5JREA

Crystal structure of nec3po in complex with ssdna.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
GSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jreA00
5JREA 3ZC0A 3ZC1A 5JRCB 5JRCA 5JR9B 5JR9A 5JR9C
chains in the Genus database with same CATH superfamily
3C4ZA 2BG9A 4U7IA 1HTJF 3CVRA 4MHCA 4YSYA 3V5SA 4JI1T 3AEBA 2V7IA 4DV5T 5JTGA 4PFOA 4OYKA 5LJNA 4AXPA 1FEWA 3AE2A 5F8PA 3AEFA 2DNXA 3V5UA 4AIUA 4IDNA 3N9LA 2X9WA 3FHNA 2Y48B 4PJMA 2LSKA 1LVFA 3KDSE 2X66A 3P4SA 3NZQA 4OFZA 2VVNA 3ABVA 1FIOA 5LYJE 3JCFA 5HXCA 5FL1A 2EHOB 2KINB 4PW8A 2YU1A 3U78A 4DR2T 2CE7A 5E0OA 2XAJB 2WM9A 4JUYA 1YD8G 2BDEA 3RGLA 3I9YA 3R6NA 2X9XA 4WBOA 1IBLT 3UULA 5AQMB 3LBXB 5KXJA 4IL9A 4YT0A 4ILUA 3PUSA 2XQ9A 3Q5DA 3M3ZB 1MMGA 1Z0PA 3GMIA 2B1EA 2KNDA 2BG9C 4ZS2A 2X9HA 3L8RA 3AB3B 5FYMA 1IBMT 4UF0A 4TUYE 2E9XA 4B3ST 2ACXA 4QX8B 2V5DA 2CBJA 3MJXA 2ES0A 1VRBA 3KBTA 5LB7B 3TKLB 4NIQA 3N9NA 3F2EA 3C51A 5C2TA 3CX7B 2FJDA 2K48A 4AISA 2MAWA 5J2TE 4HTEA 3ZT6A 4EAHA 3AXJB 2E9XD 5L3BB 4JI0T 3KFWX 2E5LT 3N9QA 3AEAA 2AXDS 5LGUB 1UUSA 1M62A 4TN7B 3J9X1 2XAHB 2UXBT 3SOLA 3T1HT 2LOSA 1WR6A 2IUBA 2IW5B 1GQEA 4CXYA 3PU3A 1V9DA 3ZC0A 4LMJA 1XNQT 5A1LA 4CXWA 2UUBT 5JRCA 3AE9A 2C5JA 3MXZA 1W0AA 3PJAJ 3M65A 4JI5T 4DNDA 3HKEE 4C91A 3U3IA 5IWAT 2E9XC 1D1AA 4HEAA 2V8SV 1OWAA 4DV6T 3Q5XA 5JDHA 4JI6T 2SPCA 3I0OA 2WDQA 1HG5A 2I6HA 3AA1B 2LHRA 2V7JA 2KSRA 3HI2A 2BS2A 2WDVA 2BKOA 5FXZA 5JR9A 4EV6A 3E0ZA 3MKDA 2BKPA 5HXHA 2W66A 3ZYMA 4QWNB 4DV7T 5ETWA 4GK0E 3VKGA 1SA0E 5AQLB 4HFEA 5LA6E 2P9BA 1N33T 2OA5A 2VKHA 1MMNA 4LFCT 2YDQA 3P8CD 5LBQB 3JADA 3Q2MA 5AQIB 2Z6EA 4X1YE 4X5TA 5JDQA 5L4EA 3ZCIA 2ZM0A 3RHWA 1KNPA 1HF8A 3RF1A 2WMOA 3NBXX 2AE9A 4QH4A 3TLUA 4WBNE 2BBJA 3AAAB 3LK3B 2VKDA 5BMVE 4UV9B 5HWYA 1ZHCA 4EEDA 2PTFA 4E7ZA 2V7LA 4H9QC 4YLHA 2X0LB 4TV9E 4CI2B 2EHOA 3EHZA 5HEOA 2WAUA 3HL6A 4DIDB 5C3JA 1ZOYA 2NW8A 5JDFA 5ABFB 4Z90A 5JQGE 3FZMB 2PJQA 3LBXA 4PJJA 4H63H 1VOMA 2NR4A 5JR9C 5LG3A 3P50A 4JEUB 4TNWA 5FMNA 3RQUA 3P4PA 3OKQA 2XM2A 3I0QA 4TZ4C 1UGOA 3LK42 5IHYA 1HG2A 3PDYA 5FY1A 1EZ3A 2QGSA 2W61A 1SHZC 3OBVE 3KV9A 4QXBB 4DO0A 3RKOA 3SFDA 4HFBA 4CN1A 3Q5EA 2YDRA 4DR1T 3TLWA 4DV1T 3K3OA 3AECA 5LHIB 2D0UA 4ZI2D 3RLFF 5LXTE 1E1HB 2IDOB 3C4WA 3ZSSA 2LSJA 4V1Av 1US7B 2BVLA 3ZPOA 3AXJA 2NWBA 2DLRA 2J47A 3A5XA 4WZXA 3L3PA 5AQTB 2EHOC 2CHOA 4TWFA 2UXCT 4UR9A 4GKKT 4A98A 4HWDA 2PFVA 2JQKA 3AE8A 3GWHA 1MNDA 3NRYA 4HWHA 3CK6A 4U2YA 3UFEA 4ZEYA 2XSAA 1HR0T 3RIFA 4YHJA 3AE7A 4A56A 1UX4A 4B3TT 2VKJA 3LJCA 2N9DA 4G2AA 4HFDA 2HPLA 4BJMA 4P1NA 1WYBA 1YQ3A 4DMWA 5L3FB 4OYJA 5AQFB 4O4HE 5AQVB 4ILBA 2KWIB 3ZMTB 1OXZA 2V7MA 4YTMA 1HNWT 3QB5A 1CUNA 3FZLB 4XZCA 3QC9A 5FXVA 2D9DA 1T98A 1YKEB 2KLQA 2YOEA 3T8OA 4JI2T 3VKHA 4JV5T 1BR0A 3CKDA 1Z8UA 3NVOA 3RIUA 3N2GE 4IREA 2YU2A 3WAJA 4KMCA 3ONXA 2XHEB 2CM0A 5FXWA 2WBLA 4X64T 1WYCA 2VASA 3BQIA 3CIRA 2LM9A 4GYSA 3UUBA 2K3WA 1HX1B 2VURA 3VU7H 1HX8A 3PUAA 3UUXB 5HEGA 4JI8T 1X9BA 2I0MA 3PURA 2XY8B 4B3RT 3BQLA 5LCYA 2WWUA 5M4YA 3P7IA 3K1SA 3RYFE 2WCAA 2HN2A 3PUGA 5JREA 1WCRA 4QH5A 2XASB 3NKZA 3LG7A 2FJEA 2VK9A 2XTLA 3RYIE 1E7PA 4J2CA 2Y6XA 5ABFA 4ZI3C 2VQFT 4NXMT 4WW0A 3HA4A 4P09A 1XDOA 3X1DA 4IE6A 3IHRA 4LMLA 1MNEA 2MYSA 4I4TE 3ESLA 1YXRA 5LGNB 3HR0A 1BR1A 5CFBA 4O4LE 3FXDB 2G0UA 4IDZA 1W9RA 3RIUC 1HNXT 4HN9A 3RPUA 1X79A 1T7SA 3CQGB 2W4XA 3OPCA 3FZHB 3TLTA 1G8XA 4ANJA 3T1YT 4ZOLE 2W63A 4EB6E 5HXSA 4HFVA 2VVSA 4PJNA 1R8IA 5AQHB 4LFAT 2QA7A 2WP9A 3LSVA 2CXLA 4L0RA 3RX6A 3ANWB 3KINB 5H6QB 4TV8E 2E2AA 1WR0A 4ZI7E 1YKHB 2V1DB 4FI5A 5HXRA 5ABEA 3AE3A 4IHJE 5IYZE 4E7SA 2A72A 2FJAA 1S35A 1S94A 2WQYA 3N9MA 4PJLA 1T72A 4OX9T 4LFBT 2YEVC 2CEAA 5AFUL 2LOPA 2H7VC 1U4QA 5LJMA 3EI0A 3AVRA 4Z91A 2CWOA 1LVKA 3KV5A 3EDVA 4I0UA 2V6XA 1N36T 3PE0A 4JLEA 4HWIB 3ZN0B 4EOZB 2A2FX 4JI4T 4LMKA 4F6RC 2VKOA 3D0TA 5AQKB 4P0BA 2W62A 3KVAA 3RI5A 2CA5A 2BBHA 2BZBA 4JYAT 4OHFA 3RC8A 1E2AA 3EAMA 2ZM2A 4DR7T 1D1CA 1XZYA 4A97A 3EDUA 2LSIA 2NW9A 3RH3A 5BR8T 1XNRT 1O3XA 2FBWA 4X1KE 5DABA 3L09A 3MA9A 1MMDA 4NXNT 5F5WA 2YKSA 5HAXA 2LKGA 2IC6A 5LOVE 1ZP0A 2WU5A 4DV0T 2JMHA 4B6XA 1ZV4X 1J5WA 2CMRA 3OYXA 2BG9E 5KDMC 3HKBE 4NUVA 1AJ3A 5JH7E 4A5XA 2JMKA 2X51A 1KF6A 4OK0A 1UURA 3A8YC 5J1GA 2CLYB 3ETUA 