5JREA

Crystal structure of nec3po in complex with ssdna.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
GSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jreA00
5JR9C 5JR9A 3ZC0A 5JREA 5JRCB 5JRCA 3ZC1A 5JR9B
chains in the Genus database with same CATH superfamily
4B6XA 4A98A 2BDEA 2BS4A 4AIUA 4ASKA 3DJBA 5JVDE 4JLEA 3LJCA 5HXSA 4OFZA 2LSIA 2ZLYA 4LF6T 3IA3A 2ACXA 3ANWB 1CHUA 2XJ7A 4JI3T 1WFDA 2K9AA 2IAKA 1D0ZA 4JI7T 4YT0A 2KWHA 2KT9A 1N32T 4HWCA 2CXDA 4F6RC 3GA8A 4YHJA 2BS3A 4CXXA 3RX6A 3FZHB 3P4SA 4AQFA 2UUCT 5HEJA 3P4PA 1W09A 2K48A 2CRBA 2M67A 2VKJA 4U7IA 1G8XA 2LHRA 4U2YA 3I9WA 1ZP0A 2XAFB 4PK4A 1HNZT 2N9DA 5F5WA 2BG9E 3H3AA 2LJLA 2XM2A 5ABFA 3RIFA 2V6XA 4JI1T 4EYYR 3Q5XA 2KMFA 3ZMVB 2D0UA 1V9DA 1D0YA 2XPKA 2YN6A 1HF8A 2X0YA 5FVLA 2UXNB 3FBZA 3O4XE 3AB3B 3VR8A 4XBFB 3AVSA 3B13A 4DR6T 4AXPA 2J47A 3T1HT 2EHOC 3BQLA 2M6IA 1OWAA 1LRZA 1FEWA 5DABA 5AQNB 2XQ8A 5JDQA 3ETUA 2YINA 5EZYE 3ZYKA 1YQ3A 3BK9A 2VVSA 3I1AA 5KDMC 3R6NA 4CXWA 3LK42 2RPAA 2W4XA 1M62A 4G2AA 3RKOA 1E2AA 3MXZA 3PUZF 4PNIA 2ZM8A 1LVFA 2NTYA 2RA1A 3ZT7A 4EB6E 4EXTA 4O2BE 4CQIA 1L0VA 5AQPB 2NW7A 2WU5A 4Z91A 4HFEA 4EZHA 2UXXB 5JREA 2K24A 3KFWX 4B3RT 3IHRA 5FVKA 2V5DA 1WCRA 3ZSTA 2Y48B 4IGUA 4G63A 3L8RA 3SFEA 3Q2MA 2Q9QD 5JQGE 1VCTA 3FHNA 4DV1T 2G0UA 2FBWA 2YKSA 2ACZA 3PU8A 3FXEB 5AQOB 1VCSA 3ZEFB 3OVUA 2IDOB 1X9BA 1YKEB 4CN1A 3UUXB 3A8YC 2UXCT 2BZBA 4N78D 3HL6A 3UQ4A 5HYAA 4L5GA 1OXZA 1HCIA 4DVDA 4XAXB 3N9PA 4O4IE 1IZNB 2JQHA 3PUSA 2K5BB 2NWBA 1ZV4X 5ABGA 1MNEA 2DI4A 5HXRA 3LDQB 3AEEA 5KMGP 4PJJA 5BR8T 4LMKA 3DP7A 4BJMA 3OYZA 4HFCA 2CBIA 2H3RA 5AQKB 2WZIA 5LXTE 4CI1B 5L3FB 1DU2A 3ZJ1A 4ZHQE 2VVNA 3E08A 1HG2A 2V7MA 2EHOB 2RP4A 1MMAA 4LFBT 3UU4A 5CFBA 4ILUA 4KX6A 3ZPOA 5LMNT 1NEKA 1YXRA 3OJAA 2V8SV 2LSJA 4HTEA 3QB5A 4QH5A 4Z8XA 4H63H 3MK7C 4I50E 3UFGA 3X1DA 4X20E 2W63A 1KNZA 2X9HA 2WCAA 3T1YT 1D0XA 4I43B 2P9BA 3IBPA 2BVMA 3UUMA 3UU6A 3RF1A 3VU7H 4ZI3D 3SFDA 3Q5DA 3GN5A 4EV6A 4DBRA 2LOSA 3EAMA 2C5KT 2HPLA 2CM0A 1YQ4A 3MZKB 1KNRA 1QLBA 3PTRB 3RGLA 4LF4T 4GOUA 2VWAA 3IEEA 2LSKA 3H37A 3AEBA 2DHRA 2IIUA 2LM2A 4JEHB 4AI6A 2BS2A 4LMJA 2WB5A 3RKGA 3AEDA 4CN6A 5C2TA 4JYAT 3KV5A 5FXVA 4ZEYA 4A56A 1ZEEA 4IDNA 2H88A 4KBMB 2CWOA 3RH3A 4YSYA 3J7Yq 2JPFA 4LF7T 3AE1A 4H9RC 3C4WA 2DLRA 5AQGB 1YW0A 2DNXA 3AA7B 3L39A 4YLHA 4DR1T 3I0OA 5JRCB 4TZ4C 2EHOD 2V7KA 2QA7A 3AE5A 3ONXA 3UU8A 4E7SA 5FMNA 3LFMA 2JQKA 3VRBA 2D5UA 3UULA 2LRLA 3KVBA 2BBHA 5M4YA 3EI0A 3AE7A 3FXDB 3F57A 2YEVC 4M1PA 2NTXA 1MMDA 5EK2A 3P4RA 3CMLA 1XNQT 1J1JA 3RC3A 4C90A 2LKGA 4WBNE 4UVAB 3WAJA 4DV7T 2QVAA 3N9MA 2YDQA 3CX8B 4HFDA 2V6YA 2ES0A 1D1AA 2LM9A 2ODUA 3N5LA 4H9QC 4JI0T 4PW8A 4ILCA 4WYVA 4HWIB 3CVRA 4OHFA 3F2EA 2Q9QC 4IDOA 2WY2A 5CGMA 3KV9A 4DUYT 1FIOA 1WRDA 4A97A 5KXJA 3ONJA 5LP6E 2BG9A 3PJAA 2XUEA 1SE7A 4QXCB 4HFHA 2PJQA 2YU1A 4IL9A 2XY8B 4O2AE 3OYXA 1WYBA 2V5CA 3R84B 1N34T 3CK6A 3ZMUB 4DNDA 3RYFE 3RYIE 3V5UA 4H63V 5J2UE 4L0RA 2X9WA 2ZM2A 5EK3A 3VKGA 5IHYA 4P1NA 1HS7A 3KV4A 4U7YA 2UXDT 2MAWA 1OEDC 3C4XA 3PUAA 4QXBB 2N2NA 3AXJA 1W0AA 3BQKA 5L4EA 2W00A 4HWFA 5JDNA 3Q5WA 1ZOYA 4X1KE 2ZM6T 4HWHA 5F3JA 4LF8T 4X1IE 3CX7B 4IT4A 5L47A 2W62A 3K3QC 2YK0A 3KVAA 3AA0B 3O1IA 2D2SA 3C98B 2W0GA 3P4QA 4ZI3C 4I0UA 1XWMA 3ONLC 1Z8UA 5A1LA 2WQYA 5HWXA 4JUYA 3RYHE 3RHWA 5J2TE 1ZHCA 3NVOA 5LG4A 2WBLA 2CLYC 4TN7B 3EDUA 3HKCE 4EYUA 4AQFC 5FKYA 1UGOA 4UF0A 2Q9QB 3AAEB 4AKHA 3RLFF 2ZMAA 5LOVE 3ZYMA 3TLSA 2D0TA 2YDRA 4WNKA 5GONE 4ZXLA 3UUBA 1T98A 2VKHA 3KBTA 3FZFB 4OYKA 3W15B 1WYCA 1S94A 3QC9A 3PUXF 5AQUB 1X79A 3L3PA 3QOFA 5DQWA 4U3CA 4WW0A 5LG3A 3C50A 4DV2T 4GYSA 4TNVA 3PURA 3HA4A 2XQYA 2J1DG 2R6GF 3AECA 3ESLA 4K0UA 2JRKA 4WBOA 4Z90A 4JI8T 3DTOA 2PFVA 2X9YA 2Z6EA 4QH1A 1T8BA 3K8PC 1EZ3A 2HPJA 2F4VT 4OYJA 5L2LA 5LYJE 2PTFA 2WAUA 1B7TA 5HXHA 4DMWA 3JC6D 3N2KE 4ZI7E 3HKEE 2X0LB 5FL0A 2B76A 2JQ9A 2CBJA 1YKHB 5AQTB 4B3MT 2JMKA 4NUUA 3N2GE 3CPZA 4IHJE 2JJ9A 5AQHB 1E1HB 4FJOA 4YTNA 3ZT5A 1IJ6A 1OEDB 2D9DA 1VRBA 2MTQA 5AQMB 2C0SA 4K0KT 4ZOLE 5HCMA 5AQRB 3LK2B 4AISA 2W2UA 2H7OA 3NBXX 4PK5A 4LF5T 2E9XA 1HR0T 3OTOT 2X51A 5C8YE 5IWAT 2FJBA 5HWYA 4C91A 5KX5E 3AEGA 3ZC1A 3UU3A 4NXMT 3L09A 4OX9T 3PUWF 5FNVE 4YFSA 5L3GB 2XAJB 3NRXA 5EK4A 3RI5A 4ERRA 