1XMOT

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xmoT00
2HHHT 1N32T 1IBKT 2UUBT 1HNZT 4JI8T 1HNXT 2UXBT 2VQFT 3T1YT 2UXCT 4X66T 4X65T 4NXMT 1IBLT 4LF5T 4JI5T 5BR8T 4LFBT 4YHHT 4GKJT 1HR0T 4GKKT 1IBMT 4DR3T 4LF4T 4DUZT 1N33T 4DR7T 4B3TT 4DV3T 4DR4T 4OX9T 4DV6T 4LF6T 3OTOT 1N34T 2UXDT 4DV2T 5LMUT 4DR5T 4LF7T 1HNWT 4DR1T 2UU9T 4B3MT 4AQYT 4LF8T 4JI3T 4JV5T 2E5LT 4B3RT 1XNRT 1XMQT 4JI1T 5IWAT 4JI6T 4JYAT 4JI4T 4K0KT 4DUYT 4LFAT 5LMNT 1N36T 4DV0T 3T1HT 4JI7T 4DV4T 1XNQT 1FJGT 4JI0T 2VQET 4DR2T 1XMOT 4X62T 4KHPT 4LFCT 2F4VT 1J5ET 4DV7T 2UUCT 4LF9T 4NXNT 4DV5T 4YY3T 2UUAT 4B3ST 2ZM6T 4JI2T 4X64T 4DV1T 1I94T 4DR6T
chains in the Genus database with same CATH superfamily
1E1HB 3AE2A 4L9IA 3BQIA 2ZM2A 3I0OA 5EZYE 4JI8T 4U74A 1D0YA 2VQFT 2WWVA 3QNUA 5AQSB 5AQFB 4X66T 2YDSA 2WAUA 5LG4A 2LOPA 4F6RC 2VL8A 3N5LA 2D0TA 2LHRA 2PFVA 4IDPA 4IL4A 4H9SE 4HTEA 3CQCB 3ZLIA 2JQHA 3HKBE 2CRBA 2WDQA 3P7IA 3EHZA 5J2TE 4MBQA 2LKHA 4CI2B 3IBPA 2HPJA 4HN9A 2K9AA 4WYVA 5JH7E 3JC6D 3P8CD 3VHLA 4DR5T 2CHNA 2E9XC 2FJEA 3BQLA 3KFWX 5JDHA 5ABGA 3ZKRA 5ABEA 2VURA 4B3RT 5JDLA 4O4IE 2C0SA 3M3ZB 3C98B 4ILCA 4UF0B 2YDRA 2XQYA 2XUEA 3O1JA 1UURA 1XZYA 2XTLA 3F2EA 4DV4T 1FJGT 2CBJA 3N9LA 3KV5A 3ETVA 2CXFA 2XQ5A 2VKHA 3K3NA 5FXZA 4DV5T 3AAEB 4AXPA 3K3QC 1KNZA 2NR4A 4X64T 2FUPA 2E9XB 2XASB 3WAKA 2DHRA 3U3IA 1HNZT 3Q9DA 4H9RC 3T1YT 5GONE 2DWKA 5ETWA 2ACZA 2Q9QA 2X9WA 4Z90A 3RIAA 3B57A 1D1BA 2VKOA 3WI3A 5ABHA 2E8IA 3KVAA 1W0AA 2CCQA 5F5WA 3EI0A 4DR3T 3N9PA 2YEVC 3UU8A 4AQFA 2DL1A 5J2UE 1NAFA 4ANJA 3ZMTB 3DTOA 5JTGA 5LYJE 2UU9T 5LHHB 2LM9A 2MAWA 1J5WA 4CN4A 2XQ6A 4IDOA 3CK6A 4EYUA 2LJLA 5HWYA 2L9QA 2KXPB 3X1DA 2X67A 3UU3A 4HEAA 3LFMA 2LSGA 2HN1A 4CQIA 2BG9C 4HFIA 4G63A 2CWYA 4FI5A 3RPUA 2XQ3A 1U5PA 3I0QA 5C2TA 3Q5WA 2BG9E 3HI2A 4HFHA 4CI3B 3CQXC 3D0TA 4HFEA 1W0BA 1J1JA 3ZT5A 4JI5T 4QWNB 5AQJB 1HTJF 1ZP0A 2WDRA 2OV9A 3H3MA 5J0ZA 3CIRA 3AEEA 4GKJT 4YXDA 1LVFA 5AQMB 2N2NA 1QSDA 1BR2A 5FL0A 4TV8E 5FXVA 4HWCA 5AQRB 4I50E 3P4RA 2W0GA 4H9PC 4ILUA 5HEUA 3ZJ1A 4AQFC 5LG3A 3E08A 4B3MT 3QB5K 2WQYA 4PAGA 3RQUA 1WR0A 4X1YE 5EK3A 1LRZA 1Y64B 2KZ7B 4EAHA 4I43B 4ZS2A 4X1IE 1BR4A 4A5XA 4YHJA 2Q9QB 4H63H 3UTKA 4EZ4A 2IC6A 4YFSA 2PBIA 3EDUA 2DWGA 2H7OA 2MPKA 5LB7B 2JQ9A 3CX8B 3FBLA 4YTMA 2MBGA 4CXXA 5JDMA 3JC6C 1WFDA 2Y6XA 3EDVA 4IE4A 3KINB 4PFOA 4X65T 3RRWA 2YKSA 4PNIA 4NXMT 2X66A 2VVSA 5L3DB 1M7KA 4U31A 3P4PA 2W62A 3AEBA 3TLSA 2JJ9A 4IE5A 3AAIA 5JDGA 3N9NA 2SPCA 3VR9A 3HKDE 3ZPOA 3H3AA 4LMKA 3R84B 2X51A 3FXEB 4NPPA 1M62A 1JNZA 3AE7A 1IZNB 2A72A 3UUBA 4A56A 1T8BA 2LSYA 4DV2T 4O4HE 4MHCA 3PUAA 4HFDA 2IMLA 1Y01A 2K48A 3B13A 4IREA 4DR1T 3ZCJA 4WW0A 1MIVA 5FY7A 1ZHCA 3AEDA 2KINB 4LFAT 3NRYA 2D9DA 3T1HT 3HKCE 4PJNA 3PTRB 4EYYR 4O2BE 1XNQT 3F31A 4DR2T 4ZOLE 1MIYA 3UQ7A 2CEAA 5L47A 3AE4A 1L0VA 5IHYA 3U78A 2FJDA 2XAGB 2W2UA 2W63A 2IW5B 4JI2T 3OYZA 2XQAA 2ODVA 2JRKA 2DLRA 2QVAA 1WR6A 5ABFA 1IBKT 2LSIA 4OYKA 2UXBT 3ZMUB 2KSRA 3ONLC 1OXZA 3K8PC 3L09A 4HFVA 4H9OC 