5JREA

Crystal structure of nec3po in complex with ssdna.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
b'GSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jreA00
5JR9A 5JRCB 3ZC0A 5JR9C 5JRCA 5JREA 5JR9B 3ZC1A
chains in the Genus database with same CATH superfamily
3SS1A 5L47A 1E7PA 5LHGB 3ZKRA 3OPCA 3G06A 2VKJA 1Y01A 3UTKA 2VK9A 2ZM8A 3N5LA 4KBMB 1S35A 3Q5EA 5C3JA 3Q5XA 5LHHB 3VU7H 2HPJA 2VKHA 1LVKA 3AE7A 2PBIA 1WYCA 1X79A 2XY8B 1QSDA 4YTNA 4HKAA 4DBQA 1SHZC 1HNZT 1FMWA 2VVNA 2FJEA 1OEDC 4X62T 4IDPA 5JR9A 3HKCE 2IIUA 5KMGP 1KFYA 3QUJA 3I9WA 2KWHA 1WFDA 2DNXA 3RC3A 3V5UA 1R8IA 1OXZA 2LLYA 1HS7A 2NW8A 2BG9C 1MNEA 4YJ2E 4B3TT 2D0UA 4CN4A 4Q25A 4EAHA 3C4XA 3HKEE 3RLFF 3PUXF 3ZEFB 4JI7T 1H7CA 2V7LA 4IIJE 4JI6T 3JC6C 2ODUA 4ZHQE 3NVOA 3ZMTB 2FJBA 5LYJE 4ILUA 4ILBA 3DP7A 1MMDA 2ZLYA 4IE7A 4PAGA 4NUUA 2R6GF 2BBJA 2CXDA 4JYAT 2QA7A 1O3XA 4A56A 3K3NA 3QB5A 2X9YA 1M62A 2VVSA 3K3QC 3EUHA 5LG3A 1JNRA 2YINA 4JV5T 2VKOA 2BBHA 1YW0A 2LSIA 3ABVA 2G0UA 3ZSSA 4DUYT 2VL8A 4NUVA 4XAXB 2E9XB 4PJMA 4HFVA 3HI2A 3VRAA 2K3WA 1NWMX 2C5IT 2XM1A 5LBQB 4COFA 4JI5T 4G2AA 4DV6T 2ZM6T 4H9QC 5IYZE 4JI4T 4LFAT 3K1SA 2V26A 3FXEB 1US7B 4YT0A 1W0BA 4IE4A 4BA9A 5ABFA 5AQIB 4DMVA 5A1LA 4BJMA 3I9YA 3L8RA 3N9LA 1UX5A 1ZV4X 3FZLB 1NENA 5L4EA 3WI3A 3AEFA 4DV1T 3VKHA 4ZI3C 4DR6T 1QUUA 2L9QA 5JQGE 3JAEA 4X1IE 3RH3A 2JRKA 3RF1A 3NZPA 1FMVA 1J5WA 2P9BA 5FL0A 1FEWA 4KI0F 5AQGB 4H63H 5DQVA 3AEGA 1KF6A 4PW8A 1OEDB 2LSJA 5C2TA 1W9RA 3UQ7A 3IHRA 2CLYC 3P4WA 4KP3C 4EV6A 4HWCA 4A98A 3AE4A 1VOMA 2BVLA 2VQET 4JI2T 4QH5A 3V5SA 3L39A 3PUYF 5AQLB 3U78A 2NW7A 2A3DA 2X0HA 3DTOA 4UVBB 5JVDE 2H7VC 2LHRA 5JDHA 1S94A 4CI1B 1L0VA 2BS2A 4AKHA 4HWIB 3AEBA 5IUXA 4HN9A 4ZXLA 2BG9B 2V5DA 5HEOA 3I0OA 2WU2A 4GYSA 5LGUB 5ABHA 5C8YE 5HXCA 3L09A 3VR8A 4NIQA 1HR0T 2CHOA 2MYSA 5ABEA 2WBLA 2XASB 4IL4A 3FBZA 4E7ZA 3IBPA 4OK0A 2WWVA 1LRZA 5L3DB 2W67A 5JRCB 4U74A 3SFDA 2IAKA 3ZT5A 3J9X1 3ONJA 1D1CA 2WCAA 5LA6E 3CX6B 3ZC0A 4YHHT 3PUQA 2Y6XA 4H9SE 4YSYA 3OYZA 2CRBA 4MFRA 1IZNB 4YLHA 2V6YA 2SPCA 1AJ3A 3MA9A 1HNWT 3B13A 3LSVA 3RIUA 2WQYA 4IDQA 2YDQA 3KDSE 3N9NA 5M4YA 5FKYA 2D9DA 1I6ZA 3PURA 3PUVF 3C50A 2MTQA 2ZMAA 5CA0E 2XQ6A 4IL9A 2X0YA 5IWAT 3UU4A 2IUBA 4AKGA 3H3MA 4CI2B 3AA0B 2LSGA 2H88A 2HN2A 5L3CB 1NAFA 1XMQT 2DWKA 2DI4A 1UX4A 2EHOA 2I59A 4O4IE 4EOZB 4X20E 4JI0T 3FBLA 3B5MA 3SOLA 2DLRA 2PG8A 4EYUA 4QXBB 1N32T 4GKJT 4YSXA 2UXCT 5AQPB 2KXPB 2CBIA 3R6NA 3ZMZB 3Q2MA 3KFWX 4TNWA 4AKRB 2PTFA 4UEMA 4ILAA 3KV5A 4DV4T 2ES0A 3N9PA 4WBNE 2XAQB 2UXNB 3OYXA 3UU3A 2H3RA 1HF8A 4LF4T 4TWHA 4GK0E 1IJ5A 2EHOD 2CLYB 2KT9A 1NEKA 2YDSA 3UQ4A 2NTXA 4DUZT 3OKQA 1ZOYA 4K0UA 2JJ9A 5IHYA 4CXXA 2X66A 4OYKA 5AFUL 2YK0A 5LMNT 4QWNB 5HXRA 3LDQB 1XWMA 4AISA 1N36T 1SE7A 4B3MT 4AIUA 1VCTA 3AE3A 3UU8A 1J5ET 4Z91A 3EDVA 4O4HE 3FZFB 2XAFB 1MMAA 3ANWB 2FUPA 4UF0B 5HCMA 3AA6B 4TN7B 1D0ZA 4EZ4A 5HEGA 1T8BA 3Q5WA 2NW9A 4AXPA 2W2UA 2VWAA 3A7MA 3LFMA 4AI6A 1M7KA 2WU5A 2CXLA 2KZ7B 4HFEA 3AAEB 3GA8A 1CHUA 4TNVA 2E2AA 1LKXA 5CA1E 3RQWA 4EEDA 5JDGA 2CMRA 2B76A 4PK4A 2D0TA 1FJGT 4DV3T 2V8SV 2I6HA 3ZN1B 4DO0A 2XAJB 5L3FB 4ZS2A 5ABFB 2UXBT 2Z6EA 1YKEB 3AVSA 3ONLC 3PV0F 4C91A 4HGAA 1VRBA 5LG4A 5L3EB 4HFBA 3ZT7A 1IBMT 5FY1A 4ZI2C 2M67A 3PJAJ 5CB4E 3PUWF 5J2UE 3BQLA 4CZZB 2H89A 4KMCA 2VURA 1KK7A 1W0AA 4UV9B 2VKDA 5AQHB 1WCRA 5FXZA 4ZZBA 3AXJB 3AA7B 5EZYE 3JADA 3FB2A 4IE0A 5FY7A 1GQEA 1D1AA 3P4SA 3RI5A 4U7IA 5H6QB 3PUSA 2LM2A 3ZT6A 3F2EA 2V7KA 2CA5A 1Z8UA 4IREA 4IDNA 4V1Av 2XZEA 3NWIA 3ETUA 4WNKA 2N9DA 3RQUA 3M3ZB 2W4XA 4UELA 3ZMUB 3TLUA 4KX6A 4JBWF 3DJBA 4HFDA 4HWFA 5L2LA 2MBGA 4KHZF 4QH4A 3OTOT 3KVAA 2WZIA 5HEJA 2IHR1 4L0RA 5L4HA 3MZKB 2W66A 2AE9A 2BKPA 3EAMA 3M65A 2XQ4A 1YXRA 2XQAA 5AQVB 3K8PC 3LK3B 1KNPA 4ZEYA 4U72A 5ABGA 2CM0A 2Y48B 3N2OA 3R84B 3UFGA 4X65T 1HX8A 2CHNA 4ZZCA 2V6YB 1MIVA 4L5GA 3EI0A 5FP3A 2IDOB 4DR5T 3O1JA 4CXWA 4OFZA 4GK5E 1T7SA 3AE6A 4UXNB 4H63V 5AQSB 4MBQA 3UUMA 2OV9A 4JUYA 1U5PA 2WP9A 5HEHA 1UURA 2LHNA 2XJ7A 4WYVA 5HCJA 1XDOA 2ACXA 3MKDA 3JCFA 2MOZA 3OJAA 2OLTA 4YTMA 4B3RT 4BJNA 3H37A 4NXNT 5LJMA 4ILCA 4P09A 2W62A 2XQ3A 3LBXB 5FNVE 4GIWA 4EIWA 4U2ZA 2VL0A 1LVFA 2WDVA 3KV4A 5JR9C 2HH7A 3WAKA 3C98B 3C4WA 2L8KA 4QXCB 3IEEA 2X9HA 5CFBA 