5JREA

Crystal structure of nec3po in complex with ssdna.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
GSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
molecule keywords NEQ131
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jreA00
3ZC1A 5JR9A 3ZC0A 5JR9B 5JRCB 5JR9C 5JRCA 5JREA
chains in the Genus database with same CATH superfamily
2V7JA 4IGUA 4HFIA 3RYFE 2WSSV 2BZBA 2K9AA 3G06A 3VKGA 3QB5K 4X62T 4AKLA 5KXJA 4GKJT 3J9X1 2BDEA 2Q9QB 5LG3A 2XUEA 2QVAA 3AE9A 3O1IA 2JQHA 2WDRA 3P4QA 4TWFA 4TUYE 3MKDA 4IE5A 3JAFA 1XNQT 4LF4T 3FZMB 2XPKA 3NKZA 4EEDA 4YT0A 1OEDB 4WBOA 2IW5B 5LMUT 3N2OA 2I6HA 2PBIA 5E0OA 2W4XA 2MOZA 5LB7B 1KK7A 1D0YA 4G2AA 4IDOA 2BG9A 3ESLA 3H3MA 4O2AE 3WAKA 3UUMA 5HXHA 4AXPA 2CCQA 5CFBA 3CX7B 2FJAA 2MYSA 2VK9A 4QWNB 3S4UA 4LF5T 3T8OA 2UXCT 4V1Av 1UCUA 3MJXA 3KBTA 4X5TA 3ZPOA 5LHIB 1Y64B 4CXXA 2X9YA 5AQIB 2RP4A 2LLYA 2BS2A 2ZMAA 1GQEA 3E22E 3EHZA 3VRAA 5IWAT 3T1HT 1YKHB 4H9RC 2H7OA 1HTJF 3LFMA 4JEHB 1WR6A 2PFVA 5LP6E 2LSGA 4EEBA 2D2SA 3AE5A 2EHOB 2XAFB 1WYCA 3CMLA 2YU2A 4O4IE 4Z8XA 4QKNA 3U3IA 3ZJ2A 3ZC0A 3K3OA 4ZI7E 1VRBA 3HKEE 5EZYE 4KP3C 2XQAA 4HWFA 2J4GA 3NWIA 2LSJA 1HS7A 2IUBA 4EIWA 2XQ4A 5JDFA 4NUVA 4EYUA 4I0UA 3UT5E 3MA9A 2X0LB 1CHUA 4IIJE 4ILAA 5TAOA 1YQ3A 3F57A 4JI6T 2W00A 3F2EA 2MAWA 4JBWF 5AQNB 3N9MA 2BG9C 4MALA 4AKRB 4ZEYA 4NXMT 4YLHA 3Q5EA 3ZCJA 3W15B 3B5MA 4DV6T 3K3QC 3B57A 2IHR1 4L5GA 4UEMA 4DBQA 1HX8A 5AFUL 2V8SV 2VL0A 2W66A 2WQYA 4JI5T 2KWIB 4YY3T 3FZFB 2XZEA 4O8SA 3UQ7A 3VU7H 5LYJE 1WYBA 2FBWA 3SFEA 5DQWA 2W63A 3OVUA 3ETUA 2KZ7B 3RLFF 5JH7E 3GMIA 5JR9B 1X9BA 3NBXX 5LCYA 4TV9E 2WDVA 3NRYA 4YJ2E 2VKJA 2AE9A 3P4WA 3C50A 3PURA 2B76A 2LE8A 3ZYLA 4YFSA 2SPCA 4OX9T 1YD8G 4JUYA 3ZN0B 4YSZA 3VHLA 5FNVE 4AKHA 2Q9QD 3HKBE 4PAGA 4PK6A 5JDHA 3CK6A 3UU5A 2XQYA 1SA0E 4N78D 4UF0B 4HN9A 4Z91A 1G8XA 5HCMA 2K3WA 3RQWA 5L3EB 5JDGA 5LXTE 5M4YA 4JV5T 5HEUA 4PFOA 1OEDA 3EVYA 3LJCA 1YW0A 2D9DA 1LVKA 3RYCE 3NZQA 3Q5XA 4EAHA 5J2TE 2W62A 5KMGP 2LM9A 4IDPA 1MMNA 3EAMA 2G0UA 1MMDA 4DUZT 3SWHA 2WB5A 4WW0A 3RI5A 5EK3A 2NW9A 4KI0F 3IA3A 3HKCE 4AQFC 2VWAA 5LJNA 4LF6T 4UV8B 2CHOA 2XAQB 3AE6A 3AE4A 3FHNA 4HWDA 2E5LT 1OXZA 4OK0A 4B3MT 2ACZA 2VVNA 4QXHB 5HWYA 3TLWA 3UUBA 2DNXA 1WFDA 2JIWA 5JDMA 1T98A 5IUXA 1HG5A 2XASB 1KFYA 2E9XD 1D1AA 2NW7A 2V5CA 2VURA 3DTOA 1NENA 4H63H 2ZM8A 1FMWA 3FBLA 2YDQA 5AQOB 2OA5A 1BR1A 5HCJA 4KX6A 3ZEFB 2X67A 2HPJA 3PJAJ 3RKOA 5HEJA 2XAGB 3N9PA 3LDQB 5JDQA 3EDVA 1HNXT 2BBJA 3P4RA 3JC6D 4QH5A 4ZS2A 2LSYA 5FXWA 5H6QB 3R84B 2BS4A 3AE2A 3I0OA 1BR4A 4K0UA 2UXNB 1ZP0A 3C4ZA 3Q2MA 1FEWA 1E2AA 2CWYA 2X0HA 3BQIA 4ZXLA 1W0AA 5HXEA 5F8PA 2H88A 2BVLA 4IDNA 2PTFA 4X1IE 5ABEA 2N2NA 1QLBA 4HTEA 4WYVA 3A5XA 2WP9A 3CWZB 2C5KT 4HFBA 4DMWA 4YTPA 4DV3T 1AJ3A 3RGLA 2NW8A 3Q5DA 1ZHCA 2QYWA 4QX8B 2E9XB 2BS3A 3CVRA 2XQ8A 4XAXB 3D0TA 4OHFA 3RIFA 4CN1A 5JR9A 4DVDA 1G73A 3FBZA 1VOMA 1MIVA 3T1YT 1LKXA 3L8RA 1T72A 4YTNA 3PUGA 4ISSA 3CQCB 4LF9T 2KINB 4YSYA 4GKKT 2VL8A 5BR8T 4DV1T 2LRLA 4PK4A 5C3JA 4NPPA 4MFRA 3PU3A 2CXDA 3N9LA 3N9NA 3PJAA 1HF8A 3N9OA 4UVCB 1L0VA 3RX6A 4KBMB 2QA7A 4LMKA 5JR9C 4IE7A 2XSBA 1UGOA 4CQIA 1ZKEA 2ACXA 4B3TT 5AQMB 4A98A 5LJMA 3F31A 2UXBT 3AEAA 2E8IA 5FXXA 3JADA 5HXSA 3L39A 1IJ6A 4C90A 3ZJ1A 1IBMT 3Q5WA 1T7SA 2XM2A 3OYZA 3MK7C 4AQYT 3FB2A 3KV9A 2EHOA 5FY7A 2DI4A 2DLRA 1H7CA 1T8BA 1OEDC 4ZI3D 4I50E 3TLSA 5LHGB 4IE0A 3ABVA 4U2ZA 3J7Yq 4DV7T 4B3ST 2CM0A 3O1JA 5FY1A 4HEAA 3UU8A 3MZKB 1UK5A 4P09A 5AQRB 4NXNT 1I94T 3VKHA 2N9DA 2FJBA 4XZCA 4EZ4A 4IL9A 3NVOA 1V9DA 1ZOYA 5AQUB 5FVKA 2JMKA 3CIRA 3QOFA 4TNVA 5FXZA 1XMQT 4KMCA 2M6BA 5CGMA 2KWHA 3FZLB 1B7TA 4U33A 1BR0A 3QC9A 3OTOT 5FKYA 2CA5A 1J5WA 1HG2A 3JAEA 3PUYF 5CA1E 3QUJA 4DR4T 4IE6A 4ZOLE 2KLQA 4PFPA 3CX8B 1N36T 3OJAA 2UUBT 1IZNB 2WCAA 2J1DG 5AQGB 4B3RT 2A9UA 4XBFB 2V6YA 4GOUA 2HH7A 3RIUA 2CXFA 2ZM6T 4U7YA 2A3DA 3ANWA 3M3ZB 5C8YE 4DR2T 3ZT6A 2EHOC 2LT3A 4IT4A 3ZSTA 2A72A 3SS1A 3X1DA 3O9XA 5LGNB 4X64T 3V5SA 3FZKB 4MHCA 3OYXA 4OYJA 1Z8UA 2X0YA 4QH1A 1J5ET 1WLXA 2FUPA 4JEUB 3PUZF 2NOXA 2OV9A 2DWGA 4KHZF 3SOLA 4EZHA 3DJBA 4AQGA 2Q9QC 2BG9E 4KUMB 3EI0A 3LBXA 5AQVB 5JRCA 4TWHA 1N32T 1YQ4A 5IYZE 4U3CA 3CKDA 5ABHA 2L8KA 2JPFA 4IHJE 4U74A 2PJQA 2VQET 5ABFA 2Z6EA 1E7PA 4X20E 1IJ5A 