2KWIB 1SA0E 4EIWA 5ABEA 3UT5E 2WZHA 4HGAA 4EEDA 2KSRA 3T8OA 4KHPT 3U78A 2BKPA 4LFAT 5LHHB 4HFBA 5JDGA 2CLYB 2WDVA 4DR7T 2A72A 3LG7A 4COFA 3QNUA 4QWNB 4CI3B 5HXEA 4IE6A 5IUXA 1HNXT 2A9UA 2UUBT 2DWGA 5LBQB 2VASA 3N9LA 2LKHA 2PBIA 4QX7B 5E0OA 5F8PA 1MMGA 5H6RB 2E5LT 5ABFB 4ZZCA 4KI0F 3K1SA 1BR0A 5L4HA 1HX1B 2XM1A 2X68A 3H3MA 2Y6XA 4ZZBA 2WMNA 3NZPA 1XMOT 4V1Av 1IBLT 2CE7A 4MBQA 2VL8A 4AKGA 4CI2B 3NZQA 3RIUA 3AE6A 3CQXC 3FBLA 3JAFA 3KINB 3ZJ2A 1IAPA 4ZS3A 2KXPB 2E2AA 3ZCJA 4QKNA 2LT3A 3ZCIA 3P50A 4HKAA 4ILAA 3ZMSB 3AEAA 4IE7A 2VKDA 3A5XA 2XQ5A 2XZEA 3Q5EA 3F31A 2CWYA 4U31A 3TKLB 2JIWA 2E5VA 5FXWA 4IL4A 5IYZE 3MKDA 3UQ7A 3JADA 1BR1A 2MBGA 2BVLA 2FJAA 3B57A 2XQAA 1XMQT 2C5JA 1US7B 3PJAJ 3OPCA 1AJ3A 4BA9A 2WMOA 3UTKA 4TWHA 3ANWA 3I0QA 4JI6T 4JEUB 1LVKA 3PE0A 3JC6C 5LB7B 3ZMZB 4X66T 3Q9DA 3U3IA 2DL1A 4TWDA 3HI2A 5CB4E 4HWDA 3LSVA 3EVYA 2CMRA 4LFCT 4Q25A 4AKLA 4NPPA 3EHZA 2XQ9A 4MFRA 3S4UA 4ZS2A 3ZYLA 1D1CA 2VQFT 3C51A 4YSZA 2XQ3A 5J1GA 1IJ5A 5C3JA 3J9X1 3AVRA 3KDSE 3NRYA 3RIAA 5AQSB 2VK9A 3VKHA 5LBMA 4HFIA 3MJXA 2W66A 2B1EA 3VR9A 4JBWF 5FXZA 1XDPA 2E9XD 4HFVA 3ZT6A 1J5ET 1W9RA 3HKBE 2KINB 3PU3A 5AQJB 2BG9C 5LA6E 2CXFA 1MIVA 4KMCA 4IDQA 5CA0E 4I4TE 2XQ6A 4MHCA 2VL0A 2QRXA 4U72A 5AQQB 5LCYA 3CIRA 3UFEA 4ISSA 3N2OA 4WZXA 3VRAA 2XHEB 2DCFA 3GN5B 4MLKA 2VKOA 1I94T 1HNWT 2VQET 4YY3T 5L3BB 5LJMA 2UU9T 5LGTB 2XQ7A 3ZN0B 1Y01A 3AE8A 3AE2A 3N9NA 2E8IA 5JTGA 5HCJA 3BQIA 3HKDE 1UX4A 1MIYA 5ABHA 5LMUT 2HHHT 1S35A 1UX5A 3CKDA 4PJNA 5H6QB 1H7CA 1HFAA 1XZYA 2CHOA 4TV8E 2CCQA 3EUHA 3M3ZB 2X9XA 3A7MA 3QUJA 4YSXA 3UUNA 2X0HA 1HX8A 3OKQA 5HEOA 5JDHA 5DJQC 3AAAB 5LHIB 2WS3A 3M65A 2IHR1 2L9QA 1NWMX 4UV8B 4DR4T 1BR2A 4J2CA 3IF8B 4FI5A 3RPUA 2GK9A 4O8SA 1KF6A 1U4QA 1VOMA 2V1DB 5AQFB 4P0BA 2X66A 4ANJA 1KK7A 4E7ZA 3SWHA 1KNPA 1T72A 4DV3T 4XZCA 2XAHB 2XTLA 3RC8A 5LJNA 2V6YB 4U33A 1NENA 5ETWA 1E7PA 2DWKA 2LSGA 3SOLA 5JDLA 2MPKA 3TLUA 1WR0A 4H9OC 1O3XA 4X64T 1LKXA 3VHLA 4IE4A 3RYCE 2EHOA 2L3LA 3O9XA 1FMWA 5L3CB 5L3EB 4DV6T 1W0BA 2ZM0A 2BG9B 5L3DB 2UXBT 4NUVA 2OA5A 4H9SE 4IDZA 3V5SA 2V7JA 5AFUL 3O1JA 2WU2A 1MMNA 4ZI2D 3MA9A 1OEDE 3C4ZA 2I0MA 4HE8A 1N36T 4DR3T 1MNDA 2CHNA 3RQUA 4YJ2E 4PK6A 3QK6A 3AE3A 3NWIA 4TNWA 3PV0F 4IREA 1QSDA 2NR4A 3NKZA 4UVCB 3GWHA 2QYWA 4IE5A 1HG5A 5AQVB 2H89A 2XAGB 4UXNB 3ZLIA 5TAOA 2WP9A 1SUMB 4KHZF 2WDRA 4O4HE 4DIDB 3D0TA 3P7IA 4PFPA 5ADXL 3LBXA 4HEAA 4PAGA 5AQIB 5FXXA 4UIGA 4DMVA 2I59A 1I6ZA 4CXYA 3AXJB 2NW9A 4TV9E 3JCFA 4YTMA 2E9XC 2CXLA 1YD8G 2LRKA 1Z0PA 4KUMB 2FUPA 3AA6B 5JRCA 1KFYA 1D1BA 3ABVA 2LOPA 2MYSA 1G73A 2WWUA 2UUAT 2OV9A 2HH7A 4DV0T 4YTPA 3CQCB 4L9IA 4P0AA 2V26A 2HN2A 4GKJT 2KZ7B 4DR5T 3ETVA 3K3OA 2A2FX 2XQ4A 5HEHA 1WLXA 2BKNA 3TLTA 4UEMA 1ZKEA 5JDMA 1UK5A 3KBUA 2IMLA 2VB6A 3UU5A 5JH7E 3ZMTB 1JNRA 4U74A 3PUYF 2IC6A 3AE4A 5BMVE 4UF0B 1CUNA 1XNRT 3PUQA 4DBQA 3AEFA 3P4WA 2XSBA 5J0ZA 3PUVF 4MALA 3I9YA 4X1YE 3KV6A 4JI5T 1WR6A 3ZSSA 4UV9B 2WWVA 4UR9A 4EEBA 4CN4A 4PJMA 4GK0E 3E22E 2XAQB 4GKKT 1XDOA 5HAXA 3CQGB 2YDSA 2IUBA 4H9NC 2I6HA 5LNKA 4JI2T 2SPCA 3JAEA 1KEYA 2XASB 2H7VC 4B3ST 2KNDA 2AE9A 2ODVA 3RIUC 2VURA 1U5PA 2YOEA 1FMVA 1BR4A 4YHHT 4BAYB 2LHNA 1FJGT 4YXDA 4ILBA 2JQQA 1QUUA 2V7LA 3FZKB 3O1HA 4U2ZA 3SRZA 4EAHA 1HTJF 4B3TT 2N1GA 5JR9A 3TLWA 4LMLA 1R8IA 2BKOA 3AA1B 3AE9A 4UELA 4NIQA 2HN1A 4EZ4A 4BJNA 2LEHA 4EGWA 5FY1A 4YJ3E 4IE0A 2FJEA 4KP3C 2E9XB 4IIJE 5JR9C 4X65T 1N33T 3LBXB 4AKRB 2PG8A 5FY0A 3ZKRA 2Y8DA 4A5XA 4O4LE 4ADZA 4UVBB 4AQGA 3P8CD 2OLTA 2J4GA 4ZI2C 1GQEA 2NP9A 3AAIA 5CA1E 4NXNT 2WSSV 3E0ZA 2KLQA 3CWZB 3MACA 3FZMB 2J62A 1J5WA 3PDYA 4QXHB 4QHOA 4X5TA 5LHGB 1UUSA 4TX5A 5FL1A 3WI3A 2W61A 4O4JE 3N9OA 3G06A 5LGUB 5HEGA 1M7KA 2IW5B 3ZC0A 1UCUA 3OBVE 1MIWA 2Q9QA 1JNZA 4PJLA 4P09A 3RRCA 1NAFA 2NOXA 1UURA 3C64A 4GIWA 3QB5K 4H9PC 4IDPA 5AQLB 5DQVA 3PUGA 5CJ5A 3RQWA 2V7IA 5FYMA 4CZZB 4DR2T 4JI4T 2A3DA 5HXCA 4EOZB 4X62T 4F8HA 4PFOA 4DO0A 3FZLB 4HN9A 3N9QA 2WM9A 5JDFA 4QH4A 4DV4T 3LK3B 2QGSA 2CA5A 5FP3A 3TLVA 3EDVA 2IC9A 2FJDA 2M6BA 4AQYT 2CEAA 2LE8A 2AXDS 2NW8A 2K3WA 4I55E 4ISTA 1SHZC 2LSYA 5HEUA 2YU2A 2L8KA 4QX8B 1T7SA 1IBKT 4DV5T 4LF9T 3K3NA 2W67A 3FB2A 4TWFA 1IBMT 2XSAA 3HR0A 4DUZT 3WAKA 4JV5T 2JMHA 4OK0A 1OEDA 1Y64B 2LLYA 3EABA 4AKIA 2BBJA 5JR9B 3B5MA 2X67A 4TUYE 3CX6B 2CPTA 5FY7A 3RRWA 2C5IT 4GYRA 2MOZA 4GK5E 3SS1A 3GMIA 2WDQA 5LGNB 3ZN1B
