVA 2XM1A 2LM2A 2YDRA 4IE7A 4DUZT 1BR4A 2E9XC 4A5XA 4ERRA 1LKXA 3PV0F 2N1GA 3LJCA 1D0YA 1S35A 5AQHB 4ADZA 5CJ5A 4ISTA 2D5UA 2LKGA 1WYCA 2KINB 3A7MA 4H9QC 4TNVA 2UUBT 2MPKA 2LOSA 1W0AA 2W4XA 2XJ7A 4DV6T 3UU5A 3AAEB 2YN6A 5LHIB 2FBWA 3LDQB 2JQQA 3C64A 2CXFA 5ETWA 2UXNB 3PJAJ 4DNDA 3AA6B 5JDGA 3MKDA 4OFZA 4H9NC 3UU8A 2WMOA 3U3IA 4U7YA 2CBIA 2XZEA 1BR2A 1YKEB 3CX6B 1VCSA 3I1AA 4MFRA 2X9XA 4UVAB 4QWNB 3J9X1 3O9XA 4H63V 2QGSA 5AQMB 3IHRA 4TN7B 2BBJA 3D0TA 2DHRA 2ES0A 3AE7A 3B5MA 2W2UA 3AEAA 1ZEEA 2FJAA 2E9XB 4PK5A 4MHCA 4XZCA 5AQJB 4MALA 5FY7A 1KNRA 2NW8A 2X68A 5FL1A 1IBLT 2NR4A 3AE4A 2A72A 1UURA 2X0HA 4Q25A 2H89A 2VKDA 4NUUA 4QH5A 4X5TA 4ZS2A 5AQGB 4O4HE 5H6QB 4HFVA 5AQFB 2CWYA 3KV4A 2VQET 5HWXA 4DV4T 3MACA 5LJMA 2WB5A 4ASKA 2F4VT 2XAQB 3F57A 1SA0E 3A8YC 3LBXB 4Z91A 1KF6A 4ILCA 5AQOB 3AE8A 3KV6A 4DR1T 2DNXA 2RP4A 2XQ8A 5HYAA 3LFMA 2EHOB 2JQ9A 1S94A 3KFWX 2DWGA 4WYVA 2H7VC 1OEDE 1D1AA 2CE7A 2KZ7B 4FI5A 4HWHA 3G06A 2JMHA 4K0UA 5LA6E 4EB6E 2G0UA 2W67A 3OJAA 2DCFA 4EYUA 3VHLA 3M3ZB 2HHHT 2E5LT 4KBMB 3ONXA 4I4TE 2H7OA 1XMOT 4DR4T 2PBIA 2V6YB 4IDNA 3AA0B 5FXZA 2HPJA 1B7TA 4OYKA 4WW0A 4BJMA 3AXJB 3DP7A 4TWHA 4JUYA 4CN6A 3JADA 5C2TA 5FXWA 2BG9B 2V7KA 4EZ4A 3ANWA 3SRZA 5ABFA 5DQVA 1HX1B 2ZM8A 3Q5WA 2XQ7A 4TX5A 5LNKA 4DV2T 1WCRA 2J47A 1NENA 3LG7A 1ZP0A 1NAFA 2JQKA 4QH4A 4X20E 4IDOA 4K0KT 4CI1B 2V5DA 3PJAA 2X51A 5HEGA 1E1HB 4PJLA 4HE8A 2LSJA 3QUJA 3CMLA 2UXBT 2UXCT 3AB3B 3PUVF 1NEKA 1LRZA 3K3QC 5J2UE 3OYZA 1FMWA 2WP9A 4A97A 5JDLA 3ZSTA 1HX8A 2CHOA 3HA4A 3UFGA 1XNRT 5AQVB 1MMGA 2J4GA 2WWUA 2LT3A 2N9DA 3AA1B 2WZHA 3EDUA 3ZMSB 2AE9A 3O1JA 3ZYMA 1UGOA 5ABHA 2BG9C 4YSYA 4HWDA 5IHYA 3UU4A 2V7IA 4O4LE 4C91A 4DBQA 1Y64B 2EHOC 3OBVE 2NTXA 3UTKA 3AAAB 3EABA 5FKYA 2EHOD 3QOFA 4HN9A 4L9IA 3MA9A 2Q9QC 4P09A 3RX6A 5AQIB 3OPCA 3ZMTB 3LK3B 2WDRA 5LHHB 1MMDA 5LJNA 2LSIA 1X9BA 2XQ6A 3L8RA 4KUMB 3NZQA 1XDPA 3PUGA 2XTLA 4QX8B 5GONE 2XY8B 4X66T 4JI8T 2WCAA 2I59A 3P4WA 4GYSA 1I94T 4JI0T 1J1JA 2K24A 4O2AE 5LGNB 4AKHA 1UUSA 2ZLYA 3I0QA 4IL9A 2LOPA 1I6ZA 3VRAA 2IIUA 3KBTA 2E8IA 2XPKA 2A3DA 4IHJE 5HXCA 3ZPOA 2YDSA 4N78D 3RIFA 2PJQA 2V6XA 4JI6T 3T8OA 4AKRB 2UUAT 3FXEB 4HTEA 5HEOA 3ZT6A 2YEVC 3K3NA 5AQSB 5L3GB 4KHZF 4B3TT 2IC9A 3P4SA 3PU3A 3HKDE 3PE0A 4HFEA 3JCFA 4DR2T 3GMIA 5KXJA 5LYJE 2Z6EA 1KEYA 4DUYT 3RH3A 3MZKB 2AXDS 4U7IA 5LBQB 4H63H 2J62A 5JTGA 4U31A 4IE0A 2MOZA 5ABGA 2CWOA 3TLSA 3ETVA 3ZMUB 5F8PA 3T1YT 4JI3T 3E22E 3QB5K 5KX5E 3FZMB 5AQQB 1N32T 1AJ3A 5C8YE 4CQIA 1UK5A 3QK6A 4LF8T 3RYHE 4CN1A 4PW8A 2LKHA 5FXXA 3O1IA 3PURA 4IE5A 1J5ET 4HKAA 1WYBA 4H9SE 3OTOT 4LFBT 3TLWA 4CI3B 4O2BE 3PU8A 1G8XA 3C4XA 4Z90A 2Y6XA 2MBGA 4L5GA 4O4JE 3PUWF 4TWFA 4TWDA 3K8PC 4QXHB 2MTQA 4TZ4C 5TAOA 3IBPA 3QB5A 4AKIA 1R8IA 5JDFA 4U74A 4UVBB 3AE5A 3RF1A 3RGLA 5KMGP 1FJGT 4AQYT 3X1DA 1SUMB 2Q9QA 