3EVYA 2JQ9A 2LSKA 4AKLA 3O9XA 2V1DB 2FBWA 3TLVA 4YTPA 4FI5A 4LFBT 4O2BE 5FYMA 3CX7B 1YD8G 1XNRT 3OBVE 1G73A 3T1HT 4HFHA 2CBJA 4I43B 4H9RC 2XAGB 4FJOA 3PUZF 2YN6A 4GOUA 5AQMB 3ZC1A 3N9QA 4P1NA 2KMFA 2BDEA 4LF9T 3NKZA 3AEAA 4OX9T 5EK3A 5AQFB 4ERRA 2PJQA 4JEHB 1B7TA 1KEYA 5KXJA 3MACA 4X1YE 1OWAA 1YQ4A 5JDLA 4U2YA 3GN5B 3ZCIA 1IBLT 3AE9A 3J7Yq 1MIYA 2M6BA 1WR6A 2NOXA 1U4QA 2Y8DA 3N2GE 2CE7A 4I4TE 4F6RC 4LMLA 4PFPA 3KV9A 5J1GA 1UCUA 4M1PA 2JPFA 2QYWA 3FXDB 4K0KT 5KDMC 1W09A 3KBUA 3CX8B 1ZHCA 4P0BA 2XQ8A 4HFIA 5FMNA 3AA1B 5JH7E 3RYCE 2A9UA 2NR4A 4J2CA 5AQQB 2E9XA 4DR7T 5F8PA 4HWDA 1IBKT 5JDQA 2OA5A 1N33T 1XDPA 3CIRA 2LRKA 4TUYE 3AAAB 5CGMA 1X9BA 1IJ6A 2CWYA 4B3ST 2DL1A 2LRLA 2N2NA 3VR9A 3B57A 2W0GA 4H9NC 2UU9T 1UUSA 4LF6T 3HR0A 5AQKB 5CJ5A 3EABA 4CN6A 3AAIA 2M6IA 5L3GB 4G63A 4IDZA 5JR9B 4ANJA 2E9XD 4HWHA 4I0UA 3CK6A 4IHJE 1HX1B 2V5CA 4O8SA 4IDOA 1MMGA 3GWHA 3MK7C 1SUMB 1E2AA 2ODVA 5AQJB 4PJJA 2QVAA 3AE1A 2XQ9A 2XQ5A 4DNDA 2XTLA 3UUNA 5LXTE 2X67A 4XBFB 5LHIB 2XQYA 3ZPOA 4XZCA 2D5UA 2YU1A 5HWYA 5J2TE 2RP4A 3LJCA 2KWIB 3CKDA 4DV7T 2LEHA 2JQKA 3UUXB 4OYJA 3QOFA 3QNUA 2JMHA 4LFCT 3UFEA 3E0ZA 3O1HA 5AQTB 2XHEB 2W00A 3P4RA 5JDMA 3RYFE 4CQIA 4WW0A 5F3JA 4WBOA 3RGLA 4IT4A 5JDFA 3BQKA 2X9WA 3N9OA 2LM9A 1DU2A 4U3CA 4UVAB 4QHOA 1BR1A 1XZYA 4IE6A 5LB7B 5LOVE 4X1KE 3ZSTA 5DJQC 4TZ4C 4ZOLE 3RIUC 4ZS3A 1SA0E 4F8HA 3ZN0B 2LE8A 1FIOA 2JMKA 2D2SA 5JRCA 3N9MA 3FZMB 3E22E 2IMLA 4U33A 3UULA 3TKLB 2BKNA 3K3OA 2V7MA 2YDRA 5HWXA 1MMNA 2MPKA 2HHHT 2EHOC 2PFVA 3JC6D 1OEDE 1BR4A 2J47A 1BR0A 4TWDA 2YOEA 2XPKA 3AVRA 2FJDA 4Z90A 3VRBA 5FL1A 3RYIE 4LF8T 2NTYA 2Q9QA 4GKKT 2XSBA 4LMKA 3I1AA 3CQXC 3AE5A 5LJNA 4O4JE 2BKOA 2BVMA 4IGUA 4MALA 3WAJA 2YKSA 5J0ZA 5JTGA 3MJXA 3NZQA 4MHCA 1J1JA 2BG9E 2W61A 5LCYA 3C51A 3IF8B 3ZMVB 1Z0PA 4DV2T 3BK9A 2BS4A 1HG5A 4TX5A 4MLKA 2WB5A 2LOPA 4HE8A 5KX5E 1MIWA 2UXXB 1E1HB 4JLEA 4TV8E 4JI3T 3AE2A 2GK9A 2Q9QD 1YKHB 2LT3A 5AQUB 5LGTB 4AQFA 4ZI7E 3PU3A 2XQ7A 4CI3B 3ZLIA 5E0OA 4N78D 3RHWA 3W15B 4NPPA 2CPTA 4X64T 2WY2A 3AEEA 3AB3B 3T8OA 1UK5A 4ZI3D 2LKGA 3QK6A 4O2AE 3HA4A 4A97A 3MXZA 3ZJ2A 4DIDB 3UU6A 4I55E 2JIWA 2HN1A 2C5JA 5HXHA 3FHNA 3QC9A 2LJLA 3CQGB 3UT5E 2E5LT 5JDNA 5EK2A 4EXTA 4P0AA 4WZXA 2J1DG 2N1GA 3ANWA 1EZ3A 4UF0A 2F4VT 5LBMA 4AKIA 2A72A 2KSRA 5AQNB 3LK2B 5FXWA 3F31A 4A5XA 2WM9A 5FVLA 5JREA 4PK6A 4LF7T 2UUBT 4X5TA 4LF5T 3O4XE 3C64A 4E7SA 3KV6A 3EHZA 2J62A 4UV8B 3PTRB 3QB5K 4YXDA 2VQFT 5EK4A 3LK42 5LNKA 2Q9QC 3NBXX 1ZKEA 2H7OA 3ZYLA 4ADZA 5HEUA 2C0SA 2EHOB 3Q5DA 2XAHB 2L3LA 4DBRA 5TAOA 5GONE 3UUBA 1V9DA 5HXEA 4TV9E 2DHRA 3GMIA 4JEUB 5FY0A 2IC6A 4HEAA 1ZEEA 1HCIA 3RYHE 1HTJF 2W63A 2LSYA 3OVUA 3I0QA 4C90A 3ESLA 1BR2A 3RRCA 3S4UA 5ADXL 2X0LB 2ZM2A 4YHJA 1Y64B 4ASKA 4AQGA 4AQFC 2X9XA 4PJNA 3ZJ1A 3ZMSB 4Z8XA 3TLWA 2XSAA 3AXJA 4KUMB 4YFSA 4DR3T 3KINB 3JAFA 1ZP0A 3F57A 3RRWA 5HYAA 3HKBE 4YSZA 2BS3A 3P50A 3IA3A 5F5WA 3CQCB 3AE8A 3PJAA 2E8IA 3A5XA 5BR8T 3P7IA 3RX6A 3U3IA 4CXYA 1HNXT 4ISTA 4ISSA 3VHLA 5FVKA 1QLBA 4DR4T 4DMWA 5FXVA 4AQYT 3X1DA 4LMJA 5DQWA 1IAPA 3PDYA 2B1EA 2C5KT 2NWBA 3TLSA 4DVDA 2ZM0A 1KNRA 2WMNA 2IC9A 1VCSA 1WR0A 4EYYR 4KHPT 4H9PC 2AXDS 2JQHA 2CCQA 4JI1T 2LOSA 2KINB 4QX8B 1XMOT 3P4PA 2WZHA 2IW5B 4QX7B 3PE0A 3RKOA 2NP9A 2V7JA 3RKGA 1WRDA 2X51A 2DCFA 3BQIA 3NRXA 4U7YA 2CWOA 4O4LE 2WAUA 4HTEA 2LKHA 4BAYB 5LMUT 3FZKB 3CWZB 3VKGA 5HAXA 4QXHB 2E5VA 3HKDE 5ETWA 4YJ3E 2KNDA 2ACZA 2WDRA 2V6XA 4EZHA 2Q9QB 3SRZA 2XUEA 4QKNA 4B6XA 1D0XA 1XNQT 3P8CD 2UUAT 3EDUA 2UXDT 1WYBA 4L9IA 1KNZA 4EGWA 2VASA 3O1IA 5AQRB 2WSSV 3FZHB 4PJLA 3PU8A 3Q9DA 2K48A 3LBXA 3RIAA 3TLTA 5AQOB 2RA1A 3HL6A 3KVBA 3NRYA 1D0YA 2K24A 3RIFA 4TWFA 3SFEA 2WS3A 4H9OC 4IE5A 3H3AA 3N2KE 4GYRA 1CUNA 3KBTA 2X68A 2MAWA 1OEDA 2FJAA 1N34T 1HFAA 4UVCB 5LGNB 3PUGA 3ONXA 3ZYKA 2QRXA 3RC8A 3P4QA 4DR1T 3T1YT 3CPZA 4DV0T 1HG2A 2QGSA 2RPAA 2HPLA 2K5BB 4X66T 1UGOA 4EEBA 4ZI2D 3C4ZA 1G8XA 2WMOA 3L3PA 2WDQA 4PK5A 5BMVE 5DABA 4I50E 5HXSA 3ZYMA 2I0MA 1T98A 2BG9A 1MNDA 4UIGA 1JNZA 5FXXA 2XM2A 4JI8T 2KLQA 2V7IA 5LP6E 4CN1A 2YEVC 4OHFA 4NXMT 3UU5A 1T72A 1I94T 3PUAA 4HFCA 5L3BB 3A8YC 2UUCT 3GN5A 3ETVA 3CMLA 4EB6E 3ZCJA 4U31A 2K9AA 3LG7A 2BZBA 2E9XC 1WLXA 3D0TA 2DWGA 4PFOA 4PNIA 2CEAA 2VB6A 3RPUA 3AECA 1YQ3A 2A2FX 3AEDA 3E08A 3CVRA 2JQQA 2CXFA 2WWUA 2YU2A 4QH1A 4UR9A 2J4GA 4YY3T 1D1BA 5H6RB 4DV5T 4DR2T 3SWHA
