1XMOT

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xmoT00
4LFAT 4JI5T 4DR4T 4X64T 4NXNT 4X66T 2UXCT 2VQFT 2UXBT 4OX9T 4DV4T 2UXDT 1I94T 4JYAT 4LF9T 4JI3T 4GKJT 3T1HT 1N32T 2UUBT 4LFBT 1HNXT 4X62T 2F4VT 4DUYT 1HR0T 4JI0T 4LFCT 1IBKT 1XMQT 4DV2T 5LMUT 1HNZT 4DV5T 2E5LT 4DV1T 4YHHT 4B3RT 2UU9T 4JI1T 4DR7T 4JI4T 4JI2T 4KHPT 4DV3T 4DV7T 5BR8T 1FJGT 5LMNT 1XNQT 5IWAT 1IBMT 4JV5T 1N36T 4JI7T 2ZM6T 1N34T 4B3MT 4GKKT 4LF6T 4DV0T 2UUAT 4K0KT 4DV6T 4LF7T 4DUZT 1J5ET 4DR5T 1XMOT 4DR3T 4X65T 4JI6T 4B3TT 4B3ST 3OTOT 4AQYT 1N33T 1IBLT 4LF8T 4DR1T 2VQET 4LF4T 2UUCT 4JI8T 1XNRT 4DR2T 4DR6T 3T1YT 4YY3T 4LF5T 4NXMT 1HNWT 2HHHT
chains in the Genus database with same CATH superfamily
5AQKB 3HA4A 4JLEA 4GOUA 1WR0A 3AB3B 3DP7A 5LGNB 2C5JA 1OWAA 2VWAA 3DTOA 3ZKRA 2BBJA 3SFDA 3LBXB 1IAPA 1N32T 4ADZA 4KBMB 2XTLA 3V5SA 3N2OA 2J4GA 1D1CA 3B57A 2J1DG 4O2BE 3U78A 2YDRA 3MKDA 3VR8A 3P4PA 4JI2T 2WY2A 3JC6C 2YDQA 3GMIA 2B1EA 4L0RA 5AQVB 2UXNB 5CA0E 3ZMTB 4DV0T 4EIWA 3ANWA 5DQWA 4XBFB 2K48A 3ZSSA 4PJMA 2JQQA 3UQ4A 4C91A 1QUUA 3EABA 1N33T 4YTPA 4NIQA 2E9XB 5ABGA 5J2UE 1HX8A 2WAUA 5E0OA 2LT3A 2XAFB 4ISSA 3ZT6A 2X0HA 5DQVA 2CLYB 3EHZA 3I0OA 2WU5A 5C2TA 2X9YA 4XAXB 4MALA 1KNRA 4QH5A 2J47A 4QH4A 4ZZBA 1SHZC 3OVUA 4IE0A 2V5DA 4H9PC 4GK5E 3CIRA 5JQGE 1I94T 3RKOA 2CXDA 2NTYA 2W67A 2XUEA 4L9IA 4P0BA 4LFBT 4JI0T 2LOPA 2HPJA 4HGAA 3KV4A 3UUXB 3CQXC 3ONJA 1BR1A 3PUSA 2M6BA 2NW9A 4I43B 4DV3T 2D5UA 3VR9A 5BR8T 3CQGB 4YXDA 1XDPA 5IWAT 2V7IA 3PUVF 2VK9A 5H6QB 3FXEB 5JVDE 4NUVA 5HEJA 4HFIA 3UU5A 3P4RA 2BDEA 3KFWX 2ACZA 3EUHA 2WBLA 3HKDE 4I4TE 2IUBA 3IBPA 1W09A 4U2ZA 4PK5A 2SPCA 3ETVA 4DO0A 2XSAA 2XAJB 3V5UA 2R6GF 2FUPA 4CN4A 2HN1A 4QX7B 2W66A 2WDVA 3NRXA 4X1KE 3RH3A 4MHCA 1KFYA 2V26A 4X66T 4CQIA 4AKHA 3KBUA 5HEGA 3GA8A 5LNKA 3ZCJA 2Q9QC 2KT9A 4U2YA 1UK5A 4PFOA 4NUUA 5C3JA 4HFHA 4GKJT 5AQGB 3C50A 5LGUB 2KZ7B 4EYYR 1HR0T 3AXJA 2N1GA 3RC3A 4U31A 1MMDA 2WZHA 3O1JA 4YHJA 5LMUT 2AE9A 2UU9T 2LM2A 2BG9C 4KHZF 5JRCB 3RYCE 4X5TA 1HF8A 3C4ZA 5ABEA 4O8SA 2BZBA 3C64A 3CMLA 1CUNA 4ZS3A 3CPZA 4UVAB 3CK6A 1XMOT 1E2AA 3OYZA 3RKGA 4TZ4C 1ZV4X 2D0TA 2C0SA 3KV9A 4Z90A 1D0ZA 4UVBB 3VRBA 3IEEA 2W00A 2LSGA 3ZYMA 2H3RA 2Q9QA 4A97A 4ZI7E 3RIAA 3H3MA 5JDQA 3C4XA 4O4LE 5AQOB 4TX5A 4HN9A 1UGOA 3I9YA 2WZIA 2E8IA 4X1IE 4YLHA 3RPUA 3LJCA 3F31A 4WNKA 2Y8DA 2CRBA 4Q25A 3TLVA 4JBWF 3RYFE 3ZYLA 2PG8A 4JI3T 2AXDS 5IHYA 1HNXT 2BG9A 4X62T 2F4VT 2L8KA 3L8RA 2C5KT 4ANJA 4LFCT 5JR9B 4PW8A 2OV9A 3AAIA 2N2NA 4ZOLE 2CPTA 3JAEA 2W61A 2KLQA 4YHHT 4IT4A 2BS3A 3UUNA 2LM9A 1Z8UA 3ZT5A 3QOFA 3PURA 4ILCA 3I1AA 2FBWA 4JV5T 5LB7B 3N2GE 2ZMAA 1MNEA 2W2UA 2HH7A 1HS7A 4HKAA 3UFGA 3ZMZB 4GK0E 1E1HB 1ZHCA 2XQ3A 3E08A 2BBHA 4HFCA 4IIJE 4LF4T 3I0QA 4UIGA 4AQFC 3TKLB 3AECA 5L47A 1WYCA 3Q2MA 3AE7A 4V1Av 4DR4T 3N5LA 2XQ8A 3UUMA 2CHNA 3BQLA 5FKYA 5JDFA 5JTGA 5CGMA 4PJLA 2CM0A 2EHOB 2VASA 4A56A 1HFAA 4F8HA 4JYAT 1Z0PA 1SUMB 3HR0A 2I6HA 2H89A 5JH7E 4IDPA 2CBJA 2D9DA 4EAHA 4HFBA 2NWBA 1W9RA 2HN2A 2LE8A 