2L9QA 2LKHA 2JIWA 3SWHA 1W0BA 2BS4A 4WNKA 2LRKA 4H9OC 4H9RC 4AKHA 4ISSA 3BQKA 5LHGB 2VQET 3QK6A 4I55E 3GA8A 2JRKA 1MIYA 2WSSV 5LMNT 4IDQA 4JBWF 4IE5A 5AQNB 5CGMA 4UVAB 2VB6A 4EXTA 3OVUA 3FBLA 4GK5E 3PUQA 3ZSTA 1VCSA 3E08A 3AA6B 5HCMA 4UVBB 1L0VA 5DJQC 2FJBA 3RRCA 3DTOA 3VRAA 4TX5A 3ZLIA 3N2KE 4PNIA 2V6YB 2K9AA 4DV3T 1LKXA 5EZYE 2IIUA 2D5UA 3ANWA 3Q9DA 5L3CB 2BG9B 4CN6A 2C5IT 4O4IE 2IC9A 4QX7B 4YFSA 3MK7C 4TWDA 4QXCB 1I6ZA 3R84B 2WY2A 4AKIA 3AEEA 5H6RB 3OTOT 3P4QA 3QOFA 2H89A 3PUZF 3DP7A 2XQ3A 2HH7A 2JPFA 2EHOD 2UUCT 2XJ7A 1HNZT 4NUUA 5FVLA 1VCTA 5JDLA 5LHHB 2W2UA 4UXNB 3H37A 2LRLA 4IIJE 4IE7A 3IBPA 4DVDA 2ZM8A 1KFYA 2ZLYA 3DJBA 4HFHA 1M7KA 5LGTB 3KVBA 1XMOT 5AQJB 2YK0A 3ZT5A 3C4XA 2A3DA 4H63V 3UQ7A 5ADXL 1J1JA 3O1IA 4ERRA 4C90A 2LM2A 5CB4E 4PK4A 3LFMA 3PTRB 4KUMB 2XSBA 1B7TA 1MMAA 2LT3A 2M6IA 2A9UA 4M1PA 4U3CA 2M67A 4I43B 4KHZF 1N34T 2MOZA 4EZHA 3ZMUB 4ASKA 2UU9T 4AQYT 1FMWA 4MALA 5JVDE 1BR2A 2QVAA 3WAKA 1KEYA 3N2OA 2UUAT 1OEDE 2JQHA 3BK9A 2DHRA 4HFIA 3RRWA 3HKCE 5HCJA 4H9SE 2DCFA 3LDQB 4MBQA 5IUXA 4ILCA 2QRXA 2DL1A 2J4GA 4KX6A 3SRZA 1IJ5A 4KHPT 2HN1A 3ZCJA 2N2NA 4CN4A 4O2BE 5FNVE 3SS1A 2NOXA 1D0YA 1JNRA 2BS3A 1BR4A 5FXXA 3N9PA 5ABHA 4DBRA 5L4HA 2LSYA 2J1DG 2Q9QB 3CMLA 2RA1A 3C64A 3P4WA 4JI7T 4O8SA 4ZHQE 4YSXA 3AE5A 2BVMA 3IA3A 2R6GF 4IGUA 5JRCB 4DR5T 4U74A 3AEGA 4GKJT 2W67A 4ZI3D 4CI3B 2W00A 2CPTA 5DQWA 3ONLC 2V26A 2CXFA 4DR6T 1D0ZA 1XMQT 2L8KA 1G73A 4H9PC 3ONJA 2UXXB 2X0HA 3VR8A 3ZKRA 4YHHT 2VWAA 4HFCA 4IDOA 3CX6B 4Q25A 3JAEA 2MBGA 2XAGB 2WB5A 1DU2A 5J0ZA 2KZ7B 2V6YA 4ZZBA 2VL0A 2UXDT 5JR9B 3ZMVB 1IJ6A 3AA0B 3RYCE 4UEMA 4HWFA 5GONE 3ZEFB 1OEDB 1ZEEA 2IAKA 2DWGA 4KP3C 4U7YA 5L3EB 3N5LA 3ZMSB 4EYUA 2CLYC 2H3RA 4BA9A 3PU8A 4DR4T 1JNZA 3N9OA 3W15B 3RIAA 3A7MA 5FL0A 2H88A 1MIVA 5KMGP 4X65T 4ILAA 2XQ4A 3KV6A 2ODUA 2B76A 3J7Yq 1XDPA 3O1HA 2YN6A 4AQFA 3C50A 1QLBA 1HCIA 2J62A 5LMUT 4DV4T 3RQWA 3SFEA 3LK2B 4U33A 2H7OA 4LF9T 2M6BA 3ZYLA 3S4UA 2BKNA 3ZJ1A 1SE7A 5FY7A 4N78D 5ABGA 4AKRB 5AQOB 1MIWA 2PBIA 5EK2A 4U2ZA 3AAEB 4YJ3E 5FKYA 4UELA 3O9XA 1YW0A 4YXDA 2XPKA 4UIGA 2CXDA 4BAYB 5JDMA 2RP4A 3ZT7A 4EGWA 3L39A 4ZXLA 4LF4T 5HYAA 2NTXA 4ADZA 4EIWA 4DUZT 4IE4A 3E22E 3FZFB 2HHHT 2LSGA 1N32T 2XAFB 3UQ4A 4CQIA 4I50E 5AQSB 4MLKA 3I9WA 1T8BA 5LG4A 3PUWF 3AE1A 3H3AA 3RC3A 3UTKA 4YJ2E 4QKNA 2XQYA 4UVCB 5CA0E 3OYZA 4AQFC 2FUPA 1D1BA 3PV0F 3OJAA 4U72A 3FXEB 2W0GA 3AEDA 1FMVA 1YQ4A 4LF5T 2C0SA 2LEHA 3UT5E 4U31A 1W09A 2LE8A 2I59A 3FBZA 2E8IA 3GN5B 3PUVF 2XQ8A 5AQUB 2ODVA 3RYHE 2WZIA 2Q9QA 1IZNB 1WFDA 4G63A 3ZJ2A 3CPZA 4TWHA 5AQPB 3B5MA 4XBFB 2JQ9A 2ZMAA 4YY3T 3WI3A 2HPJA 2CRBA 2XM1A 2JJ9A 1NAFA 5JDGA 1HFAA 4JEHB 4H9NC 1NENA 3AA7B 1QUUA 3NWIA 1FJGT 2E5VA 3UU4A 2CCQA 3C98B 5L3GB 3UU6A 2Q9QD 3UUMA 4AI6A 4O2AE 3I1AA 4ISTA 4IT4A 4HKAA 3K8PC 2LLYA 5AQQB 4DBQA 3CQCB 3UFGA 5J2UE 4WYVA 2CWYA 3PUXF 2V7KA 4MFRA 3B13A 3AE6A 3AE4A 1OEDA 3IEEA 2XQ6A 3ETVA 4COFA 2WMNA 3CWZB 4IDPA 3CX8B 4X66T 3P4RA 4GYRA 1UX5A 2X67A 3CQXC 4LF6T 1NEKA 1U5PA 4DMVA 2Q9QC 4KBMB 1NWMX 4FJOA 2F4VT 4L9IA 3IF8B 3O4XE 3EVYA 3UU5A 4EYYR 3TLSA 3AAIA 1HS7A 3QB5K 3UU3A 5F3JA 3VRBA 2MPKA 2DI4A 4UV8B 4P0AA 5HEJA 1Y01A 4PK5A 1WLXA 4LF8T 4GOUA 3F57A 4AQGA 1I94T 2D0TA 3EABA 2QYWA 3Q5WA 4X1IE 1D0XA 2X9YA 2CBIA 4K0UA 4CZZB 1QSDA 2KMFA 2V5CA 4CXXA 2XQ7A 4KI0F 2WS3A 3ZN1B 2XZEA 4HWCA 5LBMA 5HXEA 4O4JE 2UXNB 1LRZA 4DV2T 1ZKEA 2WDRA 2LHNA 2Y8DA 2C5KT 2LJLA 1OEDC 4EZ4A 4QH1A 2ZM6T 2YINA 1UK5A 2L3LA 2WWVA 3PUYF 5L3DB 3VR9A 3JC6D 2XQ5A 3EUHA 3JAFA 5LP6E 3FZKB 4ZZCA 1CHUA 3MZKB 2YDSA 3QNUA 1H7CA 2VL8A 4YTPA 4X62T 2IHR1 5HWXA 5FY0A 2PG8A 1IAPA 1IBKT 4QXHB 4DUYT 2NP9A 3K3QC 2GK9A 3UUNA 4YSZA 3QUJA 3K3NA 4NPPA 2XQAA 2WU2A 4X20E 2JQQA 1UCUA 2ACZA 3GN5A 4XAXB 4UF0B 2E9XB 3ZC1A 2MTQA 2D2SA 4BJNA 1KNZA 4ZS3A 3B57A 4YTNA 5FP3A 4IL4A 2KXPB 3JC6C 3MACA 3ZYKA 4ZI2C 2K5BB 5L47A 4L5GA 4AKLA 3PJAA 3HKDE 5HEHA 4CI1B 2KWHA 3VHLA 4EEBA 3UU8A 3O1JA 4GIWA 1Y64B 3KV4A 4PFPA 1SUMB 2KT9A 5TAOA 5JDNA 4TNVA 3NRXA 1XWMA 5KX5E 2RPAA 4PK6A 3H3MA 3RKGA 1KNRA 1WRDA 2K24A 2OV9A 4AKGA 2X0YA 2IMLA 5AQRB 4B3MT 2N1GA 2NW7A 2OLTA 5LNKA 3G06A 5EK4A 2X68A 4K0KT 3KBUA 5CA1E 4Z8XA 2XUEA 4QHOA 5HEUA 4JI3T 3AVSA 5EK3A 3F31A 2NTYA 3NZPA 4PAGA 1KK7A 3ZMZB 4F8HA 2XAQB 4LF7T 5AQGB 2DWKA 4IE0A 5C8YE 5CJ5A 2CHNA 4HE8A 5FVKA 5DQVA 3FB2A 3TLVA 4DR3T 5L2LA 4HGAA 2WZHA 1J5ET