chains in the Genus database with same CATH topology
3SOLA 3SS1A 2DLRA 2PG8A 5LHGB 4EYUA 3UT5E 4QXBB 5JDNA 5EK2A 4EXTA 2KXPB 4P0AA 3R6NA 5EK3A 2VKJA 3ZMZB 2J1DG 3Q2MA 2N1GA 4ERRA 2PJQA 3ANWA 3KFWX 1EZ3A 1B7TA 4JEHB 4UF0A 3UTKA 2VK9A 2ZM8A 3N5LA 4KBMB 5LBMA 1S35A 4AKIA 4AKRB 4UEMA 2A72A 3MACA 3LK2B 3Q5XA 5LHHB 3KV5A 3VU7H 5FXWA 3F31A 2ES0A 3N9PA 4WBNE 2XAQB 2UXNB 3OYXA 2WM9A 2HPJA 2H3RA 5JREA 4PK6A 1HF8A 4X1YE 1OWAA 5JDLA 4GK0E 2VKHA 1IJ5A 1LVKA 3O4XE 3C64A 3GN5B 2EHOD 4E7SA 2CLYB 2KT9A 3KV6A 2PBIA 2NTXA 3ZCIA 4UV8B 1WYCA 3OKQA 3PTRB 1X79A 1QSDA 3J7Yq 4HKAA 1MIYA 4K0UA 2JJ9A 4DBQA 5IHYA 5EK4A 1FMWA 1WR6A 3LK42 2NOXA 5LNKA 1U4QA 2Y8DA 4CXXA 2Q9QC 3NBXX 2X66A 1ZKEA 4OYKA 2H7OA 3N2GE 5AFUL 2YK0A 3ZYLA 4ADZA 2CE7A 4I4TE 4QWNB 4F6RC 2C0SA 5HXRA 4PFPA 3KV9A 2EHOB 5J1GA 1UCUA 5JR9A 2XAHB 2L3LA 4DBRA 4M1PA 2JPFA 3FXDB 5KDMC 3HKCE 5TAOA 3KBUA 5GONE 3CX8B 5KMGP 1V9DA 5HXEA 3QUJA 1ZHCA 3I9WA 2KWHA 4P0BA 4TV9E 2DHRA 3GMIA 4JEUB 5FMNA 5FY0A 3AA1B 2DNXA 2IC6A 3EDVA 3RC3A 5JH7E 4O4HE 3V5UA 4HEAA 2XAFB 1MMAA 1ZEEA 1HCIA 1OXZA 3ANWB 3RYHE 3RYCE 4UF0B 1HTJF 4J2CA 2E9XA 2W63A 3AA6B 4TN7B 5F8PA 1D0ZA 4EZ4A 2LSYA 5JDQA 3I0QA 4C90A 3SWHA 3ESLA 2OA5A 1HS7A 2NW8A 3Q5WA 1MNEA 4YJ2E 1BR2A 2NW9A 3RRCA 3S4UA 4AXPA 2D0UA 5ADXL 2VWAA 4EAHA 4TUYE 3AAAB 3C4XA 3HKEE 2X0LB 3LFMA 1IJ6A 2CWYA 2ZM2A 4YHJA 1Y64B 1H7CA 4AQFC 2V7LA 4IIJE 2X9XA 4AQGA 2N2NA 3ZEFB 3B57A 3JC6C 4AI6A 2ODUA 2W0GA 4PJNA 4ZHQE 4H9NC 2CXLA 2KZ7B 3ZJ1A 3ZMTB 3ZMSB 4Z8XA 5LYJE 4ILUA 3AAEB 3GA8A 3HR0A 4KUMB 4YFSA 3DP7A 1MMDA 3KINB 1LKXA 3F57A 3RRWA 5CA1E 2ZLYA 4IE7A 3HKBE 5HYAA 5JDGA 2CMRA 4PK4A 4PAGA 4NUUA 2CXDA 3AAIA 2D0TA 3CQCB 2QA7A 5L3GB 4G63A 1O3XA 2E8IA 4IDZA 3A5XA 3ZN1B 4ANJA 5JR9B 2E9XD 4A56A 3P7IA 4DO0A 3RX6A 3K3NA 2XAJB 4IHJE 2X9YA 3U3IA 5L3FB 4ZS2A 4CXYA 4ASKA 4ISTA 4ISSA 4O8SA 3K3QC 3EUHA 3VHLA 2Z6EA 2YINA 1MMGA 2VKOA 3GWHA 1YKEB 3AVSA 4C91A 1YW0A 2LSIA 4HGAA 1VRBA 4DMWA 3MK7C 2G0UA 5LG4A 5FXVA 5L3EB 2ODVA 4PJJA 2VL8A 4NUVA 5DQWA 4XAXB 1IAPA 3PDYA 2B1EA 5FY1A 4ZI2C 2M67A 2E9XB 2C5KT 2NWBA 5CB4E 4PJMA 4HFVA 5J2UE 4DNDA 3BQLA 3HI2A 2XTLA 3UUNA 5LXTE 4DVDA 2X67A 4CZZB 4XBFB 2ZM0A 1NWMX 2C5IT 5LHIB 5LBQB 4G2AA 4KMCA 2XQYA 3ZPOA 2WMNA 1KK7A 4XZCA 2YU1A 2D5UA 2IC9A 4H9QC 4UV9B 2RP4A 5HWYA 5IYZE 5J2TE 3LJCA 2KWIB 3CKDA 2VKDA 4EYYR 4H9PC 2LEHA 2V26A 5FXZA 3UUXB 4OYJA 3FXEB 1US7B 2CCQA 3AA7B 2JMHA 2LOSA 5EZYE 3UFEA 3E0ZA 2KINB 4IE4A 4QX8B 3O1HA 3FB2A 4IE0A 5FY7A 4BA9A 1D1AA 2XHEB 2W00A 2IW5B 4DMVA 5A1LA 5H6QB 3PUSA 4BJMA 4QX7B 3PE0A 5JDMA 3RYFE 3I9YA 3RKOA 2NP9A 4CQIA 4WW0A 2V7JA 3F2EA 3N9LA 1UX5A 1ZV4X 2V7KA 5F3JA 2CA5A 4WBOA 1WRDA 2X51A 2DCFA 3WI3A 3BQIA 3VKHA 3NRXA 5JDFA 3BQKA 4ZI3C 2X9WA 3N9OA 4V1Av 2CWOA 4O4LE 2WAUA 4HTEA 2LM9A 4BAYB 1QUUA 2L9QA 4UVAB 4QHOA 5JQGE 1BR1A 3ETUA 4IE6A 4WNKA 5LOVE 4X1IE 3CWZB 2N9DA 4X1KE 5HAXA 3VKGA 4UELA 4QXHB 4TZ4C 5DJQC 2JRKA 3RH3A 3ZMUB 3NZPA 1FMVA 3HKDE 4ZOLE 5ETWA 4YJ3E 2KNDA 2P9BA 4ZS3A 1SA0E 1FEWA 4H63H 5DQVA 3DJBA 3ZN0B 4EZHA 2LE8A 2Q9QB 3SRZA 1FIOA 4PW8A 2XUEA 5L2LA 2LSJA 2MBGA 2JMKA 4QKNA 2D2SA 4B6XA 3IHRA 3KVAA 5JRCA 3N9MA 1D0XA 2CLYC 4L0RA 4KP3C 3E22E 3P8CD 3EDUA 1WYBA 4L9IA 3MZKB 3UULA 1KNZA 1VOMA 2BVLA 3TKLB 3M65A 2VASA 3O1IA 3V5SA 3K3OA 2V7MA 3K8PC 3LK3B 5HWXA 2WSSV 1MMNA 3U78A 4PJLA 3PU8A 2NW7A 3Q9DA 2K48A 4U72A 2A3DA 3LBXA 3DTOA 4UVBB 2CM0A 2Y48B 3N2OA 5JVDE 2H7VC 2LHRA 5JDHA 2RA1A 1S94A 2EHOC 2PFVA 3HL6A 3JC6D 4CI1B 3R84B 3KVBA 3NRYA 1BR4A 1D0YA 2K24A 1HX8A 4AKHA 1BR0A 4H9OC 4HN9A 4IE5A 3H3AA 1MIVA 3AVRA 3N2KE 4L5GA 4GYRA 1CUNA 3KBTA 3I0OA 3RYIE 2X68A 2NTYA 5FP3A 2Q9QA 3O1JA 4GYSA 5LGUB 4CXWA 5C8YE 4OFZA 5HXCA 1HFAA 3L09A 4GK5E 4UVCB 5LGNB 3PUGA 4UXNB 3I1AA 3CQXC 3ONXA 3ZYKA 4H63V 3RC8A 2MYSA 2WBLA 5LJNA 3CPZA 4O4JE 2XASB 3FBZA 4MBQA 3UUMA 2BVMA 4IGUA 4E7ZA 4MALA 3WAJA 3IBPA 1HG2A 4OK0A 2QGSA 4JUYA 1U5PA 3MJXA 2HPLA 1LRZA 5L3DB 5JRCB 4U74A 3NZQA 2IAKA 2K5BB 4MHCA 2W61A 3J9X1 2LHNA 3C51A 5LCYA 4ZI2D 1D1CA 2ACXA 3C4ZA 3MKDA 5LA6E 3IF8B 3ZMVB 1G8XA 1Z0PA 2WMOA 2MOZA 3CX6B 3L3PA 3ZC0A 3OJAA 3BK9A 1HG5A 4PK5A 4TX5A 5BMVE 4BJNA 3H37A 4I50E 5DABA 4MLKA 5HXSA 