1LRZA 4DV4T 2IC9A 2WS3A 2AXDS 3ZC1A 1YXRA 4H9QC 4UIGA 5FMNA 2WU5A 2ZM2A 3DP7A 4MBQA 2UXXB 5LMNT 3QNUA 4P1NA 2HN2A 2UXDT 4QXBB 4JI4T 5JQGE 3I9YA 5C2TA 2V6XA 2QGSA 2VKDA 5F5WA 1HR0T 1SUMB 5LNKA 4ZI2D 5CB4E 1KF6A 2H7VC 2YOEA 4U72A 4GIWA 2LKHA 2ODUA 3AEBA 4TZ4C 4UVAB 4CI1B 5H6RB 1DU2A 4H9OC 4G63A 4EV6A 4LFCT 2XTLA 5AQFB 1OEDE 4NUUA 4YHJA 4GK0E 4DR3T 3HI2A 3UFEA 4DR6T 4TV8E 5EK2A 4F8HA 1S35A 2RA1A 3CQXC 4J2CA 2MBGA 1JNRA 1S94A 1YKEB 5J2UE 2YK0A 5AQHB 5JRCB 1MIYA 4PK5A 5GONE 3UQ4A 3ZMVB 3L3PA 4HWIB 1IBKT 4EXTA 2ES0A 2D5UA 4HFEA 1D0XA 1MIWA 1MNEA 2BKOA 1N33T 1W0BA 4HFCA 2DL1A 3ONLC 5AQKB 2WBLA 2EHOD 2ODVA 4AISA 4CI3B 5AQSB 2X51A 5JDNA 1MMGA 2VKOA 3AEEA 4O2BE 2LSIA 3P4PA 5AQLB 4DBRA 3C98B 2CPTA 4TN7B 2W2UA 3HA4A 2BBHA 2X66A 3AE1A 3AB3B 4IDQA 3AXJA 4PJJA 1HCIA 2XQ7A 4I43B 3TLVA 4BAYB 5LGUB 3OPCA 1XDPA 4E7ZA 4NIQA 4ISTA 2A2FX 1HX1B 4HFVA 3RIAA 2NP9A 3AAAB 2CWOA 2CEAA 5HWXA 4YHHT 2E9XC 5HXCA 1E1HB 4DV2T 2VKHA 1JNZA 4M1PA 4ADZA 2D0UA 3QK6A 3UU3A 3E08A 3UFGA 4H9NC 3RH3A 2M6IA 3PDYA 3RQUA 5AQJB 5KDMC 1NAFA 3AA7B 1QSDA 2XY8B 4K0KT 1LVFA 2D0TA 2I59A 2KXPB 3C4WA 3RRWA 4JI7T 2J47A 3K8PC 4AKGA 2KT9A 2I0MA 1SE7A 4UXNB 3PUXF 2VASA 4FJOA 3UTKA 3ZSSA 2WM9A 4ZI2C 1IBLT 4AKIA 3AE8A 3NZPA 3PUWF 5L4EA 3RC3A 4LF7T 2XAJB 1VCTA 3PE0A 5ABGA 3EDUA 4PNIA 2CMRA 4DR5T 4IREA 2NTXA 3KBUA 5FP3A 1KNRA 3KVBA 4CZZB 2X9XA 4P0AA 4DIDB 5L3DB 1XNRT 2CLYC 4I55E 2WZHA 2H89A 4ZI3C 3RHWA 3PUAA 4HKAA 3ZT5A 3FXDB 3UUNA 4CN6A 2MPKA 3VR8A 5ABFB 5F3JA 5JDLA 3RRCA 3TKLB 4ERRA 4Z90A 3QB5A 1FIOA 4ILCA 1UX5A 4H63V 4TX5A 3PUSA 1R8IA 2JMHA 1VCSA 3EABA 1BR2A 3E0ZA 5JREA 4WBNE 2V7KA 4DV5T 1KNPA 1W9RA 4JLEA 2HN1A 1WR0A 2LEHA 2XQ5A 2WMOA 3C51A 3H37A 2NWBA 4L0RA 4BJMA 5LGTB 1D1CA 2W0GA 4KHPT 5HYAA 4HGAA 1CUNA 2CHNA 1D1BA 2BKPA 3ZYKA 2UUCT 2JJ9A 2OLTA 2UU9T 2CRBA 4UF0A 4GYRA 3BQLA 4F6RC 5L3BB 1U4QA 1ZEEA 2LHNA 2QRXA 2V7LA 2XAHB 3C64A 5AQTB 3ZKRA 4AIUA 4FI5A 1Y01A 1O3XA 2XM1A 4AQFA 2L9QA 2V1DB 2XJ7A 3BQKA 3A8YC 3ONXA 3KFWX 3ZLIA 3I1AA 2YU1A 3PV0F 4GYSA 4HFHA 2KNDA 2V6YB 5LBQB 4JI2T 3RPUA 2IIUA 2YDSA 3WAJA 3A7MA 4PJMA 3K1SA 2YDRA 2BKNA 4YJ3E 3ZYMA 4X65T 4C91A 3N9QA 4HE8A 1NWMX 2BVMA 2VQFT 5J0ZA 3PU8A 2ZM0A 3V5UA 4DUYT 2MTQA 4LFBT 3RF1A 3PUVF 5FL0A 3MXZA 3IHRA 4UR9A 3HL6A 5CA0E 5LHHB 4HWCA 3ONJA 5FL1A 3LK3B 4ILBA 2LSKA 3KV4A 3AA0B 4UV9B 3RIUC 3U78A 2XQ9A 2IAKA 4PJLA 4QX7B 4CXWA 2NR4A 2NTYA 4L9IA 4QXCB 3VRBA 5J1GA 2JQQA 1OWAA 1HNZT 2WAUA 3LG7A 3N2GE 5IHYA 2JQ9A 4PW8A 1MNDA 2LHRA 5AQPB 3ZMSB 3JC6C 4CN4A 2GK9A 3KDSE 3FZHB 2DWKA 4HFDA 3BK9A 5LA6E 2WZIA 5EK4A 2P9BA 3AE3A 4ANJA 4DNDA 3AAIA 2C5IT 4BA9A 4EOZB 2K24A 5ADXL 2VVSA 1HNWT 2FJEA 3ZMTB 2V5DA 3C4XA 5HEOA 3ZT7A 3RYHE 3ZN1B 2LM2A 2X9WA 2L3LA 5DQVA 3SFDA 5BMVE 5FVLA 1KNZA 4A5XA 5HAXA 3AXJB 4AI6A 2JQKA 5LOVE 4YSXA 5L47A 3Q9DA 2KSRA 4IE4A 5JVDE 1UURA 3AEDA 2HHHT 3ANWB 3OKQA 3ZCIA 1X79A 2Y6XA 4U2YA 4H9PC 2LOSA 4JI3T 4X66T 5HXRA 3FXEB 3KVAA 3KV6A 1KEYA 4IDZA 2E9XA 5DABA 2FJDA 4E7SA 2JRKA 3TLTA 5L2LA 4U7IA 1SHZC 2V26A 5L3FB 3RC8A 3PTRB 4ILUA 2LKGA 5LG4A 4JI0T 2RPAA 4QH4A 3P50A 2YINA 3UU6A 4WZXA 2IC6A 1NEKA 2ZLYA 3UULA 1ZV4X 4OYKA 3AE7A 5A1LA 3OBVE 2BG9B 1I6ZA 5FY0A 1WCRA 1M7KA 3KINB 4WNKA 3B13A 5LBMA 3TLUA 4LMLA 2WU2A 3N5LA 4MLKA 5L3GB 4TWDA 2XHEB 2UUAT 2F4VT 4DR1T 5AQQB 4OFZA 4BJNA 3LK2B 3WI3A 1XZYA 5HEGA 2WY2A 2X68A 3CPZA 4UELA 4EYYR 2E2AA 2DHRA 2Q9QA 5ETWA 1FMVA 3AECA 1D0ZA 4O4HE 3P7IA 4DR7T 3LK42 3R6NA 2R6GF 3MACA 4YXDA 1MMAA 3I0QA 4H9SE 4LMJA 4UVBB 5L4HA 1QUUA 3ETVA 1U5PA 1XWMA 3GN5A 4X1KE 3M65A 3P4SA 3UU4A 4ZZBA 4JYAT 2CXLA 4LFAT 4HWHA 5FYMA 1XDOA 3VR9A 4DMVA 1XMOT 3NRXA 4EGWA 2XSAA 4CI2B 4LF8T 5KX5E 3IBPA 3O1HA 3LSVA 3RYIE 2CE7A 3N2KE 1UUSA 2YKSA 4B6XA 3AEGA 4CXYA 2IMLA 3K3NA 3LBXB 2K48A 1IAPA 1US7B 2K5BB 4X1YE 2V7IA 3I9WA 3SRZA 3KV5A 2VB6A 3O4XE 1M62A 3JCFA 4JI8T 5DJQC 4DO0A 1EZ3A 2YN6A 1FJGT 2CLYB 5JTGA 3HR0A 2C0SA 3CX6B 3HKDE 4O4JE 4COFA 2WMNA 2H3RA 3L09A 2CBJA 3AVSA 3UUXB 1N34T 3GA8A 3ZMZB 4Q25A 1Z0PA 2Y48B 4P0BA 5L3CB 2DCFA 2LRKA 2LOPA 2HPLA 2WWVA 2V7MA 2XQ6A 2W61A 3PUQA 4IL4A 1WRDA 2Y8DA 4TNWA 4EB6E 5FXVA 2J62A 3AAEB 3IEEA 4YTMA 5CJ5A 4JI1T 3ZMUB 2KMFA 3AA1B 3AEFA 3AVRA 4ASKA 4ZZCA 4DV0T 3IF8B 2WWUA 1W09A 2LJLA 2W67A 5HEHA 4I4TE 2C5JA 4A97A 3RKGA 2WDQA 1J1JA 2B1EA 4GK5E 4U31A 3CQGB 2N1GA 2YEVC 4A56A 1UX4A 2IDOB 4PJNA 3AA6B 1HFAA 3EUHA 4QHOA 2M67A 2E5VA 2X9HA 2CBIA 3H3AA 4O4LE 2PG8A 3GWHA 4ZHQE 2XQ3A 4ZS3A 3P8CD 3GN5B