2I0MA 1D0XA 2LE8A 2X0YA 1DU2A 4PK4A 3VRBA 1ZEEA 1YW0A 4IDZA 4TWHA 4Z8XA 4YTNA 3Q5XA 5L3GB 3RHWA 4ZXLA 1MIWA 3GA8A 1QLBA 2PG8A 4TV9E 2WMOA 2BBHA 2XM1A 1AJ3A 2BKPA 3PUGA 2VB6A 3AE1A 5LMUT 5CFBA 2Y8DA 4NUVA 2BKNA 3ZC1A 5KXJA 2V7KA 4YSZA 1KNRA 3AVRA 3QK6A 4K0KT 2NW7A 2LOSA 1ZV4X 3QUJA 5FYMA 4JEHB 1HF8A 2EHOC 4V1Av 2NW9A 2ES0A 3RIUA 5KMGP 1S35A 4PJMA 3N2GE 4F8HA 4ZZCA 5FMNA 4I4TE 3LK42 3OVUA 3E22E 1T7SA 2IC9A 2BS3A 1Z8UA 4YSXA 1VRBA 4U2ZA 5LHIB 3RF1A 3V5UA 2UUBT 1YD8G 1KFYA 3G06A 3FBZA 3PU3A 2VASA 3JADA 1OWAA 5JVDE 5F3JA 2HN2A 2VWAA 2KMFA 2HH7A 5JDFA 2V7MA 4GYSA 4DNDA 3ZEFB 4NIQA 3MA9A 2WCAA 4LF4T 5HCMA 4GK0E 2DI4A 3AE6A 3FXDB 2MOZA 1NENA 1XWMA 4DV3T 3I9WA 1B7TA 4WBNE 5JREA 3AE3A 4QHOA 5J1GA 3SWHA 1BR0A 2KWHA 5ABFB 2ODUA 4IE0A 4JI6T 4FJOA 5F8PA 4ZI3D 3AXJA 5HEGA 3O1IA 3ZSSA 3HKEE 2WSSV 3QC9A 5AQLB 4X62T 2P9BA 1WYCA 2UUCT 4L5GA 2M6IA 5CA1E 4OFZA 4YY3T 3RC3A 4O4LE 4N78D 1FIOA 5HXSA 1UK5A 2JMKA 5IYZE 1I94T 5FY1A 2LKGA 5L3FB 3MJXA 3MZKB 5EK4A 5AFUL 2C5KT 4CXYA 3FZMB 4U72A 1UX5A 2BVMA 3IEEA 5AQNB 4TZ4C 2W61A 2K3WA 5FXWA 3ZN0B 3W15B 4P0AA 2NP9A 2ACXA 2XQ9A 4KX6A 5JDNA 4NUUA 2XM2A 2A2FX 3PV0F 3IA3A 5LBQB 2K5BB 4YLHA 1MNDA 4AKGA 4JV5T 3FZFB 2XAQB 4QXCB 4PK6A 3ZYLA 1R8IA 4TNWA 2FJAA 4AKHA 4DV0T 4ILBA 2N1GA 2OLTA 4PW8A 2YDQA 2IAKA 3ZCIA 2XSAA 1UCUA 3EABA 2M6BA 3H37A 2YINA 3LG7A 2KLQA 5CGMA 3FZKB 4IT4A 3QB5A 1HNXT 4EGWA 3GMIA 3HR0A 5M4YA 3SOLA 1LKXA 3LDQB 2XAHB 5HWXA 2QYWA 2X9HA 5HEOA 4TWFA 4GOUA 2RPAA 4YHHT 2LM2A 2D5UA 2G0UA 3ZSTA 3AXJB 4TX5A 5AQUB 4YJ3E 1YKHB 5LOVE 4L0RA 3UUXB 3N2OA 4XAXB 1IBMT 3UFGA 3JAEA 3RH3A 4MFRA 3RKGA 4ADZA 4DMWA 3AVSA 4GIWA 4EXTA 2ZM8A 2Q9QC 3PUSA 3AEAA 2LSKA 5FP3A 4MLKA 4JI3T 1IJ6A 2PJQA 3FZHB 3E0ZA 1D0ZA 4JI1T 2WY2A 4DUYT 2C5IT 3DP7A 3RYHE 1UGOA 3RKOA 5LHGB 5HXEA 3VR8A 4AKRB 3P4WA 4DV7T 3C51A 2V6YA 1ZOYA 5LGTB 2NTXA 3ONJA 3N9OA 4U7IA 5L4HA 3C4WA 5HYAA 1IJ5A 3PUZF 4U33A 4Z91A 4P0BA 2XHEB 4EIWA 3CMLA 3ZMZB 2KT9A 3AECA 3M65A 3CVRA 4ZI3C 3A7MA 3AE5A 5BR8T 3ZN1B 2XQ8A 4DIDB 3LBXA 2VL0A 2FBWA 2H7VC 3NRXA 5LA6E 3A8YC 1HR0T 4GKKT 1EZ3A 4CXWA 3UUNA 4DUZT 3I9YA 2WU2A 1V9DA 4EV6A 5JRCA 4H9QC 3GWHA 3HA4A 4YTPA 3GN5A 4LF7T 2DCFA 1SHZC 3PUXF 2I6HA 3C50A 3KV9A 1XDPA 5IWAT 1E2AA 5JR9A 2CLYC 4UELA 3A5XA 2A9UA 4WZXA 4KBMB 5AQVB 3ZMSB 2RP4A 4JI0T 1NWMX 4ASKA 4DBRA 3PDYA 3MKDA 4UVCB 5C8YE 4LFCT 3LK2B 5LBMA 3AEFA 1W9RA 4NXNT 3AE9A 5CB4E 3CKDA 2J62A 2Z6EA 4IGUA 2L3LA 5KDMC 2XAFB 1HX1B 2X68A 3UT5E 4DV1T 3JAFA 4UEMA 1SA0E 2WZIA 4P09A 2UXCT 3TKLB 1T98A 4UV8B 4UVAB 2YK0A 3ZT7A 1KNPA 4I55E 2CLYB 5FKYA 4JLEA 4G2AA 4HFCA 3NBXX 4CI1B 3NWIA 3ABVA 1GQEA 1I6ZA 2BBJA 3MACA 5DJQC 3UU4A 2V6YB 2V7LA 4MALA 2MYSA 1HFAA 3MK7C 3K3OA 1N34T 2XQ4A 2BS4A 2CHOA 2HPLA 4DMVA 3AA7B 5HEJA 5LCYA 1HNWT 4ILAA 4H63V 4HKAA 2CXDA 3FB2A 4JYAT 2VKDA 4TNVA 4BJMA 5LMNT 2CM0A 3PUQA 2VK9A 3SS1A 2VQET 4BAYB 1XMOT 3KV4A 3WAJA 4DO0A 1HG2A 5TAOA 4H9NC 3LBXB 1J5ET 4E7ZA 2XAJB 4OHFA 3RGLA 5L4EA 3RQWA 5L3BB 4ZHQE 1WRDA 4ZI2D 5E0OA 5CJ5A 3T8OA 3NKZA 4X1KE 