5JREA

Crystal structure of nec3po in complex with ssdna.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
GSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
molecule keywords NEQ131
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jreA00
5JR9B 3ZC1A 5JR9A 3ZC0A 5JRCA 5JR9C 5JRCB 5JREA
chains in the Genus database with same CATH superfamily
2UXNB 2FJAA 2N2NA 3VU7H 3GA8A 1D1AA 2WS3A 2JQQA 3P4QA 2LKHA 3PTRB 4CN6A 1XNRT 4LFBT 3UU8A 1M62A 2IC9A 1D1CA 3M65A 3NVOA 1LVFA 4ZHQE 2WMOA 2WY2A 4JUYA 2VKOA 4U74A 2G0UA 3VHLA 1UX4A 2Y8DA 3UU4A 2SPCA 2WZHA 3T1HT 4NUUA 5DQWA 5TAOA 4ZXLA 3UU6A 4AKRB 2BG9A 3WI3A 2WMNA 4F8HA 5FXWA 1MNEA 2VWAA 4HFVA 4UF0A 2D5UA 4AKHA 4EB6E 3RC8A 3L09A 5JDQA 3ONJA 3A8YC 3L39A 1OWAA 2VASA 3N9OA 5AQGB 3CMLA 2IDOB 2BKPA 4N78D 5LA6E 3BQLA 3UUMA 1O3XA 4EV6A 4P0BA 4QHOA 3KBTA 4TZ4C 1LVKA 4PFPA 4PK5A 1D0YA 5HAXA 1HFAA 2LLYA 5IHYA 2ACZA 4YLHA 3CQCB 2RA1A 2JQKA 1M7KA 2PTFA 2VKJA 3KFWX 2E8IA 4EIWA 1BR1A 5AQVB 5A1LA 3H3MA 4DV5T 4JI1T 3BQIA 3ANWB 3A7MA 3LBXA 4QX8B 2K9AA 2W63A 5DABA 1OEDC 3RKGA 4ANJA 4TNWA 4NIQA 4EXTA 5JDMA 2E2AA 2W62A 3ETUA 2VVSA 3K3QC 2IC6A 2NTYA 2C5IT 5ADXL 4TWFA 2VL8A 2XQ5A 3GN5A 4UVCB 5LBQB 5IUXA 5JREA 2CM0A 5LBMA 4ZZCA 2MOZA 3JC6D 4GYRA 4BJNA 4H9OC 4ZI3D 4I55E 4YT0A 1HNWT 2BKOA 1U4QA 4UEMA 3Q5EA 3FZKB 4IHJE 5LHHB 2KWHA 2RPAA 3FB2A 3ZPOA 2CEAA 1N32T 3QB5K 1LKXA 1OEDA 2JJ9A 3NBXX 1FMVA 3PE0A 3QNUA 4JI3T 2EHOD 2E9XA 4BJMA 5JRCB 4ERRA 3NRYA 3PUQA 3LK2B 4E7SA 3AEEA 3E08A 4KX6A 4DIDB 5J1GA 1E2AA 3OYZA 5HXCA 4U7YA 5BR8T 1MIWA 3RGLA 3FZLB 2X9HA 3K3NA 1WR0A 5LYJE 5IWAT 4DV7T 2IUBA 2YU2A 5FP3A 1UUSA 3WAKA 4YHJA 4DR3T 4JI2T 2V6YA 4CQIA 3R84B 3RIFA 3ZSTA 1D1BA 2C5KT 1HNXT 1JNRA 1BR4A 1WR6A 2V7JA 3MJXA 4PK6A 5LXTE 4EEDA 4LF9T 2P9BA 4H63H 3R6NA 4IGUA 4JI0T 4JYAT 1KK7A 4GK0E 3QUJA 1G73A 2I59A 1IZNB 1HX1B 3GWHA 4XZCA 1G8XA 4X1KE 5E0OA 5AQHB 3AE1A 4DMWA 5EK2A 4X66T 1Z0PA 2IIUA 2JQ9A 2CHNA 2V7KA 3AE9A 3UU3A 4AQFA 2XQ9A 3K3OA 5FL1A 3FXDB 3AE3A 5DJQC 3N5LA 4UR9A 5HEJA 3ETVA 4HWFA 2WU2A 4HEAA 4PJMA 4X5TA 4JV5T 2NW7A 4GKJT 3RQUA 1WYCA 3PUYF 2V5DA 3X1DA 3ZMSB 1R8IA 4HFDA 4L9IA 4P0AA 2FBWA 5FMNA 3KINB 4HFHA 4QH4A 3ZC1A 5J2TE 2BS2A 4IE5A 3EDVA 1XNQT 4XBFB 3FXEB 4MALA 2XQ6A 5AQJB 3U3IA 3N9NA 2LOSA 4HFBA 3CVRA 2LHRA 3PJAA 4WZXA 2M6IA 3RIUC 5CB4E 3ZEFB 1V9DA 1SHZC 1H7CA 2XAHB 3BQKA 1YD8G 4IL4A 5LJNA 2LHNA 2HN1A 4CN4A 2PFVA 4IREA 3D0TA 2LSYA 5C3JA 1ZKEA 4K0KT 4ZI2C 5JDGA 1S94A 4KHPT 2KZ7B 1HS7A 2ES0A 3IEEA 1HF8A 4O4HE 4B3MT 4EYYR 5F5WA 3ZMZB 3AE4A 5GONE 4DBQA 3VRBA 5LHGB 3L3PA 5J0ZA 3JAFA 5LB7B 4OHFA 3P4WA 4NXNT 4OX9T 2QA7A 3OKQA 4MLKA 2H88A 3V5UA 2V7MA 1HX8A 2D0UA 2KWIB 2NOXA 3AAIA 3AA7B 3PUWF 1KEYA 4HKAA 4ILCA 3TKLB 3MACA 4FJOA 3ZMVB 2LSIA 4BA9A 4DV6T 3LFMA 2LM9A 2I6HA 4QKNA 2QGSA 3O9XA 4ILBA 4YTMA 3B13A 2XM2A 3ZMUB 4HE8A 4CXWA 2UXBT 3QC9A 2JMKA 2KMFA 3NZPA 4GK5E 3O1HA 3RYCE 2LEHA 4IE6A 4DNDA 1YQ3A 3U78A 5BMVE 3ZT6A 5L3BB 4X65T 4QXBB 1EZ3A 2CXDA 1XMOT 3VR8A 1W0BA 3J9X1 5L3FB 3VKHA 4LFAT 3E0ZA 5AQSB 3PV0F 5HEUA 2X68A 3AB3B 1XMQT 1IBMT 1NAFA 1ZHCA 4IE0A 5KXJA 3KV9A 2XHEB 3NRXA 5JDLA 2QVAA 5L3DB 2BVMA 2DHRA 4IL9A 2E9XD 5JH7E 3PURA 4DV0T 2AXDS 4KMCA 3OYXA 3DTOA 2A3DA 4JI5T 1KNPA 1X79A 1UX5A 2WCAA 2WM9A 3EI0A 4DBRA 3RRCA 4B3TT 2M6BA 4HWCA 5FY7A 1N33T 4KHZF 3FZFB 1HTJF 5LMNT 2V7IA 5AQMB 1BR0A 3VR9A 2X9YA 3DP7A 4B3ST 2KNDA 4I50E 2FJBA 2K48A 4YFSA 3ZYLA 4EZHA 2E5LT 4COFA 4YXDA 4TV9E 2MBGA 3TLTA 3CKDA 1IAPA 2OLTA 3EUHA 4MFRA 4WBOA 4AKIA 4DO0A 2E5VA 3RF1A 2LRKA 1T8BA 3NWIA 2VB6A 2NP9A 4A5XA 2V1DB 1UURA 5FVLA 5AQUB 4AKLA 2Q9QC 5L3CB 4LF6T 4QWNB 2YU1A 4Q25A 4CI1B 2OA5A 1UCUA 2CBJA 2X9WA 4BAYB 1BR2A 4FI5A 3EDUA 4JEUB 3AE7A 1FEWA 4HFIA 3UT5E 5AQIB 2YDRA 4X64T 5FY1A 4DV1T 3N2KE 1VRBA 3E22E 2XY8B 3AXJB 2DLRA 3IHRA 4DR2T 1MMNA 4EZ4A 3PUSA 4A97A 5AQQB 3ZC0A 2PG8A 4J2CA 2A9UA 3LJCA 2ZM2A 3SWHA 3P4SA 5L3GB 4HWHA 4O4IE 3ABVA 3VRAA 4MBQA 5HXHA 4O4JE 4WW0A 2WAUA 3N9QA 4AISA 1J1JA 4JLEA 3RIUA 2DWKA 3IA3A 2YKSA 4TNVA 4ASKA 4B6XA 4IE4A 5AQTB 5HEOA 4CXXA 1U5PA 5LGTB 3HKDE 2XAQB 5DQVA 2ZM6T 3MKDA 2VVNA 4DMVA 5JDNA 3RYHE 1CHUA 2BVLA 2H7VC 5ABHA 3LBXB 2XJ7A 3L8RA 1MIYA 2Q9QA 3N2GE 4AQYT 1IBLT 2VL0A 3P4PA 2CLYC 4K0UA 4QH1A 3EHZA 2WDRA 5AQPB 4IT4A 2KXPB 4I0UA 4LMLA 3SS1A 