3R84B

Structure of the mediator head subcomplex med11/22
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
80
Chain Sequence
SNQALYEKLEQTRTILSVKLAELINITTIADFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mediator head subcomplex Med11/22 contains a common helix bundle building block with a specific function in transcription initiation complex stabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Mediator of RNA polymerase II transcription subunit 11
total genus 29
structure length 80
sequence length 88
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2011-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r84B00
3R84B 4H63V
chains in the Genus database with same CATH superfamily
3ABVA 2BBHA 3SWHA 4AKRB 2ZM8A 4ILCA 4PJNA 4KP3C 2CLYC 4EV6A 3KV9A 2VQFT 1VRBA 4QXHB 4ZS2A 3K8PC 2V7IA 2YDSA 4P0AA 1MNDA 1YKEB 4PK4A 4H9NC 3RIFA 2CE7A 5JQGE 4JI8T 2DHRA 3SOLA 5LXTE 1UK5A 2JMHA 4IE4A 1EZ3A 2L8KA 2OV9A 3Q2MA 2Y6XA 2D9DA 3UUNA 3EI0A 3VR9A 1OXZA 5C3JA 1AJ3A 4LF9T 3AE8A 5L3FB 2XY8B 2Q9QD 2V7JA 2XJ7A 3MA9A 4ISSA 3UU5A 3ZSTA 4DV5T 1IBMT 2B1EA 2FJBA 1N34T 2W0GA 1LVKA 4HWIB 4J2CA 4ZZBA 3EABA 1Y64B 3OYXA 4QX7B 5CFBA 4LFCT 1VCSA 1HX8A 2Z6EA 3KDSE 4EXTA 3LK42 3RQWA 3BQLA 2NTXA 4QXBB 2FUPA 5AQLB 2UUBT 5ABHA 2ODVA 2XASB 3FZLB 2J1DG 4GOUA 4TN7B 5J0ZA 4DV0T 3QB5A 3RKGA 2XAQB 1WYCA 5DQWA 4LFBT 1W0BA 2IC6A 3VR8A 4X65T 3ZN0B 3AEAA 4KHZF 4CXWA 2CM0A 2XQYA 4PNIA 2DWKA 3H37A 4EYUA 5FXXA 3N9MA 4JI4T 3RIUA 1NWMX 2ZLYA 1WCRA 3E0ZA 2LM2A 2LSIA 2QA7A 2CWOA 5AQGB 5C8YE 3PTRB 3D0TA 3N9LA 1WYBA 3P4QA 3Q5EA 4WW0A 4CZZB 2WP9A 4DR3T 2CHOA 4P0BA 5LOVE 4YT0A 5AQPB 3MZKB 1XNRT 2UXNB 1IJ6A 4YY3T 3F2EA 3VKGA 3ZN1B 2YDQA 2WCAA 2E9XB 5CB4E 2UXXB 1D1CA 3ANWB 2JQHA 2X9WA 5HEJA 1J5ET 3L09A 1IJ5A 3FXEB 5CGMA 4XZCA 2WQYA 3TLTA 1XDOA 2OA5A 5AQOB 2WBLA 3ZMUB 4GYRA 3NZPA 2X9YA 3O1HA 2MOZA 2YK0A 4U7IA 3P4SA 2XQ3A 3I0QA 3KV4A 1HS7A 2BVMA 3ONXA 4TWDA 2XM1A 2XAHB 3ZMTB 4NPPA 3RKOA 4EAHA 4ASKA 3O1JA 1KK7A 2WDVA 3I9YA 3K1SA 4UEMA 4XBFB 2Y48B 3P4RA 1UCUA 5ETWA 3QUJA 4H63V 1ZKEA 4H9PC 3AECA 2W66A 4AQGA 2MTQA 3RHWA 3RRWA 2WZIA 4YHHT 4U31A 2UUCT 3AVRA 4I55E 3TLSA 5A1LA 2VKOA 3QB5K 4U7YA 2X68A 2XSBA 3Q5WA 2CMRA 2KLQA 2DI4A 3AAIA 3JC6D 2RP4A 1FMVA 3O9XA 4IL4A 1N33T 3AXJA 4COFA 1IBKT 1KEYA 1LRZA 2H7OA 1OEDC 1ZEEA 2IUBA 5M4YA 2Q9QC 4QKNA 3QK6A 3AE7A 1D1AA 2JQ9A 5F5WA 2N2NA 3ZC1A 5GONE 2GK9A 3HR0A 4I4TE 5JR9A 5JDGA 2KWIB 4HEAA 2XAFB 3ZT6A 3ZEFB 2VVSA 1ZV4X 1U5PA 2BDEA 3I1AA 1BR2A 3CMLA 2LM9A 2KZ7B 2LLYA 4JUYA 5HCJA 5AQIB 4EZHA 1YKHB 4AQYT 3O1IA 5L3CB 1GQEA 4HWDA 2LOSA 3LBXA 2CCQA 5LB7B 2XZEA 3VHLA 3DJBA 5LJNA 4QH1A 1X9BA 1G8XA 3ESLA 4IE6A 5KXJA 4JYAT 4CN4A 2XQ6A 4LFAT 2NP9A 3JAEA 1IZNB 2VL0A 4IE7A 5AQKB 5FY7A 4ZI2D 3BQIA 3HKCE 3KBUA 4I0UA 4QH5A 5FXZA 5AQMB 2C5KT 2JPFA 1YD8G 3LJCA 4PFOA 4TV8E 2RPAA 4X20E 4U74A 4U72A 1IAPA 5F3JA 5IWAT 3OPCA 2R6GF 2YDRA 5L3GB 4CN1A 2W63A 2WWVA 3TLVA 2CHNA 2LRLA 3ZSSA 2L9QA 3AA1B 5LP6E 4JEUB 2IAKA 4EEDA 1XMOT 2BS2A 3UU4A 2RA1A 2X67A 1U4QA 5JDLA 5ABEA 2KMFA 3H3AA 5AQNB 3MK7C 2LSGA 2VWAA 4HFEA 2CA5A 1UURA 3C51A 3NWIA 3MXZA 2JIWA 2K5BB 4YFSA 4YSYA 5LG4A 1OEDE 5IHYA 3DP7A 2Q9QA 3IF8B 4HWCA 5AQTB 2CRBA 2LE8A 2WDRA 2QRXA 5IUXA 4X66T 3N9PA 5IYZE 3CQGB 1HG5A 3CWZB 1N32T 1FMWA 2WY2A 4OHFA 2D0UA 4AKIA 5HXSA 2CXLA 4YJ3E 2XUEA 2DWGA 2WZHA 1FIOA 2X9HA 1M7KA 2LOPA 3AE2A 3HKEE 2CXDA 3M65A 4QXCB 2E8IA 4HTEA 3Q9DA 2PFVA 4UV9B 3NBXX 4X1KE 2VL8A 4YLHA 3UFEA 3KINB 2SPCA 2MPKA 3ZMSB 3QNUA 3UT5E 5LHHB 4DV3T 1E7PA 4E7SA 1Y01A 5JDMA 5AQSB 4Z90A 2JQQA 5JVDE 3AE5A 4DMVA 3WI3A 5LA6E 2E9XA 3RGLA 5CA0E 2KT9A 3PJAA 4IDPA 4NIQA 4HWFA 5L3DB 3AVSA 5LGUB 3IEEA 4A98A 1I6ZA 1H7CA 5FNVE 3C64A 3G06A 4UV8B 5C2TA 1QUUA 5ABFA 4DV7T 4UXNB 3UUBA 4K0UA 2D5UA 3ZC0A 4HE8A 1UGOA 4IREA 2MAWA 3EVYA 4U33A 4X64T 5BR8T 2ACZA 2FJDA 2VQET 2CWYA 3CK6A 2EHOC 2PJQA 2V1DB 4NXNT 1WRDA 2V7KA 4JI3T 3RX6A 3UU3A 3N9NA 2V6YA 4HN9A 4QHOA 2HPLA 2I6HA 2W67A 3CX8B 3HL6A 4I50E 4ZXLA 2X66A 4CQIA 3SRZA 4TNVA 2NW7A 4ILUA 2FJAA 1LVFA 2KXPB 3EDUA 2EHOB 3PUGA 3UQ4A 3ZT7A 3ETVA 2QVAA 3AAEB 2PTFA 3NRYA 4UVAB 4DBRA 5LYJE 1I94T 4MHCA 3VRBA 1O3XA 4U2YA 3RIUC 1MNEA 4LF7T 3CX6B 4CI2B 5J1GA 3AXJB 3ZJ2A 2YU1A 2BG9C 3B5MA 3AE4A 1S35A 3PUWF 4ISTA 3VU7H 5AFUL 3WAJA 2ZM6T 4JI6T 4YHJA 4WNKA 4JI0T 