3PUQA 2LOPA 2Y6XA 4H9SE 3OYZA 4HE8A 5KX5E 4MFRA 1IZNB 1MIWA 5LJMA 4YLHA 2UXXB 1E1HB 4JLEA 4P09A 4TV8E 3ZYMA 2GK9A 2SPCA 2W62A 3LBXB 1T98A 2Q9QD 5FNVE 1AJ3A 1MNDA 4GIWA 1YKHB 4UIGA 4EIWA 2LT3A 5FXXA 2KLQA 1LVFA 3MA9A 2V7IA 3B13A 3KV4A 2HH7A 5JR9C 5LP6E 3WAKA 2YEVC 4OHFA 3C98B 5LGTB 3C4WA 4AQFA 2L8KA 3KDSE 4ZI7E 3PUAA 3N9NA 3PU3A 5M4YA 4QXCB 3IEEA 2X9HA 5L3BB 3PURA 4CI3B 3EVYA 3C50A 3ETVA 3GN5A 3CMLA 2MTQA 2ZMAA 3ZLIA 5CA0E 2LSKA 4AKLA 4EB6E 5E0OA 4N78D 3W15B 3O9XA 2V1DB 3ZCJA 2K9AA 4FI5A 3LG7A 4O2BE 5FYMA 3CX7B 4AKGA 3AB3B 2BZBA 2E9XC 4CI2B 1YD8G 1WLXA 3AA0B 3OBVE 3T8OA 3D0TA 1G73A 2LSGA 2DWGA 3QK6A 4I43B 4ZI3D 4PFOA 4PNIA 2CEAA 4H9RC 2XAGB 5L3CB 4O2AE 3HA4A 2VB6A 3RPUA 1NAFA 4FJOA 2A2FX 3MXZA 3E08A 3CVRA 3ZJ2A 2JQQA 2WWUA 2CXFA 2DI4A 1UX4A 2DWKA 2EHOA 2I59A 4GOUA 2YU2A 4I55E 3ZC1A 3N9QA 2C5JA 1D1BA 4O4IE 4EOZB 2KMFA 4X20E 5H6RB 5HXHA 2BDEA 3FHNA 3QC9A 2LJLA 3CQGB 1SHZC 3FBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 A;  5JRC B;  3ZC0 A;  5JR9 C;  5JRC A;  5JRE A;  5JR9 B;  3ZC1 A; 
#chains in the Genus database with same CATH topology
 3SS1 A;  5L47 A;  1E7P A;  5LHG B;  3ZKR A;  3OPC A;  3G06 A;  2VKJ A;  1Y01 A;  3UTK A;  2VK9 A;  2ZM8 A;  3N5L A;  4KBM B;  1S35 A;  3Q5E A;  5C3J A;  3Q5X A;  5LHH B;  3VU7 H;  2HPJ A;  2VKH A;  1LVK A;  3AE7 A;  2PBI A;  1WYC A;  1X79 A;  2XY8 B;  1QSD A;  4YTN A;  4HKA A;  4DBQ A;  1SHZ C;  1HNZ T;  1FMW A;  2VVN A;  2FJE A;  1OED C;  4X62 T;  4IDP A;  5JR9 A;  3HKC E;  2IIU A;  5KMG P;  1KFY A;  3QUJ A;  3I9W A;  2KWH A;  1WFD A;  2DNX A;  3RC3 A;  3V5U A;  1R8I A;  1OXZ A;  2LLY A;  1HS7 A;  2NW8 A;  2BG9 C;  1MNE A;  4YJ2 E;  4B3T T;  2D0U A;  4CN4 A;  4Q25 A;  4EAH A;  3C4X A;  3HKE E;  3RLF F;  3PUX F;  3ZEF B;  4JI7 T;  1H7C A;  2V7L A;  4IIJ E;  4JI6 T;  3JC6 C;  2ODU A;  4ZHQ E;  3NVO A;  3ZMT B;  2FJB A;  5LYJ E;  4ILU A;  4ILB A;  3DP7 A;  1MMD A;  2ZLY A;  4IE7 A;  4PAG A;  4NUU A;  2R6G F;  2BBJ A;  2CXD A;  4JYA T;  2QA7 A;  1O3X A;  4A56 A;  3K3N A;  3QB5 A;  2X9Y A;  1M62 A;  2VVS A;  3K3Q C;  3EUH A;  5LG3 A;  1JNR A;  2YIN A;  4JV5 T;  2VKO A;  2BBH A;  1YW0 A;  2LSI A;  3ABV A;  2G0U A;  3ZSS A;  4DUY T;  2VL8 A;  4NUV A;  4XAX B;  2E9X B;  4PJM A;  4HFV A;  3HI2 A;  3VRA A;  2K3W A;  1NWM X;  2C5I T;  2XM1 A;  5LBQ B;  4COF A;  4JI5 T;  4G2A A;  4DV6 T;  2ZM6 T;  4H9Q C;  5IYZ E;  4JI4 T;  4LFA T;  3K1S A;  2V26 A;  3FXE B;  1US7 B;  4YT0 A;  1W0B A;  4IE4 A;  4BA9 A;  5ABF A;  5AQI B;  4DMV A;  5A1L A;  4BJM A;  3I9Y A;  3L8R A;  3N9L A;  1UX5 A;  1ZV4 X;  3FZL B;  1NEN A;  5L4E A;  3WI3 A;  3AEF A;  4DV1 T;  3VKH A;  4ZI3 C;  4DR6 T;  1QUU A;  2L9Q A;  5JQG E;  3JAE A;  4X1I E;  3RH3 A;  2JRK A;  3RF1 A;  3NZP A;  1FMV A;  1J5W A;  2P9B A;  5FL0 A;  1FEW A;  4KI0 F;  5AQG B;  4H63 H;  5DQV A;  3AEG A;  1KF6 A;  4PW8 A;  1OED B;  2LSJ A;  5C2T A;  1W9R A;  3UQ7 A;  3IHR A;  2CLY C;  3P4W A;  4KP3 C;  4EV6 A;  4HWC A;  4A98 A;  3AE4 A;  1VOM A;  2BVL A;  2VQE T;  4JI2 T;  4QH5 A;  3V5S A;  3L39 A;  3PUY F;  5AQL B;  3U78 A;  2NW7 A;  2A3D A;  2X0H A;  3DTO A;  4UVB B;  5JVD E;  2H7V C;  2LHR A;  5JDH A;  1S94 A;  4CI1 B;  1L0V A;  2BS2 A;  4AKH A;  4HWI B;  3AEB A;  5IUX A;  4HN9 A;  4ZXL A;  2BG9 B;  2V5D A;  5HEO A;  3I0O A;  2WU2 A;  4GYS A;  5LGU B;  5ABH A;  5C8Y E;  5HXC A;  3L09 A;  3VR8 A;  4NIQ A;  1HR0 T;  2CHO A;  2MYS A;  5ABE A;  2WBL A;  2XAS B;  4IL4 A;  3FBZ A;  4E7Z A;  3IBP A;  4OK0 A;  2WWV A;  1LRZ A;  5L3D B;  2W67 A;  5JRC B;  4U74 A;  3SFD A;  2IAK A;  3ZT5 A;  3J9X 1;  3ONJ A;  1D1C A;  2WCA A;  5LA6 E;  3CX6 B;  3ZC0 A;  4YHH T;  3PUQ A;  2Y6X A;  4H9S E;  4YSY A;  3OYZ A;  2CRB A;  4MFR A;  1IZN B;  4YLH A;  2V6Y A;  2SPC A;  1AJ3 A;  3MA9 A;  1HNW T;  3B13 A;  3LSV A;  3RIU A;  2WQY A;  4IDQ A;  2YDQ A;  3KDS E;  3N9N A;  5M4Y A;  5FKY A;  2D9D A;  1I6Z A;  3PUR A;  3PUV F;  3C50 A;  2MTQ A;  2ZMA A;  5CA0 E;  2XQ6 A;  4IL9 A;  2X0Y A;  5IWA T;  3UU4 A;  2IUB A;  4AKG A;  3H3M A;  4CI2 B;  3AA0 B;  2LSG A;  2H88 A;  2HN2 A;  5L3C B;  1NAF A;  1XMQ T;  2DWK A;  2DI4 A;  1UX4 A;  2EHO A;  2I59 A;  4O4I E;  4EOZ B;  4X20 E;  4JI0 T;  3FBL A;  3B5M