5JREA

Crystal structure of nec3po in complex with ssdna.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
GSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
molecule keywords NEQ131
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jreA00
5JR9B 5JRCA 5JRCB 5JR9A 5JREA 3ZC1A 3ZC0A 5JR9C
chains in the Genus database with same CATH superfamily
3LK2B 2KINB 2XAJB 4UIGA 2WQYA 2PFVA 2I6HA 2YEVC 4H9SE 4G2AA 4X20E 4H63H 3SOLA 1D0YA 3EHZA 2XQ5A 1OXZA 4QXHB 3ZSSA 3AA7B 4DV4T 2JQQA 3S4UA 3N5LA 4PK6A 2XQ3A 4LF7T 5L3EB 1XMQT 4WZXA 3Q5WA 4HGAA 1BR4A 4YJ2E 2CBJA 4GK0E 2YINA 1WLXA 3GN5B 4PJLA 4AKIA 2X9XA 3KDSE 3UU8A 2CBIA 3PUSA 2B76A 2CLYC 4G63A 4MBQA 4QKNA 5HEGA 4TZ4C 1W0BA 5FXVA 5J1GA 4AISA 2VK9A 3MA9A 2JQ9A 3FHNA 4WBNE 2PG8A 2WM9A 3Q5EA 5J2UE 4IDQA 2VASA 1UX5A 1SHZC 1YXRA 3NVOA 4F6RC 2WZHA 2YKSA 2ZMAA 4EYUA 3UUXB 4ANJA 3N9OA 2DI4A 4AQFA 1N36T 4JI3T 1S35A 1ZV4X 4J2CA 4NXNT 2E9XD 4I43B 5HYAA 3ZN1B 4IE0A 2F4VT 2V7IA 2LSIA 4TWFA 4ASKA 3PJAJ 3OTOT 1FMWA 1QLBA 2CA5A 4HFEA 3UULA 3ZKRA 3UU6A 4B3TT 4X1YE 3ZJ1A 4EGWA 5LHIB 3VR8A 3B5MA 3ZMUB 1E7PA 4U72A 1IBLT 3RIFA 5LB7B 4TN7B 4A98A 1U4QA 4TWDA 2H88A 2V1DB 3RYCE 3ZMVB 4XAXB 1YQ4A 2C0SA 2X0YA 4JI4T 1Z8UA 3OBVE 3AA6B 1O3XA 1HNXT 4PJMA 4TUYE 1E1HB 2L3LA 5HEHA 3KVBA 3N2OA 4O4HE 2NW9A 5L3FB 4IL9A 1HCIA 2MYSA 3PUWF 5HAXA 1HR0T 1R8IA 1X79A 3FBLA 4KHZF 3WAKA 2MTQA 4U74A 3I9WA 5FYMA 2YN6A 5C3JA 3PV0F 1CHUA 4CI1B 4PAGA 3W15B 3F57A 3N9QA 2N2NA 2JJ9A 2VKDA 3H3AA 3N2KE 3PUAA 5FY1A 3RF1A 3RIUC 1HNWT 4L5GA 3I0OA 4O2BE 4ZZCA 4TX5A 1VCTA 2BG9E 5FKYA 3RYFE 2BS2A 3FXEB 2BS3A 5H6QB 4TWHA 1N32T 1BR0A 1LKXA 3ZSTA 1OWAA 4LF8T 4ZOLE 4LFBT 3H37A 2CWOA 3IBPA 5CA1E 4X66T 4IE6A 5F8PA 2Q9QD 2M6IA 4X62T 5LMUT 5JRCA 2KXPB 1QSDA 1T7SA 3QUJA 1SE7A 4NIQA 3RIUA 2UXBT 5JDHA 2IAKA 3Q5DA 3RKGA 5HXCA 4DO0A 5IWAT 3PDYA 3M3ZB 3BQLA 5AQJB 4PFOA 5LXTE 5J0ZA 2HHHT 3RC3A 3JC6C 4IDPA 2PTFA 4QX7B 3RC8A 3QNUA 5AQKB 3B57A 5LHHB 4JI0T 1KF6A 2K9AA 2XQ4A 3G06A 2QRXA 4P09A 4AKLA 3T1YT 2UUBT 2J62A 3KV4A 3FZFB 4HKAA 2XQ9A 1BR2A 4HWHA 4L9IA 4PK4A 4O8SA 5HEOA 2A3DA 3AVSA 1UUSA 1BR1A 2W67A 2WMNA 2YK0A 3CQGB 3BQIA 2FJDA 3IHRA 3ZYKA 5FXXA 3PU3A 1US7B 3FBZA 1B7TA 1YQ3A 5F3JA 2KSRA 4NUUA 5JQGE 2CM0A 5FVKA 3ANWA 1G73A 5FXZA 4ZI2C 1IJ5A 5M4YA 1EZ3A 2ZM8A 5KX5E 2HH7A 3LFMA 3T8OA 2UXDT 1YKEB 1Y64B 2LM9A 4H9NC 3CK6A 4UVCB 1UGOA 3VKHA 3K3OA 3C50A 4EEDA 4HFHA 4OFZA 4AQYT 2JQHA 3RRWA 4HFCA 4QH4A 1QUUA 4GOUA 5JDNA 4DR1T 2ZM6T 2CWYA 3NZPA 1Y01A 2M67A 3AE3A 4K0UA 2ZM0A 3SFEA 2BKOA 4EYYR 4LFAT 3D0TA 5HXEA 3Q5XA 2C5KT 2WMOA 4HTEA 3CX8B 3PUQA 4LFCT 2RPAA 4UEMA 4ZI3D 2X0LB 4MHCA 3I9YA 2D0TA 3JADA 4WW0A 4H63V 1WFDA 4IL4A 2VURA 3QC9A 3OPCA 4KUMB 4MALA 2H7OA 1HG5A 3UU3A 3ZPOA 5ADXL 4NPPA 3KV9A 3R84B 2UXXB 3Q2MA 1VCSA 4LMJA 3CWZB 5FL1A 2XM1A 2Y8DA 3ETVA 3LBXB 2MAWA 2KNDA 4UF0B 5J2TE 1UCUA 5LJNA 4QH1A 3AXJB 3ZN0B 1YW0A 3UQ4A 2WWUA 3J7Yq 2BDEA 4MFRA 3UTKA 5LBMA 5AQMB 1AJ3A 1Z0PA 2QYWA 2X66A 2MBGA 3MXZA 4YJ3E 3RI5A 2LHRA 4CN1A 4JEUB 2R6GF 2XQ8A 3C4ZA 2V7KA 3FB2A 4YLHA 2J4GA 3ZCJA 4AKGA 3AVRA 1IJ6A 4CN6A 4MLKA 2XM2A 5CB4E 5L3CB 4ILUA 5CGMA 2CLYB 3OVUA 3F2EA 1GQEA 3ONLC 5AQHB 3ZEFB 3EI0A 4DR4T 2AE9A 2XQYA 3UU5A 2JRKA 4DR2T 2CHOA 3AE2A 3O9XA 1J5ET 4GYSA 5LGNB 1W9RA 4KI0F 3SFDA 5AQQB 5AQFB 3RHWA 4IE4A 4X65T 4HFDA 4CXWA 2KLQA 3AXJA 1YKHB 3FZKB 3RYIE 5HWXA 1SA0E 1M62A 4V1Av 1IBKT 1MMDA 1X9BA 5FP3A 3KV6A 4DVDA 2E9XC 3U3IA 3EDVA 2V26A 3N9MA 3PJAA 4DV6T 3AEGA 2ZLYA 4KHPT 3L3PA 2V6XA 4ZZBA 2XASB 4EAHA 2H3RA 3AEAA 5CJ5A 3CX6B 3DTOA 3RYHE 3DJBA 3O1HA 4YSZA 1LRZA 2LSGA 2W0GA 3ABVA 4O2AE 4UR9A 2XPKA 5JDLA 3L39A 3CKDA 4E7ZA 5LYJE 2UUCT 4JV5T 4OX9T 3ZLIA 1N34T 2WY2A 2H89A 3FZMB 4DV7T 3EABA 4HWDA 5LBQB 4DR7T 4EOZB 3KFWX 2NWBA 2DWGA 3A5XA 3P4WA 4DUZT 2XAGB 2YOEA 3AEEA 3HKCE 2V7MA 4IE5A 2I0MA 2IC9A 3KBUA 3WI3A 4EEBA 1NENA 2VVNA 4KP3C 2WDVA 3NWIA 4JBWF 5BR8T 5FMNA 1XNRT 3UU4A 4H9PC 5IYZE 2XAHB 3UQ7A 2IIUA 2M6BA 5L4EA 2CXFA 4QWNB 1W09A 3EVYA 2EHOC 2WBLA 4OK0A 3PTRB 5JDMA 2XZEA 2KWHA 1I94T 3BK9A 1MIVA 3IEEA 2DL1A 5F5WA 4HE8A 3U78A 5ABEA 5FY7A 4LF6T 4O4JE 2LEHA 1NEKA 3GMIA 2VKOA 4N78D 2W4XA 3UT5E 3O4XE 2LJLA 2AXDS 2HPJA 2CPTA 2BVMA 1D1AA 4I55E 3VHLA 4AKHA 1XZYA 3RQWA 3AB3B 5LJMA 3RRCA 5JTGA 2NTXA 3SS1A 4YHHT 1UX4A 