1HG2A 2LLYA 2V7MA 5BMVE 4DO0A 5FVKA 3HKBE 5HEHA 3AEDA 1M7KA 3ZYLA 3UT5E 3V5UA 3QNUA 4COFA 3ZCIA 4QXBB 3KBUA 3UFEA 1HNWT 3CQGB 3I9YA 4X1KE 1HNXT 4YJ2E 3KINB 5AQPB 1U4QA 3Q9DA 2KSRA 2HN2A 2B1EA 3RLFF 5JDMA 1WLXA 3IF8B 4OX9T 2W63A 5J0ZA 4IDQA 4AISA 4YJ3E 3RYCE 1HFAA 1G73A 3WI3A 1IBKT 2KWIB 2H3RA 4UF0A 3B57A 2XQ5A 3DTOA 2ACZA 2I6HA 2OA5A 3NWIA 4V1Av 2WAUA 3ZEFB 4WBNE 2I0MA 4DV3T 2NW7A 3HL6A 2XQYA 5L3EB 3NKZA 3N5LA 3RIAA 2IDOB 3LSVA 2Q9QD 2XQAA 4CXWA 4LF4T 2HPLA 2XAHB 4A56A 4NUVA 2B76A 3C4ZA 2YKSA 2C5KT 4GOUA 3RYIE 5BR8T 3ESLA 2YOEA 4FJOA 4IREA 3RHWA 4ZS3A 3WAKA 3MJXA 2YU2A 5AQLB 2C5IT 5CFBA 3VKHA 5DQWA 2IAKA 2DWKA 1KNPA 3FBZA 5JR9C 4EV6A 1IJ6A 2PTFA 2UU9T 4LF5T 2XASB 3N2OA 2XHEB 4QX7B 5ADXL 3BQIA 3FBLA 5F3JA 5LMNT 4ZZBA 3RKOA 5L3CB 2JRKA 3AEBA 4BAYB 4DV0T 2FJEA 5AQTB 4DVDA 4JI5T 5LOVE 2FJBA 3CVRA 4YFSA 5L4HA 1J5WA 2K3WA 1T72A 4B3MT 1WR6A 4PNIA 4I43B 2VKOA 2VQFT 3CKDA 3ZKRA 4DBRA 3EAMA 2QRXA 2E9XA 4U2YA 4UV8B 5L3FB 2MAWA 1ZKEA 3EI0A 4MLKA 2D2SA 2ZM6T 3RC8A 2FJDA 3RRCA 1DU2A 4YTMA 4AQFA 4F6RC 4YSZA 4BJNA 1X79A 2BS4A 1MIWA 3AAIA 2VK9A 5EK4A 5FXVA 1MNDA 2VKJA 2WY2A 4WBOA 3SS1A 5H6RB 5JRCB 3CPZA 3RRWA 2D9DA 3C50A 3F31A 2XQ9A 4ILAA 4I0UA 4OK0A 3ZJ2A 4ZI2C 2CLYB 3BQKA 3CK6A 1ZHCA 2XUEA 4YLHA 1CHUA 4KP3C 4DV5T 3Q5DA 3EUHA 4H9RC 4ZOLE 5EK3A 4HFDA 2CA5A 2Y8DA 4I50E 4HWIB 4ZI2D 5L3DB 1JNRA 1YW0A 2D0TA 4QH1A 2N2NA 5HAXA 3R6NA 3W15B 4WZXA 2NOXA 2LRKA 2K9AA 2GK9A 5DABA 2V5CA 3ETUA 5LG4A 3EDVA 1D1BA 4UELA 4YY3T 3PUYF 2V7JA 1W09A 1Z0PA 3FZFB 4HFBA 4UF0B 4LMKA 1KNZA 1SHZC 5AQUB 3UU3A 5CGMA 2VL8A 2CCQA 2QA7A 2LM9A 3B13A 3ONLC 3N9PA 3TKLB 3Q5EA 3NZPA 4IE4A 1W9RA 2BVMA 1SE7A 4TUYE 3HKEE 3E0ZA 4U72A 4DIDB 3H3AA 3A5XA 4ISSA 4IIJE 3TLUA 1IBMT 2BZBA 2H88A 2LHRA 1UX5A 3O1HA 4OHFA 5HCMA 3ZSSA 2VURA 4JEUB 3RKGA 4DV7T 5HXSA 3AECA 4HWCA 2X0YA 4GK0E 4H9PC 4WNKA 3FB2A 4IL4A 4PFPA 2WWVA 3FZLB 3AE1A 3JAFA 3U78A 1UCUA 3NRYA 4U2ZA 2VVNA 2LSKA 3ANWB 5FMNA 2ACXA 4GYRA 2L3LA 2XQ3A 4ILBA 2BDEA 2NW9A 3HR0A 2CBJA 4DV1T 3PUAA 4JI4T 4DR6T 2D0UA 3KDSE 3AXJA 2IW5B 4P1NA 3S4UA 2JMKA 4GKKT 1OEDA 4LMJA 3RIUA 4AQFC 1Z8UA 1HS7A 4YTNA 2NWBA 5DJQC 1T8BA 3ZYKA 4UXNB 5L4EA 1N33T 1XWMA 4O8SA 3CWZB 2C5JA 2ZM0A 3WAJA 3O4XE 3AE3A 1OWAA 3UUXB 2R6GF 2RPAA 1E2AA 3ZCJA 1IJ5A 3BK9A 3N9MA 4JYAT 3PDYA 3KVBA 3ZMZB 2BG9E 1XNQT 2LEHA 2P9BA 3PUXF 2UXDT 1HNZT 1W0BA 3UQ4A 3GWHA 3CX7B 4PJNA 3VRBA 4LFAT 3ZMVB 5JREA 2SPCA 2E5VA 2IMLA 1WFDA 2C0SA 4HFCA 4AKGA 3LK42 3ONJA 4NIQA 2L8KA 3C98B 2KMFA 1U5PA 5JR9A 1QLBA 3RC3A 1N36T 4XBFB 1MIYA 5FVLA 4HWFA 2HH7A 3PUSA 4EEDA 4CZZB 5JDHA 2BVLA 4F8HA 2YK0A 2WMNA 4EIWA 1HCIA 1FEWA 2JQHA 4X62T 2BS2A 4PK4A 1E7PA 2XAFB 3CQXC 1VCTA 5HXRA 2VL0A 3PTRB 2WQYA 5L3BB 5LXTE 3HI2A 2QYWA 3CIRA 3K1SA 2KLQA 2ZMAA 4E7ZA 1N34T 2X0LB 3OVUA 3AE9A 4QXCB 4CN4A 5AQNB 4ZI3C 2M6BA 2A9UA 4ZHQE 4YHHT 