4GKKT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4gkkT00
1N32T 4DUYT 4DV7T 4LFAT 4DR4T 4KHPT 4B3MT 1N36T 2UXDT 4JI5T 4DV4T 1IBKT 4LF6T 1HNWT 2VQFT 1HNXT 4JYAT 2HHHT 4LF5T 2ZM6T 4JI6T 4AQYT 1XNRT 3T1HT 1J5ET 4DR6T 4JI7T 4JI4T 4DV5T 4DR1T 1HNZT 4DR5T 4DUZT 1IBMT 4NXMT 4JI2T 4X65T 4JI8T 5IWAT 4LF7T 5BR8T 3T1YT 2UXCT 2UUCT 4NXNT 4DR3T 1N33T 2UXBT 2F4VT 2UUBT 2UU9T 1IBLT 4X62T 1XMQT 4K0KT 4JI0T 4LF9T 4B3TT 4GKJT 1I94T 4DR2T 2UUAT 4YY3T 4X66T 4B3RT 4DV6T 4DR7T 4LF4T 4GKKT 4JI3T 2VQET 4B3ST 1HR0T 3OTOT 1XMOT 1N34T 2E5LT 4OX9T 5LMUT 4LF8T 4DV1T 4DV0T 4X64T 4DV3T 1FJGT 1XNQT 4JI1T 5LMNT 4JV5T 4YHHT 4LFBT 4DV2T 4LFCT
chains in the Genus database with same CATH superfamily
3JADA 5JDFA 4I43B 3PJAJ 4HKAA 5LG4A 4TV8E 1HG5A 3PUSA 3HL6A 1MMNA 2W61A 3D0TA 2A9UA 1M62A 4JYAT 1UCUA 3FZKB 3PURA 3CPZA 4PNIA 2WDQA 4ZOLE 5LCYA 3C50A 4IREA 4ZEYA 1WYCA 2WQYA 1OEDE 5AQTB 2LOPA 4IIJE 2Q9QA 4BAYB 2CEAA 5LJNA 4YSXA 4U33A 3ABVA 3KV5A 1ZKEA 4NUVA 4AQGA 4GKJT 3RYCE 3UFEA 5LHGB 4YY3T 1NAFA 2CRBA 3RKOA 5AQPB 2G0UA 2NWBA 5JVDE 1W0AA 2PBIA 4UV8B 3KBTA 2ODVA 4AKIA 4NUUA 4B3ST 3FZMB 3PV0F 4AIUA 4IE6A 1BR2A 4UVAB 3ZMVB 1YD8G 4YTMA 1D0YA 3KVBA 5FMNA 2QRXA 4MLKA 4AQFC 5CFBA 2PFVA 4LFBT 2J62A 2VWAA 4TNWA 4HFCA 1SE7A 4CQIA 2MYSA 3EHZA 5AQQB 2V7LA 2DL1A 2ODUA 3LJCA 3ZMTB 4FJOA 2UXDT 1HF8A 1WR0A 2M67A 4ZXLA 3OPCA 4YT0A 3I1AA 3FZLB 3IF8B 3ANWA 4DO0A 4EEDA 3AEBA 2Q9QD 1OEDC 4A98A 4EIWA 5JREA 3NRXA 3JCFA 1HFAA 5JQGE 2ACXA 3LFMA 3RH3A 4F8HA 1W9RA 1KFYA 3N9PA 3P4PA 2VK9A 5ADXL 4NIQA 3KV6A 3NRYA 1D0XA 1YKEB 5JDQA 4HTEA 4DBQA 2DWGA 2BDEA 4A97A 4JI3T 5E0OA 3ZKRA 2GK9A 5TAOA 2KZ7B 5LG3A 3N2GE 1N34T 1AJ3A 3UQ4A 4PJLA 3K3QC 4YHJA 3H3MA 2E9XA 1E2AA 3UU4A 1XNQT 1S35A 2IC9A 2WB5A 2HH7A 3WAJA 1FMWA 4YTNA 3MK7C 4EV6A 3P8CD 3AEFA 4H63H 4LFCT 3RHWA 1J1JA 3OYZA 1LVKA 2X66A 3HA4A 1LVFA 3AEGA 4KHPT 2V1DB 4KX6A 4U2YA 3EUHA 2YK0A 2X51A 1HNXT 2BZBA 2HHHT 2XQ4A 2ZM6T 4JI6T 4KUMB 4DR6T 3EDVA 3OVUA 2CWOA 2X9YA 4DUZT 2NW9A 2QVAA 3LG7A 3P4SA 3MJXA 2H7VC 1QLBA 3K3NA 4X1YE 5HEHA 2V7IA 2N2NA 4Z90A 5AQNB 4X1KE 4HFDA 2XUEA 3R84B 4K0KT 4JLEA 2XSBA 3ZCIA 3IA3A 2JQKA 5F5WA 5KDMC 4PK6A 3ZT5A 4YTPA 4DV6T 2Q9QB 2WMOA 4DR7T 1VCTA 5AQRB 5AQHB 1XMOT 2H89A 4IE4A 2CHOA 4WBNE 2FJEA 2YDRA 2A2FX 3CQCB 3GN5A 2WS3A 3DP7A 4LMJA 2J4GA 4CXXA 1XDOA 5IYZE 3UUBA 4BJMA 4AKGA 1YKHB 4O4IE 2JIWA 1Y64B 1MIYA 1Y01A 3CX7B 2W67A 2CA5A 4UR9A 1IJ6A 4PJMA 1IAPA 2V26A 4UVCB 2MOZA 3ZEFB 4JI7T 1O3XA 3RYIE 2I6HA 3AEAA 5EK3A 3NZQA 2WZHA 4NXMT 3O9XA 4JI2T 4LMLA 1FMVA 3RKGA 2WP9A 3R6NA 2CXFA 1N33T 2CLYB 2W4XA 2WAUA 3H3AA 4DIDB 1DU2A 3TLSA 3FB2A 3ANWB 3V5SA 3RRCA 2E5VA 3ZJ2A 3K1SA 3LBXA 2UUAT 2WWUA 4IT4A 2CM0A 4X66T 2X68A 2HN2A 3S4UA 3CMLA 4UEMA 2VKHA 3SFDA 5FY1A 3QOFA 3L39A 5JR9C 3BQLA 1ZEEA 4QXHB 2X0HA 2BG9A 4WBOA 4CN4A 1XWMA 5LJMA 4DMVA 3ZT7A 4ZI7E 4JV5T 5FYMA 5J2TE 4P0BA 3JAEA 3ZCJA 2ZM8A 3P4WA 4ERRA 4HFEA 3C64A 2HPJA 5DJQC 3QNUA 2LE8A 2C5IT 1WLXA 3LK3B 2YU2A 1VRBA 3N2KE 3JC6C 2W62A 5HCMA 2K3WA 4DR5T 1HX1B 