4H9OC 2NW8A 2XHEB 3C51A 5L2LA 3MK7C 3P4SA 2BG9C 3P8CD 4X64T 3A8YC 4X5TA 3FZHB 2BKNA 4B6XA 2W66A 3GA8A 4IDZA 3JAFA 5EZYE 2LSJA 2RP4A 5HXHA 4Z90A 4O4LE 1KNPA 3RKOA 3MACA 2LKHA 2X67A 2WB5A 5LGTB 4U33A 1OEDE 2VQET 2LRLA 3JC6D 4HFVA 5LNKA 4B3MT 3ESLA 5AQIB 2WAUA 4QXCB 2BKPA 1W0AA 5AQPB 3VRAA 3MZKB 4QX8B 3RGLA 2XY8B 1FJGT 3QOFA 5FNVE 1OEDA 4EIWA 1WCRA 4OYJA 3AAEB 2ODUA 5CFBA 3KINB 3ZT5A 2BG9A 3RPUA 3RQUA 2J47A 4DMWA 4YY3T 2VKJA 4AI6A 2K48A 4U3CA 4EZHA 2VL0A 2OLTA 4HFIA 2CHNA 2XAFB 2X9YA 1FEWA 1T98A 4U31A 4ZS3A 5HCMA 2ACXA 4KMCA 3C64A 2Q9QB 3AEFA 2L9QA 3LDQB 5LMNT 4DR6T 2RA1A 2VQFT 3AAAB 1J1JA 1T72A 4QH5A 2C5IT 3KV5A 1ZHCA 3OKQA 3TKLB 4I4TE 1D1BA 1ZEEA 2K3WA 2XUEA 4ISTA 3VU7H 2A72A 2GK9A 2HN1A 4ILBA 5BMVE 4B3ST 3LK3B 5KXJA 4YFSA 5JDGA 5ABFA 4JYAT 4DBQA 5FXWA 5DJQC 2UXNB 1HFAA 2D9DA 3CMLA 3K3QC 3OYXA 2G0UA 5L3GB 3RX6A 4CI2B 3VKGA 2Z6EA 4ERRA 2V6YA 2W63A 4ZI3C 3OYZA 3F31A 2LT3A 5EK4A 3KVAA 1HNZT 2NP9A 2DLRA 3PURA 4TNVA 2NR4A 3PUGA 2WU2A 4X1KE 3HR0A 5FL0A 4ZI7E 5LP6E 3SWHA 2Q9QA 4WNKA 4IIJE 2UXCT 4PJJA 4UVAB 2CCQA 2SPCA 3PUYF 3ZYMA 4CXXA 4BAYB 2YU2A 3O1IA 3N9NA 4WBOA 4EV6A 2BZBA 3ZC1A 5AFUL 5AQRB 3R6NA 5JR9C 4NXMT 4GKJT 1WRDA 4A56A 4HWIB 4O4IE 3CQXC 1HF8A 3E22E 5KDMC 2K5BB 2LKGA 4BJMA 1FIOA 4IHJE 4Q25A 4ZS2A 2ODVA 3ONJA 2ZM2A 4H9QC 2WWVA 2JMHA 1OEDC 2X51A 3C98B 5JVDE 3TLUA 4YT0A 5IUXA 2Q9QC 5HWYA 3GN5A 4C90A 4P1NA 4HWFA 1L0VA 2PJQA 2DCFA 5AQUB 1HX8A 3EDUA 1IAPA 2DHRA 4I0UA 1T8BA 4LF9T 1DU2A 3UUNA 2VKHA 3O1JA 1XMOT 4LMKA 5EK2A 2A2FX 4DR3T 1M7KA 4UVBB 3E08A 5C8YE 3IF8B 2IHR1 5E0OA 1FMVA 2IDOB 5JH7E 3LK42 4AQFC 4DV1T 4DV2T 2E9XA 3AE8A 3K1SA 5ETWA 3ZMTB 4GK5E 4HFBA 3TLWA 2LSYA 5JREA 4YTMA 5EK3A 3ZT6A 2NW7A 1XDOA 2BBJA 2P9BA 3NZQA 5AQOB 2UUAT 3AEBA 4JI5T 1H7CA 1HS7A 5AQNB 4B3RT 2IMLA 5DABA 3PUVF 3T1HT 4EB6E 4XBFB 1HTJF 3P4PA 5LHGB 2FJEA 1V9DA 1SUMB 2H7VC 2CMRA 5L3DB 3UFGA 3CPZA 2XQ6A 2EHOA 4KX6A 3ZCIA 1U5PA 3OJAA 4LMLA 5LG3A 3I1AA 4UV8B 4I50E 4E7SA 4LF4T 2XQAA 1YD8G 4YHJA 2BS4A 4CZZB 1MMAA 2YDSA 2YDQA 3C4XA 2LRKA 2X0HA 4CN4A 3AE9A 2W2UA 4U2YA 1HG2A 3H3MA 3Q9DA 2EHOB 4U2ZA 2QGSA 4P0AA 4ZHQE 1OEDB 4OHFA 4CQIA 2J1DG 2XTLA 3P50A 4UXNB 1S94A 2VWAA 3CVRA 4IGUA 5HCJA 4DV0T 4LF5T 4TV8E 1NWMX 2L8KA 4JI2T 4X1IE 5CA0E 4ILCA 4JI7T 2EHOD 1ZKEA 4QHOA 5JR9B 5HEJA 5H6RB 3AA1B 3RH3A 3HA4A 1IBMT 3LG7A 2OV9A 2LOPA 4YXDA 4YTPA 3V5UA 3ZYLA 4JI6T 2D5UA 3HKDE 3CIRA 2IW5B 2FUPA 1KFYA 1WR6A 2CXDA 2KMFA 3EAMA 3NBXX 2XJ7A 3PU8A 4U7IA 1HX1B 4HWCA 1ZOYA 5TAOA 2MOZA 2FJAA 3BQKA 5AQSB 3AECA 1MNEA 3VR9A 3RIAA 1JNRA 3HKBE 2N9DA 5FVLA 2WDQA 2K24A 5A1LA 1MMGA 5LOVE 2XSBA 2X68A 3VRBA 3ZT7A 4YTNA 3TLSA 2XSAA 4IE7A 2BVLA 2V5DA 5DQVA 4IDOA 3NRYA 4AQGA 3AE5A 5HXRA 4C91A 4QXBB 4A97A 3A7MA 4ZEYA 2W62A 4PNIA 5HEUA 2UU9T 1VOMA 3CX7B 3EUHA 4JEHB 4AXPA 1MMNA 4PK5A 4BJNA 4DR5T 2LE8A 3M65A 4Z8XA 4L0RA 2YDRA 3AE7A 3N9PA 2WS3A 3AE4A 4IT4A 5AQGB 4DV5T 3HL6A 1KNZA 3ONXA 3LBXA 2E9XB 4UF0A 5JDFA 4JI8T 3P4QA 4COFA 2CEAA 3N2GE 2DNXA 3B13A 4PW8A 5AQTB 4DNDA 3C4WA 4UELA 5FY0A 4GKKT 3TLTA 4FJOA 4TNWA 1MIWA 2LOSA 2XAQB 2JQKA 1LVKA 3AEDA 3P4RA 3AE1A 2NOXA 2CXLA 1G8XA 2CRBA 2XQ7A 4AIUA 5LGUB 4PJNA 2VB6A 2B1EA 3GWHA 5JDQA 3JCFA 3RLFF 3P7IA 1J5WA 2PBIA 2HN2A 4ADZA 2QVAA 1UK5A 1KNRA 1D0XA 2KZ7B 5HXSA 1E2AA 4JUYA 2WZIA 2IUBA 1MIYA 3LJCA 3QB5K 1NAFA 5C2TA 5L47A 1KK7A 2E8IA 1D1CA 1JNZA 4XZCA 5ABGA 2JIWA 3TLVA 4DIDB 4DMVA 5KMGP 2FBWA 2X9HA 2N1GA 2YU1A 3MKDA 3L09A 3NKZA 2Y48B 4HN9A 4M1PA 3X1DA 1I6ZA 3FXDB 3K3NA 1MNDA 4PFPA 5AQLB 2LM2A 4CI3B 3ZMSB 5LG4A 3E0ZA 3L8RA 2WCAA 4FI5A 2ACZA 4P0BA 2WP9A 2D2SA 3J9X1 2WSSV 4GIWA 4ISSA 2BBHA 2LSKA 3DP7A 4ILAA 1WYBA 2A9UA 2KT9A 3AAIA 1N33T 2HPLA 2QA7A 1WYCA 2D0UA 2BG9B 2C5JA 3NRXA 3V5SA 1XWMA 2Y6XA 3N9LA 2E5LT 2V6YB 4JLEA 5DQWA 2JMKA 2LHNA 4YSYA 4AKRB 2JPFA 4BA9A 4Z91A 2V5CA 4EZ4A 3KBTA 5LCYA 2W61A 4IDNA 2VVSA 4UV9B 2IC6A 3QK6A 3FZLB 1UURA 5ABFB 2OA5A 3PUXF 2E5VA 4H9RC 4TV9E 3IA3A 2KWIB 1IZNB 3HI2A 4ZI2D 1LVFA 3I0QA 4DBRA 1VRBA 5LA6E 3UFEA 3K8PC 3HKEE 3SRZA 5JRCB 3ZJ2A 5JR9A 4OYKA 2E2AA 2WDRA 4YSXA 4WYVA 3ZC0A 4IREA 5L4HA 4JI1T 3MJXA 4HEAA 4EXTA 1WR0A 2V7JA 3PE0A 2WU5A 2VL8A 2I59A 3CQCB 5AQVB 5ABHA 2ES0A 4GYRA 2LLYA 1XNQT 1XDPA 1CUNA 2V7LA 3UUMA 2DWKA 4ZXLA 2CE7A 4DV3T 3ETUA 2V8SV 3AA0B 3PUZF 5IHYA 3UUBA 5L3BB 1ZP0A 4K0KT 3JAEA 2NTYA 5GONE 4KBMB 3WAJA 4CXYA 2W00A 3QB5A 2MPKA 4NUVA 3ZMZB 1KEYA 2X9WA 3ANWB 3AE6A 4F8HA 3LSVA 4A5XA 4U7YA 1D0ZA 2FJBA 4DUYT
