2CPTA

Solution structure of mit domain from human skd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
GSSGSSGMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar sorting protein 4b
publication title Solution structure of MIT domain from human SKD1
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 117
sequence length 117
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2cptA01
4U2ZA 5LB7B 2W2UA 4IT4A 5FVLA 4CN1A 5CGMA 2V6YB 2LRLA 1WR0A 4NIQA 4WZXA 2RPAA 4A5XA 2K3WA 2CRBA 1YXRA 2MPKA 4CN4A 1WFDA 2V6XA 2JQ9A 3ZT7A 4U7YA 3ZSSA 3ZT6A 3ZSTA 4U2YA 2V6YA 2DL1A 3K1SA 2JQKA 2LRKA 4CN6A 4P1NA 2WY2A 2CPTA 2XZEA 2JQHA 1WCRA 4U33A 4ZEYA 2A9UA 2WWVA 4U3CA 5CJ5A 5FVKA 3EABA 4U31A 4U7IA 3ZT5A
chains in the Genus database with same CATH superfamily
1GQEA 2CLYB 3EDUA 5IWAT 3R84B 3ANWA 1WLXA 4CI3B 2BKPA 2X9YA 2CPTA 3LDQB 4DNDA 3V5SA 5J0ZA 4HFCA 2WB5A 3MXZA 1BR1A 2BVMA 5HCJA 1UGOA 4A56A 3PUXF 2XHEB 4YSYA 4ANJA 2V26A 2BKNA 3FZKB 4ZOLE 5JDGA 2YOEA 4U2ZA 2OLTA 4NUVA 2WCAA 2CXFA 1D1BA 1U5PA 3KVBA 4EYYR 4EYUA 5LGTB 1HFAA 3L8RA 3IF8B 3AE5A 4GYRA 1UURA 3N9MA 3PUSA 3WI3A 2XQ3A 4HFIA 5FXVA 3AE4A 2ZM8A 2YINA 2DCFA 3PU8A 2F4VT 4CZZB 5JDFA 2V5CA 3UUXB 3RYCE 4X5TA 5JDNA 2LOPA 3A8YC 5HXEA 1YQ4A 3ZYKA 2CE7A 2AXDS 3QNUA 1Y64B 4JYAT 2VQFT 2JQKA 1WCRA 2V1DB 4C91A 3AAIA 5HCMA 3UU6A 4DV4T 1X79A 4DIDB 4DR5T 1MMNA 3PJAJ 5CA1E 1X9BA 2WMOA 5LMUT 3F57A 3N2KE 3CQGB 1M62A 1FJGT 4I43B 4HFBA 4MHCA 4PJJA 3AA6B 2C5IT 5FP3A 4L0RA 4ZZCA 3FBZA 2XZEA 3AAEB 4JI5T 2HH7A 5LYJE 5LMNT 3RYFE 5LBMA 3ONJA 3ZMTB 4LF6T 5LHHB 4YSZA 4PK6A 2LKGA 1OEDB 5AQOB 4F8HA 2LRKA 4PAGA 4X65T 1T72A 2MAWA 1HX8A 1UX5A 2BVLA 4EAHA 1FMWA 4DR4T 4GK5E 3I0OA 5F5WA 2K3WA 2KZ7B 2H89A 4DV6T 3PTRB 4XBFB 4LF7T 5LA6E 3CX7B 1ZP0A 2XSBA 5HXSA 2VB6A 3ZMZB 2BG9B 2CCQA 2VKHA 3JAFA 4YHJA 5CFBA 4DUYT 2XQ7A 2MPKA 1HNWT 4BJNA 2VKDA 5AQSB 4DV5T 2DL1A 4NXNT 5ABFA 2KWIB 4E7ZA 4PK5A 4JI6T 3ZN1B 2XQ5A 3OYXA 5LB7B 4I50E 2Q9QB 5ADXL 2LKHA 2X0HA 2MTQA 4HGAA 2WS3A 2VVSA 3P4QA 3FHNA 5CJ5A 3SWHA 1IAPA 3UULA 5EK2A 3Q5DA 3FXDB 2ZM6T 3U3IA 3L09A 5JREA 5C8YE 2M6IA 5JR9B 2WZHA 2WDVA 3AEDA 2VKOA 3AXJA 3NVOA 2W00A 4O4JE 3AE1A 4IT4A 1DU2A 3JC6D 4UXNB 3UT5E 3RHWA 5AQPB 2LSIA 2JQ9A 4HWCA 2B1EA 4WBNE 3E22E 4TNWA 3FZFB 4HKAA 2YDSA 3AVSA 1J1JA 3ZCJA 3I9YA 3NRXA 2E5VA 3J7Yq 3PUYF 3CX6B 5AQGB 2J62A 4B3MT 2DI4A 2E2AA 2W62A 4HTEA 4IGUA 4AXPA 4AKHA 1N36T 5FY1A 4IL4A 3QC9A 2W4XA 5FVKA 2V8SV 3PV0F 4DV3T 1HTJF 3RC8A 2PFVA 2JMHA 1D0XA 5AQUB 4CQIA 1SUMB 4U33A 2ACZA 1HF8A 2ZLYA 5LXTE 5LNKA 1HX1B 3V5UA 4X20E 4GOUA 4MLKA 4DO0A 3ZSSA 3OJAA 1SE7A 1YW0A 3GA8A 4UVCB 2WY2A 3O1HA 2OV9A 2W63A 2PTFA 2LOSA 1IJ6A 1VOMA 2CMRA 4O4HE 3P4SA 2XQ8A 2EHOA 4I0UA 4B3ST 1VCTA 2VURA 5FNVE 4AQGA 2FUPA 4YLHA 1HCIA 3VR9A 4O8SA 4JUYA 3GWHA 4U7IA 2J1DG 2OA5A 4C90A 4TV9E 2RA1A 1Z0PA 3WAJA 1U4QA 5LJMA 4X62T 4PFOA 3AEEA 2YN6A 3ZYLA 