2X9YA 4AIUA 3UUMA 1YQ4A 2WDVA 4PJMA 1WR0A 3ZC1A 4JEHB 3R84B 4P0AA 2X66A 2K5BB 5FNVE 3HKCE 2ZM2A 5LGUB 2UUCT 4LF6T 2J1DG 3L3PA 1IZNB 2PFVA 2WU2A 4AI6A 1D0XA 1MMAA 5HEJA 2E2AA 4A98A 1V9DA 4M1PA 4ZI7E 2LE8A 2W61A 2YU1A 2LRLA 3JC6D 2JPFA 5JDNA 4QKNA 3OKQA 4DR3T 1BR0A 2VASA 4L0RA 4AXPA 5CB4E 4YT0A 1GQEA 2RA1A 2ODUA 3AEGA 3FZKB 3AVRA 3F2EA 3Q2MA 4IDZA 4C90A 5HWYA 2LSGA 3ZN1B 4E7SA 3SWHA 1WRDA 2YINA 3FHNA 4MBQA 3QC9A 3K3OA 3TLTA 1HF8A 1US7B 4JLEA 3UU6A 3ZT7A 2JJ9A 3DJBA 3EHZA 5EZYE 1VRBA 2LJLA 2WSSV 3N9NA 5FYMA 5J1GA 3VU7H 4EGWA 3AVSA 3IEEA 4EOZB 2Q9QB 3NBXX 2UXXB 2LSYA 4J2CA 2CPTA 1MNEA 1T98A 2E9XD 3NVOA 2CM0A 4KI0F 4GKJT 4B6XA 3ZJ1A 3H37A 4HGAA 5EK2A 4G63A 1FIOA 3ZN0B 3KV5A 5LGTB 4CXYA 3N9OA 3V5SA 3E08A 4GK5E 4EZHA 2V26A 3C51A 2XAGB 3RQWA 3VR9A 4NXNT 2XSBA 3M65A 4X1IE 1OEDC 4HFIA 5IYZE 3RIUC 3FXDB 1BR1A 2JIWA 1D1CA 1D0ZA 5AQKB 5IWAT 4LFCT 4JI2T 4OYJA 3ZC0A 3J7Yq 4ZZCA 2CXLA 5AFUL 2M6IA 1YD8G 3MXZA 4EAHA 3MK7C 4HEAA 5LB7B 1MIVA 4DMVA 2W00A 3BQLA 2XQ4A 3P4RA 4U3CA 5FL0A 4AKLA 1T7SA 4JI1T 2VVSA 5J2TE 2BS3A 4HFHA 2A2FX 2EHOA 2XM2A 4UVCB 2M67A 3SOLA 4YXDA 2IHR1 1JNZA 2W0GA 5A1LA 1XDOA 2KT9A 2W62A 3JAEA 5LG3A 3VKGA 4EEBA 1XMQT 5FY0A 2WU5A 3LBXA 1HR0T 2L9QA 1EZ3A 2KNDA 3P8CD 4LMLA 3C4WA 2WS3A 3GA8A 4NPPA 5JH7E 2X9WA 4B3ST 5M4YA 1KK7A 3GN5B 2CMRA 4XAXB 1OXZA 1YXRA 1LVFA 2K48A 4PFOA 4EXTA 4G2AA 2VKHA 4YHJA 5IUXA 3KV9A 3P4PA 4UIGA 4ANJA 2LHNA 2WBLA 1ZV4X 2OV9A 1HG5A 2DLRA 4GIWA 4X65T 4LF9T 1UX4A 3N9QA 2CRBA 4TV9E 1Y01A 4I55E 4X64T 4KHPT 2FUPA 2OLTA 3RPUA 1L0VA 3CX8B 3P7IA 3GN5A 4CI2B 4PK6A 4YSXA 1YKHB 1CUNA 1OEDB 4DR7T 5LHGB 5JR9B 4TV8E 3NRXA 4DR5T 4PAGA 5AQRB 4NXMT 5E0OA 5F5WA 4Z8XA 3RQUA 5CA1E 3SFDA 4UV9B 5L2LA 3IA3A 4PJJA 1NWMX 1YQ3A 1QUUA 2CHNA 2IUBA 2BBHA 4QHOA 4YTPA 5LMUT 3RYFE 3AEFA 1KFYA 4AQGA 2IC6A 3JC6C 2V1DB 4KMCA 2VWAA 3RI5A 4CXXA 4KX6A 1MMNA 5LP6E 4LF7T 5HEUA 2QVAA 3P50A 3I9WA 5JDQA
chains in the Genus database with same CATH topology
4X62T 1XNRT 1N34T 2UU9T 4LF5T 4YHHT 5LMNT 4DV0T 4B3RT 4JI5T 4JV5T 2UUCT 4LF6T 4B3MT 4DR3T 2VQFT 4JI8T 4X66T 1I94T 4JI0T 2ZM6T 4JI7T 3T1HT 4JI6T 2UUAT 4B3TT 4DV5T 4DUZT 4DR2T 4LF9T 4GKJT 2UUBT 4DV6T 4YY3T 4NXNT 4JI3T 3T1YT 1N32T 4LF8T 5IWAT 1XMOT 4LFCT 4JI2T 1J5ET 4DUYT 3OTOT 1IBMT 4LFBT 4DV7T 4JI1T 1IBLT 1XMQT 2VQET 4DV4T 1FJGT 1HR0T 4AQYT 2F4VT 4DV1T 4B3ST 4JI4T 4DR6T 4DR1T 4GKKT 1HNWT 1HNXT 1N33T 2HHHT 2E5LT 4X65T 4DR4T 4OX9T 4X64T 4KHPT 1XNQT 4DR7T 4JYAT 2UXDT 1IBKT 1HNZT 4DR5T 4NXMT 4LFAT 4DV2T 4DV3T 5LMUT 1N36T 4K0KT 4LF4T 2UXBT 2UXCT 4LF7T 5BR8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 T;  1XNR T;  1N34 T;  2UU9 T;  4LF5 T;  4YHH T;  5LMN T;  4DV0 T;  4B3R T;  4JI5 T;  4JV5 T;  2UUC T;  4LF6 T;  4B3M T;  4DR3 T;  2VQF T;  4JI8 T;  4X66 T;  1I94 T;  4JI0 T;  2ZM6 T;  4JI7 T;  3T1H T;  