chains in the Genus database with same CATH topology
3LK2B 2KINB 2XAJB 4UIGA 2YEVC 2PFVA 4G2AA 4X20E 4H63H 3SOLA 1D0YA 4QXHB 1OXZA 3AA7B 2JQQA 3S4UA 3N5LA 4PK6A 5L3EB 3Q5WA 4HGAA 1BR4A 4YJ2E 4GK0E 2YINA 1WLXA 3GN5B 4PJLA 4AKIA 2X9XA 3KDSE 3PUSA 4G63A 2CLYC 4MBQA 4QKNA 4TZ4C 5FXVA 5J1GA 2VK9A 3MA9A 3FHNA 4WBNE 5J2UE 2PG8A 2WM9A 5LG4A 2VASA 1UX5A 1SHZC 4F6RC 4EYUA 2ZMAA 3UUXB 4ANJA 3N9OA 2DI4A 4AQFA 1S35A 1ZV4X 4J2CA 2E9XD 4I43B 5HYAA 3ZN1B 4IE0A 2V7IA 2LSIA 4ASKA 1FMWA 2CA5A 3UULA 4X1YE 3ZJ1A 5LHIB 3ZMUB 4U72A 4TN7B 1U4QA 3RYCE 2V1DB 3ZMVB 4XAXB 2C0SA 3OBVE 3AA6B 1O3XA 4PJMA 4TUYE 1E1HB 2L3LA 5L3FB 3KVBA 3N2OA 4O4HE 2NW9A 1HCIA 2MYSA 5HAXA 1X79A 3FBLA 3WAKA 2MTQA 4U74A 3I9WA 5FYMA 4CI1B 4PAGA 3W15B 3F57A 3N9QA 2N2NA 2JJ9A 2VKDA 3H3AA 3N2KE 3PUAA 4L5GA 3I0OA 4O2BE 4TX5A 3RYFE 5H6QB 3FXEB 1BR0A 1LKXA 1OWAA 4ZOLE 3H37A 2CWOA 3IBPA 5CA1E 4IE6A 5F8PA 2Q9QD 5JRCA 2KXPB 1QSDA 3QUJA 5JDHA 2IAKA 5HXCA 4DO0A 3PDYA 3BQLA 4PFOA 3RC3A 3JC6C 4QX7B 3RC8A 5LHHB 3B57A 2K9AA 4P09A 4AKLA 3KV4A 4HKAA 1BR2A 4L9IA 4PK4A 4O8SA 3AVSA 2A3DA 4H9SE 1BR1A 3CQGB 2WMNA 2YK0A 3IHRA 3BQIA 5JDFA 3ZYKA 5FXXA 3PU3A 1US7B 3FBZA 1B7TA 5F3JA 4NUUA 5JQGE 2CM0A 3ANWA 1G73A 5FXZA 4ZI2C 1IJ5A 5M4YA 1EZ3A 2ZM8A 5KX5E 2HH7A 3LFMA 3T8OA 1YKEB 1Y64B 2LM9A 4H9NC 4UVCB 3VKHA 3K3OA 3C50A 4OFZA 3RRWA 1QUUA 4GOUA 5JDNA 2CWYA 3NZPA 2M67A 4K0UA 2ZM0A 3D0TA 5HXEA 3Q5XA 2C5KT 2WMOA 4HTEA 3CX8B 3PUQA 4UEMA 4ZI3D 2X0LB 4MHCA 3I9YA 2D0TA 4WW0A 4H63V 3QC9A 4KUMB 4MALA 2H7OA 1HG5A 3ZPOA 5ADXL 3R84B 3KV9A 2UXXB 3Q2MA 3CWZB 2Y8DA 3ETVA 3LBXB 4UF0B 2KNDA 5J2TE 1UCUA 5LJNA 3ZN0B 1YW0A 2WWUA 3J7Yq 2BDEA 4MFRA 3UTKA 5LBMA 1AJ3A 1Z0PA 2X66A 2MBGA 3MXZA 4YJ3E 2LHRA 4JEUB 3C4ZA 2V7KA 3FB2A 4YLHA 3ZCJA 4AKGA 3AVRA 1IJ6A 4MLKA 5L3CB 5CB4E 4ILUA 2CLYB 3F2EA 3ZEFB 2XQYA 2JRKA 3O9XA 4GYSA 5LGNB 4IE4A 4CXWA 2KLQA 1YKHB 3RYIE 5HWXA 1SA0E 4V1Av 1MMDA 5FP3A 3KV6A 4DVDA 2E9XC 3U3IA 3EDVA 2V26A 3N9MA 2ZLYA 3L3PA 2XASB 4EAHA 2H3RA 3CX6B 3DTOA 3RYHE 3DJBA 3O1HA 1LRZA 2LSGA 2W0GA 5JDLA 4O2AE 5LYJE 3CKDA 4E7ZA 3ZLIA 5LBQB 4EOZB 3KFWX 2NWBA 2DWGA 3A5XA 2XAGB 4IE5A 3HKCE 2V7MA 3KBUA 2IC9A 3WI3A 4KP3C 5FMNA 4H9PC 5IYZE 2XAHB 2CXFA 4QWNB 3EVYA 2EHOC 2WBLA 4OK0A 3PTRB 5JDMA 2KWHA 3BK9A 1MIVA 3IEEA 4HE8A 3U78A 5FY7A 4O4JE 2LEHA 3GMIA 2VKOA 4N78D 3UT5E 3O4XE 2LJLA 4AKHA 2BVMA 2HPJA 4I55E 1D1AA 3VHLA 5LJMA 3AB3B 3RRCA 2NTXA 3SS1A 1UX4A 4H9OC 2NW8A 2XHEB 3C51A 5L2LA 3MK7C 3P8CD 4BJMA 4B6XA 3GA8A 4IDZA 5EZYE 2LSJA 2RP4A 5HXHA 3RKOA 4O4LE 5LGTB 3MACA 2X67A 3JC6D 4HFVA 5LNKA 3ESLA 2WAUA 4QXCB 3MZKB 4QX8B 5FNVE 4EIWA 4OYJA 3AAEB 2ODUA 3KINB 3RPUA 4DMWA 4AI6A 2VKJA 2K48A 4EZHA 4ZS3A 2XAFB 2X9YA 1FEWA 1T98A 2ACXA 4KMCA 3C64A 2Q9QB 2L9QA 2RA1A 3AAAB 2C5IT 3KV5A 1ZHCA 3OKQA 3TKLB 4I4TE 1D1BA 1ZEEA 2XUEA 4ISTA 3VU7H 2A72A 2GK9A 5BMVE 3LK3B 4YFSA 5JDGA 4DBQA 5FXWA 5DJQC 2UXNB 1HFAA 3CMLA 3OYXA 3K3QC 2G0UA 5L3GB 3RX6A 4CI2B 3VKGA 2Z6EA 4ERRA 2W63A 4ZI3C 3OYZA 3F31A 2LT3A 5EK4A 3KVAA 2NP9A 2DLRA 3PURA 3PUGA 4ZI7E 4X1KE 3HR0A 5LP6E 3SWHA 2Q9QA 4WNKA 4IIJE 4PJJA 4UVAB 2CCQA 2SPCA 3ZYMA 4CXXA 4BAYB 2YU2A 3O1IA 3N9NA 4WBOA 2BZBA 3ZC1A 5AFUL 3R6NA 5JR9C 1WRDA 4A56A 4O4IE 3CQXC 1HF8A 3E22E 5KDMC 2K5BB 1FIOA 4IHJE 4ZS2A 2ODVA 4H9QC 2ZM2A 2JMHA 2X51A 3C98B 5JVDE 2Q9QC 5HWYA 3GN5A 4C90A 2PJQA 2DCFA 1HX8A 3EDUA 1IAPA 2DHRA 3UUNA 2VKHA 3O1JA 5EK2A 2A2FX 4UVBB 3E08A 5C8YE 3IF8B 5E0OA 1FMVA 5JH7E 3LK42 4AQFC 2E9XA 5ETWA 3ZMTB 4GK5E 2LSYA 5JREA 5EK3A 2NW7A 3NZQA 2P9BA 1H7CA 1HS7A 5DABA 4EB6E 4XBFB 1HTJF 5LHGB 1V9DA 2H7VC 2CMRA 5L3DB 3CPZA 2EHOA 3ZCIA 1U5PA 3OJAA 3I1AA 4UV8B 4I50E 4E7SA 1YD8G 4YHJA 4CZZB 1MMAA 3C4XA 1HG2A 3Q9DA 2EHOB 2QGSA 4P0AA 4ZHQE 4OHFA 4CQIA 2J1DG 2XTLA 4UXNB 1S94A 2VWAA 3CVRA 4IGUA 4TV8E 1NWMX 2L8KA 5CA0E 4X1IE 2EHOD 1ZKEA 4QHOA 5JR9B 5H6RB 3AA1B 3RH3A 3HA4A 3LG7A 2LOPA 3V5UA 3ZYLA 2D5UA 3HKDE 2IW5B 1WR6A 2CXDA 2KMFA 3NBXX 3PU8A 5LXTE 5TAOA 2MOZA 3BQKA 1MNEA 3HKBE 2N9DA 2K24A 5A1LA 1MMGA 5LOVE 2X68A 4IE7A 5DQVA 2BVLA 4AQGA 4C91A 3NRYA 5HXRA 4QXBB 2W62A 4PNIA 1VOMA 3CX7B 3EUHA 4JEHB 4AXPA 