4ZZCA 2Y48B 1YW0A 2UXNB 5L2LA 3AA1B 4IE5A 4TX5A 3P4QA 2BBHA 3NZPA 2X9XA 5CB4E 4Z91A 2B76A 2FUPA 3A7MA 3SFEA 4B3TT 1U4QA 1ZOYA 2CXDA 2KXPB 4PJNA 5L4HA 4B3RT 3V5UA 1CHUA 5FP3A 4EEBA 5FXXA 2YDSA 3ZSTA 2ZMAA 5AQKB 2XQ6A 1HR0T 3AAIA 2LLYA 4HWIB 4CZZB 4IDPA 5HXRA 4GK0E 4QXCB 4HN9A 3AE9A 4IHJE 5DABA 5LGTB 2XM2A 3UQ7A 4QKNA 5L3CB 1XDPA 4CN6A 5GONE 4DV7T 4YJ2E 5LB7B 2YN6A 2YU1A 2XAJB 2CBIA 5JDLA 1WYBA 1H7CA 3AE5A 4EOZB 2W66A 5FXVA 1W0BA 2J1DG 3CIRA 3BK9A 2IC6A 2MPKA 3VRBA 2NTYA 3TLWA 1BR1A 5IWAT 2A3DA 5ABFA 4DR3T 2WU2A 2MAWA 2LSJA 3AAAB 3Q5DA 1KNPA 2PG8A 5HEOA 5FY0A 5AQFB 3CQGB 3UUXB 2MTQA 3N9LA 3MACA 4JI0T 1G8XA 2X0YA 3ZSSA 1OXZA 2JPFA 4UV9B 5LXTE 1MIWA 4AKRB 3T8OA 5JDGA 2D2SA 5C2TA 2VQET 1VCSA 5L4EA 2VVSA 4PAGA 3LBXB 3RF1A 2V5DA 3ESLA 2XASB 3CX8B 4O4LE 2XQAA 2I0MA 2KWHA 4IL9A 1U5PA 4BA9A 4P1NA 5JTGA 4ZS3A 4DV2T 4ZI3C 2XAHB 3HKEE 1ZHCA 2Y8DA 4EZHA 5HCJA 1KEYA 2ACZA 1V9DA 3F57A 1UX4A 2BG9B 3KVAA 2IDOB 2JQHA 2Z6EA 2JRKA 2XQ7A 2M6BA 5A1LA 3F2EA 3RPUA 1XNRT 3AE6A 2A72A 4JI4T 4MBQA 4TUYE 3KINB 3O1JA 5L3GB 2XY8B 3FBLA 3JAFA 4U2ZA 3B57A 5JRCA 3KBUA 4ISTA 3T1YT 3RYHE 3N9OA 4YXDA 4G2AA 1E7PA 3RIUA 1IBLT 1VOMA 3FHNA 4H9OC 3DJBA 1US7B 2IMLA 3OBVE 4QHOA 4TWDA 5AQUB 5LGUB 3ZMUB 1BR0A 2HPLA 2VKJA 2WY2A 3UUMA 2VVNA 2EHOA 3PUGA 1S94A 5FY7A 2XJ7A 2V7KA 4H9SE 4ANJA 3BQIA 1SHZC 5ABGA 5LHIB 3AAEB 3UU8A 3AA0B 3I0QA 5EK2A 3G06A 2IHR1 5CA1E 4JEUB 3ZN1B 3QB5K 5AQJB 3UUNA 5LMNT 1D1AA 2W00A 3I9WA 2N1GA 2LEHA 1CUNA 3AXJB 3AA7B 4UF0A 1UURA 3UU3A 2V8SV 2V7JA 4B3MT 2RP4A 2WMNA 3PTRB 2VL0A 2K5BB 2V6YA 2QA7A 4DV5T 3Q5EA 4U74A 3CQXC 5HYAA 2JQ9A 3VHLA 4GYRA 4HWDA 3VRAA 2SPCA 1KNRA 3HKDE 2NOXA 4M1PA 4ZI2D 3QUJA 4MHCA 3HI2A 5FL1A 4LF9T 3GA8A 3AEDA 5HEGA 4X5TA 2EHOD 2XHEB 4WZXA 3RGLA 5ABFB 3OYXA 2DI4A 3SWHA 3ZC1A 3DTOA 4IDNA 2K24A 2CBJA 5HWXA 2LSKA 3RC3A 3AE8A 2CE7A 3QB5A 4EZ4A 5LMUT 3X1DA 4JI1T 3KV4A 2L8KA 4O4HE 3RI5A 3PUQA 4QX8B 4IL4A 4E7ZA 5JDMA 3C51A 4Z8XA 2VL8A 2E9XD 2RPAA 1QUUA 5IUXA 2C5KT 3FZFB 4L9IA 4WYVA 1IBKT 3NKZA 3HKBE 2IUBA 5AQGB 5LBQB 2XQ8A 4EGWA 1T7SA 3I0OA 5L47A 3RYFE 3AB3B 4JI8T 4UXNB 4EYUA 4YJ3E 3PDYA 4NXNT 3H37A 2BS4A 3MZKB 4UIGA 5LNKA 3L09A 2PTFA 5JRCB 1ZV4X 2Q9QC 4AQFA 4IE0A 3N5LA 4LF4T 5FKYA 3RIFA 1WFDA 3MA9A 2IW5B 5BMVE 4TNVA 3VU7H 3Q5XA 5HEJA 5CA0E 1FJGT 2WM9A 2W2UA 4KMCA 2EHOB 2XAFB 2WU5A 4GK5E 1YQ4A 4KI0F 5IHYA 5L3BB 4HGAA 3AE4A 5KMGP 1B7TA 4YSYA 4LFAT 1OEDA 2BKPA 4L5GA 3FZHB 4JI5T 4U7YA 4Q25A 4DV4T 4LF6T 4ISSA 3C4ZA 2YDQA 1IZNB 4LF5T 1I6ZA 2LHRA 1X79A 1HNZT 3LK42 1GQEA 1E1HB 3M3ZB 2XQYA 4UF0B 1T72A 4ASKA 3PUXF 2E9XB 3PJAA 1WCRA 2LOSA 3SOLA 2CLYC 2V6YB 4ZI2C 3UU6A 4I50E 3RRWA 4PFPA 3E0ZA 5KX5E 2Y6XA 1MNDA 5FVKA 1HG2A 3RX6A 2V7MA 2WDRA 4DBRA 2M6IA 2E5LT 2H88A 2AXDS 2JQQA 2LHNA 1XZYA 4LF8T 2BVLA 5HXEA 4YLHA 2LSGA 3HR0A 3FXEB 2CCQA 4WNKA 4X1IE 1Z8UA 3ZMSB 2KNDA 3C98B 2V6XA 2X9HA 3Q2MA 4CI2B 4P09A 2D0TA 2DNXA 4XZCA 2OA5A 1D1BA 4IGUA 4QH4A 2NW7A 1T98A 5ABHA 4G63A 2FBWA 4CXYA 5KXJA 1SA0E 4L0RA 2VQFT 4MALA 2KWIB 4PK5A 