5JRCB 1E7PA 3RLFF 3Q2MA 4C91A 2WWUA 1CHUA 5HXRA 5FVKA 4IIJE 3K1SA 1YQ3A 3GN5B 2NWBA 3OPCA 4HWHA 1LVKA 1VOMA 1WLXA 5H6RB 5LGUB 1JNRA 4UR9A 3ZYMA 4LFBT 5JR9B 1WYBA 4ZS3A 2UXNB 4YSYA 2J4GA 2XY8B 5KX5E 4GYRA 2AE9A 1KK7A 4IE6A 2NW8A 2XQ7A 4JUYA 2W66A 4E7SA 2JQQA 4UV9B 4TWDA 2QGSA 5DABA 4JEUB 2R6GF 3UULA 4KI0F 4JI4T 1FEWA 3DJBA 2WMNA 2LHNA 4ERRA 3RYCE 2BZBA 5AQIB 5LNKA 2XJ7A 5LP6E 2CA5A 4UXNB 1BR1A 4IHJE 4LF9T 4U3CA 2LEHA 4XZCA 3SFDA 5CA0E 3R6NA 4B3ST 3KDSE 3PJAA 3Q5EA 4ISSA 3LSVA 5BMVE 4CN6A 2WB5A 2V26A 4O4JE 3RYFE 3ONXA 3RIUC 3RIFA 1IBLT 3SFEA 4KP3C 4HWDA 4AISA 1XDOA 2QA7A 3LJCA 1FMWA 3TLWA 5AQQB 3UU5A 2CBIA 2GK9A 5AQGB 1N33T 3LK3B 2CPTA 5HXCA 2YU1A 4AKLA 2PTFA 3OBVE 3PU8A 3Q5DA 2LT3A 1HG5A 2E2AA 3VKHA 1NEKA 3OKQA 4IDNA 2UXXB 2BG9A 3NZQA 1D1AA 3BK9A 3OYXA 2WBLA 3PUVF 3ZT6A 5L2LA 3L3PA 2VVNA 3AE8A 5AQKB 2J47A 3OJAA 3UUMA 3S4UA 2X0LB 2V6XA 4AI6A 2YU2A 2ZM6T 2DNXA 3IHRA 2W4XA 2BKOA 2JQKA 3RC8A 1KF6A 1WCRA 2W00A 5H6QB 4HWIB 4HFBA 2W67A 2A3DA 3V5SA 5FVLA 5HXHA 2LRLA 1HS7A 2KNDA 3MXZA 4X20E 3B5MA 4UVBB 4DVDA 2B76A 3EAMA 1HCIA 2NTYA 4WNKA 1OEDA 4U2YA 3NZPA 5LJNA 2ZLYA 3O9XA 4QX7B 3UU6A 5AQPB 4DR7T 4ZI2C 4ZEYA 5DQWA 4X5TA 2RA1A 2V5DA 2J1DG 1UUSA 2YOEA 1VCTA 4A97A 1MMAA 3C4ZA 3KBTA 4PJLA 4DBQA 4HGAA 3IF8B 4JI7T 3P50A 4OK0A 5HAXA 4QXHB 4COFA 4U7YA 4AKIA 2IUBA 4LMJA 3L39A 4HWFA 2EHOD 1KEYA 5DQVA 4Q25A 3AA0B 4OYJA 3RYIE 3BQKA 4C90A 3L8RA 2BG9B 3ANWA 3EVYA 2FJBA 1H7CA 3CWZB 4M1PA 4BA9A 3O4XE 2M67A 5LXTE 2LLYA 1MNEA 4ZZBA 1OEDC 4CZZB 1X9BA 4B3TT 1X79A 4DV6T 2N9DA 4LF6T 4EEBA 1OEDE 3JCFA 2BS2A 3UFEA 3N2KE 5A1LA 3TLTA 4AQYT 2Y48B 4ISTA 2WM9A 5LGNB 4QH5A 3P4QA 4KHZF 2V7JA 2B1EA 3PURA 3UQ4A 1N36T 5LJMA 2X9XA 3HL6A 4YT0A 2VKJA 3TLVA 1FMVA 3J7Yq 3CQGB 4J2CA 2ZMAA 3AEGA 5HEHA 3VKGA 1OEDB 5C3JA 5AQTB 1S94A 3N9MA 2UUAT 3QOFA 3ZJ2A 4I0UA 3FZLB 3CX7B 4EZHA 4EEDA 3PUYF 2H89A 3ZYKA 2E9XD 1O3XA 4XBFB 2AXDS 2WU5A 2BDEA 3FHNA 3P4SA 4LF5T 2H88A 2D2SA 3VRAA 3J9X1 2QRXA 2D0UA 4QX8B 3AA6B 3O1HA 2KWIB 3F57A 2EHOA 4QH1A 2NOXA 1QUUA 2X0HA 4TN7B 3OTOT 4PFPA 4ZI7E 4LMLA 5L3CB 3RX6A 5AQHB 2WDVA 4LF8T 3CX6B 2OA5A 1U4QA 5ADXL 3I1AA 1XNRT 1XMQT 2XSBA 2I59A 4WBOA 1YQ4A 2C5JA 3RRCA 2X9YA 2IIUA 2V7IA 5JQGE 4A98A 5L3EB 3ETUA 3C4XA 3ANWB 2WS3A 4KHPT 1G8XA 2V5CA 5FY0A 1IAPA 2F4VT 1YKEB 4BJNA 3ZMVB 5JDQA 4K0UA 3NVOA 4GK5E 2CMRA 3AAAB 2XPKA 4PK5A 4QH4A 2L8KA 5JR9C 2HHHT 3PJAJ 4AQGA 1N32T 2ZM0A 1CUNA 4IE7A 4QKNA 1MMGA 2WZHA 4UF0A 5FL1A 3KVBA 4UIGA 4QXBB 3EUHA 1G73A 5EK2A 2YN6A 1ZKEA 1HX8A 2K24A 4EB6E 3ZC0A 2IDOB 5HCJA 4KUMB 2LSJA 3TLUA 1Z0PA 4KMCA 1D1CA 2JMHA 2MTQA 4HE8A 5FNVE 2JIWA 4B6XA 2E9XA 1SE7A 4AIUA 4EOZB 4DR4T 4OX9T 2IHR1 2UXDT 3C64A 2XZEA 1VCSA 3PE0A 2WP9A 3KBUA 2V8SV 4P1NA 4JBWF 1SUMB 2LRKA 2V1DB 2E5LT 2CXLA 3KV6A 1W09A 1T72A 2H3RA 1MMNA 1UX4A 2CE7A 5AQOB 3N9QA 4O8SA 4PJJA 1MMDA 3SRZA 2Q9QD 1US7B 3AA1B 2BVLA 2CWOA 2JPFA 3ESLA 4IL9A 4IDQA 3CPZA 3VU7H 1YXRA 3PUWF 2E5VA 5FXXA 4YJ2E 4TUYE 4CN1A 3AB3B 3RI5A 2EHOB 5IUXA 4O2AE 4DR6T
