2CPTA

Solution structure of mit domain from human skd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
b'GSSGSSGMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar sorting protein 4b
publication title Solution structure of MIT domain from human SKD1
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 117
sequence length 117
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2cptA01
4WZXA 5FVKA 4U2ZA 3K1SA 2V6YB 4CN6A 2RPAA 1WCRA 4U7IA 2MPKA 2DL1A 3ZT5A 5FVLA 2LRKA 2V6XA 2W2UA 5LB7B 3ZT7A 3ZSTA 4NIQA 2LRLA 2JQ9A 2WY2A 2V6YA 2CPTA 2JQKA 4P1NA 3EABA 4CN4A 4ZEYA 3ZT6A 4U33A 2WWVA 2JQHA 2XZEA 1YXRA 4U7YA 4A5XA 1WR0A 4CN1A 3ZSSA 5CJ5A 2A9UA 4U31A 5CGMA 4U3CA 2CRBA 4U2YA 4IT4A 1WFDA 2K3WA
chains in the Genus database with same CATH superfamily
4YLHA 2NTYA 2UXDT 4ZI2C 2CXLA 3RQUA 1OEDB 2WU2A 3JAFA 4NIQA 4CN4A 4FJOA 4P1NA 3KVAA 4OHFA 5JDHA 4JI4T 5AQUB 2HN2A 2BG9C 2KMFA 2IIUA 3E0ZA 5AFUL 4JI5T 2XQ8A 4JV5T 4XBFB 3RIUC 5EK3A 3CQCB 3QNUA 2VB6A 5LYJE 3PDYA 2IDOB 2B1EA 4DBQA 4DV0T 2UXBT 2ZM2A 4UV9B 3EAMA 2QGSA 5L3BB 3SRZA 3DJBA 1BR1A 1R8IA 2L9QA 4UELA 5IYZE 4CN1A 1IBMT 2ZMAA 4JI1T 1HNXT 3N9NA 3RYCE 4KBMB 4IGUA 4PFPA 3S4UA 2XUEA 4DR3T 5FVLA 5FKYA 3L39A 3IBPA 3IHRA 5FMNA 4TZ4C 5LHIB 4O4IE 3I1AA 2XQYA 2IC9A 3W15B 1ZP0A 3ONXA 1N36T 1BR4A 4U7IA 1Y01A 4IDNA 2XAQB 2V6YA 2CLYB 4EV6A 1KF6A 2V5CA 2XHEB 1O3XA 1UUSA 4HE8A 1XDOA 3OVUA 4K0KT 3ZEFB 4TX5A 3LDQB 3RQWA 2Q9QB 4KMCA 2D9DA 1VCSA 1HFAA 3EVYA 5AQSB 3RI5A 5HCJA 4E7SA 2LE8A 3NRXA 2WWUA 2K24A 3V5UA 2EHOA 3RC3A 4A56A 2VK9A 2FBWA 3PU8A 4A98A 2E9XC 3HA4A 1NENA 2MTQA 4C90A 5DABA 2JPFA 2V7IA 4HWDA 5HXRA 4OX9T 2H7OA 3FB2A 4DR4T 3F31A 4DV6T 4U74A 4DR5T 2ODVA 2WB5A 3PUGA 1UX5A 1Y64B 2XAJB 3N2OA 2CRBA 3U78A 3OBVE 1WRDA 2OLTA 3ETVA 3H3MA 2DL1A 1XNQT 3ABVA 3AE3A 5HEOA 4YTNA 2CCQA 4GKKT 4MBQA 2M6IA 3GN5B 1V9DA 3MXZA 4AKLA 3AEAA 1HX1B 4XZCA 2D5UA 2BDEA 3DP7A 3JCFA 1D1CA 5HYAA 2BBJA 2BG9A 4GOUA 1YD8G 3EDUA 1WR6A 2X0YA 1B7TA 5JDLA 3RIUA 5LGTB 1MIYA 3V5SA 3ZJ2A 1T72A 3UFEA 3AE9A 4DMVA 3BQLA 3LSVA 2KXPB 2H89A 5LOVE 2MAWA 2RPAA 5LGNB 4LMKA 5LG4A 2C5KT 2LT3A 5AQNB 5L3CB 3ZC0A 4YTMA 4NXMT 3AE7A 4CI1B 4OFZA 3N5LA 4AI6A 2E9XD 4HFIA 4PJJA 4JYAT 5AQRB 2CXDA 2LEHA 3QB5A 2W2UA 3ZT7A 