3H3MA 4FI5A 3HI2A 3RF1A 3ESLA 5KXJA 1NAFA 2LLYA 3HL6A 2XPKA 3CVRA 1J5ET 1OEDE 1G8XA 3DP7A 1W0BA 2KXPB 5LHGB 3JADA 4IHJE 2VKJA 3ZCIA 4QHOA 3HR0A 1UX4A 4OK0A 4ZXLA 1YKHB 4DBRA 1W9RA 3JCFA 5HXRA 5J2UE 1G73A 4IL9A 3AE3A 5HEGA 3AEGA 1LVKA 4JI7T 4AKGA 5AQVB 2X51A 4UF0B 3RH3A 2E9XD 3PUAA 4DVDA 3EUHA 3TLVA 4YXDA 3I9WA 2W0GA 4XAXB 1I6ZA 2BG9E 1LKXA 2XASB 3OPCA 2FJDA 4BAYB 3AE2A 4UEMA 4KI0F 3E0ZA 2IC6A 2B76A 2J4GA 2WBLA 2LSJA 4EV6A 5LBQB 4KX6A 3B5MA 3DTOA 2FJBA 2FJEA 3OYZA 1MIVA 3RX6A 5C2TA 1NWMX 1ZV4X 3Q2MA 2NOXA 1E2AA 1OEDA 3UUMA 3ZMSB 2MBGA 5JQGE 2UXBT 2CWOA 3OTOT 4JEUB 3C64A 3C4ZA 5HEUA 2CXLA 3PUQA 5AQRB 5CB4E 4UR9A 1S94A 1B7TA 1R8IA 4PFPA 4IE5A 1AJ3A 1SHZC 4DR7T 4UV8B 3BK9A 1YXRA 4JI8T 1WFDA 2H7VC 3RGLA 4MBQA 4EXTA 3ZSTA 2BG9A 2V6YA 4J2CA 3LG7A 2X9XA 2A9UA 2WU2A 3ZPOA 3KDSE 3UU8A 4CXYA 4LF9T 4H9RC 4AKRB 5HYAA 1D1AA 3SOLA 3AE8A 5FY0A 2XQ6A 3O9XA 3N9LA 1MMGA 3ZEFB 2Q9QA 2K5BB 2YK0A 4L9IA 4JV5T 5CA0E 4IDNA 4TZ4C 2BZBA 4UIGA 3EDVA 3NZQA 2YU1A 2WM9A 3HA4A 2QA7A 5H6QB 5E0OA 2JJ9A 4JI0T 3W15B 4IE6A 5JDHA 4TV8E 2IDOB 2UXXB 3WAKA 3C50A 2C5JA 3ZN0B 2V5DA 5FXWA 4EIWA 3G06A 3RIUC 5HXCA 4LMLA 5J1GA 4IREA 3SFDA 2UXDT 3O1JA 3AVRA 2UU9T 4IE0A 3MACA 2V7JA 1XNQT 2HN2A 4LFBT 1BR0A 4BJMA 2WWUA 2Y6XA 3DJBA 3N9QA 3K1SA 4QXHB 3JAEA 2HPJA 2L9QA 3X1DA 1WR0A 2CHOA 4JI3T 3UUNA 2XQYA 4IDQA 4H63H 3AAAB 4UELA 4CN6A 2KT9A 1NEKA 5JDMA 5BMVE 1NENA 4I4TE 3LK2B 4HWDA 5L47A 1VCSA 5H6RB 4CI2B 4DR6T 2ACXA 2LSKA 1N32T 3AE9A 2WMNA 1KFYA 4ASKA 2DLRA 3NZPA 2CBJA 4AQFA 3KV9A 3H37A 4B3RT 5JRCB 4GK0E 4CXXA 2UUCT 4Q25A 3UQ7A 2V7KA 4CXWA 4O2AE 3IHRA 2IW5B 1FIOA 1WR6A 2X66A 3T8OA 5DABA 2W61A 3N9OA 1KNPA 1ZEEA 3MKDA 2AE9A 3VKGA 2XJ7A 1T98A 5CGMA 3P4RA 3CPZA 5LGUB 4COFA 3IEEA 3UUBA 1EZ3A 3AB3B 4ILAA 2H3RA 5EK4A 5A1LA 2VQET 4UV9B 4TWHA 2EHOD 3RIUA 5AFUL 5AQMB 2LM9A 1E1HB 4EB6E 3UU5A 2EHOC 3RYHE 2QGSA 2W2UA 2IIUA 4CN1A 3C98B 4JLEA 4TUYE 2XSAA 2CRBA 4IIJE 1OWAA 2UXNB 1UUSA 2VVNA 3HKCE 2Z6EA 4AKIA 2UUAT 5AQNB 4AQYT 3TKLB 2SPCA 2YEVC 2NR4A 2E9XB 4IDPA 4YTPA 3S4UA 2YU2A 4U7YA 4YJ3E 3AECA 4K0KT 4TX5A 3EAMA 2W66A 4XZCA 4JI2T 4NUUA 4UF0A 4ZZBA 5J2TE 5IHYA 1I94T 5IYZE 2H88A 3EVYA 4PNIA 1LRZA 2JPFA 2BBHA 4TNVA 4YSXA 4ISTA 1WYBA 2XAFB 3SS1A 2CXDA 4QH4A 5HWXA 2A2FX 5ETWA 4UVBB 3M3ZB 2I6HA 4O4IE 4U72A 4AI6A 2LHRA 1YD8G 3OBVE 4IE7A 4IDOA 1VRBA 4EZHA 1FEWA 2LT3A 3FZMB 4P0BA 2KINB 2DNXA 2IAKA 2IHR1 5F3JA 3ETUA 2WSSV 2ZMAA 2MYSA 1N34T 2KSRA 4JI1T 3UU3A 4PW8A 4ZS2A 2LHNA 5L3DB 1JNRA 2ZM2A 3TLUA 3AA0B 1YQ3A 2VASA 2FJAA 3N9PA 2YKSA 4X1IE 2KLQA 3C4WA 3KV5A 2K24A 2JRKA 3R6NA 3VU7H 1OEDC 2FBWA 3AEFA 4DV1T 2JIWA 3PDYA 3C51A 3AE6A 3CIRA 4EEBA 3Q9DA 3RKGA 1QUUA 2M67A 5AQHB 3N5LA 3ZC1A 4LFAT 2MOZA 4PJMA 2NWBA 3RQUA 4G2AA 4O2BE 4HFEA 2BG9C 5AQLB 4QXCB 3QB5K 4YTNA 3AA7B 4TWDA 4DBQA 2CHNA 2W67A 2Q9QD 2Q9QC 4MALA 3CK6A 5TAOA 4HEAA 2VL8A 2N1GA 4Z8XA 4QX7B 4LMKA 2Y8DA 3CMLA 