chains in the Genus database with same CATH topology
4M1PA 4B6XA 2NTXA 2WMNA 1MMDA 2BDEA 4UVCB 5EK2A 3NZPA 3GWHA 4V1Av 3CMLA 4IE5A 1HG5A 2CE7A 4MBQA 4ASKA 3DJBA 5JVDE 2VL8A 3RC3A 4AKGA 4CI2B 4JLEA 2XAGB 3NZQA 4C90A 3LJCA 4UXNB 3ZLIA 5HXSA 4OFZA 4WBNE 4UVAB 3WAJA 2LSIA 5TAOA 2ZLYA 3CQXC 3FBLA 2ACXA 3N9MA 3CX8B 3KINB 3ANWB 4O4HE 2ES0A 3ZJ2A 1IAPA 2K9AA 4ZS3A 1D1AA 2KXPB 2IAKA 2LM9A 2ODUA 1D0ZA 3D0TA 3P7IA 4PFPA 5ADXL 3LBXA 3ZCJA 4QKNA 4HEAA 3N5LA 4H9QC 4PAGA 2KWHA 2KT9A 2LT3A 4PW8A 5FXXA 2CXDA 3CVRA 4UIGA 3ZCIA 4DMVA 4F6RC 3GA8A 2I59A 3F2EA 4OHFA 4YHJA 2Q9QC 4CXXA 4HKAA 4CXYA 3RX6A 2NW9A 3KV9A 4AQFA 1FIOA 4TV9E 1WRDA 3ZMSB 4IE7A 2VKDA 2E9XC 3A5XA 5LP6E 2CXLA 2K48A 2XUEA 2M67A 2VKJA 1YD8G 1G8XA 4QXCB 2LHRA 3F31A 2PJQA 2CWYA 1Z0PA 2YU1A 3I9WA 4KUMB 3TKLB 2XAFB 4O2AE 3OYXA 4PK4A 2N9DA 1WYBA 3AA6B 5JRCA 5FXWA 1D1BA 3R84B 2LOPA 2MYSA 5IYZE 3H3AA 2LJLA 1G73A 2WWUA 3MKDA 2HH7A 4EYYR 3ZMUB 3Q5XA 1BR1A 2KMFA 4DNDA 3RYFE 3RYIE 3CQCB 4L9IA 3ZMVB 3V5UA 2D0UA 4P0AA 2MBGA 4H63V 2V26A 5J2UE 1V9DA 1D0YA 2KZ7B 4L0RA 3ETVA 3K3OA 1HF8A 2A2FX 2BVLA 2UXNB 3FBZA 1WLXA 3O4XE 4UEMA 1ZKEA 3AB3B 3B57A 5JDMA 3KBUA 2C5JA 1US7B 4XBFB 2VB6A 2X9WA 2ZM2A 3AVSA 3B13A 1AJ3A 5EK3A 4BA9A 3VKGA 5JH7E 3ZMTB 5IHYA 4AXPA 2WMOA 3UTKA 4U74A 2IC6A 3ANWA 2EHOC 3I0QA 3BQLA 4JEUB 5BMVE 1HS7A 3KV4A 4UF0B 1LVKA 1CUNA 1OWAA 3PE0A 3JC6C 1LRZA 1FEWA 5DABA 3ZMZB 3PUQA 4DBQA 3Q9DA 3C4XA 3PUAA 5JDQA 3ETUA 4QXBB 3U3IA 2YINA 5EZYE 3ZYKA 4MALA 3BK9A 2N2NA 3I9YA 3I1AA 4X1YE 5KDMC 3KV6A 3BQKA 3HI2A 5CB4E 1WR6A 3R6NA 4CXWA 4UV9B 3LK42 3EVYA 2W00A 2CMRA 5JDNA 4PJMA 4GK0E 3E22E 4AKLA 2XAQB 3Q5WA 4G2AA 4X1KE 3RKOA 4MFRA 3MXZA 5HAXA 3CQGB 3S4UA 4PNIA 5F3JA 4H9NC 4ZS2A 2ZM8A 4X1IE 3ZYLA 1LVFA 3CX7B 5LNKA 1D1CA 3C51A 2NTYA 2SPCA 2RA1A 2W62A 3K3QC 5J1GA 4EB6E 2XASB 1IJ5A 2H7VC 2YK0A 4O2BE 4EXTA 2KNDA 3KVAA 4CQIA 3AA0B 2NW7A 3O1IA 3J9X1 3AVRA 3KDSE 2ODVA 2D2SA 4EZHA 1U5PA 1FMVA 3C98B 2W0GA 2UXXB 4ZI3C 1BR4A 4BAYB 5JREA 2K24A 3KFWX 2LHNA 3IHRA 3NRYA 5A1LA 5HWXA 4JUYA 2JQQA 1QUUA 2V7LA 2Y48B 4IGUA 3O1HA 3SRZA 4G63A 4EAHA 3Q2MA 2Q9QD 3RYHE 5JQGE 5J2TE 1ZHCA 1HTJF 2VK9A 3VKHA 3FHNA 5LG4A 5LBMA 3MJXA 2WBLA 2B1EA 2N1GA 5JR9A 5FXZA 2CLYC 4TN7B 2G0UA 3EDUA 3HKCE 4EYUA 2E9XD 4HFVA 3AA1B 4UELA 4AQFC 3PU8A 3HKBE 2KINB 4EZ4A 3FXEB 3PU3A 4UF0A 2Q9QB 3AAEB 4BJNA 2LEHA 5FY1A 3ZEFB 4AKHA 4YJ3E 5LA6E 2ZMAA 4IE0A 5LOVE 2CXFA 1MIVA 3ZYMA 4KMCA 2D0TA 5GONE 4WNKA 4I4TE 5CA0E 4MHCA 1YKEB 1T98A 4KP3C 2E9XB 2VKHA 3KBTA 3UUXB 4IIJE 4OYKA 5JR9C 2BZBA 3W15B 1WYCA 1S94A 4N78D 3HL6A 3LBXB 3QC9A 4AKRB 2PG8A 4U72A 5HYAA 1X79A 1OXZA 4L5GA 5FY0A 5LCYA 1HCIA 3L3PA 5DQWA 4DVDA 3UFEA 4WW0A 4ISSA 4XAXB 3N2OA 3N9PA 2XHEB 2DCFA 3C50A 1IZNB 3GN5B 4MLKA 2VKOA 4O4IE 2Y8DA 4GYSA 3PUSA 4O4LE 5L3BB 5LJMA 2K5BB 4ADZA 4UVBB 2NWBA 4AQGA 3P8CD 3PURA 5LGTB 3HA4A 1ZV4X 2XQYA 1MNEA 2J1DG 2DI4A 3ZN0B 5HXRA 3N9NA 2E8IA 3ESLA 4ZI2C 2NP9A 4K0UA 5KMGP 3AAIA 2JRKA 4PJJA 4WBOA 5CA1E 2WSSV 3DTOA 2PFVA 3DP7A 4BJMA 2X9YA 2Z6EA 3E0ZA 3BQIA 3HKDE 2KLQA 1UX4A 3OYZA 3CWZB 3K8PC 1EZ3A 2HPJA 3MACA 4OYJA 5L2LA 5LYJE 1MIYA 2WAUA 1S35A 2H3RA 1B7TA 3PDYA 1UX5A 5HXHA 3CKDA 4DMWA 5LXTE 3JC6D 4QXHB 3N2KE 4PJNA 5H6QB 4CI1B 4ZI7E 5L3FB 1H7CA 4QHOA 3HKEE 1HFAA 2X0LB 4TV8E 3ZJ1A 4ZHQE 5LHGB 3E08A 2CCQA 4TX5A 1HG2A 2V7MA 3EUHA 3WI3A 2X9XA 2EHOB 1YKHB 2RP4A 1MMAA 2W61A 3QUJA 4O4JE 3N9OA 4ILUA 2JMKA 3ZPOA 5LGUB 4NUUA 3UUNA 3N2GE 1HX8A 3OKQA 2IW5B 3CPZA 4IHJE 2JJ9A 5JDHA 1E1HB 4FJOA 3OJAA 1IJ6A 5DJQC 3ZC0A 1UCUA 2LSJA 4HTEA 3AAAB 3OBVE 1VRBA 5LHIB 4Z8XA 2MTQA 4H63H 1MIWA 2C0SA 2Q9QA 3M65A 3MK7C 4I50E 2L9QA 4X20E 4ZOLE 4PJLA 2W63A 1KNZA 2X9HA 4P09A 3RRCA 3LK2B 1D0XA 1NAFA 2NOXA 2H7OA 4I43B 3NBXX 1NWMX 3C64A 2P9BA 4PK5A 4UV8B 4GIWA 1BR2A 2E9XA 3IBPA 2BVMA 4J2CA 3IF8B 4FI5A 3RPUA 2GK9A 2X51A 4O8SA 3UUMA 5C8YE 4H9PC 5HWYA 1U4QA 4C91A 1VOMA 5KX5E 5DQVA 3PUGA 3VU7H 4ZI3D 2V7IA 5FYMA 3ZC1A 2V1DB 4CZZB 4P0BA 3GN5A 2X66A 2A3DA 4DBRA 4ANJA 5HXCA 1KK7A 2LOSA 3L09A 2C5KT 4EOZB 4E7ZA 2HPLA 2CM0A 5FNVE 4PFOA 3MZKB 4DO0A 3PTRB 4YFSA 4HN9A 3SWHA 5L3GB 3N9QA 4GOUA 2VWAA 2WM9A 4XZCA 2XAJB 3IEEA 3NRXA 5EK4A 