A;  3SOL A;  2DLR A;  2PG8 A;  4EYU A;  4QXB B;  1N32 T;  4GKJ T;  4YSX A;  2UXC T;  5AQP B;  2KXP B;  2CBI A;  3R6N A;  3ZMZ B;  3Q2M A;  3KFW X;  4TNW A;  4AKR B;  2PTF A;  4UEM A;  4ILA A;  3KV5 A;  4DV4 T;  2ES0 A;  3N9P A;  4WBN E;  2XAQ B;  2UXN B;  3OYX A;  3UU3 A;  2H3R A;  1HF8 A;  4LF4 T;  4TWH A;  4GK0 E;  1IJ5 A;  2EHO D;  2CLY B;  2KT9 A;  1NEK A;  2YDS A;  3UQ4 A;  2NTX A;  4DUZ T;  3OKQ A;  1ZOY A;  4K0U A;  2JJ9 A;  5IHY A;  4CXX A;  2X66 A;  4OYK A;  5AFU L;  2YK0 A;  5LMN T;  4QWN B;  5HXR A;  3LDQ B;  1XWM A;  4AIS A;  1N36 T;  1SE7 A;  4B3M T;  4AIU A;  1VCT A;  3AE3 A;  3UU8 A;  1J5E T;  4Z91 A;  3EDV A;  4O4H E;  3FZF B;  2XAF B;  1MMA A;  3ANW B;  2FUP A;  4UF0 B;  5HCM A;  3AA6 B;  4TN7 B;  1D0Z A;  4EZ4 A;  5HEG A;  1T8B A;  3Q5W A;  2NW9 A;  4AXP A;  2W2U A;  2VWA A;  3A7M A;  3LFM A;  4AI6 A;  1M7K A;  2WU5 A;  2CXL A;  2KZ7 B;  4HFE A;  3AAE B;  3GA8 A;  1CHU A;  4TNV A;  2E2A A;  1LKX A;  5CA1 E;  3RQW A;  4EED A;  5JDG A;  2CMR A;  2B76 A;  4PK4 A;  2D0T A;  1FJG T;  4DV3 T;  2V8S V;  2I6H A;  3ZN1 B;  4DO0 A;  2XAJ B;  5L3F B;  4ZS2 A;  5ABF B;  2UXB T;  2Z6E A;  1YKE B;  3AVS A;  3ONL C;  3PV0 F;  4C91 A;  4HGA A;  1VRB A;  5LG4 A;  5L3E B;  4HFB A;  3ZT7 A;  1IBM T;  5FY1 A;  4ZI2 C;  2M67 A;  3PJA J;  5CB4 E;  3PUW F;  5J2U E;  3BQL A;  4CZZ B;  2H89 A;  4KMC A;  2VUR A;  1KK7 A;  1W0A A;  4UV9 B;  2VKD A;  5AQH B;  1WCR A;  5FXZ A;  4ZZB A;  3AXJ B;  3AA7 B;  5EZY E;  3JAD A;  3FB2 A;  4IE0 A;  5FY7 A;  1GQE A;  1D1A A;  3P4S A;  3RI5 A;  4U7I A;  5H6Q B;  3PUS A;  2LM2 A;  3ZT6 A;  3F2E A;  2V7K A;  2CA5 A;  1Z8U A;  4IRE A;  4IDN A;  4V1A v;  2XZE A;  3NWI A;  3ETU A;  4WNK A;  2N9D A;  3RQU A;  3M3Z B;  2W4X A;  4UEL A;  3ZMU B;  3TLU A;  4KX6 A;  4JBW F;  3DJB A;  4HFD A;  4HWF A;  5L2L A;  2MBG A;  4KHZ F;  4QH4 A;  3OTO T;  3KVA A;  2WZI A;  5HEJ A;  2IHR 1;  4L0R A;  5L4H A;  3MZK B;  2W66 A;  2AE9 A;  2BKP A;  3EAM A;  3M65 A;  2XQ4 A;  1YXR A;  2XQA A;  5AQV B;  3K8P C;  3LK3 B;  1KNP A;  4ZEY A;  4U72 A;  5ABG A;  2CM0 A;  2Y48 B;  3N2O A;  3R84 B;  3UFG A;  4X65 T;  1HX8 A;  2CHN A;  4ZZC A;  2V6Y B;  1MIV A;  4L5G A;  3EI0 A;  5FP3 A;  2IDO B;  4DR5 T;  3O1J A;  4CXW A;  4OFZ A;  4GK5 E;  1T7S A;  3AE6 A;  4UXN B;  4H63 V;  5AQS B;  4MBQ A;  3UUM A;  2OV9 A;  4JUY A;  1U5P A;  2WP9 A;  5HEH A;  1UUR A;  2LHN A;  2XJ7 A;  4WYV A;  5HCJ A;  1XDO A;  2ACX A;  3MKD A;  3JCF A;  2MOZ A;  3OJA A;  2OLT A;  4YTM A;  4B3R T;  4BJN A;  3H37 A;  4NXN T;  5LJM A;  4ILC A;  4P09 A;  2W62 A;  2XQ3 A;  3LBX B;  5FNV E;  4GIW A;  4EIW A;  4U2Z A;  2VL0 A;  1LVF A;  2WDV A;  3KV4 A;  5JR9 C;  2HH7 A;  3WAK A;  3C98 B;  3C4W A;  2L8K A;  4QXC B;  3IEE A;  2X9H A;  5CFB A;  3EVY A;  2JQ9 A;  2LSK A;  4AKL A;  3O9X A;  2V1D B;  2FBW A;  3TLV A;  4YTP A;  4FI5 A;  4LFB T;  4O2B E;  5FYM A;  3CX7 B;  1YD8 G;  1XNR T;  3OBV E;  1G73 A;  3T1H T;  4HFH A;  2CBJ A;  4I43 B;  4H9R C;  2XAG B;  4FJO A;  3PUZ F;  2YN6 A;  4GOU A;  5AQM B;  3ZC1 A;  3N9Q A;  4P1N A;  2KMF A;  2BDE A;  4LF9 T;  3NKZ A;  3AEA A;  4OX9 T;  5EK3 A;  5AQF B;  4ERR A;  2PJQ A;  4JEH B;  1B7T A;  1KEY A;  5KXJ A;  3MAC A;  4X1Y E;  1OWA A;  1YQ4 A;  5JDL A;  4U2Y A;  3GN5 B;  3ZCI A;  1IBL T;  3AE9 A;  3J7Y q;  1MIY A;  2M6B A;  1WR6 A;  2NOX A;  1U4Q A;  2Y8D A;  3N2G E;  2CE7 A;  4I4T E;  4F6R C;  4LML A;  4PFP A;  3KV9 A;  5J1G A;  1UCU A;  4M1P A;  2JPF A;  2QYW A;  3FXD B;  4K0K T;  5KDM C;  1W09 A;  3KBU A;  3CX8 B;  1ZHC A;  4P0B A;  2XQ8 A;  4HFI A;  5FMN A;  3AA1 B;  5JH7 E;  3RYC E;  2A9U A;  2NR4 A;  4J2C A;  5AQQ B;  2E9X A;  4DR7 T;  5F8P A;  4HWD A;  1IBK T;  5JDQ A;  2OA5 A;  1N33 T;  1XDP A;  3CIR A;  2LRK A;  4TUY E;  3AAA B;  5CGM A;  1X9B A;  1IJ6 A;  2CWY A;  4B3S T;  2DL1 A;  2LRL A;  2N2N A;  3VR9 A;  3B57 A;  2W0G A;  4H9N C;  2UU9 T;  1UUS A;  4LF6 T;  3HR0 A;  5AQK B;  5CJ5 A;  3EAB A;  4CN6 A;  3AAI A;  2M6I A;  5L3G B;  4G63 A;  4IDZ A;  5JR9 B;  4ANJ A;  2E9X D;  4HWH A;  4I0U A;  3CK6 A;  4IHJ E;  1HX1 B;  2V5C A;  4O8S A;  4IDO A;  1MMG A;  3GWH A;  3MK7 C;  1SUM B;  1E2A A;  2ODV A;  5AQJ B;  4PJJ A;  2QVA A;  3AE1 