chains in the Genus database with same CATH topology
2HHHT 1N32T 1IBKT 2UUBT 1HNZT 4JI8T 1HNXT 2UXBT 2VQFT 3T1YT 2UXCT 4X66T 4X65T 4NXMT 1IBLT 4LF5T 4JI5T 5BR8T 4LFBT 4YHHT 4GKJT 1HR0T 4GKKT 1IBMT 4DR3T 4LF4T 4DUZT 1N33T 4DR7T 4B3TT 4DV3T 4DR4T 4OX9T 4DV6T 4LF6T 3OTOT 1N34T 2UXDT 4DV2T 5LMUT 4DR5T 4LF7T 1HNWT 4DR1T 2UU9T 4B3MT 4AQYT 4LF8T 4JI3T 4JV5T 2E5LT 4B3RT 1XNRT 1XMQT 4JI1T 5IWAT 4JI6T 4JYAT 4JI4T 4K0KT 4DUYT 4LFAT 5LMNT 1N36T 4DV0T 3T1HT 4JI7T 4DV4T 1XNQT 1FJGT 4JI0T 2VQET 4DR2T 1XMOT 4X62T 4KHPT 4LFCT 2F4VT 1J5ET 4DV7T 2UUCT 4LF9T 4NXNT 4DV5T 4YY3T 2UUAT 4B3ST 2ZM6T 4JI2T 4X64T 4DV1T 1I94T 4DR6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH T;  1N32 T;  1IBK T;  2UUB T;  1HNZ T;  4JI8 T;  1HNX T;  2UXB T;  2VQF T;  3T1Y T;  2UXC T;  4X66 T;  4X65 T;  4NXM T;  1IBL T;  4LF5 T;  4JI5 T;  5BR8 T;  4LFB T;  4YHH T;  4GKJ T;  1HR0 T;  4GKK T;  1IBM T;  4DR3 T;  4LF4 T;  4DUZ T;  1N33 T;  4DR7 T;  4B3T T;  4DV3 T;  4DR4 T;  4OX9 T;  4DV6 T;  4LF6 T;  3OTO T;  1N34 T;  2UXD T;  4DV2 T;  5LMU T;  4DR5 T;  4LF7 T;  1HNW T;  4DR1 T;  2UU9 T;  4B3M T;  4AQY T;  4LF8 T;  4JI3 T;  4JV5 T;  2E5L T;  4B3R T;  1XNR T;  1XMQ T;  4JI1 T;  5IWA T;  4JI6 T;  4JYA T;  4JI4 T;  4K0K T;  4DUY T;  4LFA T;  5LMN T;  1N36 T;  4DV0 T;  3T1H T;  4JI7 T;  4DV4 T;  1XNQ T;  1FJG T;  4JI0 T;  2VQE T;  4DR2 T;  1XMO T;  4X62 T;  4KHP T;  4LFC T;  2F4V T;  1J5E T;  4DV7 T;  2UUC T;  4LF9 T;  4NXN T;  4DV5 T;  4YY3 T;  2UUA T;  4B3S T;  2ZM6 T;  4JI2 T;  4X64 T;  4DV1 T;  1I94 T;  4DR6 T; 
#chains in the Genus database with same CATH topology
 1E1H B;  3AE2 A;  4L9I A;  3BQI A;  2ZM2 A;  3I0O A;  5EZY E;  4JI8 T;  4U74 A;  1D0Y A;  2VQF T;  2WWV A;  3QNU A;  5AQS B;  5AQF B;  4X66 T;  2YDS A;  2WAU A;  5LG4 A;  2LOP A;  4F6R C;  2VL8 A;  3N5L A;  2D0T A;  2LHR A;  2PFV A;  4IDP A;  4IL4 A;  4H9S E;  4HTE A;  3CQC B;  3ZLI A;  2JQH A;  3HKB E;  2CRB A;  2WDQ A;  3P7I A;  3EHZ A;  5J2T E;  4MBQ A;  2LKH A;  4CI2 B;  3IBP A;  2HPJ A;  4HN9 A;  2K9A A;  4WYV A;  5JH7 E;  3JC6 D;  3P8C D;  3VHL A;  4DR5 T;  2CHN A;  2E9X C;  2FJE A;  3BQL A;  3KFW X;  5JDH A;  5ABG A;  3ZKR A;  5ABE A;  2VUR A;  4B3R T;  5JDL A;  4O4I E;  2C0S A;  3M3Z B;  3C98 B;  4ILC A;  4UF0 B;  2YDR A;  2XQY A;  2XUE A;  3O1J A;  1UUR A;  1XZY A;  2XTL A;  3F2E A;  4DV4 T;  1FJG T;  2CBJ A;  3N9L A;  3KV5 A;  3ETV A;  2CXF A;  2XQ5 A;  2VKH A;  3K3N A;  5FXZ A;  4DV5 T;  3AAE B;  4AXP A;  3K3Q C;  1KNZ A;  2NR4 A;  4X64 T;  2FUP A;  2E9X B;  2XAS B;  3WAK A;  2DHR A;  3U3I A;  1HNZ T;  3Q9D A;  4H9R C;  3T1Y T;  5GON E;  2DWK A;  5ETW A;  2ACZ A;  2Q9Q A;  2X9W A;  4Z90 A;  3RIA A;  3B57 A;  1D1B A;  2VKO A;  3WI3 A;  5ABH A;  2E8I A;  3KVA A;  1W0A A;  2CCQ A;  5F5W A;  3EI0 A;  4DR3 T;  3N9P A;  2YEV C;  3UU8 A;  4AQF A;  2DL1 A;  5J2U E;  1NAF A;  4ANJ A;  3ZMT B;  3DTO A;  5JTG A;  5LYJ E;  2UU9 T;  5LHH B;  2LM9 A;  2MAW A;  1J5W A;  4CN4 A;  2XQ6 A;  4IDO A;  3CK6 