2CBJA 3FZMB 3L39A 3LG7A 3Q5XA 4GK5E 4TNWA 2LT3A 2PG8A 2YOEA 3AEGA 2A3DA 3A8YC 4ZI3C 2D0TA 3QC9A 4MFRA 3ZCIA 5KDMC 2NW9A 2IDOB 1WLXA 2XQ8A 3K3QC 4IGUA 5LBMA 3PUYF 3N2GE 5HWXA 3RI5A 3P8CD 1JNZA 5J2TE 3LSVA 2L3LA 3PE0A 4V1Av 4H63H 4X1YE 3RC8A 1NAFA 3KV5A 3N9QA 4HFHA 5J2UE 4TX5A 1FJGT 4HFDA 2C5JA 3C98B 1DU2A 3RF1A 4DV1T 4IDZA 4NUVA 2BKNA 3AEDA 4WBNE 4JBWF 3NZQA 3KV6A 5AQRB 3N5LA 2XHEB 3KVBA 4UF0A 4QWNB 2VKJA 4TWFA 3J9X1 2E2AA 3V5SA 4P1NA 5LHIB 2BBJA 2ZMAA 3ETUA 3U78A 4CN6A 3LFMA 3C4WA 3Q5DA 1V9DA 4C90A 5HAXA 4N78D 2K48A 2W2UA 4H9OC 3PU8A 4TV9E 4UVCB 1HTJF 3RPUA 4EB6E 1HR0T 4DR7T 4AKGA 4AKLA 4O4LE 3BK9A 3OBVE 3KVAA 3AE9A 2X0YA 3ZPOA 4CI3B 4EZ4A 4KI0F 1YQ4A 2BKPA 3AA7B 1MIYA 3P4PA 4PAGA 5LBQB 5AQFB 2H88A 2V8SV 2WSSV 5EK2A 2EHOA 2XM2A 1D0YA 2VK9A 3B13A 1SHZC 5FVLA 3R84B 1VOMA 2NOXA 3QOFA 2CBIA 4IHJE 4GKKT 4PJJA 2K24A 2XAGB 4IDNA 4YJ2E 4ANJA 4X5TA 2JMKA 3RYFE 2XPKA 4DR2T 4JLEA 1XDPA 3M3ZB 4LMKA 4PFPA 2E9XD 4WZXA 4DNDA 4YSXA 2G0UA 5KX5E 3T1YT 2X0LB 5JRCB 5EK3A 5TAOA 2E9XC 3SFDA 4A56A 3OYZA 2HN2A 1HX1B 2UXDT 1XWMA 1KNRA 3B57A 3FHNA 3NRXA 3DTOA 3PU3A 2WDQA 5FP3A 4HFBA 3RIAA 5ABFB 2IHR1 3A7MA 3MACA 1MIVA 5L2LA 1VCTA 4G2AA 1UUSA 3ONJA 2YU2A 3AA0B 4UVBB 2V26A 4KMCA 3RH3A 3RQUA 3X1DA 5HYAA 4DR6T 4H9SE 1UX5A 2LSJA 3HA4A 4PK5A 4HFCA 2MBGA 4DMWA 4U2ZA 4DO0A 4AI6A 4B3RT 3UFGA 5FY1A 4A5XA 3TLWA 1MMGA 2H89A 3UU8A 4JI1T 3N9OA 1J5WA 2V6YB 5HCMA 5JREA 2UUAT 1W0AA 2WWUA 4MBQA 5DJQC 5HEOA 3ZCJA 4LMJA 5HXEA 4H9RC 1WR6A 2BKOA 2FBWA 2HPJA 4MLKA 3UTKA 4E7ZA 4DR5T 3A5XA 2UU9T 3ZKRA 1Z8UA 1KNZA 3RYCE 1WFDA 2W61A 2WMNA 3KFWX 5EZYE 2NW8A 1MIWA 3GN5A 2JQKA 4PJLA 2BG9A 4B6XA 2CEAA 3PDYA 2KWHA 3VKHA 2LKGA 3FBZA 4JV5T 3CPZA 2NR4A 2J62A 2YN6A 3FBLA 3RRCA 1N36T 2XQAA 2DLRA 2LSKA 3HKDE 2FJEA 2YKSA 3IA3A 3FB2A 3IBPA 3PUAA 2XQ7A 4G63A 4UR9A 3AE1A 2X0HA 5LG3A 2DNXA 4ILAA 3K3OA 4GKJT 4OYKA 2V7MA 5FVKA 4DV2T 3EAMA 3JADA 3UU6A 4ZI2C 4U3CA 4B3TT 4GK0E 5JDHA 2W00A 3IHRA 2K3WA 3N2KE 4OK0A 4DBQA 4IDQA 1YW0A 4OFZA 3FZFB 3CX7B 5HXRA 3GWHA 4DR1T 4K0KT 3ZMVB 3H3MA 1KF6A 3PJAJ 2C0SA 4HFVA 2HN1A 4PK6A 3ZMZB 4EOZB 5LGNB 1MMDA 4A97A 3FZKB 5FXVA 4EYYR 2J47A 1ZP0A 4H9QC 1OEDA 2CLYB 3AEBA 4O2BE 4UELA 4ZS3A 5CA1E 4JI5T 4DV6T 3T8OA 2IMLA 4O8SA 2WM9A 1D0ZA 2I59A 3PUZF 4O2AE 2IW5B 4DVDA 4O4HE 3P4WA 5HEUA 2F4VT 2K9AA 2J4GA 4LMLA 4Z91A 3UUMA 4YXDA 3OTOT 4ZEYA 1FEWA 4BAYB 5LMUT 1BR4A 2LEHA 2B76A 2VKHA 3C4XA 4FI5A 2LSYA 2W62A 2XQ5A 3V5UA 2W4XA 5F8PA 4DIDB 4IIJE 2XSAA 3N2OA 1XNQT 4DR4T 2NWBA 2WB5A 5FXWA 5L4HA 5LHGB 3JAFA 4KX6A 3LK2B 4AQFC 4QX8B 5AQQB 1T72A 2WS3A 1HNWT 4KBMB 2OLTA 1HF8A 1T8BA 3P7IA 5JDFA 5BMVE 2XTLA 4JI7T 2V5CA 2HH7A 1YXRA 3FXDB 4HWHA 3ZYLA 2LJLA 3AEEA 2VB6A 4Q25A 3CIRA 3NKZA 3HI2A 2ODUA 4ZOLE 4EIWA 4UF0B 2LKHA 1W9RA 5EK4A 2C5IT 3F57A 4QH4A 1QLBA 4EGWA 3P50A 3AE3A 5KMGP 2E5VA 4AQFA 2CPTA 4AIUA 2UXCT 1L0VA 4GYSA 3GA8A 2MYSA 3WAKA 4YSZA 2P9BA 4HGAA 1Z0PA 4IE0A 4WYVA 5CJ5A 4DUZT 5JDNA 3F31A 2AE9A 1HNZT 2WU5A 3OJAA 3ZYMA 2LHNA 5LCYA 1QSDA 4PJMA 2KNDA 2JJ9A 5HWYA 2PBIA 2V6XA 4ADZA 4BJMA 5JDQA 1ZHCA 3VRAA 1SA0E 4AXPA 2XAJB 1US7B 3MKDA 2Y8DA 3CVRA 3L8RA 4L9IA 2JRKA 3PUVF 2A9UA 1XMQT 3RYHE 2VASA 1T7SA 5LNKA 3C50A 2A2FX 2KINB 4ZI3D 1HFAA 5JTGA 4DV4T 3LDQB 4OX9T 2QGSA 3EDVA 3L3PA 3E08A 1NENA 2VVNA 2XQ9A 3CQCB 1SE7A 3I0OA 1E2AA 3O4XE 1SUMB 3AEFA 4GIWA 2CXFA 4JEHB 5E0OA 1R8IA 1T98A 2H7VC 4L5GA 3ZLIA 2DCFA 4OYJA 5HXHA 4PW8A 3SFEA 3ANWA 5JR9C 5L3BB 2IC9A 3S4UA 2M6BA 5DQVA 3UQ7A 4O4IE 2UXBT 4WBOA 1CHUA 5HEGA 3U3IA 2VKDA 2BG9B 3NVOA 5H6QB 3TKLB 2HHHT 3PUQA 3EHZA 5LJMA 1E1HB 3PURA 3PUSA 4ZHQE 2YEVC 2YINA 4HKAA 3EUHA 4C91A 1OWAA 4YTPA 3TLUA 3ONLC 1LKXA 5FYMA 1KFYA 4CXXA 2XQ4A 4Z8XA 4F8HA 2BVLA 2I0MA 4FJOA 5ABGA 4ZI7E 4O4JE 4ERRA 2LHRA 3JC6C 5L47A 4ZZCA 4BJNA 5FL1A 5LGTB 4XAXB 4X62T 3E22E 4TZ4C 2V5DA 1MMAA 3MJXA 3I9WA 4IE5A 5AQJB 1JNRA 4YTNA 2BS4A 5AQUB 1HG2A 2ES0A 4I43B 3UUXB 4B3ST 3ZT5A 1B7TA 5L4EA 2LRKA 2N1GA 2AXDS 3R6NA 4CXYA 2VURA 3GN5B 4L0RA 3BQKA 1BR1A 3GMIA 1KNPA 4P09A 5H6RB 1WR0A 1XZYA 2WU2A 4UIGA 4AKHA 4B3MT 1W09A 3LK3B 4NUUA 4KUMB 2BZBA 5DABA 4X1IE 4YTMA 3SS1A 5AQHB 2DL1A 2Q9QB 1HNXT 5JRCA 4EEBA 5JR9B 4JI2T 5FKYA 5FMNA 4NXMT 3HKBE 2WAUA 3ZYKA 2ZM2A 4KHPT 2D2SA 2A72A 3AA6B 2H3RA 2N9DA 1YQ3A 4AISA 5AQVB 3RC3A 3ZJ1A 3CKDA 2X9XA 3AAAB 1D0XA 1M62A 3CQXC 4HFIA 4IT4A 4MALA 2EHOD 4IL9A 5FL0A 3C4ZA 3K3NA 4ILBA 5HXCA 3RLFF 3RYIE 2IIUA 2ZM0A 4BA9A 2KSRA 2X51A 5HEHA 2NTYA 2V7LA 3UULA 3W15B 4F6RC 4CI1B 1D1BA 1HCIA 1S94A 3AE6A 1NEKA 5ADXL 1OEDB 5LMNT 2WMOA 4TWHA 3T1HT 3PUXF 1UX4A 2BS3A 4LF4T 3J7Yq 4LF6T 1CUNA 1G73A 1MMNA 2BG9E 2QYWA 1BR0A 3KBTA 3JCFA 1ZOYA 3OVUA 1J1JA 1IBLT 2ACXA 3PV0F 2M6IA 5FY0A 4IDOA 2E5LT 4LF5T 3AB3B 4TUYE 1X79A 4LF8T 5L3EB 5JH7E 3OKQA 4M1PA 2M67A 4DUYT 3FZHB 3LBXB