A;  2XQ9 A;  2XQ5 A;  4DND A;  2XTL A;  3UUN A;  5LXT E;  2X67 A;  4XBF B;  5LHI B;  2XQY A;  3ZPO A;  4XZC A;  2D5U A;  2YU1 A;  5HWY A;  5J2T E;  2RP4 A;  3LJC A;  2KWI B;  3CKD A;  4DV7 T;  2LEH A;  2JQK A;  3UUX B;  4OYJ A;  3QOF A;  3QNU A;  2JMH A;  4LFC T;  3UFE A;  3E0Z A;  3O1H A;  5AQT B;  2XHE B;  2W00 A;  3P4R A;  5JDM A;  3RYF E;  4CQI A;  4WW0 A;  5F3J A;  4WBO A;  3RGL A;  4IT4 A;  5JDF A;  3BQK A;  2X9W A;  3N9O A;  2LM9 A;  1DU2 A;  4U3C A;  4UVA B;  4QHO A;  1BR1 A;  1XZY A;  4IE6 A;  5LB7 B;  5LOV E;  4X1K E;  3ZST A;  5DJQ C;  4TZ4 C;  4ZOL E;  3RIU C;  4ZS3 A;  1SA0 E;  4F8H A;  3ZN0 B;  2LE8 A;  1FIO A;  2JMK A;  2D2S A;  5JRC A;  3N9M A;  3FZM B;  3E22 E;  2IML A;  4U33 A;  3UUL A;  3TKL B;  2BKN A;  3K3O A;  2V7M A;  2YDR A;  5HWX A;  1MMN A;  2MPK A;  2HHH T;  2EHO C;  2PFV A;  3JC6 D;  1OED E;  1BR4 A;  2J47 A;  1BR0 A;  4TWD A;  2YOE A;  2XPK A;  3AVR A;  2FJD A;  4Z90 A;  3VRB A;  5FL1 A;  3RYI E;  4LF8 T;  2NTY A;  2Q9Q A;  4GKK T;  2XSB A;  4LMK A;  3I1A A;  3CQX C;  3AE5 A;  5LJN A;  4O4J E;  2BKO A;  2BVM A;  4IGU A;  4MAL A;  3WAJ A;  2YKS A;  5J0Z A;  5JTG A;  3MJX A;  3NZQ A;  4MHC A;  1J1J A;  2BG9 E;  2W61 A;  5LCY A;  3C51 A;  3IF8 B;  3ZMV B;  1Z0P A;  4DV2 T;  3BK9 A;  2BS4 A;  1HG5 A;  4TX5 A;  4MLK A;  2WB5 A;  2LOP A;  4HE8 A;  5KX5 E;  1MIW A;  2UXX B;  1E1H B;  4JLE A;  4TV8 E;  4JI3 T;  3AE2 A;  2GK9 A;  2Q9Q D;  1YKH B;  2LT3 A;  5AQU B;  5LGT B;  4AQF A;  4ZI7 E;  3PU3 A;  2XQ7 A;  4CI3 B;  3ZLI A;  5E0O A;  4N78 D;  3RHW A;  3W15 B;  4NPP A;  2CPT A;  4X64 T;  2WY2 A;  3AEE A;  3AB3 B;  3T8O A;  1UK5 A;  4ZI3 D;  2LKG A;  3QK6 A;  4O2A E;  3HA4 A;  4A97 A;  3MXZ A;  3ZJ2 A;  4DID B;  3UU6 A;  4I55 E;  2JIW A;  2HN1 A;  2C5J A;  5HXH A;  3FHN A;  3QC9 A;  2LJL A;  3CQG B;  3UT5 E;  2E5L T;  5JDN A;  5EK2 A;  4EXT A;  4P0A A;  4WZX A;  2J1D G;  2N1G A;  3ANW A;  1EZ3 A;  4UF0 A;  2F4V T;  5LBM A;  4AKI A;  2A72 A;  2KSR A;  5AQN B;  3LK2 B;  5FXW A;  3F31 A;  4A5X A;  2WM9 A;  5FVL A;  5JRE A;  4PK6 A;  4LF7 T;  2UUB T;  4X5T A;  4LF5 T;  3O4X E;  3C64 A;  4E7S A;  3KV6 A;  3EHZ A;  2J62 A;  4UV8 B;  3PTR B;  3QB5 K;  4YXD A;  2VQF T;  5EK4 A;  3LK4 2;  5LNK A;  2Q9Q C;  3NBX X;  1ZKE A;  2H7O A;  3ZYL A;  4ADZ A;  5HEU A;  2C0S A;  2EHO B;  3Q5D A;  2XAH B;  2L3L A;  4DBR A;  5TAO A;  5GON E;  3UUB A;  1V9D A;  5HXE A;  4TV9 E;  2DHR A;  3GMI A;  4JEU B;  5FY0 A;  2IC6 A;  4HEA A;  1ZEE A;  1HCI A;  3RYH E;  1HTJ F;  2W63 A;  2LSY A;  3OVU A;  3I0Q A;  4C90 A;  3ESL A;  1BR2 A;  3RRC A;  3S4U A;  5ADX L;  2X0L B;  2ZM2 A;  4YHJ A;  1Y64 B;  4ASK A;  4AQG A;  4AQF C;  2X9X A;  4PJN A;  3ZJ1 A;  3ZMS B;  4Z8X A;  3TLW A;  2XSA A;  3AXJ A;  4KUM B;  4YFS A;  4DR3 T;  3KIN B;  3JAF A;  1ZP0 A;  3F57 A;  3RRW A;  5HYA A;  3HKB E;  4YSZ A;  2BS3 A;  3P50 A;  3IA3 A;  5F5W A;  3CQC B;  3AE8 A;  3PJA A;  2E8I A;  3A5X A;  5BR8 T;  3P7I A;  3RX6 A;  3U3I A;  4CXY A;  1HNX T;  4IST A;  4ISS A;  3VHL A;  5FVK A;  1QLB A;  4DR4 T;  4DMW A;  5FXV A;  4AQY T;  3X1D A;  4LMJ A;  5DQW A;  1IAP A;  3PDY A;  2B1E A;  2C5K T;  2NWB A;  3TLS A;  4DVD A;  2ZM0 A;  1KNR A;  2WMN A;  2IC9 A;  1VCS A;  1WR0 A;  4EYY R;  4KHP T;  4H9P C;  2AXD S;  2JQH A;  2CCQ A;  4JI1 T;  2LOS A;  2KIN B;  4QX8 B;  1XMO T;  3P4P A;  2WZH A;  2IW5 B;  4QX7 B;  3PE0 A;  3RKO A;  2NP9 A;  2V7J A;  3RKG A;  1WRD A;  2X51 A;  2DCF A;  3BQI A;  3NRX A;  4U7Y A;  2CWO A;  4O4L E;  2WAU A;  4HTE A;  2LKH A;  4BAY B;  5LMU T;  3FZK B;  3CWZ B;  3VKG A;  5HAX A;  4QXH B;  2E5V A;  3HKD E;  5ETW A;  4YJ3 E;  2KND A;  2ACZ A;  2WDR A;  2V6X A;  4EZH A;  2Q9Q B;  3SRZ A;  2XUE A;  4QKN A;  4B6X A;  1D0X A;  1XNQ T;  3P8C D;  2UUA T;  3EDU A;  2UXD T;  1WYB A;  4L9I A;  1KNZ A;  4EGW A;  2VAS A;  3O1I A;  5AQR B;  2WSS V;  3FZH B;  4PJL A;  3PU8 A;  3Q9D A;  2K48 A;  3LBX A;  3RIA A;  3TLT A;  5AQO B;  2RA1 A;  3HL6 A;  3KVB A;  3NRY A;  1D0Y A;  2K24 A;  3RIF A;  4TWF A;  3SFE A;  2WS3 A;  4H9O C;  4IE5 A;  3H3A A;  3N2K E;  4GYR A;  1CUN A;  3KBT A;  2X68 A;  2MAW A;  1OED A;  2FJA A;  1N34 T;  1HFA A;  4UVC B;  5LGN B;  3PUG A;  3ONX A;  