A;  4EYU A;  2LJL A;  5HWY A;  2L9Q A;  2KXP B;  3X1D A;  2X67 A;  3UU3 A;  4HEA A;  3LFM A;  2LSG A;  2HN1 A;  4CQI A;  2BG9 C;  4HFI A;  4G63 A;  2CWY A;  4FI5 A;  3RPU A;  2XQ3 A;  1U5P A;  3I0Q A;  5C2T A;  3Q5W A;  2BG9 E;  3HI2 A;  4HFH A;  4CI3 B;  3CQX C;  3D0T A;  4HFE A;  1W0B A;  1J1J A;  3ZT5 A;  4JI5 T;  4QWN B;  5AQJ B;  1HTJ F;  1ZP0 A;  2WDR A;  2OV9 A;  3H3M A;  5J0Z A;  3CIR A;  3AEE A;  4GKJ T;  4YXD A;  1LVF A;  5AQM B;  2N2N A;  1QSD A;  1BR2 A;  5FL0 A;  4TV8 E;  5FXV A;  4HWC A;  5AQR B;  4I50 E;  3P4R A;  2W0G A;  4H9P C;  4ILU A;  5HEU A;  3ZJ1 A;  4AQF C;  5LG3 A;  3E08 A;  4B3M T;  3QB5 K;  2WQY A;  4PAG A;  3RQU A;  1WR0 A;  4X1Y E;  5EK3 A;  1LRZ A;  1Y64 B;  2KZ7 B;  4EAH A;  4I43 B;  4ZS2 A;  4X1I E;  1BR4 A;  4A5X A;  4YHJ A;  2Q9Q B;  4H63 H;  3UTK A;  4EZ4 A;  2IC6 A;  4YFS A;  2PBI A;  3EDU A;  2DWG A;  2H7O A;  2MPK A;  5LB7 B;  2JQ9 A;  3CX8 B;  3FBL A;  4YTM A;  2MBG A;  4CXX A;  5JDM A;  3JC6 C;  1WFD A;  2Y6X A;  3EDV A;  4IE4 A;  3KIN B;  4PFO A;  4X65 T;  3RRW A;  2YKS A;  4PNI A;  4NXM T;  2X66 A;  2VVS A;  5L3D B;  1M7K A;  4U31 A;  3P4P A;  2W62 A;  3AEB A;  3TLS A;  2JJ9 A;  4IE5 A;  3AAI A;  5JDG A;  3N9N A;  2SPC A;  3VR9 A;  3HKD E;  3ZPO A;  3H3A A;  4LMK A;  3R84 B;  2X51 A;  3FXE B;  4NPP A;  1M62 A;  1JNZ A;  3AE7 A;  1IZN B;  2A72 A;  3UUB A;  4A56 A;  1T8B A;  2LSY A;  4DV2 T;  4O4H E;  4MHC A;  3PUA A;  4HFD A;  2IML A;  1Y01 A;  2K48 A;  3B13 A;  4IRE A;  4DR1 T;  3ZCJ A;  4WW0 A;  1MIV A;  5FY7 A;  1ZHC A;  3AED A;  2KIN B;  4LFA T;  3NRY A;  2D9D A;  3T1H T;  3HKC E;  4PJN A;  3PTR B;  4EYY R;  4O2B E;  1XNQ T;  3F31 A;  4DR2 T;  4ZOL E;  1MIY A;  3UQ7 A;  2CEA A;  5L47 A;  3AE4 A;  1L0V A;  5IHY A;  3U78 A;  2FJD A;  2XAG B;  2W2U A;  2W63 A;  2IW5 B;  4JI2 T;  3OYZ A;  2XQA A;  2ODV A;  2JRK A;  2DLR A;  2QVA A;  1WR6 A;  5ABF A;  1IBK T;  2LSI A;  4OYK A;  2UXB T;  3ZMU B;  2KSR A;  3ONL C;  1OXZ A;  3K8P C;  3L09 A;  4HFV A;  4H9O C;  2I0M A;  1D0X A;  2LE8 A;  2X0Y A;  1DU2 A;  4PK4 A;  3VRB A;  1ZEE A;  1YW0 A;  4IDZ A;  4TWH A;  4Z8X A;  4YTN A;  3Q5X A;  5L3G B;  3RHW A;  4ZXL A;  1MIW A;  3GA8 A;  1QLB A;  2PG8 A;  4TV9 E;  2WMO A;  2BBH A;  2XM1 A;  1AJ3 A;  2BKP A;  3PUG A;  2VB6 A;  3AE1 A;  5LMU T;  5CFB A;  2Y8D A;  4NUV A;  2BKN A;  3ZC1 A;  5KXJ A;  2V7K A;  4YSZ A;  1KNR A;  3AVR A;  3QK6 A;  4K0K T;  2NW7 A;  2LOS A;  1ZV4 X;  3QUJ A;  5FYM A;  4JEH B;  1HF8 A;  2EHO C;  4V1A v;  2NW9 A;  2ES0 A;  3RIU A;  5KMG P;  1S35 A;  4PJM A;  3N2G E;  4F8H A;  4ZZC A;  5FMN A;  4I4T E;  3LK4 2;  3OVU A;  3E22 E;  1T7S A;  2IC9 A;  2BS3 A;  1Z8U A;  4YSX A;  1VRB A;  4U2Z A;  5LHI B;  3RF1 A;  3V5U A;  2UUB T;  1YD8 G;  1KFY A;  3G06 A;  3FBZ A;  3PU3 A;  2VAS A;  3JAD A;  1OWA A;  5JVD E;  5F3J A;  2HN2 A;  2VWA A;  2KMF A;  2HH7 A;  5JDF A;  2V7M A;  4GYS A;  4DND A;  3ZEF B;  4NIQ A;  3MA9 A;  2WCA A;  4LF4 T;  5HCM A;  4GK0 E;  