chains in the Genus database with same CATH topology
2V7JA 4IGUA 3RYFE 2WSSV 2BZBA 2K9AA 3VKGA 4AKLA 3J9X1 2BDEA 2Q9QB 2XUEA 3O1IA 4TUYE 3MKDA 4IE5A 4WBOA 2IW5B 3N2OA 2PBIA 5E0OA 2MOZA 1KK7A 1D0YA 4G2AA 3ESLA 4O2AE 3WAKA 3UUMA 5HXHA 4AXPA 2CCQA 3CX7B 2MYSA 2VK9A 4QWNB 3S4UA 3T8OA 4V1Av 1UCUA 3MJXA 3KBTA 3ZPOA 5LHIB 1Y64B 4CXXA 2X9YA 2RP4A 2ZMAA 3E22E 1YKHB 4H9RC 2H7OA 1HTJF 3LFMA 4JEHB 1WR6A 2PFVA 5LP6E 2LSGA 2D2SA 3CMLA 2EHOB 2XAFB 1WYCA 4O4IE 2YU2A 3ZJ2A 4Z8XA 4QKNA 3U3IA 3J7Yq 3ZC0A 3K3OA 4ZI7E 1VRBA 3HKEE 5EZYE 4KP3C 2LSJA 4EIWA 4EYUA 5JDFA 4NUVA 3UT5E 3MA9A 2X0LB 4IIJE 5TAOA 3F57A 2W00A 3F2EA 3N9MA 4AKRB 4MALA 4YLHA 3ZCJA 3W15B 3K3QC 3B57A 4L5GA 4UEMA 4DBQA 1HX8A 2KWIB 4O8SA 3VU7H 1WYBA 5DQWA 2W63A 5JR9B 3ETUA 2KZ7B 5JH7E 3GMIA 3NBXX 5LCYA 4TV9E 3NRYA 4YJ2E 2VKJA 3C50A 3PURA 2LE8A 3ZYLA 4YFSA 2SPCA 1YD8G 4JUYA 3ZN0B 3VHLA 5FNVE 4AKHA 2Q9QD 3HKBE 4PAGA 4PK6A 5JDHA 4EOZB 2XQYA 1SA0E 4N78D 4UF0B 4HN9A 5L3EB 1G8XA 5M4YA 5JDGA 5LXTE 4PFOA 3EVYA 3LJCA 1YW0A 3RYCE 1LVKA 3NZQA 3Q5XA 4EAHA 5J2TE 2W62A 5KMGP 2LM9A 1MMNA 2G0UA 1MMDA 3SWHA 4WW0A 5EK3A 2NW9A 3HKCE 4AQFC 2VWAA 5LJNA 4UV8B 2XAQB 3FHNA 1OXZA 4OK0A 4QXHB 5HWYA 2DNXA 5JDMA 1T98A 1HG5A 2XASB 2E9XD 1D1AA 2NW7A 3DTOA 4H63H 2ZM8A 1FMWA 3FBLA 2OA5A 1BR1A 3ZEFB 2X67A 2HPJA 3RKOA 2XAGB 3N9PA 5JDQA 3EDVA 3JC6D 4ZS2A 5H6QB 2LSYA 5FXWA 3R84B 3I0OA 1BR4A 4K0UA 2UXNB 3C4ZA 3Q2MA 1FEWA 3BQIA 2CWYA 5HXEA 5F8PA 2BVLA 4X1IE 5LJMA 2N2NA 4HTEA 3A5XA 3CWZB 2C5KT 4DMWA 1AJ3A 2NW8A 1ZHCA 4QX8B 2E9XB 3CVRA 4XAXB 4DVDA 3D0TA 4OHFA 5JR9A 1G73A 3FBZA 1VOMA 1MIVA 1LKXA 3PUGA 4ISSA 3CQCB 2KINB 2VL8A 4PK4A 4MFRA 3PU3A 2CXDA 3N9LA 3N9NA 1HF8A 3N9OA 4UVCB 3RX6A 4KBMB 2QA7A 5JR9C 4IE7A 4CQIA 1ZKEA 2ACXA 3F31A 2E8IA 5FXXA 5HXSA 1IJ6A 4C90A 3ZJ1A 3Q5WA 3OYZA 3MK7C 3FB2A 3KV9A 2EHOA 5FY7A 2DI4A 2DLRA 1H7CA 4ZI3D 4I50E 5LHGB 4IE0A 2CM0A 3O1JA 5FY1A 4HEAA 3MZKB 4P09A 3VKHA 2N9DA 4XZCA 4EZ4A 1V9DA 5FXZA 2JMKA 4KMCA 1BR0A 2KWHA 1B7TA 3QC9A 2CA5A 1HG2A 3QUJA 4IE6A 4ZOLE 2KLQA 4PFPA 3CX8B 3OJAA 1IZNB 2J1DG 4XBFB 4GOUA 2HH7A 2CXFA 2A3DA 3ANWA 5C8YE 2EHOC 2LT3A 2A72A 3SS1A 3O9XA 5LGNB 3V5SA 4MHCA 3OYXA 4OYJA 1WLXA 4JEUB 4EZHA 3SOLA 2DWGA 2NOXA 3DJBA 4AQGA 2Q9QC 4KUMB 5JRCA 3LBXA 5IYZE 3CKDA 2L8KA 2JPFA 4IHJE 4U74A 2PJQA 2Z6EA 4X20E 1IJ5A 1LRZA 2IC9A 3ZC1A 4H9QC 4UIGA 5FMNA 2ZM2A 3DP7A 4MBQA 2UXXB 4QXBB 5JQGE 3I9YA 2QGSA 2VKDA 5LNKA 4ZI2D 5CB4E 2H7VC 4U72A 4GIWA 4TZ4C 2ODUA 4UVAB 4CI1B 5H6RB 4H9OC 4G63A 2XTLA 4NUUA 4YHJA 4GK0E 3HI2A 3UFEA 4TV8E 5EK2A 1S35A 2RA1A 3CQXC 4J2CA 2MBGA 5J2UE 1S94A 1YKEB 2YK0A 5JRCB 1MIYA 4PK5A 5GONE 3ZMVB 3L3PA 4EXTA 2ES0A 2D5UA 1D0XA 1MIWA 1MNEA 2WBLA 2EHOD 2ODVA 4CI3B 2X51A 5JDNA 1MMGA 2VKOA 4O2BE 4DBRA 2LSIA 3C98B 4TN7B 3HA4A 2X66A 3AB3B 5LGUB 4PJJA 1HCIA 4I43B 4BAYB 4E7ZA 4ISTA 2A2FX 4HFVA 2NP9A 3AAAB 2CWOA 2CEAA 5HWXA 2E9XC 5HXCA 1E1HB 2VKHA 4M1PA 4ADZA 2D0UA 3QK6A 3E08A 4H9NC 3RH3A 3PDYA 5KDMC 1NAFA 3AA7B 1QSDA 1LVFA 2D0TA 2I59A 2KXPB 3C4WA 3RRWA 3K8PC 4AKGA 2KT9A 4UXNB 2VASA 4FJOA 3UTKA 2WM9A 4ZI2C 4AKIA 3NZPA 3RC3A 2XAJB 3PE0A 3EDUA 4PNIA 2CMRA 5FP3A 2NTXA 3KBUA 4P0AA 3KVBA 4CZZB 2X9XA 5L3DB 2CLYC 4I55E 4ZI3C 3PUAA 4HKAA 3FXDB 3UUNA 5JDLA 3RRCA 3TKLB 4ERRA 1FIOA 1UX5A 4H63V 4TX5A 3PUSA 2JMHA 5JREA 1BR2A 3E0ZA 4WBNE 2V7KA 4JLEA 2LEHA 3C51A 2WMOA 3H37A 4BJMA 2NWBA 4L0RA 5LGTB 1D1CA 2W0GA 5HYAA 4HGAA 1CUNA 1D1BA 3ZYKA 2JJ9A 1HS7A 4UF0A 4GYRA 3BQLA 4F6RC 5L3BB 1U4QA 1ZEEA 2LHNA 2XAHB 2V7LA 3C64A 5AFUL 4FI5A 4AQFA 1O3XA 5LYJE 2L9QA 2V1DB 3ONXA 3BQKA 5CA1E 3ZLIA 3KFWX 5L3GB 3I1AA 2YU1A 4GYSA 5LBQB 2KNDA 3WAJA 3RPUA 4PJMA 4YJ3E 3ZYMA 4C91A 3N9QA 4HE8A 1NWMX 2BVMA 3PU8A 2ZM0A 3V5UA 2MTQA 5CA0E 3MXZA 3IHRA 5LHHB 3HL6A 3LK3B 5F3JA 2LSKA 3KV4A 3AA0B 4UV9B 3U78A 4CXWA 2IAKA 4PJLA 4QX7B 2NTYA 4L9IA 4QXCB 5J1GA 2JQQA 1OWAA 2WAUA 3LG7A 3N2GE 5IHYA 4PW8A 1MNDA 2LHRA 3ZMSB 3JC6C 2GK9A 3KDSE 2DWKA 5LA6E 3BK9A 4ANJA 4DNDA 5EK4A 2P9BA 3AAIA 2C5IT 4BA9A 2K24A 5ADXL 3ZMTB 3C4XA 3RYHE 3ZN1B 2X9WA 1KNZA 2L3LA 5DQVA 5BMVE 4AI6A 5HAXA 5LOVE 3RC8A 3Q9DA 4IE4A 5JVDE 3ANWB 