3UUXB 5M4YA 4PNIA 5JR9B 3I9WA 2XUEA 1UGOA 2W0GA 2CLYB 3ONXA 2YK0A 1I94T 3ZSSA 1D0ZA 3LSVA 3LK3B 1IJ6A 4ISSA 4U31A 3A5XA 5CFBA 3ESLA 4U3CA 4UV9B 3PUAA 3AAAB 4H9SE 5HCJA 2CMRA 3C51A 5AQRB 2X67A 2E9XB 4Z8XA 2FJEA 3V5SA 1QSDA 2Z6EA 3PU8A 2BG9E 3FHNA 3CQGB 4H9NC 1T98A 4OFZA 1UK5A 2XPKA 3Q2MA 2PBIA 5AQLB 3RI5A 1SUMB 2ACXA 5LG4A 5CA0E 2E9XC 4ZI7E 5AFUL 2DL1A 3KVAA 3Q5WA 2WDVA 4O4LE 4X1IE 3W15B 4PAGA 3ZKRA 2VKHA 2JMHA 4U72A 1XZYA 2X9XA 3AXJA 3AVSA 5IYZE 4PW8A 3O4XE 5JRCA 2VQET 5HEHA 2B1EA 3AE8A 4L5GA 2DNXA 2UUCT 2V5CA 4OYKA 2JPFA 3ZMTB 4YSYA 2HH7A 3CX6B 3HI2A 1W9RA 1VCTA 2CBIA 2LSKA 5LP6E 2DI4A 4MHCA 3RH3A 2XAJB 4GOUA 2MTQA 3O1JA 3HKCE 3TLVA 4YJ2E 1FJGT 2HPJA 5HXSA 5JVDE 3RIAA 3ZJ1A 2KINB 3ZN1B 4WNKA 3AA0B 4LF7T 3RKOA 2XZEA 4H9QC 3K1SA 2UXCT 1GQEA 3SFEA 2WSSV 2JRKA 4NXMT 3BK9A 3AEBA 2UUBT 3N9PA 2LJLA 5F8PA 5CA1E 4EEBA 3OTOT 2NW9A 1QUUA 5F3JA 3IBPA 4P1NA 5JTGA 4X20E 5JR9A 4DV3T 4XAXB 1YXRA 3AE6A 3CK6A 4TX5A 1QLBA 4H63V 2VQFT 1US7B 3I0OA 1Z8UA 3ZCIA 4UVBB 2VK9A 2UU9T 3N9LA 3OVUA 3I1AA 2LM2A 4IDOA 2I0MA 2XASB 5LOVE 4CN1A 3Q9DA 2WBLA 5L4EA 4JI7T 4WYVA 3MA9A 3UU5A 4EAHA 2XQYA 2K5BB 2ZLYA 2D0TA 2KT9A 3PUZF 4KBMB 5FXXA 1XDPA 1T7SA 2KSRA 3MXZA 3UQ4A 4IDPA 1ZV4X 4NPPA 5LGNB 4DV2T 4ISTA 1YQ4A 4O2BE 4GYSA 2BG9C 5HEGA 3JAEA 4YSXA 2BBHA 2V8SV 3TLUA 4I43B 4YSZA 2W66A 4IDQA 4KI0F 5L4HA 2XQ7A 2LSGA 5HYAA 3HKEE 4X1YE 1MMGA 2W2UA 4PJLA 3QB5A 2X0YA 4OYJA 2D2SA 4HTEA 5FVKA 3LG7A 2FUPA 3FBZA 2Y48B 3WAJA 3P4RA 3RC3A 3CX8B 3AVRA 1B7TA 3C50A 3ONLC 4H9RC 2IW5B 1Y64B 3Q5DA 3UFGA 2W00A 2J62A 3RQWA 2CHOA 3LDQB 2XSAA 4U2YA 2R6GF 2BBJA 3ZCJA 3C4WA 4NUVA 3CQXC 3C4XA 4PJNA 3HA4A 2HN2A 2ZMAA 4AIUA 4ZOLE 1KF6A 1IJ5A 2N9DA 2CCQA 2NTXA 5EK4A 4A98A 5LNKA 3N2OA 5LMUT 4L0RA 5JR9C 2YOEA 1ZP0A 1YKHB 4U2ZA 4EOZB 2CWOA 3RPUA 2C5JA 1HG5A 3C4ZA 3JCFA 3PUGA 3AEFA 4DR4T 2IAKA 3PU3A 2XAFB 3AEGA 2CRBA 3F2EA 3RYIE 4TUYE 4U33A 5AQFB 3UUBA 2D9DA 2W61A 3MK7C 4IE7A 2B76A 5J2UE 5ABFB 2C0SA 3Q5XA 2EHOC 1L0VA 4UVAB 3HR0A 5H6QB 4YTPA 2V26A 3RX6A 5ABFA 1X9BA 3RHWA 2JIWA 3OJAA 3RRWA 3QOFA 5HWXA 1N36T 2MAWA 1J5ET 4HGAA 2YN6A 4U7IA 5AQKB 1NENA 2LRLA 2WB5A 4IDZA 4LMKA 5EK3A 2IHR1 5FYMA 2L9QA 4M1PA 1WFDA 2DCFA 4ZI3C 2H7OA 3F31A 4CI3B 5HCMA 4HFEA 1OXZA 2LOPA 2L3LA 2WWUA 2H89A 4LMJA 4DUYT 1KNZA 1MNDA 1WRDA 2V6XA 1W0AA 5LCYA 2UUAT 4JI4T 5LJMA 4AI6A 2XQAA 4ILAA 2HPLA 2LE8A 2LKGA 1YKEB 5AQOB 5LGUB 5FY0A 3GMIA 5FXVA 2HHHT 3SFDA 3KV5A 3PDYA 3AECA 3LK42 1HG2A 2GK9A 3JADA 2JQHA 4GIWA 5EZYE 3ZYMA 2KLQA 3AEDA 4ZZBA 4YTNA 3KDSE 4PJJA 4E7ZA 4DR6T 2XAGB 4ZS2A 1WYBA 3ZYKA 4JBWF 2F4VT 2K24A 2WDQA 1J5WA 2X0HA 5LHIB 1HR0T 2VURA 2Y6XA 4KUMB 3F57A 2XTLA 3SRZA 2YINA 2CXFA 5FNVE 1KNRA 3M3ZB 2EHOB 3O1IA 4IDNA 5LG3A 3UQ7A 4ZS3A 2RP4A 3FZMB 2YDQA 3P50A 3UULA 1VCSA 2MYSA 2LSJA 4DUZT 4DR5T 2FJDA 2LT3A 5KX5E 1I6ZA 3QK6A 1FIOA 4LF4T 1ZOYA 2XQ4A 1HNZT 2W4XA 2XQ3A 2L8KA 2MPKA 4LFCT 1W09A 1VOMA 5JQGE 4ZI2D 2PJQA 4HWIB 2CA5A 2Q9QB 2BS4A 5FL0A 3AE5A 3ZT7A 4AQFC 5L2LA 2X66A 4B3RT 1Y01A 3CPZA 3ZT5A 1MMAA 3AEAA 4O2AE 4P09A 4C91A 2ODUA 3G06A 3IF8B 4UXNB 3AA1B 3RLFF 4CZZB 4DV4T 4AKGA 4EGWA 4DR7T 2OV9A 2WP9A 2ZM8A 1MMDA 4F6RC 4JI6T 3FZHB 1OEDB 3AA6B 2BKNA 2A2FX 3AE2A 3N9MA 3C64A 3PUXF 5C2TA 1E7PA 2QRXA 2Q9QD 1FMWA 2WQYA 3ANWA 3EVYA 3I0QA 4HWDA 3ZLIA 3C98B 3H3AA 2A72A 5JDFA 4EYUA 5KDMC 5ABGA 4OK0A 2H3RA 4YJ3E 1CUNA 3ZJ2A 2J4GA 4KP3C 1SE7A 1YW0A 3FBLA 3GN5B 2K3WA 3UFEA 4X62T 2NR4A 2XM1A 1D0XA 4ZEYA 2WWVA 2YEVC 3UTKA 5L3EB 4UV8B 3P8CD 4AQGA 2W67A 2CPTA 3TLSA 3OPCA 1S35A 1XWMA 2UXXB 2XQ8A 4ADZA 4QX7B 2X51A 4QXHB 4LF8T 1N34T 3KBUA 4O8SA 3KV4A 3PJAJ 5AQNB 4JEHB 2X0LB 1IBKT 5JDHA 3AAEB 3SOLA 2YDSA 2NW8A 4UF0B 4YHHT 4V1Av 4ILUA 3S4UA 3T1YT 3CWZB 3CIRA 2ODVA 1E1HB 1WCRA 3OBVE 1AJ3A 2V7LA 5H6RB 5KMGP 5CJ5A 2ZM0A 4DVDA 4CXYA 5FXZA 4Z91A 2WU5A 5HXRA 3EAMA 4H9PC 1JNZA 4YY3T 2EHOA 2BZBA 2N1GA 1LRZA 4QXCB 3EABA 4C90A 1HCIA 2J1DG 4G63A 2BG9B 2V6YB 4WBNE 4GKKT 3VKGA 3HL6A 1DU2A 2WZIA 1NWMX 2VKDA 5HWYA 3B5MA 3DJBA 1KFYA 3H37A 4TWDA 4UELA 3KVBA 2UXDT 5ABEA 3HKBE 2QYWA 2CWYA 4HN9A 2NWBA 4DR1T 4PFOA 4IIJE 3NKZA 4TWHA 4LF5T 3KV6A 2IMLA 5L47A 3ZN0B 2BDEA 4AXPA 1OEDE 2M67A 3PUVF 4PK4A 3I9YA 4I4TE 3RYFE 3TLWA 2XSBA 5HXEA 2AE9A 4JI8T 1T72A 3B57A 4QH5A 5ETWA 2CXLA 3JC6C 4CI2B 3MZKB 2DWGA 3J7Yq 1WLXA 3K8PC 4A56A 5C8YE 5CGMA 1NEKA 3T8OA 1ZEEA 3P7IA 1SA0E 4Z90A 2BS3A 4HFCA 3CX7B 3UUNA 1MIVA 2J47A 3NZQA 4TV8E 4TN7B 2CE7A 4G2AA 1XDOA 5FKYA 4UIGA