2DI4 A;  3AE6 A;  3FXD B;  2MOZ A;  1NEN A;  1XWM A;  4DV3 T;  3I9W A;  1B7T A;  4WBN E;  5JRE A;  3AE3 A;  4QHO A;  5J1G A;  3SWH A;  1BR0 A;  2KWH A;  5ABF B;  2ODU A;  4IE0 A;  4JI6 T;  4FJO A;  5F8P A;  4ZI3 D;  3AXJ A;  5HEG A;  3O1I A;  3ZSS A;  3HKE E;  2WSS V;  3QC9 A;  5AQL B;  4X62 T;  2P9B A;  1WYC A;  2UUC T;  4L5G A;  2M6I A;  5CA1 E;  4OFZ A;  4YY3 T;  3RC3 A;  4O4L E;  4N78 D;  1FIO A;  5HXS A;  1UK5 A;  2JMK A;  5IYZ E;  1I94 T;  5FY1 A;  2LKG A;  5L3F B;  3MJX A;  3MZK B;  5EK4 A;  5AFU L;  2C5K T;  4CXY A;  3FZM B;  4U72 A;  1UX5 A;  2BVM A;  3IEE A;  5AQN B;  4TZ4 C;  2W61 A;  2K3W A;  5FXW A;  3ZN0 B;  3W15 B;  4P0A A;  2NP9 A;  2ACX A;  2XQ9 A;  4KX6 A;  5JDN A;  4NUU A;  2XM2 A;  2A2F X;  3PV0 F;  3IA3 A;  5LBQ B;  2K5B B;  4YLH A;  1MND A;  4AKG A;  4JV5 T;  3FZF B;  2XAQ B;  4QXC B;  4PK6 A;  3ZYL A;  1R8I A;  4TNW A;  2FJA A;  4AKH A;  4DV0 T;  4ILB A;  2N1G A;  2OLT A;  4PW8 A;  2YDQ A;  2IAK A;  3ZCI A;  2XSA A;  1UCU A;  3EAB A;  2M6B A;  3H37 A;  2YIN A;  3LG7 A;  2KLQ A;  5CGM A;  3FZK B;  4IT4 A;  3QB5 A;  1HNX T;  4EGW A;  3GMI A;  3HR0 A;  5M4Y A;  3SOL A;  1LKX A;  3LDQ B;  2XAH B;  5HWX A;  2QYW A;  2X9H A;  5HEO A;  4TWF A;  4GOU A;  2RPA A;  4YHH T;  2LM2 A;  2D5U A;  2G0U A;  3ZST A;  3AXJ B;  4TX5 A;  5AQU B;  4YJ3 E;  1YKH B;  5LOV E;  4L0R A;  3UUX B;  3N2O A;  4XAX B;  1IBM T;  3UFG A;  3JAE A;  3RH3 A;  4MFR A;  3RKG A;  4ADZ A;  4DMW A;  3AVS A;  4GIW A;  4EXT A;  2ZM8 A;  2Q9Q C;  3PUS A;  3AEA A;  2LSK A;  5FP3 A;  4MLK A;  4JI3 T;  1IJ6 A;  2PJQ A;  3FZH B;  3E0Z A;  1D0Z A;  4JI1 T;  2WY2 A;  4DUY T;  2C5I T;  3DP7 A;  3RYH E;  1UGO A;  3RKO A;  5LHG B;  5HXE A;  3VR8 A;  4AKR B;  3P4W A;  4DV7 T;  3C51 A;  2V6Y A;  1ZOY A;  5LGT B;  2NTX A;  3ONJ A;  3N9O A;  4U7I A;  5L4H A;  3C4W A;  5HYA A;  1IJ5 A;  3PUZ F;  4U33 A;  4Z91 A;  4P0B A;  2XHE B;  4EIW A;  3CML A;  3ZMZ B;  2KT9 A;  3AEC A;  3M65 A;  3CVR A;  4ZI3 C;  3A7M A;  3AE5 A;  5BR8 T;  3ZN1 B;  2XQ8 A;  4DID B;  3LBX A;  2VL0 A;  2FBW A;  2H7V C;  3NRX A;  5LA6 E;  3A8Y C;  1HR0 T;  4GKK T;  1EZ3 A;  4CXW A;  3UUN A;  4DUZ T;  3I9Y A;  2WU2 A;  1V9D A;  4EV6 A;  5JRC A;  4H9Q C;  3GWH A;  3HA4 A;  4YTP A;  3GN5 A;  4LF7 T;  2DCF A;  1SHZ C;  3PUX F;  2I6H A;  3C50 A;  3KV9 A;  1XDP A;  5IWA T;  1E2A A;  5JR9 A;  2CLY C;  4UEL A;  3A5X A;  2A9U A;  4WZX A;  4KBM B;  5AQV B;  3ZMS B;  2RP4 A;  4JI0 T;  1NWM X;  4ASK A;  4DBR A;  3PDY A;  3MKD A;  4UVC B;  5C8Y E;  4LFC T;  3LK2 B;  5LBM A;  3AEF A;  1W9R A;  4NXN T;  3AE9 A;  5CB4 E;  3CKD A;  2J62 A;  2Z6E A;  4IGU A;  2L3L A;  5KDM C;  2XAF B;  1HX1 B;  2X68 A;  3UT5 E;  4DV1 T;  3JAF A;  4UEM A;  1SA0 E;  2WZI A;  4P09 A;  2UXC T;  3TKL B;  1T98 A;  4UV8 B;  4UVA B;  2YK0 A;  3ZT7 A;  1KNP A;  4I55 E;  2CLY B;  5FKY A;  4JLE A;  4G2A A;  4HFC A;  3NBX X;  4CI1 B;  3NWI A;  3ABV A;  1GQE A;  1I6Z A;  2BBJ A;  3MAC A;  5DJQ C;  3UU4 A;  2V6Y