3R84B

Structure of the mediator head subcomplex med11/22
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
80
Chain Sequence
b'SNQALYEKLEQTRTILSVKLAELINITTIADFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 11
publication title Mediator head subcomplex Med11/22 contains a common helix bundle building block with a specific function in transcription initiation complex stabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 80
sequence length 88
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2011-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r84B00
4H63V 3R84B
chains in the Genus database with same CATH superfamily
3AE6A 3AEDA 3UU3A 5AQKB 5LBQB 3K1SA 2W00A 2V7MA 3ZSSA 1MIYA 2A9UA 3SS1A 3ZJ1A 3DP7A 3IEEA 2L8KA 5AQMB 3NZPA 3FZKB 2YKSA 2HPLA 2NWBA 3ABVA 1IBKT 4TNWA 2LM9A 2A2FX 1KF6A 2YDQA 1WLXA 3ZLIA 4L0RA 2CBIA 4DV0T 3N9LA 4FI5A 3JC6D 4IE7A 1OEDB 4UR9A 4IL9A 4I0UA 1US7B 2NW9A 4WBNE 2EHOB 3PUYF 1FEWA 2YU2A 3KV4A 5AFUL 1T72A 2WMOA 5JQGE 4AKHA 2D5UA 2N9DA 3QC9A 3PUAA 2CLYC 2PJQA 4P1NA 3ZYMA 3FZMB 2Y48B 2NTXA 4JI2T 2V6XA 2WZHA 5ABFB 3VU7H 3VKGA 3SWHA 5FXZA 3CKDA 1UX4A 3H37A 3N2OA 2NP9A 3KBTA 1XDOA 4HFBA 4DV5T 3M65A 4HKAA 1JNRA 4EEDA 3RIFA 4U7YA 2WMNA 2LHRA 3H3AA 1VRBA 5LOVE 3ZJ2A 4AISA 3EHZA 3G06A 3LK42 1T98A 3RYHE 5JRCB 2LSYA 1XNRT 2DNXA 3OJAA 2N1GA 1YKHB 5LCYA 2IAKA 4PFPA 5FXWA 2X67A 1D1BA 1LVKA 3ZMZB 4UV9B 3WI3A 2LOSA 3A7MA 4DV7T 3SRZA 3L8RA 4IREA 2VWAA 4ZEYA 4UEMA 4A5XA 2XQYA 5JDQA 1HTJF 2E9XD 4N78D 1L0VA 3O1HA 3D0TA 2ZM6T 4UV8B 5FYMA 2H7OA 2MTQA 4TV8E 5ABEA 2IHR1 3CQXC 3O1JA 2W67A 3AA0B 1YQ3A 4EYYR 4JUYA 1SE7A 3HA4A 3I0QA 3ZT6A 1D1AA 2BG9B 2NW7A 1HF8A 2LOPA 4PJJA 3OYZA 3ZCIA 3N2KE 4QXHB 3C51A 3BQKA 2C5KT 3RGLA 1XNQT 1BR1A 2XQ3A 4IE4A 4COFA 2VVSA 4ZI2D 4AKRB 5J2UE 2FJBA 4XZCA 4BAYB 2AE9A 4JEHB 1G73A 1XMQT 4AKIA 2JQHA 2BS2A 3Q5XA 3NBXX 4IDOA 4P0BA 2DLRA 4NUUA 4CI2B 1FMWA 5HXCA 2UUBT 1X79A 3ZKRA 2NW8A 4H9QC 4ZHQE 2V26A 2Y8DA 3CK6A 3N9OA 4IIJE 4ERRA 3WAJA 2BKNA 4IHJE 3C64A 1J5ET 3UULA 2V8SV 3C4XA 3L09A 2CMRA 5LGTB 4U3CA 1O3XA 2XSAA 5AQPB 4U74A 5KXJA 1LKXA 5FXVA 3KFWX 1BR0A 2C0SA 3EABA 2SPCA 3RX6A 3RKOA 2H7VC 1J5WA 3IHRA 4X65T 2X9XA 4YSXA 1E2AA 4GKKT 5FL0A 3I0OA 3UUBA 2FBWA 4QH5A 4Z91A 2D0UA 3Q9DA 2B1EA 3RIUC 2D2SA 2E9XA 4IGUA 1N36T 2XAQB 5LMUT 1VOMA 1IJ6A 5L3BB 3P8CD 2IMLA 4OYKA 2A3DA 5HWYA 4JI7T 2X0HA 3ZSTA 3KVAA 3GN5B 2M6BA 4LF5T 2XJ7A 5H6RB 3SOLA 2CPTA 3F31A 1AJ3A 2UXBT 1UK5A 1WYCA 4AKLA 3RH3A 3QB5K 2BVMA 3HR0A 3S4UA 4OFZA 4U7IA 2LM2A 4G2AA 4AI6A 2JQKA 2VKJA 1VCSA 1S35A 4ILUA 3K8PC 2M6IA 4AQGA 1QUUA 4H9NC 2V7JA 2XQ6A 3EUHA 2WWUA 5JDHA 2WU2A 4KI0F 1W0BA 1WYBA 2JRKA 5EK3A 2PG8A 2CLYB 2NR4A 2HPJA 4PK6A 2VL8A 2DWKA 3ZMVB 3FBLA 3N9QA 5AQIB 4EZHA 2UUCT 5HEOA 4QX8B 3KV6A 4LMJA 5HEJA 5LHIB 2WWVA 4WYVA 4WZXA 5L3CB 4TZ4C 1HNZT 2EHOD 5LP6E 3AAEB 3SFDA 3RQWA 4UF0A 4CXXA 3RF1A 4H63H 4ILCA 5AQLB 4F6RC 2PFVA 4I43B 3PUWF 1I94T 5CB4E 1HG2A 2WP9A 2VASA 4C90A 4TN7B 1MMDA 4UELA 2V5CA 2V7IA 3I9WA 4MBQA 3Q5EA 5EZYE 1R8IA 3RHWA 3AECA 3ONXA 5AQRB 3T1YT 2V5DA 3RYCE 3MA9A 4JEUB 4UVAB 2CXDA 3T8OA 4CN4A 2XAFB 4ZZBA 3UUNA 1HNWT 3K3OA 3CQCB 2J4GA 5JREA 1UCUA 2UXCT 5A1LA 2JQ9A 3L39A 2VL0A 2KWIB 2LHNA 4XBFB 4O4HE 2Q9QB 4EV6A 3O1IA 3LSVA 1Y64B 2LRLA 1YKEB 2VQFT 4JYAT 4P0AA 4KMCA 4TNVA 4CN1A 4O4IE 4PJMA 3LBXA 1EZ3A 2MBGA 4AQFC 3A8YC 5FNVE 4YXDA 5C8YE 1IBLT 4NXMT 5DQVA 4DR3T 2XHEB 4Z90A 3PURA 3P4RA 5LJMA 4DNDA 2V7KA 2BDEA 5FKYA 1YD8G 2CRBA 2XPKA 4QKNA 1HCIA 2K48A 3TLUA 2VURA 2YINA 5ADXL 3NVOA 1YQ4A 2L9QA 1MMAA 3K3NA 1WR0A 3NWIA 5HXEA 1Z8UA 3PU3A 3HKEE 5JTGA 5C3JA 2F4VT 1OEDA 1ZHCA 1SA0E 3C98B 3ZT5A 2DWGA 5L3DB 2JQQA 4HFEA 4GKJT 1ZV4X 2EHOA 2V6YA 3OYXA 4JI1T 3ESLA 1T7SA 5AQUB 1SUMB 4DR5T 4IT4A 3E08A 1WFDA 2V7LA 4H9PC 2XAGB 4HFDA 4WBOA 3ETVA 5IWAT 2VQET 5ABFA 3PUZF 2KZ7B 2WAUA 4QHOA 3NRYA 2E5VA 3MKDA 3O9XA 3OTOT 3HI2A 3P4PA 2WSSV 3GMIA 4FJOA 3P4QA 2VKOA 5BMVE 3UUXB 2W4XA 5KX5E 3TLVA 2X9HA 3FXDB 4MFRA 4H63V 5LNKA 1FMVA 3FZLB 2LE8A 1U4QA 2JPFA 2AXDS 2XM2A 5C2TA 5HYAA 5JRCA 3UFGA 2MYSA 4O2BE 4F8HA 4UVCB 2BVLA 4DVDA 3ZMTB 3Q2MA 1IBMT 4WW0A 1JNZA 2ZLYA 3OVUA 2IIUA 4EEBA 4DBQA 1ZKEA 4HFCA 2W0GA 3VHLA 4LFCT 5LXTE 3CX8B 3I1AA 4JI3T 2BBHA 2K24A 4NIQA 3RKGA 2ACZA 3AA6B 2OV9A 3L3PA 4HN9A 1HX1B 2XQ9A 3AVRA 