chains in the Genus database with same CATH topology
3C4ZA 3UFEA 4UVBB 4AQFC 1D1BA 3OJAA 4U72A 5DJQC 3FXEB 4YHJA 1HTJF 4A56A 1UX4A 3CVRA 4MHCA 3RRCA 2W0GA 3DTOA 3V5SA 1FMVA 4TX5A 3ZLIA 3N2KE 4PNIA 2VKJA 3LJCA 2N9DA 2V7IA 4G2AA 2C0SA 2HPLA 2LEHA 3UT5E 4PFOA 4BJMA 4OYKA 5LJNA 2K9AA 4AXPA 1FEWA 1LKXA 2LE8A 2I59A 3FBZA 5F8PA 2E8IA 3GN5B 5EZYE 1WYBA 2DNXA 3V5UA 2ODVA 3N9LA 3RYHE 4DMWA 5L3FB 2X9WA 2D5UA 2Q9QA 3ANWA 4OYJA 3Q9DA 5L3CB 4O4HE 1IZNB 2C5IT 2KWIB 4O4IE 2IC9A 3ZMTB 3FHNA 4G63A 3ZJ2A 3CPZA 2Y48B 4PJMA 2LSKA 1LVFA 4QX7B 1OXZA 4YFSA 3MK7C 3KDSE 2V7MA 2X66A 4QXCB 4XBFB 2ZMAA 3NZQA 4OFZA 3R84B 4AKIA 1CUNA 1FIOA 3WI3A 2HPJA 4XZCA 3QC9A 5LYJE 5FXVA 5HXCA 5H6RB 2EHOB 2JJ9A 2KINB 4PW8A 2YU1A 1NAFA 1T98A 5JDGA 1YKEB 2KLQA 3T8OA 3U78A 3DP7A 1HFAA 2HH7A 2JPFA 2EHOD 3VKHA 2CE7A 5E0OA 2XAJB 4JEHB 2WM9A 4H9NC 4JUYA 4NUUA 1BR0A 3CKDA 3AA7B 1QUUA 1YD8G 2BDEA 5JDLA 5LHHB 2CCQA 3C98B 3I9YA 5L3GB 4UXNB 3R6NA 2X9XA 2Q9QD 3N2GE 4WBOA 3UULA 3H37A 3LBXB 2YU2A 4IIJE 3UUMA 4IE7A 4AI6A 4ILUA 3WAJA 3IBPA 3I1AA 4O2AE 4ISTA 3PUSA 4DVDA 4KMCA 2ZM8A 4HKAA 3ONXA 1MMGA 3K8PC 1Z0PA 2CM0A 2XHEB 2ZLYA 5FXWA 3DJBA 4DBQA 2WBLA 3CQCB 3GMIA 2B1EA 1WYCA 2KNDA 2VASA 5J2UE 3BQIA 2CWYA 4ZS2A 5LGTB 2LM9A 3KVBA 4GYSA 2X9HA 2YK0A 3AB3B 2V7KA 3C4XA 5FYMA 3VU7H 1HX8A 3PUAA 2A3DA 4MFRA 3B13A 4TUYE 2E9XA 4UF0A 4H63V 3UUXB 5ADXL 3O1IA 2ACXA 4ERRA 4C90A 3IEEA 3ETVA 3PURA 4QX8B 5CB4E 2WMNA 3CWZB 4PK4A 3BQLA 3CX8B 3LFMA 3MJXA 3PTRB 4KUMB 2ES0A 5LCYA 4GYRA 1UX5A 1VRBA 2WWUA 2X67A 3CQXC 1B7TA 3KBTA 5M4YA 3TKLB 1MMAA 3P7IA 2LT3A 3N9NA 1U5PA 3F2EA 4DMVA 4M1PA 3RYFE 2Q9QC 3C51A 4KBMB 1NWMX 2M67A 4I43B 3CX7B 2K48A 3PUGA 2MOZA 5JREA 4FJOA 4L9IA 4EZHA 3IF8B 3ZMUB 2XASB 5J2TE 4HTEA 3O4XE 3LG7A 3EVYA 4ASKA 4EYYR 3AAIA 2VK9A 1HS7A 2XTLA 4EAHA 3RYIE 2E9XD 5L3BB 5F3JA 4J2CA 2Y6XA 3KFWX 4ZI3C 4WW0A 2DI4A 3HA4A 4P09A 3N9QA 4UV8B 1FMWA 4P0AA 4MALA 4IE6A 3IHRA 5JVDE 1MNEA 2MYSA 4I4TE 1BR2A 3ESLA 3WAKA 3N2OA 5LGNB 4PK5A 1WLXA 5LGUB 4GOUA 3HR0A 1BR1A 4TN7B 3J9X1 2XAHB 3F57A 4O4LE 4AQGA 3FXDB 3BK9A 2DHRA 3RRWA 2D0TA 3SOLA 3HKCE 2G0UA 4H9SE 4IDZA 2DCFA 2LOSA 4MBQA 1WR6A 3Q5WA 4X1IE 1D0XA 2IW5B 2X9YA 4HN9A 4CXYA 3RPUA 1X79A 3PU3A 4K0UA 4CZZB 1V9DA 1QSDA 3CQGB 3ZC0A 2KMFA 3SRZA 5A1LA 4CXWA 4CXXA 1IJ5A 5JRCA 3ZCJA 2N2NA 3ZN1B 2C5JA 3MXZA 5LBMA 1G8XA 5HXEA 4O4JE 4ANJA 4O2BE 2UXNB 2W63A 4ZOLE 4EB6E 5HXSA 3M65A 4HFVA 1LRZA 5FNVE 3SS1A 2NOXA 4DNDA 3HKEE 1D0YA 5JR9B 4C91A 1ZKEA 1BR4A 4PJNA 5FXXA 2LHNA 3N9PA 3U3IA 2Y8DA 4DBRA 2LSYA 2QA7A 2E9XC 2C5KT 2J1DG 4L0RA 2CXLA 2Q9QB 3RX6A 3ANWB 3CMLA 1D1AA 2RA1A 3KINB 4HEAA 5H6QB 3C64A 2LJLA 4O8SA 1OWAA 4TV8E 4EZ4A 4ZI7E 4ZHQE 1YKHB 2V1DB 3Q5XA 2YINA 4FI5A 5HXRA 4IHJE 2L3LA 5IYZE 4E7SA 2BVMA 2A72A 5JDHA 4IGUA 2SPCA 3I0OA 1HG5A 3AA1B 5JRCB 2LHRA 2V7JA 1S35A 1S94A 4U74A 3HI2A 4ZI3D 4CI3B 3N9MA 5FXZA 4PJLA 5JR9A 5L3DB 3E0ZA 3MKDA 2W00A 5DQWA 2V26A 3EUHA 2YEVC 3JC6D 5LP6E 2CXFA 2CEAA 5AFUL 5HXHA 2LOPA 3ZYMA 2H7VC 3MZKB 4QWNB 1D0ZA 1U4QA 5ETWA 4GK0E 5LJMA 3VKGA 1SA0E 1H7CA 5LA6E 2P9BA 2VL8A 5HWXA 5FY0A 2PG8A 2OA5A 2L8KA 2VKHA 1G73A 1MMNA 1IAPA 4QXHB 4H9PC 3AVRA 2UXXB 3P8CD 2CWOA 2NP9A 1LVKA 2VWAA 3KV5A 3CX6B 3EDVA 3K3QC 5LBQB 3Q2MA 2GK9A 3UUNA 2MBGA 2Z6EA 3QUJA 4X1YE 2XAGB 5JDQA 3ZCIA 3K3NA 2KZ7B 2ZM0A 1HF8A 4X20E 2WMOA 3PE0A 3NBXX 4JLEA 2JQQA 1UCUA 3ZMVB 1IJ6A 3AA0B 2A2FX 3RYCE 3ZN0B 3GN5A 4EOZB 4XAXB 4UF0B 4F6RC 2E9XB 2VKOA 3D0TA 4UEMA 4P0BA 5GONE 2W62A 4WBNE 3AAAB 3ZEFB 3KVAA 3LK3B 3ZC1A 2MTQA 2CA5A 1ZEEA 2VKDA 2BZBA 2D2SA 4BJNA 2IAKA 5BMVE 1KNZA 2DWGA 4KP3C 4OHFA 4UV9B 4ZS3A 5HWYA 3B57A 5L3EB 3N5LA 1ZHCA 5FP3A 3ZMSB 4EYUA 3RC8A 2KXPB 2CLYC 3JC6C 2ZM2A 1D1CA 2H3RA 3MACA 3ZYKA 4BA9A 3PU8A 4ZI2C 4E7ZA 2V7LA 4H9QC 3N9OA 3W15B 3EDUA 2K5BB 4YLHA 2X0LB 2LSIA 4TV9E 2NW9A 3RH3A 4CI2B 2EHOA 4L5GA 1MIVA 5KMGP 4AKLA 3HKDE 1O3XA 3KV6A 2ODUA 2WAUA 3HL6A 3J7Yq 4X1KE 3O1HA 5DABA 4CI1B 2KWHA 3L09A 2NW8A 3MA9A 1MMDA 3VHLA 5JDFA 4AQFA 3C50A 1HCIA 5JQGE 3O1JA 4GIWA 2PJQA 3LBXA 4PJJA 5HAXA 4H63H 2IC6A 1VOMA 1Y64B 5LOVE 3KV4A 4PFPA 5JR9C 2KT9A 4JEUB 5TAOA 5JDNA 3NRXA 2JMHA 5FMNA 4B6XA 1ZV4X 3LK2B 3OKQA 