3MZKB 4DV1T 4CXXA 3BK9A 3RRWA 3AE1A 2LHRA 3AE9A 2XQ9A 4DR7T 3E22E 1XNQT 3UU6A 3JC6D 1N36T 4JI7T 2YEVC 4UVCB 1G8XA 2X9XA 3JADA 2ZM8A 1VCTA 1LRZA 2PTFA 2WB5A 1BR0A 4DR5T 1BR4A 4H9RC 2YOEA 2KNDA 2WCAA 4PK4A 2CLYC 5L4HA 1DU2A 1XNRT 2IAKA 5FNVE 5JDGA 4LMKA 5F3JA 3I9WA 5F5WA 3F2EA 2XQAA 1D0YA 4CXWA 4O4JE 2WMOA 3PUZF 5EK3A 3AA7B 3FXDB 5C8YE 2XZEA 2UXBT 3HKCE 3KBTA 5CJ5A 4Z8XA 4HWIB 1WCRA 2KSRA 2RPAA 4PK6A 4ZEYA 3PUYF 4FI5A 5AQFB 3QK6A 4DV5T 4A5XA 2CXFA 3ZEFB 4AXPA 1LVKA 4LMLA 3RX6A 1W0BA 2E9XA 4X1YE 3ZMSB 3ZLIA 4EEDA 3HKBE 1MMGA 4IE6A 3N9QA 2K24A 2A3DA 1T98A 1UX5A 4DUZT 1HTJF 2XQ5A 2NTXA 4O4HE 4U3CA 2E5VA 3ZC0A 4UV8B 4AI6A 4AQYT 4DR1T 4U74A 5AQHB 3QC9A 2UUCT 3UFEA 4L5GA 3IHRA 3R84B 2WS3A 3VHLA 1XDOA 1OEDE 3EAMA 5AQNB 5L4EA 5A1LA 3K1SA 3AE5A 5LG4A 4DNDA 1US7B 4WZXA 3RRCA 1IJ6A 1JNZA 2MAWA 4IHJE 1YD8G 2PJQA 3ABVA 3K3OA 3MJXA 2L3LA 2JRKA 3T1HT 5DJQC 1Y01A 4OK0A 5LHGB 3Q5EA 2XJ7A 3HL6A 4WBNE 2QVAA 3AE4A 1O3XA 3K8PC 3FBZA 2KWHA 5HXEA 4UXNB 5JDLA 3IF8B 3P4QA 1I6ZA 3JAFA 2JJ9A 2LSKA 5FXWA 3A8YC 2FJBA 1FJGT 3PUGA 5FMNA 3RHWA 2W4XA 2BVLA 2ZLYA 3OKQA 2WM9A 1N34T 2VKJA 3FZFB 2EHOD 2IHR1 5FXZA 4K0KT 1OEDB 3ANWB 5KXJA 4LF7T 4C90A 2WWUA 2FJDA 3RIUC 5HWXA 3E0ZA 1FEWA 3NBXX 2DHRA 4B3ST 1J5WA 4TV8E 5JREA 4LF8T 3RQWA 2XM2A 4H63H 2DCFA 5CB4E 3T1YT 4IE4A 4DMWA 5L2LA 3QB5A 2K5BB 3AE6A 4NXMT 2C5IT 2LHNA 2XM1A 3AEAA 3ZMUB 2LSJA 1HG5A 1D1BA 3CVRA 5FY0A 3WAJA 5ETWA 3QUJA 1X9BA 3LK42 5LHHB 1T8BA 2LLYA 2UXDT 3PJAJ 5JRCA 2XAGB 3GWHA 3KVAA 4OYJA 1NENA 4DUYT 5TAOA 5AQJB 1XMQT 5JDHA 3LDQB 2BKPA 3O9XA 2BVMA 3KINB 4P09A 2BS2A 2B76A 4OHFA 3ZT7A 1NEKA 1SE7A 4A98A 4OYKA 5ABHA 4NPPA 4GYRA 3QB5K 5AQTB 5HXHA 1D1AA 2MBGA 3RIUA 2M6IA 3SRZA 3CX8B 5LMNT 2DNXA 3ONLC 4YSXA 2CWYA 2X67A 1ZKEA 5LG3A 4UEMA 5AQRB 4QXHB 3HI2A 3ESLA 2BS4A 4DR3T 1IZNB 5ADXL 5HYAA 3OYXA 2RA1A 3AEEA 1SA0E 4IDOA 3ETUA 1FIOA 4CI2B 5LOVE 4HWHA 2NP9A 4ZHQE 1WRDA 4P0AA 3AAAB 2DWGA 2HHHT 5JR9A 3MXZA 5LYJE 2XPKA 4EZ4A 2LJLA 4TV9E 4UV9B 5JDMA 4DIDB 4QXBB 4DV4T 3P4WA 3QNUA 5FYMA 2PBIA 4AISA 3B5MA 3J9X1 4QH1A 2VURA 1KK7A 5HEOA 1T72A 4ZI2D 1WFDA 2NR4A 3B13A 2V5CA 4B3RT 4HE8A 4WYVA 1CHUA 4UF0A 3RYHE 1M7KA 4H9NC 5LGTB 4KX6A 3AA6B 1Y64B 3N2KE 1UX4A 2ACXA 3GN5B 5J1GA 4IL9A 3RQUA 1ZP0A 3K3NA 3LK2B 2ZM6T 4GKKT 4ZS2A 3JCFA 4YFSA 2V1DB 4LMJA 2YN6A 5H6RB 2CHOA 5AQPB 4MFRA 2D2SA 1UUSA 1KEYA 5FL0A 3TLSA 3EDVA 2H7VC 3PE0A 4DR6T 5LA6E 5EK4A 2Q9QB 2V7JA 3H3AA 5L3EB 2QA7A 2XASB 2X0YA 2XQ4A 3RF1A 4QXCB 2N9DA 2QRXA 4YSZA 3NVOA 4IREA 2IC9A 4HWFA 2CXLA 4E7SA 3PTRB 1ZOYA 5EK2A 3T8OA 2Y48B 1VRBA 3FB2A 2WU2A 4DV2T 4X20E 1UURA 4IL4A 1R8IA 4ZI3C 2KINB 2XAHB 4U7YA 3PUAA 5ABFB 4YT0A 3AE3A 4DBRA 2JQKA 4P1NA 4KHPT 3SS1A 3ZN0B 1YQ4A 4TN7B 5BMVE 4DV7T 3AE2A 4ILAA 4TWFA 2JMHA 5KDMC 3LFMA 4AIUA 1MMNA 3MACA 2LOSA 4IE5A 2X66A 2LKGA 2Y6XA 1J1JA 4JI6T 1UCUA 3Q9DA 2OLTA 4AKGA 1E7PA 2LEHA 4EEBA 2CCQA 2JMKA 4FJOA 4PFPA 2WDQA 4CXYA 3AA1B 5L3CB 4KI0F 3FBLA 1FMWA 5LJMA 2E9XC 2NW8A 4E7ZA 2UXCT 4HFDA 2G0UA 3P4SA 5AQSB 4N78D 3LBXA 