chains in the Genus database with same CATH topology
2UXNB 2N2NA 3VU7H 3GA8A 1D1AA 2JQQA 3PTRB 3M65A 2IC9A 1D1CA 1LVFA 4ZHQE 2WMOA 4JUYA 2VKOA 4U74A 2G0UA 3VHLA 1UX4A 2Y8DA 2SPCA 4NUUA 5DQWA 5TAOA 4AKRB 3WI3A 2WMNA 5FXWA 1MNEA 2VWAA 4HFVA 4UF0A 2D5UA 4AKHA 4EB6E 3RC8A 3L09A 5JDQA 1OWAA 2VASA 3N9OA 3CMLA 4N78D 3UUMA 5LA6E 3BQLA 1O3XA 4P0BA 4QHOA 3KBTA 4TZ4C 1LVKA 4PFPA 4PK5A 1D0YA 5HAXA 1HFAA 5IHYA 4YLHA 3CQCB 2RA1A 2VKJA 3KFWX 2E8IA 4EIWA 1BR1A 5A1LA 3BQIA 3ANWB 3LBXA 4QX8B 2K9AA 2W63A 5DABA 4ANJA 4EXTA 5JDMA 2W62A 3ETUA 3K3QC 2IC6A 2NTYA 2C5IT 5ADXL 2VL8A 3GN5A 4UVCB 5LBQB 5JREA 2CM0A 5LBMA 2MOZA 3JC6D 4GYRA 4BJNA 4H9OC 4ZI3D 4I55E 1U4QA 4UEMA 4IHJE 5LHHB 2KWHA 3FB2A 3ZPOA 2CEAA 1LKXA 2JJ9A 3NBXX 3PE0A 1FMVA 2EHOD 2E9XA 4BJMA 5JRCB 4ERRA 3NRYA 3PUQA 3LK2B 4E7SA 3E08A 5J1GA 3OYZA 5HXCA 1MIWA 2X9HA 3K3NA 5LYJE 2YU2A 5FP3A 3WAKA 4YHJA 4CQIA 3R84B 1D1BA 2C5KT 1BR4A 1WR6A 2V7JA 3MJXA 4PK6A 5LXTE 2P9BA 4H63H 3R6NA 4IGUA 1KK7A 4GK0E 3QUJA 1G73A 2I59A 3GWHA 1IZNB 4XZCA 5E0OA 1G8XA 4X1KE 5EK2A 4DMWA 1Z0PA 2V7KA 4AQFA 3K3OA 3FXDB 5DJQC 3N5LA 3ETVA 4HEAA 4PJMA 2NW7A 3ZMSB 1WYCA 4P0AA 4L9IA 5FMNA 3KINB 3ZC1A 5J2TE 4XBFB 4IE5A 3EDVA 3FXEB 4MALA 3U3IA 3N9NA 2LOSA 3CVRA 2LHRA 5CB4E 3ZEFB 1SHZC 3BQKA 1V9DA 2XAHB 1H7CA 1YD8G 5LJNA 2LHNA 2PFVA 3D0TA 2LSYA 1ZKEA 4ZI2C 5JDGA 1S94A 2KZ7B 1HS7A 2ES0A 3IEEA 1HF8A 4O4HE 4EYYR 3ZMZB 5GONE 4DBQA 5LHGB 3L3PA 4OHFA 2QA7A 3OKQA 4MLKA 3V5UA 2V7MA 1HX8A 2D0UA 2KWIB 2NOXA 3AAIA 3AA7B 4HKAA 3TKLB 3MACA 4FJOA 3ZMVB 2LSIA 4BA9A 3LFMA 2LM9A 4QKNA 2QGSA 3O9XA 3B13A 3ZMUB 4HE8A 4CXWA 3QC9A 2JMKA 2KMFA 3NZPA 4GK5E 3O1HA 3RYCE 2LEHA 4IE6A 4DNDA 3U78A 5BMVE 5L3BB 4QXBB 1EZ3A 2CXDA 5L3FB 3J9X1 3VKHA 3E0ZA 2X68A 3AB3B 1NAFA 1ZHCA 4IE0A 3KV9A 2XHEB 3NRXA 5JDLA 5L3DB 2BVMA 2DHRA 2E9XD 5JH7E 3PURA 4KMCA 3OYXA 3DTOA 2A3DA 1X79A 2WM9A 1UX5A 4DBRA 3RRCA 5FY7A 1HTJF 2V7IA 1BR0A 2X9YA 3DP7A 2KNDA 4I50E 3ZYLA 2K48A 4YFSA 4EZHA 4TV9E 2MBGA 3CKDA 1IAPA 3EUHA 4AKIA 4MFRA 4WBOA 4DO0A 2VB6A 2NP9A 4AKLA 2V1DB 5L3CB 2Q9QC 4QWNB 2YU1A 4CI1B 2OA5A 1UCUA 2X9WA 4BAYB 1BR2A 4FI5A 3EDUA 4JEUB 1FEWA 3UT5E 5FY1A 3N2KE 1VRBA 3E22E 2DLRA 3IHRA 1MMNA 4EZ4A 3PUSA 3ZC0A 2PG8A 4J2CA 3LJCA 3SWHA 2ZM2A 5L3GB 4O4IE 4MBQA 5HXHA 4O4JE 4WW0A 2WAUA 3N9QA 4JLEA 4ASKA 2DWKA 4B6XA 4CXXA 5LGTB 4IE4A 1U5PA 3HKDE 2XAQB 5DQVA 3MKDA 4DMVA 5JDNA 3RYHE 2BVLA 2H7VC 3LBXB 1MIYA 2Q9QA 3N2GE 4K0UA 2CLYC 2KXPB 3UUXB 3SS1A 5M4YA 4PNIA 5JR9B 3I9WA 2XUEA 2W0GA 2CLYB 3ONXA 2YK0A 1D0ZA 3LK3B 1IJ6A 4ISSA 3A5XA 3ESLA 4UV9B 3PUAA 3AAAB 4H9SE 2CMRA 3C51A 2X67A 2E9XB 4Z8XA 3V5SA 1QSDA 2Z6EA 3PU8A 3FHNA 3CQGB 4H9NC 1T98A 4OFZA 3Q2MA 2PBIA 5LG4A 2ACXA 5CA0E 2E9XC 4ZI7E 5AFUL 3KVAA 3Q5WA 4O4LE 4X1IE 3W15B 4PAGA 2VKHA 2JMHA 4U72A 2X9XA 3AVSA 5IYZE 4PW8A 3O4XE 5JRCA 2B1EA 4L5GA 2DNXA 4OYKA 2JPFA 3ZMTB 2HH7A 3CX6B 3HI2A 5LP6E 2LSKA 2DI4A 4MHCA 3RH3A 2XAJB 4GOUA 2MTQA 3O1JA 3HKCE 4YJ2E 2HPJA 5HXSA 5JVDE 3ZJ1A 2KINB 3ZN1B 4WNKA 3AA0B 3RKOA 4H9QC 2WSSV 2JRKA 3BK9A 3N9PA 2LJLA 5F8PA 5CA1E 2NW9A 1QUUA 5F3JA 3IBPA 4X20E 5JR9A 4XAXB 4TX5A 4H63V 1US7B 3I0OA 3ZCIA 4UVBB 2VK9A 3N9LA 3I1AA 2XASB 5LOVE 3Q9DA 2WBLA 3MA9A 4EAHA 2XQYA 2K5BB 2ZLYA 2D0TA 2KT9A 4KBMB 5FXXA 5LGNB 3MXZA 1ZV4X 4ISTA 4O2BE 4GYSA 4I43B 2LSGA 5HYAA 3HKEE 4X1YE 1MMGA 4PJLA 4OYJA 2D2SA 4HTEA 3LG7A 3FBZA 2Y48B 3WAJA 3RC3A 3CX8B 3AVRA 1B7TA 3C50A 4H9RC 2IW5B 1Y64B 2W00A 3ZCJA 3C4WA 4NUVA 3CQXC 3C4XA 4PJNA 3HA4A 2ZMAA 4ZOLE 1IJ5A 2N9DA 2CCQA 2NTXA 5EK4A 5LNKA 3N2OA 4L0RA 5JR9C 1YKHB 4EOZB 2CWOA 3RPUA 2C5JA 1HG5A 3C4ZA 3PUGA 2IAKA 3PU3A 2XAFB 3RYIE 3F2EA 4TUYE 2W61A 4IE7A 3MK7C 5J2UE 2C0SA 3Q5XA 2EHOC 4UVAB 3HR0A 5H6QB 2V26A 3RX6A 3OJAA 3RRWA 5HWXA 4HGAA 4IDZA 5EK3A 5FYMA 4ZI3C 2L9QA 4M1PA 2DCFA 4CI3B 2H7OA 3F31A 1KNZA 1OXZA 2LOPA 2L3LA 2WWUA 1MNDA 1WRDA 5LCYA 4AI6A 5LJMA 2HPLA 2LE8A 1YKEB 5LGUB 5FY0A 3GMIA 5FXVA 3KV5A 3PDYA 3LK42 1HG2A 2GK9A 5EZYE 4GIWA 3ZYMA 2KLQA 3KDSE 4PJJA 4E7ZA 2XAGB 4ZS2A 1WYBA 3ZYKA 2K24A 5LHIB 2Y6XA 4KUMB 3F57A 2XTLA 3SRZA 2YINA 2CXFA 5FNVE 3O1IA 2EHOB 4ZS3A 2RP4A 3UULA 