5FYMA 4U31A 5HEOA 2ZM0A 3MJXA 3FXEB 3Q5WA 3KFWX 1HG5A 1S35A 3TLTA 1HS7A 2V7IA 1XMOT 3FZHB 5L2LA 1M7KA 4YY3T 4QH5A 3ZT6A 3BQKA 4WW0A 2CM0A 1V9DA 4NXMT 4X1KE 4TN7B 4M1PA 4OYKA 4EOZB 5M4YA 5HEJA 3RRWA 2LRLA 2WQYA 4WZXA 4QXBB 5EK3A 2G0UA 3I0QA 5FY7A 2LM2A 3KV4A 1MNDA 3ZMVB 3MK7C 4WNKA 4H9SE 2E8IA 2H7OA 4YTMA 5FL0A 3HKDE 1BR2A 1ZOYA 4KHPT 1XWMA 3RI5A 2ODVA 4IE4A 3EABA 5JRCA 3PJAA 4GKKT 3SRZA 3NBXX 2LEHA 3EI0A 3ZYMA 4B3TT 2XTLA 4V1Av 3ZLIA 4P09A 2JQQA 3LSVA 3VRAA 2I0MA 2JMKA 4N78D 4GKJT 4YT0A 3KBTA 3BQIA 1J5WA 2CA5A 3CWZB 2NTXA 5LHIB 4AQFC 3RKOA 3GN5B 4UVAB 3RLFF 3PURA 2BDEA 2BS3A 4KP3C 1MNEA 1KK7A 3P7IA 4O4LE 3ONXA 2RP4A 2PJQA 4DMVA 3MZKB 1HG2A 2NW9A 3N2OA 2N9DA 4YHHT 2WWVA 3PUWF 5FL1A 3ZJ2A 3LBXB 1KNRA 5JVDE 5JDLA 4KUMB 4DV7T 4QH1A 4ADZA 5HEHA 2PG8A 2KMFA 1D0YA 5HXHA 2KNDA 5LJNA 4FJOA 5DQWA 3ZC0A 5JR9A 3N9NA 1MIYA 2XAQB 5L4HA 2XQ4A 2XM2A 1XMQT 2E9XA 4X64T 3RC3A 4HWIB 2CEAA 5DJQC 3A5XA 3P50A 4ZEYA 4JEHB 3ZKRA 4A98A 1N33T 3NWIA 4EGWA 2QYWA 3UU4A 2BS4A 2LSGA 3T1YT 4LF4T 3RYIE 4HN9A 3K8PC 2D2SA 4NPPA 3RQWA 2WAUA 4AKLA 1O3XA 2X68A 2NW7A 3LK42 2LSYA 2CBIA 3TLSA 2XAGB 2BS2A 4U3CA 4A97A 3EHZA 4WYVA 3ZT5A 3B13A 2L8KA 3UQ4A 4A5XA 1H7CA 5GONE 2V6XA 3QOFA 3F2EA 3A7MA 1UCUA 5KDMC 4P1NA 1IBLT 3CQXC 2Y48B 2C5KT 4ZI2D 3KINB 5LG3A 1Y01A 4ZI2C 4QKNA 3E08A 4H63V 3M65A 3PUZF 1W09A 3AA1B 1Z8UA 4ERRA 3CKDA 4ZS3A 4IDZA 2K9AA 3QK6A 3LJCA 4DUZT 5L3GB 5C3JA 4EEDA 2R6GF 5ABHA 5JDQA 1ZKEA 1XZYA 1W0AA 4G63A 5LCYA 5LGNB 4QX8B 2PBIA 2WDQA 4Z91A 1YKEB 1IZNB 5AQJB 2I59A 1MMAA 2DWKA 3TLWA 4KHZF 2J47A 3K3NA 4GYSA 4P0AA 2C0SA 3I1AA 3RIFA 1OXZA 3ANWB 2V6YB 2V7LA 1HR0T 3VRBA 5FXXA 2D0UA 2XQAA 1T7SA 4HFVA 3C4XA 1KEYA 2XY8B 2X0LB 3ONLC 3D0TA 3NKZA 2CLYC 2XQ9A 1JNZA 2X0YA 4ZHQE 3UTKA 3IBPA 4H9QC 1BR4A 3J9X1 3BQLA 5EZYE 4X1YE 3UFEA 2VWAA 5FVLA 4WBOA 3AEBA 1IBMT 2NP9A 3T1HT 5L3EB 3O4XE 5JTGA 4AISA 4X66T 1KNZA 4HWFA 3RRCA 2CWYA 3OVUA 3B57A 5FMNA 1D1CA 3JC6C 1MMDA 4I55E 3KVAA 2M6BA 5HWYA 3K3QC 2VL0A 2P9BA 5LOVE 3P4PA 3L3PA 4HFDA 5ABEA 3GMIA 4YFSA 3ABVA 4B6XA 5IUXA 4OX9T 5L4EA 1L0VA 5AQFB 3HKEE 1KF6A 3ZT7A 2UXCT 2NTYA 4OHFA 5AQKB 2XM1A 4BA9A 4LMJA 4L5GA 4EZ4A 1XNRT 2YDQA 5ABGA 2ODUA 4ILCA 4H9OC 4H9NC 2HPLA 5KX5E 5L3CB 2E5LT 3N2GE 2KWHA 1WRDA 3L39A 4DR1T 5AQIB 3AEAA 4JI4T 4MFRA 2IMLA 3RPUA 2RPAA 4H9PC 3VHLA 2IC9A 4HWHA 2WDRA 3Q5XA 5F8PA 1UK5A 2LJLA 3RIAA 1QSDA 1FMVA 2ES0A 1IJ5A 2WZIA 4OFZA 5ABFB 2XUEA 4KMCA 4JBWF 2X9HA 4PJLA 1WYCA 4LF8T 4F6RC 3FZLB 3KBUA 3PU3A 3GN5A 4ILUA 2D5UA 4PK4A 2UUBT 1MIWA 4Z90A 3KV6A 1E7PA 3FBLA 3O1IA 3LBXA 5L3BB 4LFCT 5FKYA 2X9WA 3LK3B 2HHHT 2L3LA 3MA9A 4U2YA 3VKHA 3P8CD 3PE0A 2YDRA 2N2NA 5FXZA 4GIWA 1ZHCA 1IBKT 4QWNB 3AE7A 1CHUA 1SA0E 1T8BA 4TWFA 4CN4A 2QVAA 4E7SA 3HKBE 3AXJB 4DV0T 1CUNA 4HFHA 2XAHB 4AIUA 2JQHA 3PUVF 2X67A 2GK9A 3VR8A 2DHRA 3LFMA 2D9DA 3U78A 3ZMUB 1QLBA 4U74A 4DMWA 5AQTB 2D0TA 3NRYA 3K3OA 5JR9C 4CI1B 3Q5EA 5HAXA 4DR3T 3P4WA 4DR2T 5L3FB 3ZJ1A 4HE8A 3SFEA 1XDPA 2E9XC 4PJNA 2XAJB 5BR8T 1LVFA 4OYJA 3H3AA 1XDOA 3QB5A 5LG4A 3ETVA 2BBJA 1D0ZA 4ISSA 2LE8A 4DV2T 4ZI7E 3CQCB 1HNZT 3OKQA 4YJ2E 4K0UA 2A72A 2BKOA 2DWGA 2V7MA 5KMGP 5DQVA 1US7B 3IA3A 3FB2A 4KBMB 3CX8B 3QUJA 2WP9A 2WU5A 1HNXT 3F31A 4NIQA 2IUBA 3UFGA 4ZI3D 2K48A 3PUGA 4ZI3C 2VK9A 2HN1A 5LP6E 2A3DA 4LF5T 5JH7E 2QRXA 5AQQB 4ILBA 2EHOB 2NW8A