4JI6 T;  2UUA T;  4B3T T;  4DV5 T;  4DUZ T;  4DR2 T;  4LF9 T;  4GKJ T;  2UUB T;  4DV6 T;  4YY3 T;  4NXN T;  4JI3 T;  3T1Y T;  1N32 T;  4LF8 T;  5IWA T;  1XMO T;  4LFC T;  4JI2 T;  1J5E T;  4DUY T;  3OTO T;  1IBM T;  4LFB T;  4DV7 T;  4JI1 T;  1IBL T;  1XMQ T;  2VQE T;  4DV4 T;  1FJG T;  1HR0 T;  4AQY T;  2F4V T;  4DV1 T;  4B3S T;  4JI4 T;  4DR6 T;  4DR1 T;  4GKK T;  1HNW T;  1HNX T;  1N33 T;  2HHH T;  2E5L T;  4X65 T;  4DR4 T;  4OX9 T;  4X64 T;  4KHP T;  1XNQ T;  4DR7 T;  4JYA T;  2UXD T;  1IBK T;  1HNZ T;  4DR5 T;  4NXM T;  4LFA T;  4DV2 T;  4DV3 T;  5LMU T;  1N36 T;  4K0K T;  4LF4 T;  2UXB T;  2UXC T;  4LF7 T;  5BR8 T; 
#chains in the Genus database with same CATH topology
 2ODV A;  3ZLI A;  2MYS A;  4IGU A;  4JBW F;  3UUB A;  3N2G E;  2Y48 B;  1M62 A;  3UUN A;  1ZOY A;  3ABV A;  2BKO A;  5LBM A;  5C3J A;  2V8S V;  1LVK A;  3CQC B;  4IT4 A;  2KXP B;  3FZH B;  4O4I E;  4EYY R;  4ZI3 D;  3UQ7 A;  3H3M A;  2BKN A;  2WDQ A;  4X1Y E;  5JVD E;  4UEM A;  5FP3 A;  3UUL A;  5FY1 A;  3LK2 B;  3SFE A;  2XAJ B;  2NP9 A;  2WZI A;  3AA7 B;  3PUZ F;  3AE6 A;  3PUQ A;  4UR9 A;  3VR8 A;  4U33 A;  4P0B A;  1FMV A;  2CLY C;  2PG8 A;  4DMW A;  1H7C A;  2BKP A;  3AE2 A;  4ILU A;  5JQG E;  4B3R T;  4JV5 T;  2VB6 A;  3EVY A;  3KVA A;  1XZY A;  4TNW A;  5KDM C;  2NTY A;  1QSD A;  5ABE A;  4IE6 A;  5HCJ A;  3N9L A;  5LCY A;  5CA0 E;  1O3X A;  2WM9 A;  3ZT5 A;  2CEA A;  1VOM A;  5ABF B;  2CXD A;  4H9O C;  2BG9 A;  4JI7 T;  2DL1 A;  4ZEY A;  3L39 A;  3T1H T;  2V7L A;  2W66 A;  2HN1 A;  2YDQ A;  3AEE A;  4ZXL A;  3Q5X A;  4IDP A;  2DI4 A;  2V6Y A;  5L47 A;  4BA9 A;  1HTJ F;  5HXH A;  2XSA A;  3OYX A;  2X9H A;  2KWH A;  3N2K E;  5JRC A;  1IAP A;  2X67 A;  3L09 A;  3I0O A;  5HXE A;  3P4Q A;  3TLV A;  2XM1 A;  2LM2 A;  2YDR A;  4IE7 A;  4DUZ T;  1BR4 A;  2E9X C;  4A5X A;  4ERR A;  1LKX A;  3PV0 F;  2N1G A;  3LJC A;  1D0Y A;  1S35 A;  5AQH B;  4ADZ A;  5CJ5 A;  4IST A;  2D5U A;  2LKG A;  1WYC A;  2KIN B;  3A7M A;  4H9Q C;  4TNV A;  2UUB T;  2MPK A;  2LOS A;  1W0A A;  2W4X A;  2XJ7 A;  4DV6 T;  3UU5 A;  3AAE B;  2YN6 A;  5LHI B;  2FBW A;  3LDQ B;  2JQQ A;  3C64 A;  2CXF A;  5ETW A;  2UXN B;  3PJA J;  4DND A;  3AA6 B;  5JDG A;  3MKD A;  4OFZ A;  4H9N C;  3UU8 A;  2WMO A;  3U3I A;  4U7Y A;  2CBI A;  2XZE A;  1BR2 A;  1YKE B;  3CX6 B;  1VCS A;  3I1A A;  4MFR A;  2X9X A;  4UVA B;  4QWN B;  3J9X 1;  3O9X A;  4H63 V;  2QGS A;  5AQM B;  3IHR A;  4TN7 B;  2BBJ A;  3D0T A;  2DHR A;  2ES0 A;  3AE7 A;  3B5M A;  2W2U A;  3AEA A;  1ZEE A;  2FJA A;  2E9X B;  4PK5 A;  4MHC A;  4XZC A;  5AQJ B;  4MAL A;  5FY7 A;  1KNR A;  2NW8 A;  2X68 A;  5FL1 A;  1IBL T;  2NR4 A;  3AE4 A;  2A72 A;  1UUR A;  2X0H A;  4Q25 A;  2H89 A;  2VKD A;  4NUU A;  4QH5 A;  4X5T A;  4ZS2 A;  5AQG B;  4O4H