2W63A 3ETVA 3SRZA 1FIOA 3ZYKA 4O2AE 1IBMT 4A56A 1NENA 1YQ3A 5BR8T 2DHRA 2X0LB 3GMIA 2UXCT 3GN5B 4EXTA 3SS1A 3EABA 2NR4A 4ZS2A 2L9QA 3Q5WA 5CJ5A 3J7Yq 4V1Av 1LKXA 4JUYA 3N9QA 2KINB 2DLRA 3OJAA 2NP9A 2P9BA 3O4XE 3PUZF 2NW8A 4GKKT 3LSVA 2YKSA 4DV0T 3TLVA 3NVOA 2JMHA 3ZT6A 4DV3T 4CN1A 2MBGA 2V5CA 3F31A 4PW8A 4AKHA 5AFUL 4YHHT 3ZC0A 1D0ZA 3VR9A 5FNVE 1UGOA 5FL0A 3EAMA 4DR4T 2X67A 5J1GA 3K8PC 5EK4A 4E7SA 4YSZA 2BG9E 5HEUA 4IE7A 4TZ4C 1KNZA 2YOEA 3UT5E 5C3JA 2DWKA 5LGNB 3K3OA 4DR1T 3TLTA 1MMGA 4HFIA 1D1CA 4H9PC 1OEDB 5F8PA 3C4WA 4AISA 2ZLYA 2XTLA 5C8YE 2BS3A 2F4VT 3I9YA 3U78A 4X62T 3B5MA 5JR9A 4OYKA 3W15B 1YXRA 4YFSA 2BS2A 5CGMA 2WSSV 4UVBB 1ZP0A 3N9NA 3FBZA 4EYYR 4TV9E 4GOUA 5JDNA 3MXZA 2LSYA 2XQ3A 3KDSE 4OFZA 3OTOT 2XZEA 5AQVB 4O2BE 4COFA 2WBLA 4ILAA 3KV9A 2BBJA 2VKDA 2XAQB 2DCFA 3NBXX 1FEWA 2WZIA 4H63V 2VASA 4LMKA 3ZPOA 3VKGA 3N9MA 2BG9C 2L3LA 4HWFA 1HNWT 3RC8A 1LRZA 4JEHB 4ZZBA 1J5ET 5JDHA 3A5XA 5LBMA 3ZLIA 2XSAA 4U31A 4TWHA 2LKGA 3CVRA 2R6GF 2LM9A 3ZYMA 2CWYA 2IIUA 2UUCT 5DQWA 3ZJ1A 4H9RC 4C90A 2QGSA 4U72A 4H9NC 3E22E 2FJBA 5H6RB 1Z0PA 3FXDB 3LK2B 2PJQA 2BVMA 2XQ9A 4DMWA 2RA1A 2XPKA 1WRDA 2ZM0A 2H3RA 2AE9A 5HXCA 2XAGB 2WWVA 4IDOA 5HXSA 2XM1A 3A8YC 2IAKA 4I55E 1OWAA 3BQKA 3TLUA 2E8IA 4OX9T 1W09A 3CKDA 5AQOB 4ILCA 3B13A 2CMRA 3JC6D 2W0GA 3QK6A 3ONJA 3PUAA 3P4RA 4K0UA 3LDQB 1N32T 1HCIA 2K9AA 1JNZA 3AE7A 4J2CA 5AQLB 1L0VA 4AKLA 3RLFF 3PU8A 5HXHA 4GIWA 2VB6A 2X9WA 4QX7B 3EVYA 2J47A 2ZM2A 3AE3A 4QXBB 3AECA 4JBWF 1KK7A 2OLTA 3UULA 3RIAA 4DNDA 4AQYT 2LSIA 3CX6B 4QWNB 5L3FB 3P7IA 1T8BA 5H6QB 3C4XA 1UK5A 4C91A 4PFOA 3AA6B 5LOVE 1R8IA 3MKDA 2UXBT 2UU9T 1XMQT 3AE2A 5LYJE 5DQVA 4DR2T 1HTJF 4ILBA 3QC9A 3IHRA 2LJLA 2ES0A 2WCAA 2E2AA 4MFRA 4CXWA 3UU5A 3J9X1 3CWZB 2KLQA 4H9QC 2YEVC 5J0ZA 2JJ9A 4B6XA 2NTXA 4DVDA 5JR9B 3RQWA 2FJAA 4WW0A 3AVSA 3AEEA 4I4TE 3ZMZB 4X64T 1QSDA 2C0SA 4O8SA 4KHZF 2CPTA 4TN7B 4TWFA 2CHNA 3TKLB 5AQSB 3EDUA 3ZYLA 2I59A 3ONXA 4DUYT 3AVRA 4P0AA 2LRLA 4XBFB 3U3IA 4PJJA 3M65A 1HS7A 3P50A 4X20E 5AQMB 3PUVF 2XQ5A 3GWHA 2VKOA 3T1HT 3ONLC 4HEAA 2VURA 3NWIA 3Q9DA 3EI0A 3PU3A 4CI3B 1UX5A 1MMDA 1NEKA 2FJDA 2KMFA 1HX8A 4LF7T 3L8RA 5ABEA 2UUBT 4OYJA 2QYWA 3PE0A 5HWYA 4QH5A 4HFBA 4U3CA 4A5XA 4CI1B 4FI5A 5L3DB 4EB6E 3IEEA 5ETWA 3CK6A 1MMAA 3ETUA 3WI3A 2BKOA 1SUMB 4IDQA 4ZI3D 1NWMX 3RIUC 4XAXB 4N78D 4HFHA 3OKQA 1BR4A 4HE8A 5LA6E 4DV1T 4AXPA 1JNRA 1EZ3A 2D0UA 4OHFA 4KBMB 2EHOC 4ILUA 1IJ5A 4HFVA 3UTKA 5FVLA 2H7OA 4KP3C 4QH1A 5JH7E 5LHHB 4EAHA 1N36T 4O4JE 2K48A 3KFWX 1MNEA 1MIVA 5F3JA 3HKCE 3IBPA 4F6RC 3O1HA 3AE1A 2JMKA 4I0UA 4BJNA 4U7IA 4X65T 2LT3A 3RQUA 1WR6A 2BKNA 3VKHA 2HN1A 2YINA 2E9XC 2WDVA 1G73A 5M4YA 4UELA 4OK0A 4NPPA 3E08A 3AXJA 4ADZA 2LKHA 4HWHA 4PK4A 1I94T 2KT9A 1M7KA 5AQIB 2N9DA 2OV9A 2CXLA 3WAKA 2LM2A 2KSRA 2D5UA 1J5WA 3UFGA 3O1IA 5EZYE 3VR8A 4ZHQE 3N2OA 2D9DA 5FXWA 5LP6E 5FXZA 1X9BA 4AI6A 4IDZA 2C5JA 2LRKA 1UUSA 2UXXB 1KF6A 4GYSA 2B1EA 3L3PA 3PUYF 3PUWF 3ZN0B 4HWCA 5L3EB 5J2UE 5HAXA