3OKQA 3ZCIA 1X79A 2Y6XA 4H9PC 2LOSA 5HXRA 3FXEB 3KVAA 3KV6A 4IDZA 5DABA 2E9XA 4E7SA 2JRKA 5L2LA 1SHZC 2V26A 5L3FB 3PTRB 4ILUA 5LG4A 2YINA 2ZLYA 2IC6A 3UULA 1ZV4X 4OYKA 5A1LA 3OBVE 5FY0A 3KINB 4WNKA 3B13A 5LBMA 4MLKA 3N5LA 2XHEB 4OFZA 4BJNA 3LK2B 3WI3A 2X68A 3CPZA 4UELA 4EYYR 2DHRA 2Q9QA 5ETWA 1FMVA 4O4HE 1D0ZA 3P7IA 3LK42 3R6NA 3MACA 1MMAA 3I0QA 4H9SE 4UVBB 1QUUA 3ETVA 1U5PA 3GN5A 4X1KE 3M65A 2CXLA 5FYMA 4DMVA 3NRXA 4CI2B 5KX5E 3IBPA 3O1HA 3RYIE 4B6XA 2CE7A 3N2KE 4CXYA 3LBXB 3K3NA 4X1YE 2K48A 1IAPA 1US7B 2K5BB 2V7IA 3I9WA 3SRZA 3KV5A 2VB6A 3O4XE 5DJQC 4DO0A 1EZ3A 2CLYB 3HR0A 2C0SA 3CX6B 3HKDE 4O4JE 2WMNA 2H3RA 3L09A 3UUXB 3AVSA 3GA8A 3ZMZB 1Z0PA 2Y48B 4P0BA 5L3CB 2DCFA 2LOPA 2HPLA 2V7MA 2W61A 3PUQA 4EB6E 1WRDA 2Y8DA 5FXVA 3AAEB 3IEEA 3ZMUB 2KMFA 3AA1B 3AVRA 4ASKA 3IF8B 2WWUA 2LJLA 4I4TE 2C5JA 4GK5E 2B1EA 3CQGB 2N1GA 2YEVC 4A56A 1UX4A 4PJNA 3AA6B 1HFAA 3EUHA 4QHOA 2M67A 2X9HA 3H3AA 4O4LE 2PG8A 3GWHA 4ZHQE 4ZS3A 3P8CD 3GN5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZC1 A;  5JR9 A;  3ZC0 A;  5JR9 B;  5JRC B;  5JR9 C;  5JRC A;  5JRE A; 
#chains in the Genus database with same CATH topology
 2V7J A;  4IGU A;  4HFI A;  3RYF E;  2WSS V;  2BZB A;  2K9A A;  3G06 A;  3VKG A;  3QB5 K;  4X62 T;  4AKL A;  5KXJ A;  4GKJ T;  3J9X 1;  2BDE A;  2Q9Q B;  5LG3 A;  2XUE A;  2QVA A;  3AE9 A;  3O1I A;  2JQH A;  2WDR A;  3P4Q A;  4TWF A;  4TUY E;  3MKD A;  4IE5 A;  3JAF A;  1XNQ T;  4LF4 T;  3FZM B;  2XPK A;  3NKZ A;  4EED A;  4YT0 A;  1OED B;  4WBO A;  2IW5 B;  5LMU T;  3N2O A;  2I6H A;  2PBI A;  5E0O A;  2W4X A;  2MOZ A;  5LB7 B;  1KK7 A;  1D0Y A;  4G2A A;  4IDO A;  2BG9 A;  3ESL A;  3H3M A;  4O2A E;  3WAK A;  3UUM A;  5HXH A;  4AXP A;  2CCQ A;  5CFB A;  3CX7 B;  2FJA A;  2MYS A;  2VK9 A;  4QWN B;  3S4U A;  4LF5 T;  3T8O A;  2UXC T;  4V1A v;  1UCU A;  3MJX A;  3KBT A;  4X5T A;  3ZPO A;  5LHI B;  1Y64 B;  4CXX A;  2X9Y A;  5AQI B;  2RP4 A;  2LLY A;  2BS2 A;  2ZMA A;  1GQE A;  3E22 E;  3EHZ A;  3VRA A;  5IWA T;  3T1H T;  1YKH B;  4H9R C;  2H7O A;  1HTJ F;  3LFM A;  4JEH B;  1WR6 A;  2PFV A;  5LP6 E;  2LSG A;  4EEB A;  2D2S A;  3AE5 A;  2EHO B;  2XAF B;  1WYC A;  3CML A;  2YU2 A;  4O4I E;  4Z8X A;  4QKN A;  3U3I A;  3ZJ2 A;  3ZC0 A;  3K3O A;  4ZI7 E;  1VRB A;  3HKE E;  5EZY E;  4KP3 C;  2XQA A;  4HWF A;  2J4G A;  3NWI A;  2LSJ A;  1HS7 A;  2IUB A;  4EIW A;  2XQ4 A;  5JDF A;  4NUV A;  4EYU A;  4I0U A;  3UT5 E;  3MA9 A;  2X0L B;  1CHU A;  4IIJ E;  4ILA A;  5TAO A;  1YQ3 A;  3F57 A;  4JI6 T;  2W00 A;  3F2E A;  2MAW A;  4JBW F;  5AQN B;  3N9M A;  2BG9 C;  4MAL A;  4AKR B;  4ZEY A;  4NXM T;  4YLH A;  3Q5E A;  3ZCJ A;  3W15 B;  3B5M A;  4DV6 T;  3K3Q C;  3B57 A;  2IHR 1;  4L5G A;  4UEM A;  4DBQ A;  1HX8 A;  5AFU L;  2V8S V;  2VL0 A;  2W66 A;  2WQY A;  4JI5 T;  2KWI B;  4YY3 T;  3FZF B;  2XZE A;  4O8S A;  3UQ7 A;  3VU7 H;  5LYJ E;  1WYB A;  2FBW A;  3SFE A;  5DQW A;  2W63 A;  3OVU A;  3ETU A;  2KZ7 B;  3RLF F;  5JH7 E;  3GMI A;  5JR9 B;  1X9B A;  3NBX X;  5LCY A;  4TV9 E;  2WDV A;  3NRY A;  4YJ2 E;  2VKJ A;  2AE9 A;  3P4W A;  3C50 A;  3PUR A;  2B76 A;  2LE8 A;  3ZYL A;  4YFS A;  2SPC A;  4OX9 T;  1YD8 G;  4JUY A;  3ZN0 B;  4YSZ A;  3VHL A;  5FNV E;  4AKH A;  2Q9Q D;  3HKB E;  4PAG A;  4PK6 A;  5JDH A;  3CK6 A;  3UU5 A;  2XQY A;  1SA0 E;  4N78 D;  4UF0 B;  4HN9 A;  4Z91 A;  1G8X A;  5HCM A;  2K3W A;  3RQW A;  5L3E B;  5JDG A;  5LXT E;  5M4Y A;  4JV5 T;  5HEU A;  4PFO A;  1OED A;  3EVY A;  3LJC A;  1YW0 A;  2D9D A;  1LVK A;  3RYC E;  3NZQ A;  3Q5X A;  4EAH A;  5J2T E;  2W62 A;  5KMG P;  2LM9 A;  4IDP A;  1MMN A;  3EAM A;  2G0U A;  1MMD A;  4DUZ T;  3SWH A;  2WB5 A;  4WW0 A;  3RI5 A;  5EK3 A;  2NW9 A;  4KI0 F;  3IA3 A;  3HKC E;  4AQF C;  2VWA A;  5LJN A;  4LF6 T;  4UV8 B;  2CHO A;  2XAQ B;  3AE6 A;  3AE4 A;  3FHN A;  4HWD A;  2E5L T;  1OXZ A;  4OK0 A;  4B3M T;  2ACZ A;  2VVN A;  4QXH B;  5HWY A;  3TLW A;  3UUB A;  2DNX A;  1WFD A;  2JIW A;  5JDM A;  1T98 A;  5IUX A;  1HG5 A;  2XAS B;  1KFY A;  2E9X D;  1D1A A;  2NW7 A;  2V5C A;  2VUR A;  3DTO A;  1NEN A;  4H63 H;  2ZM8 A;  1FMW A;  3FBL A;  2YDQ A;  5AQO B;  2OA5 A;  1BR1 A;  5HCJ A;  4KX6 A;  3ZEF B;  2X67 A;  2HPJ A;  