chains in the Genus database with same CATH topology
3SWHA 4AKRB 2ZM8A 4PJNA 4KP3C 2CLYC 3KV9A 1VRBA 4QXHB 4ZS2A 3K8PC 2V7IA 4P0AA 1MNDA 1YKEB 4PK4A 4H9NC 2CE7A 5JQGE 2DHRA 3SOLA 5LXTE 2JMHA 4IE4A 1EZ3A 2L8KA 3Q2MA 2Y6XA 3UUNA 1OXZA 1AJ3A 5L3FB 2Q9QD 2V7JA 3MA9A 4ISSA 2B1EA 2W0GA 1LVKA 4J2CA 3OYXA 1Y64B 4QX7B 4EXTA 1HX8A 2Z6EA 3KDSE 3LK42 3BQLA 2NTXA 4QXBB 2ODVA 2XASB 2J1DG 4GOUA 4TN7B 2XAQB 1WYCA 5DQWA 2IC6A 3ZN0B 4CXWA 2CM0A 2XQYA 4PNIA 2DWKA 3H37A 4EYUA 5FXXA 3N9MA 1NWMX 2ZLYA 3E0ZA 2LSIA 2QA7A 2CWOA 3PTRB 3D0TA 3N9LA 1WYBA 4WW0A 4CZZB 4P0BA 5LOVE 3MZKB 2UXNB 1IJ6A 3F2EA 3ZN1B 5CB4E 2E9XB 2UXXB 1D1CA 3ANWB 2X9WA 3L09A 1IJ5A 3FXEB 4XZCA 2OA5A 2WBLA 3ZMUB 4GYRA 3NZPA 2X9YA 3O1HA 2MOZA 2YK0A 3KV4A 3I0QA 1HS7A 2BVMA 3ONXA 2XAHB 3ZMTB 3RKOA 4EAHA 4ASKA 3O1JA 1KK7A 3I9YA 4XBFB 2Y48B 1UCUA 5ETWA 3QUJA 4H63V 1ZKEA 4H9PC 4AQGA 2MTQA 3RRWA 3AVRA 4I55E 5A1LA 2VKOA 2X68A 3Q5WA 2CMRA 2KLQA 2DI4A 3AAIA 3JC6D 2RP4A 1FMVA 3O9XA 1LRZA 2H7OA 1ZEEA 5M4YA 2Q9QC 4QKNA 3QK6A 1D1AA 3ZC1A 2N2NA 5GONE 2GK9A 3HR0A 4I4TE 5JR9A 5JDGA 2KWIB 2XAFB 3ZEFB 1ZV4X 1U5PA 2BDEA 3I1AA 1BR2A 3CMLA 2LM9A 2KZ7B 4JUYA 4EZHA 1YKHB 3O1IA 5L3CB 3VHLA 2LOSA 3LBXA 2CCQA 5LJNA 3DJBA 1G8XA 3ESLA 4IE6A 2NP9A 1IZNB 4IE7A 5FY7A 4ZI2D 3BQIA 3HKCE 3KBUA 5FXZA 2C5KT 2JPFA 1YD8G 3LJCA 4PFOA 4TV8E 4X20E 4U74A 4U72A 1IAPA 5L3GB 2W63A 2L9QA 3AA1B 5LP6E 4JEUB 2IAKA 2RA1A 2X67A 1U4QA 5JDLA 2KMFA 3H3AA 3MK7C 2LSGA 2VWAA 4HEAA 2CA5A 3C51A 5LG4A 3MXZA 4YFSA 2K5BB 5IHYA 3DP7A 2Q9QA 3IF8B 2LE8A 3N9PA 5IYZE 3CQGB 1HG5A 3CWZB 4AKIA 1FMWA 4OHFA 2D0UA 5HXSA 2CXLA 4YJ3E 2XUEA 2DWGA 5EZYE 1FIOA 2X9HA 2LOPA 3HKEE 4QXCB 3M65A 2CXDA 4UEMA 3ZC0A 2E8IA 4HTEA 3Q9DA 2PFVA 4UV9B 3NBXX 4X1KE 2VL8A 4YLHA 3UFEA 3KINB 2SPCA 3ZMSB 5LHHB 3UT5E 4E7SA 5JDMA 2JQQA 5JVDE 4DMVA 3WI3A 5LA6E 2E9XA 5CA0E 2KT9A 5L3DB 3AVSA 5LGUB 3IEEA 1H7CA 5FNVE 3C64A 4UV8B 1QUUA 4UXNB 4K0UA 2D5UA 4HE8A 3EVYA 2CWYA 2EHOC 2PJQA 2V1DB 1WRDA 2V7KA 3RX6A 3N9NA 4HN9A 4QHOA 2HPLA 3CX8B 4I50E 3HL6A 4CQIA 2X66A 3SRZA 2NW7A 4ILUA 2KXPB 1LVFA 3PUGA 3EDUA 2EHOB 5F3JA 5KDMC 4DBRA 3ETVA 3AAEB 3NRYA 4UVAB 5LYJE 4MHCA 1O3XA 1MNEA 3CX6B 4CI2B 5J1GA 3ZJ2A 2YU1A 1S35A 3VU7H 4ISTA 3WAJA 5AFUL 4YHJA 4WNKA 4GK5E 3LG7A 3Q5XA 2LT3A 2PG8A 2A3DA 4ZI3C 2D0TA 3QC9A 4MFRA 3ZCIA 4CXYA 2NW9A 1WLXA 3K3QC 4IGUA 5LBMA 3N2GE 5HWXA 3P8CD 5J2TE 2L3LA 3PE0A 4V1Av 4H63H 4X1YE 3RC8A 1NAFA 3KV5A 3N9QA 5J2UE 4TX5A 2C5JA 3C98B 4IDZA 4NUVA 4WBNE 3NZQA 3KV6A 3N5LA 2XHEB 3KVBA 4UF0A 4QWNB 2VKJA 3J9X1 3V5SA 5LHIB 2ZMAA 3ETUA 3U78A 3LFMA 3C4WA 1V9DA 4C90A 5HAXA 4N78D 2K48A 4H9OC 4UVCB 3PU8A 4TV9E 3RPUA 1HTJF 4EB6E 4AKGA 4AKLA 4O4LE 3BK9A 3OBVE 3KVAA 3ZPOA 4CI3B 4EZ4A 5LBQB 3AA7B 1MIYA 4PAGA 2WSSV 5EK2A 2EHOA 3B13A 1D0YA 2VK9A 1SHZC 3R84B 1VOMA 2NOXA 4IHJE 4PJJA 2K24A 2XAGB 4YJ2E 4ANJA 2JMKA 3RYFE 4JLEA 4DNDA 4PFPA 2E9XD 2G0UA 5KX5E 2X0LB 5JRCB 5EK3A 5TAOA 2E9XC 4A56A 3OYZA 3FHNA 3B57A 3NRXA 3DTOA 3PU3A 5FP3A 3MACA 1MIVA 5L2LA 4G2AA 2YU2A 3AA0B 4UVBB 2V26A 4KMCA 3RH3A 5HYAA 4H9SE 1UX5A 2LSJA 3HA4A 4PK5A 2MBGA 4DMWA 4DO0A 4AI6A 5FY1A 1MMGA 3N9OA 5JREA 2WWUA 4MBQA 5DJQC 3ZCJA 5HXEA 4H9RC 1WR6A 4MLKA 2HPJA 3UTKA 4E7ZA 3A5XA 1KNZA 3RYCE 2W61A 2WMNA 3KFWX 2NW8A 1MIWA 3GN5A 4PJLA 4B6XA 2CEAA 3PDYA 2KWHA 3VKHA 3FBZA 3CPZA 3FBLA 3RRCA 3HKDE 2DLRA 2LSKA 3PUAA 3IBPA 4G63A 3FB2A 2DNXA 3K3OA 4OYKA 2V7MA 4ZI2C 4GK0E 5JDHA 2W00A 3IHRA 3N2KE 4OK0A 4DBQA 1YW0A 4OFZA 5HXRA 3CX7B 3GWHA 3ZMVB 4HFVA 4PK6A 2C0SA 4EOZB 3ZMZB 5LGNB 1MMDA 5FXVA 4EYYR 4H9QC 2CLYB 4ZS3A 4O2BE 4UELA 5CA1E 3T8OA 4O8SA 2WM9A 1D0ZA 2I59A 4O2AE 2IW5B 4DVDA 4O4HE 2K9AA 3UUMA 1FEWA 4BAYB 1BR4A 3C4XA 2LEHA 2VKHA 4FI5A 3VKGA 2LSYA 2W62A 3V5UA 5F8PA 4IIJE 3N2OA 2NWBA 5FXWA 5LHGB 3LK2B 4AQFC 4QX8B 4KBMB 1HF8A 5JDFA 3P7IA 5BMVE 2XTLA 2HH7A 3FXDB 3ZYLA 2LJLA 2VB6A 