5L3GB 1QLBA 3L3PA 2Z6EA 4Z91A 2X51A 5AQLB 3A5XA 3LSVA 2FJAA 4YJ3E 3C4WA 5FXVA 4ERRA 2QYWA 4PNIA 2V6YB 3NKZA 3ZSTA 2V6XA 2VB6A 4QX8B 2D0UA 1VCSA 4H9QC 2H88A 2XHEB 2UXXB 4AQGA 5CA1E 4WBOA 1OEDC 2W0GA 4B3MT 4WW0A 1HCIA 3P7IA 4U33A 2UUAT 2W62A 4TWHA 2XY8B 2BKOA 2VKOA 3AVRA 4TNWA 4X65T 2VL8A 5LBQB 5LCYA 2E2AA 3H37A 2CWOA 4TWDA 4H63V 4G63A 1AJ3A 1YW0A 4PJNA 4YSYA 3VU7H 3AEFA 5AQIB 3KDSE 4ISTA 2VKDA 2YDSA 2CA5A 3PU3A 4ILUA 4HEAA 3P50A 4EB6E 2W63A 4CI3B 3UQ7A 3NZQA 2VQFT 2FJEA 5HEHA 1MIYA 3EVYA 3AE8A 4HWCA 4F6RC 5AQMB 5F8PA 4PAGA 3W15B 4TUYE 4M1PA 3VKGA 1MMAA 3NRYA 1KNZA 2LRLA 2IMLA 4KMCA 2LSIA 1MIWA 1OEDA 3WAKA 1OXZA 4KP3C 2Q9QD 2ES0A 4JI1T 5L3BB 2H7OA 5IYZE 2V7MA 5HCMA 1IBMT 3PU8A 4DBQA 2V7KA 1EZ3A 3SOLA 3O4XE 3UU8A 2ODUA 4I50E 3S4UA 2MTQA 5HAXA 1BR2A 4EGWA 2X68A 4J2CA 4O4IE 3ZJ2A 4JEUB 2VQET 1LVFA 2XQ7A 2WWVA 5LXTE 5HXRA 1B7TA 4LF5T 2WQYA 5FXXA 1HNWT 5L3DB 1WYBA 4DMVA 2V8SV 2P9BA 4JI5T 4JEHB 4HTEA 4I55E 4GIWA 5LBMA 3PDYA 3UU3A 3AA0B 4EZHA 3O1HA 2PFVA 3G06A 5IUXA 3ZC1A 4PJJA 3ZN1B 1X79A 1V9DA 4JUYA 3AAEB 2BKNA 3AEDA 3N9LA 4YJ2E 3WI3A 4AKRB 4U7IA 3Q5XA 1IJ5A 5FY1A 2X0LB 1YKHB 4COFA 4DVDA 1XZYA 5CFBA 3N9OA 3NWIA 3BQKA 4QHOA 2YK0A 4IDZA 4KUMB 2I59A 3UU4A 5JR9C 3AEGA 4EOZB 1D0XA 1HX1B 3C51A 2L9QA 3O1IA 4I0UA 5J0ZA 4K0UA 2IIUA 2ZM2A 3CWZB 3PUWF 3Q5WA 3LK3B 4MLKA 1QSDA 2A2FX 4QWNB 5HXCA 2X9HA 1W0AA 4AKIA 2JQHA 3SWHA 2VKHA 3OTOT 1IBLT 1YKEB 3FZLB 5DABA 5AQUB 1L0VA 5M4YA 3N9NA 1WR6A 5EZYE 3F57A 4HWDA 2WSSV 3N9PA 2OA5A 3FZHB 2K9AA 2WMNA 4OX9T 3VKHA 3IA3A 3RYIE 4EXTA 4UELA 5FY7A 4BJMA 2UUBT 5JDNA 3GN5A 2MPKA 4G2AA 3M65A 3RC8A 3BQIA 2A72A 2EHOC 2MYSA 4XZCA 3L39A 1T7SA 3CKDA 3EI0A 2IDOB 4EV6A 3N9MA 1HNZT 4ZI3D 3UTKA 1S94A 4CI1B 4CZZB 2J62A 4JI4T 4AKLA 1YQ3A 4U72A 5AFUL 2K3WA 5HEUA 2NW7A 1M62A 3MA9A 3AXJB 1YXRA 4HFVA 1LKXA 3TLTA 1NAFA 5GONE 4DV6T 1FMVA 4CN1A 4IGUA 3X1DA 5LP6E 4ZXLA 4B3TT 3ZCIA 1KNPA 4BAYB 2XSBA 2IC6A 1KF6A 2BG9E 3U3IA 2DLRA 1MIVA 4H9SE 3NZPA 4H9OC 5J2TE 1ZEEA 3PUQA 1HG2A 3A7MA 2CMRA 4OFZA 4YTNA 2JIWA 3OPCA 2GK9A 4X64T 2E9XD 3CX7B 3KV5A 4CN6A 4EYUA 3TLUA 3MK7C 4MBQA 2LKHA 2EHOA 2CEAA 3DJBA 3HKEE 4QKNA 5ABFA 3LG7A 2DI4A 2XAQB 5AQQB 4TNVA 3EDUA 2VVNA 5KMGP 3SFEA 2QGSA 3P8CD 3TLWA 2NOXA 2LSYA 4UF0B 3CX6B 2XQ6A 3FHNA 4BJNA 2V7LA 3CQCB 2BG9B 5FL1A 5FP3A 2A9UA 4HFEA 2HPLA 2KWIB 1XWMA 2I0MA 2VVSA 3PV0F 4ZZCA 1WLXA 3RIFA 3J7Yq 3ZPOA 3D0TA 1G73A 1H7CA 3ONXA 4B6XA 3UULA 1U4QA 4YTMA 5FVKA 2LRKA 3RGLA 2YU1A 3RLFF 4YY3T 2RP4A 4O2AE 4ILBA 1NWMX 3VRAA 4LFAT 4IDQA 2KXPB 4NXNT 1S35A 2YU2A 2V6YA 4ZI2C 5HCJA 4BA9A 1GQEA 2KMFA 3UUBA 3KVBA 3UT5E 2CBIA 3K3QC 2IW5B 3RI5A 3AEBA 4LF9T 2WDRA 4GYSA 3OJAA 2YINA 3PUXF 3C98B 3PJAA 4IDNA 2JPFA 1IBKT 5LHIB 4IE7A 1JNRA 2E5LT 3ZJ1A 2WP9A 2MOZA 1MNDA 3AVSA 4AQFA 3ZYKA 3M3ZB 2XQYA 3FZKB 2CE7A 5LJNA 2YKSA 1VOMA 5KX5E 3OBVE 3Q5DA 2DL1A 1U5PA 4LF6T 2ODVA 3ZMVB 1J5ET 4ASKA 3KV6A 2ZM0A 3L09A 2JQ9A 2M67A 2DWKA 4UR9A 5HWYA 4JI8T 3R6NA 4DR2T 2X9WA 2VL0A 5HXSA 5L3FB 3FZMB 5FVLA