3PJA J;  3RKO A;  5HEJ A;  2XAG B;  3N9P A;  3LDQ B;  5JDQ A;  3EDV A;  1HNX T;  2BBJ A;  3P4R A;  3JC6 D;  4QH5 A;  4ZS2 A;  2LSY A;  5FXW A;  5H6Q B;  3R84 B;  2BS4 A;  3AE2 A;  3I0O A;  1BR4 A;  4K0U A;  2UXN B;  1ZP0 A;  3C4Z A;  3Q2M A;  1FEW A;  1E2A A;  2CWY A;  2X0H A;  3BQI A;  4ZXL A;  1W0A A;  5HXE A;  5F8P A;  2H88 A;  2BVL A;  4IDN A;  2PTF A;  4X1I E;  5ABE A;  2N2N A;  1QLB A;  4HTE A;  4WYV A;  3A5X A;  2WP9 A;  3CWZ B;  2C5K T;  4HFB A;  4DMW A;  4YTP A;  4DV3 T;  1AJ3 A;  3RGL A;  2NW8 A;  3Q5D A;  1ZHC A;  2QYW A;  4QX8 B;  2E9X B;  2BS3 A;  3CVR A;  2XQ8 A;  4XAX B;  3D0T A;  4OHF A;  3RIF A;  4CN1 A;  5JR9 A;  4DVD A;  1G73 A;  3FBZ A;  1VOM A;  1MIV A;  3T1Y T;  1LKX A;  3L8R A;  1T72 A;  4YTN A;  3PUG A;  4ISS A;  3CQC B;  4LF9 T;  2KIN B;  4YSY A;  4GKK T;  2VL8 A;  5BR8 T;  4DV1 T;  2LRL A;  4PK4 A;  5C3J A;  4NPP A;  4MFR A;  3PU3 A;  2CXD A;  3N9L A;  3N9N A;  3PJA A;  1HF8 A;  3N9O A;  4UVC B;  1L0V A;  3RX6 A;  4KBM B;  2QA7 A;  4LMK A;  5JR9 C;  4IE7 A;  2XSB A;  1UGO A;  4CQI A;  1ZKE A;  2ACX A;  4B3T T;  5AQM B;  4A98 A;  5LJM A;  3F31 A;  2UXB T;  3AEA A;  2E8I A;  5FXX A;  3JAD A;  5HXS A;  3L39 A;  1IJ6 A;  4C90 A;  3ZJ1 A;  1IBM T;  3Q5W A;  1T7S A;  2XM2 A;  3OYZ A;  3MK7 C;  4AQY T;  3FB2 A;  3KV9 A;  2EHO A;  5FY7 A;  2DI4 A;  2DLR A;  1H7C A;  1T8B A;  1OED C;  4ZI3 D;  4I50 E;  3TLS A;  5LHG B;  4IE0 A;  3ABV A;  4U2Z A;  3J7Y q;  4DV7 T;  4B3S T;  2CM0 A;  3O1J A;  5FY1 A;  4HEA A;  3UU8 A;  3MZK B;  1UK5 A;  4P09 A;  5AQR B;  4NXN T;  1I94 T;  3VKH A;  2N9D A;  2FJB A;  4XZC A;  4EZ4 A;  4IL9 A;  3NVO A;  1V9D A;  1ZOY A;  5AQU B;  5FVK A;  2JMK A;  3CIR A;  3QOF A;  4TNV A;  5FXZ A;  1XMQ T;  4KMC A;  2M6B A;  5CGM A;  2KWH A;  3FZL B;  1B7T A;  4U33 A;  1BR0 A;  3QC9 A;  3OTO T;  5FKY A;  2CA5 A;  1J5W A;  1HG2 A;  3JAE A;  3PUY F;  5CA1 E;  3QUJ A;  4DR4 T;  4IE6 A;  4ZOL E;  2KLQ A;  4PFP A;  3CX8 B;  1N36 T;  3OJA A;  2UUB T;  1IZN B;  2WCA A;  2J1D G;  5AQG B;  4B3R T;  2A9U A;  4XBF B;  2V6Y A;  4GOU A;  2HH7 A;  3RIU A;  2CXF A;  2ZM6 T;  4U7Y A;  2A3D A;  3ANW A;  3M3Z B;  5C8Y E;  4DR2 T;  3ZT6 A;  2EHO C;  2LT3 A;  4IT4 A;  3ZST A;  2A72 A;  3SS1 A;  3X1D A;  3O9X A;  5LGN B;  4X64 T;  3V5S A;  3FZK B;  4MHC A;  3OYX A;  4OYJ A;  1Z8U A;  2X0Y A;  4QH1 A;  1J5E T;  1WLX A;  2FUP A;  4JEU B;  3PUZ F;  2NOX A;  2OV9 A;  2DWG A;  4KHZ F;  3SOL A;  4EZH A;  3DJB A;  4AQG A;  2Q9Q C;  2BG9 E;  4KUM B;  3EI0 A;  3LBX A;  5AQV B;  5JRC A;  4TWH A;  1N32 T;  1YQ4 A;  5IYZ E;  4U3C A;  3CKD A;  5ABH A;  2L8K A;  2JPF A;  4IHJ E;  4U74 A;  2PJQ A;  2VQE T;  5ABF A;  2Z6E A;  1E7P A;  4X20 E;  1IJ5 A;  1LRZ A;  4DV4 T;  2IC9 A;  2WS3 A;  2AXD S;  3ZC1 A;  1YXR A;  4H9Q C;  4UIG A;  5FMN A;  2WU5 A;  2ZM2 A;  3DP7 A;  4MBQ A;  2UXX B;  5LMN T;  3QNU A;  4P1N A;  2HN2 A;  2UXD T;  4QXB B;  4JI4 T;  5JQG E;  3I9Y A;  5C2T A;  2V6X A;  2QGS A;  2VKD A;  5F5W A;  1HR0 T;  1SUM B;  5LNK A;  4ZI2 D;  5CB4 E;  1KF6 A;  2H7V C;  2YOE A;  4U72 A;  4GIW A;  2LKH A;  2ODU A;  3AEB A;  4TZ4 C;  4UVA B;  4CI1 B;  5H6R B;  1DU2 A;  4H9O C;  4G63 A;  4EV6 A;  4LFC T;  2XTL A;  5AQF B;  1OED E;  4NUU A;  4YHJ A;  4GK0 E;  4DR3 T;  3HI2 A;  3UFE A;  4DR6 T;  4TV8 E;  5EK2 A;  4F8H A;  1S35 A;  2RA1 A;  3CQX C;  4J2C A;  2MBG A;  1JNR A;  1S94 A;  1YKE B;  5J2U E;  2YK0 A;  5AQH B;  5JRC B;  1MIY A;  4PK5 A;  5GON E;  3UQ4 A;  3ZMV B;  3L3P A;  4HWI B;  1IBK T;  4EXT A;  2ES0 A;  2D5U A;  4HFE A;  1D0X A;  1MIW A;  1MNE A;  2BKO A;  1N33 T;  1W0B A;  4HFC A;  2DL1 A;  3ONL C;  5AQK B;  2WBL A;  2EHO D;  2ODV A;  4AIS A;  4CI3 B;  5AQS B;  2X51 A;  5JDN A;  1MMG A;  2VKO A;  3AEE A;  4O2B E;  2LSI A;  3P4P A;  5AQL B;  4DBR A;  3C98 B;  2CPT A;  4TN7 B;  2W2U A;  3HA4 A;  2BBH A;  2X66 A;  3AE1 A;  3AB3 B;  4IDQ A;  3AXJ A;  4PJJ A;  1HCI A;  2XQ7 A;  4I43 B;  3TLV A;  4BAY B;  5LGU B;  3OPC A;  1XDP A;  4E7Z A;  4NIQ A;  4IST A;  2A2F X;  1HX1 B;  4HFV A;  3RIA A;  2NP9 A;  3AAA B;  2CWO A;  2CEA A;  5HWX A;  4YHH T;  2E9X C;  5HXC A;  1E1H B;  4DV2 T;  2VKH A;  1JNZ A;  4M1P A;  4ADZ A;  2D0U A;  3QK6 A;  3UU3 A;  3E08 A;  