chains in the Genus database with same CATH topology
4U2ZA 5LB7B 2W2UA 4IT4A 5FVLA 4CN1A 5CGMA 2V6YB 2LRLA 1WR0A 4NIQA 4WZXA 2RPAA 4A5XA 2K3WA 2CRBA 1YXRA 2MPKA 4CN4A 1WFDA 2V6XA 2JQ9A 3ZT7A 4U7YA 3ZSSA 3ZT6A 3ZSTA 4U2YA 2V6YA 2DL1A 3K1SA 2JQKA 2LRKA 4CN6A 4P1NA 2WY2A 2CPTA 2XZEA 2JQHA 1WCRA 4U33A 4ZEYA 2A9UA 2WWVA 4U3CA 5CJ5A 5FVKA 3EABA 4U31A 4U7IA 3ZT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U2Z A;  5LB7 B;  2W2U A;  4IT4 A;  5FVL A;  4CN1 A;  5CGM A;  2V6Y B;  2LRL A;  1WR0 A;  4NIQ A;  4WZX A;  2RPA A;  4A5X A;  2K3W A;  2CRB A;  1YXR A;  2MPK A;  4CN4 A;  1WFD A;  2V6X A;  2JQ9 A;  3ZT7 A;  4U7Y A;  3ZSS A;  3ZT6 A;  3ZST A;  4U2Y A;  2V6Y A;  2DL1 A;  3K1S A;  2JQK A;  2LRK A;  4CN6 A;  4P1N A;  2WY2 A;  2CPT A;  2XZE A;  2JQH A;  1WCR A;  4U33 A;  4ZEY A;  2A9U A;  2WWV A;  4U3C A;  5CJ5 A;  5FVK A;  3EAB A;  4U31 A;  4U7I A;  3ZT5 A; 
#chains in the Genus database with same CATH topology
 1GQE A;  2CLY B;  3EDU A;  5IWA T;  3R84 B;  3ANW A;  1WLX A;  4CI3 B;  2BKP A;  2X9Y A;  2CPT A;  3LDQ B;  4DND A;  3V5S A;  5J0Z A;  4HFC A;  2WB5 A;  3MXZ A;  1BR1 A;  2BVM A;  5HCJ A;  1UGO A;  4A56 A;  3PUX F;  2XHE B;  4YSY A;  4ANJ A;  2V26 A;  2BKN A;  3FZK B;  4ZOL E;  5JDG A;  2YOE A;  4U2Z A;  2OLT A;  4NUV A;  2WCA A;  2CXF A;  1D1B A;  1U5P A;  3KVB A;  4EYY R;  4EYU A;  5LGT B;  1HFA A;  3L8R A;  3IF8 B;  3AE5 A;  4GYR A;  1UUR A;  3N9M A;  3PUS A;  3WI3 A;  2XQ3 A;  4HFI A;  5FXV A;  3AE4 A;  2ZM8 A;  2YIN A;  2DCF A;  3PU8 A;  2F4V T;  4CZZ B;  5JDF A;  2V5C A;  3UUX B;  3RYC E;  4X5T A;  5JDN A;  2LOP A;  3A8Y C;  5HXE A;  1YQ4 A;  3ZYK A;  2CE7 A;  2AXD S;  3QNU A;  1Y64 B;  4JYA T;  2VQF T;  2JQK A;  1WCR A;  2V1D B;  4C91 A;  3AAI A;  5HCM A;  3UU6 A;  4DV4 T;  1X79 A;  4DID B;  4DR5 T;  1MMN A;  3PJA J;  5CA1 E;  1X9B A;  2WMO A;  5LMU T;  3F57 A;  3N2K E;  3CQG B;  1M62 A;  1FJG T;  4I43 B;  4HFB A;  4MHC A;  4PJJ A;  3AA6 B;  2C5I T;  5FP3 A;  4L0R A;  4ZZC A;  3FBZ A;  2XZE A;  3AAE B;  4JI5 T;  2HH7 A;  5LYJ E;  5LMN T;  3RYF E;  5LBM A;  3ONJ A;  3ZMT B;  4LF6 T;  5LHH B;  4YSZ A;  4PK6 A;  2LKG A;  1OED B;  5AQO B;  4F8H A;  2LRK A;  4PAG A;  4X65 T;  1T72 A;  2MAW A;  1HX8 A;  1UX5 A;  2BVL A;  4EAH A;  1FMW A;  4DR4 T;  4GK5 E;  3I0O A;  5F5W A;  2K3W A;  2KZ7 B;  2H89 A;  4DV6 T;  3PTR B;  4XBF B;  4LF7 T;  5LA6 E;  3CX7 B;  1ZP0 A;  2XSB A;  5HXS A;  