E;  5H6Q B;  4HFV A;  5AQF B;  2CWY A;  3KV4 A;  2VQE T;  5HWX A;  4DV4 T;  3MAC A;  5LJM A;  2WB5 A;  4ASK A;  2F4V T;  2XAQ B;  3F57 A;  1SA0 E;  3A8Y C;  3LBX B;  4Z91 A;  1KF6 A;  4ILC A;  5AQO B;  3AE8 A;  3KV6 A;  4DR1 T;  2DNX A;  2RP4 A;  2XQ8 A;  5HYA A;  3LFM A;  2EHO B;  2JQ9 A;  1S94 A;  3KFW X;  2DWG A;  4WYV A;  2H7V C;  1OED E;  1D1A A;  2CE7 A;  2KZ7 B;  4FI5 A;  4HWH A;  3G06 A;  2JMH A;  4K0U A;  5LA6 E;  4EB6 E;  2G0U A;  2W67 A;  3OJA A;  2DCF A;  4EYU A;  3VHL A;  3M3Z B;  2HHH T;  2E5L T;  4KBM B;  3ONX A;  4I4T E;  2H7O A;  1XMO T;  4DR4 T;  2PBI A;  2V6Y B;  4IDN A;  3AA0 B;  5FXZ A;  2HPJ A;  1B7T A;  4OYK A;  4WW0 A;  4BJM A;  3AXJ B;  3DP7 A;  4TWH A;  4JUY A;  4CN6 A;  3JAD A;  5C2T A;  5FXW A;  2BG9 B;  2V7K A;  4EZ4 A;  3ANW A;  3SRZ A;  5ABF A;  5DQV A;  1HX1 B;  2ZM8 A;  3Q5W A;  2XQ7 A;  4TX5 A;  5LNK A;  4DV2 T;  1WCR A;  2J47 A;  1NEN A;  3LG7 A;  1ZP0 A;  1NAF A;  2JQK A;  4QH4 A;  4X20 E;  4IDO A;  4K0K T;  4CI1 B;  2V5D A;  3PJA A;  2X51 A;  5HEG A;  1E1H B;  4PJL A;  4HE8 A;  2LSJ A;  3QUJ A;  3CML A;  2UXB T;  2UXC T;  3AB3 B;  3PUV F;  1NEK A;  1LRZ A;  3K3Q C;  5J2U E;  3OYZ A;  1FMW A;  2WP9 A;  4A97 A;  5JDL A;  3ZST A;  1HX8 A;  2CHO A;  3HA4 A;  3UFG A;  1XNR T;  5AQV B;  1MMG A;  2J4G A;  2WWU A;  2LT3 A;  2N9D A;  3AA1 B;  2WZH A;  3EDU A;  3ZMS B;  2AE9 A;  3O1J A;  3ZYM A;  1UGO A;  5ABH A;  2BG9 C;  4YSY A;  4HWD A;  5IHY A;  3UU4 A;  2V7I A;  4O4L E;  4C91 A;  4DBQ A;  1Y64 B;  2EHO C;  3OBV E;  2NTX A;  3UTK A;  3AAA B;  3EAB A;  5FKY A;  2EHO D;  3QOF A;  4HN9 A;  4L9I A;  3MA9 A;  2Q9Q C;  4P09 A;  3RX6 A;  5AQI B;  3OPC A;  3ZMT B;  3LK3 B;  2WDR A;  5LHH B;  1MMD A;  5LJN A;  2LSI A;  1X9B A;  2XQ6 A;  3L8R A;  4KUM B;  3NZQ A;  1XDP A;  3PUG A;  2XTL A;  4QX8 B;  5GON E;  2XY8 B;  4X66 T;  4JI8 T;  2WCA A;  2I59 A;  3P4W A;  4GYS A;  1I94 T;  4JI0 T;  1J1J A;  2K24 A;  4O2A E;  5LGN B;  4AKH A;  1UUS A;  2ZLY A;  3I0Q A;  4IL9 A;  2LOP A;  1I6Z A;  3VRA A;  2IIU A;  3KBT A;  2E8I A;  2XPK A;  2A3D A;  4IHJ E;  5HXC A;  3ZPO A;  2YDS A;  4N78 D;  3RIF A;  2PJQ A;  2V6X A;  4JI6 T;  3T8O A;  4AKR B;  2UUA T;  3FXE B;  4HTE A;  5HEO A;  3ZT6 A;  2YEV C;  3K3N A;  5AQS B;  5L3G B;  4KHZ F;  4B3T T;  2IC9 A;  3P4S A;  3PU3 A;  3HKD E;  3PE0 A;  4HFE A;  3JCF A;  4DR2 T;  3GMI A;  5KXJ A;  5LYJ E;  2Z6E A;  1KEY A;  4DUY T;  3RH3 A;  3MZK B;  2AXD S;  4U7I A;  5LBQ B;  4H63 H;  2J62 A;  5JTG A;  4U31 A;  4IE0 A;  2MOZ A;  5ABG A;  2CWO A;  3TLS A;  3ETV A;  3ZMU B;  5F8P A;  3T1Y T;  4JI3 T;  3E22 E;  3QB5 K;  5KX5 E;  3FZM B;  5AQQ B;  1N32 T;  1AJ3 A;  5C8Y E;  4CQI A;  1UK5 A;  3QK6 A;  4LF8 T;  3RYH E;  4CN1 A;  4PW8 A;  2LKH A;  5FXX A;  3O1I A;  3PUR A;  4IE5 A;  1J5E T;  4HKA