1MMNA 4PK5A 4BJNA 2LE8A 3M65A 4Z8XA 4L0RA 3N9PA 3HL6A 1KNZA 3ONXA 3LBXA 2E9XB 4UF0A 4DNDA 2CEAA 3N2GE 2DNXA 3B13A 4PW8A 3C4WA 4UELA 5FY0A 4FJOA 1MIWA 2LOSA 2XAQB 1LVKA 2NOXA 2CXLA 1G8XA 5LGUB 4PJNA 2VB6A 2B1EA 3GWHA 5JDQA 3P7IA 2PBIA 4ADZA 2KZ7B 1D0XA 5HXSA 4JUYA 3LJCA 1MIYA 1NAFA 1KK7A 2E8IA 1D1CA 4XZCA 4DMVA 5KMGP 2X9HA 3MKDA 2N1GA 2YU1A 4M1PA 3L09A 4EYYR 2Y48B 4HN9A 3FXDB 3K3NA 1MNDA 4PFPA 4CI3B 3ZMSB 3E0ZA 4FI5A 4P0BA 3J9X1 2D2SA 2WSSV 4GIWA 4ISSA 2LSKA 3DP7A 1WYBA 2KT9A 3AAIA 2HPLA 2QA7A 1WYCA 2D0UA 2C5JA 3NRXA 3V5SA 2Y6XA 3N9LA 4JLEA 5DQWA 2JMKA 2LHNA 4AKRB 2JPFA 4BA9A 4EZ4A 3KBTA 5LCYA 2W61A 4UV9B 2IC6A 3QK6A 2OA5A 4H9RC 4TV9E 2KWIB 1IZNB 3HI2A 4ZI2D 1LVFA 3I0QA 4DBRA 1VRBA 5LA6E 3UFEA 3K8PC 3HKEE 3SRZA 5JRCB 3ZJ2A 5JR9A 4OYKA 3ZC0A 3MJXA 4HEAA 4EXTA 2V7JA 3PE0A 2VL8A 2I59A 3CQCB 2ES0A 4GYRA 1CUNA 2V7LA 3UUMA 2DWKA 2CE7A 3ETUA 3AA0B 5IHYA 5L3BB 2NTYA 5GONE 4KBMB 3WAJA 4CXYA 2W00A 4NUVA 3ZMZB 2X9WA 3ANWB 5FY1A 1D0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 B;  5JRC A;  5JRC B;  5JR9 A;  5JRE A;  3ZC1 A;  3ZC0 A;  5JR9 C; 
#chains in the Genus database with same CATH topology
 3LK2 B;  2KIN B;  2XAJ B;  4UIG A;  2WQY A;  2PFV A;  2I6H A;  2YEV C;  4H9S E;  4G2A A;  4X20 E;  4H63 H;  3SOL A;  1D0Y A;  3EHZ A;  2XQ5 A;  1OXZ A;  4QXH B;  3ZSS A;  3AA7 B;  4DV4 T;  2JQQ A;  3S4U A;  3N5L A;  4PK6 A;  2XQ3 A;  4LF7 T;  5L3E B;  1XMQ T;  4WZX A;  3Q5W A;  4HGA A;  1BR4 A;  4YJ2 E;  2CBJ A;  4GK0 E;  2YIN A;  1WLX A;  3GN5 B;  4PJL A;  4AKI A;  2X9X A;  3KDS E;  3UU8 A;  2CBI A;  3PUS A;  2B76 A;  2CLY C;  4G63 A;  4MBQ A;  4QKN A;  5HEG A;  4TZ4 C;  1W0B A;  5FXV A;  5J1G A;  4AIS A;  2VK9 A;  3MA9 A;  2JQ9 A;  3FHN A;  4WBN E;  2PG8 A;  2WM9 A;  3Q5E A;  5J2U E;  4IDQ A;  2VAS A;  1UX5 A;  1SHZ C;  1YXR A;  3NVO A;  4F6R C;  2WZH A;  2YKS A;  2ZMA A;  4EYU A;  3UUX B;  4ANJ A;  3N9O A;  2DI4 A;  4AQF A;  1N36 T;  4JI3 T;  1S35 A;  1ZV4 X;  4J2C A;  4NXN T;  2E9X D;  4I43 B;  5HYA A;  3ZN1 B;  4IE0 A;  2F4V T;  2V7I A;  2LSI A;  4TWF A;  4ASK A;  3PJA J;  3OTO T;  1FMW A;  1QLB A;  2CA5 A;  4HFE A;  3UUL A;  3ZKR A;  3UU6 A;  4B3T T;  4X1Y E;  3ZJ1 A;  4EGW A;  5LHI B;  3VR8 A;  3B5M A;  3ZMU B;  1E7P A;  4U72 A;  1IBL T;  3RIF A;  5LB7 B;  4TN7 B;  4A98 A;  1U4Q A;  4TWD A;  2H88 A;  2V1D B;  3RYC E;  3ZMV B;  4XAX B;  1YQ4 A;  2C0S A;  2X0Y A;  4JI4 T;  1Z8U A;  3OBV E;  3AA6 B;  1O3X A;  1HNX T;  4PJM A;  4TUY E;  1E1H B;  2L3L A;  5HEH A;  3KVB A;  3N2O A;  4O4H E;  2NW9 A;  5L3F B;  4IL9 A;  1HCI A;  2MYS A;  3PUW F;  5HAX A;  1HR0 T;  1R8I A;  1X79 A;  3FBL A;  4KHZ F;  3WAK A;  2MTQ A;  4U74 A;  3I9W A;  5FYM A;  2YN6 A;  5C3J A;  3PV0 F;  1CHU A;  4CI1 B;  4PAG A;  3W15 B;  3F57 A;  3N9Q A;  2N2N A;  2JJ9 A;  2VKD A;  3H3A A;  3N2K E;  3PUA A;  5FY1 A;  3RF1 A;  3RIU C;  1HNW T;  4L5G A;  3I0O A;  4O2B E;  4ZZC A;  4TX5 A;  1VCT A;  2BG9 E;  5FKY A;  3RYF E;  2BS2 A;  3FXE B;  2BS3 A;  5H6Q B;  4TWH A;  1N32 T;  1BR0 A;  1LKX A;  3ZST A;  1OWA A;  4LF8 T;  4ZOL E;  4LFB T;  3H37 A;  2CWO A;  3IBP A;  5CA1 E;  4X66 T;  4IE6 A;  5F8P A;  2Q9Q D;  2M6I A;  4X62 T;  5LMU T;  5JRC A;  2KXP B;  1QSD A;  1T7S A;  3QUJ A;  1SE7 A;  4NIQ A;  3RIU A;  2UXB T;  5JDH A;  2IAK A;  3Q5D A;  3RKG A;  5HXC A;  4DO0 A;  5IWA T;  3PDY A;  3M3Z B;  3BQL A;  5AQJ B;  4PFO A;  5LXT E;  5J0Z A;  2HHH T;  3RC3 A;  3JC6 C;  4IDP A;  2PTF A;  4QX7 B;  3RC8 A;  3QNU A;  5AQK B;  3B57 A;  5LHH B;  4JI0 T;  1KF6 A;  2K9A A;  2XQ4 A;  3G06 A;  2QRX A;  4P09 A;  4AKL A;  3T1Y T;  2UUB T;  2J62 A;  3KV4 A;  3FZF B;  4HKA A;  2XQ9 A;  1BR2 A;  4HWH A;  4L9I A;  4PK4 A;  4O8S A;  5HEO A;  2A3D A;  3AVS A;  1UUS A;  1BR1 A;  2W67 A;  2WMN A;  2YK0 A;  3CQG B;  3BQI A;  2FJD A;  3IHR A;  3ZYK A;  5FXX A;  3PU3 A;  1US7 B;  3FBZ A;  1B7T A;  1YQ3 A;  5F3J A;  2KSR A;  4NUU A;  5JQG E;  2CM0 A;  5FVK A;  3ANW A;  1G73 A;  5FXZ A;  4ZI2 C;  1IJ5 A;  5M4Y A;  1EZ3 A;  2ZM8 A;  5KX5 E;  2HH7 A;  3LFM A;  3T8O A;  2UXD T;  1YKE B;  1Y64 B;  2LM9 A;  4H9N C;  3CK6 A;  4UVC B;  1UGO A;  3VKH A;  3K3O A;  3C50 A;  4EED A;  4HFH A;  4OFZ A;  4AQY T;  2JQH A;  3RRW A;  4HFC