chains in the Genus database with same CATH topology
1N32T 4DUYT 4DV7T 4LFAT 4DR4T 4KHPT 4B3MT 1N36T 2UXDT 4JI5T 4DV4T 1IBKT 4LF6T 1HNWT 2VQFT 1HNXT 4JYAT 2HHHT 4LF5T 2ZM6T 4JI6T 4AQYT 1XNRT 3T1HT 1J5ET 4DR6T 4JI7T 4JI4T 4DV5T 4DR1T 1HNZT 4DR5T 4DUZT 1IBMT 4NXMT 4JI2T 4X65T 4JI8T 5IWAT 4LF7T 5BR8T 3T1YT 2UXCT 2UUCT 4NXNT 4DR3T 1N33T 2UXBT 2F4VT 2UUBT 2UU9T 1IBLT 4X62T 1XMQT 4K0KT 4JI0T 4LF9T 4B3TT 4GKJT 1I94T 4DR2T 2UUAT 4YY3T 4X66T 4B3RT 4DV6T 4DR7T 4LF4T 4GKKT 4JI3T 2VQET 4B3ST 1HR0T 3OTOT 1XMOT 1N34T 2E5LT 4OX9T 5LMUT 4LF8T 4DV1T 4DV0T 4X64T 4DV3T 1FJGT 1XNQT 4JI1T 5LMNT 4JV5T 4YHHT 4LFBT 4DV2T 4LFCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 T;  4DUY T;  4DV7 T;  4LFA T;  4DR4 T;  4KHP T;  4B3M T;  1N36 T;  2UXD T;  4JI5 T;  4DV4 T;  1IBK T;  4LF6 T;  1HNW T;  2VQF T;  1HNX T;  4JYA T;  2HHH T;  4LF5 T;  2ZM6 T;  4JI6 T;  4AQY T;  1XNR T;  3T1H T;  1J5E T;  4DR6 T;  4JI7 T;  4JI4 T;  4DV5 T;  4DR1 T;  1HNZ T;  4DR5 T;  4DUZ T;  1IBM T;  4NXM T;  4JI2 T;  4X65 T;  4JI8 T;  5IWA T;  4LF7 T;  5BR8 T;  3T1Y T;  2UXC T;  2UUC T;  4NXN T;  4DR3 T;  1N33 T;  2UXB T;  2F4V T;  2UUB T;  2UU9 T;  1IBL T;  4X62 T;  1XMQ T;  4K0K T;  4JI0 T;  4LF9 T;  4B3T T;  4GKJ T;  1I94 T;  4DR2 T;  2UUA T;  4YY3 T;  4X66 T;  4B3R T;  4DV6 T;  4DR7 T;  4LF4 T;  4GKK T;  4JI3 T;  2VQE T;  4B3S T;  1HR0 T;  3OTO T;  1XMO T;  1N34 T;  2E5L T;  4OX9 T;  5LMU T;  4LF8 T;  4DV1 T;  4DV0 T;  4X64 T;  4DV3 T;  1FJG T;  1XNQ T;  4JI1 T;  5LMN T;  4JV5 T;  4YHH T;  4LFB T;  4DV2 T;  4LFC T; 
#chains in the Genus database with same CATH topology
 3JAD A;  5JDF A;  4I43 B;  3PJA J;  4HKA A;  5LG4 A;  4TV8 E;  1HG5 A;  3PUS A;  3HL6 A;  1MMN A;  2W61 A;  3D0T A;  2A9U A;  1M62 A;  4JYA T;  1UCU A;  3FZK B;  3PUR A;  3CPZ A;  4PNI A;  2WDQ A;  4ZOL E;  5LCY A;  3C50 A;  4IRE A;  4ZEY A;  1WYC A;  2WQY A;  1OED E;  5AQT B;  2LOP A;  4IIJ E;  2Q9Q A;  4BAY B;  2CEA A;  5LJN A;  4YSX A;  4U33 A;  3ABV A;  3KV5 A;  1ZKE A;  4NUV A;  4AQG A;  4GKJ T;  3RYC E;  3UFE A;  5LHG B;  4YY3 T;  1NAF A;  2CRB A;  3RKO A;  5AQP B;  2G0U A;  2NWB A;  5JVD E;  1W0A A;  2PBI A;  4UV8 B;  3KBT A;  2ODV A;  4AKI A;  4NUU A;  4B3S T;  3FZM B;  3PV0 F;  4AIU A;  4IE6 A;  1BR2 A;  4UVA B;  3ZMV B;  1YD8 G;  4YTM A;  1D0Y A;  3KVB A;  5FMN A;  2QRX A;  4MLK A;  4AQF C;  5CFB A;  2PFV A;  4LFB T;  2J62 A;  2VWA A;  4TNW A;  4HFC A;  1SE7 A;  4CQI A;  2MYS A;  3EHZ A;  5AQQ B;  2V7L A;  2DL1 A;  2ODU A;  3LJC A;  3ZMT B;  4FJO A;  2UXD T;  1HF8 A;  1WR0 A;  2M67 A;  4ZXL A;  3OPC A;  4YT0 A;  3I1A A;  3FZL B;  3IF8 B;  3ANW A;  4DO0 A;  4EED A;  3AEB A;  2Q9Q D;  1OED C;  4A98 A;  4EIW A;  5JRE A;  3NRX A;  3JCF A;  1HFA A;  5JQG E;  2ACX A;  3LFM A;  3RH3 A;  4F8H A;  1W9R A;  1KFY A;  3N9P A;  3P4P A;  2VK9 A;  5ADX L;  4NIQ A;  3KV6 A;  3NRY A;  1D0X A;  1YKE B;  5JDQ A;  4HTE A;  4DBQ A;  2DWG A;  2BDE A;  4A97 A;  4JI3 T;  5E0O A;  3ZKR A;  2GK9 A;  5TAO A;  2KZ7 