2VB6 A;  3ZMZ B;  2BG9 B;  2CCQ A;  2VKH A;  3JAF A;  4YHJ A;  5CFB A;  4DUY T;  2XQ7 A;  2MPK A;  1HNW T;  4BJN A;  2VKD A;  5AQS B;  4DV5 T;  2DL1 A;  4NXN T;  5ABF A;  2KWI B;  4E7Z A;  4PK5 A;  4JI6 T;  3ZN1 B;  2XQ5 A;  3OYX A;  5LB7 B;  4I50 E;  2Q9Q B;  5ADX L;  2LKH A;  2X0H A;  2MTQ A;  4HGA A;  2WS3 A;  2VVS A;  3P4Q A;  3FHN A;  5CJ5 A;  3SWH A;  1IAP A;  3UUL A;  5EK2 A;  3Q5D A;  3FXD B;  2ZM6 T;  3U3I A;  3L09 A;  5JRE A;  5C8Y E;  2M6I A;  5JR9 B;  2WZH A;  2WDV A;  3AED A;  2VKO A;  3AXJ A;  3NVO A;  2W00 A;  4O4J E;  3AE1 A;  4IT4 A;  1DU2 A;  3JC6 D;  4UXN B;  3UT5 E;  3RHW A;  5AQP B;  2LSI A;  2JQ9 A;  4HWC A;  2B1E A;  4WBN E;  3E22 E;  4TNW A;  3FZF B;  4HKA A;  2YDS A;  3AVS A;  1J1J A;  3ZCJ A;  3I9Y A;  3NRX A;  2E5V A;  3J7Y q;  3PUY F;  3CX6 B;  5AQG B;  2J62 A;  4B3M T;  2DI4 A;  2E2A A;  2W62 A;  4HTE A;  4IGU A;  4AXP A;  4AKH A;  1N36 T;  5FY1 A;  4IL4 A;  3QC9 A;  2W4X A;  5FVK A;  2V8S V;  3PV0 F;  4DV3 T;  1HTJ F;  3RC8 A;  2PFV A;  2JMH A;  1D0X A;  5AQU B;  4CQI A;  1SUM B;  4U33 A;  2ACZ A;  1HF8 A;  2ZLY A;  5LXT E;  5LNK A;  1HX1 B;  3V5U A;  4X20 E;  4GOU A;  4MLK A;  4DO0 A;  3ZSS A;  3OJA A;  1SE7 A;  1YW0 A;  3GA8 A;  4UVC B;  2WY2 A;  3O1H A;  2OV9 A;  2W63 A;  2PTF A;  2LOS A;  1IJ6 A;  1VOM A;  2CMR A;  4O4H E;  3P4S A;  2XQ8 A;  2EHO A;  4I0U A;  4B3S T;  1VCT A;  2VUR A;  5FNV E;  4AQG A;  2FUP A;  4YLH A;  1HCI A;  3VR9 A;  4O8S A;  4JUY A;  3GWH A;  4U7I A;  2J1D G;  2OA5 A;  4C90 A;  4TV9 E;  2RA1 A;  1Z0P A;  3WAJ A;  1U4Q A;  5LJM A;  4X62 T;  4PFO A;  3AEE A;  2YN6 A;  3ZYL A;  3H3M A;  4FI5 A;  3HI2 A;  3RF1 A;  3ESL A;  5KXJ A;  1NAF A;  2LLY A;  3HL6 A;  2XPK A;  3CVR A;  1J5E T;  1OED E;  1G8X A;  3DP7 A;  1W0B A;  2KXP B;  5LHG B;  3JAD A;  4IHJ E;  2VKJ A;  3ZCI A;  4QHO A;  3HR0 A;  1UX4 A;  4OK0 A;  4ZXL A;  1YKH B;  4DBR A;  1W9R A;  3JCF A;  5HXR A;  5J2U E;  1G73 A;  4IL9 A;  3AE3 A;  5HEG A;  3AEG A;  1LVK A;  4JI7 T;  4AKG A;  5AQV B;  2X51 A;  4UF0 B;  3RH3 A;  2E9X D;  3PUA A;  4DVD A;  3EUH A;  3TLV A;  4YXD A;  3I9W A;  2W0G A;  4XAX B;  1I6Z A;  2BG9 E;  1LKX A;  2XAS B;  3OPC A;  2FJD A;  4BAY B;  3AE2 A;  4UEM A;  4KI0 F;  3E0Z A;  2IC6 A;  2B76 A;  2J4G A;  2WBL A;  2LSJ A;  4EV6 A;  5LBQ B;  4KX6 A;  3B5M A;  3DTO A;  2FJB A;  2FJE A;  3OYZ A;  1MIV A;  3RX6 A;  5C2T A;  1NWM X;  1ZV4 X;  3Q2M A;  2NOX A;  1E2A A;  1OED A;  3UUM A;  3ZMS B;  2MBG A;  5JQG E;  2UXB T;  2CWO A;  3OTO T;  4JEU B;  3C64 A;  3C4Z A;  5HEU A;  2CXL A;  3PUQ A;  5AQR B;  5CB4 E;  4UR9 A;  1S94 A;  1B7T A;  1R8I A;  4PFP A;  4IE5 A;  1AJ3 A;  1SHZ C;  4DR7 T;  4UV8 B;  3BK9 A;  1YXR A;  4JI8 T;  1WFD A;  2H7V C;  3RGL A;  4MBQ A;  4EXT A;  3ZST A;  2BG9 A;  2V6Y A;  4J2C A;  3LG7 A;  2X9X A;  2A9U A;  2WU2 A;  3ZPO A;  3KDS E;  3UU8 