3HI2A 2ODUA 4ZOLE 4EIWA 4UF0B 5EK4A 2C5IT 3F57A 5KMGP 4AQFA 4GYSA 3GA8A 2MYSA 3WAKA 2P9BA 4HGAA 1Z0PA 4IE0A 5JDNA 3F31A 3OJAA 3ZYMA 2LHNA 5LCYA 1QSDA 4PJMA 2KNDA 2JJ9A 5HWYA 2PBIA 4ADZA 4BJMA 5JDQA 1ZHCA 1SA0E 4AXPA 2XAJB 1US7B 3MKDA 2Y8DA 3CVRA 4L9IA 2JRKA 3RYHE 2VASA 5LNKA 3C50A 2A2FX 2KINB 4ZI3D 1HFAA 2QGSA 3EDVA 3L3PA 3E08A 3I0OA 3CQCB 3O4XE 4GIWA 5E0OA 5C8YE 4JEHB 2CXFA 3ZLIA 1T98A 4L5GA 2H7VC 5HXHA 5L3BB 2DCFA 4OYJA 5JR9C 4PW8A 3ANWA 2IC9A 3S4UA 5DQVA 4O4IE 4WBOA 3U3IA 2VKDA 5H6QB 3TKLB 3PUQA 5LJMA 1E1HB 3PURA 3PUSA 4ZHQE 2YEVC 2YINA 4HKAA 3EUHA 4C91A 1OWAA 1LKXA 5FYMA 4CXXA 4Z8XA 2BVLA 4FJOA 4ZI7E 4O4JE 4ERRA 2LHRA 3JC6C 4BJNA 5LGTB 4XAXB 3E22E 4TZ4C 1MMAA 3MJXA 3I9WA 4IE5A 1HG2A 2ES0A 4I43B 3UUXB 1B7TA 3R6NA 2N1GA 3GN5B 4L0RA 3BQKA 1BR1A 3GMIA 4P09A 5H6RB 4UIGA 4AKHA 3LK3B 4NUUA 4KUMB 2BZBA 5DABA 4X1IE 3SS1A 5JRCA 2Q9QB 5JR9B 5FMNA 3HKBE 2WAUA 3ZYKA 2ZM2A 2D2SA 2A72A 3AA6B 2H3RA 2N9DA 3RC3A 3ZJ1A 3CKDA 2X9XA 3AAAB 1D0XA 3CQXC 4MALA 2EHOD 3C4ZA 3K3NA 5HXCA 3RYIE 4BA9A 2ZM0A 2X51A 4CI1B 4F6RC 2NTYA 2V7LA 3UULA 3W15B 1D1BA 1HCIA 1S94A 5ADXL 2WMOA 1UX4A 3J7Yq 1CUNA 1G73A 1MMNA 1BR0A 3KBTA 2ACXA 5FY0A 3AB3B 4TUYE 1X79A 5L3EB 5JH7E 3OKQA 4M1PA 2M67A 3LBXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R84 B;  4H63 V; 
#chains in the Genus database with same CATH topology
 3ABV A;  2BBH A;  3SWH A;  4AKR B;  2ZM8 A;  4ILC A;  4PJN A;  4KP3 C;  2CLY C;  4EV6 A;  3KV9 A;  2VQF T;  1VRB A;  4QXH B;  4ZS2 A;  3K8P C;  2V7I A;  2YDS A;  4P0A A;  1MND A;  1YKE B;  4PK4 A;  4H9N C;  3RIF A;  2CE7 A;  5JQG E;  4JI8 T;  2DHR A;  3SOL A;  5LXT E;  1UK5 A;  2JMH A;  4IE4 A;  1EZ3 A;  2L8K A;  2OV9 A;  3Q2M A;  2Y6X A;  2D9D A;  3UUN A;  3EI0 A;  3VR9 A;  1OXZ A;  5C3J A;  1AJ3 A;  4LF9 T;  3AE8 A;  5L3F B;  2XY8 B;  2Q9Q D;  2V7J A;  2XJ7 A;  3MA9 A;  4ISS A;  3UU5 A;  3ZST A;  4DV5 T;  1IBM T;  2B1E A;  2FJB A;  1N34 T;  2W0G A;  1LVK A;  4HWI B;  4J2C A;  4ZZB A;  3EAB A;  1Y64 B;  3OYX A;  4QX7 B;  5CFB A;  4LFC T;  1VCS A;  1HX8 A;  2Z6E A;  3KDS E;  4EXT A;  3LK4 2;  3RQW A;  3BQL A;  2NTX A;  4QXB B;  2FUP A;  5AQL B;  2UUB T;  5ABH A;  2ODV A;  2XAS B;  3FZL B;  2J1D G;  4GOU A;  4TN7 B;  5J0Z A;  4DV0 T;  3QB5 A;  3RKG A;  2XAQ B;  1WYC A;  5DQW A;  4LFB T;  1W0B A;  2IC6 A;  3VR8 A;  4X65 T;  3ZN0 B;  3AEA A;  4KHZ F;  4CXW A;  2CM0 A;  2XQY A;  4PNI A;  2DWK A;  3H37 A;  4EYU A;  5FXX A;  3N9M A;  4JI4 T;  3RIU A;  1NWM X;  2ZLY A;  1WCR A;  3E0Z A;  2LM2 A;  2LSI A;  2QA7 A;  2CWO A;  5AQG B;  5C8Y E;  3PTR B;  3D0T A;  3N9L A;  1WYB A;  3P4Q A;  3Q5E A;  4WW0 A;  4CZZ B;  2WP9 A;  4DR3 T;  2CHO A;  4P0B A;  5LOV E;  4YT0 A;  5AQP B;  3MZK B;  1XNR T;  2UXN B;  1IJ6 A;  4YY3 T;  3F2E A;  3VKG A;  3ZN1 B;  2YDQ A;  2WCA A;  2E9X B;  5CB4 E;  2UXX B;  1D1C A;  3ANW B;  2JQH A;  2X9W A;  5HEJ A;  1J5E T;  3L09 A;  1IJ5 A;  3FXE B;  5CGM A;  4XZC A;  2WQY A;  3TLT A;  1XDO A;  2OA5 A;  5AQO B;  2WBL A;  3ZMU B;  4GYR A;  3NZP A;  2X9Y A;  3O1H A;  2MOZ A;  2YK0 A;  4U7I A;  3P4S A;  2XQ3 A;  3I0Q A;  3KV4 A;  1HS7 A;  2BVM A;  3ONX A;  4TWD A;  2XM1 A;  2XAH B;  3ZMT B;  4NPP A;  3RKO A;  4EAH A;  4ASK A;  3O1J A;  1KK7 A;  2WDV A;  3I9Y A;  3K1S A;  4UEM A;  4XBF B;  2Y48 B;  3P4R A;  1UCU A;  5ETW A;  3QUJ A;  4H63 V;  1ZKE A;  4H9P C;  3AEC A;  2W66 A;  4AQG A;  2MTQ A;  3RHW A;  3RRW A;  2WZI A;  4YHH T;  4U31 A;  2UUC T;  3AVR A;  4I55 E;  3TLS A;  5A1L A;  2VKO A;  3QB5 K;  4U7Y A;  2X68 A;  2XSB A;  3Q5W A;  2CMR A;  2KLQ A;  2DI4 A;  3AAI A;  3JC6 D;  2RP4 A;  1FMV A;  3O9X A;  4IL4 A;  1N33 T;  3AXJ A;  4COF A;  1IBK T;  1KEY A;  1LRZ A;  2H7O A;  1OED C;  1ZEE A;  2IUB A;  5M4Y A;  2Q9Q C;  4QKN A;  3QK6 A;  3AE7 A;  1D1A A;  2JQ9 A;  5F5W A;  2N2N A;  3ZC1 A;  5GON E;  2GK9 A;  3HR0 A;  4I4T E;  5JR9 A;  5JDG A;  2KWI B;  4HEA A;  2XAF B;  3ZT6 A;  3ZEF B;  2VVS A;  1ZV4 X;  1U5P A;  2BDE A;  3I1A A;  1BR2 A;  3CML A;  2LM9 A;  2KZ7 B;  2LLY A;  4JUY A;  5HCJ A;  5AQI B;  4EZH A;  1YKH B;  4AQY T;  3O1I A;  5L3C B;  1GQE A;  4HWD A;  2LOS A;  3LBX A;  2CCQ A;  5LB7 B;  2XZE A;  3VHL A;  3DJB A;  5LJN A;  4QH1 A;  1X9B A;  1G8X A;  3ESL A;  4IE6 A;  5KXJ A;  4JYA T;  4CN4 