chains in the Genus database with same CATH topology
4LFAT 4JI5T 4DR4T 4X64T 4NXNT 4X66T 2UXCT 2VQFT 2UXBT 4OX9T 4DV4T 2UXDT 1I94T 4JYAT 4LF9T 4JI3T 4GKJT 3T1HT 1N32T 2UUBT 4LFBT 1HNXT 4X62T 2F4VT 4DUYT 1HR0T 4JI0T 4LFCT 1IBKT 1XMQT 4DV2T 5LMUT 1HNZT 4DV5T 2E5LT 4DV1T 4YHHT 4B3RT 2UU9T 4JI1T 4DR7T 4JI4T 4JI2T 4KHPT 4DV3T 4DV7T 5BR8T 1FJGT 5LMNT 1XNQT 5IWAT 1IBMT 4JV5T 1N36T 4JI7T 2ZM6T 1N34T 4B3MT 4GKKT 4LF6T 4DV0T 2UUAT 4K0KT 4DV6T 4LF7T 4DUZT 1J5ET 4DR5T 1XMOT 4DR3T 4X65T 4JI6T 4B3TT 4B3ST 3OTOT 4AQYT 1N33T 1IBLT 4LF8T 4DR1T 2VQET 4LF4T 2UUCT 4JI8T 1XNRT 4DR2T 4DR6T 3T1YT 4YY3T 4LF5T 4NXMT 1HNWT 2HHHT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA T;  4JI5 T;  4DR4 T;  4X64 T;  4NXN T;  4X66 T;  2UXC T;  2VQF T;  2UXB T;  4OX9 T;  4DV4 T;  2UXD T;  1I94 T;  4JYA T;  4LF9 T;  4JI3 T;  4GKJ T;  3T1H T;  1N32 T;  2UUB T;  4LFB T;  1HNX T;  4X62 T;  2F4V T;  4DUY T;  1HR0 T;  4JI0 T;  4LFC T;  1IBK T;  1XMQ T;  4DV2 T;  5LMU T;  1HNZ T;  4DV5 T;  2E5L T;  4DV1 T;  4YHH T;  4B3R T;  2UU9 T;  4JI1 T;  4DR7 T;  4JI4 T;  4JI2 T;  4KHP T;  4DV3 T;  4DV7 T;  5BR8 T;  1FJG T;  5LMN T;  1XNQ T;  5IWA T;  1IBM T;  4JV5 T;  1N36 T;  4JI7 T;  2ZM6 T;  1N34 T;  4B3M T;  4GKK T;  4LF6 T;  4DV0 T;  2UUA T;  4K0K T;  4DV6 T;  4LF7 T;  4DUZ T;  1J5E T;  4DR5 T;  1XMO T;  4DR3 T;  4X65 T;  4JI6 T;  4B3T T;  4B3S T;  3OTO T;  4AQY T;  1N33 T;  1IBL T;  4LF8 T;  4DR1 T;  2VQE T;  4LF4 T;  2UUC T;  4JI8 T;  1XNR T;  4DR2 T;  4DR6 T;  3T1Y T;  4YY3 T;  4LF5 T;  4NXM T;  1HNW T;  2HHH T; 
#chains in the Genus database with same CATH topology
 5AQK B;  3HA4 A;  4JLE A;  4GOU A;  1WR0 A;  3AB3 B;  3DP7 A;  5LGN B;  2C5J A;  1OWA A;  2VWA A;  3DTO A;  3ZKR A;  2BBJ A;  3SFD A;  3LBX B;  1IAP A;  1N32 T;  4ADZ A;  4KBM B;  2XTL A;  3V5S A;  3N2O A;  2J4G A;  1D1C A;  3B57 A;  2J1D G;  4O2B E;  3U78 A;  2YDR A;  3MKD A;  3VR8 A;  3P4P A;  4JI2 T;  2WY2 A;  3JC6 C;  2YDQ A;  3GMI A;  2B1E A;  4L0R A;  5AQV B;  2UXN B;  5CA0 E;  3ZMT B;  4DV0 T;  4EIW A;  3ANW A;  5DQW A;  4XBF B;  2K48 A;  3ZSS A;  4PJM A;  2JQQ A;  3UQ4 A;  4C91 A;  1QUU A;  3EAB A;  1N33 T;  4YTP A;  4NIQ A;  2E9X B;  5ABG A;  5J2U E;  1HX8 A;  2WAU A;  5E0O A;  2LT3 A;  2XAF B;  4ISS A;  3ZT6 A;  2X0H A;  5DQV A;  2CLY B;  3EHZ A;  3I0O A;  2WU5 A;  5C2T A;  2X9Y A;  4XAX B;  4MAL A;  1KNR A;  4QH5 A;  2J47 A;  4QH4 A;  4ZZB A;  1SHZ C;  3OVU A;  4IE0 A;  2V5D A;  4H9P C;  4GK5 E;  3CIR A;  5JQG E;  1I94 T;  3RKO A;  2CXD A;  2NTY A;  2W67 A;  2XUE A;  4L9I A;  4P0B A;  4LFB T;  4JI0 T;  2LOP A;  2HPJ A;  4HGA A;  3KV4 A;  3UUX B;  3CQX C;  3ONJ A;  1BR1 A;  3PUS A;  2M6B A;  2NW9 A;  4I43 B;  4DV3 T;  2D5U A;  3VR9 A;  5BR8 T;  3CQG B;  4YXD A;  1XDP A;  5IWA T;  2V7I A;  3PUV F;  2VK9 A;  5H6Q B;  3FXE B;  5JVD E;  4NUV A;  5HEJ A;  4HFI A;  3UU5 A;  3P4R A;  2BDE A;  3KFW X;  2ACZ A;  3EUH A;  2WBL A;  3HKD E;  4I4T E;  2IUB A;  3IBP A;  1W09 A;  4U2Z A;  4PK5 A;  2SPC