2W66A 2BZBA 3QUJA 1WCRA 1T8BA 3LDQB 3PTRB 1YXRA 1Z0PA 5HEGA 1GQEA 5JDNA 1MNDA 2CBJA 1BR2A 1VCTA 2IDOB 3N2GE 4OK0A 5HAXA 2Q9QC 2CWOA 5CGMA 3PUXF 2ODVA 3E0ZA 2WBLA 2ZMAA 3PUQA 3PUVF 4A56A 3RQUA 3ONJA 3QK6A 4ZS3A 3RYIE 3UFEA 2LEHA 3R6NA 4BJMA 2JIWA 2LT3A 3BQIA 3RC3A 3UU8A 5LHHB 1W0AA 4UXNB 5LG4A 2I6HA 4YTMA 5AQVB 3ZEFB 4JI5T 5L2LA 5LJNA 4QWNB 5CJ5A 3NZQA 5AQSB 4X1IE 2XQ4A 5JDFA 2C5IT 2M67A 2WQYA 4ZI3C 2J1DG 3PUGA 5HEUA 5L3FB 4TX5A 2XAJB 4EYUA 2DI4A 2K5BB 4IDPA 5AQQB 3P4SA 1E7PA 2FJDA 1XDPA 1W09A 3DTOA 4TWFA 4HWIB 1HFAA 2MOZA 3CX6B 2C5JA 4X1KE 4KUMB 3WAKA 4I50E 3AAAB 1KNPA 2X0LB 3RIAA 3AE5A 3FB2A 2YEVC 3B57A 4QH1A 3B13A 4ZS2A 3AE3A 4V1Av 3KINB 5LMNT 1OEDE 2X0YA 5LHGB 4X20E 1MIWA 4O8SA 4HWCA 2YK0A 5JDGA 3FXEB 2IUBA 2LSIA 5FVLA 3W15B 4X1YE 4A97A 4KP3C 1CHUA 5DJQC 1IZNB 3HL6A 4DV4T 3I9YA 4JLEA 2WM9A 2KWHA 2QRXA 5BR8T 3FBZA 4WNKA 4NPPA 1KK7A 4X62T 4J2CA 5ABGA 1FIOA 1QSDA 5LYJE 4U72A 4MALA 3DJBA 2LSGA 1D0YA 2RP4A 2ZM8A 3K3QC 5HCJA 4PNIA 3JADA 4DMVA 4JI4T 2HN1A 2DHRA 2E9XB 4YSYA 2E2AA 1XMOT 3RLFF 3AEGA 4GYSA 5L4EA 3CQGB 4G63A 2KLQA 4IE0A 5L3GB 4OYJA 2W62A 4JBWF 3ANWA 1H7CA 3AA1B 2X9YA 2IC9A 3TKLB 4ILBA 3P4WA 4PJNA 4QXCB 3LK3B 3H3MA 4YY3T 5LGNB 3NKZA 2X68A 4YHHT 2D9DA 2WCAA 4ISTA 4NUVA 3UU5A 4O4LE 3LK2B 2VVNA 3PJAA 2KNDA 1IJ5A 1E1HB 4GOUA 1HR0T 5FY7A 3B5MA 4HFHA 1N34T 5FL1A 3TLSA 3PE0A 3CWZB 1MIVA 1XWMA 3E22E 4H9OC 4HFIA 3KDSE 2HHHT 1XZYA 5LBMA 2E5LT 3U78A 2WU5A 2BG9E 4LF4T 4X5TA 3F2EA 3R84B 5HCMA 2D0TA 2KSRA 2LKHA 3P7IA 3RRCA 1LRZA 3AE1A 4JI6T 2J62A 2UXDT 2A72A 4IL4A 4A98A 3JC6C 5FY0A 1ZEEA 2L3LA 3CX7B 3AXJA 1KEYA 2FJEA 4UF0B 2PTFA 5LGUB 4GK0E 3LJCA 2H89A 2W63A 5JR9A 1SHZC 3FZHB 3BK9A 3AEBA 3PJAJ 5HXRA 4KBMB 3CIRA 2XQ7A 4TWHA 1QLBA 5H6QB 5IUXA 2JMHA 3PDYA 2LKGA 2VKHA 4E7SA 2YU1A 3JAFA 3RI5A 1WRDA 3QB5A 4JV5T 3AAIA 4ZXLA 3V5SA 1N33T 3ZYKA 3UTKA 2XAHB 2IC6A 4U31A 3IBPA 2VKDA 5EK2A 4B3MT 5FY1A 1HX8A 2I0MA 3RPUA 2VB6A 4DUYT 3AE8A 4AQYT 3LBXB 5KDMC 2MAWA 4HTEA 5EK4A 4KX6A 5FMNA 2E9XC 5ABHA 3AEAA 2CXLA 4L9IA 2CWYA 1WR6A 4LF8T 4EXTA 4UIGA 2I59A 1OXZA 4X66T 3HKCE 2BS3A 3J7Yq 2H88A 3A5XA 4Q25A 4XAXB 5JH7E 3GWHA 3ZT7A 4YT0A 4DR6T 4ISSA 5HWXA 3EDUA 2XSBA 5ETWA 3J9X1 4JI0T 2K3WA 4EZ4A 3U3IA 4QH4A 2CCQA 1U5PA 1W9RA 2V6YB 2J47A 3RIUA 5CFBA 3T1HT 4ZI2C 3RYFE 5FVKA 3AE7A 4H9RC 1KNRA 1NWMX 2XUEA 2WDVA 3TLWA 3C4ZA 5AQOB 4LFBT 2P9BA 1Y01A 3ZN0B 1I6ZA 5HXSA 4C91A 1NAFA 2XM1A 2VK9A 5FXXA 3AEEA 2LRKA 1B7TA 2XZEA 3TLTA 4YHJA 3UQ7A 4L5GA 2XASB 5JDMA 2XQAA 5IHYA 3UUMA 4DMWA 4B6XA 3N9MA 3PV0F 2CHOA 5FP3A 1UGOA 5AQHB 4CQIA 4IDNA 1M7KA 2UXXB 2RPAA 1IAPA 2X9WA 1KNZA 4HWFA 3HKDE 4YTPA 4LF9T 4PK5A 1UURA 2YOEA 2QGSA 2BG9A 3VRBA 5L4HA 4DR2T 4HEAA 5GONE 4I55E 4UVBB 5AQGB 5JR9C 2HN2A 2PBIA 4EB6E 4HFVA 2K9AA 4ASKA 2E8IA 2XTLA 4GIWA 4IE6A 3PU8A 4JI8T 2KMFA 2WDRA 3KBUA 4PK4A 2X51A 5L3EB 3AA7B 2CM0A 4O2AE 2MPKA 4QX7B 1J1JA 4B3TT 2RA1A 4PJLA 4YLHA 2DL1A 3F57A 1MNEA 5JDLA 1HNXT 2LSJA 3EAMA 4ADZA 4YJ2E 5CA1E 4DV1T 1LVFA 4LF6T 4PFOA 5HEHA 1MMNA 5AQFB 4DR7T 2NTYA 4HWHA 1OWAA 2V1DB 2GK9A 4LFAT 3RC8A 5J2TE 1UUSA 5TAOA 4PW8A 4U2YA 2ZM0A 4EIWA 4PAGA 3ZC1A 3UU6A 3MJXA 3BQLA 3MXZA 4AKGA 4NXNT 4MHCA 4ZOLE 2XQ5A 5CA0E 4YTNA 3IF8B 2ACXA 3QNUA 2WS3A 4MLKA 1M62A 4GYRA 3RRWA 4IDQA 3AVSA 3OBVE 5AQNB 1OEDC 4AQFA 4BA9A 4OX9T 2UXNB 5L47A 4DUZT 2EHOC 2FUPA 3LG7A 1D0ZA 4HE8A 2CXFA 3PUSA 4CI3B 5IYZE 3EI0A 3HKBE 1HG5A 5HXHA 1CUNA 2Y6XA 3Q5WA 3Q5DA 3P50A 2Z6EA 4ZI7E 5F5WA 4YSZA 5LG3A 4DR4T 3X1DA 4TUYE 2DCFA 3AE4A 2Q9QD 4DV6T 3ZMUB 3GN5A 1FJGT 1D0XA 3MZKB 4DV2T 2IW5B 3UT5E 3MK7C 3EVYA 2ES0A 3OPCA 2QYWA 4B3RT 2XQ8A 3OKQA 3JCFA 2UU9T 4LF7T 5DABA 3ZPOA 4U33A 4TV9E 2JMKA 1G8XA 3CVRA 3N9NA 4GK5E 2QA7A 3MACA 2JJ9A 5AQJB 3LFMA 2OLTA 2FJAA 2KINB 4I4TE 3SFEA 3FZFB 2W61A 3M3ZB 2ZM2A 2G0UA 4ZZCA 2W2UA 3GA8A 4KHPT 4BJNA 4CXYA 2BKOA 3AE9A 4ZI3D 1N32T 4U2ZA 4ANJA 3C50A 4P09A 4CZZB 1MMGA 4DBRA 5J0ZA 5F3JA 2LJLA 3EDVA 2QVAA 1V9DA 4Z8XA 1NENA 3ANWB 2WB5A 3KVBA 4EGWA 2YN6A 2X66A 2CHNA 4HGAA 2KT9A 4E7ZA 3ZCJA 2OA5A 3C4WA 3ZC0A 5J1GA 4QXBB 2LLYA 3UQ4A 1YW0A 4O4JE 3N5LA 2B76A 4IDZA 2BG9C 4TWDA 4YFSA 5DQWA 5LA6E 4AIUA 1NEKA 2XY8B 2BKPA 1ZP0A 2CA5A 3NRXA 4B3ST 3V5UA 2CE7A 2BBJA 2YDSA 1HS7A 3N9PA 1KFYA 3VR9A 4M1PA 3AEFA 3CPZA 2ODUA 4X64T 2YDRA 1D1CA 1DU2A 3CMLA 1X9BA 4EAHA 4AXPA 3KV9A 3ETUA 3JAEA 3ONLC 2H3RA 3AB3B 1UX5A 2KXPB 2Q9QA 4DV3T 4YJ3E 5M4YA 4HWDA 4LMKA 3UU4A 4ILAA 5KMGP 2LSKA 4KHZF 5F8PA 2N2NA 4EOZB 3FHNA 3AXJB 5JVDE 5LB7B 4H9SE 3VRAA 2WDQA 3ZN1B 1ZOYA 4LMLA 5AQTB 2UUAT 2WZIA 4K0UA 3O4XE 5JR9B 3AE2A 4DIDB 5E0OA 2NOXA 2WY2A 1S94A 3KV5A 3ZYLA 4IE5A 3QOFA 4DO0A 2CEAA 2R6GF 4DR1T 3VKHA 3ZMSB 3VR8A 4CXWA 4OHFA 4K0KT 1BR4A 3IA3A 2BS4A 2HH7A 4CN6A 4CI1B