B;  5LG3 A;  3N2G E;  1N34 T;  1AJ3 A;  3UQ4 A;  4PJL A;  3K3Q C;  4YHJ A;  3H3M A;  2E9X A;  1E2A A;  3UU4 A;  1XNQ T;  1S35 A;  2IC9 A;  2WB5 A;  2HH7 A;  3WAJ A;  1FMW A;  4YTN A;  3MK7 C;  4EV6 A;  3P8C D;  3AEF A;  4H63 H;  4LFC T;  3RHW A;  1J1J A;  3OYZ A;  1LVK A;  2X66 A;  3HA4 A;  1LVF A;  3AEG A;  4KHP T;  2V1D B;  4KX6 A;  4U2Y A;  3EUH A;  2YK0 A;  2X51 A;  1HNX T;  2BZB A;  2HHH T;  2XQ4 A;  2ZM6 T;  4JI6 T;  4KUM B;  4DR6 T;  3EDV A;  3OVU A;  2CWO A;  2X9Y A;  4DUZ T;  2NW9 A;  2QVA A;  3LG7 A;  3P4S A;  3MJX A;  2H7V C;  1QLB A;  3K3N A;  4X1Y E;  5HEH A;  2V7I A;  2N2N A;  4Z90 A;  5AQN B;  4X1K E;  4HFD A;  2XUE A;  3R84 B;  4K0K T;  4JLE A;  2XSB A;  3ZCI A;  3IA3 A;  2JQK A;  5F5W A;  5KDM C;  4PK6 A;  3ZT5 A;  4YTP A;  4DV6 T;  2Q9Q B;  2WMO A;  4DR7 T;  1VCT A;  5AQR B;  5AQH B;  1XMO T;  2H89 A;  4IE4 A;  2CHO A;  4WBN E;  2FJE A;  2YDR A;  2A2F X;  3CQC B;  3GN5 A;  2WS3 A;  3DP7 A;  4LMJ A;  2J4G A;  4CXX A;  1XDO A;  5IYZ E;  3UUB A;  4BJM A;  4AKG A;  1YKH B;  4O4I E;  2JIW A;  1Y64 B;  1MIY A;  1Y01 A;  3CX7 B;  2W67 A;  2CA5 A;  4UR9 A;  1IJ6 A;  4PJM A;  1IAP A;  2V26 A;  4UVC B;  2MOZ A;  3ZEF B;  4JI7 T;  1O3X A;  3RYI E;  2I6H A;  3AEA A;  5EK3 A;  3NZQ A;  2WZH A;  4NXM T;  3O9X A;  4JI2 T;  4LML A;  1FMV A;  3RKG A;  2WP9 A;  3R6N A;  2CXF A;  1N33 T;  2CLY B;  2W4X A;  2WAU A;  3H3A A;  4DID B;  1DU2 A;  3TLS A;  3FB2 A;  3ANW B;  3V5S A;  3RRC A;  2E5V A;  3ZJ2 A;  3K1S A;  3LBX A;  2UUA T;  2WWU A;  4IT4 A;  2CM0 A;  4X66 T;  2X68 A;  2HN2 A;  3S4U A;  3CML A;  4UEM A;  2VKH A;  3SFD A;  5FY1 A;  3QOF A;  3L39 A;  5JR9 C;  3BQL A;  1ZEE A;  4QXH B;  2X0H A;  2BG9 A;  4WBO A;  4CN4 A;  1XWM A;  5LJM A;  4DMV A;  3ZT7 A;  4ZI7 E;  4JV5 T;  5FYM A;  5J2T E;  4P0B A;  3JAE A;  3ZCJ A;  2ZM8 A;  3P4W A;  4ERR A;  4HFE A;  3C64 A;  2HPJ A;  5DJQ C;  3QNU A;  2LE8 A;  2C5I T;  1WLX A;  3LK3 B;  2YU2 A;  1VRB A;  3N2K E;  3JC6 C;  2W62 A;  5HCM A;  2K3W A;  4DR5 T;  1HX1 B;  4ZZC A;  2Y48 B;  1YW0 A;  2UXN B;  5L2L A;  3AA1 B;  4IE5 A;  4TX5 A;  3P4Q A;  2BBH A;  3NZP A;  2X9X A;  5CB4 E;  4Z91 A;  2B76 A;  2FUP A;  3A7M A;  3SFE A;  4B3T T;  1U4Q A;  1ZOY A;  2CXD A;  2KXP B;  4PJN A;  5L4H A;  4B3R T;  3V5U A;  1CHU A;  5FP3 A;  4EEB A;  5FXX A;  2YDS A;  3ZST A;  2ZMA A;  5AQK B;  2XQ6 A;  1HR0 T;  3AAI A;  2LLY A;  4HWI B;  4CZZ B;  4IDP A;  5HXR A;  4GK0 E;  4QXC B;  4HN9 A;  3AE9 A;  4IHJ E;  5DAB A;  5LGT B;  2XM2 A;  3UQ7 A;  4QKN A;  5L3C B;  1XDP A;  4CN6 A;  5GON E;  4DV7 T;  4YJ2 E;  5LB7 B;  2YN6 A;  2YU1 A;  2XAJ B;  2CBI A;  5JDL A;  1WYB A;  1H7C A;  3AE5 A;  4EOZ B;  2W66 A;  5FXV A;  1W0B A;  2J1D G;  3CIR A;  3BK9 A;  2IC6 A;  2MPK A;  3VRB A;  2NTY A;  3TLW A;  1BR1 A;  5IWA T;  2A3D A;  5ABF A;  4DR3 T;  2WU2 A;  2MAW A;  2LSJ A;  3AAA B;  3Q5D A;  1KNP A;  2PG8 A;  5HEO A;  5FY0 A;  5AQF B;  3CQG B;  3UUX B;  2MTQ A;  3N9L A;  3MAC A;  4JI0 T;  