A;  3ETV A;  4DO0 A;  2XSA A;  2XAJ B;  3V5U A;  2R6G F;  2FUP A;  4CN4 A;  2HN1 A;  4QX7 B;  2W66 A;  2WDV A;  3NRX A;  4X1K E;  3RH3 A;  4MHC A;  1KFY A;  2V26 A;  4X66 T;  4CQI A;  4AKH A;  3KBU A;  5HEG A;  3GA8 A;  5LNK A;  3ZCJ A;  2Q9Q C;  2KT9 A;  4U2Y A;  1UK5 A;  4PFO A;  4NUU A;  5C3J A;  4HFH A;  4GKJ T;  5AQG B;  3C50 A;  5LGU B;  2KZ7 B;  4EYY R;  1HR0 T;  3AXJ A;  2N1G A;  3RC3 A;  4U31 A;  1MMD A;  2WZH A;  3O1J A;  4YHJ A;  5LMU T;  2AE9 A;  2UU9 T;  2LM2 A;  2BG9 C;  4KHZ F;  5JRC B;  3RYC E;  4X5T A;  1HF8 A;  3C4Z A;  5ABE A;  4O8S A;  2BZB A;  3C64 A;  3CML A;  1CUN A;  4ZS3 A;  3CPZ A;  4UVA B;  3CK6 A;  1XMO T;  1E2A A;  3OYZ A;  3RKG A;  4TZ4 C;  1ZV4 X;  2D0T A;  2C0S A;  3KV9 A;  4Z90 A;  1D0Z A;  4UVB B;  3VRB A;  3IEE A;  2W00 A;  2LSG A;  3ZYM A;  2H3R A;  2Q9Q A;  4A97 A;  4ZI7 E;  3RIA A;  3H3M A;  5JDQ A;  3C4X A;  4O4L E;  5AQO B;  4TX5 A;  4HN9 A;  1UGO A;  3I9Y A;  2WZI A;  2E8I A;  4X1I E;  4YLH A;  3RPU A;  3LJC A;  3F31 A;  4WNK A;  2Y8D A;  2CRB A;  4Q25 A;  3TLV A;  4JBW F;  3RYF E;  3ZYL A;  2PG8 A;  4JI3 T;  2AXD S;  5IHY A;  1HNX T;  2BG9 A;  4X62 T;  2F4V T;  2L8K A;  3L8R A;  2C5K T;  4ANJ A;  4LFC T;  5JR9 B;  4PW8 A;  2OV9 A;  3AAI A;  2N2N A;  4ZOL E;  2CPT A;  3JAE A;  2W61 A;  2KLQ A;  4YHH T;  4IT4 A;  2BS3 A;  3UUN A;  2LM9 A;  1Z8U A;  3ZT5 A;  3QOF A;  3PUR A;  4ILC A;  3I1A A;  2FBW A;  4JV5 T;  5LB7 B;  3N2G E;  2ZMA A;  1MNE A;  2W2U A;  2HH7 A;  1HS7 A;  4HKA A;  3UFG A;  3ZMZ B;  4GK0 E;  1E1H B;  1ZHC A;  2XQ3 A;  3E08 A;  2BBH A;  4HFC A;  4IIJ E;  4LF4 T;  3I0Q A;  4UIG A;  4AQF C;  3TKL B;  3AEC A;  5L47 A;  1WYC A;  3Q2M A;  3AE7 A;  4V1A v;  4DR4 T;  3N5L A;  2XQ8 A;  3UUM A;  2CHN A;  3BQL A;  5FKY A;  5JDF A;  5JTG A;  5CGM A;  4PJL A;  2CM0 A;  2EHO B;  2VAS A;  4A56 A;  1HFA A;  4F8H A;  4JYA T;  1Z0P A;  1SUM B;  3HR0 A;  2I6H A;  2H89 A;  5JH7 E;  4IDP A;  2CBJ A;  2D9D A;  4EAH A;  4HFB A;  2NWB A;  1W9R A;  2HN2 A;  2LE8 A;  3MZK B;  4DV1 T;  4CXX A;  3BK9 A;  3RRW A;  3AE1 A;  2LHR A;  3AE9 A;  2XQ9 A;  4DR7 T;  3E22 E;  1XNQ T;  3UU6 A;  3JC6 D;  1N36 T;  4JI7 T;  2YEV C;  4UVC B;  1G8X A;  2X9X A;  3JAD A;  2ZM8 A;  1VCT A;  1LRZ A;  2PTF A;  2WB5 A;  1BR0 A;  4DR5 T;  1BR4 A;  4H9R C;  2YOE A;  2KND A;  2WCA A;  4PK4 A;  2CLY C;  5L4H A;  1DU2 A;  1XNR T;  2IAK A;  5FNV E;  5JDG A;  4LMK A;  5F3J A;  3I9W A;  5F5W A;  3F2E A;  2XQA A;  1D0Y A;  4CXW A;  4O4J E;  2WMO A;  3PUZ F;  5EK3 A;  3AA7 B;  3FXD B;  5C8Y E;  2XZE A;  2UXB T;  3HKC E;  3KBT A;  5CJ5 A;  4Z8X A;  4HWI B;  1WCR A;  2KSR A;  2RPA A;  4PK6 A;  4ZEY A;  3PUY F;  4FI5 A;  5AQF B;  3QK6 A;  4DV5 T;  4A5X A;  2CXF A;  3ZEF B;  4AXP A;  1LVK A;  4LML A;  3RX6 A;  1W0B A;  2E9X A;  4X1Y E;  3ZMS B;  3ZLI A;  4EED A;  3HKB E;  1MMG A;  4IE6 A;  3N9Q A;  2K24 A;  2A3D A;  1T98 A;  1UX5 A;  4DUZ T;  1HTJ F;  2XQ5 A;  2NTX A;  4O4H E;  4U3C A;  2E5V A;  3ZC0 A;  