chains in the Genus database with same CATH topology
4CQIA 4ZS2A 5L3CB 4TZ4C 5LBQB 4V1Av 3KINB 2W00A 2V7MA 2UXXB 2EHOD 5LP6E 1IAPA 2X9WA 1KNZA 5LHGB 3AAEB 4X20E 4UF0A 3HKDE 4CXXA 1MIYA 1MIWA 4F6RC 4H63H 4O8SA 3SS1A 3ZJ1A 2YK0A 2PFVA 3DP7A 4I43B 5JDGA 3IEEA 3FXEB 4PK5A 2LSIA 5CB4E 2QGSA 2L8KA 1HG2A 3NZPA 3W15B 2HPLA 2NWBA 2VASA 4C90A 4X1YE 4TN7B 2LM9A 4KP3C 2A2FX 1MMDA 4HEAA 1IZNB 5DJQC 4UELA 5GONE 3HL6A 4I55E 3I9YA 4UVBB 1WLXA 4JLEA 3ZLIA 2WM9A 2V7IA 4L0RA 5JR9C 3I9WA 4MBQA 3N9LA 4FI5A 2KWHA 3JC6D 2PBIA 3FBZA 4EB6E 4WNKA 4HFVA 5EZYE 2K9AA 1KK7A 4IE7A 4J2CA 4ASKA 2E8IA 2XTLA 4GIWA 4IE6A 3PU8A 3ONXA 2KMFA 3KBUA 4PK4A 2X51A 5L3EB 3AA7B 1US7B 1FIOA 1QSDA 2CM0A 3RYCE 3MA9A 4JEUB 4O2AE 2NW9A 4WBNE 2EHOB 4UVAB 1FEWA 2CXDA 2YU2A 5LYJE 4QX7B 3T8OA 2XAFB 4U72A 3KV4A 2RA1A 3DJBA 4MALA 4PJLA 2LSGA 4YLHA 1D0YA 2RP4A 3UUNA 3F57A 2ZM8A 3K3QC 5AFUL 2WMOA 1MNEA 5JDLA 5JQGE 4PNIA 4AKHA 2D5UA 2N9DA 2LSJA 3K3OA 3CQCB 4DMVA 4ADZA 4YJ2E 3QC9A 3PUAA 5CA1E 2CLYC 1LVFA 2PJQA 4XBFB 5JREA 1UCUA 4PFOA 2DHRA 5A1LA 3ZYMA 2E9XB 1MMNA 2Y48B 2NTXA 2KWIB 4GYSA 3VU7H 2NTYA 2LHNA 1OWAA 3CQGB 4G63A 2KLQA 4IE0A 3VKGA 2V1DB 5FXZA 3SWHA 3CKDA 2GK9A 1UX4A 2W62A 4O4HE 4OYJA 2Q9QB 5L3GB 3H37A 3ANWA 3N2OA 1H7CA 2NP9A 3AA1B 2X9YA 2IC9A 3KBTA 5J2TE 3TKLB 3RC8A 5TAOA 3O1IA 4PW8A 4PJNA 4QXCB 2ZM0A 3LK3B 3M65A 1Y64B 4HKAA 4EIWA 1YKEB 4PAGA 3ZC1A 5LGNB 2X68A 4P0AA 3MJXA 4KMCA 3BQLA 2WMNA 4O4IE 3MXZA 4PJMA 4AKGA 2LHRA 4ISTA 4NUVA 3LBXA 1EZ3A 2MBGA 3H3AA 4MHCA 4AQFC 4O4LE 3LK2B 1VRBA 4ZOLE 5FNVE 5LOVE 5C8YE 3ZJ2A 5CA0E 3LK42 1T98A 5DQVA 3RYHE 2LSYA 5JRCB 2KNDA 1IJ5A 3IF8B 2ACXA 1E1HB 4GOUA 4MLKA 2DNXA 5FY7A 2XHEB 3PURA 5LJMA 3OJAA 4GYRA 2N1GA 4DNDA 2V7KA 2BDEA 1YKHB 1YD8G 3RRWA 5LCYA 2IAKA 4QKNA 4PFPA 3AVSA 3OBVE 3PE0A 5FXWA 1HCIA 4AQFA 2K48A 3CWZB 2X67A 4BA9A 1MIVA 1D1BA 2UXNB 1LVKA 2YINA 3ZMZB 5ADXL 4UV9B 3WI3A 2LOSA 3E22E 4H9OC 2L9QA 3KDSE 1MMAA 3SRZA 3K3NA 2EHOC 3LG7A 1D0ZA 4HE8A 5HXEA 3PU3A 3HKEE 2CXFA 2VWAA 5LBMA 3PUSA 4UEMA 4CI3B 2XQYA 5IYZE 3U78A 4CI1B 3HKBE 5JDQA 1HG5A 5HXHA 1CUNA 2Y6XA 1HTJF 3F2EA 3Q5WA 3R84B 2E9XD 4N78D 1ZHCA 1SA0E 3C98B 2D0TA 2DWGA 3O1HA 5L3DB 2JQQA 3P7IA 3RRCA 1LRZA 3D0TA 2Z6EA 4ZI7E 1ZV4X 2EHOA 4UV8B 2A72A 4TUYE 2DCFA 5FYMA 2H7OA 3JC6C 2Q9QD 3OYXA 5FY0A 2MTQA 4TV8E 3CQXC 3ZMUB 1ZEEA 3GN5A 3O1JA 2L3LA 3ESLA 3AA0B 3CX7B 4EYYR 1D0XA 4UF0B 4JUYA 3E08A 5LGUB 4GK0E 3MZKB 3HA4A 3I0QA 2V7LA 4H9PC 2IW5B 3LJCA 2XAGB 2W63A 4WBOA 1D1AA 3UT5E 3MK7C 3ETVA 3EVYA 5JR9A 2ES0A 1SHZC 2NW7A 2KZ7B 2WAUA 1HF8A 3BK9A 2LOPA 4QHOA 3NRYA 4PJJA 3OYZA 3ZCIA 3MKDA 3OKQA 3O9XA 3N2KE 3HI2A 4QXHB 5DABA 5HXRA 2WSSV 3GMIA 3C51A 3ZPOA 4KBMB 3BQKA 4FJOA 2C5KT 4TV9E 2VKOA 1BR1A 5BMVE 2JMKA 3UUXB 1G8XA 3CVRA 3N9NA 5KX5E 4GK5E 4IE4A 2QA7A 3MACA 2JJ9A 5H6QB 2X9HA 3LFMA 3FXDB 4ZI2D 2JMHA 4MFRA 4H63V 3PDYA 5LNKA 4AKRB 5J2UE 2KINB 4I4TE 2VKHA 4XZCA 1FMVA 4E7SA 4BAYB 2LE8A 2YU1A 1U4QA 2JPFA 2W61A 4JEHB 2ZM2A 2G0UA 1G73A 4AKIA 3Q5XA 3NBXX 5HYAA 5JRCA 4P0BA 3GA8A 2MYSA 4BJNA 4CXYA 1WRDA 2DLRA 4O2BE 4ZI3D 4NUUA 2BVLA 4UVCB 4CI2B 1FMWA 4ANJA 3C50A 3AAIA 5HXCA 4P09A 3V5SA 4DVDA 4CZZB 3ZMTB 1X79A 3Q2MA 1MMGA 4DBRA 2NW8A 4WW0A 2ZLYA 3ZYKA 3UTKA 5F3JA 4H9QC 4ZHQE 2LJLA 2V26A 2Y8DA 3EDVA 3N9OA 4DBQA 1ZKEA 4IIJE 4ERRA 1V9DA 4Z8XA 2XAHB 2IC6A 2W0GA 3IBPA 3ANWB 3KVBA 3WAJA 2VKDA 2X66A 3VHLA 5EK2A 4IHJE 3C64A 4HGAA 3UULA 5FY1A 2KT9A 1HX8A 3CX8B 4E7ZA 5LXTE 3C4XA 3I1AA 3ZCJA 3L09A 3RPUA 2CMRA 2OA5A 5LGTB 2VB6A 3C4WA 2K24A 5J1GA 3ZC0A 4QXBB 1YW0A 4O4JE 3AA6B 3LBXB 3N5LA 1O3XA 3L3PA 4HN9A 4U74A 4IDZA 5KDMC 4YFSA 1LKXA 5DQWA 5FXVA 3AVRA 4HTEA 5LA6E 3KFWX 2BZBA 1BR0A 3QUJA 5EK4A 2C0SA 2SPCA 3PTRB 5FMNA 3RX6A 2CA5A 3NRXA 3RKOA 2E9XC 1Z0PA 2H7VC 2CXLA 3V5UA 5JDNA 3IHRA 2CE7A 1MNDA 1HS7A 1BR2A 2X9XA 3N9PA 4L9IA 4M1PA 3N2GE 2CWYA 1WR6A 4OK0A 5HAXA 2Q9QC 4EXTA 3I0OA 2CWOA 2D0UA 