3R84B

Structure of the mediator head subcomplex med11/22
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
80
Chain Sequence
SNQALYEKLEQTRTILSVKLAELINITTIADFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Mediator of RNA polymerase II transcription subunit 11
publication title Mediator head subcomplex Med11/22 contains a common helix bundle building block with a specific function in transcription initiation complex stabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 80
sequence length 88
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2011-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r84B00
3R84B 4H63V
chains in the Genus database with same CATH superfamily
1HNWT 2NTYA 4HFEA 2NTXA 3N2GE 5LCYA 1HR0T 3B57A 4FI5A 5LHGB 2W0GA 4JEHB 3AECA 1R8IA 3O1IA 2HN1A 2CBIA 3AA0B 1UGOA 5L47A 5FXZA 4O4JE 2KMFA 1E2AA 2CHOA 3MXZA 5FP3A 3CKDA 5BMVE 5BR8T 1WFDA 2PTFA 1W9RA 4EB6E 3F31A 4AQFC 4YTMA 3AA6B 1FIOA 2UXCT 3CIRA 4YXDA 1IAPA 5FMNA 2OA5A 4DV4T 3AE2A 2ZM8A 3FZLB 4MALA 2JMHA 2WZIA 4IDQA 3Q5WA 4L9IA 4GKKT 1HX1B 3T8OA 1D1CA 5JVDE 3UUNA 2E5VA 4DO0A 3N9LA 3JC6C 4ZI2C 3OTOT 2BG9B 1Y64B 3AEBA 1M7KA 1L0VA 3AVRA 1SUMB 1UURA 1CUNA 5AQTB 4DV5T 3TLWA 2ACXA 3S4UA 1US7B 3P7IA 4UV9B 4NIQA 3QB5K 1G73A 2CXDA 2W00A 4ILBA 5FVLA 4X64T 2CWOA 5JDHA 1WR0A 3ZKRA 2ACZA 2UU9T 2CBJA 4CQIA 2XQAA 3K8PC 3NZPA 3PUXF 2CRBA 5FY1A 1XZYA 2D2SA 1VCTA 4HE8A 4U33A 2BG9E 4IDNA 4WW0A 3W15B 1SA0E 3K3NA 4IDOA 3OVUA 3N9PA 4AKRB 5AQSB 2WQYA 4B3RT 5FL0A 2VKOA 4AKIA 4H9SE 5LA6E 3RC8A 5CGMA 5F5WA 3ZN0B 4CZZB 1NENA 4OYJA 5LYJE 3LK42 3D0TA 2XQ4A 3ZC1A 3N2OA 4H9PC 2MTQA 5ABEA 5KDMC 5EK2A 2IC9A 3ZMVB 3CMLA 4FJOA 5HXSA 1KNRA 4AQGA 5FXXA 5HEJA 5LHHB 5JH7E 5ETWA 4QHOA 2BKPA 4LF8T 5AQGB 5AQIB 5HXRA 3RIUA 3BQIA 4GIWA 3Q5EA 1NAFA 3FB2A 4O4LE 2VKHA 5LJNA 2YEVC 2M6IA 4EXTA 4YLHA 3KV6A 4DMVA 4ZI7E 1W0BA 1T7SA 4TNVA 3CWZB 3RYCE 2V7IA 2WU2A 4Z90A 4GK5E 5DABA 2EHOB 1HF8A 3P4PA 1D0ZA 2LKHA 5LB7B 4CN1A 4MFRA 2AE9A 4HKAA 3ETVA 4DR6T 2BBJA 1QLBA 5L3EB 1KK7A 4JI0T 2PG8A 5F3JA 2DCFA 1G8XA 4U3CA 2E5LT 4LFBT 1EZ3A 3HKDE 3GN5B 1I94T 3P4RA 4EZHA 3RIUC 2I0MA 4ASKA 4LMJA 1FMVA 1ZV4X 4NUUA 3PDYA 1HS7A 1UK5A 1QUUA 5ABFA 4IREA 4YT0A 4JI1T 2HPJA 2LEHA 2C0SA 1U5PA 2LSGA 3C98B 3O9XA 3TLSA 5IUXA 2CEAA 3KBTA 4IGUA 3UU3A 2N2NA 2EHOD 4QX7B 3GMIA 3SFEA 3P4WA 2BVMA 4B3MT 4M1PA 1N36T 2WB5A 3AEFA 4QH4A 2W2UA 4WZXA 3MA9A 4E7ZA 4Q25A 3IA3A 4MHCA 4YSZA 5HXHA 1OEDA 3HL6A 3IHRA 3FZKB 2LSKA 1NEKA 5CA1E 3E22E 2V6XA 2BS2A 2JQ9A 3QC9A 3AB3B 1HNXT 1MNEA 2JMKA 4JV5T 1VRBA 2WWVA 1ZP0A 2JQQA 2UUAT 4UVAB 3EAMA 3L8RA 1HNZT 4HTEA 4JI7T 4DIDB 2DLRA 5HWYA 2R6GF 2CPTA 3PJAJ 3Q5XA 5HAXA 4B3ST 4PJJA 3CQCB 4XZCA 4AKGA 1T8BA 4DBQA 4HGAA 3UFEA 4TUYE 1X79A 4TX5A 4ZI3C 1HTJF 3Q2MA 1UCUA 2XAQB 3U78A 4WNKA 4XBFB 4U72A 3RX6A 4TN7B 3V5UA 1KEYA 4I0UA 5KMGP 2E9XC 1OEDC 3I9WA 4IDPA 3IBPA 1MIVA 4QXCB 2C5KT 3RPUA 1B7TA 2JQKA 4TNWA 3WI3A 1IBMT 2XAFB 5FY7A 4X5TA 2V1DB 4QWNB 3T1YT 2XQYA 3QOFA 2XASB 4WBNE 2VURA 3KVBA 4IE6A 2LHNA 1VOMA 2V26A 4OHFA 4BJNA 3ZMZB 4GKJT 4KBMB 4DR3T 2D9DA 2DNXA 1KF6A 3EI0A 3FBZA 4I50E 4IDZA 1MMGA 2IUBA 1XDPA 4IIJE 4QX8B 3N5LA 4L0RA 3IEEA 4ZEYA 2Y6XA 2NW7A 1FJGT 3AE7A 1DU2A 3NZQA 4TV8E 4H9RC 1D0YA 3K1SA 2CM0A 4HWCA 3AEEA 2WMOA 5EZYE 3PUWF 3FZMB 4V1Av 2NW9A 3ANWB 3Q9DA 5C8YE 2HH7A 2FJDA 4AQYT 4PK6A 2IW5B 2UXDT 4P0AA 3UTKA 3DJBA 5CA0E 4UVCB 2YINA 2CA5A 2JRKA 2CXFA 2HPLA 4ILAA 5AQFB 5JDNA 2WBLA 3ZYLA 2V6YB 1S94A 3KVAA 5JDGA 3AE1A 1V9DA 4DR2T 1YKEB 2LM2A 3L09A 3DP7A 2LSIA 4O4IE 2VQFT 2X0LB 3OYXA 3CQXC 2WCAA 5LXTE 2WDVA 2ZLYA 5FVKA 1ZOYA 3AE9A 4DV2T 4DMWA 1Z8UA 4DV3T 2KT9A 2FJEA 2LKGA 4UF0B 4HWFA 2IC6A 3AXJA 2YU1A 4E7SA 5J2TE 1FEWA 3GWHA 3IF8B 5JQGE 2H3RA 3ZLIA 4HFHA 5L3FB 2MPKA 1ZKEA 4YHJA 2JQHA 4HFDA 4ZXLA 1VCSA 4B6XA 2M67A 2KWIB 2V5DA 4LFCT 4L5GA 2ODUA 4EEDA 4ISTA 3ZT7A 2Z6EA 1GQEA 4CXWA 1IJ5A 2E2AA 2K9AA 2XQ7A 4ZZBA 2LSYA 3BQKA 4PJNA 4LF6T 1WLXA 2VWAA 3C4XA 4X65T 1T98A 1YQ3A 3ZT5A 2Q9QA 5EK3A 5AQMB 4TV9E 2QA7A 5HXEA 1H7CA 2OV9A 2XQ5A 3C64A 3P50A 4GYRA 4BJMA 4JI5T 2A3DA 5L2LA 3CX6B 3NRYA 5HXCA 4JI4T 1ZEEA 4BAYB 2K5BB 2K3WA 5GONE 3UUMA 1LVKA 2QYWA 1HFAA 3RI5A 2YOEA 3UUBA 3R6NA 4EGWA 1XWMA 4HFIA 3AA1B 3ONLC 5LG3A 2X9XA 2VK9A 3OPCA 3RYHE 5LBQB 4YSYA 5AFUL 4QH5A 2BKOA 3UUXB 