3UFG A;  4H9N C;  3RH3 A;  2M6I A;  3PDY A;  3RQU A;  5AQJ B;  5KDM C;  1NAF A;  3AA7 B;  1QSD A;  2XY8 B;  4K0K T;  1LVF A;  2D0T A;  2I59 A;  2KXP B;  3C4W A;  3RRW A;  4JI7 T;  2J47 A;  3K8P C;  4AKG A;  2KT9 A;  2I0M A;  1SE7 A;  4UXN B;  3PUX F;  2VAS A;  4FJO A;  3UTK A;  3ZSS A;  2WM9 A;  4ZI2 C;  1IBL T;  4AKI A;  3AE8 A;  3NZP A;  3PUW F;  5L4E A;  3RC3 A;  4LF7 T;  2XAJ B;  1VCT A;  3PE0 A;  5ABG A;  3EDU A;  4PNI A;  2CMR A;  4DR5 T;  4IRE A;  2NTX A;  3KBU A;  5FP3 A;  1KNR A;  3KVB A;  4CZZ B;  2X9X A;  4P0A A;  4DID B;  5L3D B;  1XNR T;  2CLY C;  4I55 E;  2WZH A;  2H89 A;  4ZI3 C;  3RHW A;  3PUA A;  4HKA A;  3ZT5 A;  3FXD B;  3UUN A;  4CN6 A;  2MPK A;  3VR8 A;  5ABF B;  5F3J A;  5JDL A;  3RRC A;  3TKL B;  4ERR A;  4Z90 A;  3QB5 A;  1FIO A;  4ILC A;  1UX5 A;  4H63 V;  4TX5 A;  3PUS A;  1R8I A;  2JMH A;  1VCS A;  3EAB A;  1BR2 A;  3E0Z A;  5JRE A;  4WBN E;  2V7K A;  4DV5 T;  1KNP A;  1W9R A;  4JLE A;  2HN1 A;  1WR0 A;  2LEH A;  2XQ5 A;  2WMO A;  3C51 A;  3H37 A;  2NWB A;  4L0R A;  4BJM A;  5LGT B;  1D1C A;  2W0G A;  4KHP T;  5HYA A;  4HGA A;  1CUN A;  2CHN A;  1D1B A;  2BKP A;  3ZYK A;  2UUC T;  2JJ9 A;  2OLT A;  2UU9 T;  2CRB A;  4UF0 A;  4GYR A;  3BQL A;  4F6R C;  5L3B B;  1U4Q A;  1ZEE A;  2LHN A;  2QRX A;  2V7L A;  2XAH B;  3C64 A;  5AQT B;  3ZKR A;  4AIU A;  4FI5 A;  1Y01 A;  1O3X A;  2XM1 A;  4AQF A;  2L9Q A;  2V1D B;  2XJ7 A;  3BQK A;  3A8Y C;  3ONX A;  3KFW X;  3ZLI A;  3I1A A;  2YU1 A;  3PV0 F;  4GYS A;  4HFH A;  2KND A;  2V6Y B;  5LBQ B;  4JI2 T;  3RPU A;  2IIU A;  2YDS A;  3WAJ A;  3A7M A;  4PJM A;  3K1S A;  2YDR A;  2BKN A;  4YJ3 E;  3ZYM A;  4X65 T;  4C91 A;  3N9Q A;  4HE8 A;  1NWM X;  2BVM A;  2VQF T;  5J0Z A;  3PU8 A;  2ZM0 A;  3V5U A;  4DUY T;  2MTQ A;  4LFB T;  3RF1 A;  3PUV F;  5FL0 A;  3MXZ A;  3IHR A;  4UR9 A;  3HL6 A;  5CA0 E;  5LHH B;  4HWC A;  3ONJ A;  5FL1 A;  3LK3 B;  4ILB A;  2LSK A;  3KV4 A;  3AA0 B;  4UV9 B;  3RIU C;  3U78 A;  2XQ9 A;  2IAK A;  4PJL A;  4QX7 B;  4CXW A;  2NR4 A;  2NTY A;  4L9I A;  4QXC B;  3VRB A;  5J1G A;  2JQQ A;  1OWA A;  1HNZ T;  2WAU A;  3LG7 A;  3N2G E;  5IHY A;  2JQ9 A;  4PW8 A;  1MND A;  2LHR A;  5AQP B;  3ZMS B;  3JC6 C;  4CN4 A;  2GK9 A;  3KDS E;  3FZH B;  2DWK A;  4HFD A;  3BK9 A;  5LA6 E;  2WZI A;  5EK4 A;  2P9B A;  3AE3 A;  4ANJ A;  4DND A;  3AAI A;  2C5I T;  4BA9 A;  4EOZ B;  2K24 A;  5ADX L;  2VVS A;  1HNW T;  2FJE A;  3ZMT B;  2V5D A;  3C4X A;  5HEO A;  3ZT7 A;  3RYH E;  3ZN1 B;  2LM2 A;  2X9W A;  2L3L A;  5DQV A;  3SFD A;  5BMV E;  5FVL A;  1KNZ A;  4A5X A;  5HAX A;  3AXJ B;  4AI6 A;  2JQK A;  5LOV E;  4YSX A;  5L47 A;  3Q9D A;  2KSR A;  4IE4 A;  5JVD E;  1UUR A;  3AED A;  2HHH T;  3ANW B;  3OKQ A;  3ZCI A;  1X79 A;  2Y6X A;  4U2Y A;  4H9P C;  2LOS A;  4JI3 T;  4X66 T;  5HXR A;  3FXE B;  3KVA A;  3KV6 A;  1KEY A;  4IDZ A;  2E9X A;  5DAB A;  2FJD A;  4E7S A;  2JRK A;  3TLT A;  5L2L A;  4U7I A;  1SHZ C;  2V26 A;  5L3F B;  3RC8 A;  3PTR B;  4ILU A;  2LKG A;  5LG4 A;  4JI0 T;  2RPA A;  4QH4 A;  3P50 A;  2YIN A;  3UU6 A;  4WZX A;  2IC6 A;  1NEK A;  2ZLY A;  3UUL A;  1ZV4 X;  4OYK A;  3AE7 A;  5A1L A;  3OBV E;  2BG9 B;  1I6Z A;  5FY0 A;  1WCR A;  1M7K A;  3KIN B;  4WNK A;  3B13 A;  5LBM A;  3TLU A;  4LML A;  2WU2 A;  3N5L A;  4MLK A;  5L3G B;  4TWD A;  2XHE B;  2UUA T;  2F4V T;  4DR1 T;  5AQQ B;  4OFZ A;  4BJN A;  3LK2 B;  3WI3 A;  1XZY A;  5HEG A;  2WY2 A;  2X68 A;  3CPZ A;  4UEL A;  4EYY R;  2E2A A;  2DHR A;  2Q9Q A;  5ETW A;  1FMV A;  3AEC A;  1D0Z A;  4O4H E;  3P7I A;  4DR7 T;  3LK4 2;  3R6N A;  2R6G F;  3MAC A;  4YXD A;  1MMA A;  3I0Q A;  4H9S E;  4LMJ A;  4UVB B;  5L4H A;  1QUU A;  3ETV A;  1U5P A;  1XWM A;  3GN5 A;  4X1K E;  3M65 A;  3P4S A;  3UU4 A;  4ZZB A;  4JYA T;  2CXL A;  4LFA T;  4HWH A;  5FYM A;  1XDO A;  3VR9 A;  4DMV A;  1XMO T;  3NRX A;  4EGW A;  2XSA A;  4CI2 B;  4LF8 T;  5KX5 E;  3IBP A;  3O1H A;  3LSV A;  3RYI E;  2CE7 A;  3N2K E;  1UUS A;  2YKS A;  4B6X A;  3AEG A;  4CXY A;  2IML A;  3K3N A;  3LBX B;  2K48 A;  1IAP A;  1US7 B;  2K5B B;  4X1Y E;  2V7I A;  3I9W A;  3SRZ A;  3KV5 A;  2VB6 A;  3O4X E;  1M62 A;  3JCF A;  4JI8 T;  5DJQ C;  4DO0 A;  1EZ3 A;  2YN6 A;  