1G8X A;  2X0Y A;  3ZSS A;  1OXZ A;  2JPF A;  4UV9 B;  5LXT E;  1MIW A;  4AKR B;  3T8O A;  5JDG A;  2D2S A;  5C2T A;  2VQE T;  1VCS A;  5L4E A;  2VVS A;  4PAG A;  3LBX B;  3RF1 A;  2V5D A;  3ESL A;  2XAS B;  3CX8 B;  4O4L E;  2XQA A;  2I0M A;  2KWH A;  4IL9 A;  1U5P A;  4BA9 A;  4P1N A;  5JTG A;  4ZS3 A;  4DV2 T;  4ZI3 C;  2XAH B;  3HKE E;  1ZHC A;  2Y8D A;  4EZH A;  5HCJ A;  1KEY A;  2ACZ A;  1V9D A;  3F57 A;  1UX4 A;  2BG9 B;  3KVA A;  2IDO B;  2JQH A;  2Z6E A;  2JRK A;  2XQ7 A;  2M6B A;  5A1L A;  3F2E A;  3RPU A;  1XNR T;  3AE6 A;  2A72 A;  4JI4 T;  4MBQ A;  4TUY E;  3KIN B;  3O1J A;  5L3G B;  2XY8 B;  3FBL A;  3JAF A;  4U2Z A;  3B57 A;  5JRC A;  3KBU A;  4IST A;  3T1Y T;  3RYH E;  3N9O A;  4YXD A;  4G2A A;  1E7P A;  3RIU A;  1IBL T;  1VOM A;  3FHN A;  4H9O C;  3DJB A;  1US7 B;  2IML A;  3OBV E;  4QHO A;  4TWD A;  5AQU B;  5LGU B;  3ZMU B;  1BR0 A;  2HPL A;  2VKJ A;  2WY2 A;  3UUM A;  2VVN A;  2EHO A;  3PUG A;  1S94 A;  5FY7 A;  2XJ7 A;  2V7K A;  4H9S E;  4ANJ A;  3BQI A;  1SHZ C;  5ABG A;  5LHI B;  3AAE B;  3UU8 A;  3AA0 B;  3I0Q A;  5EK2 A;  3G06 A;  2IHR 1;  5CA1 E;  4JEU B;  3ZN1 B;  3QB5 K;  5AQJ B;  3UUN A;  5LMN T;  1D1A A;  2W00 A;  3I9W A;  2N1G A;  2LEH A;  1CUN A;  3AXJ B;  3AA7 B;  4UF0 A;  1UUR A;  3UU3 A;  2V8S V;  2V7J A;  4B3M T;  2RP4 A;  2WMN A;  3PTR B;  2VL0 A;  2K5B B;  2V6Y A;  2QA7 A;  4DV5 T;  3Q5E A;  4U74 A;  3CQX C;  5HYA A;  2JQ9 A;  3VHL A;  4GYR A;  4HWD A;  3VRA A;  2SPC A;  1KNR A;  3HKD E;  2NOX A;  4M1P A;  4ZI2 D;  3QUJ A;  4MHC A;  3HI2 A;  5FL1 A;  4LF9 T;  3GA8 A;  3AED A;  5HEG A;  4X5T A;  2EHO D;  2XHE B;  4WZX A;  3RGL A;  5ABF B;  3OYX A;  2DI4 A;  3SWH A;  3ZC1 A;  3DTO A;  4IDN A;  2K24 A;  2CBJ A;  5HWX A;  2LSK A;  3RC3 A;  3AE8 A;  2CE7 A;  3QB5 A;  4EZ4 A;  5LMU T;  3X1D A;  4JI1 T;  3KV4 A;  2L8K A;  4O4H E;  3RI5 A;  3PUQ A;  4QX8 B;  4IL4 A;  4E7Z A;  5JDM A;  3C51 A;  4Z8X A;  2VL8 A;  2E9X D;  2RPA A;  1QUU A;  5IUX A;  2C5K T;  3FZF B;  4L9I A;  4WYV A;  1IBK T;  3NKZ A;  3HKB E;  2IUB A;  5AQG B;  5LBQ B;  2XQ8 A;  4EGW A;  1T7S A;  3I0O A;  5L47 A;  3RYF E;  3AB3 B;  4JI8 T;  4UXN B;  4EYU A;  4YJ3 E;  3PDY A;  4NXN T;  3H37 A;  2BS4 A;  3MZK B;  4UIG A;  5LNK A;  3L09 A;  2PTF A;  5JRC B;  1ZV4 X;  2Q9Q C;  4AQF A;  4IE0 A;  3N5L A;  4LF4 T;  5FKY A;  3RIF A;  1WFD A;  3MA9 A;  2IW5 B;  5BMV E;  4TNV A;  3VU7 H;  3Q5X A;  5HEJ A;  5CA0 E;  1FJG T;  2WM9 A;  2W2U A;  4KMC A;  2EHO B;  2XAF B;  2WU5 A;  4GK5 E;  1YQ4 A;  4KI0 F;  5IHY A;  5L3B B;  4HGA A;  3AE4 A;  5KMG P;  1B7T A;  4YSY A;  4LFA T;  1OED A;  2BKP A;  4L5G A;  3FZH B;  4JI5 T;  4U7Y A;  4Q25 A;  4DV4 T;  4LF6 T;  4ISS A;  3C4Z A;  2YDQ A;  1IZN B;  4LF5 T;  1I6Z A;  2LHR A;  1X79 A;  1HNZ T;  3LK4 2;  1GQE A;  1E1H B;  3M3Z B;  2XQY A;  4UF0 B;  1T72 A;  4ASK A;  3PUX F;  2E9X B;  3PJA A;  1WCR A;  2LOS A;  3SOL A;  2CLY C;  2V6Y B;  4ZI2 C;  3UU6 A;  4I50 E;  3RRW A;  4PFP