3WAKA 2CLYC 3G06A 3PUYF 4TWDA 4DV1T 4Z8XA 3WAJA 2V7MA 5JDMA 3VR8A 4EYYR 3MKDA 5LBMA 5H6QB 1JNZA 1LKXA 4F6RC 2LJLA 2ES0A 2Q9QC 3CX7B 5FXWA 2OLTA 2YDSA 2BS3A 2LE8A 5LOVE 3ZMUB 3M65A 2X0YA 4KX6A 4ANJA 2W63A 5J0ZA 4YJ3E 3RKGA 3BQLA 3P4SA 4IL9A 3C4WA 2W61A 5CFBA 4PJMA 3OBVE 2A2FX 3H3MA 3TKLB 3JC6D 4ZI2D 2XM2A 2XSBA 3B5MA 1MMNA 2VKJA 3EDUA 2VVNA 3RLFF 5IYZE 3CQGB 5AQLB 3FZFB 4U2YA 2N1GA 4HFBA 1IBKT 4EEBA 4CI2B 3EVYA 5AQKB 3UU6A 3ESLA 2VL8A 3OKQA 5DJQC 4DR1T 2D5UA 3AEDA 3L39A 4H9OC 4MBQA 5TAOA 4LFAT 1W0AA 1WYBA 3PE0A 2X51A 4BA9A 1M62A 3UFGA 1MNDA 3O1HA 4JI8T 3PTRB 4ZZCA 3ZC0A 4X1KE 2VVSA 2JJ9A 2XUEA 3L3PA 3JCFA 2I59A 4DUZT 2WDQA 4UVBB 3LK2B 3AEAA 1MMDA 3KV5A 2RA1A 2X66A 3ZYMA 4J2CA 4YTPA 4TWHA 2CE7A 4EIWA 3PV0F 3SOLA 2LLYA 4K0KT 2XZEA 3RGLA 4JI6T 4EV6A 5ABHA 2NP9A 2XQ6A 1IZNB 2CXLA 4PJLA 4UIGA 5CB4E 5F8PA 5LMUT 1YD8G 2X68A 3PUQA 4YTNA 1IBLT 2LRKA 5AQRB 2K24A 3CK6A 3PUZF 2KINB 4AXPA 4U2ZA 2XTLA 2KNDA 4IE7A 1Y01A 3I0QA 1NWMX 5C2TA 3QB5A 5E0OA 1LVFA 3LBXA 4C90A 4OK0A 5AQHB 4KUMB 2B1EA 3SS1A 4HWIB 3ZCJA 3B13A 5EK4A 5FNVE 3E08A 3A8YC 2ZM6T 4IE4A 5DQVA 4G2AA 2F4VT 4YY3T 4COFA 4AKHA 3NKZA 3C4ZA 2DWKA 3F57A 2PJQA 1LRZA 3ZSTA 4MLKA 3RQUA 5AQOB 1D0XA 2M6BA 3N9NA 4EYUA 2XAHB 3HR0A 3UU5A 1O3XA 1BR2A 1OWAA 3RYIE 3PUGA 2NW8A 4EZ4A 3ANWA 4DV6T 2H89A 5ABGA 1IJ6A 2XSAA 5LG4A 2B76A 3HKCE 4CXYA 5L3BB 4UXNB 1SE7A 1X9BA 4EOZB 1FMWA 4LF9T 1S35A 3RKOA 4LMKA 2DL1A 5ABFB 3RIAA 3UULA 4ILUA 1E7PA 1OXZA 1J5ET 3MACA 4DR7T 3QK6A 4XAXB 3JAFA 4U7YA 2V7KA 1YXRA 4PFPA 3UQ4A 2W62A 2WS3A 4QKNA 5HEUA 4AISA 3MJXA 5C3JA 3AAIA 4I43B 4DNDA 4HFVA 3VKGA 1XDOA 3AEGA 3NBXX 4O8SA 2Y8DA 4UF0A 4IE0A 2E9XB 2WZHA 1OEDB 3OJAA 5L4EA 2A9UA 2FBWA 1N33T 4P1NA 3FHNA 2W67A 4F8HA 5FXVA 1N34T 2VB6A 3UT5E 2XQ3A 3ZSSA 1D1AA 5LGUB 5JR9B 3X1DA 4U74A 3T1HT 5JRCB 4HN9A 4IT4A 2I6HA 4WYVA 1KNZA 2FJBA 3GA8A 1XMQT 5J1GA 2V7LA 3RF1A 2YK0A 2WAUA 2BVLA 2BG9A 2BDEA 2CCQA 3KV4A 3SFDA 3ETUA 1OEDE 5AQPB 3FZHB 2IIUA 3VHLA 2E9XD 3E0ZA 3NWIA 2W66A 2K48A 2UUBT 3NRXA 4JUYA 4AQFA 3J7Yq 5A1LA 3HKEE 3ZPOA 5LJMA 2QRXA 4G63A 1BR0A 2NOXA 2BBHA 4CXXA 1HX8A 2J1DG 2JIWA 4YFSA 2J47A 2MYSA 4IL4A 4PNIA 5JTGA 4KMCA 5ADXL 3P4QA 2V7JA 3I1AA 2XQ9A 4QH1A 4JLEA 5JDLA 4ADZA 2NWBA 2YN6A 4JEUB 5AQJB 3KINB 2BG9C 4H63V 3LSVA 4DV7T 3ONJA 2A72A 4UEMA 4AI6A 2HN2A 4UR9A 3H3AA 2BS4A 2FJAA 3J9X1 2VQET 1XNQT 4Z91A 2DI4A 3KDSE 4X62T 4HWHA 2XAGB 2UUCT 2LSJA 2PFVA 4JI2T 3CPZA 3PU8A 3PUVF 2L3LA 1UX5A 2ZMAA 5LNKA 1HCIA 5FL1A 3CVRA 2XM1A 3RRWA 3V5SA 2P9BA 5HYAA 4P0BA 5JDFA 1HG5A 4A5XA 4UV8B 4LF7T 2QVAA 1XMOT 2H7VC 2FUPA 2AXDS 3ZMSB 2UXBT 1QSDA 1UUSA 5FKYA 3PJAA 5JREA 2X67A 3SWHA 5AQQB 1YW0A 2UXXB 4YJ2E 4I4TE 3TLUA 3N2KE 1D1BA 2V8SV 1J5WA 2EHOA 3HI2A 3R84B 2WU5A 1SHZC 1T72A 3ZN1B 2NR4A 3TLTA 3AXJB 2V5CA 5L3DB 2L9QA 1AJ3A 2UXNB 5KX5E 3AVSA 2CMRA 2KZ7B 4U7IA 2ZM0A 1YKHB 3GN5A 4NPPA 5LMNT 3K3QC 3LG7A 3F2EA 2VKDA 3RQWA 2CLYB 3RC3A 3AA7B 3C50A 5L3GB 3VRBA 3EHZA 3ZEFB 1BR4A 2Q9QB 5LGNB 2CWYA 4TZ4C 3CX8B 2WDRA 2D0TA 2VL0A 2X0HA 5IHYA 4UELA 2EHOC 1WR6A 4OFZA 2C5IT 4WBOA 5HCJA 4A97A 4NUVA 4A56A 4PFOA 4ERRA 4CI3B 4AIUA 4C91A 5LHIB 1MMAA 1XNRT 3FBLA 2LRLA 4HEAA 4DR4T 2WM9A 3FXDB 3M3ZB 2G0UA 4N78D 2BZBA 4NXNT 3DTOA 2WY2A 4ZS3A 2L8KA 3EDVA 4GK0E 2DHRA 3ABVA 3AE8A 3HA4A 2QGSA 5LGTB 2IMLA 2MAWA 4KP3C 2W4XA 3UQ7A 4DVDA 3UU4A 2YU2A 2GK9A 3RYFE 3PUAA 4ZHQE 2IDOB 2Q9QD 2YDRA 5FY0A 4KHZF 2KLQA 3AAAB 4CI1B 1JNRA 1WRDA 4O4HE 3FXEB 4KHPT 4IE5A 2MOZA 5JDQA 3U3IA 3UU8A 3OYZA 3PURA 2H88A 3QUJA 1KFYA 1HG2A 2KWHA 2X9HA 1BR1A 3TLVA 1ZHCA 1MIYA 4X66T 3K3OA 2JPFA 2DWGA 2C5JA 4JI3T 3AE6A 1MIWA 3PUSA 3AAEB 4DBRA 4P09A 3P8CD 2J4GA 4LF5T 3RHWA 2WSSV 3AE4A 2H7OA 3LFMA 4U31A 3RIFA 2KSRA 4H63H 2LOSA 4PW8A 4H9QC 3KBUA 3O4XE 4QXBB 1YQ4A 2X9YA 4PK5A 5DQWA 4JBWF 2CHNA 4OX9T 2E9XA 4GOUA 3AE3A 3RRCA 3PU3A 4OYKA 5HWXA 3I0OA 2RPAA 3VRAA 2SPCA 2VASA 4PK4A 3BK9A 3I9YA 2IHR1 3EUHA 5IWAT 4NXMT 4YSXA 5HEHA 4I55E 4DV0T 3VKHA 4QXHB 4A98A 4EAHA 4X20E 4DUYT 2BKNA 5JR9A 2KXPB 2PBIA 4HFCA 3H37A 5LP6E 2MBGA 5JRCA 2YDQA 2XQ8A 4HWDA 4PAGA 2XPKA 2XHEB 2V6YA 3LK3B 2XY8B 3KFWX 4AKLA 4O2BE 2RP4A 1J1JA 3KV9A 1I6ZA 4DR5T 1UX4A 5KXJA 1N32T 4ZS2A 1WCRA 3A5XA 2IAKA 3Q5DA 2XAJB 2XJ7A 1W09A 5CJ5A 3A7MA 1U4QA 2ZM2A 1WYCA 4ZOLE 4K0UA 4B3TT 2LHRA 2X9WA 3JADA 3LBXB 2Y48B 5JR9C 2LM9A 1Z0PA 4TWFA 5AQVB 2J62A 4ILCA 3VR9A 5H6RB 4X1IE 3RH3A 2ODVA 3LDQB 5L3CB 4X1YE 2WMNA 4GYSA 5HEGA 3MZKB 5HEOA 3C51A 3ONXA 4O2AE 3O1JA 4CN6A 3ZMTB 3N9QA 4YHHT 3JAEA 4CN4A 2YKSA 3LJCA 3ZJ2A 2WWUA 5AQUB 5HCMA 3ZT6A 4ZI3D 3SRZA 4H9NC 4LMLA 4LF4T 2LT3A 4JYAT 2LOPA 3NVOA 5J2UE 4ISSA 3AE5A 3EABA 5L4HA 1E1HB 4IHJE 3ZJ1A 3MK7C 4KI0F 5M4YA 5AQNB 2D0UA 2E8IA 3HKBE 2N9DA 3QNUA 3ZCIA 2HHHT 2WP9A 1CHUA 1KNPA 3N9MA 3N9OA 3VU7H 5FYMA 3ZYKA