1FJG T;  2CLY B;  5JTG A;  3HR0 A;  2C0S A;  3CX6 B;  3HKD E;  4O4J E;  4COF A;  2WMN A;  2H3R A;  3L09 A;  2CBJ A;  3AVS A;  3UUX B;  1N34 T;  3GA8 A;  3ZMZ B;  4Q25 A;  1Z0P A;  2Y48 B;  4P0B A;  5L3C B;  2DCF A;  2LRK A;  2LOP A;  2HPL A;  2WWV A;  2V7M A;  2XQ6 A;  2W61 A;  3PUQ A;  4IL4 A;  1WRD A;  2Y8D A;  4TNW A;  4EB6 E;  5FXV A;  2J62 A;  3AAE B;  3IEE A;  4YTM A;  5CJ5 A;  4JI1 T;  3ZMU B;  2KMF A;  3AA1 B;  3AEF A;  3AVR A;  4ASK A;  4ZZC A;  4DV0 T;  3IF8 B;  2WWU A;  1W09 A;  2LJL A;  2W67 A;  5HEH A;  4I4T E;  2C5J A;  4A97 A;  3RKG A;  2WDQ A;  1J1J A;  2B1E A;  4GK5 E;  4U31 A;  3CQG B;  2N1G A;  2YEV C;  4A56 A;  1UX4 A;  2IDO B;  4PJN A;  3AA6 B;  1HFA A;  3EUH A;  4QHO A;  2M67 A;  2E5V A;  2X9H A;  2CBI A;  3H3A A;  4O4L E;  2PG8 A;  3GWH A;  4ZHQ E;  2XQ3 A;  4ZS3 A;  3P8C D;  3GN5 B; 
#chains in the Genus database with same CATH homology
 2V7J A;  4IGU A;  3RYF E;  2WSS V;  2BZB A;  2K9A A;  3VKG A;  4AKL A;  3J9X 1;  2BDE A;  2Q9Q B;  2XUE A;  3O1I A;  4TUY E;  3MKD A;  4IE5 A;  4WBO A;  2IW5 B;  3N2O A;  2PBI A;  5E0O A;  2MOZ A;  1KK7 A;  1D0Y A;  4G2A A;  3ESL A;  4O2A E;  3WAK A;  3UUM A;  5HXH A;  4AXP A;  2CCQ A;  3CX7 B;  2MYS A;  2VK9 A;  4QWN B;  3S4U A;  3T8O A;  4V1A v;  1UCU A;  3MJX A;  3KBT A;  3ZPO A;  5LHI B;  1Y64 B;  4CXX A;  2X9Y A;  2RP4 A;  2ZMA A;  3E22 E;  1YKH B;  4H9R C;  2H7O A;  1HTJ F;  3LFM A;  4JEH B;  1WR6 A;  2PFV A;  5LP6 E;  2LSG A;  2D2S A;  3CML A;  2EHO B;  2XAF B;  1WYC A;  4O4I E;  2YU2 A;  3ZJ2 A;  4Z8X A;  4QKN A;  3U3I A;  3J7Y q;  3ZC0 A;  3K3O A;  4ZI7 E;  1VRB A;  3HKE E;  5EZY E;  4KP3 C;  2LSJ A;  4EIW A;  4EYU A;  5JDF A;  4NUV A;  3UT5 E;  3MA9 A;  2X0L B;  4IIJ E;  5TAO A;  3F57 A;  2W00 A;  3F2E A;  3N9M A;  4AKR B;  4MAL A;  4YLH A;  3ZCJ A;  3W15 B;  3K3Q C;  3B57 A;  4L5G A;  4UEM A;  4DBQ A;  1HX8 A;  2KWI B;  4O8S A;  3VU7 H;  1WYB A;  5DQW A;  2W63 A;  5JR9 B;  3ETU A;  2KZ7 B;  5JH7 E;  3GMI A;  3NBX X;  5LCY A;  4TV9 E;  3NRY A;  4YJ2 E;  2VKJ A;  3C50 A;  3PUR A;  2LE8 A;  3ZYL A;  4YFS A;  2SPC A;  1YD8 G;  4JUY A;  3ZN0 B;  3VHL A;  5FNV E;  4AKH A;  2Q9Q D;  3HKB E;  4PAG A;  4PK6 A;  5JDH A;  4EOZ B;  2XQY A;  1SA0 E;  4N78 D;  4UF0 B;  4HN9 A;  5L3E B;  1G8X A;  5M4Y A;  5JDG A;  5LXT E;  4PFO A;  3EVY A;  3LJC A;  1YW0 A;  3RYC E;  1LVK A;  3NZQ A;  3Q5X A;  4EAH A;  5J2T E;  2W62 A;  5KMG P;  2LM9 A;  1MMN A;  2G0U A;  1MMD A;  3SWH A;  4WW0 A;  5EK3 A;  2NW9 A;  3HKC E;  4AQF C;  2VWA A;  5LJN A;  4UV8 B;  2XAQ B;  3FHN A;  1OXZ A;  4OK0 A;  4QXH B;  5HWY A;  2DNX A;  5JDM A;  1T98 A;  1HG5 A;  2XAS B;  2E9X D;  1D1A A;  2NW7 A;  3DTO A;  4H63 H;  2ZM8 A;  1FMW A;  3FBL A;  2OA5 A;  1BR1 A;  3ZEF B;  2X67 A;  2HPJ A;  3RKO A;  2XAG B;  3N9P A;  5JDQ A;  3EDV A;  3JC6 D;  4ZS2 A;  5H6Q B;  2LSY A;  5FXW A;  3R84 B;  3I0O A;  1BR4 A;  4K0U A;  2UXN B;  3C4Z A;  3Q2M A;  1FEW A;  3BQI A;  2CWY A;  5HXE A;  5F8P A;  2BVL A;  4X1I E;  5LJM A;  2N2N A;  4HTE A;  3A5X A;  3CWZ B;  2C5K T;  4DMW A;  1AJ3 A;  2NW8 A;  1ZHC A;  4QX8 B;  2E9X B;  3CVR A;  4XAX B;  4DVD A;  3D0T A;  4OHF A;  5JR9 A;  1G73 A;  3FBZ A;  1VOM A;  1MIV A;  1LKX A;  3PUG A;  4ISS A;  3CQC B;  2KIN B;  2VL8 A;  4PK4 A;  4MFR A;  3PU3 A;  2CXD A;  3N9L A;  3N9N A;  1HF8 A;  3N9O A;  4UVC B;  3RX6 A;  4KBM B;  2QA7 A;  5JR9 C;  4IE7 A;  4CQI A;  1ZKE A;  2ACX A;  3F31 A;  2E8I A;  5FXX A;  5HXS A;  1IJ6 A;  4C90 A;  3ZJ1 A;  3Q5W A;  3OYZ A;  3MK7 C;  3FB2 A;  3KV9 A;  2EHO A;  5FY7 A;  2DI4 A;  2DLR A;  1H7C A;  4ZI3 D;  4I50 E;  5LHG B;  4IE0 A;  2CM0 A;  3O1J A;  5FY1 A;  4HEA A;  3MZK B;  4P09 A;  3VKH A;  2N9D A;  4XZC A;  4EZ4 A;  1V9D A;  5FXZ A;  2JMK A;  4KMC A;  1BR0 A;  2KWH A;  1B7T A;  3QC9 A;  2CA5 A;  1HG2 A;  3QUJ A;  4IE6 A;  4ZOL E;  2KLQ A;  4PFP A;  3CX8 B;  3OJA A;  1IZN B;  2J1D G;  4XBF B;  4GOU A;  2HH7 A;  2CXF A;  2A3D A;  3ANW A;  5C8Y E;  2EHO C;  2LT3 A;  2A72 A;  3SS1 A;  3O9X A;  5LGN B;  3V5S A;  4MHC A;  3OYX A;  4OYJ A;  1WLX A;  4JEU B;  4EZH A;  3SOL A;  2DWG A;  2NOX A;  3DJB A;  4AQG A;  2Q9Q C;  4KUM B;  5JRC A;  3LBX A;  5IYZ E;  3CKD A;  2L8K A;  2JPF