2MYSA 2LSJA 2LT3A 5KX5E 3QK6A 1FIOA 2L8KA 1VOMA 5JQGE 4ZI2D 2PJQA 2CA5A 2Q9QB 4AQFC 5L2LA 2X66A 3CPZA 1MMAA 4O2AE 4P09A 4C91A 2ODUA 3IF8B 4UXNB 3AA1B 4CZZB 4AKGA 2ZM8A 1MMDA 4F6RC 3AA6B 2A2FX 3N9MA 3C64A 2Q9QD 1FMWA 3ANWA 3EVYA 3I0QA 3ZLIA 4EYUA 5KDMC 3C98B 3H3AA 2A72A 5JDFA 4OK0A 2H3RA 4YJ3E 1CUNA 3ZJ2A 4KP3C 1YW0A 3FBLA 3GN5B 3UFEA 1D0XA 5L3EB 2YEVC 3UTKA 4UV8B 3P8CD 4AQGA 1S35A 2UXXB 4ADZA 4QX7B 2X51A 4QXHB 3KBUA 4O8SA 3KV4A 4JEHB 2X0LB 5JDHA 3AAEB 3SOLA 2NW8A 4UF0B 4V1Av 4ILUA 3S4UA 3CWZB 3OBVE 2ODVA 1E1HB 1AJ3A 2V7LA 5H6RB 5KMGP 2ZM0A 4DVDA 4CXYA 5FXZA 5HXRA 4H9PC 2EHOA 2BZBA 2N1GA 1LRZA 4QXCB 4C90A 1HCIA 2J1DG 4G63A 4WBNE 3VKGA 3HL6A 1NWMX 2VKDA 5HWYA 3DJBA 3H37A 4UELA 3KVBA 3HKBE 4HN9A 2CWYA 2NWBA 4PFOA 4IIJE 3KV6A 3ZN0B 2BDEA 4AXPA 2M67A 4PK4A 3I9YA 4I4TE 3RYFE 5HXEA 3B57A 5ETWA 4CI2B 2CXLA 3JC6C 3MZKB 2DWGA 3J7Yq 1WLXA 3K8PC 4A56A 5C8YE 3T8OA 1ZEEA 3P7IA 1SA0E 3CX7B 3UUNA 1MIVA 4TV8E 3NZQA 4TN7B 2CE7A 4G2AA 4UIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 B;  3ZC1 A;  5JR9 A;  3ZC0 A;  5JRC A;  5JR9 C;  5JRC B;  5JRE A; 
#chains in the Genus database with same CATH topology
 2UXN B;  2FJA A;  2N2N A;  3VU7 H;  3GA8 A;  1D1A A;  2WS3 A;  2JQQ A;  3P4Q A;  2LKH A;  3PTR B;  4CN6 A;  1XNR T;  4LFB T;  3UU8 A;  1M62 A;  2IC9 A;  1D1C A;  3M65 A;  3NVO A;  1LVF A;  4ZHQ E;  2WMO A;  2WY2 A;  4JUY A;  2VKO A;  4U74 A;  2G0U A;  3VHL A;  1UX4 A;  2Y8D A;  3UU4 A;  2SPC A;  2WZH A;  3T1H T;  4NUU A;  5DQW A;  5TAO A;  4ZXL A;  3UU6 A;  4AKR B;  2BG9 A;  3WI3 A;  2WMN A;  4F8H A;  5FXW A;  1MNE A;  2VWA A;  4HFV A;  4UF0 A;  2D5U A;  4AKH A;  4EB6 E;  3RC8 A;  3L09 A;  5JDQ A;  3ONJ A;  3A8Y C;  3L39 A;  1OWA A;  2VAS A;  3N9O A;  5AQG B;  3CML A;  2IDO B;  2BKP A;  4N78 D;  5LA6 E;  3BQL A;  3UUM A;  1O3X A;  4EV6 A;  4P0B A;  4QHO A;  3KBT A;  4TZ4 C;  1LVK A;  4PFP A;  4PK5 A;  1D0Y A;  5HAX A;  1HFA A;  2LLY A;  5IHY A;  2ACZ A;  4YLH A;  3CQC B;  2RA1 A;  2JQK A;  1M7K A;  2PTF A;  2VKJ A;  3KFW X;  2E8I A;  4EIW A;  1BR1 A;  5AQV B;  5A1L A;  3H3M A;  4DV5 T;  4JI1 T;  3BQI A;  3ANW B;  3A7M A;  3LBX A;  4QX8 B;  2K9A A;  2W63 A;  5DAB A;  1OED C;  3RKG A;  4ANJ A;  4TNW A;  4NIQ A;  4EXT A;  5JDM A;  2E2A A;  2W62 A;  3ETU A;  2VVS A;  3K3Q C;  2IC6 A;  2NTY A;  2C5I T;  5ADX L;  4TWF A;  2VL8 A;  2XQ5 A;  3GN5 A;  4UVC B;  5LBQ B;  5IUX A;  5JRE A;  2CM0 A;  5LBM A;  4ZZC A;  2MOZ A;  3JC6 D;  4GYR A;  4BJN A;  4H9O C;  4ZI3 D;  4I55 E;  4YT0 A;  1HNW T;  2BKO A;  1U4Q A;  4UEM A;  3Q5E A;  3FZK B;  4IHJ E;  5LHH B;  2KWH A;  2RPA A;  3FB2 A;  3ZPO A;  2CEA A;  1N32 T;  3QB5 K;  1LKX A;  1OED A;  2JJ9 A;  3NBX X;  1FMV A;  3PE0 A;  3QNU A;  4JI3 T;  2EHO D;  2E9X A;  4BJM A;  5JRC B;  4ERR A;  3NRY A;  3PUQ A;  3LK2 B;  4E7S A;  3AEE A;  3E08 A;  4KX6 A;  4DID B;  5J1G A;  1E2A A;  3OYZ A;  5HXC A;  4U7Y A;  5BR8 T;  1MIW A;  3RGL A;  3FZL B;  2X9H A;  3K3N A;  1WR0 A;  5LYJ E;  5IWA T;  4DV7 T;  2IUB A;  2YU2 A;  5FP3 A;  1UUS A;  3WAK A;  4YHJ A;  4DR3 T;  4JI2 T;  2V6Y A;  4CQI A;  3R84 B;  3RIF A;  3ZST A;  1D1B A;  2C5K T;  1HNX T;  1JNR A;  1BR4 A;  1WR6 A;  2V7J A;  3MJX A;  4PK6 A;  5LXT E;  4EED A;  4LF9 T;  2P9B A;  4H63 H;  3R6N A;  4IGU A;  4JI0 T;  4JYA T;  1KK7 A;  4GK0 E;  3QUJ A;  1G73 A;  2I59 A;  1IZN B;  1HX1 B;  3GWH A;  4XZC A;  1G8X A;  4X1K E;  5E0O A;  5AQH B;  3AE1 A;  4DMW A;  5EK2 A;  4X66 T;  1Z0P A;  2IIU A;  2JQ9 A;  2CHN A;  2V7K A;  3AE9 A;  3UU3 A;  4AQF A;  2XQ9 A;  3K3O A;  5FL1 A;  3FXD B;  3AE3 A;  5DJQ C;  3N5L A;  4UR9 A;  5HEJ A;  3ETV A;  4HWF A;  2WU2 A;  4HEA A;  4PJM A;  4X5T A;  4JV5 T;  2NW7 A;  4GKJ T;  3RQU A;  1WYC A;  3PUY F;  2V5D A;  3X1D A;  3ZMS B;  1R8I A;  4HFD A;  4L9I A;  4P0A A;  2FBW A;  5FMN A;  3KIN B;  4HFH A;  4QH4 A;  3ZC1 A;  5J2T E;  2BS2 A;  4IE5 A;  3EDV A;  1XNQ T;  4XBF B;  3FXE B;  4MAL A;  2XQ6 A;  5AQJ B;  3U3I A;  3N9N A;  2LOS A;  4HFB A;  3CVR A;  2LHR A;  3PJA A;  4WZX A;  2M6I A;  3RIU C;  5CB4 E;  3ZEF B;  1V9D A;  1SHZ C;  1H7C A;  2XAH B;  3BQK A;  1YD8 G;  4IL4 A;  5LJN A;  2LHN A;  2HN1 A;  4CN4 A;  2PFV A;  4IRE A;  3D0T A;  2LSY A;  5C3J A;  1ZKE