chains in the Genus database with same CATH topology
2X66A 3ZYMA 4J2CA 5L3DB 2NTYA 2L9QA 3I9WA 2NTXA 1AJ3A 2CE7A 2UXNB 3IBPA 1MIVA 3N2GE 4QXCB 4EIWA 5KX5E 2C5KT 5LCYA 3RPUA 3SOLA 1B7TA 3WI3A 3AVSA 3B57A 2XAFB 2CMRA 2KZ7B 5FY7A 2V1DB 4QWNB 4FI5A 5LHGB 2ZM0A 1YKHB 3GN5A 2W0GA 2XQYA 4JEHB 2NP9A 3K3QC 1IZNB 3O1IA 3LG7A 2XASB 2CXLA 3F2EA 3AA0B 4PJLA 2VKDA 4WBNE 4UIGA 3KVBA 5CB4E 4IE6A 2LHNA 5F8PA 1YD8G 1VOMA 2X68A 3PUQA 2V26A 4OHFA 5FXZA 4BJNA 2CLYB 2KMFA 4O4JE 3ZMZB 3MXZA 4KBMB 5FP3A 3RC3A 3CKDA 5BMVE 2K24A 2KINB 3AA7B 3C50A 2DNXA 4AXPA 4EB6E 3F31A 5L3GB 2XTLA 3FBZA 2KNDA 4AQFC 3ZEFB 1BR4A 3AA6B 4IE7A 1FIOA 2Q9QB 3I0QA 5LGNB 1NWMX 2CWYA 4I50E 4TZ4C 4IDZA 3CX8B 1IAPA 5E0OA 1MMGA 5FMNA 1LVFA 4IIJE 2D0TA 3LBXA 4QX8B 2OA5A 3N5LA 4L0RA 5IHYA 4C90A 4OK0A 4UELA 2ZM8A 2EHOC 3IEEA 4KUMB 4MALA 2JMHA 2Y6XA 2B1EA 1WR6A 2NW7A 4OFZA 3SS1A 2C5IT 4WBOA 3Q5WA 4L9IA 4NUVA 3T8OA 1D1CA 3NZQA 4TV8E 3B13A 4H9RC 3ZCJA 5JVDE 4A56A 1D0YA 5EK4A 2CM0A 4PFOA 3UUNA 4ERRA 4CI3B 5FNVE 4DO0A 2WMOA 3N9LA 4C91A 3E08A 5EZYE 4IE4A 5LHIB 5DQVA 4G2AA 1MMAA 3JC6C 3FBLA 4ZI2C 4HEAA 1Y64B 4AKHA 2WM9A 3FXDB 4V1Av 3AVRA 2NW9A 3ANWB 3Q9DA 2G0UA 5C8YE 2HH7A 3C4ZA 4N78D 2DWKA 3F57A 4PK6A 2IW5B 1CUNA 2BZBA 2PJQA 1LRZA 4P0AA 3UTKA 3DJBA 4MLKA 3DTOA 5CA0E 4ZS3A 4UVCB 2YINA 1D0XA 3N9NA 2CA5A 2JRKA 2L8KA 3EDVA 2CXFA 4EYUA 2HPLA 2XAHB 4GK0E 3HR0A 2DHRA 2ACXA 1O3XA 1BR2A 1OWAA 2QGSA 3HA4A 3RYIE 3S4UA 5JDNA 5LGTB 3PUGA 2WBLA 2NW8A 1US7B 4KP3C 3ZYLA 3P7IA 4UV9B 1G73A 2CXDA 4DVDA 1S94A 2W00A 2YU2A 3ANWA 3KVAA 4EZ4A 5JDGA 1V9DA 1IJ6A 2CWOA 5LG4A 2GK9A 5JDHA 3HKCE 1YKEB 4CXYA 3RYFE 3PUAA 5L3BB 3L09A 4ZHQE 4UXNB 2Q9QD 3DP7A 5FY0A 4CQIA 3K8PC 4EOZB 3NZPA 2LSIA 2KLQA 3AAAB 1FMWA 4O4IE 4CI1B 5FY1A 2X0LB 3OYXA 2D2SA 3CQXC 1S35A 4HE8A 1WRDA 3RKOA 4O4HE 3FXEB 5LXTE 4IE5A 4WW0A 3W15B 2ZLYA 2MOZA 5JDQA 1SA0E 3K3NA 3U3IA 3OYZA 3UULA 3PURA 4ILUA 4DMWA 1OXZA 3QUJA 3N9PA 3MACA 2KT9A 4AKRB 3QK6A 1HG2A 4UF0B 2IC6A 2KWHA 4XAXB 2X9HA 1BR1A 2VKOA 4AKIA 4H9SE 2V7KA 5LA6E 4PFPA 2YU1A 1ZHCA 2W62A 4QKNA 4E7SA 5J2TE 3RC8A 1FEWA 3GWHA 3MJXA 1MIYA 3ZN0B 3AAIA 3IF8B 3K3OA 2JPFA 4CZZB 5JQGE 4I43B 2DWGA 2H3RA 3ZLIA 2C5JA 4OYJA 5LYJE 3LK42 4DNDA 3D0TA 1MIWA 4HFVA 5L3FB 3ZC1A 3VKGA 3N2OA 3PUSA 3AAEB 1ZKEA 3NBXX 4H9PC 3P8CD 4O8SA 4P09A 4YHJA 4DBRA 2MTQA 4B6XA 2Y8DA 2M67A 4UF0A 5KDMC 5EK2A 2KWIB 2IC9A 4IE0A 3CMLA 2E9XB 3ZMVB 4FJOA 5HXSA 2WSSV 2ODUA 4L5GA 4AQGA 2H7OA 3LFMA 3OJAA 4ISTA 5FXXA 5LHHB 5JH7E 5ETWA 2Z6EA 4H63H 4QHOA 4CXWA 2LOSA 4PW8A 4H9QC 1IJ5A 3KBUA 3O4XE 4QXBB 2K9AA 2X9YA 2LSYA 3BQKA 4PK5A 4PJNA 5DQWA 1WLXA 2VWAA 3FHNA 3C4XA 1T98A 2E9XA 5FXVA 5HXRA 2VB6A 4GOUA 3UT5E 3BQIA 4GIWA 3RRCA 2Q9QA 5EK3A 4TV9E 1NAFA 2QA7A 3PU3A 4OYKA 1D1AA 5HXEA 5HWXA 1H7CA 5LGUB 5JR9B 3C64A 3I0OA 3FB2A 4U74A 4O4LE 2VKHA 5JRCB 2SPCA 4HN9A 4GYRA 4BJMA 2VASA 5LJNA 4PK4A 3BK9A 2A3DA 5L2LA 2YEVC 3CX6B 3NRYA 3I9YA 5HXCA 4EXTA 3EUHA 1ZEEA 4BAYB 2K5BB 5GONE 1KNZA 3GA8A 5J1GA 2V7LA 3UUMA 2YK0A 4YLHA 1LVKA 3KV6A 4I55E 1HFAA 2WAUA 4DMVA 2BVLA 4ZI7E 3VKHA 3R6NA 2BDEA 2CCQA 3KV4A 4QXHB 4EAHA 3CWZB 4X20E 3RYCE 2V7IA 3ETUA 5JR9A 3AA1B 4GK5E 2KXPB 5DABA 2EHOB 2PBIA 1HF8A 3VHLA 1D0ZA 2X9XA 2E9XD 3H37A 2MBGA 5LP6E 5JRCA 2VK9A 3E0ZA 4MFRA 3RYHE 5LBQB 4HKAA 2K48A 5AFUL 3ETVA 4PAGA 3NRXA 4JUYA 4AQFA 2XHEB 3J7Yq 5A1LA 3UUXB 3WAKA 3LK3B 5L3EB 1KK7A 3HKEE 3KFWX 3ZPOA 4AKLA 4O2BE 5LJMA 2RP4A 2CLYC 4G63A 2PG8A 1BR0A 5F3JA 2DCFA 1G8XA 2NOXA 3KV9A 4CXXA 1HX8A 2J1DG 4YFSA 1EZ3A 4Z8XA 3WAJA 2V7MA 5JDMA 4EYYR 3MKDA 5LBMA 3HKDE 2MYSA 1UX4A 5H6QB 1LKXA 4PNIA 4F6RC 3GN5B 4KMCA 2LJLA 4EZHA 2ES0A 2Q9QC 4ZS2A 3A5XA 3CX7B 4ASKA 5ADXL 5FXWA 1FMVA 1ZV4X 2V7JA 4NUUA 2LE8A 2IAKA 5LOVE 2XAJB 3PDYA 1HS7A 3ZMUB 3I1AA 3M65A 1QUUA 4JLEA 4ANJA 2HPJA 2LEHA 2W63A 2C0SA 5JDLA 1U4QA 1U5PA 2ZM2A 4ADZA 2LSGA 3C98B 3O9XA 