A;  2XQ6 A;  4LFA T;  2NP9 A;  3JAE A;  1IZN B;  2VL0 A;  4IE7 A;  5AQK B;  5FY7 A;  4ZI2 D;  3BQI A;  3HKC E;  3KBU A;  4I0U A;  4QH5 A;  5FXZ A;  5AQM B;  2C5K T;  2JPF A;  1YD8 G;  3LJC A;  4PFO A;  4TV8 E;  2RPA A;  4X20 E;  4U74 A;  4U72 A;  1IAP A;  5F3J A;  5IWA T;  3OPC A;  2R6G F;  2YDR A;  5L3G B;  4CN1 A;  2W63 A;  2WWV A;  3TLV A;  2CHN A;  2LRL A;  3ZSS A;  2L9Q A;  3AA1 B;  5LP6 E;  4JEU B;  2IAK A;  4EED A;  1XMO T;  2BS2 A;  3UU4 A;  2RA1 A;  2X67 A;  1U4Q A;  5JDL A;  5ABE A;  2KMF A;  3H3A A;  5AQN B;  3MK7 C;  2LSG A;  2VWA A;  4HFE A;  2CA5 A;  1UUR A;  3C51 A;  3NWI A;  3MXZ A;  2JIW A;  2K5B B;  4YFS A;  4YSY A;  5LG4 A;  1OED E;  5IHY A;  3DP7 A;  2Q9Q A;  3IF8 B;  4HWC A;  5AQT B;  2CRB A;  2LE8 A;  2WDR A;  2QRX A;  5IUX A;  4X66 T;  3N9P A;  5IYZ E;  3CQG B;  1HG5 A;  3CWZ B;  1N32 T;  1FMW A;  2WY2 A;  4OHF A;  2D0U A;  4AKI A;  5HXS A;  2CXL A;  4YJ3 E;  2XUE A;  2DWG A;  2WZH A;  1FIO A;  2X9H A;  1M7K A;  2LOP A;  3AE2 A;  3HKE E;  2CXD A;  3M65 A;  4QXC B;  2E8I A;  4HTE A;  3Q9D A;  2PFV A;  4UV9 B;  3NBX X;  4X1K E;  2VL8 A;  4YLH A;  3UFE A;  3KIN B;  2SPC A;  2MPK A;  3ZMS B;  3QNU A;  3UT5 E;  5LHH B;  4DV3 T;  1E7P A;  4E7S A;  1Y01 A;  5JDM A;  5AQS B;  4Z90 A;  2JQQ A;  5JVD E;  3AE5 A;  4DMV A;  3WI3 A;  5LA6 E;  2E9X A;  3RGL A;  5CA0 E;  2KT9 A;  3PJA A;  4IDP A;  4NIQ A;  4HWF A;  5L3D B;  3AVS A;  5LGU B;  3IEE A;  4A98 A;  1I6Z A;  1H7C A;  5FNV E;  3C64 A;  3G06 A;  4UV8 B;  5C2T A;  1QUU A;  5ABF A;  4DV7 T;  4UXN B;  3UUB A;  4K0U A;  2D5U A;  3ZC0 A;  4HE8 A;  1UGO A;  4IRE A;  2MAW A;  3EVY A;  4U33 A;  4X64 T;  5BR8 T;  2ACZ A;  2FJD A;  2VQE T;  2CWY A;  3CK6 A;  2EHO C;  2PJQ A;  2V1D B;  4NXN T;  1WRD A;  2V7K A;  4JI3 T;  3RX6 A;  3UU3 A;  3N9N A;  2V6Y A;  4HN9 A;  4QHO A;  2HPL A;  2I6H A;  2W67 A;  3CX8 B;  3HL6 A;  4I50 E;  4ZXL A;  2X66 A;  4CQI A;  3SRZ A;  4TNV A;  2NW7 A;  4ILU A;  2FJA A;  1LVF A;  2KXP B;  3EDU A;  2EHO B;  3PUG A;  3UQ4 A;  3ZT7 A;  3ETV A;  2QVA A;  3AAE B;  2PTF A;  3NRY A;  4UVA B;  4DBR A;  5LYJ E;  1I94 T;  4MHC A;  3VRB A;  1O3X A;  4U2Y A;  3RIU C;  1MNE A;  4LF7 T;  3CX6 B;  4CI2 B;  5J1G A;  3AXJ B;  3ZJ2 A;  2YU1 A;  2BG9 C;  3B5M A;  3AE4 A;  1S35 A;  3PUW F;  4IST A;  3VU7 H;  5AFU L;  3WAJ A;  2ZM6 T;  4JI6 T;  4YHJ A;  4WNK A;  4JI0 T;  2CBJ A;  3FZM B;  3L39 A;  3LG7 A;  3Q5X A;  4GK5 E;  4TNW A;  2LT3 A;  2PG8 A;  2YOE A;  3AEG A;  2A3D A;  3A8Y C;  4ZI3 C;  2D0T A;  3QC9 A;  4MFR A;  3ZCI A;  5KDM C;  2NW9 A;  2IDO B;  1WLX A;  2XQ8 A;  3K3Q C;  4IGU A;  5LBM A;  3PUY F;  3N2G E;  5HWX A;  3RI5 A;  3P8C D;  1JNZ A;  5J2T E;  3LSV A;  2L3L A;  3PE0 A;  4V1A v;  4H63 H;  4X1Y E;  3RC8 A;  1NAF A;  3KV5 A;  3N9Q A;  4HFH A;  5J2U E;  4TX5 A;  1FJG T;  4HFD A;  2C5J A;  3C98 B;  1DU2 A;  3RF1 A;  4DV1 T;  4IDZ A;  4NUV A;  2BKN A;  3AED A;  4WBN E;  4JBW F;  3NZQ A;  3KV6 A;  5AQR B;  3N5L A;  2XHE B;  3KVB A;  4UF0 A;  4QWN B;  2VKJ A;  4TWF A;  3J9X 1;  2E2A A;  3V5S A;  4P1N A;  5LHI B;  2BBJ A;  2ZMA A;  3ETU A;  3U78 A;  4CN6 A;  3LFM A;  3C4W A;  3Q5D A;  1V9D A;  4C90 A;  5HAX A;  4N78 D;  2K48 A;  2W2U A;  4H9O C;  3PU8 A;  4TV9 E;  4UVC B;  1HTJ F;  3RPU A;  4EB6 E;  1HR0 T;  4DR7 T;  4AKG A;  4AKL A;  4O4L E;  3BK9 A;  3OBV E;  3KVA A;  3AE9 A;  2X0Y A;  3ZPO A;  4CI3 B;  4EZ4 A;  4KI0 F;  1YQ4 A;  2BKP A;  3AA7 B;  1MIY A;  3P4P A;  4PAG A;  5LBQ B;  5AQF B;  2H88 A;  2V8S V;  2WSS V;  5EK2 A;  2EHO A;  2XM2 A;  1D0Y A;  2VK9 A;  3B13 A;  1SHZ C;  5FVL A;  3R84 B;  1VOM A;  2NOX A;  3QOF A;  2CBI A;  4IHJ E;  4GKK T;  4PJJ A;  2K24 A;  2XAG B;  4IDN A;  4YJ2 E;  4ANJ A;  4X5T A;  2JMK A;  3RYF E;  2XPK A;  4DR2 T;  4JLE A;  1XDP A;  3M3Z B;  4LMK A;  4PFP A;  2E9X D;  4WZX A;  4DND A;  4YSX A;  2G0U A;  5KX5 E;  3T1Y T;  2X0L B;  5JRC B;  5EK3 A;  5TAO A;  2E9X C;  3SFD A;  4A56 A;  3OYZ A;  2HN2 A;  1HX1 B;  2UXD T;  1XWM A;  1KNR A;  3B57 A;  3FHN A;  3NRX A;  3DTO A;  3PU3 A;  2WDQ A;  5FP3 A;  4HFB A;  3RIA A;  5ABF B;  2IHR 1;  3A7M A;  3MAC A;  1MIV A;  5L2L A;  1VCT A;  4G2A A;  1UUS A;  3ONJ A;  2YU2 A;  3AA0 B;  4UVB B;  2V26 A;  4KMC A;  3RH3 A;  3RQU A;  3X1D A;  5HYA