3I0QA 2CMRA 4TZ4C 3OYXA 3LK42 5KX5E 5IHYA 2H7OA 4PK6A 1HG2A 5KDMC 3HKBE 4NUVA 3PDYA 5FY1A 1AJ3A 1EZ3A 2QGSA 5JH7E 1WRDA 2W61A 1SHZC 2JMKA 3ZYLA 2X51A 3S4UA 3ZJ1A 3OBVE 4OK0A 2K24A 5FY7A 3KV9A 4N78D 4QXBB 4AKGA 4DO0A 3RKOA 5J1GA 4AKRB 1MIWA 2PBIA 5EK2A 3AAEB 2N1GA 4YJ3E 2NW7A 3K3OA 2CLYB 4UELA 3O9XA 3ETUA 2L9QA 3SWHA 1YW0A 4UIGA 5LNKA 2CXDA 5LHIB 4WNKA 5EK4A 4BAYB 2D0UA 2X68A 4ZI2D 3KBUA 5JDMA 4H9OC 4H9RC 4AKHA 4ISSA 5CA1E 2RP4A 4Z8XA 2XUEA 4QHOA 3BQKA 5LHGB 3QK6A 5HYAA 5LXTE 2NTXA 4I55E 3GA8A 4ADZA 4EIWA 3AVSA 1E1HB 2JRKA 5EK3A 3F31A 2NTYA 1MIYA 2WSSV 3NZPA 3C4WA 4IE5A 2LSJA 4PAGA 1KK7A 4V1Av 4IE4A 1US7B 3E22E 3ZMZB 2BVLA 2XAQB 3ZPOA 2LSGA 2DWKA 4IE0A 4UVAB 2XAFB 2VB6A 2NWBA 2DLRA 4CQIA 4I50E 3A5XA 4MLKA 3I9WA 3L3PA 5C8YE 5LG4A 4EXTA 3H3AA 2EHOC 4HE8A 3RC3A 5DQVA 3FB2A 3UTKA 3FBLA 5L2LA 4GK5E 4HGAA 4YJ2E 4QKNA 2PFVA 3PUQA 2XQYA 4UVCB 3GWHA 5CA0E 1MNDA 3OYZA 3E08A 3AA6B 3NRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRE A;  3ZC0 A;  3ZC1 A;  5JRC B;  5JRC A;  5JR9 B;  5JR9 A;  5JR9 C; 
#chains in the Genus database with same CATH topology
 3C4Z A;  2BG9 A;  4U7I A;  1HTJ F;  3CVR A;  4MHC A;  4YSY A;  3V5S A;  4JI1 T;  3AEB A;  2V7I A;  4DV5 T;  5JTG A;  4PFO A;  4OYK A;  5LJN A;  4AXP A;  1FEW A;  3AE2 A;  5F8P A;  3AEF A;  2DNX A;  3V5U A;  4AIU A;  4IDN A;  3N9L A;  2X9W A;  3FHN A;  2Y48 B;  4PJM A;  2LSK A;  1LVF A;  3KDS E;  2X66 A;  3P4S A;  3NZQ A;  4OFZ A;  2VVN A;  3ABV A;  1FIO A;  5LYJ E;  3JCF A;  5HXC A;  5FL1 A;  2EHO B;  2KIN B;  4PW8 A;  2YU1 A;  3U78 A;  4DR2 T;  2CE7 A;  5E0O A;  2XAJ B;  2WM9 A;  4JUY A;  1YD8 G;  2BDE A;  3RGL A;  3I9Y A;  3R6N A;  2X9X A;  4WBO A;  1IBL T;  3UUL A;  5AQM B;  3LBX B;  5KXJ A;  4IL9 A;  4YT0 A;  4ILU A;  3PUS A;  2XQ9 A;  3Q5D A;  3M3Z B;  1MMG A;  1Z0P A;  3GMI A;  2B1E A;  2KND A;  2BG9 C;  4ZS2 A;  2X9H A;  3L8R A;  3AB3 B;  5FYM A;  1IBM T;  4UF0 A;  4TUY E;  2E9X A;  4B3S T;  2ACX A;  4QX8 B;  2V5D A;  2CBJ A;  3MJX A;  2ES0 A;  1VRB A;  3KBT A;  5LB7 B;  3TKL B;  4NIQ A;  3N9N A;  3F2E A;  3C51 A;  5C2T A;  3CX7 B;  2FJD A;  2K48 A;  4AIS A;  2MAW A;  5J2T E;  4HTE A;  3ZT6 A;  4EAH A;  3AXJ B;  2E9X D;  5L3B B;  4JI0 T;  3KFW X;  2E5L T;  3N9Q A;  3AEA A;  2AXD S;  5LGU B;  1UUS A;  1M62 A;  4TN7 B;  3J9X 1;  2XAH B;  2UXB T;  3SOL A;  3T1H T;  2LOS A;  1WR6 A;  2IUB A;  2IW5 B;  1GQE A;  4CXY A;  3PU3 A;  1V9D A;  3ZC0 A;  4LMJ A;  1XNQ T;  5A1L A;  4CXW A;  2UUB T;  5JRC A;  3AE9 A;  2C5J A;  3MXZ A;  1W0A A;  3PJA J;  3M65 A;  4JI5 T;  4DND A;  3HKE E;  4C91 A;  3U3I A;  5IWA T;  2E9X C;  1D1A A;  4HEA A;  2V8S V;  1OWA A;  4DV6 T;  3Q5X A;  5JDH A;  4JI6 T;  2SPC A;  3I0O A;  2WDQ A;  1HG5 A;  2I6H A;  3AA1 B;  2LHR A;  2V7J A;  2KSR A;  3HI2 A;  2BS2 A;  2WDV A;  2BKO A;  5FXZ A;  5JR9 A;  4EV6 A;  3E0Z A;  3MKD A;  2BKP A;  5HXH A;  2W66 A;  3ZYM A;  4QWN B;  4DV7 T;  5ETW A;  4GK0 E;  3VKG A;  1SA0 E;  5AQL B;  4HFE A;  5LA6 E;  2P9B A;  1N33 T;  2OA5 A;  2VKH A;  1MMN A;  4LFC T;  2YDQ A;  3P8C D;  5LBQ B;  3JAD A;  3Q2M A;  5AQI B;  2Z6E A;  4X1Y E;  4X5T A;  5JDQ A;  5L4E A;  3ZCI A;  2ZM0 A;  3RHW A;  1KNP A;  1HF8 A;  3RF1 A;  2WMO A;  3NBX X;  2AE9 A;  4QH4 A;  3TLU A;  4WBN E;  2BBJ A;  3AAA B;  3LK3 B;  2VKD A;  5BMV E;  4UV9 B;  5HWY A;  1ZHC A;  4EED A;  2PTF A;  4E7Z A;  2V7L A;  4H9Q C;  4YLH A;  2X0L B;  4TV9 E;  4CI2 B;  2EHO A;  3EHZ A;  5HEO A;  2WAU A;  3HL6 A;  4DID B;  5C3J A;  1ZOY A;  2NW8 A;  5JDF A;  5ABF B;  4Z90 A;  5JQG E;  3FZM B;  2PJQ A;  3LBX A;  4PJJ A;  4H63 H;  1VOM A;  2NR4 A;  5JR9 C;  5LG3 A;  3P50 A;  4JEU B;  4TNW A;  5FMN A;  3RQU A;  3P4P A;  3OKQ A;  2XM2 A;  3I0Q A;  4TZ4 C;  1UGO A;  3LK4 2;  5IHY A;  1HG2 A;  3PDY A;  5FY1 A;  1EZ3 A;  2QGS A;  2W61 A;  1SHZ C;  3OBV E;  3KV9 A;  4QXB B;  4DO0 A;  3RKO A;  3SFD A;  4HFB A;  4CN1 A;  3Q5E A;  2YDR A;  4DR1 T;  3TLW A;  4DV1 T;  3K3O A;  3AEC A;  5LHI B;  2D0U A;  4ZI2 D;  3RLF F;  5LXT E;  1E1H B;  2IDO B;  3C4W A;  3ZSS A;  2LSJ A;  4V1A v;  1US7 B;  2BVL A;  3ZPO A;  3AXJ A;  2NWB A;  2DLR A;  2J47 A;  3A5X A;  4WZX A;  3L3P A;  5AQT B;  2EHO C;  2CHO A;  4TWF A;  2UXC