3CPZA 2ODVA 2I59A 3E0ZA 4UIGA 3Q9DA 2B1EA 1OXZA 2WBLA 3HKCE 2ODUA 3J7Yq 2D2SA 1D1CA 2ZMAA 3PUQA 2E9XA 3A5XA 4IGUA 3CMLA 4XAXB 4A56A 5JH7E 3GWHA 4EAHA 2XAQB 1VOMA 4AXPA 3QK6A 3KV9A 3ETUA 1IJ6A 4ISSA 5HWXA 3EDUA 5ETWA 3J9X1 5L3BB 2H3RA 4ZS3A 3AB3B 3RYIE 3UFEA 3P8CD 1UX5A 2KXPB 2Q9QA 4EZ4A 4YJ3E 5M4YA 2LEHA 2A3DA 4OYKA 5HWYA 3R6NA 3U3IA 4BJMA 5KMGP 2CCQA 2LT3A 1U5PA 3BQIA 2LSKA 3RC3A 5F8PA 5LHHB 2N2NA 4EOZB 3KVAA 4UXNB 3GN5B 5LG4A 3FHNA 3ZEFB 4ZI2C 3RYFE 5H6RB 5JVDE 3SOLA 5L2LA 3F31A 1AJ3A 5LJNA 4H9RC 4QWNB 4H9SE 3ZN1B 3NZQA 4X1IE 1WYCA 1NWMX 2XUEA 4K0UA 5JDFA 4AKLA 3O4XE 2C5IT 3RH3A 5JR9B 2M67A 2BVMA 3HR0A 3S4UA 3C4ZA 4OFZA 2P9BA 4ZI3C 2J1DG 4G2AA 4AI6A 3PUGA 5L3FB 3ZN0B 4TX5A 2NOXA 5E0OA 5HXSA 2VKJA 4C91A 1NAFA 1S94A 2XAJB 4EYUA 2DI4A 1S35A 3KV5A 4ILUA 3ZYLA 4IE5A 2K5BB 2VK9A 3K8PC 4AQGA 1QUUA 4H9NC 2V7JA 5FXXA 3EUHA 4DO0A 2WWUA 5JDHA 2CEAA 1B7TA 3VKHA 3DTOA 4YHJA 1WYBA 2JRKA 3ZMSB 4CXWA 4OHFA 5EK3A 2PG8A 4L5GA 1HFAA 2MOZA 3CX6B 2CLYB 2XASB 2C5JA 4X1KE 2HPJA 4PK6A 2VL8A 1BR4A 4KUMB 3WAKA 2DWKA 5JDMA 3ZMVB 3FBLA 3N9QA 5IHYA 3UUMA 4DMWA 4B6XA 4EZHA 4I50E 2HH7A 3AAAB 4QX8B 3KV6A 2X0LB 3FB2A 2YEVC 3B57A 5LHIB 3B13A 3N9MA 5FP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H63 V;  3R84 B; 
#chains in the Genus database with same CATH topology
 3AE6 A;  3AED A;  3UU3 A;  5AQK B;  5LBQ B;  3K1S A;  2W00 A;  2V7M A;  3ZSS A;  1MIY A;  2A9U A;  3SS1 A;  3ZJ1 A;  3DP7 A;  3IEE A;  2L8K A;  5AQM B;  3NZP A;  3FZK B;  2YKS A;  2HPL A;  2NWB A;  3ABV A;  1IBK T;  4TNW A;  2LM9 A;  2A2F X;  1KF6 A;  2YDQ A;  1WLX A;  3ZLI A;  4L0R A;  2CBI A;  4DV0 T;  3N9L A;  4FI5 A;  3JC6 D;  4IE7 A;  1OED B;  4UR9 A;  4IL9 A;  4I0U A;  1US7 B;  2NW9 A;  4WBN E;  2EHO B;  3PUY F;  1FEW A;  2YU2 A;  3KV4 A;  5AFU L;  1T72 A;  2WMO A;  5JQG E;  4AKH A;  2D5U A;  2N9D A;  3QC9 A;  3PUA A;  2CLY C;  2PJQ A;  4P1N A;  3ZYM A;  3FZM B;  2Y48 B;  2NTX A;  4JI2 T;  2V6X A;  2WZH A;  5ABF B;  3VU7 H;  3VKG A;  3SWH A;  5FXZ A;  3CKD A;  1UX4 A;  3H37 A;  3N2O A;  2NP9 A;  3KBT A;  1XDO A;  4HFB A;  4DV5 T;  3M65 A;  4HKA A;  1JNR A;  4EED A;  3RIF A;  4U7Y A;  2WMN A;  2LHR A;  3H3A A;  1VRB A;  5LOV E;  3ZJ2 A;  4AIS A;  3EHZ A;  3G06 A;  3LK4 2;  1T98 A;  3RYH E;  5JRC B;  2LSY A;  1XNR T;  2DNX A;  3OJA A;  2N1G A;  1YKH B;  5LCY A;  2IAK A;  4PFP A;  5FXW A;  2X67 A;  1D1B A;  1LVK A;  3ZMZ B;  4UV9 B;  3WI3 A;  2LOS A;  3A7M A;  4DV7 T;  3SRZ A;  3L8R A;  4IRE A;  2VWA A;  4ZEY A;  4UEM A;  4A5X A;  2XQY A;  5JDQ A;  1HTJ F;  2E9X D;  4N78 D;  1L0V A;  3O1H A;  3D0T A;  2ZM6 T;  4UV8 B;  5FYM A;  2H7O A;  2MTQ A;  4TV8 E;  5ABE A;  2IHR 1;  3CQX C;  3O1J A;  2W67 A;  3AA0 B;  1YQ3 A;  4EYY R;  4JUY A;  1SE7 A;  3HA4 A;  3I0Q A;  3ZT6 A;  1D1A A;  2BG9 B;  2NW7 A;  1HF8 A;  2LOP A;  4PJJ A;  3OYZ A;  3ZCI A;  3N2K E;  4QXH B;  3C51 A;  3BQK A;  2C5K T;  3RGL A;  1XNQ T;  1BR1 A;  2XQ3 A;  4IE4 A;  4COF A;  2VVS A;  4ZI2 D;  4AKR B;  5J2U E;  2FJB A;  4XZC A;  4BAY B;  2AE9 A;  4JEH B;  1G73 A;  1XMQ T;  4AKI A;  2JQH A;  2BS2 A;  3Q5X A;  3NBX X;  4IDO A;  4P0B A;  2DLR A;  4NUU A;  4CI2 B;  1FMW A;  5HXC A;  2UUB T;  1X79 A;  3ZKR A;  2NW8 A;  4H9Q C;  4ZHQ E;  2V26 A;  2Y8D A;  3CK6 A;  3N9O A;  4IIJ E;  4ERR A;  3WAJ A;  2BKN A;  4IHJ E;  3C64 A;  1J5E T;  3UUL A;  2V8S V;  3C4X A;  3L09 A;  2CMR A;  5LGT B;  4U3C A;  1O3X A;  2XSA A;  5AQP B;  4U74 A;  5KXJ A;  1LKX A;  5FXV A;  3KFW X;  1BR0 A;  2C0S A;  3EAB A;  2SPC A;  3RX6 A;  3RKO A;  2H7V C;  1J5W A;  3IHR A;  4X65 T;  2X9X A;  4YSX A;  1E2A A;  4GKK T;  5FL0 A;  3I0O A;  3UUB A;  2FBW A;  4QH5 A;  4Z91 A;  2D0U A;  3Q9D A;  2B1E A;  3RIU C;  2D2S A;  2E9X A;  4IGU A;  1N36 T;  2XAQ B;  5LMU T;  1VOM A;  1IJ6 A;  5L3B B;  3P8C D;  2IML A;  4OYK A;  2A3D A;  5HWY A;  4JI7 T;  2X0H A;  3ZST A;  3KVA A;  3GN5 B;  2M6B A;  4LF5 T;  2XJ7 A;  5H6R B;  3SOL A;  2CPT A;  3F31 A;  1AJ3 A;  2UXB T;  1UK5 A;  1WYC A;  4AKL A;  3RH3 A;  3QB5 K;  2BVM A;  3HR0 A;  3S4U A;  4OFZ A;  4U7I A;  2LM2 A;  4G2A A;  4AI6 A;  2JQK A;  2VKJ A;  1VCS A;  1S35 A;  4ILU A;  3K8P C;  2M6I A;  4AQG A;  1QUU A;  4H9N C;  2V7J A;  2XQ6 A;  3EUH A;  2WWU A;  5JDH A;  2WU2 A;  