A;  4QH4 A;  1QUU A;  4GOU A;  5JDN A;  4DR1 T;  2ZM6 T;  2CWY A;  3NZP A;  1Y01 A;  2M67 A;  3AE3 A;  4K0U A;  2ZM0 A;  3SFE A;  2BKO A;  4EYY R;  4LFA T;  3D0T A;  5HXE A;  3Q5X A;  2C5K T;  2WMO A;  4HTE A;  3CX8 B;  3PUQ A;  4LFC T;  2RPA A;  4UEM A;  4ZI3 D;  2X0L B;  4MHC A;  3I9Y A;  2D0T A;  3JAD A;  4WW0 A;  4H63 V;  1WFD A;  4IL4 A;  2VUR A;  3QC9 A;  3OPC A;  4KUM B;  4MAL A;  2H7O A;  1HG5 A;  3UU3 A;  3ZPO A;  5ADX L;  4NPP A;  3KV9 A;  3R84 B;  2UXX B;  3Q2M A;  1VCS A;  4LMJ A;  3CWZ B;  5FL1 A;  2XM1 A;  2Y8D A;  3ETV A;  3LBX B;  2MAW A;  2KND A;  4UF0 B;  5J2T E;  1UCU A;  5LJN A;  4QH1 A;  3AXJ B;  3ZN0 B;  1YW0 A;  3UQ4 A;  2WWU A;  3J7Y q;  2BDE A;  4MFR A;  3UTK A;  5LBM A;  5AQM B;  1AJ3 A;  1Z0P A;  2QYW A;  2X66 A;  2MBG A;  3MXZ A;  4YJ3 E;  3RI5 A;  2LHR A;  4CN1 A;  4JEU B;  2R6G F;  2XQ8 A;  3C4Z A;  2V7K A;  3FB2 A;  4YLH A;  2J4G A;  3ZCJ A;  4AKG A;  3AVR A;  1IJ6 A;  4CN6 A;  4MLK A;  2XM2 A;  5CB4 E;  5L3C B;  4ILU A;  5CGM A;  2CLY B;  3OVU A;  3F2E A;  1GQE A;  3ONL C;  5AQH B;  3ZEF B;  3EI0 A;  4DR4 T;  2AE9 A;  2XQY A;  3UU5 A;  2JRK A;  4DR2 T;  2CHO A;  3AE2 A;  3O9X A;  1J5E T;  4GYS A;  5LGN B;  1W9R A;  4KI0 F;  3SFD A;  5AQQ B;  5AQF B;  3RHW A;  4IE4 A;  4X65 T;  4HFD A;  4CXW A;  2KLQ A;  3AXJ A;  1YKH B;  3FZK B;  3RYI E;  5HWX A;  1SA0 E;  1M62 A;  4V1A v;  1IBK T;  1MMD A;  1X9B A;  5FP3 A;  3KV6 A;  4DVD A;  2E9X C;  3U3I A;  3EDV A;  2V26 A;  3N9M A;  3PJA A;  4DV6 T;  3AEG A;  2ZLY A;  4KHP T;  3L3P A;  2V6X A;  4ZZB A;  2XAS B;  4EAH A;  2H3R A;  3AEA A;  5CJ5 A;  3CX6 B;  3DTO A;  3RYH E;  3DJB A;  3O1H A;  4YSZ A;  1LRZ A;  2LSG A;  2W0G A;  3ABV A;  4O2A E;  4UR9 A;  2XPK A;  5JDL A;  3L39 A;  3CKD A;  4E7Z A;  5LYJ E;  2UUC T;  4JV5 T;  4OX9 T;  3ZLI A;  1N34 T;  2WY2 A;  2H89 A;  3FZM B;  4DV7 T;  3EAB A;  4HWD A;  5LBQ B;  4DR7 T;  4EOZ B;  3KFW X;  2NWB A;  2DWG A;  3A5X A;  3P4W A;  4DUZ T;  2XAG B;  2YOE A;  3AEE A;  3HKC E;  2V7M A;  4IE5 A;  2I0M A;  2IC9 A;  3KBU A;  3WI3 A;  4EEB A;  1NEN A;  2VVN A;  4KP3 C;  2WDV A;  3NWI A;  4JBW F;  5BR8 T;  5FMN A;  1XNR T;  3UU4 A;  4H9P C;  5IYZ E;  2XAH B;  3UQ7 A;  2IIU A;  2M6B A;  5L4E A;  2CXF A;  4QWN B;  1W09 A;  3EVY A;  2EHO C;  2WBL A;  4OK0 A;  3PTR B;  5JDM A;  2XZE A;  2KWH A;  1I94 T;  3BK9 A;  1MIV A;  3IEE A;  2DL1 A;  5F5W A;  4HE8 A;  3U78 A;  5ABE A;  5FY7 A;  4LF6 T;  4O4J E;  2LEH A;  1NEK A;  3GMI A;  2VKO A;  4N78 D;  2W4X A;  3UT5 E;  3O4X E;  2LJL A;  2AXD S;  2HPJ A;  2CPT A;  2BVM A;  1D1A A;  4I55 E;  3VHL A;  4AKH A;  1XZY A;  3RQW A;  3AB3 B;  5LJM A;  3RRC A;  5JTG A;  2NTX A;  3SS1 A;  4YHH T;  1UX4 A;  4H9O C;  2NW8 A;  2XHE B;  3C51 A;  5L2L A;  3MK7 C;  3P4S A;  2BG9 C;  3P8C D;  4X64 T;  3A8Y C;  4X5T A;  3FZH B;  2BKN A;  4B6X A;  2W66 A;  3GA8 A;  4IDZ A;  3JAF A;  5EZY E;  2LSJ A;  2RP4 A;  5HXH A;  4Z90 A;  4O4L E;  1KNP A;  3RKO A;  3MAC A;  2LKH A;  2X67 A;  2WB5 A;  5LGT B;  4U33 A;  1OED E;  2VQE T;  2LRL A;  3JC6 D;  4HFV A;  5LNK A;  4B3M T;  3ESL A;  5AQI B;  2WAU A;  4QXC B;  2BKP A;  1W0A A;  5AQP B;  3VRA A;  3MZK B;  4QX8 B;  3RGL A;  2XY8 B;  1FJG T;  3QOF A;  5FNV E;  1OED A;  4EIW A;  1WCR A;  4OYJ A;  3AAE B;  2ODU A;  5CFB A;  3KIN B;  3ZT5 A;  2BG9 A;  3RPU A;  3RQU A;  2J47 A;  4DMW A;  4YY3 T;  2VKJ A;  4AI6 A;  2K48 A;  4U3C A;  4EZH A;  2VL0 A;  2OLT A;  4HFI A;  2CHN A;  2XAF B;  2X9Y A;  1FEW A;  1T98 A;  4U31 A;  4ZS3 A;  5HCM A;  2ACX A;  4KMC A;  3C64 A;  2Q9Q B;  3AEF A;  2L9Q A;  3LDQ B;  5LMN T;  4DR6 T;  2RA1 A;  2VQF T;  3AAA B;  1J1J A;  1T72 A;  4QH5 A;  2C5I T;  3KV5 A;  1ZHC A;  3OKQ A;  3TKL B;  4I4T E;  1D1B A;  1ZEE A;  2K3W A;  2XUE A;  4IST A;  3VU7 H;  2A72 A;  2GK9 A;  2HN1 A;  4ILB A;  5BMV E;  4B3S T;  3LK3 B;  5KXJ A;  4YFS A;  5JDG A;  5ABF A;  4JYA T;  4DBQ A;  5FXW A;  5DJQ C;  2UXN B;  1HFA A;  2D9D A;  3CML A;  3K3Q C;  3OYX A;  2G0U A;  5L3G B;  3RX6 A;  4CI2 B;  3VKG A;  2Z6E A;  4ERR A;  2V6Y A;  2W63 A;  4ZI3 C;  3OYZ A;  3F31 A;  2LT3 A;  5EK4 A;  3KVA A;  1HNZ T;  2NP9 A;  2DLR A;  3PUR A;  4TNV A;  2NR4 A;  3PUG A;  2WU2 A;  4X1K E;  3HR0 A;  