A;  4DR6 T;  4H9S E;  1UX5 A;  2LSJ A;  3HA4 A;  4PK5 A;  4HFC A;  2MBG A;  4DMW A;  4U2Z A;  4DO0 A;  4AI6 A;  4B3R T;  3UFG A;  5FY1 A;  4A5X A;  3TLW A;  1MMG A;  2H89 A;  3UU8 A;  4JI1 T;  3N9O A;  1J5W A;  2V6Y B;  5HCM A;  5JRE A;  2UUA T;  1W0A A;  2WWU A;  4MBQ A;  5DJQ C;  5HEO A;  3ZCJ A;  4LMJ A;  5HXE A;  4H9R C;  1WR6 A;  2BKO A;  2FBW A;  2HPJ A;  4MLK A;  3UTK A;  4E7Z A;  4DR5 T;  3A5X A;  2UU9 T;  3ZKR A;  1Z8U A;  1KNZ A;  3RYC E;  1WFD A;  2W61 A;  2WMN A;  3KFW X;  5EZY E;  2NW8 A;  1MIW A;  3GN5 A;  2JQK A;  4PJL A;  2BG9 A;  4B6X A;  2CEA A;  3PDY A;  2KWH A;  3VKH A;  2LKG A;  3FBZ A;  4JV5 T;  3CPZ A;  2NR4 A;  2J62 A;  2YN6 A;  3FBL A;  3RRC A;  1N36 T;  2XQA A;  2DLR A;  2LSK A;  3HKD E;  2FJE A;  2YKS A;  3IA3 A;  3FB2 A;  3IBP A;  3PUA A;  2XQ7 A;  4G63 A;  4UR9 A;  3AE1 A;  2X0H A;  5LG3 A;  2DNX A;  4ILA A;  3K3O A;  4GKJ T;  4OYK A;  2V7M A;  5FVK A;  4DV2 T;  3EAM A;  3JAD A;  3UU6 A;  4ZI2 C;  4U3C A;  4B3T T;  4GK0 E;  5JDH A;  2W00 A;  3IHR A;  2K3W A;  3N2K E;  4OK0 A;  4DBQ A;  4IDQ A;  1YW0 A;  4OFZ A;  3FZF B;  3CX7 B;  5HXR A;  3GWH A;  4DR1 T;  4K0K T;  3ZMV B;  3H3M A;  1KF6 A;  3PJA J;  2C0S A;  4HFV A;  2HN1 A;  4PK6 A;  3ZMZ B;  4EOZ B;  5LGN B;  1MMD A;  4A97 A;  3FZK B;  5FXV A;  4EYY R;  2J47 A;  1ZP0 A;  4H9Q C;  1OED A;  2CLY B;  3AEB A;  4O2B E;  4UEL A;  4ZS3 A;  5CA1 E;  4JI5 T;  4DV6 T;  3T8O A;  2IML A;  4O8S A;  2WM9 A;  1D0Z A;  2I59 A;  3PUZ F;  4O2A E;  2IW5 B;  4DVD A;  4O4H E;  3P4W A;  5HEU A;  2F4V T;  2K9A A;  2J4G A;  4LML A;  4Z91 A;  3UUM A;  4YXD A;  3OTO T;  4ZEY A;  1FEW A;  4BAY B;  5LMU T;  1BR4 A;  2LEH A;  2B76 A;  2VKH A;  3C4X A;  4FI5 A;  2LSY A;  2W62 A;  2XQ5 A;  3V5U A;  2W4X A;  5F8P A;  4DID B;  4IIJ E;  2XSA A;  3N2O A;  1XNQ T;  4DR4 T;  2NWB A;  2WB5 A;  5FXW A;  5L4H A;  5LHG B;  3JAF A;  4KX6 A;  3LK2 B;  4AQF C;  4QX8 B;  5AQQ B;  1T72 A;  2WS3 A;  1HNW T;  4KBM B;  2OLT A;  1HF8 A;  1T8B A;  3P7I A;  5JDF A;  5BMV E;  2XTL A;  4JI7 T;  2V5C A;  2HH7 A;  1YXR A;  3FXD B;  4HWH A;  3ZYL A;  2LJL A;  3AEE A;  2VB6 A;  4Q25 A;  3CIR A;  3NKZ A;  3HI2 A;  2ODU A;  4ZOL E;  4EIW A;  4UF0 B;  2LKH A;  1W9R A;  5EK4 A;  2C5I T;  3F57 A;  4QH4 A;  1QLB A;  4EGW A;  3P50 A;  3AE3 A;  5KMG P;  2E5V A;  4AQF A;  2CPT A;  4AIU A;  2UXC T;  1L0V A;  4GYS A;  3GA8 A;  2MYS A;  3WAK A;  4YSZ A;  2P9B A;  4HGA A;  1Z0P A;  4IE0 A;  4WYV A;  5CJ5 A;  4DUZ T;  5JDN A;  3F31 A;  2AE9 A;  1HNZ T;  2WU5 A;  3OJA A;  3ZYM A;  2LHN A;  5LCY A;  1QSD A;  4PJM A;  2KND A;  2JJ9 A;  5HWY A;  2PBI A;  2V6X A;  4ADZ A;  4BJM A;  5JDQ A;  1ZHC A;  3VRA A;  1SA0 E;  4AXP A;  2XAJ B;  1US7 B;  3MKD A;  2Y8D A;  3CVR A;  3L8R A;  4L9I A;  2JRK A;  3PUV F;  2A9U A;  1XMQ T;  3RYH E;  2VAS A;  1T7S A;  5LNK A;  3C50 A;  2A2F X;  2KIN B;  4ZI3 D;  1HFA A;  5JTG A;  4DV4 T;  3LDQ B;  4OX9 T;  2QGS A;  3EDV A;  3L3P A;  3E08 A;  1NEN A;  2VVN A;  2XQ9 A;  3CQC B;  1SE7 A;  3I0O A;  1E2A A;  3O4X E;  1SUM B;  3AEF A;  4GIW A;  2CXF A;  4JEH B;  5E0O A;  1R8I A;  1T98 A;  2H7V C;  4L5G A;  3ZLI A;  2DCF A;  4OYJ A;  5HXH A;  4PW8 A;  3SFE A;  3ANW A;  5JR9 C;  5L3B B;  2IC9 A;  3S4U A;  2M6B A;  5DQV A;  3UQ7 A;  4O4I E;  2UXB T;  4WBO A;  1CHU A;  5HEG A;  3U3I A;  2VKD A;  2BG9 B;  3NVO A;  5H6Q B;  3TKL B;  2HHH T;  3PUQ A;  3EHZ A;  5LJM A;  1E1H B;  3PUR A;  3PUS A;  4ZHQ E;  2YEV C;  2YIN A;  4HKA A;  3EUH A;  4C91 A;  1OWA A;  4YTP A;  3TLU A;  3ONL C;  1LKX A;  5FYM A;  1KFY A;  4CXX A;  2XQ4 A;  4Z8X A;  4F8H A;  2BVL A;  2I0M A;  4FJO A;  5ABG A;  4ZI7 E;  4O4J E;  4ERR A;  2LHR A;  3JC6 C;  5L47 A;  4ZZC A;  4BJN A;  5FL1 A;  5LGT B;  4XAX B;  4X62 T;  3E22 E;  4TZ4 C;  2V5D A;  1MMA A;  3MJX A;  3I9W A;  4IE5 A;  5AQJ B;  1JNR A;  4YTN A;  2BS4 A;  5AQU B;  1HG2 A;  2ES0 A;  4I43 B;  3UUX B;  4B3S T;  3ZT5 A;  1B7T A;  5L4E A;  2LRK A;  2N1G A;  2AXD S;  3R6N A;  4CXY A;  2VUR A;  3GN5 B;  4L0R A;  3BQK A;  1BR1 A;  3GMI A;  1KNP A;  4P09 A;  5H6R B;  1WR0 A;  1XZY A;  2WU2 A;  4UIG A;  4AKH A;  4B3M T;  1W09 A;  3LK3 B;  4NUU A;  4KUM B;  2BZB A;  5DAB A;  4X1I E;  4YTM A;  3SS1 A;  5AQH B;  2DL1 A;  2Q9Q B;  1HNX T;  5JRC