3ZYK A;  2QRX A;  3RC8 A;  3P4Q A;  4DR1 T;  3T1Y T;  3CPZ A;  4DV0 T;  1HG2 A;  2QGS A;  2RPA A;  2HPL A;  2K5B B;  4X66 T;  1UGO A;  4EEB A;  4ZI2 D;  3C4Z A;  1G8X A;  2WMO A;  3L3P A;  2WDQ A;  4PK5 A;  5BMV E;  5DAB A;  4I50 E;  5HXS A;  3ZYM A;  2I0M A;  1T98 A;  2BG9 A;  1MND A;  4UIG A;  1JNZ A;  5FXX A;  2XM2 A;  4JI8 T;  2KLQ A;  2V7I A;  5LP6 E;  4CN1 A;  2YEV C;  4OHF A;  4NXM T;  3UU5 A;  1T72 A;  1I94 T;  3PUA A;  4HFC A;  5L3B B;  3A8Y C;  2UUC T;  3GN5 A;  3ETV A;  3CML A;  4EB6 E;  3ZCJ A;  4U31 A;  2K9A A;  3LG7 A;  2BZB A;  2E9X C;  1WLX A;  3D0T A;  2DWG A;  4PFO A;  4PNI A;  2CEA A;  2VB6 A;  3RPU A;  3AEC A;  1YQ3 A;  2A2F X;  3AED A;  3E08 A;  3CVR A;  2JQQ A;  2CXF A;  2WWU A;  2YU2 A;  4QH1 A;  4UR9 A;  2J4G A;  4YY3 T;  1D1B A;  5H6R B;  4DV5 T;  4DR2 T;  3SWH A; 
#chains in the Genus database with same CATH homology
 3SOL A;  3SS1 A;  2DLR A;  2PG8 A;  5LHG B;  4EYU A;  3UT5 E;  4QXB B;  5JDN A;  5EK2 A;  4EXT A;  2KXP B;  4P0A A;  3R6N A;  5EK3 A;  2VKJ A;  3ZMZ B;  2J1D G;  3Q2M A;  2N1G A;  4ERR A;  2PJQ A;  3ANW A;  3KFW X;  1EZ3 A;  1B7T A;  4JEH B;  4UF0 A;  3UTK A;  2VK9 A;  2ZM8 A;  3N5L A;  4KBM B;  5LBM A;  1S35 A;  4AKI A;  4AKR B;  4UEM A;  2A72 A;  3MAC A;  3LK2 B;  3Q5X A;  5LHH B;  3KV5 A;  3VU7 H;  5FXW A;  3F31 A;  2ES0 A;  3N9P A;  4WBN E;  2XAQ B;  2UXN B;  3OYX A;  2WM9 A;  2HPJ A;  2H3R A;  5JRE A;  4PK6 A;  1HF8 A;  4X1Y E;  1OWA A;  5JDL A;  4GK0 E;  2VKH A;  1IJ5 A;  1LVK A;  3O4X E;  3C64 A;  3GN5 B;  2EHO D;  4E7S A;  2CLY B;  2KT9 A;  3KV6 A;  2PBI A;  2NTX A;  3ZCI A;  4UV8 B;  1WYC A;  3OKQ A;  3PTR B;  1X79 A;  1QSD A;  3J7Y q;  4HKA A;  1MIY A;  4K0U A;  2JJ9 A;  4DBQ A;  5IHY A;  5EK4 A;  1FMW A;  1WR6 A;  3LK4 2;  2NOX A;  5LNK A;  1U4Q A;  2Y8D A;  4CXX A;  2Q9Q C;  3NBX X;  2X66 A;  1ZKE A;  4OYK A;  2H7O A;  3N2G E;  5AFU L;  2YK0 A;  3ZYL A;  4ADZ A;  2CE7 A;  4I4T E;  4QWN B;  4F6R C;  2C0S A;  5HXR A;  4PFP A;  3KV9 A;  2EHO B;  5J1G A;  1UCU A;  5JR9 A;  2XAH B;  2L3L A;  4DBR A;  4M1P A;  2JPF A;  3FXD B;  5KDM C;  3HKC E;  5TAO A;  3KBU A;  5GON E;  3CX8 B;  5KMG P;  1V9D A;  5HXE A;  3QUJ A;  1ZHC A;  3I9W A;  2KWH A;  4P0B A;  4TV9 E;  2DHR A;  3GMI A;  4JEU B;  5FMN A;  5FY0 A;  3AA1 B;  2DNX A;  2IC6 A;  3EDV A;  3RC3 A;  5JH7 E;  4O4H E;  3V5U A;  4HEA A;  2XAF B;  1MMA A;  1ZEE A;  1HCI A;  1OXZ A;  3ANW B;  3RYH E;  3RYC E;  4UF0 B;  1HTJ F;  4J2C A;  2E9X A;  2W63 A;  3AA6 B;  4TN7 B;  5F8P A;  1D0Z A;  4EZ4 A;  2LSY A;  5JDQ A;  3I0Q A;  4C90 A;  3SWH A;  3ESL A;  2OA5 A;  1HS7 A;  2NW8 A;  3Q5W A;  1MNE A;  4YJ2 E;  1BR2 A;  2NW9 A;  3RRC A;  3S4U A;  4AXP A;  2D0U A;  5ADX L;  2VWA A;  4EAH A;  4TUY E;  3AAA B;  3C4X A;  3HKE E;  2X0L B;  3LFM A;  1IJ6 A;  2CWY A;  2ZM2 A;  4YHJ A;  1Y64 B;  1H7C A;  4AQF C;  2V7L A;  4IIJ E;  2X9X A;  4AQG A;  2N2N A;  3ZEF B;  3B57 A;  3JC6 C;  4AI6 A;  2ODU A;  2W0G A;  4PJN A;  4ZHQ E;  4H9N C;  2CXL A;  2KZ7 B;  3ZJ1 A;  3ZMT B;  3ZMS B;  4Z8X A;  5LYJ E;  4ILU A;  3AAE B;  3GA8 A;  3HR0 A;  4KUM B;  4YFS A;  3DP7 A;  1MMD A;  3KIN B;  1LKX A;  3F57 A;  3RRW A;  5CA1 E;  2ZLY A;  4IE7 A;  3HKB E;  5HYA A;  5JDG A;  2CMR A;  4PK4 A;  4PAG A;  4NUU A;  2CXD A;  3AAI A;  2D0T A;  3CQC B;  2QA7 A;  5L3G B;  4G63 A;  1O3X A;  2E8I A;  4IDZ A;  3A5X A;  3ZN1 B;  4ANJ A;  5JR9 B;  2E9X D;  4A56 A;  3P7I A;  4DO0 A;  3RX6 A;  3K3N A;  2XAJ B;  4IHJ E;  2X9Y A;  3U3I A;  5L3F B;  4ZS2 A;  4CXY A;  4ASK A;  4IST A;  4ISS A;  4O8S A;  3K3Q C;  3EUH A;  3VHL A;  2Z6E A;  2YIN A;  1MMG A;  2VKO A;  3GWH A;  1YKE B;  3AVS A;  4C91 A;  1YW0 A;  2LSI A;  4HGA A;  1VRB A;  4DMW A;  3MK7 C;  2G0U A;  5LG4 A;  5FXV A;  5L3E B;  2ODV A;  4PJJ A;  2VL8 A;  4NUV A;  5DQW A;  4XAX B;  1IAP A;  3PDY A;  2B1E A;  5FY1 A;  4ZI2 C;  2M67 A;  2E9X B;  2C5K T;  2NWB A;  5CB4 E;  4PJM A;  4HFV A;  5J2U E;  4DND A;  3BQL A;  3HI2 A;  2XTL A;  3UUN A;  5LXT E;  4DVD A;  2X67 A;  4CZZ B;  4XBF B;  2ZM0 A;  1NWM X;  2C5I T;  5LHI B;  5LBQ B;  4G2A A;  4KMC A;  2XQY A;  3ZPO A;  2WMN A;  1KK7 A;  4XZC A;  2YU1 A;  2D5U A;  2IC9 A;  4H9Q C;  4UV9 B;  2RP4 A;  