A;  4CXY A;  4LF9 T;  4H9R C;  4AKR B;  5HYA A;  1D1A A;  3SOL A;  3AE8 A;  5FY0 A;  2XQ6 A;  3O9X A;  3N9L A;  1MMG A;  3ZEF B;  2Q9Q A;  2K5B B;  2YK0 A;  4L9I A;  4JV5 T;  5CA0 E;  4IDN A;  4TZ4 C;  2BZB A;  4UIG A;  3EDV A;  3NZQ A;  2YU1 A;  2WM9 A;  3HA4 A;  2QA7 A;  5H6Q B;  5E0O A;  2JJ9 A;  4JI0 T;  3W15 B;  4IE6 A;  5JDH A;  4TV8 E;  2IDO B;  2UXX B;  3WAK A;  3C50 A;  2C5J A;  3ZN0 B;  2V5D A;  5FXW A;  4EIW A;  3G06 A;  3RIU C;  5HXC A;  4LML A;  5J1G A;  4IRE A;  3SFD A;  2UXD T;  3O1J A;  3AVR A;  2UU9 T;  4IE0 A;  3MAC A;  2V7J A;  1XNQ T;  2HN2 A;  4LFB T;  1BR0 A;  4BJM A;  2WWU A;  2Y6X A;  3DJB A;  3N9Q A;  3K1S A;  4QXH B;  3JAE A;  2HPJ A;  2L9Q A;  3X1D A;  1WR0 A;  2CHO A;  4JI3 T;  3UUN A;  2XQY A;  4IDQ A;  4H63 H;  3AAA B;  4UEL A;  4CN6 A;  2KT9 A;  1NEK A;  5JDM A;  5BMV E;  1NEN A;  4I4T E;  3LK2 B;  4HWD A;  5L47 A;  1VCS A;  5H6R B;  4CI2 B;  4DR6 T;  2ACX A;  2LSK A;  1N32 T;  3AE9 A;  2WMN A;  1KFY A;  4ASK A;  2DLR A;  3NZP A;  2CBJ A;  4AQF A;  3KV9 A;  3H37 A;  4B3R T;  5JRC B;  4GK0 E;  4CXX A;  2UUC T;  4Q25 A;  3UQ7 A;  2V7K A;  4CXW A;  4O2A E;  3IHR A;  2IW5 B;  1FIO A;  1WR6 A;  2X66 A;  3T8O A;  5DAB A;  2W61 A;  3N9O A;  1KNP A;  1ZEE A;  3MKD A;  2AE9 A;  3VKG A;  2XJ7 A;  1T98 A;  5CGM A;  3P4R A;  3CPZ A;  5LGU B;  4COF A;  3IEE A;  3UUB A;  1EZ3 A;  3AB3 B;  4ILA A;  2H3R A;  5EK4 A;  5A1L A;  2VQE T;  4UV9 B;  4TWH A;  2EHO D;  3RIU A;  5AFU L;  5AQM B;  2LM9 A;  1E1H B;  4EB6 E;  3UU5 A;  2EHO C;  3RYH E;  2QGS A;  2W2U A;  2IIU A;  4CN1 A;  3C98 B;  4JLE A;  4TUY E;  2XSA A;  2CRB A;  4IIJ E;  1OWA A;  2UXN B;  1UUS A;  2VVN A;  3HKC E;  2Z6E A;  4AKI A;  2UUA T;  5AQN B;  4AQY T;  3TKL B;  2SPC A;  2YEV C;  2NR4 A;  2E9X B;  4IDP A;  4YTP A;  3S4U A;  2YU2 A;  4U7Y A;  4YJ3 E;  3AEC A;  4K0K T;  4TX5 A;  3EAM A;  2W66 A;  4XZC A;  4JI2 T;  4NUU A;  4UF0 A;  4ZZB A;  5J2T E;  5IHY A;  1I94 T;  5IYZ E;  2H88 A;  3EVY A;  4PNI A;  1LRZ A;  2JPF A;  2BBH A;  4TNV A;  4YSX A;  4IST A;  1WYB A;  2XAF B;  3SS1 A;  2CXD A;  4QH4 A;  5HWX A;  2A2F X;  5ETW A;  4UVB B;  3M3Z B;  2I6H A;  4O4I E;  4U72 A;  4AI6 A;  2LHR A;  1YD8 G;  3OBV E;  4IE7 A;  4IDO A;  1VRB A;  4EZH A;  1FEW A;  2LT3 A;  3FZM B;  4P0B A;  2KIN B;  2DNX A;  2IAK A;  2IHR 1;  5F3J A;  3ETU A;  2WSS V;  2ZMA A;  2MYS A;  1N34 T;  2KSR A;  4JI1 T;  3UU3 A;  4PW8 A;  4ZS2 A;  2LHN A;  5L3D B;  1JNR A;  2ZM2 A;  3TLU A;  3AA0 B;  1YQ3 A;  2VAS A;  2FJA A;  3N9P A;  2YKS A;  4X1I E;  2KLQ A;  3C4W A;  3KV5 A;  2K24 A;  2JRK A;  3R6N A;  3VU7 H;  1OED C;  2FBW A;  3AEF A;  4DV1 T;  2JIW A;  3PDY A;  3C51 A;  3AE6 A;  3CIR A;  4EEB A;  3Q9D A;  3RKG A;  1QUU A;  2M67 A;  5AQH B;  3N5L A;  3ZC1 A;  4LFA T;  2MOZ A;  4PJM A;  2NWB A;  3RQU A;  4G2A A;  4O2B E;  4HFE A;  2BG9 C;  5AQL