A;  3E0Z A;  5KX5 E;  2Y6X A;  1MND A;  5FVK A;  1HG2 A;  3RX6 A;  2V7M A;  2WDR A;  4DBR A;  2M6I A;  2E5L T;  2H88 A;  2AXD S;  2JQQ A;  2LHN A;  1XZY A;  4LF8 T;  2BVL A;  5HXE A;  4YLH A;  2LSG A;  3HR0 A;  3FXE B;  2CCQ A;  4WNK A;  4X1I E;  1Z8U A;  3ZMS B;  2KND A;  3C98 B;  2V6X A;  2X9H A;  3Q2M A;  4CI2 B;  4P09 A;  2D0T A;  2DNX A;  4XZC A;  2OA5 A;  1D1B A;  4IGU A;  4QH4 A;  2NW7 A;  1T98 A;  5ABH A;  4G63 A;  2FBW A;  4CXY A;  5KXJ A;  1SA0 E;  4L0R A;  2VQF T;  4MAL A;  2KWI B;  4PK5 A;  2W63 A;  3ETV A;  3SRZ A;  1FIO A;  3ZYK A;  4O2A E;  1IBM T;  4A56 A;  1NEN A;  1YQ3 A;  5BR8 T;  2DHR A;  2X0L B;  3GMI A;  2UXC T;  3GN5 B;  4EXT A;  3SS1 A;  3EAB A;  2NR4 A;  4ZS2 A;  2L9Q A;  3Q5W A;  5CJ5 A;  3J7Y q;  4V1A v;  1LKX A;  4JUY A;  3N9Q A;  2KIN B;  2DLR A;  3OJA A;  2NP9 A;  2P9B A;  3O4X E;  3PUZ F;  2NW8 A;  4GKK T;  3LSV A;  2YKS A;  4DV0 T;  3TLV A;  3NVO A;  2JMH A;  3ZT6 A;  4DV3 T;  4CN1 A;  2MBG A;  2V5C A;  3F31 A;  4PW8 A;  4AKH A;  5AFU L;  4YHH T;  3ZC0 A;  1D0Z A;  3VR9 A;  5FNV E;  1UGO A;  5FL0 A;  3EAM A;  4DR4 T;  2X67 A;  5J1G A;  3K8P C;  5EK4 A;  4E7S A;  4YSZ A;  2BG9 E;  5HEU A;  4IE7 A;  4TZ4 C;  1KNZ A;  2YOE A;  3UT5 E;  5C3J A;  2DWK A;  5LGN B;  3K3O A;  4DR1 T;  3TLT A;  1MMG A;  4HFI A;  1D1C A;  4H9P C;  1OED B;  5F8P A;  3C4W A;  4AIS A;  2ZLY A;  2XTL A;  5C8Y E;  2BS3 A;  2F4V T;  3I9Y A;  3U78 A;  4X62 T;  3B5M A;  5JR9 A;  4OYK A;  3W15 B;  1YXR A;  4YFS A;  2BS2 A;  5CGM A;  2WSS V;  4UVB B;  1ZP0 A;  3N9N A;  3FBZ A;  4EYY R;  4TV9 E;  4GOU A;  5JDN A;  3MXZ A;  2LSY A;  2XQ3 A;  3KDS E;  4OFZ A;  3OTO T;  2XZE A;  5AQV B;  4O2B E;  4COF A;  2WBL A;  4ILA A;  3KV9 A;  2BBJ A;  2VKD A;  2XAQ B;  2DCF A;  3NBX X;  1FEW A;  2WZI A;  4H63 V;  2VAS A;  4LMK A;  3ZPO A;  3VKG A;  3N9M A;  2BG9 C;  2L3L A;  4HWF A;  1HNW T;  3RC8 A;  1LRZ A;  4JEH B;  4ZZB A;  1J5E T;  5JDH A;  3A5X A;  5LBM A;  3ZLI A;  2XSA A;  4U31 A;  4TWH A;  2LKG A;  3CVR A;  2R6G F;  2LM9 A;  3ZYM A;  2CWY A;  2IIU A;  2UUC T;  5DQW A;  3ZJ1 A;  4H9R C;  4C90 A;  2QGS A;  4U72 A;  4H9N C;  3E22 E;  2FJB A;  5H6R B;  1Z0P A;  3FXD B;  3LK2 B;  2PJQ A;  2BVM A;  2XQ9 A;  4DMW A;  2RA1 A;  2XPK A;  1WRD A;  2ZM0 A;  2H3R A;  2AE9 A;  5HXC A;  2XAG B;  2WWV A;  4IDO A;  5HXS A;  2XM1 A;  3A8Y C;  2IAK A;  4I55 E;  1OWA A;  3BQK A;  3TLU A;  2E8I A;  4OX9 T;  1W09 A;  3CKD A;  5AQO B;  4ILC A;  3B13 A;  2CMR A;  3JC6 D;  2W0G A;  3QK6 A;  3ONJ A;  3PUA A;  3P4R A;  4K0U A;  3LDQ B;  1N32 T;  1HCI A;  2K9A A;  1JNZ A;  3AE7 A;  4J2C A;  5AQL B;  1L0V A;  4AKL A;  3RLF F;  3PU8 A;  5HXH A;  4GIW A;  2VB6 A;  2X9W A;  4QX7 B;  3EVY A;  2J47 A;  2ZM2 A;  3AE3 A;  4QXB B;  3AEC A;  4JBW F;  1KK7 A;  2OLT A;  3UUL A;  3RIA A;  4DND A;  4AQY T;  2LSI A;  3CX6 B;  4QWN B;  5L3F B;  3P7I A;  1T8B A;  5H6Q B;  3C4X A;  1UK5 A;  4C91 A;  4PFO A;  3AA6 B;  5LOV E;  1R8I A;  3MKD A;  2UXB T;  