A;  4K0K T;  4ZI2 C;  5JDG A;  1S94 A;  4KHP T;  2KZ7 B;  1HS7 A;  2ES0 A;  3IEE A;  1HF8 A;  4O4H E;  4B3M T;  4EYY R;  5F5W A;  3ZMZ B;  3AE4 A;  5GON E;  4DBQ A;  3VRB A;  5LHG B;  3L3P A;  5J0Z A;  3JAF A;  5LB7 B;  4OHF A;  3P4W A;  4NXN T;  4OX9 T;  2QA7 A;  3OKQ A;  4MLK A;  2H88 A;  3V5U A;  2V7M A;  1HX8 A;  2D0U A;  2KWI B;  2NOX A;  3AAI A;  3AA7 B;  3PUW F;  1KEY A;  4HKA A;  4ILC A;  3TKL B;  3MAC A;  4FJO A;  3ZMV B;  2LSI A;  4BA9 A;  4DV6 T;  3LFM A;  2LM9 A;  2I6H A;  4QKN A;  2QGS A;  3O9X A;  4ILB A;  4YTM A;  3B13 A;  2XM2 A;  3ZMU B;  4HE8 A;  4CXW A;  2UXB T;  3QC9 A;  2JMK A;  2KMF A;  3NZP A;  4GK5 E;  3O1H A;  3RYC E;  2LEH A;  4IE6 A;  4DND A;  1YQ3 A;  3U78 A;  5BMV E;  3ZT6 A;  5L3B B;  4X65 T;  4QXB B;  1EZ3 A;  2CXD A;  1XMO T;  3VR8 A;  1W0B A;  3J9X 1;  5L3F B;  3VKH A;  4LFA T;  3E0Z A;  5AQS B;  3PV0 F;  5HEU A;  2X68 A;  3AB3 B;  1XMQ T;  1IBM T;  1NAF A;  1ZHC A;  4IE0 A;  5KXJ A;  3KV9 A;  2XHE B;  3NRX A;  5JDL A;  2QVA A;  5L3D B;  2BVM A;  2DHR A;  4IL9 A;  2E9X D;  5JH7 E;  3PUR A;  4DV0 T;  2AXD S;  4KMC A;  3OYX A;  3DTO A;  2A3D A;  4JI5 T;  1KNP A;  1X79 A;  1UX5 A;  2WCA A;  2WM9 A;  3EI0 A;  4DBR A;  3RRC A;  4B3T T;  2M6B A;  4HWC A;  5FY7 A;  1N33 T;  4KHZ F;  3FZF B;  1HTJ F;  5LMN T;  2V7I A;  5AQM B;  1BR0 A;  3VR9 A;  2X9Y A;  3DP7 A;  4B3S T;  2KND A;  4I50 E;  2FJB A;  2K48 A;  4YFS A;  3ZYL A;  4EZH A;  2E5L T;  4COF A;  4YXD A;  4TV9 E;  2MBG A;  3TLT A;  3CKD A;  1IAP A;  2OLT A;  3EUH A;  4MFR A;  4WBO A;  4AKI A;  4DO0 A;  2E5V A;  3RF1 A;  2LRK A;  1T8B A;  3NWI A;  2VB6 A;  2NP9 A;  4A5X A;  2V1D B;  1UUR A;  5FVL A;  5AQU B;  4AKL A;  2Q9Q C;  5L3C B;  4LF6 T;  4QWN B;  2YU1 A;  4Q25 A;  4CI1 B;  2OA5 A;  1UCU A;  2CBJ A;  2X9W A;  4BAY B;  1BR2 A;  4FI5 A;  3EDU A;  4JEU B;  3AE7 A;  1FEW A;  4HFI A;  3UT5 E;  5AQI B;  2YDR A;  4X64 T;  5FY1 A;  4DV1 T;  3N2K E;  1VRB A;  3E22 E;  2XY8 B;  3AXJ B;  2DLR A;  3IHR A;  4DR2 T;  1MMN A;  4EZ4 A;  3PUS A;  4A97 A;  5AQQ B;  3ZC0 A;  2PG8 A;  4J2C A;  2A9U A;  3LJC A;  2ZM2 A;  3SWH A;  3P4S A;  5L3G B;  4HWH A;  4O4I E;  3ABV A;  3VRA A;  4MBQ A;  5HXH A;  4O4J E;  4WW0 A;  2WAU A;  3N9Q A;  4AIS A;  1J1J A;  4JLE A;  3RIU A;  2DWK A;  3IA3 A;  2YKS A;  4TNV A;  4ASK A;  4B6X A;  4IE4 A;  5AQT B;  5HEO A;  4CXX A;  1U5P A;  5LGT B;  3HKD E;  2XAQ B;  5DQV A;  2ZM6 T;  3MKD A;  2VVN A;  4DMV A;  5JDN A;  3RYH E;  1CHU A;  2BVL A;  2H7V C;  5ABH A;  3LBX B;  2XJ7 A;  3L8R A;  1MIY A;  2Q9Q A;  3N2G E;  4AQY T;  1IBL T;  2VL0 A;  3P4P A;  2CLY C;  4K0U A;  4QH1 A;  3EHZ A;  2WDR A;  5AQP B;  4IT4 A;  2KXP B;  4I0U A;  4LML A;  3SS1 A;  3UUX B;  5M4Y A;  4PNI A;  5JR9 B;  3I9W A;  2XUE A;  1UGO A;  2W0G A;  2CLY B;  3ONX A;  2YK0 A;  1I94 T;  3ZSS A;  1D0Z A;  3LSV A;  3LK3 B;  1IJ6 A;  4ISS A;  4U31 A;  3A5X A;  5CFB A;  3ESL A;  4U3C A;  4UV9 B;  3PUA A;  3AAA B;  4H9S E;  5HCJ A;  2CMR A;  3C51 A;  5AQR B;  2X67 A;  2E9X B;  4Z8X A;  2FJE A;  3V5S A;  1QSD A;  2Z6E A;  3PU8 A;  2BG9 E;  3FHN A;  3CQG B;  4H9N C;  1T98 A;  4OFZ A;  1UK5 A;  2XPK A;  3Q2M A;  2PBI A;  5AQL B;  3RI5 A;  1SUM B;  2ACX A;  5LG4 A;  5CA0 E;  2E9X C;  4ZI7 E;  5AFU L;  2DL1 A;  3KVA A;  3Q5W A;  2WDV A;  4O4L E;  4X1I E;  3W15 B;  4PAG A;  3ZKR A;  2VKH A;  2JMH A;  4U72 A;  1XZY A;  2X9X A;  3AXJ A;  3AVS A;  5IYZ E;  4PW8 A;  3O4X E;  5JRC A;  2VQE T;  5HEH A;  2B1E A;  3AE8 A;  4L5G A;  2DNX A;  2UUC T;  2V5C A;  4OYK A;  2JPF A;  3ZMT B;  4YSY A;  2HH7 A;  3CX6 B;  3HI2 A;  1W9R A;  1VCT A;  2CBI A;  2LSK A;  5LP6 E;  2DI4 A;  4MHC A;  3RH3 A;  2XAJ B;  4GOU A;  2MTQ A;  3O1J A;  3HKC E;  3TLV A;  4YJ2 E;  1FJG T;  2HPJ A;  5HXS A;  5JVD E;  3RIA A;  3ZJ1 A;  2KIN B;  3ZN1 B;  4WNK A;  3AA0 B;  4LF7 T;  3RKO A;  2XZE A;  4H9Q C;  3K1S A;  2UXC T;  1GQE A;  3SFE A;  2WSS V;  2JRK A;  4NXM T;  3BK9 A;  3AEB A;  2UUB T;  3N9P A;  2LJL A;  5F8P A;  5CA1 E;  4EEB A;  3OTO T;  2NW9 A;  1QUU A;  5F3J A;  3IBP A;  4P1N A;  5JTG A;  4X20 E;  5JR9 A;  4DV3 T;  4XAX B;  1YXR A;  3AE6 A;  3CK6 A;  4TX5 A;  1QLB A;  4H63 V;  2VQF T;  1US7 B;  3I0O A;  1Z8U A;  3ZCI A;  