4KI0 F;  1W0B A;  1WYB A;  2JRK A;  5EK3 A;  2PG8 A;  2CLY B;  2NR4 A;  2HPJ A;  4PK6 A;  2VL8 A;  2DWK A;  3ZMV B;  3FBL A;  3N9Q A;  5AQI B;  4EZH A;  2UUC T;  5HEO A;  4QX8 B;  3KV6 A;  4LMJ A;  5HEJ A;  5LHI B;  2WWV A;  4WYV A;  4WZX A;  5L3C B;  4TZ4 C;  1HNZ T;  2EHO D;  5LP6 E;  3AAE B;  3SFD A;  3RQW A;  4UF0 A;  4CXX A;  3RF1 A;  4H63 H;  4ILC A;  5AQL B;  4F6R C;  2PFV A;  4I43 B;  3PUW F;  1I94 T;  5CB4 E;  1HG2 A;  2WP9 A;  2VAS A;  4C90 A;  4TN7 B;  1MMD A;  4UEL A;  2V5C A;  2V7I A;  3I9W A;  4MBQ A;  3Q5E A;  5EZY E;  1R8I A;  3RHW A;  3AEC A;  3ONX A;  5AQR B;  3T1Y T;  2V5D A;  3RYC E;  3MA9 A;  4JEU B;  4UVA B;  2CXD A;  3T8O A;  4CN4 A;  2XAF B;  4ZZB A;  3UUN A;  1HNW T;  3K3O A;  3CQC B;  2J4G A;  5JRE A;  1UCU A;  2UXC T;  5A1L A;  2JQ9 A;  3L39 A;  2VL0 A;  2KWI B;  2LHN A;  4XBF B;  4O4H E;  2Q9Q B;  4EV6 A;  3O1I A;  3LSV A;  1Y64 B;  2LRL A;  1YKE B;  2VQF T;  4JYA T;  4P0A A;  4KMC A;  4TNV A;  4CN1 A;  4O4I E;  4PJM A;  3LBX A;  1EZ3 A;  2MBG A;  4AQF C;  3A8Y C;  5FNV E;  4YXD A;  5C8Y E;  1IBL T;  4NXM T;  5DQV A;  4DR3 T;  2XHE B;  4Z90 A;  3PUR A;  3P4R A;  5LJM A;  4DND A;  2V7K A;  2BDE A;  5FKY A;  1YD8 G;  2CRB A;  2XPK A;  4QKN A;  1HCI A;  2K48 A;  3TLU A;  2VUR A;  2YIN A;  5ADX L;  3NVO A;  1YQ4 A;  2L9Q A;  1MMA A;  3K3N A;  1WR0 A;  3NWI A;  5HXE A;  1Z8U A;  3PU3 A;  3HKE E;  5JTG A;  5C3J A;  2F4V T;  1OED A;  1ZHC A;  1SA0 E;  3C98 B;  3ZT5 A;  2DWG A;  5L3D B;  2JQQ A;  4HFE A;  4GKJ T;  1ZV4 X;  2EHO A;  2V6Y A;  3OYX A;  4JI1 T;  3ESL A;  1T7S A;  5AQU B;  1SUM B;  4DR5 T;  4IT4 A;  3E08 A;  1WFD A;  2V7L A;  4H9P C;  2XAG B;  4HFD A;  4WBO A;  3ETV A;  5IWA T;  2VQE T;  5ABF A;  3PUZ F;  2KZ7 B;  2WAU A;  4QHO A;  3NRY A;  2E5V A;  3MKD A;  3O9X A;  3OTO T;  3HI2 A;  3P4P A;  2WSS V;  3GMI A;  4FJO A;  3P4Q A;  2VKO A;  5BMV E;  3UUX B;  2W4X A;  5KX5 E;  3TLV A;  2X9H A;  3FXD B;  4MFR A;  4H63 V;  5LNK A;  1FMV A;  3FZL B;  2LE8 A;  1U4Q A;  2JPF A;  2AXD S;  2XM2 A;  5C2T A;  5HYA A;  5JRC A;  3UFG A;  2MYS A;  4O2B E;  4F8H A;  4UVC B;  2BVL A;  4DVD A;  3ZMT B;  3Q2M A;  1IBM T;  4WW0 A;  1JNZ A;  2ZLY A;  3OVU A;  2IIU A;  4EEB A;  4DBQ A;  1ZKE A;  4HFC A;  2W0G A;  3VHL A;  4LFC T;  5LXT E;  3CX8 B;  3I1A A;  4JI3 T;  2BBH A;  2K24 A;  4NIQ A;  3RKG A;  2ACZ A;  3AA6 B;  2OV9 A;  3L3P A;  4HN9 A;  1HX1 B;  2XQ9 A;  3AVR A;  2W66 A;  2BZB A;  3QUJ A;  1WCR A;  1T8B A;  3LDQ B;  3PTR B;  1YXR A;  1Z0P A;  5HEG A;  1GQE A;  5JDN A;  1MND A;  2CBJ A;  1BR2 A;  1VCT A;  2IDO B;  3N2G E;  4OK0 A;  5HAX A;  2Q9Q C;  2CWO A;  5CGM A;  3PUX F;  2ODV A;  3E0Z A;  2WBL A;  2ZMA A;  3PUQ A;  3PUV F;  4A56 A;  3RQU A;  3ONJ A;  3QK6 A;  4ZS3 A;  3RYI E;  3UFE A;  2LEH A;  3R6N A;  4BJM A;  2JIW A;  2LT3 A;  3BQI A;  3RC3 A;  3UU8 A;  5LHH B;  1W0A A;  4UXN B;  5LG4 A;  2I6H A;  4YTM A;  5AQV B;  3ZEF B;  4JI5 T;  5L2L A;  5LJN A;  4QWN B;  5CJ5 A;  3NZQ A;  5AQS B;  4X1I E;  2XQ4 A;  5JDF A;  2C5I T;  2M67 A;  2WQY A;  4ZI3 C;  2J1D G;  3PUG A;  5HEU A;  5L3F B;  4TX5 A;  2XAJ B;  4EYU A;  2DI4 A;  2K5B B;  4IDP A;  5AQQ B;  3P4S A;  1E7P A;  2FJD A;  1XDP A;  1W09 A;  3DTO A;  4TWF A;  4HWI B;  1HFA A;  2MOZ A;  3CX6 B;  2C5J A;  4X1K E;  4KUM B;  3WAK A;  4I50 E;  3AAA B;  1KNP A;  2X0L B;  3RIA A;  3AE5 A;  3FB2 A;  2YEV C;  3B57 A;  4QH1 A;  3B13 A;  4ZS2 A;  3AE3 A;  4V1A v;  3KIN B;  5LMN T;  1OED E;  2X0Y A;  5LHG B;  4X20 E;  1MIW A;  4O8S A;  4HWC A;  2YK0 A;  5JDG A;  3FXE B;  2IUB A;  2LSI A;  5FVL A;  3W15 B;  4X1Y E;  4A97 A;  4KP3 C;  1CHU A;  5DJQ C;  1IZN B;  3HL6 A;  4DV4 T;  3I9Y A;  4JLE A;  2WM9 A;  2KWH A;  2QRX A;  5BR8 T;  3FBZ A;  4WNK A;  4NPP A;  1KK7 A;  4X62 T;  4J2C A;  5ABG A;  1FIO A;  1QSD A;  5LYJ E;  4U72 A;  4MAL A;  3DJB A;  2LSG A;  1D0Y A;  2RP4 A;  2ZM8 A;  3K3Q C;  5HCJ A;  4PNI A;  3JAD A;  4DMV A;  4JI4 T;  2HN1 A;  2DHR A;  2E9X B;  4YSY A;  2E2A A;  1XMO T;  3RLF F;  3AEG A;  4GYS A;  5L4E A;  3CQG B;  4G63 A;  2KLQ A;  4IE0 A;  5L3G B;  4OYJ A;  2W62 A;  4JBW F;  3ANW A;  1H7C A;  3AA1 B;  2X9Y A;  2IC9 A;  3TKL B;  4ILB A;  3P4W A;  4PJN A;  4QXC B;  3LK3 B;  3H3M A;  4YY3 T;  5LGN B;  