2LSKA 5JDFA 4ERRA 2XAHB 2XTLA 2KWIB 3H37A 3RC8A 1SA0E 4EIWA 5LJNA 2DHRA 3LK3B 3UT5E 2QGSA 4JEHB 4AI6A 2CA5A 5FP3A 4HGAA 3EDVA 5ETWA 2IC9A 2CEAA 2LE8A 2DWKA 3T8OA 2LSGA 2NW8A 3SOLA 5JDLA 4I55E 3U78A 4ISTA 3KV5A 1SHZC 5LHHB 4H9OC 1O3XA 2LSYA 5JDGA 2YU2A 1LKXA 5FXVA 3VHLA 2L8KA 2CLYB 4A56A 4QX8B 1ZEEA 4IE4A 2A72A 3K3NA 3LG7A 4KBMB 3FB2A 3RYCE 2CWOA 2EHOA 2L3LA 3RH3A 3O9XA 1FMWA 3HR0A 5L3CB 5L3EB 4QWNB 2ZM0A 3WAKA 5L3DB 4CI3B 5HXEA 3J7Yq 2JPFA 4IE6A 4NUVA 2JMHA 4OK0A 4H9RC 3C4WA 2DLRA 1YW0A 2DNXA 1Y64B 3AA7B 2DWGA 4YLHA 4AKIA 2OA5A 5LBQB 2VASA 3I0OA 4H9SE 5JR9B 3N9LA 2PBIA 4QX7B 4IDZA 3V5SA 5E0OA 2V7JA 5F8PA 5JRCB 2X67A 4TZ4C 2EHOD 4TUYE 5AFUL 1MMGA 2V7KA 3O1JA 1MMNA 2QA7A 3CX6B 3ONXA 5H6RB 4E7SA 5FMNA 3LFMA 4ZI2D 5FY7A 3RRWA 2C5IT 3MA9A 3C4ZA 4HE8A 2D5UA 3UULA 4GYRA 1BR0A 2MOZA 4GK5E 3KVBA 3SS1A 1MNDA 4YJ2E 3GMIA 4PK6A 3QK6A 5M4YA 2X68A 3FXDB 3F57A 2YEVC 5LGNB 2Y6XA 3ZN1B 1QSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 C;  5JR9 A;  3ZC0 A;  5JRE A;  5JRC B;  5JRC A;  3ZC1 A;  5JR9 B; 
#chains in the Genus database with same CATH topology
 4B6X A;  4A98 A;  2BDE A;  2BS4 A;  4AIU A;  4ASK A;  3DJB A;  5JVD E;  4JLE A;  3LJC A;  5HXS A;  4OFZ A;  2LSI A;  2ZLY A;  4LF6 T;  3IA3 A;  2ACX A;  3ANW B;  1CHU A;  2XJ7 A;  4JI3 T;  1WFD A;  2K9A A;  2IAK A;  1D0Z A;  4JI7 T;  4YT0 A;  2KWH A;  2KT9 A;  1N32 T;  4HWC A;  2CXD A;  4F6R C;  3GA8 A;  4YHJ A;  2BS3 A;  4CXX A;  3RX6 A;  3FZH B;  3P4S A;  4AQF A;  2UUC T;  5HEJ A;  3P4P A;  1W09 A;  2K48 A;  2CRB A;  2M67 A;  2VKJ A;  4U7I A;  1G8X A;  2LHR A;  4U2Y A;  3I9W A;  1ZP0 A;  2XAF B;  4PK4 A;  1HNZ T;  2N9D A;  5F5W A;  2BG9 E;  3H3A A;  2LJL A;  2XM2 A;  5ABF A;  3RIF A;  2V6X A;  4JI1 T;  4EYY R;  3Q5X A;  2KMF A;  3ZMV B;  2D0U A;  1V9D A;  1D0Y A;  2XPK A;  2YN6 A;  1HF8 A;  2X0Y A;  5FVL A;  2UXN B;  3FBZ A;  3O4X E;  3AB3 B;  3VR8 A;  4XBF B;  3AVS A;  3B13 A;  4DR6 T;  4AXP A;  2J47 A;  3T1H T;  2EHO C;  3BQL A;  2M6I A;  1OWA A;  1LRZ A;  1FEW A;  5DAB A;  5AQN B;  2XQ8 A;  5JDQ A;  3ETU A;  2YIN A;  5EZY E;  3ZYK A;  1YQ3 A;  3BK9 A;  2VVS A;  3I1A A;  5KDM C;  3R6N A;  4CXW A;  3LK4 2;  2RPA A;  2W4X A;  1M62 A;  4G2A A;  3RKO A;  1E2A A;  3MXZ A;  3PUZ F;  4PNI A;  2ZM8 A;  1LVF A;  2NTY A;  2RA1 A;  3ZT7 A;  4EB6 E;  4EXT A;  4O2B E;  4CQI A;  1L0V A;  5AQP B;  2NW7 A;  2WU5 A;  4Z91 A;  4HFE A;  4EZH A;  2UXX B;  5JRE A;  2K24 A;  3KFW X;  4B3R T;  3IHR A;  5FVK A;  2V5D A;  1WCR A;  3ZST A;  2Y48 B;  4IGU A;  4G63 A;  3L8R A;  3SFE A;  3Q2M A;  2Q9Q D;  5JQG E;  1VCT A;  3FHN A;  4DV1 T;  2G0U A;  2FBW A;  2YKS A;  2ACZ A;  3PU8 A;  3FXE B;  5AQO B;  1VCS A;  3ZEF B;  3OVU A;  2IDO B;  1X9B A;  1YKE B;  4CN1 A;  3UUX B;  3A8Y C;  2UXC T;  2BZB A;  4N78 D;  3HL6 A;  3UQ4 A;  5HYA A;  4L5G A;  1OXZ A;  1HCI A;  4DVD A;  4XAX B;  3N9P A;  4O4I E;  1IZN B;  2JQH A;  3PUS A;  2K5B B;  2NWB A;  1ZV4 X;  5ABG A;  1MNE A;  2DI4 A;  5HXR A;  3LDQ B;  3AEE A;  5KMG P;  4PJJ A;  5BR8 T;  4LMK A;  3DP7 A;  4BJM A;  3OYZ A;  4HFC A;  2CBI A;  2H3R A;  5AQK B;  2WZI A;  5LXT E;  4CI1 B;  5L3F B;  1DU2 A;  3ZJ1 A;  4ZHQ E;  2VVN A;  3E08 A;  1HG2 A;  2V7M A;  2EHO B;  2RP4 A;  1MMA A;  4LFB T;  3UU4 A;  5CFB A;  4ILU A;  4KX6 A;  3ZPO A;  5LMN T;  1NEK A;  1YXR A;  3OJA A;  2V8S V;  2LSJ A;  4HTE A;  3QB5 A;  4QH5 A;  4Z8X A;  4H63 H;  3MK7 C;  4I50 E;  3UFG A;  3X1D A;  4X20 E;  2W63 A;  1KNZ A;  2X9H A;  2WCA A;  3T1Y T;  1D0X A;  4I43 B;  2P9B A;  3IBP A;  2BVM A;  3UUM A;  3UU6 A;  3RF1 A;  3VU7 H;  4ZI3 D;  3SFD A;  3Q5D A;  3GN5 A;  4EV6 A;  4DBR A;  2LOS A;  3EAM A;  2C5K T;  2HPL A;  2CM0 A;  1YQ4 A;  3MZK B;  1KNR A;  1QLB A;  3PTR B;  3RGL A;  4LF4 T;  4GOU A;  2VWA A;  3IEE A;  2LSK A;  3H37 A;  3AEB A;  2DHR A;  2IIU A;  2LM2 A;  4JEH B;  4AI6 A;  2BS2 A;  4LMJ A;  2WB5 A;  3RKG A;  3AED A;  4CN6 A;  5C2T A;  4JYA T;  3KV5 A;  5FXV A;  4ZEY A;  4A56 A;  1ZEE A;  4IDN A;  2H88 A;  4KBM B;  2CWO A;  3RH3 A;  4YSY A;  3J7Y q;  2JPF A;  4LF7 T;  3AE1 A;  4H9R C;  3C4W A;  2DLR A;  5AQG B;  1YW0 A;  2DNX A;  3AA7 B;  3L39 A;  4YLH A;  4DR1 T;  3I0O A;  5JRC B;  4TZ4 C;  2EHO D;  2V7K A;  2QA7 A;  3AE5 A;  3ONX A;  3UU8 A;  4E7S A;  5FMN A;  3LFM A;  2JQK A;  3VRB A;  2D5U A;  3UUL A;  2LRL A;  3KVB A;  2BBH A;  5M4Y A;  3EI0 A;  3AE7 A;  3FXD B;  3F57 A;  2YEV C;  4M1P A;  2NTX A;  1MMD A;  5EK2 A;  3P4R A;  3CML A;  1XNQ T;  1J1J A;  3RC3 A;  4C90 A;  2LKG A;  4WBN E;  4UVA B;  3WAJ A;  4DV7 T;  2QVA A;  3N9M A;  2YDQ A;  3CX8 B;  4HFD A;  2V6Y A;  2ES0 A;  1D1A A;  2LM9 A;  2ODU A;  3N5L A;  4H9Q C;  4JI0 T;  4PW8 A;  4ILC A;  4WYV A;  4HWI B;  3CVR A;  4OHF A;  3F2E A;  2Q9Q C;  4IDO A;  2WY2 A;  5CGM A;  3KV9 A;  4DUY T;  1FIO A;  1WRD A;  4A97 A;  5KXJ A;  3ONJ A;  5LP6 E;  2BG9 A;  3PJA A;  2XUE A;  1SE7 A;  4QXC B;  4HFH A;  2PJQ A;  2YU1 A;  4IL9 A;  2XY8 B;  4O2A E;  3OYX A;  1WYB A;  2V5C A;  3R84 B;  1N34 T;  3CK6 A;  3ZMU B;  4DND A;  3RYF E;  3RYI E;  3V5U A;  4H63 V;  5J2U E;  4L0R A;  2X9W A;  2ZM2 A;  5EK3 A;  3VKG A;  5IHY A;  4P1N A;  1HS7 A;  3KV4 A;  4U7Y A;  2UXD T;  2MAW A;  1OED C;  3C4X A;  3PUA A;  4QXB B;  2N2N A;  3AXJ A;  1W0A A;  3BQK A;  5L4E A;  2W00 A;  4HWF A;  5JDN A;  3Q5W A;  1ZOY A;  4X1K E;  2ZM6 T;  4HWH A;  5F3J A;  4LF8 T;  4X1I E;  3CX7 B;  4IT4 A;  5L47 A;  2W62 A;  3K3Q C;  2YK0 A;  3KVA A;  3AA0 B;  3O1I A;  2D2S A;  3C98 B;  2W0G A;  3P4Q A;  4ZI3 C;  4I0U A;  1XWM A;  3ONL C;  1Z8U A;  5A1L A;  2WQY A;  5HWX A;  4JUY A;  3RYH E;  3RHW A;  5J2T E;  1ZHC A;  3NVO A;  5LG4 A;  2WBL A;  2CLY C;  4TN7 B;  3EDU A;  3HKC E;  4EYU A;  4AQF C;  5FKY A;  1UGO A;  4UF0 A;  2Q9Q B;  3AAE B;  4AKH A;  3RLF F;  2ZMA A;  5LOV E;  3ZYM A;  3TLS A;  2D0T A;  2YDR A;  4WNK A;  5GON E;  4ZXL A;  3UUB A;  1T98 A;  2VKH A;  3KBT A;  3FZF B;  4OYK A;  3W15 B;  1WYC A;  1S94 A;  3QC9 A;  3PUX F;  5AQU B;  1X79 A;  3L3P A;  3QOF A;  5DQW A;  4U3C A;  4WW0 A;  5LG3 A;  3C50 A;  4DV2 T;  4GYS A;  4TNV A;  3PUR A;  3HA4 A;  2XQY A;  2J1D G;  2R6G F;  3AEC A;  3ESL A;  4K0U A;  2JRK A;  4WBO A;  4Z90 A;  4JI8 T;  3DTO A;  2PFV A;  2X9Y A;  2Z6E A;  4QH1 A;  1T8B A;  3K8P C;  1EZ3 A;  2HPJ A;  2F4V T;  4OYJ A;  5L2L A;  5LYJ E;  2PTF A;  2WAU A;  1B7T A;  5HXH A;  4DMW A;  3JC6 D;  3N2K E;  4ZI7 E;  3HKE E;  2X0L B;  5FL0 A;  2B76 A;  2JQ9 A;  2CBJ A;  1YKH B;  5AQT B;  4B3M T;  2JMK A;  4NUU A;  3N2G E;  3CPZ A;  4IHJ E;  2JJ9 A;  5AQH B;  1E1H B;  4FJO A;  4YTN A;  3ZT5 A;  1IJ6 A;  1OED B;  2D9D A;  1VRB A;  2MTQ A;  5AQM B;  2C0S A;  4K0K T;  4ZOL E;  5HCM A;  5AQR B;  3LK2 B;  4AIS A;  2W2U A;  2H7O A;  3NBX X;  4PK5 A;  4LF5 T;  2E9X A;  1HR0 T;  3OTO T;  2X51 A;  5C8Y E;  5IWA T;  2FJB A;  5HWY A;  4C91 A;  5KX5 E;  3AEG A;  3ZC1 A;  3UU3 A;  4NXM T;  3L09 A;  4OX9 T;  3PUW F;  5FNV E;  4YFS A;  5L3G B;  2XAJ B;  3NRX A;  5EK4 A;  3RI5 A;  4ERR A;  2KWI B;  1SA0 E;  4EIW A;  5ABE A;  3UT5 E;  2WZH A;  4HGA A;  4EED A;  2KSR A;  3T8O A;  4KHP T;  3U78 A;  2BKP A;  4LFA T;  5LHH B;  4HFB A;  5JDG A;  2CLY B;  2WDV A;  4DR7 T;  2A72 A;  3LG7 A;  4COF A;  3QNU A;  4QWN B;  4CI3 B;  5HXE A;  4IE6 A;  5IUX A;  1HNX T;  2A9U A;  2UUB T;  2DWG A;  5LBQ B;  2VAS A;  3N9L A;  2LKH A;  2PBI A;  4QX7 B;  5E0O A;  5F8P A;  1MMG A;  5H6R B;  2E5L T;  5ABF B;  4ZZC A;  4KI0 F;  3K1S A;  1BR0 A;  5L4H A;  1HX1 B;  2XM1 A;  2X68 A;  3H3M A;  2Y6X A;  4ZZB A;  2WMN A;  3NZP A;  1XMO T;  4V1A v;  1IBL T;  2CE7 A;  4MBQ A;  2VL8 A;  4AKG A;  4CI2 B;  3NZQ A;  3RIU A;  3AE6 A;  3CQX C;  3FBL A;  3JAF A;  3KIN B;  3ZJ2 A;  1IAP A;  4ZS3 A;  2KXP B;  2E2A A;  3ZCJ A;  4QKN A;  2LT3 A;  3ZCI A;  3P50 A;  4HKA A;  4ILA A;  3ZMS B;  3AEA A;  4IE7 A;  2VKD A;  3A5X A;  2XQ5 A;  2XZE A;  3Q5E A;  3F31 A;  2CWY A;  4U31 A;  3TKL B;  2JIW A;  2E5V A;  5FXW A;  4IL4 A;  5IYZ E;  3MKD A;  3UQ7 A;  3JAD A;  1BR1 A;  2MBG A;  2BVL A;  2FJA A;  3B57 A;  2XQA A;  1XMQ T;  2C5J A;  1US7 B;  3PJA J;  3OPC A;  1AJ3 A;  4BA9 A;  2WMO A;  3UTK A;  4TWH A;  3ANW A;  3I0Q A;  4JI6 T;  4JEU B;  1LVK A;  3PE0 A;  3JC6 C;  5LB7 B;  3ZMZ B;  4X66 T;  3Q9D A;  3U3I A;  2DL1 A;  4TWD A;  3HI2 A;  5CB4 E;  4HWD A;  3LSV A;  3EVY A;  2CMR A;  4LFC T;  4Q25 A;  4AKL A;  4NPP A;  3EHZ A;  2XQ9 A;  4MFR A;  3S4U A;  4ZS2 A;  3ZYL A;  1D1C