T;  4UR9 A;  4GKK T;  4A98 A;  4HWD A;  2PFV A;  2JQK A;  3AE8 A;  3GWH A;  1MND A;  3NRY A;  4HWH A;  3CK6 A;  4U2Y A;  3UFE A;  4ZEY A;  2XSA A;  1HR0 T;  3RIF A;  4YHJ A;  3AE7 A;  4A56 A;  1UX4 A;  4B3T T;  2VKJ A;  3LJC A;  2N9D A;  4G2A A;  4HFD A;  2HPL A;  4BJM A;  4P1N A;  1WYB A;  1YQ3 A;  4DMW A;  5L3F B;  4OYJ A;  5AQF B;  4O4H E;  5AQV B;  4ILB A;  2KWI B;  3ZMT B;  1OXZ A;  2V7M A;  4YTM A;  1HNW T;  3QB5 A;  1CUN A;  3FZL B;  4XZC A;  3QC9 A;  5FXV A;  2D9D A;  1T98 A;  1YKE B;  2KLQ A;  2YOE A;  3T8O A;  4JI2 T;  3VKH A;  4JV5 T;  1BR0 A;  3CKD A;  1Z8U A;  3NVO A;  3RIU A;  3N2G E;  4IRE A;  2YU2 A;  3WAJ A;  4KMC A;  3ONX A;  2XHE B;  2CM0 A;  5FXW A;  2WBL A;  4X64 T;  1WYC A;  2VAS A;  3BQI A;  3CIR A;  2LM9 A;  4GYS A;  3UUB A;  2K3W A;  1HX1 B;  2VUR A;  3VU7 H;  1HX8 A;  3PUA A;  3UUX B;  5HEG A;  4JI8 T;  1X9B A;  2I0M A;  3PUR A;  2XY8 B;  4B3R T;  3BQL A;  5LCY A;  2WWU A;  5M4Y A;  3P7I A;  3K1S A;  3RYF E;  2WCA A;  2HN2 A;  3PUG A;  5JRE A;  1WCR A;  4QH5 A;  2XAS B;  3NKZ A;  3LG7 A;  2FJE A;  2VK9 A;  2XTL A;  3RYI E;  1E7P A;  4J2C A;  2Y6X A;  5ABF A;  4ZI3 C;  2VQF T;  4NXM T;  4WW0 A;  3HA4 A;  4P09 A;  1XDO A;  3X1D A;  4IE6 A;  3IHR A;  4LML A;  1MNE A;  2MYS A;  4I4T E;  3ESL A;  1YXR A;  5LGN B;  3HR0 A;  1BR1 A;  5CFB A;  4O4L E;  3FXD B;  2G0U A;  4IDZ A;  1W9R A;  3RIU C;  1HNX T;  4HN9 A;  3RPU A;  1X79 A;  1T7S A;  3CQG B;  2W4X A;  3OPC A;  3FZH B;  3TLT A;  1G8X A;  4ANJ A;  3T1Y T;  4ZOL E;  2W63 A;  4EB6 E;  5HXS A;  4HFV A;  2VVS A;  4PJN A;  1R8I A;  5AQH B;  4LFA T;  2QA7 A;  2WP9 A;  3LSV A;  2CXL A;  4L0R A;  3RX6 A;  3ANW B;  3KIN B;  5H6Q B;  4TV8 E;  2E2A A;  1WR0 A;  4ZI7 E;  1YKH B;  2V1D B;  4FI5 A;  5HXR A;  5ABE A;  3AE3 A;  4IHJ E;  5IYZ E;  4E7S A;  2A72 A;  2FJA A;  1S35 A;  1S94 A;  2WQY A;  3N9M A;  4PJL A;  1T72 A;  4OX9 T;  4LFB T;  2YEV C;  2CEA A;  5AFU L;  2LOP A;  2H7V C;  1U4Q A;  5LJM A;  3EI0 A;  3AVR A;  4Z91 A;  2CWO A;  1LVK A;  3KV5 A;  3EDV A;  4I0U A;  2V6X A;  1N36 T;  3PE0 A;  4JLE A;  4HWI B;  3ZN0 B;  4EOZ B;  2A2F X;  4JI4 T;  4LMK A;  4F6R C;  2VKO A;  3D0T A;  5AQK B;  4P0B A;  2W62 A;  3KVA A;  3RI5 A;  2CA5 A;  2BBH A;  2BZB A;  4JYA T;  4OHF A;  3RC8 A;  1E2A A;  3EAM A;  2ZM2 A;  4DR7 T;  1D1C A;  1XZY A;  4A97 A;  3EDU A;  2LSI A;  2NW9 A;  3RH3 A;  5BR8 T;  1XNR T;  1O3X A;  2FBW A;  4X1K E;  5DAB A;  3L09 A;  3MA9 A;  1MMD A;  4NXN T;  5F5W A;  2YKS A;  5HAX A;  2LKG A;  2IC6 A;  5LOV E;  1ZP0 A;  2WU5 A;  4DV0 T;  2JMH A;  4B6X A;  1ZV4 X;  1J5W A;  2CMR A;  3OYX A;  2BG9 E;  5KDM C;  3HKB E;  4NUV A;  1AJ3 A;  5JH7 E;  4A5X A;  2JMK A;  2X51 A;  1KF6 A;  4OK0 A;  1UUR A;  3A8Y C;  5J1G A;  2CLY B;  3ETU A;  2L9Q A;  2LKH A;  2JIW A;  3SWH A;  1W0B A;  2BS4 A;  4WNK A;  2LRK A;  4H9O C;  4H9R C;  4AKH A;  4ISS A;  3BQK A;  5LHG B;  2VQE T;  3QK6 A;  4I55 E;  3GA8 A;  2JRK A;  1MIY A;  2WSS V;  5LMN T;  4IDQ A;  4JBW F;  4IE5 A;  5AQN B;  5CGM A;  4UVA B;  2VB6 A;  4EXT A;  3OVU A;  3FBL A;  4GK5 E;  3PUQ A;  3ZST A;  1VCS A;  3E08 A;  3AA6 B;  5HCM A;  4UVB B;  1L0V A;  5DJQ C;  2FJB A;  3RRC A;  3DTO A;  3VRA A;  4TX5 A;  3ZLI A;  3N2K E;  4PNI A;  2V6Y B;  2K9A A;  4DV3 T;  1LKX A;  5EZY E;  2IIU A;  2D5U A;  3ANW A;  3Q9D A;  5L3C B;  2BG9 B;  4CN6 A;  2C5I T;  4O4I E;  2IC9 A;  4QX7 B;  4YFS A;  3MK7 C;  4TWD A;  4QXC B;  1I6Z A;  3R84 B;  2WY2 A;  4AKI A;  3AEE A;  5H6R B;  3OTO T;  3P4Q A;  3QOF A;  2H89 A;  3PUZ F;  3DP7 A;  2XQ3 A;  2HH7 A;  2JPF A;  2EHO D;  2UUC T;  2XJ7 A;  1HNZ T;  4NUU A;  5FVL A;  1VCT A;  5JDL A;  5LHH B;  2W2U A;  4UXN B;  3H37 A;  2LRL A;  4IIJ E;  4IE7 A;  3IBP A;  4DVD A;  2ZM8 A;  1KFY A;  2ZLY A;  3DJB A;  4HFH A;  1M7K A;  5LGT B;  3KVB A;  1XMO T;  5AQJ B;  2YK0 A;  3ZT5 A;  3C4X A;  2A3D A;  4H63 V;  3UQ7 A;  5ADX L;  1J1J A;  3O1I A;  4ERR A;  4C90 A;  2LM2 A;  5CB4 E;  4PK4 A;  3LFM A;  3PTR B;  4KUM B;  2XSB A;  1B7T A;  1MMA A;  2LT3 A;  2M6I A;  2A9U A;  4M1P A;  4U3C A;  2M67 A;  4I43 B;  4KHZ F;  1N34 T;  2MOZ A;  4EZH A;  3ZMU B;  4ASK A;  2UU9 T;  4AQY T;  1FMW A;  4MAL A;  5JVD E;  1BR2 A;  2QVA