2NWBA 4JEUB 4YJ3E 2CEAA 3KBTA 4IGUA 3KINB 1WYCA 2N2NA 3BQLA 4ZOLE 4H63V 2EHOD 4K0UA 4QX7B 3GMIA 2LHRA 2X9WA 3C4WA 3LBXB 2Y48B 2A72A 5JR9C 2BVMA 4UEMA 4AI6A 2W61A 4M1PA 3H3AA 2LM9A 4PJMA 3OBVE 3J9X1 2A2FX 1Z0PA 3TKLB 5H6RB 4X1IE 2DI4A 3KDSE 3JC6D 4ZI2D 2XAGB 3MA9A 4E7ZA 3RH3A 2ODVA 2LSJA 5L3CB 2PFVA 4X1YE 3CPZA 3PU8A 4MHCA 1MMNA 2VKJA 2WMNA 3EDUA 5HXHA 4GYSA 2L3LA 5IYZE 3MZKB 1UX5A 2ZMAA 3CQGB 3HL6A 3IHRA 1HCIA 5LNKA 3C51A 3ONXA 3CVRA 2N1GA 4O2AE 3RRWA 3V5SA 2P9BA 3O1JA 5HYAA 2LSKA 3ZMTB 3N9QA 4P0BA 5JDFA 5CA1E 3E22E 3QC9A 1HG5A 3AB3B 1MNEA 2JMKA 4UV8B 4CI2B 3LJCA 3ZJ2A 1VRBA 3EVYA 2JQQA 3ESLA 2VL8A 2WWUA 3OKQA 5DJQC 4ZI3D 2D5UA 3SRZA 4H9NC 4UVAB 4H9OC 4MBQA 5TAOA 4HTEA 2H7VC 2LT3A 2LOPA 3ZMSB 5J2UE 1QSDA 2DLRA 4ISSA 5HWYA 3Q5XA 1WYBA 3PE0A 1E1HB 2X51A 5HAXA 4BA9A 4PJJA 3CQCB 4XZCA 4AKGA 4IHJE 4DBQA 5JREA 1MNDA 2X67A 3SWHA 3O1HA 3ZJ1A 1YW0A 3PTRB 2UXXB 3MK7C 4HGAA 4TUYE 3UFEA 3ZC0A 1X79A 4TX5A 4X1KE 5M4YA 4YJ2E 2JJ9A 2XUEA 4I4TE 3L3PA 4ZI3C 3N2KE 1D1BA 2I59A 1HTJF 2D0UA 2E8IA 3Q2MA 3HKBE 1UCUA 2EHOA 2N9DA 2XAQB 3HI2A 3U78A 3ZCIA 3R84B 4WNKA 1SHZC 4XBFB 4U72A 3RX6A 4UVBB 3ZN1B 4TN7B 3LK2B 3V5UA 3N9MA 3N9OA 5KMGP 1MMDA 2E9XC 3KV5A 2RA1A 3VU7H 5FYMA 3ZYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R84 B;  4H63 V; 
#chains in the Genus database with same CATH topology
 1HNW T;  2NTY A;  4HFE A;  2NTX A;  3N2G E;  5LCY A;  1HR0 T;  3B57 A;  4FI5 A;  5LHG B;  2W0G A;  4JEH B;  3AEC A;  1R8I A;  3O1I A;  2HN1 A;  2CBI A;  3AA0 B;  1UGO A;  5L47 A;  5FXZ A;  4O4J E;  2KMF A;  1E2A A;  2CHO A;  3MXZ A;  5FP3 A;  3CKD A;  5BMV E;  5BR8 T;  1WFD A;  2PTF A;  1W9R A;  4EB6 E;  3F31 A;  4AQF C;  4YTM A;  3AA6 B;  1FIO A;  2UXC T;  3CIR A;  4YXD A;  1IAP A;  5FMN A;  2OA5 A;  4DV4 T;  3AE2 A;  2ZM8 A;  3FZL B;  4MAL A;  2JMH A;  2WZI A;  4IDQ A;  3Q5W A;  4L9I A;  4GKK T;  1HX1 B;  3T8O A;  1D1C A;  5JVD E;  3UUN A;  2E5V A;  4DO0 A;  3N9L A;  3JC6 C;  4ZI2 C;  3OTO T;  2BG9 B;  1Y64 B;  3AEB A;  1M7K A;  1L0V A;  3AVR A;  1SUM B;  1UUR A;  1CUN A;  5AQT B;  4DV5 T;  3TLW A;  2ACX A;  3S4U A;  1US7 B;  3P7I A;  4UV9 B;  4NIQ A;  3QB5 K;  1G73 A;  2CXD A;  2W00 A;  4ILB A;  5FVL A;  4X64 T;  2CWO A;  5JDH A;  1WR0 A;  3ZKR A;  2ACZ A;  2UU9 T;  2CBJ A;  4CQI A;  2XQA A;  3K8P C;  3NZP A;  3PUX F;  2CRB A;  5FY1 A;  1XZY A;  2D2S A;  1VCT A;  4HE8 A;  4U33 A;  2BG9 E;  4IDN A;  4WW0 A;  3W15 B;  1SA0 E;  3K3N A;  4IDO A;  3OVU A;  3N9P A;  4AKR B;  5AQS B;  2WQY A;  4B3R T;  5FL0 A;  2VKO A;  4AKI A;  4H9S E;  5LA6 E;  3RC8 A;  5CGM A;  5F5W A;  3ZN0 B;  4CZZ B;  1NEN A;  4OYJ A;  5LYJ E;  3LK4 2;  3D0T A;  2XQ4 A;  3ZC1 A;  3N2O A;  4H9P C;  2MTQ A;  5ABE A;  5KDM C;  5EK2 A;  2IC9 A;  3ZMV B;  3CML A;  4FJO A;  5HXS A;  1KNR A;  4AQG A;  5FXX A;  5HEJ A;  5LHH B;  5JH7 E;  5ETW A;  4QHO A;  2BKP A;  4LF8 T;  5AQG B;  5AQI B;  5HXR A;  3RIU A;  3BQI A;  4GIW A;  3Q5E A;  1NAF A;  3FB2 A;  4O4L E;  2VKH A;  5LJN A;  2YEV C;  2M6I A;  4EXT A;  4YLH A;  3KV6 A;  4DMV A;  4ZI7 E;  1W0B A;  1T7S A;  4TNV A;  3CWZ B;  3RYC E;  2V7I A;  2WU2 A;  4Z90 A;  4GK5 E;  5DAB A;  2EHO B;  1HF8 A;  3P4P A;  1D0Z A;  2LKH A;  5LB7 B;  4CN1 A;  4MFR A;  2AE9 A;  4HKA A;  3ETV A;  4DR6 T;  2BBJ A;  1QLB A;  5L3E B;  1KK7 A;  4JI0 T;  2PG8 A;  5F3J A;  2DCF A;  1G8X A;  4U3C A;  2E5L T;  4LFB T;  1EZ3 A;  3HKD E;  3GN5 B;  1I94 T;  3P4R A;  4EZH A;  3RIU C;  2I0M A;  4ASK A;  4LMJ A;  1FMV A;  1ZV4 X;  4NUU A;  3PDY A;  1HS7 A;  1UK5 A;  1QUU A;  5ABF A;  4IRE A;  4YT0 A;  4JI1 T;  2HPJ A;  2LEH A;  2C0S A;  1U5P A;  2LSG A;  3C98 B;  3O9X A;  3TLS A;  5IUX A;  2CEA A;  3KBT A;  4IGU A;  3UU3 A;  2N2N A;  2EHO D;  4QX7 B;  3GMI A;  3SFE A;  3P4W A;  2BVM A;  4B3M T;  4M1P A;  1N36 T;  2WB5 A;  3AEF A;  4QH4 A;  2W2U A;  4WZX A;  3MA9 A;  4E7Z A;  4Q25 A;  3IA3 A;  4MHC A;  4YSZ A;  5HXH A;  1OED A;  3HL6 A;  3IHR A;  3FZK B;  2LSK A;  1NEK A;  5CA1 E;  3E22 E;  2V6X A;  2BS2 A;  2JQ9 A;  3QC9 A;  3AB3 B;  1HNX T;  1MNE A;  2JMK A;  4JV5 T;  1VRB A;  2WWV A;  1ZP0 A;  2JQQ A;  2UUA T;  4UVA B;  3EAM A;  3L8R A;  1HNZ T;  4HTE A;  4JI7 T;  4DID B;  2DLR A;  5HWY A;  2R6G F;  2CPT A;  3PJA J;  3Q5X A;  5HAX A;  4B3S