B;  4QXC B;  3QB5 K;  4YTN A;  3AA7 B;  4TWD A;  4DBQ A;  2CHN A;  2W67 A;  2Q9Q D;  2Q9Q C;  4MAL A;  3CK6 A;  5TAO A;  4HEA A;  2VL8 A;  2N1G A;  4Z8X A;  4QX7 B;  4LMK A;  2Y8D A;  3CML A;  5FYM A;  4U31 A;  5HEO A;  2ZM0 A;  3MJX A;  3FXE B;  3Q5W A;  3KFW X;  1HG5 A;  1S35 A;  3TLT A;  1HS7 A;  2V7I A;  1XMO T;  3FZH B;  5L2L A;  1M7K A;  4YY3 T;  4QH5 A;  3ZT6 A;  3BQK A;  4WW0 A;  2CM0 A;  1V9D A;  4NXM T;  4X1K E;  4TN7 B;  4M1P A;  4OYK A;  4EOZ B;  5M4Y A;  5HEJ A;  3RRW A;  2LRL A;  2WQY A;  4WZX A;  4QXB B;  5EK3 A;  2G0U A;  3I0Q A;  5FY7 A;  2LM2 A;  3KV4 A;  1MND A;  3ZMV B;  3MK7 C;  4WNK A;  4H9S E;  2E8I A;  2H7O A;  4YTM A;  5FL0 A;  3HKD E;  1BR2 A;  1ZOY A;  4KHP T;  1XWM A;  3RI5 A;  2ODV A;  4IE4 A;  3EAB A;  5JRC A;  3PJA A;  4GKK T;  3SRZ A;  3NBX X;  2LEH A;  3EI0 A;  3ZYM A;  4B3T T;  2XTL A;  4V1A v;  3ZLI A;  4P09 A;  2JQQ A;  3LSV A;  3VRA A;  2I0M A;  2JMK A;  4N78 D;  4GKJ T;  4YT0 A;  3KBT A;  3BQI A;  1J5W A;  2CA5 A;  3CWZ B;  2NTX A;  5LHI B;  4AQF C;  3RKO A;  3GN5 B;  4UVA B;  3RLF F;  3PUR A;  2BDE A;  2BS3 A;  4KP3 C;  1MNE A;  1KK7 A;  3P7I A;  4O4L E;  3ONX A;  2RP4 A;  2PJQ A;  4DMV A;  3MZK B;  1HG2 A;  2NW9 A;  3N2O A;  2N9D A;  4YHH T;  2WWV A;  3PUW F;  5FL1 A;  3ZJ2 A;  3LBX B;  1KNR A;  5JVD E;  5JDL A;  4KUM B;  4DV7 T;  4QH1 A;  4ADZ A;  5HEH A;  2PG8 A;  2KMF A;  1D0Y A;  5HXH A;  2KND A;  5LJN A;  4FJO A;  5DQW A;  3ZC0 A;  5JR9 A;  3N9N A;  1MIY A;  2XAQ B;  5L4H A;  2XQ4 A;  2XM2 A;  1XMQ T;  2E9X A;  4X64 T;  3RC3 A;  4HWI B;  2CEA A;  5DJQ C;  3A5X A;  3P50 A;  4ZEY A;  4JEH B;  3ZKR A;  4A98 A;  1N33 T;  3NWI A;  4EGW A;  2QYW A;  3UU4 A;  2BS4 A;  2LSG A;  3T1Y T;  4LF4 T;  3RYI E;  4HN9 A;  3K8P C;  2D2S A;  4NPP A;  3RQW A;  2WAU A;  4AKL A;  1O3X A;  2X68 A;  2NW7 A;  3LK4 2;  2LSY A;  2CBI A;  3TLS A;  2XAG B;  2BS2 A;  4U3C A;  4A97 A;  3EHZ A;  4WYV A;  3ZT5 A;  3B13 A;  2L8K A;  3UQ4 A;  4A5X A;  1H7C A;  5GON E;  2V6X A;  3QOF A;  3F2E A;  3A7M A;  1UCU A;  5KDM C;  4P1N A;  1IBL T;  3CQX C;  2Y48 B;  2C5K T;  4ZI2 D;  3KIN B;  5LG3 A;  1Y01 A;  4ZI2 C;  4QKN A;  3E08 A;  4H63 V;  3M65 A;  3PUZ F;  1W09 A;  3AA1 B;  1Z8U A;  4ERR A;  3CKD A;  4ZS3 A;  4IDZ A;  2K9A A;  3QK6 A;  3LJC A;  4DUZ T;  5L3G B;  5C3J A;  4EED A;  2R6G F;  5ABH A;  5JDQ A;  1ZKE A;  1XZY A;  1W0A A;  4G63 A;  5LCY A;  5LGN B;  4QX8 B;  2PBI A;  2WDQ A;  4Z91 A;  1YKE B;  1IZN B;  5AQJ B;  2I59 A;  1MMA A;  2DWK A;  3TLW A;  4KHZ F;  2J47 A;  3K3N A;  4GYS A;  4P0A A;  2C0S A;  3I1A A;  3RIF A;  1OXZ A;  3ANW B;  2V6Y B;  2V7L A;  1HR0 T;  3VRB A;  5FXX A;  2D0U A;  2XQA A;  1T7S A;  4HFV A;  3C4X A;  1KEY A;  2XY8 B;  2X0L B;  3ONL C;  3D0T A;  3NKZ A;  2CLY C;  2XQ9 A;  1JNZ A;  2X0Y A;  4ZHQ E;  3UTK A;  3IBP A;  4H9Q C;  1BR4 A;  3J9X 1;  