2UU9 T;  1XMQ T;  3AE2 A;  5LYJ E;  5DQV A;  4DR2 T;  1HTJ F;  4ILB A;  3QC9 A;  3IHR A;  2LJL A;  2ES0 A;  2WCA A;  2E2A A;  4MFR A;  4CXW A;  3UU5 A;  3J9X 1;  3CWZ B;  2KLQ A;  4H9Q C;  2YEV C;  5J0Z A;  2JJ9 A;  4B6X A;  2NTX A;  4DVD A;  5JR9 B;  3RQW A;  2FJA A;  4WW0 A;  3AVS A;  3AEE A;  4I4T E;  3ZMZ B;  4X64 T;  1QSD A;  2C0S A;  4O8S A;  4KHZ F;  2CPT A;  4TN7 B;  4TWF A;  2CHN A;  3TKL B;  5AQS B;  3EDU A;  3ZYL A;  2I59 A;  3ONX A;  4DUY T;  3AVR A;  4P0A A;  2LRL A;  4XBF B;  3U3I A;  4PJJ A;  3M65 A;  1HS7 A;  3P50 A;  4X20 E;  5AQM B;  3PUV F;  2XQ5 A;  3GWH A;  2VKO A;  3T1H T;  3ONL C;  4HEA A;  2VUR A;  3NWI A;  3Q9D A;  3EI0 A;  3PU3 A;  4CI3 B;  1UX5 A;  1MMD A;  1NEK A;  2FJD A;  2KMF A;  1HX8 A;  4LF7 T;  3L8R A;  5ABE A;  2UUB T;  4OYJ A;  2QYW A;  3PE0 A;  5HWY A;  4QH5 A;  4HFB A;  4U3C A;  4A5X A;  4CI1 B;  4FI5 A;  5L3D B;  4EB6 E;  3IEE A;  5ETW A;  3CK6 A;  1MMA A;  3ETU A;  3WI3 A;  2BKO A;  1SUM B;  4IDQ A;  4ZI3 D;  1NWM X;  3RIU C;  4XAX B;  4N78 D;  4HFH A;  3OKQ A;  1BR4 A;  4HE8 A;  5LA6 E;  4DV1 T;  4AXP A;  1JNR A;  1EZ3 A;  2D0U A;  4OHF A;  4KBM B;  2EHO C;  4ILU A;  1IJ5 A;  4HFV A;  3UTK A;  5FVL A;  2H7O A;  4KP3 C;  4QH1 A;  5JH7 E;  5LHH B;  4EAH A;  1N36 T;  4O4J E;  2K48 A;  3KFW X;  1MNE A;  1MIV A;  5F3J A;  3HKC E;  3IBP A;  4F6R C;  3O1H A;  3AE1 A;  2JMK A;  4I0U A;  4BJN A;  4U7I A;  4X65 T;  2LT3 A;  3RQU A;  1WR6 A;  2BKN A;  3VKH A;  2HN1 A;  2YIN A;  2E9X C;  2WDV A;  1G73 A;  5M4Y A;  4UEL A;  4OK0 A;  4NPP A;  3E08 A;  3AXJ A;  4ADZ A;  2LKH A;  4HWH A;  4PK4 A;  1I94 T;  2KT9 A;  1M7K A;  5AQI B;  2N9D A;  2OV9 A;  2CXL A;  3WAK A;  2LM2 A;  2KSR A;  2D5U A;  1J5W A;  3UFG A;  3O1I A;  5EZY E;  3VR8 A;  4ZHQ E;  3N2O A;  2D9D A;  5FXW A;  5LP6 E;  5FXZ A;  1X9B A;  4AI6 A;  4IDZ A;  2C5J A;  2LRK A;  1UUS A;  2UXX B;  1KF6 A;  4GYS A;  2B1E A;  3L3P A;  3PUY F;  3PUW F;  3ZN0 B;  4HWC A;  5L3E B;  5J2U E;  5HAX A; 
#chains in the Genus database with same CATH homology
 1N32 T;  4DUY T;  4DV7 T;  4LFA T;  4DR4 T;  4KHP T;  4B3M T;  1N36 T;  2UXD T;  4JI5 T;  4DV4 T;  1IBK T;  4LF6 T;  1HNW T;  2VQF T;  1HNX T;  4JYA T;  2HHH T;  4LF5 T;  2ZM6 T;  4JI6 T;  4AQY T;  1XNR T;  3T1H T;  1J5E T;  4DR6 T;  4JI7 T;  4JI4 T;  4DV5 T;  4DR1 T;  1HNZ T;  4DR5 T;  4DUZ T;  1IBM T;  4NXM T;  4JI2 T;  4X65 T;  4JI8 T;  5IWA T;  4LF7 T;  5BR8 T;  3T1Y T;  2UXC T;  2UUC T;  4NXN T;  4DR3 T;  1N33 T;  2UXB T;  2F4V T;  2UUB T;  2UU9 T;  1IBL T;  4X62 T;  1XMQ T;  4K0K T;  4JI0 T;  4LF9 T;  4B3T T;  4GKJ T;  1I94 T;  4DR2 T;  2UUA T;  4YY3 T;  4X66 T;  4B3R T;  4DV6 T;  4DR7 T;  4LF4 T;  4GKK T;  4JI3 T;  2VQE T;  4B3S T;  1HR0 T;  3OTO T;  1XMO T;  1N34 T;  2E5L T;  4OX9 T;  5LMU T;  4LF8 T;  4DV1 T;  4DV0 T;  4X64 T;  4DV3 T;  1FJG T;  1XNQ T;  4JI1 T;  5LMN T;  4JV5 T;  4YHH T;  4LFB T;  4DV2 T;  4LFC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...