T;  4PJJ A;  3CQC B;  4XZC A;  4AKG A;  1T8B A;  4DBQ A;  4HGA A;  3UFE A;  4TUY E;  1X79 A;  4TX5 A;  4ZI3 C;  1HTJ F;  3Q2M A;  1UCU A;  2XAQ B;  3U78 A;  4WNK A;  4XBF B;  4U72 A;  3RX6 A;  4TN7 B;  3V5U A;  1KEY A;  4I0U A;  5KMG P;  2E9X C;  1OED C;  3I9W A;  4IDP A;  3IBP A;  1MIV A;  4QXC B;  2C5K T;  3RPU A;  1B7T A;  2JQK A;  4TNW A;  3WI3 A;  1IBM T;  2XAF B;  5FY7 A;  4X5T A;  2V1D B;  4QWN B;  3T1Y T;  2XQY A;  3QOF A;  2XAS B;  4WBN E;  2VUR A;  3KVB A;  4IE6 A;  2LHN A;  1VOM A;  2V26 A;  4OHF A;  4BJN A;  3ZMZ B;  4GKJ T;  4KBM B;  4DR3 T;  2D9D A;  2DNX A;  1KF6 A;  3EI0 A;  3FBZ A;  4I50 E;  4IDZ A;  1MMG A;  2IUB A;  1XDP A;  4IIJ E;  4QX8 B;  3N5L A;  4L0R A;  3IEE A;  4ZEY A;  2Y6X A;  2NW7 A;  1FJG T;  3AE7 A;  1DU2 A;  3NZQ A;  4TV8 E;  4H9R C;  1D0Y A;  3K1S A;  2CM0 A;  4HWC A;  3AEE A;  2WMO A;  5EZY E;  3PUW F;  3FZM B;  4V1A v;  2NW9 A;  3ANW B;  3Q9D A;  5C8Y E;  2HH7 A;  2FJD A;  4AQY T;  4PK6 A;  2IW5 B;  2UXD T;  4P0A A;  3UTK A;  3DJB A;  5CA0 E;  4UVC B;  2YIN A;  2CA5 A;  2JRK A;  2CXF A;  2HPL A;  4ILA A;  5AQF B;  5JDN A;  2WBL A;  3ZYL A;  2V6Y B;  1S94 A;  3KVA A;  5JDG A;  3AE1 A;  1V9D A;  4DR2 T;  1YKE B;  2LM2 A;  3L09 A;  3DP7 A;  2LSI A;  4O4I E;  2VQF T;  2X0L B;  3OYX A;  3CQX C;  2WCA A;  5LXT E;  2WDV A;  2ZLY A;  5FVK A;  1ZOY A;  3AE9 A;  4DV2 T;  4DMW A;  1Z8U A;  4DV3 T;  2KT9 A;  2FJE A;  2LKG A;  4UF0 B;  4HWF A;  2IC6 A;  3AXJ A;  2YU1 A;  4E7S A;  5J2T E;  1FEW A;  3GWH A;  3IF8 B;  5JQG E;  2H3R A;  3ZLI A;  4HFH A;  5L3F B;  2MPK A;  1ZKE A;  4YHJ A;  2JQH A;  4HFD A;  4ZXL A;  1VCS A;  4B6X A;  2M67 A;  2KWI B;  2V5D A;  4LFC T;  4L5G A;  2ODU A;  4EED A;  4IST A;  3ZT7 A;  2Z6E A;  1GQE A;  4CXW A;  1IJ5 A;  2E2A A;  2K9A A;  2XQ7 A;  4ZZB A;  2LSY A;  3BQK A;  4PJN A;  4LF6 T;  1WLX A;  2VWA A;  3C4X A;  4X65 T;  1T98 A;  1YQ3 A;  3ZT5 A;  2Q9Q A;  5EK3 A;  5AQM B;  4TV9 E;  2QA7 A;  5HXE A;  1H7C A;  2OV9 A;  2XQ5 A;  3C64 A;  3P50 A;  4GYR A;  4BJM A;  4JI5 T;  2A3D A;  5L2L A;  3CX6 B;  3NRY A;  5HXC A;  4JI4 T;  1ZEE A;  4BAY B;  2K5B B;  2K3W A;  5GON E;  3UUM A;  1LVK A;  2QYW A;  1HFA A;  3RI5 A;  2YOE A;  3UUB A;  3R6N A;  4EGW A;  1XWM A;  4HFI A;  3AA1 B;  3ONL C;  5LG3 A;  2X9X A;  2VK9 A;  3OPC A;  3RYH E;  5LBQ B;  4YSY A;  5AFU L;  4QH5 A;  2BKO A;  3UUX B;  3WAK A;  2CLY C;  3G06 A;  3PUY F;  4TWD A;  4DV1 T;  4Z8X A;  3WAJ A;  2V7M A;  5JDM A;  3VR8 A;  4EYY R;  3MKD A;  5LBM A;  5H6Q B;  1JNZ A;  1LKX A;  4F6R C;  2LJL A;  2ES0 A;  2Q9Q C;  3CX7 B;  5FXW A;  2OLT A;  2YDS A;  2BS3 A;  2LE8 A;  5LOV E;  3ZMU B;  3M65 A;  2X0Y A;  4KX6 A;  4ANJ A;  2W63 A;  5J0Z A;  4YJ3 E;  3RKG A;  3BQL A;  3P4S A;  4IL9 A;  3C4W A;  2W61 A;  5CFB A;  4PJM A;  3OBV E;  2A2F X;  3H3M A;  3TKL B;  3JC6 D;  4ZI2 D;  2XM2 A;  2XSB A;  3B5M A;  1MMN A;  2VKJ A;  3EDU A;  2VVN A;  3RLF F;  5IYZ E;  3CQG B;  5AQL B;  3FZF B;  4U2Y A;  2N1G A;  4HFB A;  1IBK T;  4EEB A;  4CI2 B;  3EVY A;  5AQK B;  3UU6 A;  3ESL A;  2VL8 A;  3OKQ A;  5DJQ C;  4DR1 T;  2D5U A;  3AED A;  3L39 A;  4H9O C;  4MBQ A;  5TAO A;  4LFA T;  1W0A A;  1WYB A;  3PE0 A;  2X51 A;  4BA9 A;  1M62 A;  3UFG A;  1MND A;  3O1H A;  4JI8 T;  3PTR B;  4ZZC A;  3ZC0 A;  4X1K E;  2VVS A;  2JJ9 A;  2XUE A;  3L3P A;  3JCF A;  2I59 A;  4DUZ T;  2WDQ A;  4UVB B;  3LK2 B;  3AEA A;  1MMD A;  3KV5 A;  2RA1 A;  2X66 A;  3ZYM A;  4J2C A;  4YTP A;  4TWH A;  2CE7 A;  4EIW A;  3PV0 F;  3SOL A;  2LLY A;  4K0K T;  2XZE A;  3RGL A;  4JI6 T;  4EV6 A;  5ABH A;  2NP9 A;  2XQ6 A;  1IZN B;  2CXL A;  4PJL A;  4UIG A;  5CB4 E;  5F8P A;  5LMU T;  1YD8 G;  2X68 A;  3PUQ A;  4YTN A;  1IBL T;  2LRK A;  5AQR B;  2K24 A;  3CK6 A;  3PUZ F;  2KIN B;  4AXP A;  4U2Z A;  2XTL A;  2KND A;  4IE7 A;  1Y01 A;  3I0Q A;  1NWM X;  5C2T A;  3QB5 A;  5E0O A;  1LVF A;  3LBX A;  4C90 A;  4OK0 A;  5AQH B;  4KUM B;  2B1E A;  3SS1 A;  4HWI B;  3ZCJ A;  3B13 A;  5EK4 A;  5FNV E;  3E08 A;  3A8Y C;  2ZM6 T;  4IE4 A;  5DQV A;  4G2A A;  2F4V T;  4YY3 T;  4COF A;  4AKH A;  3NKZ A;  3C4Z A;  2DWK A;  3F57 A;  2PJQ A;  1LRZ A;  3ZST A;  4MLK A;  3RQU A;  5AQO B;  1D0X A;  2M6B A;  3N9N A;  4EYU A;  2XAH B;  3HR0 A;  3UU5 A;  