B;  2V7L A;  4MAL A;  2MYS A;  1HFA A;  3MK7 C;  3K3O A;  1N34 T;  2XQ4 A;  2BS4 A;  2CHO A;  2HPL A;  4DMV A;  3AA7 B;  5HEJ A;  5LCY A;  1HNW T;  4ILA A;  4H63 V;  4HKA A;  2CXD A;  3FB2 A;  4JYA T;  2VKD A;  4TNV A;  4BJM A;  5LMN T;  2CM0 A;  3PUQ A;  2VK9 A;  3SS1 A;  2VQE T;  4BAY B;  1XMO T;  3KV4 A;  3WAJ A;  4DO0 A;  1HG2 A;  5TAO A;  4H9N C;  3LBX B;  1J5E T;  4E7Z A;  2XAJ B;  4OHF A;  3RGL A;  5L4E A;  3RQW A;  5L3B B;  4ZHQ E;  1WRD A;  4ZI2 D;  5E0O A;  5CJ5 A;  3T8O A;  3NKZ A;  4X1K E;  5JRC B;  1E7P A;  3RLF F;  3Q2M A;  4C91 A;  2WWU A;  1CHU A;  5HXR A;  5FVK A;  4IIJ E;  3K1S A;  1YQ3 A;  3GN5 B;  2NWB A;  3OPC A;  4HWH A;  1LVK A;  1VOM A;  1WLX A;  5H6R B;  5LGU B;  1JNR A;  4UR9 A;  3ZYM A;  4LFB T;  5JR9 B;  1WYB A;  4ZS3 A;  2UXN B;  4YSY A;  2J4G A;  2XY8 B;  5KX5 E;  4GYR A;  2AE9 A;  1KK7 A;  4IE6 A;  2NW8 A;  2XQ7 A;  4JUY A;  2W66 A;  4E7S A;  2JQQ A;  4UV9 B;  4TWD A;  2QGS A;  5DAB A;  4JEU B;  2R6G F;  3UUL A;  4KI0 F;  4JI4 T;  1FEW A;  3DJB A;  2WMN A;  2LHN A;  4ERR A;  3RYC E;  2BZB A;  5AQI B;  5LNK A;  2XJ7 A;  5LP6 E;  2CA5 A;  4UXN B;  1BR1 A;  4IHJ E;  4LF9 T;  4U3C A;  2LEH A;  4XZC A;  3SFD A;  5CA0 E;  3R6N A;  4B3S T;  3KDS E;  3PJA A;  3Q5E A;  4ISS A;  3LSV A;  5BMV E;  4CN6 A;  2WB5 A;  2V26 A;  4O4J E;  3RYF E;  3ONX A;  3RIU C;  3RIF A;  1IBL T;  3SFE A;  4KP3 C;  4HWD A;  4AIS A;  1XDO A;  2QA7 A;  3LJC A;  1FMW A;  3TLW A;  5AQQ B;  3UU5 A;  2CBI A;  2GK9 A;  5AQG B;  1N33 T;  3LK3 B;  2CPT A;  5HXC A;  2YU1 A;  4AKL A;  2PTF A;  3OBV E;  3PU8 A;  3Q5D A;  2LT3 A;  1HG5 A;  2E2A A;  3VKH A;  1NEK A;  3OKQ A;  4IDN A;  2UXX B;  2BG9 A;  3NZQ A;  1D1A A;  3BK9 A;  3OYX A;  2WBL A;  3PUV F;  3ZT6 A;  5L2L A;  3L3P A;  2VVN A;  3AE8 A;  5AQK B;  2J47 A;  3OJA A;  3UUM A;  3S4U A;  2X0L B;  2V6X A;  4AI6 A;  2YU2 A;  2ZM6 T;  2DNX A;  3IHR A;  2W4X A;  2BKO A;  2JQK A;  3RC8 A;  1KF6 A;  1WCR A;  2W00 A;  5H6Q B;  4HWI B;  4HFB A;  2W67 A;  2A3D A;  3V5S A;  5FVL A;  5HXH A;  2LRL A;  1HS7 A;  2KND A;  3MXZ A;  4X20 E;  3B5M A;  4UVB B;  4DVD A;  2B76 A;  3EAM A;  1HCI A;  2NTY A;  4WNK A;  1OED A;  4U2Y A;  3NZP A;  5LJN A;  2ZLY A;  3O9X A;  4QX7 B;  3UU6 A;  5AQP B;  4DR7 T;  4ZI2 C;  4ZEY A;  5DQW A;  4X5T A;  2RA1 A;  2V5D A;  2J1D G;  1UUS A;  2YOE A;  1VCT A;  4A97 A;  1MMA A;  3C4Z A;  3KBT A;  4PJL A;  4DBQ A;  4HGA A;  3IF8 B;  4JI7 T;  3P50 A;  4OK0 A;  5HAX A;  4QXH B;  4COF A;  4U7Y A;  4AKI A;  2IUB A;  4LMJ A;  3L39 A;  4HWF A;  2EHO D;  1KEY A;  5DQV A;  4Q25 A;  3AA0 B;  4OYJ A;  3RYI E;  3BQK A;  4C90 A;  3L8R A;  2BG9 B;  3ANW A;  3EVY A;  2FJB A;  1H7C A;  3CWZ B;  4M1P A;  4BA9 A;  3O4X E;  2M67 A;  5LXT E;  2LLY A;  1MNE A;  4ZZB A;  1OED C;  4CZZ B;  1X9B A;  4B3T T;  1X79 A;  4DV6 T;  2N9D A;  4LF6 T;  4EEB A;  1OED E;  3JCF A;  2BS2 A;  3UFE A;  3N2K E;  5A1L A;  3TLT A;  4AQY T;  2Y48 B;  4IST A;  2WM9 A;  5LGN B;  4QH5 A;  