4UV8 B;  4AI6 A;  4AQY T;  4DR1 T;  4U74 A;  5AQH B;  3QC9 A;  2UUC T;  3UFE A;  4L5G A;  3IHR A;  3R84 B;  2WS3 A;  3VHL A;  1XDO A;  1OED E;  3EAM A;  5AQN B;  5L4E A;  5A1L A;  3K1S A;  3AE5 A;  5LG4 A;  4DND A;  1US7 B;  4WZX A;  3RRC A;  1IJ6 A;  1JNZ A;  2MAW A;  4IHJ E;  1YD8 G;  2PJQ A;  3ABV A;  3K3O A;  3MJX A;  2L3L A;  2JRK A;  3T1H T;  5DJQ C;  1Y01 A;  4OK0 A;  5LHG B;  3Q5E A;  2XJ7 A;  3HL6 A;  4WBN E;  2QVA A;  3AE4 A;  1O3X A;  3K8P C;  3FBZ A;  2KWH A;  5HXE A;  4UXN B;  5JDL A;  3IF8 B;  3P4Q A;  1I6Z A;  3JAF A;  2JJ9 A;  2LSK A;  5FXW A;  3A8Y C;  2FJB A;  1FJG T;  3PUG A;  5FMN A;  3RHW A;  2W4X A;  2BVL A;  2ZLY A;  3OKQ A;  2WM9 A;  1N34 T;  2VKJ A;  3FZF B;  2EHO D;  2IHR 1;  5FXZ A;  4K0K T;  1OED B;  3ANW B;  5KXJ A;  4LF7 T;  4C90 A;  2WWU A;  2FJD A;  3RIU C;  5HWX A;  3E0Z A;  1FEW A;  3NBX X;  2DHR A;  4B3S T;  1J5W A;  4TV8 E;  5JRE A;  4LF8 T;  3RQW A;  2XM2 A;  4H63 H;  2DCF A;  5CB4 E;  3T1Y T;  4IE4 A;  4DMW A;  5L2L A;  3QB5 A;  2K5B B;  3AE6 A;  4NXM T;  2C5I T;  2LHN A;  2XM1 A;  3AEA A;  3ZMU B;  2LSJ A;  1HG5 A;  1D1B A;  3CVR A;  5FY0 A;  3WAJ A;  5ETW A;  3QUJ A;  1X9B A;  3LK4 2;  5LHH B;  1T8B A;  2LLY A;  2UXD T;  3PJA J;  5JRC A;  2XAG B;  3GWH A;  3KVA A;  4OYJ A;  1NEN A;  4DUY T;  5TAO A;  5AQJ B;  1XMQ T;  5JDH A;  3LDQ B;  2BKP A;  3O9X A;  2BVM A;  3KIN B;  4P09 A;  2BS2 A;  2B76 A;  4OHF A;  3ZT7 A;  1NEK A;  1SE7 A;  4A98 A;  4OYK A;  5ABH A;  4NPP A;  4GYR A;  3QB5 K;  5AQT B;  5HXH A;  1D1A A;  2MBG A;  3RIU A;  2M6I A;  3SRZ A;  3CX8 B;  5LMN T;  2DNX A;  3ONL C;  4YSX A;  2CWY A;  2X67 A;  1ZKE A;  5LG3 A;  4UEM A;  5AQR B;  4QXH B;  3HI2 A;  3ESL A;  2BS4 A;  4DR3 T;  1IZN B;  5ADX L;  5HYA A;  3OYX A;  2RA1 A;  3AEE A;  1SA0 E;  4IDO A;  3ETU A;  1FIO A;  4CI2 B;  5LOV E;  4HWH A;  2NP9 A;  4ZHQ E;  1WRD A;  4P0A A;  3AAA B;  2DWG A;  2HHH T;  5JR9 A;  3MXZ A;  5LYJ E;  2XPK A;  4EZ4 A;  2LJL A;  4TV9 E;  4UV9 B;  5JDM A;  4DID B;  4QXB B;  4DV4 T;  3P4W A;  3QNU A;  5FYM A;  2PBI A;  4AIS A;  3B5M A;  3J9X 1;  4QH1 A;  2VUR A;  1KK7 A;  5HEO A;  1T72 A;  4ZI2 D;  1WFD A;  2NR4 A;  3B13 A;  2V5C A;  4B3R T;  4HE8 A;  4WYV A;  1CHU A;  4UF0 A;  3RYH E;  1M7K A;  4H9N C;  5LGT B;  4KX6 A;  3AA6 B;  1Y64 B;  3N2K E;  1UX4 A;  2ACX A;  3GN5 B;  5J1G A;  4IL9 A;  3RQU A;  1ZP0 A;  3K3N A;  3LK2 B;  2ZM6 T;  4GKK T;  4ZS2 A;  3JCF A;  4YFS A;  2V1D B;  4LMJ A;  2YN6 A;  5H6R B;  2CHO A;  5AQP B;  4MFR A;  2D2S A;  1UUS A;  1KEY A;  5FL0 A;  3TLS A;  3EDV A;  2H7V C;  3PE0 A;  4DR6 T;  5LA6 E;  5EK4 A;  2Q9Q B;  2V7J A;  3H3A A;  5L3E B;  2QA7 A;  2XAS B;  2X0Y A;  2XQ4 A;  3RF1 A;  4QXC B;  2N9D A;  2QRX A;  4YSZ A;  3NVO A;  4IRE A;  2IC9 A;  4HWF A;  2CXL A;  4E7S A;  3PTR B;  1ZOY A;  5EK2 A;  3T8O A;  2Y48 B;  1VRB A;  3FB2 A;  2WU2 A;  4DV2 T;  4X20 E;  1UUR A;  4IL4 A;  1R8I A;  4ZI3 C;  2KIN B;  2XAH B;  4U7Y A;  3PUA A;  5ABF B;  4YT0 