3BQL A;  5EZY E;  4X1Y E;  3UFE A;  2VWA A;  5FVL A;  4WBO A;  3AEB A;  1IBM T;  2NP9 A;  3T1H T;  5L3E B;  3O4X E;  5JTG A;  4AIS A;  4X66 T;  1KNZ A;  4HWF A;  3RRC A;  2CWY A;  3OVU A;  3B57 A;  5FMN A;  1D1C A;  3JC6 C;  1MMD A;  4I55 E;  3KVA A;  2M6B A;  5HWY A;  3K3Q C;  2VL0 A;  2P9B A;  5LOV E;  3P4P A;  3L3P A;  4HFD A;  5ABE A;  3GMI A;  4YFS A;  3ABV A;  4B6X A;  5IUX A;  4OX9 T;  5L4E A;  1L0V A;  5AQF B;  3HKE E;  1KF6 A;  3ZT7 A;  2UXC T;  2NTY A;  4OHF A;  5AQK B;  2XM1 A;  4BA9 A;  4LMJ A;  4L5G A;  4EZ4 A;  1XNR T;  2YDQ A;  5ABG A;  2ODU A;  4ILC A;  4H9O C;  4H9N C;  2HPL A;  5KX5 E;  5L3C B;  2E5L T;  3N2G E;  2KWH A;  1WRD A;  3L39 A;  4DR1 T;  5AQI B;  3AEA A;  4JI4 T;  4MFR A;  2IML A;  3RPU A;  2RPA A;  4H9P C;  3VHL A;  2IC9 A;  4HWH A;  2WDR A;  3Q5X A;  5F8P A;  1UK5 A;  2LJL A;  3RIA A;  1QSD A;  1FMV A;  2ES0 A;  1IJ5 A;  2WZI A;  4OFZ A;  5ABF B;  2XUE A;  4KMC A;  4JBW F;  2X9H A;  4PJL A;  1WYC A;  4LF8 T;  4F6R C;  3FZL B;  3KBU A;  3PU3 A;  3GN5 A;  4ILU A;  2D5U A;  4PK4 A;  2UUB T;  1MIW A;  4Z90 A;  3KV6 A;  1E7P A;  3FBL A;  3O1I A;  3LBX A;  5L3B B;  4LFC T;  5FKY A;  2X9W A;  3LK3 B;  2HHH T;  2L3L A;  3MA9 A;  4U2Y A;  3VKH A;  3P8C D;  3PE0 A;  2YDR A;  2N2N A;  5FXZ A;  4GIW A;  1ZHC A;  1IBK T;  4QWN B;  3AE7 A;  1CHU A;  1SA0 E;  1T8B A;  4TWF A;  4CN4 A;  2QVA A;  4E7S A;  3HKB E;  3AXJ B;  4DV0 T;  1CUN A;  4HFH A;  2XAH B;  4AIU A;  2JQH A;  3PUV F;  2X67 A;  2GK9 A;  3VR8 A;  2DHR A;  3LFM A;  2D9D A;  3U78 A;  3ZMU B;  1QLB A;  4U74 A;  4DMW A;  5AQT B;  2D0T A;  3NRY A;  3K3O A;  5JR9 C;  4CI1 B;  3Q5E A;  5HAX A;  4DR3 T;  3P4W A;  4DR2 T;  5L3F B;  3ZJ1 A;  4HE8 A;  3SFE A;  1XDP A;  2E9X C;  4PJN A;  2XAJ B;  5BR8 T;  1LVF A;  4OYJ A;  3H3A A;  1XDO A;  3QB5 A;  5LG4 A;  3ETV A;  2BBJ A;  1D0Z A;  4ISS A;  2LE8 A;  4DV2 T;  4ZI7 E;  3CQC B;  1HNZ T;  3OKQ A;  4YJ2 E;  4K0U A;  2A72 A;  2BKO A;  2DWG A;  2V7M A;  5KMG P;  5DQV A;  1US7 B;  3IA3 A;  3FB2 A;  4KBM B;  3CX8 B;  3QUJ A;  2WP9 A;  2WU5 A;  1HNX T;  3F31 A;  4NIQ A;  2IUB A;  3UFG A;  4ZI3 D;  2K48 A;  3PUG A;  4ZI3 C;  2VK9 A;  2HN1 A;  5LP6 E;  2A3D A;  4LF5 T;  5JH7 E;  2QRX A;  5AQQ B;  4ILB A;  2EHO B;  2NW8 A; 
#chains in the Genus database with same CATH homology
 4U2Z A;  5LB7 B;  2W2U A;  4IT4 A;  5FVL A;  4CN1 A;  5CGM A;  2V6Y B;  2LRL A;  1WR0 A;  4NIQ A;  4WZX A;  2RPA A;  4A5X A;  2K3W A;  2CRB A;  1YXR A;  2MPK A;  4CN4 A;  1WFD A;  2V6X A;  2JQ9 A;  3ZT7 A;  4U7Y A;  3ZSS A;  3ZT6 A;  3ZST A;  4U2Y A;  2V6Y A;  2DL1 A;  3K1S A;  2JQK A;  2LRK A;  4CN6 A;  4P1N A;  2WY2 A;  2CPT A;  2XZE A;  2JQH A;  1WCR A;  4U33 A;  4ZEY A;  2A9U A;  2WWV A;  4U3C A;  5CJ5 A;  5FVK A;  3EAB A;  4U31 A;  4U7I A;  3ZT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...