4UVB B;  2VK9 A;  2UU9 T;  3N9L A;  3OVU A;  3I1A A;  2LM2 A;  4IDO A;  2I0M A;  2XAS B;  5LOV E;  4CN1 A;  3Q9D A;  2WBL A;  5L4E A;  4JI7 T;  4WYV A;  3MA9 A;  3UU5 A;  4EAH A;  2XQY A;  2K5B B;  2ZLY A;  2D0T A;  2KT9 A;  3PUZ F;  4KBM B;  5FXX A;  1XDP A;  1T7S A;  2KSR A;  3MXZ A;  3UQ4 A;  4IDP A;  1ZV4 X;  4NPP A;  5LGN B;  4DV2 T;  4IST A;  1YQ4 A;  4O2B E;  4GYS A;  2BG9 C;  5HEG A;  3JAE A;  4YSX A;  2BBH A;  2V8S V;  3TLU A;  4I43 B;  4YSZ A;  2W66 A;  4IDQ A;  4KI0 F;  5L4H A;  2XQ7 A;  2LSG A;  5HYA A;  3HKE E;  4X1Y E;  1MMG A;  2W2U A;  4PJL A;  3QB5 A;  2X0Y A;  4OYJ A;  2D2S A;  4HTE A;  5FVK A;  3LG7 A;  2FUP A;  3FBZ A;  2Y48 B;  3WAJ A;  3P4R A;  3RC3 A;  3CX8 B;  3AVR A;  1B7T A;  3C50 A;  3ONL C;  4H9R C;  2IW5 B;  1Y64 B;  3Q5D A;  3UFG A;  2W00 A;  2J62 A;  3RQW A;  2CHO A;  3LDQ B;  2XSA A;  4U2Y A;  2R6G F;  2BBJ A;  3ZCJ A;  3C4W A;  4NUV A;  3CQX C;  3C4X A;  4PJN A;  3HA4 A;  2HN2 A;  2ZMA A;  4AIU A;  4ZOL E;  1KF6 A;  1IJ5 A;  2N9D A;  2CCQ A;  2NTX A;  5EK4 A;  4A98 A;  5LNK A;  3N2O A;  5LMU T;  4L0R A;  5JR9 C;  2YOE A;  1ZP0 A;  1YKH B;  4U2Z A;  4EOZ B;  2CWO A;  3RPU A;  2C5J A;  1HG5 A;  3C4Z A;  3JCF A;  3PUG A;  3AEF A;  4DR4 T;  2IAK A;  3PU3 A;  2XAF B;  3AEG A;  2CRB A;  3F2E A;  3RYI E;  4TUY E;  4U33 A;  5AQF B;  3UUB A;  2D9D A;  2W61 A;  3MK7 C;  4IE7 A;  2B76 A;  5J2U E;  5ABF B;  2C0S A;  3Q5X A;  2EHO C;  1L0V A;  4UVA B;  3HR0 A;  5H6Q B;  4YTP A;  2V26 A;  3RX6 A;  5ABF A;  1X9B A;  3RHW A;  2JIW A;  3OJA A;  3RRW A;  3QOF A;  5HWX A;  1N36 T;  2MAW A;  1J5E T;  4HGA A;  2YN6 A;  4U7I A;  5AQK B;  1NEN A;  2LRL A;  2WB5 A;  4IDZ A;  4LMK A;  5EK3 A;  2IHR 1;  5FYM A;  2L9Q A;  4M1P A;  1WFD A;  2DCF A;  4ZI3 C;  2H7O A;  3F31 A;  4CI3 B;  5HCM A;  4HFE A;  1OXZ A;  2LOP A;  2L3L A;  2WWU A;  2H89 A;  4LMJ A;  4DUY T;  1KNZ A;  1MND A;  1WRD A;  2V6X A;  1W0A A;  5LCY A;  2UUA T;  4JI4 T;  5LJM A;  4AI6 A;  2XQA A;  4ILA A;  2HPL A;  2LE8 A;  2LKG A;  1YKE B;  5AQO B;  5LGU B;  5FY0 A;  3GMI A;  5FXV A;  2HHH T;  3SFD A;  3KV5 A;  3PDY A;  3AEC A;  3LK4 2;  1HG2 A;  2GK9 A;  3JAD A;  2JQH A;  4GIW A;  5EZY E;  3ZYM A;  2KLQ A;  3AED A;  4ZZB A;  4YTN A;  3KDS E;  4PJJ A;  4E7Z A;  4DR6 T;  2XAG B;  4ZS2 A;  1WYB A;  3ZYK A;  4JBW F;  2F4V T;  2K24 A;  2WDQ A;  1J5W A;  2X0H A;  5LHI B;  1HR0 T;  2VUR A;  2Y6X A;  4KUM B;  3F57 A;  2XTL A;  3SRZ A;  2YIN A;  2CXF A;  5FNV E;  1KNR A;  3M3Z B;  2EHO B;  3O1I A;  4IDN A;  5LG3 A;  3UQ7 A;  4ZS3 A;  2RP4 A;  3FZM B;  2YDQ A;  3P50 A;  3UUL A;  1VCS A;  2MYS A;  2LSJ A;  4DUZ T;  4DR5 T;  2FJD A;  2LT3 A;  5KX5 E;  1I6Z A;  3QK6 A;  1FIO A;  4LF4 T;  1ZOY A;  2XQ4 A;  1HNZ T;  2W4X A;  2XQ3 A;  2L8K A;  2MPK A;  4LFC T;  1W09 A;  1VOM A;  5JQG E;  4ZI2 D;  2PJQ A;  4HWI B;  2CA5 A;  2Q9Q B;  2BS4 A;  5FL0 A;  3AE5 A;  3ZT7 A;  4AQF C;  5L2L A;  2X66 A;  4B3R T;  1Y01 A;  3CPZ A;  3ZT5 A;  1MMA A;  3AEA A;  4O2A E;  4P09 A;  4C91 A;  2ODU A;  3G06 A;  3IF8 B;  4UXN B;  3AA1 B;  3RLF F;  4CZZ B;  4DV4 T;  4AKG A;  4EGW A;  4DR7 T;  2OV9 A;  2WP9 A;  2ZM8 A;  1MMD A;  4F6R C;  4JI6 T;  3FZH B;  1OED B;  3AA6 B;  2BKN A;  2A2F X;  3AE2 A;  3N9M A;  3C64 A;  3PUX F;  5C2T A;  1E7P A;  2QRX A;  2Q9Q D;  1FMW A;  2WQY A;  3ANW A;  3EVY A;  3I0Q A;  4HWD A;  3ZLI A;  3C98 B;  3H3A A;  2A72 A;  5JDF A;  4EYU A;  5KDM C;  5ABG A;  4OK0 A;  2H3R A;  4YJ3 E;  1CUN A;  3ZJ2 A;  2J4G A;  4KP3 C;  1SE7 A;  1YW0 A;  3FBL A;  3GN5 B;  2K3W A;  3UFE A;  4X62 T;  2NR4 A;  2XM1 A;  1D0X A;  4ZEY A;  2WWV A;  2YEV C;  3UTK A;  5L3E B;  4UV8 B;  3P8C D;  4AQG A;  2W67 A;  2CPT A;  3TLS A;  3OPC A;  1S35 A;  1XWM A;  2UXX B;  2XQ8 A;  4ADZ A;  4QX7 B;  2X51 A;  4QXH B;  4LF8 T;  1N34 T;  3KBU A;  4O8S A;  3KV4 A;  3PJA J;  5AQN B;  4JEH B;  2X0L B;  1IBK T;  5JDH A;  3AAE B;  3SOL A;  2YDS A;  2NW8 A;  4UF0 B;  4YHH T;  4V1A v;  4ILU A;  3S4U A;  3T1Y T;  3CWZ B;  3CIR A;  2ODV A;  1E1H B;  1WCR A;  3OBV E;  1AJ3 A;  2V7L A;  5H6R B;  5KMG P;  5CJ5 A;  2ZM0 A;  4DVD A;  4CXY A;  5FXZ A;  4Z91 A;  2WU5 A;  5HXR A;  3EAM A;  4H9P C;  1JNZ A;  4YY3 T;  2EHO A;  2BZB A;  2N1G A;  