A;  1WYB A;  4H9S E;  3OTO T;  4LFB T;  3TLW A;  4CI3 B;  4O2B E;  3PU8 A;  1G8X A;  3C4X A;  4Z90 A;  2Y6X A;  2MBG A;  4L5G A;  4O4J E;  3PUW F;  4TWF A;  4TWD A;  3K8P C;  4QXH B;  2MTQ A;  4TZ4 C;  5TAO A;  3IBP A;  3QB5 A;  4AKI A;  1R8I A;  5JDF A;  4U74 A;  4UVB B;  3AE5 A;  3RF1 A;  3RGL A;  5KMG P;  1FJG T;  4AQY T;  3X1D A;  1SUM B;  2Q9Q A;  1HG2 A;  2LLY A;  2V7M A;  5BMV E;  4DO0 A;  5FVK A;  3HKB E;  5HEH A;  3AED A;  1M7K A;  3ZYL A;  3UT5 E;  3V5U A;  3QNU A;  4COF A;  3ZCI A;  4QXB B;  3KBU A;  3UFE A;  1HNW T;  3CQG B;  3I9Y A;  4X1K E;  1HNX T;  4YJ2 E;  3KIN B;  5AQP B;  1U4Q A;  3Q9D A;  2KSR A;  2HN2 A;  2B1E A;  3RLF F;  5JDM A;  1WLX A;  3IF8 B;  4OX9 T;  2W63 A;  5J0Z A;  4IDQ A;  4AIS A;  4YJ3 E;  3RYC E;  1HFA A;  1G73 A;  3WI3 A;  1IBK T;  2KWI B;  2H3R A;  4UF0 A;  3B57 A;  2XQ5 A;  3DTO A;  2ACZ A;  2I6H A;  2OA5 A;  3NWI A;  4V1A v;  2WAU A;  3ZEF B;  4WBN E;  2I0M A;  4DV3 T;  2NW7 A;  3HL6 A;  2XQY A;  5L3E B;  3NKZ A;  3N5L A;  3RIA A;  2IDO B;  3LSV A;  2Q9Q D;  2XQA A;  4CXW A;  4LF4 T;  2HPL A;  2XAH B;  4A56 A;  4NUV A;  2B76 A;  3C4Z A;  2YKS A;  2C5K T;  4GOU A;  3RYI E;  5BR8 T;  3ESL A;  2YOE A;  4FJO A;  4IRE A;  3RHW A;  4ZS3 A;  3WAK A;  3MJX A;  2YU2 A;  5AQL B;  2C5I T;  5CFB A;  3VKH A;  5DQW A;  2IAK A;  2DWK A;  1KNP A;  3FBZ A;  5JR9 C;  4EV6 A;  1IJ6 A;  2PTF A;  2UU9 T;  4LF5 T;  2XAS B;  3N2O A;  2XHE B;  4QX7 B;  5ADX L;  3BQI A;  3FBL A;  5F3J A;  5LMN T;  4ZZB A;  3RKO A;  5L3C B;  2JRK A;  3AEB A;  4BAY B;  4DV0 T;  2FJE A;  5AQT B;  4DVD A;  4JI5 T;  5LOV E;  2FJB A;  3CVR A;  4YFS A;  5L4H A;  1J5W A;  2K3W A;  1T72 A;  4B3M T;  1WR6 A;  4PNI A;  4I43 B;  2VKO A;  2VQF T;  3CKD A;  3ZKR A;  4DBR A;  3EAM A;  2QRX A;  2E9X A;  4U2Y A;  4UV8 B;  5L3F B;  2MAW A;  1ZKE A;  3EI0 A;  4MLK A;  2D2S A;  2ZM6 T;  3RC8 A;  2FJD A;  3RRC A;  1DU2 A;  4YTM A;  4AQF A;  4F6R C;  4YSZ A;  4BJN A;  1X79 A;  2BS4 A;  1MIW A;  3AAI A;  2VK9 A;  5EK4 A;  5FXV A;  1MND A;  2VKJ A;  2WY2 A;  4WBO A;  3SS1 A;  5H6R B;  5JRC B;  3CPZ A;  3RRW A;  2D9D A;  3C50 A;  3F31 A;  2XQ9 A;  4ILA A;  4I0U A;  4OK0 A;  3ZJ2 A;  4ZI2 C;  2CLY B;  3BQK A;  3CK6 A;  1ZHC A;  2XUE A;  4YLH A;  1CHU A;  4KP3 C;  4DV5 T;  3Q5D A;  3EUH A;  4H9R C;  4ZOL E;  5EK3 A;  4HFD A;  2CA5 A;  2Y8D A;  4I50 E;  4HWI B;  4ZI2 D;  5L3D B;  1JNR A;  1YW0 A;  2D0T A;  4QH1 A;  2N2N A;  5HAX A;  3R6N A;  3W15 B;  4WZX A;  2NOX A;  2LRK A;  2K9A A;  2GK9 A;  5DAB A;  2V5C A;  3ETU A;  5LG4 A;  3EDV A;  1D1B A;  4UEL A;  4YY3 T;  3PUY F;  2V7J A;  1W09 A;  1Z0P A;  3FZF B;  4HFB A;  4UF0 B;  4LMK A;  1KNZ A;  1SHZ C;  5AQU B;  3UU3 A;  5CGM A;  2VL8 A;  2CCQ A;  2QA7 A;  2LM9 A;  3B13 A;  3ONL C;  3N9P A;  3TKL B;  3Q5E A;  