5FL0 A;  4ZI7 E;  5LP6 E;  3SWH A;  2Q9Q A;  4WNK A;  4IIJ E;  2UXC T;  4PJJ A;  4UVA B;  2CCQ A;  2SPC A;  3PUY F;  3ZYM A;  4CXX A;  4BAY B;  2YU2 A;  3O1I A;  3N9N A;  4WBO A;  4EV6 A;  2BZB A;  3ZC1 A;  5AFU L;  5AQR B;  3R6N A;  5JR9 C;  4NXM T;  4GKJ T;  1WRD A;  4A56 A;  4HWI B;  4O4I E;  3CQX C;  1HF8 A;  3E22 E;  5KDM C;  2K5B B;  2LKG A;  4BJM A;  1FIO A;  4IHJ E;  4Q25 A;  4ZS2 A;  2ODV A;  3ONJ A;  2ZM2 A;  4H9Q C;  2WWV A;  2JMH A;  1OED C;  2X51 A;  3C98 B;  5JVD E;  3TLU A;  4YT0 A;  5IUX A;  2Q9Q C;  5HWY A;  3GN5 A;  4C90 A;  4P1N A;  4HWF A;  1L0V A;  2PJQ A;  2DCF A;  5AQU B;  1HX8 A;  3EDU A;  1IAP A;  2DHR A;  4I0U A;  1T8B A;  4LF9 T;  1DU2 A;  3UUN A;  2VKH A;  3O1J A;  1XMO T;  4LMK A;  5EK2 A;  2A2F X;  4DR3 T;  1M7K A;  4UVB B;  3E08 A;  5C8Y E;  3IF8 B;  2IHR 1;  5E0O A;  1FMV A;  2IDO B;  5JH7 E;  3LK4 2;  4AQF C;  4DV1 T;  4DV2 T;  2E9X A;  3AE8 A;  3K1S A;  5ETW A;  3ZMT B;  4GK5 E;  4HFB A;  3TLW A;  2LSY A;  5JRE A;  4YTM A;  5EK3 A;  3ZT6 A;  2NW7 A;  1XDO A;  2BBJ A;  2P9B A;  3NZQ A;  5AQO B;  2UUA T;  3AEB A;  4JI5 T;  1H7C A;  1HS7 A;  5AQN B;  4B3R T;  2IML A;  5DAB A;  3PUV F;  3T1H T;  4EB6 E;  4XBF B;  1HTJ F;  3P4P A;  5LHG B;  2FJE A;  1V9D A;  1SUM B;  2H7V C;  2CMR A;  5L3D B;  3UFG A;  3CPZ A;  2XQ6 A;  2EHO A;  4KX6 A;  3ZCI A;  1U5P A;  3OJA A;  4LML A;  5LG3 A;  3I1A A;  4UV8 B;  4I50 E;  4E7S A;  4LF4 T;  2XQA A;  1YD8 G;  4YHJ A;  2BS4 A;  4CZZ B;  1MMA A;  2YDS A;  2YDQ A;  3C4X A;  2LRK A;  2X0H A;  4CN4 A;  3AE9 A;  2W2U A;  4U2Y A;  1HG2 A;  3H3M A;  3Q9D A;  2EHO B;  4U2Z A;  2QGS A;  4P0A A;  4ZHQ E;  1OED B;  4OHF A;  4CQI A;  2J1D G;  2XTL A;  3P50 A;  4UXN B;  1S94 A;  2VWA A;  3CVR A;  4IGU A;  5HCJ A;  4DV0 T;  4LF5 T;  4TV8 E;  1NWM X;  2L8K A;  4JI2 T;  4X1I E;  5CA0 E;  4ILC A;  4JI7 T;  2EHO D;  1ZKE A;  4QHO A;  5JR9 B;  5HEJ A;  5H6R B;  3AA1 B;  3RH3 A;  3HA4 A;  1IBM T;  3LG7 A;  2OV9 A;  2LOP A;  4YXD A;  4YTP A;  3V5U A;  3ZYL A;  4JI6 T;  2D5U A;  3HKD E;  3CIR A;  2IW5 B;  2FUP A;  1KFY A;  1WR6 A;  2CXD A;  2KMF A;  3EAM A;  3NBX X;  2XJ7 A;  3PU8 A;  4U7I A;  1HX1 B;  4HWC A;  1ZOY A;  5TAO A;  2MOZ A;  2FJA A;  3BQK A;  5AQS B;  3AEC A;  1MNE A;  3VR9 A;  3RIA A;  1JNR A;  3HKB E;  2N9D A;  5FVL A;  2WDQ A;  2K24 A;  5A1L A;  1MMG A;  5LOV E;  2XSB A;  2X68 A;  3VRB A;  3ZT7 A;  4YTN A;  3TLS A;  2XSA A;  4IE7 A;  2BVL A;  2V5D A;  5DQV A;  4IDO A;  3NRY A;  4AQG A;  3AE5 A;  5HXR A;  4C91 A;  4QXB B;  4A97 A;  3A7M A;  4ZEY A;  2W62 A;  4PNI A;  5HEU A;  2UU9 T;  1VOM A;  3CX7 B;  3EUH A;  4JEH B;  4AXP A;  1MMN A;  4PK5 A;  4BJN A;  4DR5 T;  2LE8 A;  3M65 A;  4Z8X A;  4L0R A;  2YDR A;  3AE7 A;  3N9P A;  2WS3 A;  3AE4 A;  4IT4 A;  5AQG B;  4DV5 T;  3HL6 A;  1KNZ A;  3ONX A;  3LBX A;  2E9X B;  4UF0 A;  5JDF A;  4JI8 T;  3P4Q A;  4COF A;  2CEA A;  3N2G E;  2DNX A;  3B13 A;  4PW8 A;  5AQT B;  4DND A;  3C4W A;  4UEL A;  5FY0 A;  4GKK T;  3TLT A;  4FJO A;  4TNW A;  1MIW A;  2LOS A;  2XAQ B;  2JQK A;  1LVK A;  3AED A;  3P4R A;  3AE1 A;  2NOX A;  2CXL A;  1G8X A;  2CRB A;  2XQ7 A;  4AIU A;  5LGU B;  4PJN A;  2VB6 A;  2B1E A;  3GWH A;  5JDQ A;  3JCF A;  3RLF F;  3P7I A;  1J5W A;  2PBI A;  2HN2 A;  4ADZ A;  2QVA A;  1UK5 A;  1KNR A;  1D0X A;  2KZ7 B;  5HXS A;  1E2A A;  4JUY A;  2WZI A;  2IUB A;  1MIY A;  3LJC A;  3QB5 K;  1NAF A;  5C2T A;  5L47 A;  1KK7 A;  2E8I A;  1D1C A;  1JNZ A;  4XZC A;  5ABG A;  2JIW A;  3TLV A;  4DID B;  4DMV A;  5KMG P;  2FBW A;  2X9H A;  2N1G A;  2YU1 A;  3MKD A;  3L09 A;  3NKZ A;  2Y48 B;  4HN9 A;  4M1P A;  3X1D A;  1I6Z A;  3FXD B;  3K3N A;  1MND A;  4PFP A;  5AQL B;  2LM2 A;  4CI3 B;  3ZMS B;  5LG4 A;  3E0Z A;  3L8R A;  2WCA A;  4FI5 A;  2ACZ A;  4P0B A;  2WP9 A;  2D2S A;  3J9X 1;  2WSS V;  4GIW A;  4ISS A;  2BBH A;  2LSK A;  3DP7 A;  4ILA A;  1WYB A;  2A9U A;  2KT9 A;  3AAI A;  1N33 T;  2HPL A;  2QA7 A;  1WYC A;  2D0U A;  2BG9 B;  2C5J A;  3NRX A;  3V5S A;  1XWM A;  2Y6X A;  3N9L A;  2E5L T;  2V6Y B;  4JLE A;  5DQW A;  2JMK A;  2LHN A;  4YSY A;  4AKR B;  2JPF A;  4BA9 A;  4Z91 A;  2V5C A;  4EZ4 A;  3KBT A;  5LCY A;  2W61 A;  4IDN A;  2VVS A;  4UV9 B;  