5HWY A;  5IYZ E;  5J2T E;  3LJC A;  2KWI B;  3CKD A;  2VKD A;  4EYY R;  4H9P C;  2LEH A;  2V26 A;  5FXZ A;  3UUX B;  4OYJ A;  3FXE B;  1US7 B;  2CCQ A;  3AA7 B;  2JMH A;  2LOS A;  5EZY E;  3UFE A;  3E0Z A;  2KIN B;  4IE4 A;  4QX8 B;  3O1H A;  3FB2 A;  4IE0 A;  5FY7 A;  4BA9 A;  1D1A A;  2XHE B;  2W00 A;  2IW5 B;  4DMV A;  5A1L A;  5H6Q B;  3PUS A;  4BJM A;  4QX7 B;  3PE0 A;  5JDM A;  3RYF E;  3I9Y A;  3RKO A;  2NP9 A;  4CQI A;  4WW0 A;  2V7J A;  3F2E A;  3N9L A;  1UX5 A;  1ZV4 X;  2V7K A;  5F3J A;  2CA5 A;  4WBO A;  1WRD A;  2X51 A;  2DCF A;  3WI3 A;  3BQI A;  3VKH A;  3NRX A;  5JDF A;  3BQK A;  4ZI3 C;  2X9W A;  3N9O A;  4V1A v;  2CWO A;  4O4L E;  2WAU A;  4HTE A;  2LM9 A;  4BAY B;  1QUU A;  2L9Q A;  4UVA B;  4QHO A;  5JQG E;  1BR1 A;  3ETU A;  4IE6 A;  4WNK A;  5LOV E;  4X1I E;  3CWZ B;  2N9D A;  4X1K E;  5HAX A;  3VKG A;  4UEL A;  4QXH B;  4TZ4 C;  5DJQ C;  2JRK A;  3RH3 A;  3ZMU B;  3NZP A;  1FMV A;  3HKD E;  4ZOL E;  5ETW A;  4YJ3 E;  2KND A;  2P9B A;  4ZS3 A;  1SA0 E;  1FEW A;  4H63 H;  5DQV A;  3DJB A;  3ZN0 B;  4EZH A;  2LE8 A;  2Q9Q B;  3SRZ A;  1FIO A;  4PW8 A;  2XUE A;  5L2L A;  2LSJ A;  2MBG A;  2JMK A;  4QKN A;  2D2S A;  4B6X A;  3IHR A;  3KVA A;  5JRC A;  3N9M A;  1D0X A;  2CLY C;  4L0R A;  4KP3 C;  3E22 E;  3P8C D;  3EDU A;  1WYB A;  4L9I A;  3MZK B;  3UUL A;  1KNZ A;  1VOM A;  2BVL A;  3TKL B;  3M65 A;  2VAS A;  3O1I A;  3V5S A;  3K3O A;  2V7M A;  3K8P C;  3LK3 B;  5HWX A;  2WSS V;  1MMN A;  3U78 A;  4PJL A;  3PU8 A;  2NW7 A;  3Q9D A;  2K48 A;  4U72 A;  2A3D A;  3LBX A;  3DTO A;  4UVB B;  2CM0 A;  2Y48 B;  3N2O A;  5JVD E;  2H7V C;  2LHR A;  5JDH A;  2RA1 A;  1S94 A;  2EHO C;  2PFV A;  3HL6 A;  3JC6 D;  4CI1 B;  3R84 B;  3KVB A;  3NRY A;  1BR4 A;  1D0Y A;  2K24 A;  1HX8 A;  4AKH A;  1BR0 A;  4H9O C;  4HN9 A;  4IE5 A;  3H3A A;  1MIV A;  3AVR A;  3N2K E;  4L5G A;  4GYR A;  1CUN A;  3KBT A;  3I0O A;  3RYI E;  2X68 A;  2NTY A;  5FP3 A;  2Q9Q A;  3O1J A;  4GYS A;  5LGU B;  4CXW A;  5C8Y E;  4OFZ A;  5HXC A;  1HFA A;  3L09 A;  4GK5 E;  4UVC B;  5LGN B;  3PUG A;  4UXN B;  3I1A A;  3CQX C;  3ONX A;  3ZYK A;  4H63 V;  3RC8 A;  2MYS A;  2WBL A;  5LJN A;  3CPZ A;  4O4J E;  2XAS B;  3FBZ A;  4MBQ A;  3UUM A;  2BVM A;  4IGU A;  4E7Z A;  4MAL A;  3WAJ A;  3IBP A;  1HG2 A;  4OK0 A;  2QGS A;  4JUY A;  1U5P A;  3MJX A;  2HPL A;  1LRZ A;  5L3D B;  5JRC B;  4U74 A;  3NZQ A;  2IAK A;  2K5B B;  4MHC A;  2W61 A;  3J9X 1;  2LHN A;  3C51 A;  5LCY A;  4ZI2 D;  1D1C A;  2ACX A;  3C4Z A;  3MKD A;  5LA6 E;  3IF8 B;  3ZMV B;  1G8X A;  1Z0P A;  2WMO A;  2MOZ A;  3CX6 B;  3L3P A;  3ZC0 A;  3OJA A;  3BK9 A;  1HG5 A;  4PK5 A;  4TX5 A;  5BMV E;  4BJN A;  3H37 A;  4I50 E;  5DAB A;  4MLK A;  5HXS A;  3PUQ A;  2LOP A;  2Y6X A;  4H9S E;  3OYZ A;  4HE8 A;  5KX5 E;  4MFR A;  1IZN B;  1MIW A;  5LJM A;  4YLH A;  2UXX B;  1E1H B;  4JLE A;  4P09 A;  4TV8 E;  3ZYM A;  2GK9 A;  2SPC A;  2W62 A;  3LBX B;  1T98 A;  2Q9Q D;  5FNV E;  1AJ3 A;  1MND A;  4GIW A;  1YKH B;  4UIG A;  4EIW A;  2LT3 A;  5FXX A;  2KLQ A;  1LVF A;  3MA9 A;  2V7I A;  3B13 A;  3KV4 A;  2HH7 A;  5JR9 C;  5LP6 E;  3WAK A;  2YEV C;  4OHF A;  3C98 B;  5LGT B;  3C4W A;  4AQF A;  2L8K A;  3KDS E;  4ZI7 E;  3PUA A;  3N9N A;  3PU3 A;  5M4Y A;  4QXC B;  3IEE A;  2X9H A;  5L3B B;  3PUR A;  4CI3 B;  3EVY A;  3C50 A;  3ETV A;  3GN5 A;  3CML A;  2MTQ A;  2ZMA A;  3ZLI A;  5CA0 E;  2LSK A;  4AKL A;  4EB6 E;  5E0O A;  4N78 D;  3W15 B;  3O9X A;  2V1D B;  3ZCJ A;  2K9A A;  4FI5 A;  3LG7 A;  4O2B E;  5FYM A;  3CX7 B;  4AKG A;  3AB3 B;  2BZB A;  2E9X C;  4CI2 B;  1YD8 G;  1WLX A;  3AA0 B;  3OBV E;  3T8O A;  3D0T A;  1G73 A;  2LSG A;  2DWG A;  3QK6 A;  4I43 B;  4ZI3 D;  4PFO A;  4PNI A;  2CEA A;  4H9R C;  2XAG B;  5L3C B;  4O2A E;  3HA4 A;  2VB6 A;  3RPU A;  1NAF A;  4FJO A;  2A2F X;  3MXZ A;  3E08 A;  3CVR A;  3ZJ2 A;  2JQQ A;  2WWU A;  2CXF A;  2DI4 A;  1UX4 A;  2DWK A;  2EHO A;  2I59 A;  4GOU A;  2YU2 A;  4I55 E;  3ZC1 A;  3N9Q A;  2C5J A;  1D1B A;  4O4I E;  4EOZ B;  2KMF A;  4X20 E;  5H6R B;  5HXH A;  2BDE A;  3FHN A;  3QC9 A;  2LJL A;  3CQG B;  1SHZ C;  3FBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...