A;  2VQF T;  3C51 A;  4YSZ A;  2XQ3 A;  5J1G A;  1IJ5 A;  5C3J A;  3J9X 1;  3AVR A;  3KDS E;  3NRY A;  3RIA A;  5AQS B;  2VK9 A;  3VKH A;  5LBM A;  4HFI A;  3MJX A;  2W66 A;  2B1E A;  3VR9 A;  4JBW F;  5FXZ A;  1XDP A;  2E9X D;  4HFV A;  3ZT6 A;  1J5E T;  1W9R A;  3HKB E;  2KIN B;  3PU3 A;  5AQJ B;  2BG9 C;  5LA6 E;  2CXF A;  1MIV A;  4KMC A;  4IDQ A;  5CA0 E;  4I4T E;  2XQ6 A;  4MHC A;  2VL0 A;  2QRX A;  4U72 A;  5AQQ B;  5LCY A;  3CIR A;  3UFE A;  4ISS A;  3N2O A;  4WZX A;  3VRA A;  2XHE B;  2DCF A;  3GN5 B;  4MLK A;  2VKO A;  1I94 T;  1HNW T;  2VQE T;  4YY3 T;  5L3B B;  5LJM A;  2UU9 T;  5LGT B;  2XQ7 A;  3ZN0 B;  1Y01 A;  3AE8 A;  3AE2 A;  3N9N A;  2E8I A;  5JTG A;  5HCJ A;  3BQI A;  3HKD E;  1UX4 A;  1MIY A;  5ABH A;  5LMU T;  2HHH T;  1S35 A;  1UX5 A;  3CKD A;  4PJN A;  5H6Q B;  1H7C A;  1HFA A;  1XZY A;  2CHO A;  4TV8 E;  2CCQ A;  3EUH A;  3M3Z B;  2X9X A;  3A7M A;  3QUJ A;  4YSX A;  3UUN A;  2X0H A;  1HX8 A;  3OKQ A;  5HEO A;  5JDH A;  5DJQ C;  3AAA B;  5LHI B;  2WS3 A;  3M65 A;  2IHR 1;  2L9Q A;  1NWM X;  4UV8 B;  4DR4 T;  1BR2 A;  4J2C A;  3IF8 B;  4FI5 A;  3RPU A;  2GK9 A;  4O8S A;  1KF6 A;  1U4Q A;  1VOM A;  2V1D B;  5AQF B;  4P0B A;  2X66 A;  4ANJ A;  1KK7 A;  4E7Z A;  3SWH A;  1KNP A;  1T72 A;  4DV3 T;  4XZC A;  2XAH B;  2XTL A;  3RC8 A;  5LJN A;  2V6Y B;  4U33 A;  1NEN A;  5ETW A;  1E7P A;  2DWK A;  2LSG A;  3SOL A;  5JDL A;  2MPK A;  3TLU A;  1WR0 A;  4H9O C;  1O3X A;  4X64 T;  1LKX A;  3VHL A;  4IE4 A;  3RYC E;  2EHO A;  2L3L A;  3O9X A;  1FMW A;  5L3C B;  5L3E B;  4DV6 T;  1W0B A;  2ZM0 A;  2BG9 B;  5L3D B;  2UXB T;  4NUV A;  2OA5 A;  4H9S E;  4IDZ A;  3V5S A;  2V7J A;  5AFU L;  3O1J A;  2WU2 A;  1MMN A;  4ZI2 D;  3MA9 A;  1OED E;  3C4Z A;  2I0M A;  4HE8 A;  1N36 T;  4DR3 T;  1MND A;  2CHN A;  3RQU A;  4YJ2 E;  4PK6 A;  3QK6 A;  3AE3 A;  3NWI A;  4TNW A;  3PV0 F;  4IRE A;  1QSD A;  2NR4 A;  3NKZ A;  4UVC B;  3GWH A;  2QYW A;  4IE5 A;  1HG5 A;  5AQV B;  2H89 A;  2XAG B;  4UXN B;  3ZLI A;  5TAO A;  2WP9 A;  1SUM B;  4KHZ F;  2WDR A;  4O4H E;  4DID B;  3D0T A;  3P7I A;  4PFP A;  5ADX L;  3LBX A;  4HEA A;  4PAG A;  5AQI B;  5FXX A;  4UIG A;  4DMV A;  2I59 A;  1I6Z A;  4CXY A;  3AXJ B;  2NW9 A;  4TV9 E;  3JCF A;  4YTM A;  2E9X C;  2CXL A;  1YD8 G;  2LRK A;  1Z0P A;  4KUM B;  2FUP A;  3AA6 B;  5JRC A;  1KFY A;  1D1B A;  3ABV A;  2LOP A;  2MYS A;  1G73 A;  2WWU A;  2UUA T;  2OV9 A;  2HH7 A;  4DV0 T;  4YTP A;  3CQC B;  4L9I A;  4P0A A;  2V26 A;  2HN2 A;  4GKJ T;  2KZ7 B;  4DR5 T;  3ETV A;  3K3O A;  2A2F X;  2XQ4 A;  5HEH A;  1WLX A;  2BKN A;  3TLT A;  4UEM A;  1ZKE A;  5JDM A;  1UK5 A;  3KBU A;  2IML A;  2VB6 A;  3UU5 A;  5JH7 E;  3ZMT B;  1JNR A;  4U74 A;  3PUY F;  2IC6 A;  3AE4 A;  5BMV E;  4UF0 B;  1CUN A;  1XNR T;  3PUQ A;  4DBQ A;  3AEF A;  3P4W A;  2XSB A;  5J0Z A;  3PUV F;  4MAL A;  3I9Y A;  4X1Y E;  3KV6 A;  4JI5 T;  1WR6 A;  3ZSS A;  4UV9 B;  2WWV A;  4UR9 A;  4EEB A;  4CN4 A;  4PJM A;  4GK0 E;  3E22 E;  2XAQ B;  4GKK T;  1XDO A;  5HAX A;  3CQG B;  2YDS A;  2IUB A;  4H9N C;  2I6H A;  5LNK A;  4JI2 T;  2SPC A;  3JAE A;  1KEY A;  2XAS B;  2H7V C;  4B3S T;  2KND A;  2AE9 A;  2ODV A;  3RIU C;  2VUR A;  1U5P A;  2YOE A;  1FMV A;  1BR4 A;  4YHH T;  4BAY B;  2LHN A;  1FJG T;  4YXD A;  4ILB A;  2JQQ A;  1QUU A;  2V7L A;  3FZK B;  3O1H A;  4U2Z A;  3SRZ A;  4EAH A;  1HTJ F;  4B3T T;  2N1G A;  5JR9 A;  3TLW A;  4LML A;  1R8I A;  2BKO A;  3AA1 B;  3AE9 A;  4UEL A;  4NIQ A;  2HN1 A;  4EZ4 A;  4BJN A;  2LEH A;  4EGW A;  5FY1 A;  4YJ3 E;  4IE0 A;  2FJE A;  4KP3 C;  2E9X B;  4IIJ E;  5JR9 C;  4X65 T;  1N33 T;  3LBX B;  4AKR B;  2PG8 A;  5FY0 A;  3ZKR A;  2Y8D A;  4A5X A;  4O4L E;  4ADZ A;  4UVB B;  4AQG A;  3P8C D;  2OLT A;  2J4G A;  4ZI2 C;  1GQE A;  2NP9 A;  3AAI A;  5CA1 E;  4NXN T;  2WSS V;  3E0Z A;  2KLQ A;  3CWZ B;  3MAC A;  3FZM B;  2J62 A;  1J5W A;  3PDY A;  4QXH B;  4QHO A;  4X5T A;  5LHG B;  1UUS A;  4TX5 A;  5FL1 A;  3WI3 A;  2W61 A;  4O4J E;  3N9O A;  3G06 A;  5LGU B;  5HEG A;  1M7K A;  2IW5 B;  3ZC0 A;  1UCU A;  3OBV E;  1MIW A;  2Q9Q A;  1JNZ A;  4PJL A;  4P09 A;  3RRC A;  1NAF A;  2NOX A;  1UUR A;  3C64 A;  4GIW A;  