3NKZ A;  2X68 A;  4YHH T;  2D9D A;  2WCA A;  4IST A;  4NUV A;  3UU5 A;  4O4L E;  3LK2 B;  2VVN A;  3PJA A;  2KND A;  1IJ5 A;  1E1H B;  4GOU A;  1HR0 T;  5FY7 A;  3B5M A;  4HFH A;  1N34 T;  5FL1 A;  3TLS A;  3PE0 A;  3CWZ B;  1MIV A;  1XWM A;  3E22 E;  4H9O C;  4HFI A;  3KDS E;  2HHH T;  1XZY A;  5LBM A;  2E5L T;  3U78 A;  2WU5 A;  2BG9 E;  4LF4 T;  4X5T A;  3F2E A;  3R84 B;  5HCM A;  2D0T A;  2KSR A;  2LKH A;  3P7I A;  3RRC A;  1LRZ A;  3AE1 A;  4JI6 T;  2J62 A;  2UXD T;  2A72 A;  4IL4 A;  4A98 A;  3JC6 C;  5FY0 A;  1ZEE A;  2L3L A;  3CX7 B;  3AXJ A;  1KEY A;  2FJE A;  4UF0 B;  2PTF A;  5LGU B;  4GK0 E;  3LJC A;  2H89 A;  2W63 A;  5JR9 A;  1SHZ C;  3FZH B;  3BK9 A;  3AEB A;  3PJA J;  5HXR A;  4KBM B;  3CIR A;  2XQ7 A;  4TWH A;  1QLB A;  5H6Q B;  5IUX A;  2JMH A;  3PDY A;  2LKG A;  2VKH A;  4E7S A;  2YU1 A;  3JAF A;  3RI5 A;  1WRD A;  3QB5 A;  4JV5 T;  3AAI A;  4ZXL A;  3V5S A;  1N33 T;  3ZYK A;  3UTK A;  2XAH B;  2IC6 A;  4U31 A;  3IBP A;  2VKD A;  5EK2 A;  4B3M T;  5FY1 A;  1HX8 A;  2I0M A;  3RPU A;  2VB6 A;  4DUY T;  3AE8 A;  4AQY T;  3LBX B;  5KDM C;  2MAW A;  4HTE A;  5EK4 A;  4KX6 A;  5FMN A;  2E9X C;  5ABH A;  3AEA A;  2CXL A;  4L9I A;  2CWY A;  1WR6 A;  4LF8 T;  4EXT A;  4UIG A;  2I59 A;  1OXZ A;  4X66 T;  3HKC E;  2BS3 A;  3J7Y q;  2H88 A;  3A5X A;  4Q25 A;  4XAX B;  5JH7 E;  3GWH A;  3ZT7 A;  4YT0 A;  4DR6 T;  4ISS A;  5HWX A;  3EDU A;  2XSB A;  5ETW A;  3J9X 1;  4JI0 T;  2K3W A;  4EZ4 A;  3U3I A;  4QH4 A;  2CCQ A;  1U5P A;  1W9R A;  2V6Y B;  2J47 A;  3RIU A;  5CFB A;  3T1H T;  4ZI2 C;  3RYF E;  5FVK A;  3AE7 A;  4H9R C;  1KNR A;  1NWM X;  2XUE A;  2WDV A;  3TLW A;  3C4Z A;  5AQO B;  4LFB T;  2P9B A;  1Y01 A;  3ZN0 B;  1I6Z A;  5HXS A;  4C91 A;  1NAF A;  2XM1 A;  2VK9 A;  5FXX A;  3AEE A;  2LRK A;  1B7T A;  2XZE A;  3TLT A;  4YHJ A;  3UQ7 A;  4L5G A;  2XAS B;  5JDM A;  2XQA A;  5IHY A;  3UUM A;  4DMW A;  4B6X A;  3N9M A;  3PV0 F;  2CHO A;  5FP3 A;  1UGO A;  5AQH B;  4CQI A;  4IDN A;  1M7K A;  2UXX B;  2RPA A;  1IAP A;  2X9W A;  1KNZ A;  4HWF A;  3HKD E;  4YTP A;  4LF9 T;  4PK5 A;  1UUR A;  2YOE A;  2QGS A;  2BG9 A;  3VRB A;  5L4H A;  4DR2 T;  4HEA A;  5GON E;  4I55 E;  4UVB B;  5AQG B;  5JR9 C;  2HN2 A;  2PBI A;  4EB6 E;  4HFV A;  2K9A A;  4ASK A;  2E8I A;  2XTL A;  4GIW A;  4IE6 A;  3PU8 A;  4JI8 T;  2KMF A;  2WDR A;  3KBU A;  4PK4 A;  2X51 A;  5L3E B;  3AA7 B;  2CM0 A;  4O2A E;  2MPK A;  4QX7 B;  1J1J A;  4B3T T;  2RA1 A;  4PJL A;  4YLH A;  2DL1 A;  3F57 A;  1MNE A;  5JDL A;  1HNX T;  2LSJ A;  3EAM A;  4ADZ A;  4YJ2 E;  5CA1 E;  4DV1 T;  1LVF A;  4LF6 T;  4PFO A;  5HEH A;  1MMN A;  5AQF B;  4DR7 T;  2NTY A;  4HWH A;  1OWA A;  2V1D B;  2GK9 A;  4LFA T;  3RC8 A;  5J2T E;  1UUS A;  5TAO A;  4PW8 A;  4U2Y A;  2ZM0 A;  4EIW A;  4PAG A;  3ZC1 A;  3UU6 A;  3MJX A;  3BQL A;  3MXZ A;  4AKG A;  4NXN T;  4MHC A;  4ZOL E;  2XQ5 A;  5CA0 E;  4YTN A;  3IF8 B;  2ACX A;  3QNU A;  2WS3 A;  4MLK A;  1M62 A;  4GYR A;  3RRW A;  4IDQ A;  3AVS A;  3OBV E;  5AQN B;  1OED C;  4AQF A;  4BA9 A;  4OX9 T;  2UXN B;  5L47 A;  4DUZ T;  2EHO C;  2FUP A;  3LG7 A;  1D0Z A;  4HE8 A;  2CXF A;  3PUS A;  4CI3 B;  5IYZ E;  3EI0 A;  3HKB E;  1HG5 A;  5HXH A;  1CUN A;  2Y6X A;  3Q5W A;  3Q5D A;  3P50 A;  2Z6E A;  4ZI7 E;  5F5W A;  4YSZ A;  5LG3 A;  4DR4 T;  3X1D A;  4TUY E;  2DCF A;  3AE4 A;  2Q9Q D;  4DV6 T;  3ZMU B;  3GN5 A;  1FJG T;  1D0X A;  3MZK B;  4DV2 T;  2IW5 B;  3UT5 E;  3MK7 C;  3EVY A;  2ES0 A;  3OPC A;  2QYW A;  4B3R T;  2XQ8 A;  3OKQ A;  3JCF A;  2UU9 T;  4LF7 T;  5DAB A;  3ZPO A;  4U33 A;  4TV9 E;  2JMK A;  1G8X A;  3CVR A;  3N9N A;  4GK5 E;  2QA7 A;  3MAC A;  2JJ9 A;  5AQJ B;  3LFM A;  2OLT A;  2FJA A;  2KIN B;  4I4T E;  3SFE A;  3FZF B;  2W61 A;  3M3Z B;  2ZM2 A;  2G0U A;  4ZZC A;  2W2U A;  3GA8 A;  4KHP T;  4BJN A;  4CXY A;  2BKO A;  3AE9 A;  4ZI3 D;  1N32 T;  4U2Z A;  4ANJ A;  3C50 A;  4P09 A;  4CZZ B;  1MMG A;  4DBR A;  5J0Z A;  5F3J A;  2LJL A;  3EDV A;  2QVA A;  1V9D A;  4Z8X A;  1NEN A;  3ANW B;  2WB5 A;  3KVB A;  4EGW A;  2YN6 A;  2X66 A;  2CHN A;  4HGA A;  2KT9 A;  4E7Z A;  3ZCJ A;  2OA5 A;  3C4W A;  3ZC0 A;  5J1G A;  4QXB B;  2LLY A;  3UQ4 A;  1YW0 A;  4O4J E;  3N5L A;  2B76 A;  4IDZ A;  2BG9 C;  4TWD A;  4YFS A;  5DQW A;  5LA6 E;  4AIU A;  1NEK A;  2XY8 B;  2BKP A;  1ZP0 A;  2CA5 A;  3NRX A;  4B3S T;  3V5U A;  2CE7 A;  2BBJ A;  2YDS A;  1HS7 A;  3N9P A;  1KFY A;  3VR9 A;  4M1P A;  3AEF A;  3CPZ A;  2ODU A;  4X64 T;  2YDR A;  1D1C A;  1DU2 A;  3CML A;  1X9B A;  4EAH A;  4AXP A;  3KV9 A;  3ETU A;  3JAE A;  3ONL C;  2H3R A;  3AB3 B;  1UX5 A;  2KXP B;  2Q9Q A;  4DV3 T;  4YJ3 E;  5M4Y A;  4HWD A;  4LMK A;  3UU4 A;  4ILA A;  5KMG P;  2LSK A;  4KHZ F;  5F8P A;  2N2N A;  4EOZ B;  3FHN A;  3AXJ B;  5JVD E;  5LB7 B;  4H9S E;  3VRA A;  2WDQ A;  3ZN1 B;  1ZOY A;  4LML A;  5AQT B;  2UUA T;  2WZI A;  4K0U A;  3O4X E;  5JR9 B;  3AE2 A;  4DID B;  5E0O A;  2NOX A;  2WY2 A;  1S94 A;  3KV5 A;  3ZYL A;  4IE5 A;  3QOF A;  4DO0 A;  2CEA A;  2R6G F;  4DR1 T;  3VKH A;  3ZMS B;  3VR8 A;  4CXW A;  4OHF A;  4K0K T;  1BR4 A;  3IA3 A;  2BS4 A;  2HH7 A;  4CN6 A;  4CI1 B; 
#chains in the Genus database with same CATH homology
 4CQI A;  4ZS2 A;  5L3C B;  4TZ4 C;  5LBQ B;  4V1A v;  3KIN B;  2W00 A;  2V7M A;  2UXX B;  2EHO D;  5LP6 E;  1IAP A;  2X9W A;  1KNZ A;  5LHG B;  3AAE B;  4X20 E;  4UF0 A;  3HKD E;  4CXX A;  1MIY A;  1MIW A;  4F6R C;  4H63 H;  4O8S A;  3SS1 A;  3ZJ1 A;  2YK0 A;  2PFV A;  3DP7 A;  4I43 B;  5JDG A;  3IEE A;  3FXE B;  4PK5 A;  2LSI A;  5CB4 E;  2QGS A;  2L8K A;  1HG2 A;  3NZP A;  3W15 B;  2HPL A;  2NWB A;  2VAS A;  4C90 A;  4X1Y E;  4TN7 B;  2LM9 A;  4KP3 C;  2A2F X;  1MMD A;  4HEA A;  1IZN B;  5DJQ C;  4UEL A;  5GON E;  3HL6 A;  4I55 E;  3I9Y A;  4UVB B;  1WLX A;  4JLE A;  3ZLI A;  2WM9 A;  2V7I A;  4L0R A;  5JR9 C;  3I9W A;  4MBQ A;  3N9L A;  4FI5 A;  2KWH A;  3JC6 D;  2PBI A;  3FBZ A;  4EB6 E;  4WNK A;  4HFV A;  5EZY E;  2K9A A;  1KK7 A;  4IE7 A;  4J2C A;  4ASK A;  2E8I A;  2XTL A;  4GIW A;  4IE6 A;  3PU8 A;  3ONX A;  2KMF A;  3KBU A;  4PK4 A;  2X51 A;  5L3E B;  3AA7 B;  1US7 B;  1FIO A;  1QSD A;  2CM0 A;  3RYC E;  3MA9 A;  4JEU B;  4O2A E;  2NW9 A;  4WBN E;  2EHO B;  4UVA B;  1FEW A;  2CXD A;  2YU2 A;  5LYJ E;  4QX7 B;  3T8O A;  2XAF B;  4U72 A;  3KV4 A;  2RA1 A;  3DJB A;  4MAL A;  4PJL A;  2LSG A;  4YLH A;  1D0Y A;  2RP4 A;  3UUN A;  3F57 A;  2ZM8 A;  3K3Q C;  5AFU L;  2WMO A;  1MNE A;  5JDL A;  5JQG E;  4PNI A;  4AKH A;  2D5U A;  2N9D A;  2LSJ A;  3K3O A;  3CQC B;  4DMV A;  4ADZ A;  4YJ2 E;  3QC9 A;  3PUA A;  5CA1 E;  2CLY C;  1LVF A;  2PJQ A;  4XBF B;  5JRE A;  1UCU A;  4PFO A;  2DHR A;  5A1L A;  3ZYM A;  2E9X B;  1MMN A;  2Y48 B;  2NTX A;  2KWI B;  4GYS A;  3VU7 H;  2NTY A;  2LHN A;  1OWA A;  3CQG B;  4G63 A;  2KLQ A;  4IE0 A;  3VKG A;  2V1D B;  5FXZ A;  3SWH A;  3CKD A;  2GK9 A;  1UX4 A;  2W62 A;  4O4H E;  4OYJ A;  2Q9Q B;  5L3G B;  3H37 A;  3ANW A;  3N2O A;  1H7C A;  2NP9 A;  3AA1 B;  2X9Y A;  2IC9 A;  3KBT A;  5J2T E;  3TKL B;  3RC8 A;  5TAO A;  3O1I A;  4PW8 A;  4PJN A;  4QXC B;  2ZM0 A;  3LK3 B;  3M65 A;  1Y64 B;  4HKA A;  4EIW A;  1YKE B;  4PAG A;  3ZC1 A;  5LGN B;  2X68 A;  4P0A A;  3MJX A;  4KMC A;  3BQL A;  2WMN A;  4O4I E;  3MXZ A;  4PJM A;  4AKG A;  2LHR A;  4IST A;  4NUV A;  3LBX A;  1EZ3 A;  2MBG A;  3H3A A;  4MHC A;  4AQF C;  4O4L E;  3LK2 B;  1VRB A;  4ZOL E;  5FNV E;  5LOV E;  5C8Y E;  3ZJ2 A;  5CA0 E;  3LK4 2;  1T98 A;  5DQV A;  3RYH E;  2LSY A;  5JRC B;  2KND A;  1IJ5 A;  3IF8 B;  2ACX A;  1E1H B;  4GOU A;  4MLK A;  2DNX A;  5FY7 A;  2XHE B;  3PUR A;  5LJM A;  3OJA A;  4GYR A;  2N1G A;  4DND A;  2V7K A;  2BDE A;  1YKH B;  1YD8 G;  3RRW A;  5LCY A;  2IAK A;  4QKN A;  4PFP A;  3AVS A;  3OBV E;  3PE0 A;  5FXW A;  1HCI A;  4AQF A;  2K48 A;  3CWZ B;  2X67 A;  4BA9 A;  1MIV A;  1D1B A;  2UXN B;  1LVK A;  2YIN A;  3ZMZ B;  5ADX L;  4UV9 B;  3WI3 A;  2LOS A;  3E22 E;  4H9O C;  2L9Q A;  3KDS E;  1MMA A;  3SRZ A;  3K3N A;  2EHO C;  3LG7 A;  1D0Z A;  4HE8 A;  5HXE A;  3PU3 A;  3HKE E;  2CXF A;  2VWA A;  5LBM A;  3PUS A;  4UEM A;  4CI3 B;  2XQY A;  5IYZ E;  3U78 A;  4CI1 B;  3HKB E;  5JDQ A;  1HG5 A;  5HXH A;  1CUN A;  2Y6X A;  1HTJ F;  3F2E A;  3Q5W A;  3R84 B;  2E9X D;  4N78 D;  1ZHC A;  1SA0 E;  3C98 B;  2D0T A;  2DWG A;  3O1H A;  5L3D B;  2JQQ A;  3P7I A;  3RRC A;  1LRZ A;  3D0T A;  2Z6E A;  4ZI7 E;  1ZV4 X;  2EHO A;  4UV8 B;  2A72 A;  4TUY E;  2DCF