1LRZ A;  4QXC B;  3EAB A;  4C90 A;  1HCI A;  2J1D G;  4G63 A;  2BG9 B;  2V6Y B;  4WBN E;  4GKK T;  3VKG A;  3HL6 A;  1DU2 A;  2WZI A;  1NWM X;  2VKD A;  5HWY A;  3B5M A;  3DJB A;  1KFY A;  3H37 A;  4TWD A;  4UEL A;  3KVB A;  2UXD T;  5ABE A;  3HKB E;  2QYW A;  2CWY A;  4HN9 A;  2NWB A;  4DR1 T;  4PFO A;  4IIJ E;  3NKZ A;  4TWH A;  4LF5 T;  3KV6 A;  2IML A;  5L47 A;  3ZN0 B;  2BDE A;  4AXP A;  1OED E;  2M67 A;  3PUV F;  4PK4 A;  3I9Y A;  4I4T E;  3RYF E;  3TLW A;  2XSB A;  5HXE A;  2AE9 A;  4JI8 T;  1T72 A;  3B57 A;  4QH5 A;  5ETW A;  2CXL A;  3JC6 C;  4CI2 B;  3MZK B;  2DWG A;  3J7Y q;  1WLX A;  3K8P C;  4A56 A;  5C8Y E;  5CGM A;  1NEK A;  3T8O A;  1ZEE A;  3P7I A;  1SA0 E;  4Z90 A;  2BS3 A;  4HFC A;  3CX7 B;  3UUN A;  1MIV A;  2J47 A;  3NZQ A;  4TV8 E;  4TN7 B;  2CE7 A;  4G2A A;  1XDO A;  5FKY A;  4UIG A; 
#chains in the Genus database with same CATH homology
 2UXN B;  2N2N A;  3VU7 H;  3GA8 A;  1D1A A;  2JQQ A;  3PTR B;  3M65 A;  2IC9 A;  1D1C A;  1LVF A;  4ZHQ E;  2WMO A;  4JUY A;  2VKO A;  4U74 A;  2G0U A;  3VHL A;  1UX4 A;  2Y8D A;  2SPC A;  4NUU A;  5DQW A;  5TAO A;  4AKR B;  3WI3 A;  2WMN A;  5FXW A;  1MNE A;  2VWA A;  4HFV A;  4UF0 A;  2D5U A;  4AKH A;  4EB6 E;  3RC8 A;  3L09 A;  5JDQ A;  1OWA A;  2VAS A;  3N9O A;  3CML A;  4N78 D;  3UUM A;  5LA6 E;  3BQL A;  1O3X A;  4P0B A;  4QHO A;  3KBT A;  4TZ4 C;  1LVK A;  4PFP A;  4PK5 A;  1D0Y A;  5HAX A;  1HFA A;  5IHY A;  4YLH A;  3CQC B;  2RA1 A;  2VKJ A;  3KFW X;  2E8I A;  4EIW A;  1BR1 A;  5A1L A;  3BQI A;  3ANW B;  3LBX A;  4QX8 B;  2K9A A;  2W63 A;  5DAB A;  4ANJ A;  4EXT A;  5JDM A;  2W62 A;  3ETU A;  3K3Q C;  2IC6 A;  2NTY A;  2C5I T;  5ADX L;  2VL8 A;  3GN5 A;  4UVC B;  5LBQ B;  5JRE A;  2CM0 A;  5LBM A;  2MOZ A;  3JC6 D;  4GYR A;  4BJN A;  4H9O C;  4ZI3 D;  4I55 E;  1U4Q A;  4UEM A;  4IHJ E;  5LHH B;  2KWH A;  3FB2 A;  3ZPO A;  2CEA A;  1LKX A;  2JJ9 A;  3NBX X;  3PE0 A;  1FMV A;  2EHO D;  2E9X A;  4BJM A;  5JRC B;  4ERR A;  3NRY A;  3PUQ A;  3LK2 B;  4E7S A;  3E08 A;  5J1G A;  3OYZ A;  5HXC A;  1MIW A;  2X9H A;  3K3N A;  5LYJ E;  2YU2 A;  5FP3 A;  3WAK A;  4YHJ A;  4CQI A;  3R84 B;  1D1B A;  2C5K T;  1BR4 A;  1WR6 A;  2V7J A;  3MJX A;  4PK6 A;  5LXT E;  2P9B A;  4H63 H;  3R6N A;  4IGU A;  1KK7 A;  4GK0 E;  3QUJ A;  1G73 A;  2I59 A;  3GWH A;  1IZN B;  4XZC A;  5E0O A;  1G8X A;  4X1K E;  5EK2 A;  4DMW A;  1Z0P A;  2V7K A;  4AQF A;  3K3O A;  3FXD B;  5DJQ C;  3N5L A;  3ETV A;  4HEA A;  4PJM A;  2NW7 A;  3ZMS B;  1WYC A;  4P0A A;  4L9I A;  5FMN A;  3KIN B;  3ZC1 A;  5J2T E;  4XBF B;  4IE5 A;  3EDV A;  3FXE B;  4MAL A;  3U3I A;  3N9N A;  2LOS A;  3CVR A;  2LHR A;  5CB4 E;  3ZEF B;  1SHZ C;  3BQK A;  1V9D A;  2XAH B;  1H7C A;  1YD8 G;  5LJN A;  2LHN A;  2PFV A;  3D0T A;  2LSY A;  1ZKE A;  4ZI2 C;  5JDG A;  1S94 A;  2KZ7 B;  1HS7 A;  2ES0 A;  3IEE A;  1HF8 A;  4O4H E;  4EYY R;  3ZMZ B;  5GON E;  4DBQ A;  5LHG B;  3L3P A;  4OHF A;  2QA7 A;  3OKQ A;  4MLK A;  3V5U A;  2V7M A;  1HX8 A;  2D0U A;  2KWI B;  2NOX A;  3AAI A;  3AA7 B;  4HKA A;  3TKL B;  3MAC A;  4FJO A;  3ZMV B;  2LSI A;  4BA9 A;  3LFM A;  2LM9 A;  4QKN A;  2QGS A;  3O9X A;  3B13 A;  3ZMU B;  4HE8 A;  4CXW A;  3QC9 A;  2JMK A;  2KMF A;  3NZP A;  4GK5 E;  3O1H A;  3RYC E;  2LEH A;  4IE6 A;  4DND A;  3U78 A;  5BMV E;  5L3B B;  4QXB B;  1EZ3 A;  2CXD A;  5L3F B;  3J9X 1;  3VKH A;  3E0Z A;  2X68 A;  3AB3 B;  1NAF A;  1ZHC A;  4IE0 A;  3KV9 A;  2XHE B;  3NRX A;  5JDL A;  5L3D B;  2BVM A;  2DHR A;  2E9X D;  5JH7 E;  3PUR A;  4KMC A;  3OYX A;  3DTO A;  2A3D A;  1X79 A;  2WM9 A;  1UX5 A;  4DBR A;  3RRC A;  5FY7 A;  1HTJ F;  2V7I A;  1BR0 A;  2X9Y A;  3DP7 A;  2KND A;  4I50 E;  3ZYL A;  2K48 A;  4YFS A;  4EZH A;  4TV9 E;  2MBG A;  3CKD A;  1IAP A;  3EUH A;  4AKI A;  4MFR A;  4WBO A;  4DO0 A;  2VB6 A;  2NP9 A;  4AKL A;  2V1D B;  5L3C B;  2Q9Q C;  4QWN B;  2YU1 A;  4CI1 B;  2OA5 A;  1UCU A;  2X9W A;  4BAY B;  1BR2 A;  4FI5 A;  3EDU A;  4JEU B;  1FEW A;  3UT5 E;  5FY1 A;  3N2K E;  1VRB A;  3E22 E;  2DLR A;  3IHR A;  1MMN A;  4EZ4 A;  3PUS A;  3ZC0 A;  2PG8 A;  4J2C A;  3LJC A;  3SWH A;  2ZM2 A;  5L3G B;  4O4I E;  4MBQ A;  5HXH A;  4O4J E;  4WW0 