1O3X A;  1BR2 A;  1OWA A;  3RYI E;  3PUG A;  2NW8 A;  4EZ4 A;  3ANW A;  4DV6 T;  2H89 A;  5ABG A;  1IJ6 A;  2XSA A;  5LG4 A;  2B76 A;  3HKC E;  4CXY A;  5L3B B;  4UXN B;  1SE7 A;  1X9B A;  4EOZ B;  1FMW A;  4LF9 T;  1S35 A;  3RKO A;  4LMK A;  2DL1 A;  5ABF B;  3RIA A;  3UUL A;  4ILU A;  1E7P A;  1OXZ A;  1J5E T;  3MAC A;  4DR7 T;  3QK6 A;  4XAX B;  3JAF A;  4U7Y A;  2V7K A;  1YXR A;  4PFP A;  3UQ4 A;  2W62 A;  2WS3 A;  4QKN A;  5HEU A;  4AIS A;  3MJX A;  5C3J A;  3AAI A;  4I43 B;  4DND A;  4HFV A;  3VKG A;  1XDO A;  3AEG A;  3NBX X;  4O8S A;  2Y8D A;  4UF0 A;  4IE0 A;  2E9X B;  2WZH A;  1OED B;  3OJA A;  5L4E A;  2A9U A;  2FBW A;  1N33 T;  4P1N A;  3FHN A;  2W67 A;  4F8H A;  5FXV A;  1N34 T;  2VB6 A;  3UT5 E;  2XQ3 A;  3ZSS A;  1D1A A;  5LGU B;  5JR9 B;  3X1D A;  4U74 A;  3T1H T;  5JRC B;  4HN9 A;  4IT4 A;  2I6H A;  4WYV A;  1KNZ A;  2FJB A;  3GA8 A;  1XMQ T;  5J1G A;  2V7L A;  3RF1 A;  2YK0 A;  2WAU A;  2BVL A;  2BG9 A;  2BDE A;  2CCQ A;  3KV4 A;  3SFD A;  3ETU A;  1OED E;  5AQP B;  3FZH B;  2IIU A;  3VHL A;  2E9X D;  3E0Z A;  3NWI A;  2W66 A;  2K48 A;  2UUB T;  3NRX A;  4JUY A;  4AQF A;  3J7Y q;  5A1L A;  3HKE E;  3ZPO A;  5LJM A;  2QRX A;  4G63 A;  1BR0 A;  2NOX A;  2BBH A;  4CXX A;  1HX8 A;  2J1D G;  2JIW A;  4YFS A;  2J47 A;  2MYS A;  4IL4 A;  4PNI A;  5JTG A;  4KMC A;  5ADX L;  3P4Q A;  2V7J A;  3I1A A;  2XQ9 A;  4QH1 A;  4JLE A;  5JDL A;  4ADZ A;  2NWB A;  2YN6 A;  4JEU B;  5AQJ B;  3KIN B;  2BG9 C;  4H63 V;  3LSV A;  4DV7 T;  3ONJ A;  2A72 A;  4UEM A;  4AI6 A;  2HN2 A;  4UR9 A;  3H3A A;  2BS4 A;  2FJA A;  3J9X 1;  2VQE T;  1XNQ T;  4Z91 A;  2DI4 A;  3KDS E;  4X62 T;  4HWH A;  2XAG B;  2UUC T;  2LSJ A;  2PFV A;  4JI2 T;  3CPZ A;  3PU8 A;  3PUV F;  2L3L A;  1UX5 A;  2ZMA A;  5LNK A;  1HCI A;  5FL1 A;  3CVR A;  2XM1 A;  3RRW A;  3V5S A;  2P9B A;  5HYA A;  4P0B A;  5JDF A;  1HG5 A;  4A5X A;  4UV8 B;  4LF7 T;  2QVA A;  1XMO T;  2H7V C;  2FUP A;  2AXD S;  3ZMS B;  2UXB T;  1QSD A;  1UUS A;  5FKY A;  3PJA A;  5JRE A;  2X67 A;  3SWH A;  5AQQ B;  1YW0 A;  2UXX B;  4YJ2 E;  4I4T E;  3TLU A;  3N2K E;  1D1B A;  2V8S V;  1J5W A;  2EHO A;  3HI2 A;  3R84 B;  2WU5 A;  1SHZ C;  1T72 A;  3ZN1 B;  2NR4 A;  3TLT A;  3AXJ B;  2V5C A;  5L3D B;  2L9Q A;  1AJ3 A;  2UXN B;  5KX5 E;  3AVS A;  2CMR A;  2KZ7 B;  4U7I A;  2ZM0 A;  1YKH B;  3GN5 A;  4NPP A;  5LMN T;  3K3Q C;  3LG7 A;  3F2E A;  2VKD A;  3RQW A;  2CLY B;  3RC3 A;  3AA7 B;  3C50 A;  5L3G B;  3VRB A;  3EHZ A;  3ZEF B;  1BR4 A;  2Q9Q B;  5LGN B;  2CWY A;  4TZ4 C;  3CX8 B;  2WDR A;  2D0T A;  2VL0 A;  2X0H A;  5IHY A;  4UEL A;  2EHO C;  1WR6 A;  4OFZ A;  2C5I T;  4WBO A;  5HCJ A;  4A97 A;  4NUV A;  4A56 A;  4PFO A;  4ERR A;  4CI3 B;  4AIU A;  4C91 A;  5LHI B;  1MMA A;  1XNR T;  3FBL A;  2LRL A;  4HEA A;  4DR4 T;  2WM9 A;  3FXD B;  3M3Z B;  2G0U A;  4N78 D;  2BZB A;  4NXN T;  3DTO A;  2WY2 A;  4ZS3 A;  2L8K A;  3EDV A;  4GK0 E;  2DHR A;  3ABV A;  3AE8 A;  3HA4 A;  2QGS A;  5LGT B;  2IML A;  2MAW A;  4KP3 C;  2W4X A;  3UQ7 A;  4DVD A;  3UU4 A;  2YU2 A;  2GK9 A;  3RYF E;  3PUA A;  4ZHQ E;  2IDO B;  2Q9Q D;  2YDR A;  5FY0 A;  4KHZ F;  2KLQ A;  3AAA B;  4CI1 B;  1JNR A;  1WRD A;  4O4H E;  3FXE B;  4KHP T;  4IE5 A;  2MOZ A;  5JDQ A;  3U3I A;  3UU8 A;  3OYZ A;  3PUR A;  2H88 A;  3QUJ A;  1KFY A;  1HG2 A;  2KWH A;  2X9H A;  1BR1 A;  3TLV A;  1ZHC A;  1MIY A;  4X66 T;  3K3O A;  2JPF A;  2DWG A;  2C5J A;  4JI3 T;  3AE6 A;  1MIW A;  3PUS A;  3AAE B;  4DBR A;  4P09 A;  3P8C D;  2J4G A;  4LF5 T;  3RHW A;  2WSS V;  3AE4 A;  2H7O A;  3LFM A;  4U31 A;  3RIF A;  2KSR A;  4H63 H;  2LOS A;  4PW8 A;  4H9Q C;  3KBU A;  3O4X E;  4QXB B;  1YQ4 A;  2X9Y A;  4PK5 A;  5DQW A;  4JBW F;  2CHN A;  4OX9 T;  2E9X A;  4GOU A;  3AE3 A;  3RRC A;  3PU3 A;  4OYK A;  5HWX A;  3I0O A;  2RPA A;  3VRA A;  2SPC A;  2VAS A;  4PK4 A;  3BK9 A;  3I9Y A;  2IHR 1;  3EUH A;  5IWA T;  4NXM T;  4YSX A;  5HEH A;  4I55 E;  4DV0 T;  3VKH A;  4QXH B;  4A98 A;  4EAH A;  4X20 E;  4DUY T;  2BKN A;  5JR9 A;  2KXP B;  2PBI A;  4HFC A;  3H37 A;  5LP6 E;  2MBG A;  5JRC A;  2YDQ A;  2XQ8 A;  4HWD A;  4PAG A;  2XPK A;  2XHE B;  2V6Y A;  3LK3 B;  2XY8 B;  3KFW X;  4AKL A;  4O2B E;  2RP4 A;  1J1J A;  3KV9 A;  