3NZP A;  4IE4 A;  1W9R A;  2BVM A;  1SE7 A;  4TUY E;  3HKE E;  3E0Z A;  4U72 A;  4DID B;  3H3A A;  3A5X A;  4ISS A;  4IIJ E;  3TLU A;  1IBM T;  2BZB A;  2H88 A;  2LHR A;  1UX5 A;  3O1H A;  4OHF A;  5HCM A;  3ZSS A;  2VUR A;  4JEU B;  3RKG A;  4DV7 T;  5HXS A;  3AEC A;  4HWC A;  2X0Y A;  4GK0 E;  4H9P C;  4WNK A;  3FB2 A;  4IL4 A;  4PFP A;  2WWV A;  3FZL B;  3AE1 A;  3JAF A;  3U78 A;  1UCU A;  3NRY A;  4U2Z A;  2VVN A;  2LSK A;  3ANW B;  5FMN A;  2ACX A;  4GYR A;  2L3L A;  2XQ3 A;  4ILB A;  2BDE A;  2NW9 A;  3HR0 A;  2CBJ A;  4DV1 T;  3PUA A;  4JI4 T;  4DR6 T;  2D0U A;  3KDS E;  3AXJ A;  2IW5 B;  4P1N A;  3S4U A;  2JMK A;  4GKK T;  1OED A;  4LMJ A;  3RIU A;  4AQF C;  1Z8U A;  1HS7 A;  4YTN A;  2NWB A;  5DJQ C;  1T8B A;  3ZYK A;  4UXN B;  5L4E A;  1N33 T;  1XWM A;  4O8S A;  3CWZ B;  2C5J A;  2ZM0 A;  3WAJ A;  3O4X E;  3AE3 A;  1OWA A;  3UUX B;  2R6G F;  2RPA A;  1E2A A;  3ZCJ A;  1IJ5 A;  3BK9 A;  3N9M A;  4JYA T;  3PDY A;  3KVB A;  3ZMZ B;  2BG9 E;  1XNQ T;  2LEH A;  2P9B A;  3PUX F;  2UXD T;  1HNZ T;  1W0B A;  3UQ4 A;  3GWH A;  3CX7 B;  4PJN A;  3VRB A;  4LFA T;  3ZMV B;  5JRE A;  2SPC A;  2E5V A;  2IML A;  1WFD A;  2C0S A;  4HFC A;  4AKG A;  3LK4 2;  3ONJ A;  4NIQ A;  2L8K A;  3C98 B;  2KMF A;  1U5P A;  5JR9 A;  1QLB A;  3RC3 A;  1N36 T;  4XBF B;  1MIY A;  5FVL A;  4HWF A;  2HH7 A;  3PUS A;  4EED A;  4CZZ B;  5JDH A;  2BVL A;  4F8H A;  2YK0 A;  2WMN A;  4EIW A;  1HCI A;  1FEW A;  2JQH A;  4X62 T;  2BS2 A;  4PK4 A;  1E7P A;  2XAF B;  3CQX C;  1VCT A;  5HXR A;  2VL0 A;  3PTR B;  2WQY A;  5L3B B;  5LXT E;  3HI2 A;  2QYW A;  3CIR A;  3K1S A;  2KLQ A;  2ZMA A;  4E7Z A;  1N34 T;  2X0L B;  3OVU A;  3AE9 A;  4QXC B;  4CN4 A;  5AQN B;  4ZI3 C;  2M6B A;  2A9U A;  4ZHQ E;  4YHH T;  2X9Y A;  4AIU A;  3UUM A;  1YQ4 A;  2WDV A;  4PJM A;  1WR0 A;  3ZC1 A;  4JEH B;  3R84 B;  4P0A A;  2X66 A;  2K5B B;  5FNV E;  3HKC E;  2ZM2 A;  5LGU B;  2UUC T;  4LF6 T;  2J1D G;  3L3P A;  1IZN B;  2PFV A;  2WU2 A;  4AI6 A;  1D0X A;  1MMA A;  5HEJ A;  2E2A A;  4A98 A;  1V9D A;  4M1P A;  4ZI7 E;  2LE8 A;  2W61 A;  2YU1 A;  2LRL A;  3JC6 D;  2JPF A;  5JDN A;  4QKN A;  3OKQ A;  4DR3 T;  1BR0 A;  2VAS A;  4L0R A;  4AXP A;  5CB4 E;  4YT0 A;  1GQE A;  2RA1 A;  2ODU A;  3AEG A;  3FZK B;  3AVR A;  3F2E A;  3Q2M A;  4IDZ A;  4C90 A;  5HWY A;  2LSG A;  3ZN1 B;  4E7S A;  3SWH A;  1WRD A;  2YIN A;  3FHN A;  4MBQ A;  3QC9 A;  3K3O A;  3TLT A;  1HF8 A;  1US7 B;  4JLE A;  3UU6 A;  3ZT7 A;  2JJ9 A;  3DJB A;  3EHZ A;  5EZY E;  1VRB A;  2LJL A;  2WSS V;  3N9N A;  5FYM A;  5J1G A;  3VU7 H;  4EGW A;  3AVS A;  3IEE A;  4EOZ B;  2Q9Q B;  3NBX X;  2UXX B;  2LSY A;  4J2C A;  2CPT A;  1MNE A;  1T98 A;  2E9X D;  3NVO A;  2CM0 A;  4KI0 F;  4GKJ T;  4B6X A;  3ZJ1 A;  3H37 A;  4HGA A;  5EK2 A;  