A;  2WAU A;  3N9Q A;  4JLE A;  4ASK A;  2DWK A;  4B6X A;  4CXX A;  5LGT B;  4IE4 A;  1U5P A;  3HKD E;  2XAQ B;  5DQV A;  3MKD A;  4DMV A;  5JDN A;  3RYH E;  2BVL A;  2H7V C;  3LBX B;  1MIY A;  2Q9Q A;  3N2G E;  4K0U A;  2CLY C;  2KXP B;  3UUX B;  3SS1 A;  5M4Y A;  4PNI A;  5JR9 B;  3I9W A;  2XUE A;  2W0G A;  2CLY B;  3ONX A;  2YK0 A;  1D0Z A;  3LK3 B;  1IJ6 A;  4ISS A;  3A5X A;  3ESL A;  4UV9 B;  3PUA A;  3AAA B;  4H9S E;  2CMR A;  3C51 A;  2X67 A;  2E9X B;  4Z8X A;  3V5S A;  1QSD A;  2Z6E A;  3PU8 A;  3FHN A;  3CQG B;  4H9N C;  1T98 A;  4OFZ A;  3Q2M A;  2PBI A;  5LG4 A;  2ACX A;  5CA0 E;  2E9X C;  4ZI7 E;  5AFU L;  3KVA A;  3Q5W A;  4O4L E;  4X1I E;  3W15 B;  4PAG A;  2VKH A;  2JMH A;  4U72 A;  2X9X A;  3AVS A;  5IYZ E;  4PW8 A;  3O4X E;  5JRC A;  2B1E A;  4L5G A;  2DNX A;  4OYK A;  2JPF A;  3ZMT B;  2HH7 A;  3CX6 B;  3HI2 A;  5LP6 E;  2LSK A;  2DI4 A;  4MHC A;  3RH3 A;  2XAJ B;  4GOU A;  2MTQ A;  3O1J A;  3HKC E;  4YJ2 E;  2HPJ A;  5HXS A;  5JVD E;  3ZJ1 A;  2KIN B;  3ZN1 B;  4WNK A;  3AA0 B;  3RKO A;  4H9Q C;  2WSS V;  2JRK A;  3BK9 A;  3N9P A;  2LJL A;  5F8P A;  5CA1 E;  2NW9 A;  1QUU A;  5F3J A;  3IBP A;  4X20 E;  5JR9 A;  4XAX B;  4TX5 A;  4H63 V;  1US7 B;  3I0O A;  3ZCI A;  4UVB B;  2VK9 A;  3N9L A;  3I1A A;  2XAS B;  5LOV E;  3Q9D A;  2WBL A;  3MA9 A;  4EAH A;  2XQY A;  2K5B B;  2ZLY A;  2D0T A;  2KT9 A;  4KBM B;  5FXX A;  5LGN B;  3MXZ A;  1ZV4 X;  4IST A;  4O2B E;  4GYS A;  4I43 B;  2LSG A;  5HYA A;  3HKE E;  4X1Y E;  1MMG A;  4PJL A;  4OYJ A;  2D2S A;  4HTE A;  3LG7 A;  3FBZ A;  2Y48 B;  3WAJ A;  3RC3 A;  3CX8 B;  3AVR A;  1B7T A;  3C50 A;  4H9R C;  2IW5 B;  1Y64 B;  2W00 A;  3ZCJ A;  3C4W A;  4NUV A;  3CQX C;  3C4X A;  4PJN A;  3HA4 A;  2ZMA A;  4ZOL E;  1IJ5 A;  2N9D A;  2CCQ A;  2NTX A;  5EK4 A;  5LNK A;  3N2O A;  4L0R A;  5JR9 C;  1YKH B;  4EOZ B;  2CWO A;  3RPU A;  2C5J A;  1HG5 A;  3C4Z A;  3PUG A;  2IAK A;  3PU3 A;  2XAF B;  3RYI E;  3F2E A;  4TUY E;  2W61 A;  4IE7 A;  3MK7 C;  5J2U E;  2C0S A;  3Q5X A;  2EHO C;  4UVA B;  3HR0 A;  5H6Q B;  2V26 A;  3RX6 A;  3OJA A;  3RRW A;  5HWX A;  4HGA A;  4IDZ A;  5EK3 A;  5FYM A;  4ZI3 C;  2L9Q A;  4M1P A;  2DCF A;  4CI3 B;  2H7O A;  3F31 A;  1KNZ A;  1OXZ A;  2LOP A;  2L3L A;  2WWU A;  1MND A;  1WRD A;  5LCY A;  4AI6 A;  5LJM A;  2HPL A;  2LE8 A;  1YKE B;  5LGU B;  5FY0 A;  3GMI A;  5FXV A;  3KV5 A;  3PDY A;  3LK4 2;  1HG2 A;  2GK9 A;  5EZY E;  4GIW A;  3ZYM A;  2KLQ A;  3KDS E;  4PJJ A;  4E7Z A;  2XAG B;  4ZS2 A;  1WYB A;  3ZYK A;  2K24 A;  5LHI B;  2Y6X A;  4KUM B;  3F57 A;  2XTL A;  3SRZ A;  2YIN A;  2CXF A;  5FNV E;  3O1I A;  2EHO B;  4ZS3 A;  2RP4 A;  3UUL A;  2MYS A;  2LSJ A;  2LT3 A;  5KX5 E;  3QK6 A;  1FIO A;  2L8K A;  1VOM A;  5JQG E;  4ZI2 D;  2PJQ A;  2CA5 A;  2Q9Q B;  4AQF C;  5L2L A;  2X66 A;  3CPZ A;  1MMA A;  4O2A E;  4P09 A;  4C91 A;  2ODU A;  3IF8 B;  4UXN B;  3AA1 B;  4CZZ B;  4AKG A;  2ZM8 A;  1MMD A;  4F6R C;  3AA6 B;  2A2F X;  3N9M A;  3C64 A;  2Q9Q D;  1FMW A;  3ANW A;  3EVY A;  3I0Q A;  3ZLI A;  4EYU A;  5KDM C;  3C98 B;  3H3A A;  2A72 A;  5JDF A;  4OK0 A;  2H3R A;  4YJ3 E;  1CUN A;  3ZJ2 A;  4KP3 C;  1YW0 A;  3FBL A;  3GN5 B;  3UFE A;  1D0X A;  5L3E B;  2YEV C;  3UTK A;  4UV8 B;  3P8C D;  4AQG A;  1S35 A;  2UXX B;  4ADZ A;  4QX7 B;  2X51 A;  4QXH B;  3KBU A;  4O8S A;  3KV4 A;  4JEH B;  2X0L B;  5JDH A;  3AAE B;  3SOL A;  2NW8 A;  4UF0 B;  4V1A v;  4ILU A;  3S4U A;  3CWZ B;  3OBV E;  2ODV A;  1E1H B;  1AJ3 A;  2V7L A;  5H6R B;  5KMG P;  2ZM0 A;  4DVD A;  4CXY A;  5FXZ A;  5HXR A;  4H9P C;  2EHO A;  2BZB A;  2N1G A;  1LRZ A;  4QXC B;  4C90 A;  1HCI A;  2J1D G;  4G63 A;  4WBN E;  3VKG A;  3HL6 A;  1NWM X;  2VKD A;  5HWY A;  3DJB A;  3H37 A;  4UEL A;  3KVB A;  3HKB E;  4HN9 A;  2CWY A;  2NWB A;  4PFO A;  4IIJ E;  3KV6 A;  3ZN0 B;  2BDE A;  4AXP A;  2M67 A;  4PK4 A;  3I9Y A;  4I4T E;  3RYF E;  5HXE A;  3B57 A;  5ETW A;  4CI2 B;  2CXL A;  3JC6 C;  3MZK B;  2DWG A;  3J7Y q;  1WLX A;  3K8P C;  4A56 A;  5C8Y E;  3T8O A;  1ZEE A;  3P7I A;  1SA0 E;  3CX7 B;  3UUN A;  1MIV A;  4TV8 E;  3NZQ A;  4TN7 B;  2CE7 A;  4G2A A;  4UIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...