1I6Z A;  4DR5 T;  1UX4 A;  5KXJ A;  1N32 T;  4ZS2 A;  1WCR A;  3A5X A;  2IAK A;  3Q5D A;  2XAJ B;  2XJ7 A;  1W09 A;  5CJ5 A;  3A7M A;  1U4Q A;  2ZM2 A;  1WYC A;  4ZOL E;  4K0U A;  4B3T T;  2LHR A;  2X9W A;  3JAD A;  3LBX B;  2Y48 B;  5JR9 C;  2LM9 A;  1Z0P A;  4TWF A;  5AQV B;  2J62 A;  4ILC A;  3VR9 A;  5H6R B;  4X1I E;  3RH3 A;  2ODV A;  3LDQ B;  5L3C B;  4X1Y E;  2WMN A;  4GYS A;  5HEG A;  3MZK B;  5HEO A;  3C51 A;  3ONX A;  4O2A E;  3O1J A;  4CN6 A;  3ZMT B;  3N9Q A;  4YHH T;  3JAE A;  4CN4 A;  2YKS A;  3LJC A;  3ZJ2 A;  2WWU A;  5AQU B;  5HCM A;  3ZT6 A;  4ZI3 D;  3SRZ A;  4H9N C;  4LML A;  4LF4 T;  2LT3 A;  4JYA T;  2LOP A;  3NVO A;  5J2U E;  4ISS A;  3AE5 A;  3EAB A;  5L4H A;  1E1H B;  4IHJ E;  3ZJ1 A;  3MK7 C;  4KI0 F;  5M4Y A;  5AQN B;  2D0U A;  2E8I A;  3HKB E;  2N9D A;  3QNU A;  3ZCI A;  2HHH T;  2WP9 A;  1CHU A;  1KNP A;  3N9M A;  3N9O A;  3VU7 H;  5FYM A;  3ZYK A; 
#chains in the Genus database with same CATH homology
 2X66 A;  3ZYM A;  4J2C A;  5L3D B;  2NTY A;  2L9Q A;  3I9W A;  2NTX A;  1AJ3 A;  2CE7 A;  2UXN B;  3IBP A;  1MIV A;  3N2G E;  4QXC B;  4EIW A;  5KX5 E;  2C5K T;  5LCY A;  3RPU A;  3SOL A;  1B7T A;  3WI3 A;  3AVS A;  3B57 A;  2XAF B;  2CMR A;  2KZ7 B;  5FY7 A;  2V1D B;  4QWN B;  4FI5 A;  5LHG B;  2ZM0 A;  1YKH B;  3GN5 A;  2W0G A;  2XQY A;  4JEH B;  2NP9 A;  3K3Q C;  1IZN B;  3O1I A;  3LG7 A;  2XAS B;  2CXL A;  3F2E A;  3AA0 B;  4PJL A;  2VKD A;  4WBN E;  4UIG A;  3KVB A;  5CB4 E;  4IE6 A;  2LHN A;  5F8P A;  1YD8 G;  1VOM A;  2X68 A;  3PUQ A;  2V26 A;  4OHF A;  5FXZ A;  4BJN A;  2CLY B;  2KMF A;  4O4J E;  3ZMZ B;  3MXZ A;  4KBM B;  5FP3 A;  3RC3 A;  3CKD A;  5BMV E;  2K24 A;  2KIN B;  3AA7 B;  3C50 A;  2DNX A;  4AXP A;  4EB6 E;  3F31 A;  5L3G B;  2XTL A;  3FBZ A;  2KND A;  4AQF C;  3ZEF B;  1BR4 A;  3AA6 B;  4IE7 A;  1FIO A;  2Q9Q B;  3I0Q A;  5LGN B;  1NWM X;  2CWY A;  4I50 E;  4TZ4 C;  4IDZ A;  3CX8 B;  1IAP A;  5E0O A;  1MMG A;  5FMN A;  1LVF A;  4IIJ E;  2D0T A;  3LBX A;  4QX8 B;  2OA5 A;  3N5L A;  4L0R A;  5IHY A;  4C90 A;  4OK0 A;  4UEL A;  2ZM8 A;  2EHO C;  3IEE A;  4KUM B;  4MAL A;  2JMH A;  2Y6X A;  2B1E A;  1WR6 A;  2NW7 A;  4OFZ A;  3SS1 A;  2C5I T;  4WBO A;  3Q5W A;  4L9I A;  4NUV A;  3T8O A;  1D1C A;  3NZQ A;  4TV8 E;  3B13 A;  4H9R C;  3ZCJ A;  5JVD E;  4A56 A;  1D0Y A;  5EK4 A;  2CM0 A;  4PFO A;  3UUN A;  4ERR A;  4CI3 B;  5FNV E;  4DO0 A;  2WMO A;  3N9L A;  4C91 A;  3E08 A;  5EZY E;  4IE4 A;  5LHI B;  5DQV A;  4G2A A;  1MMA A;  3JC6 C;  3FBL A;  4ZI2 C;  4HEA A;  1Y64 B;  4AKH A;  2WM9 A;  3FXD B;  4V1A v;  3AVR A;  2NW9 A;  3ANW B;  3Q9D A;  2G0U A;  5C8Y E;  2HH7 A;  3C4Z A;  4N78 D;  2DWK A;  3F57 A;  4PK6 A;  2IW5 B;  1CUN A;  2BZB A;  2PJQ A;  1LRZ A;  4P0A A;  3UTK A;  3DJB A;  4MLK A;  3DTO A;  5CA0 E;  4ZS3 A;  4UVC B;  2YIN A;  1D0X A;  3N9N A;  2CA5 A;  2JRK A;  2L8K A;  3EDV A;  2CXF A;  4EYU A;  2HPL A;  2XAH B;  4GK0 E;  3HR0 A;  2DHR A;  2ACX A;  1O3X A;  1BR2 A;  1OWA A;  2QGS A;  3HA4 A;  3RYI E;  3S4U A;  5JDN A;  5LGT B;  3PUG A;  2WBL A;  2NW8 A;  1US7 B;  4KP3 C;  3ZYL A;  3P7I A;  4UV9 B;  1G73 A;  2CXD A;  4DVD A;  1S94 A;  2W00 A;  2YU2 A;  3ANW A;  3KVA A;  4EZ4 A;  5JDG A;  1V9D A;  1IJ6 A;  2CWO A;  5LG4 A;  2GK9 A;  5JDH A;  3HKC E;  1YKE B;  4CXY A;  3RYF E;  3PUA A;  5L3B B;  3L09 A;  4ZHQ E;  4UXN B;  2Q9Q D;  3DP7 A;  5FY0 A;  4CQI A;  3K8P C;  4EOZ B;  3NZP A;  2LSI A;  2KLQ A;  3AAA B;  1FMW A;  4O4I E;  4CI1 B;  5FY1 A;  2X0L B;  3OYX A;  2D2S A;  3CQX C;  1S35 A;  4HE8 A;  1WRD A;  3RKO A;  4O4H E;  3FXE B;  5LXT E;  4IE5 A;  4WW0 A;  3W15 B;  2ZLY A;  2MOZ A;  5JDQ A;  1SA0 E;  3K3N A;  3U3I A;  3OYZ A;  3UUL A;  3PUR A;  4ILU A;  4DMW A;  1OXZ A;  3QUJ A;  3N9P A;  3MAC A;  2KT9 A;  4AKR B;  3QK6 A;  1HG2 A;  4UF0 B;  2IC6 A;  2KWH A;  4XAX B;  2X9H A;  1BR1 A;  2VKO A;  4AKI A;  4H9S E;  2V7K A;  5LA6 E;  4PFP A;  2YU1 A;  1ZHC A;  2W62 A;  4QKN A;  4E7S A;  5J2T E;  3RC8 A;  1FEW A;  3GWH A;  3MJX A;  1MIY A;  3ZN0 B;  3AAI A;  3IF8 B;  3K3O A;  2JPF A;  4CZZ B;  5JQG E;  4I43 B;  2DWG A;  2H3R A;  3ZLI A;  2C5J A;  4OYJ A;  5LYJ E;  3LK4 2;  4DND A;  3D0T A;  1MIW A;  4HFV A;  5L3F B;  3ZC1 A;  3VKG