4G63 A;  1FIO A;  3ZN0 B;  3KV5 A;  5LGT B;  4CXY A;  3N9O A;  3V5S A;  3E08 A;  4GK5 E;  4EZH A;  2V26 A;  3C51 A;  2XAG B;  3RQW A;  3VR9 A;  4NXN T;  2XSB A;  3M65 A;  4X1I E;  1OED C;  4HFI A;  5IYZ E;  3RIU C;  3FXD B;  1BR1 A;  2JIW A;  1D1C A;  1D0Z A;  5AQK B;  5IWA T;  4LFC T;  4JI2 T;  4OYJ A;  3ZC0 A;  3J7Y q;  4ZZC A;  2CXL A;  5AFU L;  2M6I A;  1YD8 G;  3MXZ A;  4EAH A;  3MK7 C;  4HEA A;  5LB7 B;  1MIV A;  4DMV A;  2W00 A;  3BQL A;  2XQ4 A;  3P4R A;  4U3C A;  5FL0 A;  4AKL A;  1T7S A;  4JI1 T;  2VVS A;  5J2T E;  2BS3 A;  4HFH A;  2A2F X;  2EHO A;  2XM2 A;  4UVC B;  2M67 A;  3SOL A;  4YXD A;  2IHR 1;  1JNZ A;  2W0G A;  5A1L A;  1XDO A;  2KT9 A;  2W62 A;  3JAE A;  5LG3 A;  3VKG A;  4EEB A;  1XMQ T;  5FY0 A;  2WU5 A;  3LBX A;  1HR0 T;  2L9Q A;  1EZ3 A;  2KND A;  3P8C D;  4LML A;  3C4W A;  2WS3 A;  3GA8 A;  4NPP A;  5JH7 E;  2X9W A;  4B3S T;  5M4Y A;  1KK7 A;  3GN5 B;  2CMR A;  4XAX B;  1OXZ A;  1YXR A;  1LVF A;  2K48 A;  4PFO A;  4EXT A;  4G2A A;  2VKH A;  4YHJ A;  5IUX A;  3KV9 A;  3P4P A;  4UIG A;  4ANJ A;  2LHN A;  2WBL A;  1ZV4 X;  2OV9 A;  1HG5 A;  2DLR A;  4GIW A;  4X65 T;  4LF9 T;  1UX4 A;  3N9Q A;  2CRB A;  4TV9 E;  1Y01 A;  4I55 E;  4X64 T;  4KHP T;  2FUP A;  2OLT A;  3RPU A;  1L0V A;  3CX8 B;  3P7I A;  3GN5 A;  4CI2 B;  4PK6 A;  4YSX A;  1YKH B;  1CUN A;  1OED B;  4DR7 T;  5LHG B;  5JR9 B;  4TV8 E;  3NRX A;  4DR5 T;  4PAG A;  5AQR B;  4NXM T;  5E0O A;  5F5W A;  4Z8X A;  3RQU A;  5CA1 E;  3SFD A;  4UV9 B;  5L2L A;  3IA3 A;  4PJJ A;  1NWM X;  1YQ3 A;  1QUU A;  2CHN A;  2IUB A;  2BBH A;  4QHO A;  4YTP A;  5LMU T;  3RYF E;  3AEF A;  1KFY A;  4AQG A;  2IC6 A;  3JC6 C;  2V1D B;  4KMC A;  2VWA A;  3RI5 A;  4CXX A;  4KX6 A;  1MMN A;  5LP6 E;  4LF7 T;  5HEU A;  2QVA A;  3P50 A;  3I9W A;  5JDQ A; 
#chains in the Genus database with same CATH homology
 4X62 T;  1XNR T;  1N34 T;  2UU9 T;  4LF5 T;  4YHH T;  5LMN T;  4DV0 T;  4B3R T;  4JI5 T;  4JV5 T;  2UUC T;  4LF6 T;  4B3M T;  4DR3 T;  2VQF T;  4JI8 T;  4X66 T;  1I94 T;  4JI0 T;  2ZM6 T;  4JI7 T;  3T1H T;  4JI6 T;  2UUA T;  4B3T T;  4DV5 T;  4DUZ T;  4DR2 T;  4LF9 T;  4GKJ T;  2UUB T;  4DV6 T;  4YY3 T;  4NXN T;  4JI3 T;  3T1Y T;  1N32 T;  4LF8 T;  5IWA T;  1XMO T;  4LFC T;  4JI2 T;  1J5E T;  4DUY T;  3OTO T;  1IBM T;  4LFB T;  4DV7 T;  4JI1 T;  1IBL T;  1XMQ T;  2VQE T;  4DV4 T;  1FJG T;  1HR0 T;  4AQY T;  2F4V T;  4DV1 T;  4B3S T;  4JI4 T;  4DR6 T;  4DR1 T;  4GKK T;  1HNW T;  1HNX T;  1N33 T;  2HHH T;  2E5L T;  4X65 T;  4DR4 T;  4OX9 T;  4X64 T;  4KHP T;  1XNQ T;  4DR7 T;  4JYA T;  2UXD T;  1IBK T;  1HNZ T;  4DR5 T;  4NXM T;  4LFA T;  4DV2 T;  4DV3 T;  5LMU T;  1N36 T;  4K0K T;  4LF4 T;  2UXB T;  2UXC T;  4LF7 T;  5BR8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...