A;  4IHJ E;  4U74 A;  2PJQ A;  2Z6E A;  4X20 E;  1IJ5 A;  1LRZ A;  2IC9 A;  3ZC1 A;  4H9Q C;  4UIG A;  5FMN A;  2ZM2 A;  3DP7 A;  4MBQ A;  2UXX B;  4QXB B;  5JQG E;  3I9Y A;  2QGS A;  2VKD A;  5LNK A;  4ZI2 D;  5CB4 E;  2H7V C;  4U72 A;  4GIW A;  4TZ4 C;  2ODU A;  4UVA B;  4CI1 B;  5H6R B;  4H9O C;  4G63 A;  2XTL A;  4NUU A;  4YHJ A;  4GK0 E;  3HI2 A;  3UFE A;  4TV8 E;  5EK2 A;  1S35 A;  2RA1 A;  3CQX C;  4J2C A;  2MBG A;  5J2U E;  1S94 A;  1YKE B;  2YK0 A;  5JRC B;  1MIY A;  4PK5 A;  5GON E;  3ZMV B;  3L3P A;  4EXT A;  2ES0 A;  2D5U A;  1D0X A;  1MIW A;  1MNE A;  2WBL A;  2EHO D;  2ODV A;  4CI3 B;  2X51 A;  5JDN A;  1MMG A;  2VKO A;  4O2B E;  4DBR A;  2LSI A;  3C98 B;  4TN7 B;  3HA4 A;  2X66 A;  3AB3 B;  5LGU B;  4PJJ A;  1HCI A;  4I43 B;  4BAY B;  4E7Z A;  4IST A;  2A2F X;  4HFV A;  2NP9 A;  3AAA B;  2CWO A;  2CEA A;  5HWX A;  2E9X C;  5HXC A;  1E1H B;  2VKH A;  4M1P A;  4ADZ A;  2D0U A;  3QK6 A;  3E08 A;  4H9N C;  3RH3 A;  3PDY A;  5KDM C;  1NAF A;  3AA7 B;  1QSD A;  1LVF A;  2D0T A;  2I59 A;  2KXP B;  3C4W A;  3RRW A;  3K8P C;  4AKG A;  2KT9 A;  4UXN B;  2VAS A;  4FJO A;  3UTK A;  2WM9 A;  4ZI2 C;  4AKI A;  3NZP A;  3RC3 A;  2XAJ B;  3PE0 A;  3EDU A;  4PNI A;  2CMR A;  5FP3 A;  2NTX A;  3KBU A;  4P0A A;  3KVB A;  4CZZ B;  2X9X A;  5L3D B;  2CLY C;  4I55 E;  4ZI3 C;  3PUA A;  4HKA A;  3FXD B;  3UUN A;  5JDL A;  3RRC A;  3TKL B;  4ERR A;  1FIO A;  1UX5 A;  4H63 V;  4TX5 A;  3PUS A;  2JMH A;  5JRE A;  1BR2 A;  3E0Z A;  4WBN E;  2V7K A;  4JLE A;  2LEH A;  3C51 A;  2WMO A;  3H37 A;  4BJM A;  2NWB A;  4L0R A;  5LGT B;  1D1C A;  2W0G A;  5HYA A;  4HGA A;  1CUN A;  1D1B A;  3ZYK A;  2JJ9 A;  1HS7 A;  4UF0 A;  4GYR A;  3BQL A;  4F6R C;  5L3B B;  1U4Q A;  1ZEE A;  2LHN A;  2XAH B;  2V7L A;  3C64 A;  5AFU L;  4FI5 A;  4AQF A;  1O3X A;  5LYJ E;  2L9Q A;  2V1D B;  3ONX A;  3BQK A;  5CA1 E;  3ZLI A;  3KFW X;  5L3G B;  3I1A A;  2YU1 A;  4GYS A;  5LBQ B;  2KND A;  3WAJ A;  3RPU A;  4PJM A;  4YJ3 E;  3ZYM A;  4C91 A;  3N9Q A;  4HE8 A;  1NWM X;  2BVM A;  3PU8 A;  2ZM0 A;  3V5U A;  2MTQ A;  5CA0 E;  3MXZ A;  3IHR A;  5LHH B;  3HL6 A;  3LK3 B;  5F3J A;  2LSK A;  3KV4 A;  3AA0 B;  4UV9 B;  3U78 A;  4CXW A;  2IAK A;  4PJL A;  4QX7 B;  2NTY A;  4L9I A;  4QXC B;  5J1G A;  2JQQ A;  1OWA A;  2WAU A;  3LG7 A;  3N2G E;  5IHY A;  4PW8 A;  1MND A;  2LHR A;  3ZMS B;  3JC6 C;  2GK9 A;  3KDS E;  2DWK A;  5LA6 E;  3BK9 A;  4ANJ A;  4DND A;  5EK4 A;  2P9B A;  3AAI A;  2C5I T;  4BA9 A;  2K24 A;  5ADX L;  3ZMT B;  3C4X A;  3RYH E;  3ZN1 B;  2X9W A;  1KNZ A;  2L3L A;  5DQV A;  5BMV E;  4AI6 A;  5HAX A;  5LOV E;  3RC8 A;  3Q9D A;  4IE4 A;  5JVD E;  3ANW B;  3OKQ A;  3ZCI A;  1X79 A;  2Y6X A;  4H9P C;  2LOS A;  5HXR A;  3FXE B;  3KVA A;  3KV6 A;  4IDZ A;  5DAB A;  2E9X A;  4E7S A;  2JRK A;  5L2L A;  1SHZ C;  2V26 A;  5L3F B;  3PTR B;  4ILU A;  5LG4 A;  2YIN A;  2ZLY A;  2IC6 A;  3UUL A;  1ZV4 X;  4OYK A;  5A1L A;  3OBV E;  5FY0 A;  3KIN B;  4WNK A;  3B13 A;  5LBM A;  4MLK A;  3N5L A;  2XHE B;  4OFZ A;  4BJN A;  3LK2 B;  3WI3 A;  2X68 A;  3CPZ A;  4UEL A;  4EYY R;  2DHR A;  2Q9Q A;  5ETW A;  1FMV A;  4O4H E;  1D0Z A;  3P7I A;  3LK4 2;  3R6N A;  3MAC A;  1MMA A;  3I0Q A;  4H9S E;  4UVB B;  1QUU A;  3ETV A;  1U5P A;  3GN5 A;  4X1K E;  3M65 A;  2CXL A;  5FYM A;  4DMV A;  3NRX A;  4CI2 B;  5KX5 E;  3IBP A;  3O1H A;  3RYI E;  4B6X A;  2CE7 A;  3N2K E;  4CXY A;  3LBX B;  3K3N A;  4X1Y E;  2K48 A;  1IAP A;  1US7 B;  2K5B B;  2V7I A;  3I9W A;  3SRZ A;  3KV5 A;  2VB6 A;  3O4X E;  5DJQ C;  4DO0 A;  1EZ3 A;  2CLY B;  3HR0 A;  2C0S A;  3CX6 B;  3HKD E;  4O4J E;  2WMN A;  2H3R A;  3L09 A;  3UUX B;  3AVS A;  3GA8 A;  3ZMZ B;  1Z0P A;  2Y48 B;  4P0B A;  5L3C B;  2DCF A;  2LOP A;  2HPL A;  2V7M A;  2W61 A;  3PUQ A;  4EB6 E;  1WRD A;  2Y8D A;  5FXV A;  3AAE B;  3IEE A;  3ZMU B;  2KMF A;  3AA1 B;  3AVR A;  4ASK A;  3IF8 B;  2WWU A;  2LJL A;  4I4T E;  2C5J A;  4GK5 E;  2B1E A;  3CQG B;  2N1G A;  2YEV C;  4A56 A;  1UX4 A;  4PJN A;  3AA6 B;  1HFA A;  3EUH A;  4QHO A;  2M67 A;  2X9H A;  3H3A A;  4O4L E;  2PG8 A;  3GWH A;  4ZHQ E;  4ZS3 A;  3P8C D;  3GN5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...