A;  3N2O A;  3PUS A;  3AAE B;  1ZKE A;  3NBX X;  4H9P C;  3P8C D;  4O8S A;  4P09 A;  4YHJ A;  4DBR A;  2MTQ A;  4B6X A;  2Y8D A;  2M67 A;  4UF0 A;  5KDM C;  5EK2 A;  2KWI B;  2IC9 A;  4IE0 A;  3CML A;  2E9X B;  3ZMV B;  4FJO A;  5HXS A;  2WSS V;  2ODU A;  4L5G A;  4AQG A;  2H7O A;  3LFM A;  3OJA A;  4IST A;  5FXX A;  5LHH B;  5JH7 E;  5ETW A;  2Z6E A;  4H63 H;  4QHO A;  4CXW A;  2LOS A;  4PW8 A;  4H9Q C;  1IJ5 A;  3KBU A;  3O4X E;  4QXB B;  2K9A A;  2X9Y A;  2LSY A;  3BQK A;  4PK5 A;  4PJN A;  5DQW A;  1WLX A;  2VWA A;  3FHN A;  3C4X A;  1T98 A;  2E9X A;  5FXV A;  5HXR A;  2VB6 A;  4GOU A;  3UT5 E;  3BQI A;  4GIW A;  3RRC A;  2Q9Q A;  5EK3 A;  4TV9 E;  1NAF A;  2QA7 A;  3PU3 A;  4OYK A;  1D1A A;  5HXE A;  5HWX A;  1H7C A;  5LGU B;  5JR9 B;  3C64 A;  3I0O A;  3FB2 A;  4U74 A;  4O4L E;  2VKH A;  5JRC B;  2SPC A;  4HN9 A;  4GYR A;  4BJM A;  2VAS A;  5LJN A;  4PK4 A;  3BK9 A;  2A3D A;  5L2L A;  2YEV C;  3CX6 B;  3NRY A;  3I9Y A;  5HXC A;  4EXT A;  3EUH A;  1ZEE A;  4BAY B;  2K5B B;  5GON E;  1KNZ A;  3GA8 A;  5J1G A;  2V7L A;  3UUM A;  2YK0 A;  4YLH A;  1LVK A;  3KV6 A;  4I55 E;  1HFA A;  2WAU A;  4DMV A;  2BVL A;  4ZI7 E;  3VKH A;  3R6N A;  2BDE A;  2CCQ A;  3KV4 A;  4QXH B;  4EAH A;  3CWZ B;  4X20 E;  3RYC E;  2V7I A;  3ETU A;  5JR9 A;  3AA1 B;  4GK5 E;  2KXP B;  5DAB A;  2EHO B;  2PBI A;  1HF8 A;  3VHL A;  1D0Z A;  2X9X A;  2E9X D;  3H37 A;  2MBG A;  5LP6 E;  5JRC A;  2VK9 A;  3E0Z A;  4MFR A;  3RYH E;  5LBQ B;  4HKA A;  2K48 A;  5AFU L;  3ETV A;  4PAG A;  3NRX A;  4JUY A;  4AQF A;  2XHE B;  3J7Y q;  5A1L A;  3UUX B;  3WAK A;  3LK3 B;  5L3E B;  1KK7 A;  3HKE E;  3KFW X;  3ZPO A;  4AKL A;  4O2B E;  5LJM A;  2RP4 A;  2CLY C;  4G63 A;  2PG8 A;  1BR0 A;  5F3J A;  2DCF A;  1G8X A;  2NOX A;  3KV9 A;  4CXX A;  1HX8 A;  2J1D G;  4YFS A;  1EZ3 A;  4Z8X A;  3WAJ A;  2V7M A;  5JDM A;  4EYY R;  3MKD A;  5LBM A;  3HKD E;  2MYS A;  1UX4 A;  5H6Q B;  1LKX A;  4PNI A;  4F6R C;  3GN5 B;  4KMC A;  2LJL A;  4EZH A;  2ES0 A;  2Q9Q C;  4ZS2 A;  3A5X A;  3CX7 B;  4ASK A;  5ADX L;  5FXW A;  1FMV A;  1ZV4 X;  2V7J A;  4NUU A;  2LE8 A;  2IAK A;  5LOV E;  2XAJ B;  3PDY A;  1HS7 A;  3ZMU B;  3I1A A;  3M65 A;  1QUU A;  4JLE A;  4ANJ A;  2HPJ A;  2LEH A;  2W63 A;  2C0S A;  5JDL A;  1U4Q A;  1U5P A;  2ZM2 A;  4ADZ A;  2LSG A;  3C98 B;  3O9X A;  2NWB A;  4JEU B;  4YJ3 E;  2CEA A;  3KBT A;  4IGU A;  3KIN B;  1WYC A;  2N2N A;  3BQL A;  4ZOL E;  4H63 V;  2EHO D;  4K0U A;  4QX7 B;  3GMI A;  2LHR A;  2X9W A;  3C4W A;  3LBX B;  2Y48 B;  2A72 A;  5JR9 C;  2BVM A;  4UEM A;  4AI6 A;  2W61 A;  4M1P A;  3H3A A;  2LM9 A;  4PJM A;  3OBV E;  3J9X 1;  2A2F X;  1Z0P A;  3TKL B;  5H6R B;  4X1I E;  2DI4 A;  3KDS E;  3JC6 D;  4ZI2 D;  2XAG B;  3MA9 A;  4E7Z A;  3RH3 A;  2ODV A;  2LSJ A;  5L3C B;  2PFV A;  4X1Y E;  3CPZ A;  3PU8 A;  4MHC A;  1MMN A;  2VKJ A;  2WMN A;  3EDU A;  5HXH A;  4GYS A;  2L3L A;  5IYZ E;  3MZK B;  1UX5 A;  2ZMA A;  3CQG B;  3HL6 A;  3IHR A;  1HCI A;  5LNK A;  3C51 A;  3ONX A;  3CVR A;  2N1G A;  4O2A E;  3RRW A;  3V5S A;  2P9B A;  3O1J A;  5HYA A;  2LSK A;  3ZMT B;  3N9Q A;  4P0B A;  5JDF A;  5CA1 E;  3E22 E;  3QC9 A;  1HG5 A;  3AB3 B;  1MNE A;  2JMK A;  4UV8 B;  4CI2 B;  3LJC A;  3ZJ2 A;  1VRB A;  3EVY A;  2JQQ A;  3ESL A;  2VL8 A;  2WWU A;  3OKQ A;  5DJQ C;  4ZI3 D;  2D5U A;  3SRZ A;  4H9N C;  4UVA B;  4H9O C;  4MBQ A;  5TAO A;  4HTE A;  2H7V C;  2LT3 A;  2LOP A;  3ZMS B;  5J2U E;  1QSD A;  2DLR A;  4ISS A;  5HWY A;  3Q5X A;  1WYB A;  3PE0 A;  1E1H B;  2X51 A;  5HAX A;  4BA9 A;  4PJJ A;  3CQC B;  4XZC A;  4AKG A;  4IHJ E;  4DBQ A;  5JRE A;  1MND A;  2X67 A;  3SWH A;  3O1H A;  3ZJ1 A;  1YW0 A;  3PTR B;  2UXX B;  3MK7 C;  4HGA A;  4TUY E;  3UFE A;  3ZC0 A;  1X79 A;  4TX5 A;  4X1K E;  5M4Y A;  4YJ2 E;  2JJ9 A;  2XUE A;  4I4T E;  3L3P A;  4ZI3 C;  3N2K E;  1D1B A;  2I59 A;  1HTJ F;  2D0U A;  2E8I A;  3Q2M A;  3HKB E;  1UCU A;  2EHO A;  2N9D A;  2XAQ B;  3HI2 A;  3U78 A;  3ZCI A;  3R84 B;  4WNK A;  1SHZ C;  4XBF B;  4U72 A;  3RX6 A;  4UVB B;  3ZN1 B;  4TN7 B;  3LK2 B;  3V5U A;  3N9M A;  3N9O A;  5KMG P;  1MMD A;  2E9X C;  3KV5 A;  2RA1 A;  3VU7 H;  5FYM A;  3ZYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...