A;  5FYM A;  2H7O A;  3JC6 C;  2Q9Q D;  3OYX A;  5FY0 A;  2MTQ A;  4TV8 E;  3CQX C;  3ZMU B;  1ZEE A;  3GN5 A;  3O1J A;  2L3L A;  3ESL A;  3AA0 B;  3CX7 B;  4EYY R;  1D0X A;  4UF0 B;  4JUY A;  3E08 A;  5LGU B;  4GK0 E;  3MZK B;  3HA4 A;  3I0Q A;  2V7L A;  4H9P C;  2IW5 B;  3LJC A;  2XAG B;  2W63 A;  4WBO A;  1D1A A;  3UT5 E;  3MK7 C;  3ETV A;  3EVY A;  5JR9 A;  2ES0 A;  1SHZ C;  2NW7 A;  2KZ7 B;  2WAU A;  1HF8 A;  3BK9 A;  2LOP A;  4QHO A;  3NRY A;  4PJJ A;  3OYZ A;  3ZCI A;  3MKD A;  3OKQ A;  3O9X A;  3N2K E;  3HI2 A;  4QXH B;  5DAB A;  5HXR A;  2WSS V;  3GMI A;  3C51 A;  3ZPO A;  4KBM B;  3BQK A;  4FJO A;  2C5K T;  4TV9 E;  2VKO A;  1BR1 A;  5BMV E;  2JMK A;  3UUX B;  1G8X A;  3CVR A;  3N9N A;  5KX5 E;  4GK5 E;  4IE4 A;  2QA7 A;  3MAC A;  2JJ9 A;  5H6Q B;  2X9H A;  3LFM A;  3FXD B;  4ZI2 D;  2JMH A;  4MFR A;  4H63 V;  3PDY A;  5LNK A;  4AKR B;  5J2U E;  2KIN B;  4I4T E;  2VKH A;  4XZC A;  1FMV A;  4E7S A;  4BAY B;  2LE8 A;  2YU1 A;  1U4Q A;  2JPF A;  2W61 A;  4JEH B;  2ZM2 A;  2G0U A;  1G73 A;  4AKI A;  3Q5X A;  3NBX X;  5HYA A;  5JRC A;  4P0B A;  3GA8 A;  2MYS A;  4BJN A;  4CXY A;  1WRD A;  2DLR A;  4O2B E;  4ZI3 D;  4NUU A;  2BVL A;  4UVC B;  4CI2 B;  1FMW A;  4ANJ A;  3C50 A;  3AAI A;  5HXC A;  4P09 A;  3V5S A;  4DVD A;  4CZZ B;  3ZMT B;  1X79 A;  3Q2M A;  1MMG A;  4DBR A;  2NW8 A;  4WW0 A;  2ZLY A;  3ZYK A;  3UTK A;  5F3J A;  4H9Q C;  4ZHQ E;  2LJL A;  2V26 A;  2Y8D A;  3EDV A;  3N9O A;  4DBQ A;  1ZKE A;  4IIJ E;  4ERR A;  1V9D A;  4Z8X A;  2XAH B;  2IC6 A;  2W0G A;  3IBP A;  3ANW B;  3KVB A;  3WAJ A;  2VKD A;  2X66 A;  3VHL A;  5EK2 A;  4IHJ E;  3C64 A;  4HGA A;  3UUL A;  5FY1 A;  2KT9 A;  1HX8 A;  3CX8 B;  4E7Z A;  5LXT E;  3C4X A;  3I1A A;  3ZCJ A;  3L09 A;  3RPU A;  2CMR A;  2OA5 A;  5LGT B;  2VB6 A;  3C4W A;  2K24 A;  5J1G A;  3ZC0 A;  4QXB B;  1YW0 A;  4O4J E;  3AA6 B;  3LBX B;  3N5L A;  1O3X A;  3L3P A;  4HN9 A;  4U74 A;  4IDZ A;  5KDM C;  4YFS A;  1LKX A;  5DQW A;  5FXV A;  3AVR A;  4HTE A;  5LA6 E;  3KFW X;  2BZB A;  1BR0 A;  3QUJ A;  5EK4 A;  2C0S A;  2SPC A;  3PTR B;  5FMN A;  3RX6 A;  2CA5 A;  3NRX A;  3RKO A;  2E9X C;  1Z0P A;  2H7V C;  2CXL A;  3V5U A;  5JDN A;  3IHR A;  2CE7 A;  1MND A;  1HS7 A;  1BR2 A;  2X9X A;  3N9P A;  4L9I A;  4M1P A;  3N2G E;  2CWY A;  1WR6 A;  4OK0 A;  5HAX A;  2Q9Q C;  4EXT A;  3I0O A;  2CWO A;  2D0U A;  3CPZ A;  2ODV A;  2I59 A;  3E0Z A;  4UIG A;  3Q9D A;  2B1E A;  1OXZ A;  2WBL A;  3HKC E;  2ODU A;  3J7Y q;  2D2S A;  1D1C A;  2ZMA A;  3PUQ A;  2E9X A;  3A5X A;  4IGU A;  3CML A;  4XAX B;  4A56 A;  5JH7 E;  3GWH A;  4EAH A;  2XAQ B;  1VOM A;  4AXP A;  3QK6 A;  3KV9 A;  3ETU A;  1IJ6 A;  4ISS A;  5HWX A;  3EDU A;  5ETW A;  3J9X 1;  5L3B B;  2H3R A;  4ZS3 A;  3AB3 B;  3RYI E;  3UFE A;  3P8C D;  1UX5 A;  2KXP B;  2Q9Q A;  4EZ4 A;  4YJ3 E;  5M4Y A;  2LEH A;  2A3D A;  4OYK A;  5HWY A;  3R6N A;  3U3I A;  4BJM A;  5KMG P;  2CCQ A;  2LT3 A;  1U5P A;  3BQI A;  2LSK A;  3RC3 A;  5F8P A;  5LHH B;  2N2N A;  4EOZ B;  3KVA A;  4UXN B;  3GN5 B;  5LG4 A;  3FHN A;  3ZEF B;  4ZI2 C;  3RYF E;  5H6R B;  5JVD E;  3SOL A;  5L2L A;  3F31 A;  1AJ3 A;  5LJN A;  4H9R C;  4QWN B;  4H9S E;  3ZN1 B;  3NZQ A;  4X1I E;  1WYC A;  1NWM X;  2XUE A;  4K0U A;  5JDF A;  4AKL A;  3O4X E;  2C5I T;  3RH3 A;  5JR9 B;  2M67 A;  2BVM A;  3HR0 A;  3S4U A;  3C4Z A;  4OFZ A;  2P9B A;  4ZI3 C;  2J1D G;  4G2A A;  4AI6 A;  3PUG A;  5L3F B;  3ZN0 B;  4TX5 A;  2NOX A;  5E0O A;  5HXS A;  2VKJ A;  4C91 A;  1NAF A;  1S94 A;  2XAJ B;  4EYU A;  2DI4 A;  1S35 A;  3KV5 A;  4ILU A;  3ZYL A;  4IE5 A;  2K5B B;  2VK9 A;  3K8P C;  4AQG A;  1QUU A;  4H9N C;  2V7J A;  5FXX A;  3EUH A;  4DO0 A;  2WWU A;  5JDH A;  2CEA A;  1B7T A;  3VKH A;  3DTO A;  4YHJ A;  1WYB A;  2JRK A;  3ZMS B;  4CXW A;  4OHF A;  5EK3 A;  2PG8 A;  4L5G A;  1HFA A;  2MOZ A;  3CX6 B;  2CLY B;  2XAS B;  2C5J A;  4X1K E;  2HPJ A;  4PK6 A;  2VL8 A;  1BR4 A;  4KUM B;  3WAK A;  2DWK A;  5JDM A;  3ZMV B;  3FBL A;  3N9Q A;  5IHY A;  3UUM A;  4DMW A;  4B6X A;  4EZH A;  4I50 E;  2HH7 A;  3AAA B;  4QX8 B;  3KV6 A;  2X0L B;  3FB2 A;  2YEV C;  3B57 A;  5LHI B;  3B13 A;  3N9M A;  5FP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...