A;  3AE3 A;  4DBR A;  2JQK A;  4P1N A;  4KHP T;  3SS1 A;  3ZN0 B;  1YQ4 A;  4TN7 B;  5BMV E;  4DV7 T;  3AE2 A;  4ILA A;  4TWF A;  2JMH A;  5KDM C;  3LFM A;  4AIU A;  1MMN A;  3MAC A;  2LOS A;  4IE5 A;  2X66 A;  2LKG A;  2Y6X A;  1J1J A;  4JI6 T;  1UCU A;  3Q9D A;  2OLT A;  4AKG A;  1E7P A;  2LEH A;  4EEB A;  2CCQ A;  2JMK A;  4FJO A;  4PFP A;  2WDQ A;  4CXY A;  3AA1 B;  5L3C B;  4KI0 F;  3FBL A;  1FMW A;  5LJM A;  2E9X C;  2NW8 A;  4E7Z A;  2UXC T;  4HFD A;  2G0U A;  3P4S A;  5AQS B;  4N78 D;  3LBX A;  5L3G B;  1QLB A;  3L3P A;  2Z6E A;  4Z91 A;  2X51 A;  5AQL B;  3A5X A;  3LSV A;  2FJA A;  4YJ3 E;  3C4W A;  5FXV A;  4ERR A;  2QYW A;  4PNI A;  2V6Y B;  3NKZ A;  3ZST A;  2V6X A;  2VB6 A;  4QX8 B;  2D0U A;  1VCS A;  4H9Q C;  2H88 A;  2XHE B;  2UXX B;  4AQG A;  5CA1 E;  4WBO A;  1OED C;  2W0G A;  4B3M T;  4WW0 A;  1HCI A;  3P7I A;  4U33 A;  2UUA T;  2W62 A;  4TWH A;  2XY8 B;  2BKO A;  2VKO A;  3AVR A;  4TNW A;  4X65 T;  2VL8 A;  5LBQ B;  5LCY A;  2E2A A;  3H37 A;  2CWO A;  4TWD A;  4H63 V;  4G63 A;  1AJ3 A;  1YW0 A;  4PJN A;  4YSY A;  3VU7 H;  3AEF A;  5AQI B;  3KDS E;  4IST A;  2VKD A;  2YDS A;  2CA5 A;  3PU3 A;  4ILU A;  4HEA A;  3P50 A;  4EB6 E;  2W63 A;  4CI3 B;  3UQ7 A;  3NZQ A;  2VQF T;  2FJE A;  5HEH A;  1MIY A;  3EVY A;  3AE8 A;  4HWC A;  4F6R C;  5AQM B;  5F8P A;  4PAG A;  3W15 B;  4TUY E;  4M1P A;  3VKG A;  1MMA A;  3NRY A;  1KNZ A;  2LRL A;  2IML A;  4KMC A;  2LSI A;  1MIW A;  1OED A;  3WAK A;  1OXZ A;  4KP3 C;  2Q9Q D;  2ES0 A;  4JI1 T;  5L3B B;  2H7O A;  5IYZ E;  2V7M A;  5HCM A;  1IBM T;  3PU8 A;  4DBQ A;  2V7K A;  1EZ3 A;  3SOL A;  3O4X E;  3UU8 A;  2ODU A;  4I50 E;  3S4U A;  2MTQ A;  5HAX A;  1BR2 A;  4EGW A;  2X68 A;  4J2C A;  4O4I E;  3ZJ2 A;  4JEU B;  2VQE T;  1LVF A;  2XQ7 A;  2WWV A;  5LXT E;  5HXR A;  1B7T A;  4LF5 T;  2WQY A;  5FXX A;  1HNW T;  5L3D B;  1WYB A;  4DMV A;  2V8S V;  2P9B A;  4JI5 T;  4JEH B;  4HTE A;  4I55 E;  4GIW A;  5LBM A;  3PDY A;  3UU3 A;  3AA0 B;  4EZH A;  3O1H A;  2PFV A;  3G06 A;  5IUX A;  3ZC1 A;  4PJJ A;  3ZN1 B;  1X79 A;  1V9D A;  4JUY A;  3AAE B;  2BKN A;  3AED A;  3N9L A;  4YJ2 E;  3WI3 A;  4AKR B;  4U7I A;  3Q5X A;  1IJ5 A;  5FY1 A;  2X0L B;  1YKH B;  4COF A;  4DVD A;  1XZY A;  5CFB A;  3N9O A;  3NWI A;  3BQK A;  4QHO A;  2YK0 A;  4IDZ A;  4KUM B;  2I59 A;  3UU4 A;  5JR9 C;  3AEG A;  4EOZ B;  1D0X A;  1HX1 B;  3C51 A;  2L9Q A;  3O1I A;  4I0U A;  5J0Z A;  4K0U A;  2IIU A;  2ZM2 A;  3CWZ B;  3PUW F;  3Q5W A;  3LK3 B;  4MLK A;  1QSD A;  2A2F X;  4QWN B;  5HXC A;  2X9H A;  1W0A A;  4AKI A;  2JQH A;  3SWH A;  2VKH A;  3OTO T;  1IBL T;  1YKE B;  3FZL B;  5DAB A;  5AQU B;  1L0V A;  5M4Y A;  3N9N A;  1WR6 A;  5EZY E;  3F57 A;  4HWD A;  2WSS V;  3N9P A;  2OA5 A;  3FZH B;  2K9A A;  2WMN A;  4OX9 T;  3VKH A;  3IA3 A;  3RYI E;  4EXT A;  4UEL A;  5FY7 A;  4BJM A;  2UUB T;  5JDN A;  3GN5 A;  2MPK A;  4G2A A;  3M65 A;  3RC8 A;  3BQI A;  2A72 A;  2EHO C;  2MYS A;  4XZC