A;  4EEB A;  5JR9 B;  4JI2 T;  5FKY A;  5FMN A;  4NXM T;  3HKB E;  2WAU A;  3ZYK A;  2ZM2 A;  4KHP T;  2D2S A;  2A72 A;  3AA6 B;  2H3R A;  2N9D A;  1YQ3 A;  4AIS A;  5AQV B;  3RC3 A;  3ZJ1 A;  3CKD A;  2X9X A;  3AAA B;  1D0X A;  1M62 A;  3CQX C;  4HFI A;  4IT4 A;  4MAL A;  2EHO D;  4IL9 A;  5FL0 A;  3C4Z A;  3K3N A;  4ILB A;  5HXC A;  3RLF F;  3RYI E;  2IIU A;  2ZM0 A;  4BA9 A;  2KSR A;  2X51 A;  5HEH A;  2NTY A;  2V7L A;  3UUL A;  3W15 B;  4F6R C;  4CI1 B;  1D1B A;  1HCI A;  1S94 A;  3AE6 A;  1NEK A;  5ADX L;  1OED B;  5LMN T;  2WMO A;  4TWH A;  3T1H T;  3PUX F;  1UX4 A;  2BS3 A;  4LF4 T;  3J7Y q;  4LF6 T;  1CUN A;  1G73 A;  1MMN A;  2BG9 E;  2QYW A;  1BR0 A;  3KBT A;  3JCF A;  1ZOY A;  3OVU A;  1J1J A;  1IBL T;  2ACX A;  3PV0 F;  2M6I A;  5FY0 A;  4IDO A;  2E5L T;  4LF5 T;  3AB3 B;  4TUY E;  1X79 A;  4LF8 T;  5L3E B;  5JH7 E;  3OKQ A;  4M1P A;  2M67 A;  4DUY T;  3FZH B;  3LBX B; 
#chains in the Genus database with same CATH homology
 3SWH A;  4AKR B;  2ZM8 A;  4PJN A;  4KP3 C;  2CLY C;  3KV9 A;  1VRB A;  4QXH B;  4ZS2 A;  3K8P C;  2V7I A;  4P0A A;  1MND A;  1YKE B;  4PK4 A;  4H9N C;  2CE7 A;  5JQG E;  2DHR A;  3SOL A;  5LXT E;  2JMH A;  4IE4 A;  1EZ3 A;  2L8K A;  3Q2M A;  2Y6X A;  3UUN A;  1OXZ A;  1AJ3 A;  5L3F B;  2Q9Q D;  2V7J A;  3MA9 A;  4ISS A;  2B1E A;  2W0G A;  1LVK A;  4J2C A;  3OYX A;  1Y64 B;  4QX7 B;  4EXT A;  1HX8 A;  2Z6E A;  3KDS E;  3LK4 2;  3BQL A;  2NTX A;  4QXB B;  2ODV A;  2XAS B;  2J1D G;  4GOU A;  4TN7 B;  2XAQ B;  1WYC A;  5DQW A;  2IC6 A;  3ZN0 B;  4CXW A;  2CM0 A;  2XQY A;  4PNI A;  2DWK A;  3H37 A;  4EYU A;  5FXX A;  3N9M A;  1NWM X;  2ZLY A;  3E0Z A;  2LSI A;  2QA7 A;  2CWO A;  3PTR B;  3D0T A;  3N9L A;  1WYB A;  4WW0 A;  4CZZ B;  4P0B A;  5LOV E;  3MZK B;  2UXN B;  1IJ6 A;  3F2E A;  3ZN1 B;  5CB4 E;  2E9X B;  2UXX B;  1D1C A;  3ANW B;  2X9W A;  3L09 A;  1IJ5 A;  3FXE B;  4XZC A;  2OA5 A;  2WBL A;  3ZMU B;  4GYR A;  3NZP A;  2X9Y A;  3O1H A;  2MOZ A;  2YK0 A;  3KV4 A;  3I0Q A;  1HS7 A;  2BVM A;  3ONX A;  2XAH B;  3ZMT B;  3RKO A;  4EAH A;  4ASK A;  3O1J A;  1KK7 A;  3I9Y A;  4XBF B;  2Y48 B;  1UCU A;  5ETW A;  3QUJ A;  4H63 V;  1ZKE A;  4H9P C;  4AQG A;  2MTQ A;  3RRW A;  3AVR A;  4I55 E;  5A1L A;  2VKO A;  2X68 A;  3Q5W A;  2CMR A;  2KLQ A;  2DI4 A;  3AAI A;  3JC6 D;  2RP4 A;  1FMV A;  3O9X A;  1LRZ A;  2H7O A;  1ZEE A;  5M4Y A;  2Q9Q C;  4QKN A;  3QK6 A;  1D1A A;  3ZC1 A;  2N2N A;  5GON E;  2GK9 A;  3HR0 A;  4I4T E;  5JR9 A;  5JDG A;  2KWI B;  2XAF B;  3ZEF B;  1ZV4 X;  1U5P A;  2BDE A;  3I1A A;  1BR2 A;  3CML A;  2LM9 A;  2KZ7 B;  4JUY A;  4EZH A;  1YKH B;  3O1I A;  5L3C B;  3VHL A;  2LOS A;  3LBX A;  2CCQ A;  5LJN A;  3DJB A;  1G8X A;  3ESL A;  4IE6 A;  2NP9 A;  1IZN B;  4IE7 A;  5FY7 A;  4ZI2 D;  3BQI A;  3HKC E;  3KBU A;  5FXZ A;  2C5K T;  2JPF A;  1YD8 G;  3LJC A;  4PFO A;  4TV8 E;  4X20 E;  4U74 A;  4U72 A;  1IAP A;  5L3G B;  2W63 A;  2L9Q A;  3AA1 B;  5LP6 E;  4JEU B;  2IAK A;  2RA1 A;  2X67 A;  1U4Q A;  5JDL A;  2KMF A;  3H3A A;  3MK7 C;  2LSG A;  2VWA A;  4HEA A;  2CA5 A;  3C51 A;  5LG4 A;  3MXZ A;  4YFS A;  2K5B B;  5IHY A;  3DP7 A;  2Q9Q A;  3IF8 B;  2LE8 A;  3N9P A;  5IYZ E;  3CQG B;  1HG5 A;  3CWZ B;  4AKI A;  1FMW A;  4OHF A;  2D0U A;  5HXS A;  2CXL A;  4YJ3 E;  2XUE A;  2DWG A;  5EZY E;  1FIO A;  2X9H A;  2LOP A;  3HKE E;  4QXC B;  3M65 A;  2CXD A;  4UEM A;  3ZC0 A;  2E8I A;  4HTE A;  3Q9D A;  2PFV A;  4UV9 B;  3NBX X;  4X1K E;  2VL8 A;  4YLH A;  3UFE A;  3KIN B;  2SPC A;  3ZMS B;  5LHH B;  3UT5 E;  4E7S A;  5JDM A;  2JQQ A;  5JVD E;  4DMV A;  3WI3 A;  5LA6 E;  2E9X A;  5CA0 E;  2KT9 A;  5L3D B;  3AVS A;  5LGU B;  3IEE A;  1H7C A;  5FNV E;  3C64 A;  4UV8 B;  1QUU A;  4UXN B;  4K0U A;  2D5U A;  4HE8 A;  3EVY A;  2CWY A;  2EHO C;  2PJQ A;  2V1D B;  1WRD A;  2V7K A;  3RX6 A;  3N9N A;  4HN9 A;  4QHO A;  2HPL A;  3CX8 B;  4I50 E;  3HL6 A;  4CQI A;  2X66 A;  3SRZ A;  2NW7 A;  4ILU A;  2KXP B;  1LVF A;  3PUG A;  3EDU A;  2EHO B;  5F3J A;  5KDM C;  4DBR A;  3ETV A;  3AAE B;  3NRY A;  4UVA B;  5LYJ E;  4MHC A;  1O3X A;  1MNE A;  3CX6 B;  4CI2 B;  5J1G A;  3ZJ2 A;  2YU1 A;  1S35 A;  3VU7 H;  4IST A;  3WAJ A;  5AFU L;  4YHJ A;  4WNK A;  4GK5 E;  3LG7 