3P4Q A;  4KHZ F;  2V7J A;  2B1E A;  3PUR A;  3UQ4 A;  1N36 T;  5LJM A;  2X9X A;  3HL6 A;  4YT0 A;  2VKJ A;  3TLV A;  1FMV A;  3J7Y q;  3CQG B;  4J2C A;  2ZMA A;  3AEG A;  5HEH A;  3VKG A;  1OED B;  5C3J A;  5AQT B;  1S94 A;  3N9M A;  2UUA T;  3QOF A;  3ZJ2 A;  4I0U A;  3FZL B;  3CX7 B;  4EZH A;  4EED A;  3PUY F;  2H89 A;  3ZYK A;  2E9X D;  1O3X A;  4XBF B;  2AXD S;  2WU5 A;  2BDE A;  3FHN A;  3P4S A;  4LF5 T;  2H88 A;  2D2S A;  3VRA A;  3J9X 1;  2QRX A;  2D0U A;  4QX8 B;  3AA6 B;  3O1H A;  2KWI B;  3F57 A;  2EHO A;  4QH1 A;  2NOX A;  1QUU A;  2X0H A;  4TN7 B;  3OTO T;  4PFP A;  4ZI7 E;  4LML A;  5L3C B;  3RX6 A;  5AQH B;  2WDV A;  4LF8 T;  3CX6 B;  2OA5 A;  1U4Q A;  5ADX L;  3I1A A;  1XNR T;  1XMQ T;  2XSB A;  2I59 A;  4WBO A;  1YQ4 A;  2C5J A;  3RRC A;  2X9Y A;  2IIU A;  2V7I A;  5JQG E;  4A98 A;  5L3E B;  3ETU A;  3C4X A;  3ANW B;  2WS3 A;  4KHP T;  1G8X A;  2V5C A;  5FY0 A;  1IAP A;  2F4V T;  1YKE B;  4BJN A;  3ZMV B;  5JDQ A;  4K0U A;  3NVO A;  4GK5 E;  2CMR A;  3AAA B;  2XPK A;  4PK5 A;  4QH4 A;  2L8K A;  5JR9 C;  2HHH T;  3PJA J;  4AQG A;  1N32 T;  2ZM0 A;  1CUN A;  4IE7 A;  4QKN A;  1MMG A;  2WZH A;  4UF0 A;  5FL1 A;  3KVB A;  4UIG A;  4QXB B;  3EUH A;  1G73 A;  5EK2 A;  2YN6 A;  1ZKE A;  1HX8 A;  2K24 A;  4EB6 E;  3ZC0 A;  2IDO B;  5HCJ A;  4KUM B;  2LSJ A;  3TLU A;  1Z0P A;  4KMC A;  1D1C A;  2JMH A;  2MTQ A;  4HE8 A;  5FNV E;  2JIW A;  4B6X A;  2E9X A;  1SE7 A;  4AIU A;  4EOZ B;  4DR4 T;  4OX9 T;  2IHR 1;  2UXD T;  3C64 A;  2XZE A;  1VCS A;  3PE0 A;  2WP9 A;  3KBU A;  2V8S V;  4P1N A;  4JBW F;  1SUM B;  2LRK A;  2V1D B;  2E5L T;  2CXL A;  3KV6 A;  1W09 A;  1T72 A;  2H3R A;  1MMN A;  1UX4 A;  2CE7 A;  5AQO B;  3N9Q A;  4O8S A;  4PJJ A;  1MMD A;  3SRZ A;  2Q9Q D;  1US7 B;  3AA1 B;  2BVL A;  2CWO A;  2JPF A;  3ESL A;  4IL9 A;  4IDQ A;  3CPZ A;  3VU7 H;  1YXR A;  3PUW F;  2E5V A;  5FXX A;  4YJ2 E;  4TUY E;  4CN1 A;  3AB3 B;  3RI5 A;  2EHO B;  5IUX A;  4O2A E;  4DR6 T; 
#chains in the Genus database with same CATH homology
 2HHH T;  1N32 T;  1IBK T;  2UUB T;  1HNZ T;  4JI8 T;  1HNX T;  2UXB T;  2VQF T;  3T1Y T;  2UXC T;  4X66 T;  4X65 T;  4NXM T;  1IBL T;  4LF5 T;  4JI5 T;  5BR8 T;  4LFB T;  4YHH T;  4GKJ T;  1HR0 T;  4GKK T;  1IBM T;  4DR3 T;  4LF4 T;  4DUZ T;  1N33 T;  4DR7 T;  4B3T T;  4DV3 T;  4DR4 T;  4OX9 T;  4DV6 T;  4LF6 T;  3OTO T;  1N34 T;  2UXD T;  4DV2 T;  5LMU T;  4DR5 T;  4LF7 T;  1HNW T;  4DR1 T;  2UU9 T;  4B3M T;  4AQY T;  4LF8 T;  4JI3 T;  4JV5 T;  2E5L T;  4B3R T;  1XNR T;  1XMQ T;  4JI1 T;  5IWA T;  4JI6 T;  4JYA T;  4JI4 T;  4K0K T;  4DUY T;  4LFA T;  5LMN T;  1N36 T;  4DV0 T;  3T1H T;  4JI7 T;  4DV4 T;  1XNQ T;  1FJG T;  4JI0 T;  2VQE T;  4DR2 T;  1XMO T;  4X62 T;  4KHP T;  4LFC T;  2F4V T;  1J5E T;  4DV7 T;  2UUC T;  4LF9 T;  4NXN T;  4DV5 T;  4YY3 T;  2UUA T;  4B3S T;  2ZM6 T;  4JI2 T;  4X64 T;  4DV1 T;  1I94 T;  4DR6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...