A;  3L39 A;  1T7S A;  3CKD A;  3EI0 A;  2IDO B;  4EV6 A;  3N9M A;  1HNZ T;  4ZI3 D;  3UTK A;  1S94 A;  4CI1 B;  4CZZ B;  2J62 A;  4JI4 T;  4AKL A;  1YQ3 A;  4U72 A;  5AFU L;  2K3W A;  5HEU A;  2NW7 A;  1M62 A;  3MA9 A;  3AXJ B;  1YXR A;  4HFV A;  1LKX A;  3TLT A;  1NAF A;  5GON E;  4DV6 T;  1FMV A;  4CN1 A;  4IGU A;  3X1D A;  5LP6 E;  4ZXL A;  4B3T T;  3ZCI A;  1KNP A;  4BAY B;  2XSB A;  2IC6 A;  1KF6 A;  2BG9 E;  3U3I A;  2DLR A;  1MIV A;  4H9S E;  3NZP A;  4H9O C;  5J2T E;  1ZEE A;  3PUQ A;  1HG2 A;  3A7M A;  2CMR A;  4OFZ A;  4YTN A;  2JIW A;  3OPC A;  2GK9 A;  4X64 T;  2E9X D;  3CX7 B;  3KV5 A;  4CN6 A;  4EYU A;  3TLU A;  3MK7 C;  4MBQ A;  2LKH A;  2EHO A;  2CEA A;  3DJB A;  3HKE E;  4QKN A;  5ABF A;  3LG7 A;  2DI4 A;  2XAQ B;  5AQQ B;  4TNV A;  3EDU A;  2VVN A;  5KMG P;  3SFE A;  2QGS A;  3P8C D;  3TLW A;  2NOX A;  2LSY A;  4UF0 B;  3CX6 B;  2XQ6 A;  3FHN A;  4BJN A;  2V7L A;  3CQC B;  2BG9 B;  5FL1 A;  5FP3 A;  2A9U A;  4HFE A;  2HPL A;  2KWI B;  1XWM A;  2I0M A;  2VVS A;  3PV0 F;  4ZZC A;  1WLX A;  3RIF A;  3J7Y q;  3ZPO A;  3D0T A;  1G73 A;  1H7C A;  3ONX A;  4B6X A;  3UUL A;  1U4Q A;  4YTM A;  5FVK A;  2LRK A;  3RGL A;  2YU1 A;  3RLF F;  4YY3 T;  2RP4 A;  4O2A E;  4ILB A;  1NWM X;  3VRA A;  4LFA T;  4IDQ A;  2KXP B;  4NXN T;  1S35 A;  2YU2 A;  2V6Y A;  4ZI2 C;  5HCJ A;  4BA9 A;  1GQE A;  2KMF A;  3UUB A;  3KVB A;  3UT5 E;  2CBI A;  3K3Q C;  2IW5 B;  3RI5 A;  3AEB A;  4LF9 T;  2WDR A;  4GYS A;  3OJA A;  2YIN A;  3PUX F;  3C98 B;  3PJA A;  4IDN A;  2JPF A;  1IBK T;  5LHI B;  4IE7 A;  1JNR A;  2E5L T;  3ZJ1 A;  2WP9 A;  2MOZ A;  1MND A;  3AVS A;  4AQF A;  3ZYK A;  3M3Z B;  2XQY A;  3FZK B;  2CE7 A;  5LJN A;  2YKS A;  1VOM A;  5KX5 E;  3OBV E;  3Q5D A;  2DL1 A;  1U5P A;  4LF6 T;  2ODV A;  3ZMV B;  1J5E T;  4ASK A;  3KV6 A;  2ZM0 A;  3L09 A;  2JQ9 A;  2M67 A;  2DWK A;  4UR9 A;  5HWY A;  4JI8 T;  3R6N A;  4DR2 T;  2X9W A;  2VL0 A;  5HXS A;  5L3F B;  3FZM B;  5FVL A; 
#chains in the Genus database with same CATH homology
 4LFA T;  4JI5 T;  4DR4 T;  4X64 T;  4NXN T;  4X66 T;  2UXC T;  2VQF T;  2UXB T;  4OX9 T;  4DV4 T;  2UXD T;  1I94 T;  4JYA T;  4LF9 T;  4JI3 T;  4GKJ T;  3T1H T;  1N32 T;  2UUB T;  4LFB T;  1HNX T;  4X62 T;  2F4V T;  4DUY T;  1HR0 T;  4JI0 T;  4LFC T;  1IBK T;  1XMQ T;  4DV2 T;  5LMU T;  1HNZ T;  4DV5 T;  2E5L T;  4DV1 T;  4YHH T;  4B3R T;  2UU9 T;  4JI1 T;  4DR7 T;  4JI4 T;  4JI2 T;  4KHP T;  4DV3 T;  4DV7 T;  5BR8 T;  1FJG T;  5LMN T;  1XNQ T;  5IWA T;  1IBM T;  4JV5 T;  1N36 T;  4JI7 T;  2ZM6 T;  1N34 T;  4B3M T;  4GKK T;  4LF6 T;  4DV0 T;  2UUA T;  4K0K T;  4DV6 T;  4LF7 T;  4DUZ T;  1J5E T;  4DR5 T;  1XMO T;  4DR3 T;  4X65 T;  4JI6 T;  4B3T T;  4B3S T;  3OTO T;  4AQY T;  1N33 T;  1IBL T;  4LF8 T;  4DR1 T;  2VQE T;  4LF4 T;  2UUC T;  4JI8 T;  1XNR T;  4DR2 T;  4DR6 T;  3T1Y T;  4YY3 T;  4LF5 T;  4NXM T;  1HNW T;  2HHH T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...