A;  3Q5X A;  2LT3 A;  2PG8 A;  2A3D A;  4ZI3 C;  2D0T A;  3QC9 A;  4MFR A;  3ZCI A;  4CXY A;  2NW9 A;  1WLX A;  3K3Q C;  4IGU A;  5LBM A;  3N2G E;  5HWX A;  3P8C D;  5J2T E;  2L3L A;  3PE0 A;  4V1A v;  4H63 H;  4X1Y E;  3RC8 A;  1NAF A;  3KV5 A;  3N9Q A;  5J2U E;  4TX5 A;  2C5J A;  3C98 B;  4IDZ A;  4NUV A;  4WBN E;  3NZQ A;  3KV6 A;  3N5L A;  2XHE B;  3KVB A;  4UF0 A;  4QWN B;  2VKJ A;  3J9X 1;  3V5S A;  5LHI B;  2ZMA A;  3ETU A;  3U78 A;  3LFM A;  3C4W A;  1V9D A;  4C90 A;  5HAX A;  4N78 D;  2K48 A;  4H9O C;  4UVC B;  3PU8 A;  4TV9 E;  3RPU A;  1HTJ F;  4EB6 E;  4AKG A;  4AKL A;  4O4L E;  3BK9 A;  3OBV E;  3KVA A;  3ZPO A;  4CI3 B;  4EZ4 A;  5LBQ B;  3AA7 B;  1MIY A;  4PAG A;  2WSS V;  5EK2 A;  2EHO A;  3B13 A;  1D0Y A;  2VK9 A;  1SHZ C;  3R84 B;  1VOM A;  2NOX A;  4IHJ E;  4PJJ A;  2K24 A;  2XAG B;  4YJ2 E;  4ANJ A;  2JMK A;  3RYF E;  4JLE A;  4DND A;  4PFP A;  2E9X D;  2G0U A;  5KX5 E;  2X0L B;  5JRC B;  5EK3 A;  5TAO A;  2E9X C;  4A56 A;  3OYZ A;  3FHN A;  3B57 A;  3NRX A;  3DTO A;  3PU3 A;  5FP3 A;  3MAC A;  1MIV A;  5L2L A;  4G2A A;  2YU2 A;  3AA0 B;  4UVB B;  2V26 A;  4KMC A;  3RH3 A;  5HYA A;  4H9S E;  1UX5 A;  2LSJ A;  3HA4 A;  4PK5 A;  2MBG A;  4DMW A;  4DO0 A;  4AI6 A;  5FY1 A;  1MMG A;  3N9O A;  5JRE A;  2WWU A;  4MBQ A;  5DJQ C;  3ZCJ A;  5HXE A;  4H9R C;  1WR6 A;  4MLK A;  2HPJ A;  3UTK A;  4E7Z A;  3A5X A;  1KNZ A;  3RYC E;  2W61 A;  2WMN A;  3KFW X;  2NW8 A;  1MIW A;  3GN5 A;  4PJL A;  4B6X A;  2CEA A;  3PDY A;  2KWH A;  3VKH A;  3FBZ A;  3CPZ A;  3FBL A;  3RRC A;  3HKD E;  2DLR A;  2LSK A;  3PUA A;  3IBP A;  4G63 A;  3FB2 A;  2DNX A;  3K3O A;  4OYK A;  2V7M A;  4ZI2 C;  4GK0 E;  5JDH A;  2W00 A;  3IHR A;  3N2K E;  4OK0 A;  4DBQ A;  1YW0 A;  4OFZ A;  5HXR A;  3CX7 B;  3GWH A;  3ZMV B;  4HFV A;  4PK6 A;  2C0S A;  4EOZ B;  3ZMZ B;  5LGN B;  1MMD A;  5FXV A;  4EYY R;  4H9Q C;  2CLY B;  4ZS3 A;  4O2B E;  4UEL A;  5CA1 E;  3T8O A;  4O8S A;  2WM9 A;  1D0Z A;  2I59 A;  4O2A E;  2IW5 B;  4DVD A;  4O4H E;  2K9A A;  3UUM A;  1FEW A;  4BAY B;  1BR4 A;  3C4X A;  2LEH A;  2VKH A;  4FI5 A;  3VKG A;  2LSY A;  2W62 A;  3V5U A;  5F8P A;  4IIJ E;  3N2O A;  2NWB A;  5FXW A;  5LHG B;  3LK2 B;  4AQF C;  4QX8 B;  4KBM B;  1HF8 A;  5JDF A;  3P7I A;  5BMV E;  2XTL A;  2HH7 A;  3FXD B;  3ZYL A;  2LJL A;  2VB6 A;  3HI2 A;  2ODU A;  4ZOL E;  4EIW A;  4UF0 B;  5EK4 A;  2C5I T;  3F57 A;  5KMG P;  4AQF A;  4GYS A;  3GA8 A;  2MYS A;  3WAK A;  2P9B A;  4HGA A;  1Z0P A;  4IE0 A;  5JDN A;  3F31 A;  3OJA A;  3ZYM A;  2LHN A;  5LCY A;  1QSD A;  4PJM A;  2KND A;  2JJ9 A;  5HWY A;  2PBI A;  4ADZ A;  4BJM A;  5JDQ A;  1ZHC A;  1SA0 E;  4AXP A;  2XAJ B;  1US7 B;  3MKD A;  2Y8D A;  3CVR A;  4L9I A;  2JRK A;  3RYH E;  2VAS A;  5LNK A;  3C50 A;  2A2F X;  2KIN B;  4ZI3 D;  1HFA A;  2QGS A;  3EDV A;  3L3P A;  3E08 A;  3I0O A;  3CQC B;  3O4X E;  4GIW A;  5E0O A;  5C8Y E;  4JEH B;  2CXF A;  3ZLI A;  1T98 A;  4L5G A;  2H7V C;  5HXH A;  5L3B B;  2DCF A;  4OYJ A;  5JR9 C;  4PW8 A;  3ANW A;  2IC9 A;  3S4U A;  5DQV A;  4O4I E;  4WBO A;  3U3I A;  2VKD A;  5H6Q B;  3TKL B;  3PUQ A;  5LJM A;  1E1H B;  3PUR A;  3PUS A;  4ZHQ E;  2YEV C;  2YIN A;  4HKA A;  3EUH A;  4C91 A;  1OWA A;  1LKX A;  5FYM A;  4CXX A;  4Z8X A;  2BVL A;  4FJO A;  4ZI7 E;  4O4J E;  4ERR A;  2LHR A;  3JC6 C;  4BJN A;  5LGT B;  4XAX B;  3E22 E;  4TZ4 C;  1MMA A;  3MJX A;  3I9W A;  4IE5 A;  1HG2 A;  2ES0 A;  4I43 B;  3UUX B;  1B7T A;  3R6N A;  2N1G A;  3GN5 B;  4L0R A;  3BQK A;  1BR1 A;  3GMI A;  4P09 A;  5H6R B;  4UIG A;  4AKH A;  3LK3 B;  4NUU A;  4KUM B;  2BZB A;  5DAB A;  4X1I E;  3SS1 A;  5JRC A;  2Q9Q B;  5JR9 B;  5FMN A;  3HKB E;  2WAU A;  3ZYK A;  2ZM2 A;  2D2S A;  2A72 A;  3AA6 B;  2H3R A;  2N9D A;  3RC3 A;  3ZJ1 A;  3CKD A;  2X9X A;  3AAA B;  1D0X A;  3CQX C;  4MAL A;  2EHO D;  3C4Z A;  3K3N A;  5HXC A;  3RYI E;  4BA9 A;  2ZM0 A;  2X51 A;  4CI1 B;  4F6R C;  2NTY A;  2V7L A;  3UUL A;  3W15 B;  1D1B A;  1HCI A;  1S94 A;  5ADX L;  2WMO A;  1UX4 A;  3J7Y q;  1CUN A;  1G73 A;  1MMN A;  1BR0 A;  3KBT A;  2ACX A;  5FY0 A;  3AB3 B;  4TUY E;  1X79 A;  5L3E B;  5JH7 E;  3OKQ A;  4M1P A;  2M67 A;  3LBX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...