2IC6 A;  3QK6 A;  3FZL B;  1UUR A;  5ABF B;  2OA5 A;  3PUX F;  2E5V A;  4H9R C;  4TV9 E;  3IA3 A;  2KWI B;  1IZN B;  3HI2 A;  4ZI2 D;  1LVF A;  3I0Q A;  4DBR A;  1VRB A;  5LA6 E;  3UFE A;  3K8P C;  3HKE E;  3SRZ A;  5JRC B;  3ZJ2 A;  5JR9 A;  4OYK A;  2E2A A;  2WDR A;  4YSX A;  4WYV A;  3ZC0 A;  4IRE A;  5L4H A;  4JI1 T;  3MJX A;  4HEA A;  4EXT A;  1WR0 A;  2V7J A;  3PE0 A;  2WU5 A;  2VL8 A;  2I59 A;  3CQC B;  5AQV B;  5ABH A;  2ES0 A;  4GYR A;  2LLY A;  1XNQ T;  1XDP A;  1CUN A;  2V7L A;  3UUM A;  2DWK A;  4ZXL A;  2CE7 A;  4DV3 T;  3ETU A;  2V8S V;  3AA0 B;  3PUZ F;  5IHY A;  3UUB A;  5L3B B;  1ZP0 A;  4K0K T;  3JAE A;  2NTY A;  5GON E;  4KBM B;  3WAJ A;  4CXY A;  2W00 A;  3QB5 A;  2MPK A;  4NUV A;  3ZMZ B;  1KEY A;  2X9W A;  3ANW B;  3AE6 A;  4F8H A;  3LSV A;  4A5X A;  4U7Y A;  1D0Z A;  2FJB A;  4DUY T; 
#chains in the Genus database with same CATH homology
 3LK2 B;  2KIN B;  2XAJ B;  4UIG A;  2YEV C;  2PFV A;  4G2A A;  4X20 E;  4H63 H;  3SOL A;  1D0Y A;  4QXH B;  1OXZ A;  3AA7 B;  2JQQ A;  3S4U A;  3N5L A;  4PK6 A;  5L3E B;  3Q5W A;  4HGA A;  1BR4 A;  4YJ2 E;  4GK0 E;  2YIN A;  1WLX A;  3GN5 B;  4PJL A;  4AKI A;  2X9X A;  3KDS E;  3PUS A;  4G63 A;  2CLY C;  4MBQ A;  4QKN A;  4TZ4 C;  5FXV A;  5J1G A;  2VK9 A;  3MA9 A;  3FHN A;  4WBN E;  5J2U E;  2PG8 A;  2WM9 A;  5LG4 A;  2VAS A;  1UX5 A;  1SHZ C;  4F6R C;  4EYU A;  2ZMA A;  3UUX B;  4ANJ A;  3N9O A;  2DI4 A;  4AQF A;  1S35 A;  1ZV4 X;  4J2C A;  2E9X D;  4I43 B;  5HYA A;  3ZN1 B;  4IE0 A;  2V7I A;  2LSI A;  4ASK A;  1FMW A;  2CA5 A;  3UUL A;  4X1Y E;  3ZJ1 A;  5LHI B;  3ZMU B;  4U72 A;  4TN7 B;  1U4Q A;  3RYC E;  2V1D B;  3ZMV B;  4XAX B;  2C0S A;  3OBV E;  3AA6 B;  1O3X A;  4PJM A;  4TUY E;  1E1H B;  2L3L A;  5L3F B;  3KVB A;  3N2O A;  4O4H E;  2NW9 A;  1HCI A;  2MYS A;  5HAX A;  1X79 A;  3FBL A;  3WAK A;  2MTQ A;  4U74 A;  3I9W A;  5FYM A;  4CI1 B;  4PAG A;  3W15 B;  3F57 A;  3N9Q A;  2N2N A;  2JJ9 A;  2VKD A;  3H3A A;  3N2K E;  3PUA A;  4L5G A;  3I0O A;  4O2B E;  4TX5 A;  3RYF E;  5H6Q B;  3FXE B;  1BR0 A;  1LKX A;  1OWA A;  4ZOL E;  3H37 A;  2CWO A;  3IBP A;  5CA1 E;  4IE6 A;  5F8P A;  2Q9Q D;  5JRC A;  2KXP B;  1QSD A;  3QUJ A;  5JDH A;  2IAK A;  5HXC A;  4DO0 A;  3PDY A;  3BQL A;  4PFO A;  3RC3 A;  3JC6 C;  4QX7 B;  3RC8 A;  5LHH B;  3B57 A;  2K9A A;  4P09 A;  4AKL A;  3KV4 A;  4HKA A;  1BR2 A;  4L9I A;  4PK4 A;  4O8S A;  3AVS A;  2A3D A;  4H9S E;  1BR1 A;  3CQG B;  2WMN A;  2YK0 A;  3IHR A;  3BQI A;  5JDF A;  3ZYK A;  5FXX A;  3PU3 A;  1US7 B;  3FBZ A;  1B7T A;  5F3J A;  4NUU A;  5JQG E;  2CM0 A;  3ANW A;  1G73 A;  5FXZ A;  4ZI2 C;  1IJ5 A;  5M4Y A;  1EZ3 A;  2ZM8 A;  5KX5 E;  2HH7 A;  3LFM A;  3T8O A;  1YKE B;  1Y64 B;  2LM9 A;  4H9N C;  4UVC B;  3VKH A;  3K3O A;  3C50 A;  4OFZ A;  3RRW A;  1QUU A;  4GOU A;  5JDN A;  2CWY A;  3NZP A;  2M67 A;  4K0U A;  2ZM0 A;  3D0T A;  5HXE A;  3Q5X A;  2C5K T;  2WMO A;  4HTE A;  3CX8 B;  3PUQ A;  4UEM A;  4ZI3 D;  2X0L B;  4MHC A;  3I9Y A;  2D0T A;  4WW0 A;  4H63 V;  3QC9 A;  4KUM B;  4MAL A;  2H7O A;  1HG5 A;  3ZPO A;  5ADX L;  3R84 B;  3KV9 A;  2UXX B;  3Q2M A;  3CWZ B;  2Y8D A;  3ETV A;  3LBX B;  4UF0 B;  2KND A;  5J2T E;  1UCU A;  5LJN A;  3ZN0 B;  1YW0 A;  2WWU A;  3J7Y q;  2BDE A;  4MFR A;  3UTK A;  5LBM A;  1AJ3 A;  1Z0P A;  2X66 A;  2MBG A;  3MXZ A;  4YJ3 E;  2LHR A;  4JEU B;  3C4Z A;  2V7K A;  3FB2 A;  4YLH A;  3ZCJ A;  4AKG A;  3AVR A;  1IJ6 A;  4MLK A;  5L3C B;  5CB4 E;  4ILU A;  2CLY B;  3F2E A;  3ZEF B;  2XQY A;  2JRK A;  3O9X A;  4GYS A;  5LGN B;  4IE4 A;  4CXW A;  2KLQ A;  1YKH B;  3RYI E;  5HWX A;  1SA0 E;  4V1A v;  1MMD A;  5FP3 A;  3KV6 A;  4DVD A;  2E9X C;  3U3I A;  3EDV A;  2V26 A;  3N9M A;  2ZLY A;  3L3P A;  2XAS B;  4EAH A;  2H3R A;  3CX6 B;  3DTO A;  3RYH E;  3DJB A;  3O1H A;  1LRZ A;  2LSG A;  2W0G A;  5JDL A;  4O2A E;  5LYJ E;  3CKD A;  4E7Z A;  3ZLI A;  5LBQ B;  4EOZ B;  3KFW X;  2NWB A;  2DWG A;  3A5X A;  2XAG B;  4IE5 A;  3HKC E;  2V7M A;  3KBU A;  2IC9 A;  3WI3 A;  4KP3 C;  5FMN A;  4H9P C;  5IYZ E;  2XAH B;  2CXF A;  4QWN B;  3EVY A;  2EHO C;  2WBL A;  4OK0 A;  3PTR B;  5JDM A;  2KWH A;  3BK9 A;  1MIV A;  3IEE A;  4HE8 