A;  3WAK A;  1KEY A;  3N2O A;  2UUA T;  1OED E;  2JQH A;  3BK9 A;  2DHR A;  4HFI A;  3RRW A;  3HKC E;  5HCJ A;  4H9S E;  2DCF A;  3LDQ B;  4MBQ A;  5IUX A;  4ILC A;  2QRX A;  2DL1 A;  2J4G A;  4KX6 A;  3SRZ A;  1IJ5 A;  4KHP T;  2HN1 A;  3ZCJ A;  2N2N A;  4CN4 A;  4O2B E;  5FNV E;  3SS1 A;  2NOX A;  1D0Y A;  1JNR A;  2BS3 A;  1BR4 A;  5FXX A;  3N9P A;  5ABH A;  4DBR A;  5L4H A;  2LSY A;  2J1D G;  2Q9Q B;  3CML A;  2RA1 A;  3C64 A;  3P4W A;  4JI7 T;  4O8S A;  4ZHQ E;  4YSX A;  3AE5 A;  2BVM A;  3IA3 A;  2R6G F;  4IGU A;  5JRC B;  4DR5 T;  4U74 A;  3AEG A;  4GKJ T;  2W67 A;  4ZI3 D;  4CI3 B;  2W00 A;  2CPT A;  5DQW A;  3ONL C;  2V26 A;  2CXF A;  4DR6 T;  1D0Z A;  1XMQ T;  2L8K A;  1G73 A;  4H9P C;  3ONJ A;  2UXX B;  2X0H A;  3VR8 A;  3ZKR A;  4YHH T;  2VWA A;  4HFC A;  4IDO A;  3CX6 B;  4Q25 A;  3JAE A;  2MBG A;  2XAG B;  2WB5 A;  1DU2 A;  5J0Z A;  2KZ7 B;  2V6Y A;  4ZZB A;  2VL0 A;  2UXD T;  5JR9 B;  3ZMV B;  1IJ6 A;  3AA0 B;  3RYC E;  4UEM A;  4HWF A;  5GON E;  3ZEF B;  1OED B;  1ZEE A;  2IAK A;  2DWG A;  4KP3 C;  4U7Y A;  5L3E B;  3N5L A;  3ZMS B;  4EYU A;  2CLY C;  2H3R A;  4BA9 A;  3PU8 A;  4DR4 T;  1JNZ A;  3N9O A;  3W15 B;  3RIA A;  3A7M A;  5FL0 A;  2H88 A;  1MIV A;  5KMG P;  4X65 T;  4ILA A;  2XQ4 A;  3KV6 A;  2ODU A;  2B76 A;  3J7Y q;  1XDP A;  3O1H A;  2YN6 A;  4AQF A;  3C50 A;  1QLB A;  1HCI A;  2J62 A;  5LMU T;  4DV4 T;  3RQW A;  3SFE A;  3LK2 B;  4U33 A;  2H7O A;  4LF9 T;  2M6B A;  3ZYL A;  3S4U A;  2BKN A;  3ZJ1 A;  1SE7 A;  5FY7 A;  4N78 D;  5ABG A;  4AKR B;  5AQO B;  1MIW A;  2PBI A;  5EK2 A;  4U2Z A;  3AAE B;  4YJ3 E;  5FKY A;  4UEL A;  3O9X A;  1YW0 A;  4YXD A;  2XPK A;  4UIG A;  2CXD A;  4BAY B;  5JDM A;  2RP4 A;  3ZT7 A;  4EGW A;  3L39 A;  4ZXL A;  4LF4 T;  5HYA A;  2NTX A;  4ADZ A;  4EIW A;  4DUZ T;  4IE4 A;  3E22 E;  3FZF B;  2HHH T;  2LSG A;  1N32 T;  2XAF B;  3UQ4 A;  4CQI A;  4I50 E;  5AQS B;  4MLK A;  3I9W A;  1T8B A;  5LG4 A;  3PUW F;  3AE1 A;  3H3A A;  3RC3 A;  3UTK A;  4YJ2 E;  4QKN A;  2XQY A;  4UVC B;  5CA0 E;  3OYZ A;  4AQF C;  2FUP A;  1D1B A;  3PV0 F;  3OJA A;  4U72 A;  3FXE B;  2W0G A;  3AED A;  1FMV A;  1YQ4 A;  4LF5 T;  2C0S A;  2LEH A;  3UT5 E;  4U31 A;  1W09 A;  2LE8 A;  2I59 A;  3FBZ A;  2E8I A;  3GN5 B;  3PUV F;  2XQ8 A;  5AQU B;  2ODV A;  3RYH E;  2WZI A;  2Q9Q A;  1IZN B;  1WFD A;  4G63 A;  3ZJ2 A;  3CPZ A;  4TWH A;  5AQP B;  3B5M A;  4XBF B;  2JQ9 A;  2ZMA A;  4YY3 T;  3WI3 A;  2HPJ A;  2CRB A;  2XM1 A;  2JJ9 A;  1NAF A;  5JDG A;  1HFA A;  4JEH B;  4H9N C;  1NEN A;  3AA7 B;  1QUU A;  3NWI A;  1FJG T;  2E5V A;  3UU4 A;  2CCQ A;  3C98 B;  5L3G B;  3UU6 A;  2Q9Q D;  3UUM A;  4AI6 A;  4O2A E;  3I1A A;  4IST A;  4IT4 A;  4HKA A;  3K8P C;  2LLY A;  5AQQ B;  4DBQ A;  3CQC B;  3UFG A;  5J2U E;  4WYV A;  2CWY A;  3PUX F;  2V7K A;  4MFR A;  3B13 A;  3AE6 A;  3AE4 A;  1OED A;  3IEE A;  2XQ6 A;  3ETV A;  4COF A;  2WMN A;  3CWZ B;  4IDP A;  3CX8 B;  4X66 T;  3P4R A;  4GYR A;  1UX5 A;  2X67 A;  3CQX C;  4LF6 T;  1NEK A;  1U5P A;  4DMV A;  2Q9Q C;  4KBM B;  1NWM X;  4FJO A;  2F4V T;  4L9I A;  3IF8 B;  3O4X E;  3EVY A;  3UU5 A;  4EYY R;  3TLS A;  3AAI A;  1HS7 A;  3QB5 K;  3UU3 A;  5F3J A;  3VRB A;  2MPK A;  2DI4 A;  4UV8 B;  4P0A A;  5HEJ A;  1Y01 A;  4PK5 A;  1WLX A;  4LF8 T;  4GOU A;  3F57 A;  4AQG A;  1I94 T;  2D0T A;  3EAB A;  2QYW A;  3Q5W A;  4X1I E;  1D0X A;  2X9Y A;  2CBI A;  4K0U A;  4CZZ B;  1QSD A;  2KMF A;  2V5C A;  4CXX A;  2XQ7 A;  4KI0 F;  2WS3 A;  3ZN1 B;  2XZE A;  4HWC A;  5LBM A;  5HXE A;  4O4J E;  2UXN B;  1LRZ A;  4DV2 T;  1ZKE A;  2WDR A;  2LHN A;  2Y8D A;  2C5K T;  2LJL A;  1OED C;  4EZ4 A;  4QH1 A;  2ZM6 T;  2YIN A;  1UK5 A;  2L3L A;  2WWV A;  3PUY F;  5L3D B;  3VR9 A;  3JC6 D;  2XQ5 A;  3EUH A;  3JAF A;  5LP6 E;  3FZK B;  4ZZC A;  1CHU A;  3MZK B;  2YDS A;  3QNU A;  1H7C A;  2VL8 A;  4YTP A;  4X62 T;  2IHR 1;  5HWX A;  5FY0 A;  2PG8 A;  1IAP A;  1IBK T;  4QXH B;  4DUY T;  2NP9 A;  3K3Q C;  2GK9 A;  3UUN A;  4YSZ A;  3QUJ A;  3K3N A;  4NPP A;  2XQA A;  2WU2 A;  4X20 E;  2JQQ A;  1UCU A;  2ACZ A;  3GN5 A;  4XAX B;  4UF0 B;  2E9X B;  3ZC1 A;  2MTQ A;  2D2S A;  4BJN A;  1KNZ A;  4ZS3 A;  