3QB5 K;  4H9P C;  4IDP A;  5AQL B;  5DQV A;  3PUG A;  5CJ5 A;  3RQW A;  2V7I A;  5FYM A;  4CZZ B;  4DR2 T;  4JI4 T;  2A3D A;  5HXC A;  4EOZ B;  4X62 T;  4F8H A;  4PFO A;  4DO0 A;  3FZL B;  4HN9 A;  3N9Q A;  2WM9 A;  5JDF A;  4QH4 A;  4DV4 T;  3LK3 B;  2QGS A;  2CA5 A;  5FP3 A;  3TLV A;  3EDV A;  2IC9 A;  2FJD A;  2M6B A;  4AQY T;  2CEA A;  2LE8 A;  2AXD S;  2NW8 A;  2K3W A;  4I55 E;  4IST A;  1SHZ C;  2LSY A;  5HEU A;  2YU2 A;  2L8K A;  4QX8 B;  1T7S A;  1IBK T;  4DV5 T;  4LF9 T;  3K3N A;  2W67 A;  3FB2 A;  4TWF A;  1IBM T;  2XSA A;  3HR0 A;  4DUZ T;  3WAK A;  4JV5 T;  2JMH A;  4OK0 A;  1OED A;  1Y64 B;  2LLY A;  3EAB A;  4AKI A;  2BBJ A;  5JR9 B;  3B5M A;  2X67 A;  4TUY E;  3CX6 B;  2CPT A;  5FY7 A;  3RRW A;  2C5I T;  4GYR A;  2MOZ A;  4GK5 E;  3SS1 A;  3GMI A;  2WDQ A;  5LGN B;  3ZN1 B; 
#chains in the Genus database with same CATH homology
 4M1P A;  4B6X A;  2NTX A;  2WMN A;  1MMD A;  2BDE A;  4UVC B;  5EK2 A;  3NZP A;  3GWH A;  4V1A v;  3CML A;  4IE5 A;  1HG5 A;  2CE7 A;  4MBQ A;  4ASK A;  3DJB A;  5JVD E;  2VL8 A;  3RC3 A;  4AKG A;  4CI2 B;  4JLE A;  2XAG B;  3NZQ A;  4C90 A;  3LJC A;  4UXN B;  3ZLI A;  5HXS A;  4OFZ A;  4WBN E;  4UVA B;  3WAJ A;  2LSI A;  5TAO A;  2ZLY A;  3CQX C;  3FBL A;  2ACX A;  3N9M A;  3CX8 B;  3KIN B;  3ANW B;  4O4H E;  2ES0 A;  3ZJ2 A;  1IAP A;  2K9A A;  4ZS3 A;  1D1A A;  2KXP B;  2IAK A;  2LM9 A;  2ODU A;  1D0Z A;  3D0T A;  3P7I A;  4PFP A;  5ADX L;  3LBX A;  3ZCJ A;  4QKN A;  4HEA A;  3N5L A;  4H9Q C;  4PAG A;  2KWH A;  2KT9 A;  2LT3 A;  4PW8 A;  5FXX A;  2CXD A;  3CVR A;  4UIG A;  3ZCI A;  4DMV A;  4F6R C;  3GA8 A;  2I59 A;  3F2E A;  4OHF A;  4YHJ A;  2Q9Q C;  4CXX A;  4HKA A;  4CXY A;  3RX6 A;  2NW9 A;  3KV9 A;  4AQF A;  1FIO A;  4TV9 E;  1WRD A;  3ZMS B;  4IE7 A;  2VKD A;  2E9X C;  3A5X A;  5LP6 E;  2CXL A;  2K48 A;  2XUE A;  2M67 A;  2VKJ A;  1YD8 G;  1G8X A;  4QXC B;  2LHR A;  3F31 A;  2PJQ A;  2CWY A;  1Z0P A;  2YU1 A;  3I9W A;  4KUM B;  3TKL B;  2XAF B;  4O2A E;  3OYX A;  4PK4 A;  2N9D A;  1WYB A;  3AA6 B;  5JRC A;  5FXW A;  1D1B A;  3R84 B;  2LOP A;  2MYS A;  5IYZ E;  3H3A A;  2LJL A;  1G73 A;  2WWU A;  3MKD A;  2HH7 A;  4EYY R;  3ZMU B;  3Q5X A;  1BR1 A;  2KMF A;  4DND A;  3RYF E;  3RYI E;  3CQC B;  4L9I A;  3ZMV B;  3V5U A;  2D0U A;  4P0A A;  2MBG A;  4H63 V;  2V26 A;  5J2U E;  1V9D A;  1D0Y A;  2KZ7 B;  4L0R A;  3ETV A;  3K3O A;  1HF8 A;  2A2F X;  2BVL A;  2UXN B;  3FBZ A;  1WLX A;  3O4X E;  4UEM A;  1ZKE A;  3AB3 B;  3B57 A;  5JDM A;  3KBU A;  2C5J A;  1US7 B;  4XBF B;  2VB6 A;  2X9W A;  2ZM2 A;  3AVS A;  3B13 A;  1AJ3 A;  5EK3 A;  4BA9 A;  3VKG A;  5JH7 E;  3ZMT B;  5IHY A;  4AXP A;  2WMO A;  3UTK A;  4U74 A;  2IC6 A;  3ANW A;  2EHO C;  3I0Q A;  3BQL A;  4JEU B;  5BMV E;  1HS7 A;  3KV4 A;  4UF0 B;  1LVK A;  1CUN A;  1OWA A;  3PE0 A;  3JC6 C;  1LRZ A;  1FEW A;  5DAB A;  3ZMZ B;  3PUQ A;  4DBQ A;  3Q9D A;  3C4X A;  3PUA A;  5JDQ A;  3ETU A;  4QXB B;  3U3I A;  2YIN A;  5EZY E;  3ZYK A;  4MAL A;  3BK9 A;  2N2N A;  3I9Y A;  3I1A A;  4X1Y E;  5KDM C;  3KV6 A;  3BQK A;  3HI2 A;  5CB4 E;  1WR6 A;  3R6N A;  4CXW A;  4UV9 B;  3LK4 2;  3EVY A;  2W00 A;  2CMR A;  5JDN A;  4PJM A;  4GK0 E;  3E22 E;  4AKL A;  2XAQ B;  3Q5W A;  4G2A A;  4X1K E;  3RKO A;  4MFR A;  3MXZ A;  5HAX A;  3CQG B;  3S4U A;  4PNI A;  5F3J A;  4H9N C;  4ZS2 A;  2ZM8 A;  4X1I E;  3ZYL A;  1LVF A;  3CX7 B;  5LNK A;  1D1C A;  3C51 A;  2NTY A;  2SPC A;  2RA1 A;  2W62 A;  3K3Q C;  5J1G A;  4EB6 E;  2XAS B;  1IJ5 A;  2H7V C;  2YK0 A;  4O2B E;  4EXT A;  2KND A;  3KVA A;  4CQI A;  3AA0 B;  2NW7 A;  3O1I A;  3J9X 1;  3AVR A;  3KDS E;  2ODV A;  2D2S A;  4EZH A;  1U5P A;  1FMV A;  3C98 B;  2W0G A;  2UXX B;  4ZI3 C;  1BR4 A;  4BAY B;  5JRE A;  2K24 A;  3KFW X;  2LHN A;  3IHR A;  3NRY A;  5A1L A;  5HWX A;  4JUY A;  2JQQ A;  1QUU A;  2V7L A;  2Y48 B;  4IGU A;  3O1H A;  3SRZ A;  4G63 A;  4EAH A;  3Q2M A;  2Q9Q D;  3RYH E;  5JQG E;  5J2T E;  1ZHC A;  1HTJ F;  2VK9 A;  3VKH A;  3FHN A;  5LG4 A;  5LBM A;  3MJX A;  2WBL A;  2B1E A;  2N1G A;  5JR9 A;  5FXZ A;  2CLY C;  4TN7 B;  2G0U A;  3EDU A;  3HKC E;  4EYU A;  2E9X D;  4HFV A;  3AA1 B;  4UEL A;  4AQF C;  