A;  3U78 A;  5FY7 A;  4O4J E;  2LEH A;  3GMI A;  2VKO A;  4N78 D;  3UT5 E;  3O4X E;  2LJL A;  4AKH A;  2BVM A;  2HPJ A;  4I55 E;  1D1A A;  3VHL A;  5LJM A;  3AB3 B;  3RRC A;  2NTX A;  3SS1 A;  1UX4 A;  4H9O C;  2NW8 A;  2XHE B;  3C51 A;  5L2L A;  3MK7 C;  3P8C D;  4BJM A;  4B6X A;  3GA8 A;  4IDZ A;  5EZY E;  2LSJ A;  2RP4 A;  5HXH A;  3RKO A;  4O4L E;  5LGT B;  3MAC A;  2X67 A;  3JC6 D;  4HFV A;  5LNK A;  3ESL A;  2WAU A;  4QXC B;  3MZK B;  4QX8 B;  5FNV E;  4EIW A;  4OYJ A;  3AAE B;  2ODU A;  3KIN B;  3RPU A;  4DMW A;  4AI6 A;  2VKJ A;  2K48 A;  4EZH A;  4ZS3 A;  2XAF B;  2X9Y A;  1FEW A;  1T98 A;  2ACX A;  4KMC A;  3C64 A;  2Q9Q B;  2L9Q A;  2RA1 A;  3AAA B;  2C5I T;  3KV5 A;  1ZHC A;  3OKQ A;  3TKL B;  4I4T E;  1D1B A;  1ZEE A;  2XUE A;  4IST A;  3VU7 H;  2A72 A;  2GK9 A;  5BMV E;  3LK3 B;  4YFS A;  5JDG A;  4DBQ A;  5FXW A;  5DJQ C;  2UXN B;  1HFA A;  3CML A;  3OYX A;  3K3Q C;  2G0U A;  5L3G B;  3RX6 A;  4CI2 B;  3VKG A;  2Z6E A;  4ERR A;  2W63 A;  4ZI3 C;  3OYZ A;  3F31 A;  2LT3 A;  5EK4 A;  3KVA A;  2NP9 A;  2DLR A;  3PUR A;  3PUG A;  4ZI7 E;  4X1K E;  3HR0 A;  5LP6 E;  3SWH A;  2Q9Q A;  4WNK A;  4IIJ E;  4PJJ A;  4UVA B;  2CCQ A;  2SPC A;  3ZYM A;  4CXX A;  4BAY B;  2YU2 A;  3O1I A;  3N9N A;  4WBO A;  2BZB A;  3ZC1 A;  5AFU L;  3R6N A;  5JR9 C;  1WRD A;  4A56 A;  4O4I E;  3CQX C;  1HF8 A;  3E22 E;  5KDM C;  2K5B B;  1FIO A;  4IHJ E;  4ZS2 A;  2ODV A;  4H9Q C;  2ZM2 A;  2JMH A;  2X51 A;  3C98 B;  5JVD E;  2Q9Q C;  5HWY A;  3GN5 A;  4C90 A;  2PJQ A;  2DCF A;  1HX8 A;  3EDU A;  1IAP A;  2DHR A;  3UUN A;  2VKH A;  3O1J A;  5EK2 A;  2A2F X;  4UVB B;  3E08 A;  5C8Y E;  3IF8 B;  5E0O A;  1FMV A;  5JH7 E;  3LK4 2;  4AQF C;  2E9X A;  5ETW A;  3ZMT B;  4GK5 E;  2LSY A;  5JRE A;  5EK3 A;  2NW7 A;  3NZQ A;  2P9B A;  1H7C A;  1HS7 A;  5DAB A;  4EB6 E;  4XBF B;  1HTJ F;  5LHG B;  1V9D A;  2H7V C;  2CMR A;  5L3D B;  3CPZ A;  2EHO A;  3ZCI A;  1U5P A;  3OJA A;  3I1A A;  4UV8 B;  4I50 E;  4E7S A;  1YD8 G;  4YHJ A;  4CZZ B;  1MMA A;  3C4X A;  1HG2 A;  3Q9D A;  2EHO B;  2QGS A;  4P0A A;  4ZHQ E;  4OHF A;  4CQI A;  2J1D G;  2XTL A;  4UXN B;  1S94 A;  2VWA A;  3CVR A;  4IGU A;  4TV8 E;  1NWM X;  2L8K A;  5CA0 E;  4X1I E;  2EHO D;  1ZKE A;  4QHO A;  5JR9 B;  5H6R B;  3AA1 B;  3RH3 A;  3HA4 A;  3LG7 A;  2LOP A;  3V5U A;  3ZYL A;  2D5U A;  3HKD E;  2IW5 B;  1WR6 A;  2CXD A;  2KMF A;  3NBX X;  3PU8 A;  5LXT E;  5TAO A;  2MOZ A;  3BQK A;  1MNE A;  3HKB E;  2N9D A;  2K24 A;  5A1L A;  1MMG A;  5LOV E;  2X68 A;  4IE7 A;  5DQV A;  2BVL A;  4AQG A;  4C91 A;  3NRY A;  5HXR A;  4QXB B;  2W62 A;  4PNI A;  1VOM A;  3CX7 B;  3EUH A;  4JEH B;  4AXP A;  1MMN A;  4PK5 A;  4BJN A;  2LE8 A;  3M65 A;  4Z8X A;  4L0R A;  3N9P A;  3HL6 A;  1KNZ A;  3ONX A;  3LBX A;  2E9X B;  4UF0 A;  4DND A;  2CEA A;  3N2G E;  2DNX A;  3B13 A;  4PW8 A;  3C4W A;  4UEL A;  5FY0 A;  4FJO A;  1MIW A;  2LOS A;  2XAQ B;  1LVK A;  2NOX A;  2CXL A;  1G8X A;  5LGU B;  4PJN A;  2VB6 A;  2B1E A;  3GWH A;  5JDQ A;  3P7I A;  2PBI A;  4ADZ A;  2KZ7 B;  1D0X A;  5HXS A;  4JUY A;  3LJC A;  1MIY A;  1NAF A;  1KK7 A;  2E8I A;  1D1C A;  4XZC A;  4DMV A;  5KMG P;  2X9H A;  3MKD A;  2N1G A;  2YU1 A;  4M1P A;  3L09 A;  4EYY R;  2Y48 B;  4HN9 A;  3FXD B;  3K3N A;  1MND A;  4PFP A;  4CI3 B;  3ZMS B;  3E0Z A;  4FI5 A;  4P0B A;  3J9X 1;  2D2S A;  2WSS V;  4GIW A;  4ISS A;  2LSK A;  3DP7 A;  1WYB A;  2KT9 A;  3AAI A;  2HPL A;  2QA7 A;  1WYC A;  2D0U A;  2C5J A;  3NRX A;  3V5S A;  2Y6X A;  3N9L A;  4JLE A;  5DQW A;  2JMK A;  2LHN A;  4AKR B;  2JPF A;  4BA9 A;  4EZ4 A;  3KBT A;  5LCY A;  2W61 A;  4UV9 B;  2IC6 A;  3QK6 A;  2OA5 A;  4H9R C;  4TV9 E;  2KWI B;  1IZN B;  3HI2 A;  4ZI2 D;  1LVF A;  3I0Q A;  4DBR A;  1VRB A;  5LA6 E;  3UFE A;  3K8P C;  3HKE E;  3SRZ A;  5JRC B;  3ZJ2 A;  5JR9 A;  4OYK A;  3ZC0 A;  3MJX A;  4HEA A;  4EXT A;  2V7J A;  3PE0 A;  2VL8 A;  2I59 A;  3CQC B;  2ES0 A;  4GYR A;  1CUN A;  2V7L A;  3UUM A;  2DWK A;  2CE7 A;  3ETU A;  3AA0 B;  5IHY A;  5L3B B;  2NTY A;  5GON E;  4KBM B;  3WAJ A;  4CXY A;  2W00 A;  4NUV A;  3ZMZ B;  2X9W A;  3ANW B;  5FY1 A;  1D0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...