3B57 A;  4YTN A;  5FP3 A;  4IL4 A;  2KXP B;  3JC6 C;  3MAC A;  3ZYK A;  4ZI2 C;  2K5B B;  5L47 A;  4L5G A;  4AKL A;  3PJA A;  3HKD E;  5HEH A;  4CI1 B;  2KWH A;  3VHL A;  4EEB A;  3UU8 A;  3O1J A;  4GIW A;  1Y64 B;  3KV4 A;  4PFP A;  1SUM B;  2KT9 A;  5TAO A;  5JDN A;  4TNV A;  3NRX A;  1XWM A;  5KX5 E;  2RPA A;  4PK6 A;  3H3M A;  3RKG A;  1KNR A;  1WRD A;  2K24 A;  2OV9 A;  4AKG A;  2X0Y A;  2IML A;  5AQR B;  4B3M T;  2N1G A;  2NW7 A;  2OLT A;  5LNK A;  3G06 A;  5EK4 A;  2X68 A;  4K0K T;  3KBU A;  5CA1 E;  4Z8X A;  2XUE A;  4QHO A;  5HEU A;  4JI3 T;  3AVS A;  5EK3 A;  3F31 A;  2NTY A;  3NZP A;  4PAG A;  1KK7 A;  3ZMZ B;  4F8H A;  2XAQ B;  4LF7 T;  5AQG B;  2DWK A;  4IE0 A;  5C8Y E;  5CJ5 A;  2CHN A;  4HE8 A;  5FVK A;  5DQV A;  3FB2 A;  3TLV A;  4DR3 T;  5L2L A;  4HGA A;  2WZH A;  1J5E T; 
#chains in the Genus database with same CATH homology
 3C4Z A;  3UFE A;  4UVB B;  4AQF C;  1D1B A;  3OJA A;  4U72 A;  5DJQ C;  3FXE B;  4YHJ A;  1HTJ F;  4A56 A;  1UX4 A;  3CVR A;  4MHC A;  3RRC A;  2W0G A;  3DTO A;  3V5S A;  1FMV A;  4TX5 A;  3ZLI A;  3N2K E;  4PNI A;  2VKJ A;  3LJC A;  2N9D A;  2V7I A;  4G2A A;  2C0S A;  2HPL A;  2LEH A;  3UT5 E;  4PFO A;  4BJM A;  4OYK A;  5LJN A;  2K9A A;  4AXP A;  1FEW A;  1LKX A;  2LE8 A;  2I59 A;  3FBZ A;  5F8P A;  2E8I A;  3GN5 B;  5EZY E;  1WYB A;  2DNX A;  3V5U A;  2ODV A;  3N9L A;  3RYH E;  4DMW A;  5L3F B;  2X9W A;  2D5U A;  2Q9Q A;  3ANW A;  4OYJ A;  3Q9D A;  5L3C B;  4O4H E;  1IZN B;  2C5I T;  2KWI B;  4O4I E;  2IC9 A;  3ZMT B;  3FHN A;  4G63 A;  3ZJ2 A;  3CPZ A;  2Y48 B;  4PJM A;  2LSK A;  1LVF A;  4QX7 B;  1OXZ A;  4YFS A;  3MK7 C;  3KDS E;  2V7M A;  2X66 A;  4QXC B;  4XBF B;  2ZMA A;  3NZQ A;  4OFZ A;  3R84 B;  4AKI A;  1CUN A;  1FIO A;  3WI3 A;  2HPJ A;  4XZC A;  3QC9 A;  5LYJ E;  5FXV A;  5HXC A;  5H6R B;  2EHO B;  2JJ9 A;  2KIN B;  4PW8 A;  2YU1 A;  1NAF A;  1T98 A;  5JDG A;  1YKE B;  2KLQ A;  3T8O A;  3U78 A;  3DP7 A;  1HFA A;  2HH7 A;  2JPF A;  2EHO D;  3VKH A;  2CE7 A;  5E0O A;  2XAJ B;  4JEH B;  2WM9 A;  4H9N C;  4JUY A;  4NUU A;  1BR0 A;  3CKD A;  3AA7 B;  1QUU A;  1YD8 G;  2BDE A;  5JDL A;  5LHH B;  2CCQ A;  3C98 B;  3I9Y A;  5L3G B;  4UXN B;  3R6N A;  2X9X A;  2Q9Q D;  3N2G E;  4WBO A;  3UUL A;  3H37 A;  3LBX B;  2YU2 A;  4IIJ E;  3UUM A;  4IE7 A;  4AI6 A;  4ILU A;  3WAJ A;  3IBP A;  3I1A A;  4O2A E;  4IST A;  3PUS A;  4DVD A;  4KMC A;  2ZM8 A;  4HKA A;  3ONX A;  1MMG A;  3K8P C;  1Z0P A;  2CM0 A;  2XHE B;  2ZLY A;  5FXW A;  3DJB A;  4DBQ A;  2WBL A;  3CQC B;  3GMI A;  2B1E A;  1WYC A;  2KND A;  2VAS A;  5J2U E;  3BQI A;  2CWY A;  4ZS2 A;  5LGT B;  2LM9 A;  3KVB A;  4GYS A;  2X9H A;  2YK0 A;  3AB3 B;  2V7K A;  3C4X A;  5FYM A;  3VU7 H;  1HX8 A;  3PUA A;  2A3D A;  4MFR A;  3B13 A;  4TUY E;  2E9X A;  4UF0 A;  4H63 V;  3UUX B;  5ADX L;  3O1I A;  2ACX A;  4ERR A;  4C90 A;  3IEE A;  3ETV A;  3PUR A;  4QX8 B;  5CB4 E;  2WMN A;  3CWZ B;  4PK4 A;  3BQL A;  3CX8 B;  3LFM A;  3MJX A;  3PTR B;  4KUM B;  2ES0 A;  5LCY A;  4GYR A;  1UX5 A;  1VRB A;  2WWU A;  2X67 A;  3CQX C;  1B7T A;  3KBT A;  5M4Y A;  3TKL B;  1MMA A;  3P7I A;  2LT3 A;  3N9N A;  1U5P A;  3F2E A;  4DMV A;  4M1P A;  3RYF E;  2Q9Q C;  3C51 A;  4KBM B;  1NWM X;  2M67 A;  4I43 B;  3CX7 B;  2K48 A;  3PUG A;  2MOZ A;  5JRE A;  4FJO A;  4L9I A;  4EZH A;  3IF8 B;  3ZMU B;  2XAS B;  5J2T E;  4HTE A;  3O4X E;  3LG7 A;  3EVY A;  4ASK A;  4EYY R;  3AAI A;  2VK9 A;  1HS7 A;  2XTL A;  4EAH A;  3RYI E;  2E9X D;  5L3B B;  5F3J A;  4J2C A;  2Y6X A;  3KFW X;  4ZI3 C;  4WW0 A;  2DI4 A;  3HA4 A;  4P09 A;  3N9Q A;  4UV8 B;  1FMW A;  4P0A A;  4MAL A;  4IE6 A;  3IHR A;  5JVD E;  1MNE A;  2MYS A;  4I4T E;  1BR2 A;  3ESL A;  3WAK A;  3N2O A;  5LGN B;  4PK5 A;  1WLX A;  5LGU B;  4GOU A;  3HR0 A;  1BR1 A;  4TN7 B;  3J9X 1;  2XAH B;  3F57 A;  4O4L E;  4AQG A;  3FXD B;  3BK9 A;  2DHR A;  3RRW A;  2D0T A;  3SOL A;  3HKC E;  2G0U A;  4H9S E;  4IDZ A;  2DCF A;  2LOS A;  4MBQ A;  1WR6 A;  3Q5W A;  4X1I E;  1D0X A;  2IW5 B;  2X9Y A;  4HN9 A;  4CXY A;  3RPU A;  1X79 A;  3PU3 A;  4K0U A;  4CZZ B;  1V9D A;  1QSD A;  3CQG B;  3ZC0 A;  2KMF A;  3SRZ A;  5A1L A;  4CXW A;  4CXX A;  