3PU8 A;  3HKB E;  2KIN B;  4EZ4 A;  3FXE B;  3PU3 A;  4UF0 A;  2Q9Q B;  3AAE B;  4BJN A;  2LEH A;  5FY1 A;  3ZEF B;  4AKH A;  4YJ3 E;  5LA6 E;  2ZMA A;  4IE0 A;  5LOV E;  2CXF A;  1MIV A;  3ZYM A;  4KMC A;  2D0T A;  5GON E;  4WNK A;  4I4T E;  5CA0 E;  4MHC A;  1YKE B;  1T98 A;  4KP3 C;  2E9X B;  2VKH A;  3KBT A;  3UUX B;  4IIJ E;  4OYK A;  5JR9 C;  2BZB A;  3W15 B;  1WYC A;  1S94 A;  4N78 D;  3HL6 A;  3LBX B;  3QC9 A;  4AKR B;  2PG8 A;  4U72 A;  5HYA A;  1X79 A;  1OXZ A;  4L5G A;  5FY0 A;  5LCY A;  1HCI A;  3L3P A;  5DQW A;  4DVD A;  3UFE A;  4WW0 A;  4ISS A;  4XAX B;  3N2O A;  3N9P A;  2XHE B;  2DCF A;  3C50 A;  1IZN B;  3GN5 B;  4MLK A;  2VKO A;  4O4I E;  2Y8D A;  4GYS A;  3PUS A;  4O4L E;  5L3B B;  5LJM A;  2K5B B;  4ADZ A;  4UVB B;  2NWB A;  4AQG A;  3P8C D;  3PUR A;  5LGT B;  3HA4 A;  1ZV4 X;  2XQY A;  1MNE A;  2J1D G;  2DI4 A;  3ZN0 B;  5HXR A;  3N9N A;  2E8I A;  3ESL A;  4ZI2 C;  2NP9 A;  4K0U A;  5KMG P;  3AAI A;  2JRK A;  4PJJ A;  4WBO A;  5CA1 E;  2WSS V;  3DTO A;  2PFV A;  3DP7 A;  4BJM A;  2X9Y A;  2Z6E A;  3E0Z A;  3BQI A;  3HKD E;  2KLQ A;  1UX4 A;  3OYZ A;  3CWZ B;  3K8P C;  1EZ3 A;  2HPJ A;  3MAC A;  4OYJ A;  5L2L A;  5LYJ E;  1MIY A;  2WAU A;  1S35 A;  2H3R A;  1B7T A;  3PDY A;  1UX5 A;  5HXH A;  3CKD A;  4DMW A;  5LXT E;  3JC6 D;  4QXH B;  3N2K E;  4PJN A;  5H6Q B;  4CI1 B;  4ZI7 E;  5L3F B;  1H7C A;  4QHO A;  3HKE E;  1HFA A;  2X0L B;  4TV8 E;  3ZJ1 A;  4ZHQ E;  5LHG B;  3E08 A;  2CCQ A;  4TX5 A;  1HG2 A;  2V7M A;  3EUH A;  3WI3 A;  2X9X A;  2EHO B;  1YKH B;  2RP4 A;  1MMA A;  2W61 A;  3QUJ A;  4O4J E;  3N9O A;  4ILU A;  2JMK A;  3ZPO A;  5LGU B;  4NUU A;  3UUN A;  3N2G E;  1HX8 A;  3OKQ A;  2IW5 B;  3CPZ A;  4IHJ E;  2JJ9 A;  5JDH A;  1E1H B;  4FJO A;  3OJA A;  1IJ6 A;  5DJQ C;  3ZC0 A;  1UCU A;  2LSJ A;  4HTE A;  3AAA B;  3OBV E;  1VRB A;  5LHI B;  4Z8X A;  2MTQ A;  4H63 H;  1MIW A;  2C0S A;  2Q9Q A;  3M65 A;  3MK7 C;  4I50 E;  2L9Q A;  4X20 E;  4ZOL E;  4PJL A;  2W63 A;  1KNZ A;  2X9H A;  4P09 A;  3RRC A;  3LK2 B;  1D0X A;  1NAF A;  2NOX A;  2H7O A;  4I43 B;  3NBX X;  1NWM X;  3C64 A;  2P9B A;  4PK5 A;  4UV8 B;  4GIW A;  1BR2 A;  2E9X A;  3IBP A;  2BVM A;  4J2C A;  3IF8 B;  4FI5 A;  3RPU A;  2GK9 A;  2X51 A;  4O8S A;  3UUM A;  5C8Y E;  4H9P C;  5HWY A;  1U4Q A;  4C91 A;  1VOM A;  5KX5 E;  5DQV A;  3PUG A;  3VU7 H;  4ZI3 D;  2V7I A;  5FYM A;  3ZC1 A;  2V1D B;  4CZZ B;  4P0B A;  3GN5 A;  2X66 A;  2A3D A;  4DBR A;  4ANJ A;  5HXC A;  1KK7 A;  2LOS A;  3L09 A;  2C5K T;  4EOZ B;  4E7Z A;  2HPL A;  2CM0 A;  5FNV E;  4PFO A;  3MZK B;  4DO0 A;  3PTR B;  4YFS A;  4HN9 A;  3SWH A;  5L3G B;  3N9Q A;  4GOU A;  2VWA A;  2WM9 A;  4XZC A;  2XAJ B;  3IEE A;  3NRX A;  5EK4 A;  2LSK A;  5JDF A;  4ERR A;  2XAH B;  2XTL A;  2KWI B;  3H37 A;  3RC8 A;  1SA0 E;  4EIW A;  5LJN A;  2DHR A;  3LK3 B;  3UT5 E;  2QGS A;  4JEH B;  4AI6 A;  2CA5 A;  5FP3 A;  4HGA A;  3EDV A;  5ETW A;  2IC9 A;  2CEA A;  2LE8 A;  2DWK A;  3T8O A;  2LSG A;  2NW8 A;  3SOL A;  5JDL A;  4I55 E;  3U78 A;  4IST A;  3KV5 A;  1SHZ C;  5LHH B;  4H9O C;  1O3X A;  2LSY A;  5JDG A;  2YU2 A;  1LKX A;  5FXV A;  3VHL A;  2L8K A;  2CLY B;  4A56 A;  4QX8 B;  1ZEE A;  4IE4 A;  2A72 A;  3K3N A;  3LG7 A;  4KBM B;  3FB2 A;  3RYC E;  2CWO A;  2EHO A;  2L3L A;  3RH3 A;  3O9X A;  1FMW A;  3HR0 A;  5L3C B;  5L3E B;  4QWN B;  2ZM0 A;  3WAK A;  5L3D B;  4CI3 B;  5HXE A;  3J7Y q;  2JPF A;  4IE6 A;  4NUV A;  2JMH A;  4OK0 A;  4H9R C;  3C4W A;  2DLR A;  1YW0 A;  2DNX A;  1Y64 B;  3AA7 B;  2DWG A;  4YLH A;  4AKI A;  2OA5 A;  5LBQ B;  2VAS A;  3I0O A;  4H9S E;  5JR9 B;  3N9L A;  2PBI A;  4QX7 B;  4IDZ A;  3V5S A;  5E0O A;  2V7J A;  5F8P A;  5JRC B;  2X67 A;  4TZ4 C;  2EHO D;  4TUY E;  5AFU L;  1MMG A;  2V7K A;  3O1J A;  1MMN A;  2QA7 A;  3CX6 B;  3ONX A;  5H6R B;  4E7S A;  5FMN A;  3LFM A;  4ZI2 D;  5FY7 A;  3RRW A;  2C5I T;  3MA9 A;  3C4Z A;  4HE8 A;  2D5U A;  3UUL A;  4GYR A;  1BR0 A;  2MOZ A;  4GK5 E;  3KVB A;  3SS1 A;  1MND A;  4YJ2 E;  3GMI A;  4PK6 A;  3QK6 A;  5M4Y A;  2X68 A;  3FXD B;  3F57 A;  2YEV C;  5LGN B;  2Y6X A;  3ZN1 B;  1QSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...