1IJ5 A;  5JRC A;  3ZCJ A;  2N2N A;  3ZN1 B;  2C5J A;  3MXZ A;  5LBM A;  1G8X A;  5HXE A;  4O4J E;  4ANJ A;  4O2B E;  2UXN B;  2W63 A;  4ZOL E;  4EB6 E;  5HXS A;  3M65 A;  4HFV A;  1LRZ A;  5FNV E;  3SS1 A;  2NOX A;  4DND A;  3HKE E;  1D0Y A;  5JR9 B;  4C91 A;  1ZKE A;  1BR4 A;  4PJN A;  5FXX A;  2LHN A;  3N9P A;  3U3I A;  2Y8D A;  4DBR A;  2LSY A;  2QA7 A;  2E9X C;  2C5K T;  2J1D G;  4L0R A;  2CXL A;  2Q9Q B;  3RX6 A;  3ANW B;  3CML A;  1D1A A;  2RA1 A;  3KIN B;  4HEA A;  5H6Q B;  3C64 A;  2LJL A;  4O8S A;  1OWA A;  4TV8 E;  4EZ4 A;  4ZI7 E;  4ZHQ E;  1YKH B;  2V1D B;  3Q5X A;  2YIN A;  4FI5 A;  5HXR A;  4IHJ E;  2L3L A;  5IYZ E;  4E7S A;  2BVM A;  2A72 A;  5JDH A;  4IGU A;  2SPC A;  3I0O A;  1HG5 A;  3AA1 B;  5JRC B;  2LHR A;  2V7J A;  1S35 A;  1S94 A;  4U74 A;  3HI2 A;  4ZI3 D;  4CI3 B;  3N9M A;  5FXZ A;  4PJL A;  5JR9 A;  5L3D B;  3E0Z A;  3MKD A;  2W00 A;  5DQW A;  2V26 A;  3EUH A;  2YEV C;  3JC6 D;  5LP6 E;  2CXF A;  2CEA A;  5AFU L;  5HXH A;  2LOP A;  3ZYM A;  2H7V C;  3MZK B;  4QWN B;  1D0Z A;  1U4Q A;  5ETW A;  4GK0 E;  5LJM A;  3VKG A;  1SA0 E;  1H7C A;  5LA6 E;  2P9B A;  2VL8 A;  5HWX A;  5FY0 A;  2PG8 A;  2OA5 A;  2L8K A;  2VKH A;  1G73 A;  1MMN A;  1IAP A;  4QXH B;  4H9P C;  3AVR A;  2UXX B;  3P8C D;  2CWO A;  2NP9 A;  1LVK A;  2VWA A;  3KV5 A;  3CX6 B;  3EDV A;  3K3Q C;  5LBQ B;  3Q2M A;  2GK9 A;  3UUN A;  2MBG A;  2Z6E A;  3QUJ A;  4X1Y E;  2XAG B;  5JDQ A;  3ZCI A;  3K3N A;  2KZ7 B;  2ZM0 A;  1HF8 A;  4X20 E;  2WMO A;  3PE0 A;  3NBX X;  4JLE A;  2JQQ A;  1UCU A;  3ZMV B;  1IJ6 A;  3AA0 B;  2A2F X;  3RYC E;  3ZN0 B;  3GN5 A;  4EOZ B;  4XAX B;  4UF0 B;  4F6R C;  2E9X B;  2VKO A;  3D0T A;  4UEM A;  4P0B A;  5GON E;  2W62 A;  4WBN E;  3AAA B;  3ZEF B;  3KVA A;  3LK3 B;  3ZC1 A;  2MTQ A;  2CA5 A;  1ZEE A;  2VKD A;  2BZB A;  2D2S A;  4BJN A;  2IAK A;  5BMV E;  1KNZ A;  2DWG A;  4KP3 C;  4OHF A;  4UV9 B;  4ZS3 A;  5HWY A;  3B57 A;  5L3E B;  3N5L A;  1ZHC A;  5FP3 A;  3ZMS B;  4EYU A;  3RC8 A;  2KXP B;  2CLY C;  3JC6 C;  2ZM2 A;  1D1C A;  2H3R A;  3MAC A;  3ZYK A;  4BA9 A;  3PU8 A;  4ZI2 C;  4E7Z A;  2V7L A;  4H9Q C;  3N9O A;  3W15 B;  3EDU A;  2K5B B;  4YLH A;  2X0L B;  2LSI A;  4TV9 E;  2NW9 A;  3RH3 A;  4CI2 B;  2EHO A;  4L5G A;  1MIV A;  5KMG P;  4AKL A;  3HKD E;  1O3X A;  3KV6 A;  2ODU A;  2WAU A;  3HL6 A;  3J7Y q;  4X1K E;  3O1H A;  5DAB A;  4CI1 B;  2KWH A;  3L09 A;  2NW8 A;  3MA9 A;  1MMD A;  3VHL A;  5JDF A;  4AQF A;  3C50 A;  1HCI A;  5JQG E;  3O1J A;  4GIW A;  2PJQ A;  3LBX A;  4PJJ A;  5HAX A;  4H63 H;  2IC6 A;  1VOM A;  1Y64 B;  5LOV E;  3KV4 A;  4PFP A;  5JR9 C;  2KT9 A;  4JEU B;  5TAO A;  5JDN A;  3NRX A;  2JMH A;  5FMN A;  4B6X A;  1ZV4 X;  3LK2 B;  3OKQ A;  3I0Q A;  2CMR A;  4TZ4 C;  3OYX A;  3LK4 2;  5KX5 E;  5IHY A;  2H7O A;  4PK6 A;  1HG2 A;  5KDM C;  3HKB E;  4NUV A;  3PDY A;  5FY1 A;  1AJ3 A;  1EZ3 A;  2QGS A;  5JH7 E;  1WRD A;  2W61 A;  1SHZ C;  2JMK A;  3ZYL A;  2X51 A;  3S4U A;  3ZJ1 A;  3OBV E;  4OK0 A;  2K24 A;  5FY7 A;  3KV9 A;  4N78 D;  4QXB B;  4AKG A;  4DO0 A;  3RKO A;  5J1G A;  4AKR B;  1MIW A;  2PBI A;  5EK2 A;  3AAE B;  2N1G A;  4YJ3 E;  2NW7 A;  3K3O A;  2CLY B;  4UEL A;  3O9X A;  3ETU A;  2L9Q A;  3SWH A;  1YW0 A;  4UIG A;  5LNK A;  2CXD A;  5LHI B;  4WNK A;  5EK4 A;  4BAY B;  2D0U A;  2X68 A;  4ZI2 D;  3KBU A;  5JDM A;  4H9O C;  4H9R C;  4AKH A;  4ISS A;  5CA1 E;  2RP4 A;  4Z8X A;  2XUE A;  4QHO A;  3BQK A;  5LHG B;  3QK6 A;  5HYA A;  5LXT E;  2NTX A;  4I55 E;  3GA8 A;  4ADZ A;  4EIW A;  3AVS A;  1E1H B;  2JRK A;  5EK3 A;  3F31 A;  2NTY A;  1MIY A;  2WSS V;  3NZP A;  3C4W A;  4IE5 A;  2LSJ A;  4PAG A;  1KK7 A;  4V1A v;  4IE4 A;  1US7 B;  3E22 E;  3ZMZ B;  2BVL A;  2XAQ B;  3ZPO A;  2LSG A;  2DWK A;  4IE0 A;  4UVA B;  2XAF B;  2VB6 A;  2NWB A;  2DLR A;  4CQI A;  4I50 E;  3A5X A;  4MLK A;  3I9W A;  3L3P A;  5C8Y E;  5LG4 A;  4EXT A;  3H3A A;  2EHO C;  4HE8 A;  3RC3 A;  5DQV A;  3FB2 A;  3UTK A;  3FBL A;  5L2L A;  4GK5 E;  4HGA A;  4YJ2 E;  4QKN A;  2PFV A;  3PUQ A;  2XQY A;  4UVC B;  3GWH A;  5CA0 E;  1MND A;  3OYZ A;  3E08 A;  3AA6 B;  3NRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...