3CQXC 3ZKRA 2XPKA 3QB5K 1MMDA 2JQHA 4ZS3A 5F5WA 5LMNT 2VVNA 1HTJF 4H63H 5AQMB 5LHGB 1FEWA 4DO0A 5HXHA 5JR9B 3RH3A 2WAUA 2A9UA 2LHNA 2CWYA 1ZV4X 3Q2MA 4MHCA 4GYSA 1M7KA 3AEEA 5LB7B 2WQYA 5FL1A 2VKHA 3ANWB 4N78D 3JC6D 3PURA 3ZCIA 4AQYT 4HWFA 1GQEA 4KUMB 3AE1A 4H63V 2JIWA 4EXTA 2JQQA 2D0TA 1UGOA 2YINA 4BA9A 4CI2B 2BKPA 1FJGT 3OYZA 3SOLA 2CBJA 3NWIA 1SE7A 4P09A 4JI2T 4UF0A 2WDRA 3FHNA 3ESLA 1UURA 4OYKA 1BR0A 4E7ZA 4MLKA 3KINB 4QWNB 4O2AE 5J1GA 4O2BE 2XJ7A 1Z8UA 2WBLA 3ZN0B 4MFRA 2L8KA 4TV9E 5LP6E 3PUYF 5LJNA 3H3AA 2E8IA 2XAFB 3N9PA 1KNRA 2J1DG 2XQ9A 5L3EB 4UVAB 5JREA 4CZZB 4YSZA 3FXEB 5AQLB 2M6BA 2LOSA 3ETUA 4I0UA 4IE5A 3N2GE 1KK7A 1S94A 2WY2A 3KBUA 1IJ6A 4H9NC 3PUVF 4U7YA 1D0YA 4DR7T 1FMVA 5HAXA 3RYIE 2W62A 4L0RA 2C5JA 3FBLA 4QX7B 2ZM6T 4L9IA 5CB4E 3SFDA 2FJDA 4PNIA 3AE5A 1HF8A 4UVCB 3IF8B 4ZZCA 3MKDA 2FJAA 2XQ6A 2YEVC 1N32T 3N9OA 4JI8T 2JMHA 4DBRA 4EZHA 4NXNT 5ABHA 5LNKA 1ZHCA 3MZKB 4CXXA 1G73A 1LVKA 1MMNA 4PJLA 2X67A 4LMLA 4OYJA 4F8HA 4HN9A 4O4JE 3ZYLA 2G0UA 4LF9T 3ZMTB 2BVMA 2DNXA 2JMKA 1IBLT 2KT9A 1HNZT 1ZEEA 1HNWT 3J9X1 3RYFE 1WYBA 5DJQC 3QUJA 3PUZF 1HS7A 1D0ZA 5LBMA 5JDFA 4J2CA 3VKGA 4X1KE 1IAPA 1QUUA 5HEHA 2XASB 1U5PA 2H88A 2K9AA 3BQIA 2VASA 4DV4T 3AA6B 3PJAA 2UUBT 2CE7A 4DV2T 2Q9QD 2ACXA 4GYRA 5ADXL 4L5GA 4PK4A 2N2NA 2VVSA 4WBNE 3ZLIA 2JRKA 3GA8A 4I43B 4DR6T 4H9QC 3RKOA 2A2FX 3QK6A 4WZXA 5KX5E 3AAAB 1I94T 3X1DA 2XQ3A 3AVSA 3EHZA 3ONLC 5L4HA 4X20E 1HG5A 1HCIA 4P0AA 3E22E 3SFEA 3O9XA 1W9RA 1KEYA 3K3OA 4PK6A 3AA7B 4JI7T 3KDSE 1D0XA 2MPKA 3A8YC 1X79A 4QHOA 2JQ9A 3AEGA 3UU5A 2IMLA 3LJCA 4I4TE 1G8XA 2VQET 3ZPOA 3RC8A 4IE7A 5FXZA 2YDQA 4DUZT 4DV3T 2DHRA 4TWDA 1L0VA 5JR9C 2DI4A 3HR0A 5M4YA 3RIFA 1VRBA 2HH7A 4KX6A 4G63A 4NPPA 2XM1A 2CPTA 5EK4A 3ZT6A 2DWKA 4WW0A 5IUXA 2BS3A 4HFCA 4QXCB 2BVLA 3AXJA 4U3CA 4AQFC 3C4ZA 4IT4A 4B3ST 4EEBA 3RRCA 2AXDS 2QYWA 3TLTA 5JH7E 4LFCT 2NW8A 3NBXX 5AQPB 3FZHB 1N33T 1FMWA 2I0MA 4ILAA 2N9DA 4QXHB 4WYVA 5ABFA 1MMGA 3CKDA 2V6YB 5KMGP 3VR8A 4LF4T 4F6RC 5AQQB 4Z91A 2OV9A 4U31A 3PUXF 1MIVA 1YQ3A 2WP9A 5LA6E 1QLBA 2NP9A 2V1DB 5CA1E 5AQIB 2LRKA 1W0AA 4X62T 2KZ7B 4M1PA 3H37A 1NWMX 1UX4A 3LBXA 2LKHA 5FY1A 4BJNA 3A7MA 4ZHQE 2Y6XA 1FIOA 2KWIB 3LK42 5J2UE 5FP3A 1EZ3A 3EDVA 2EHOB 2WM9A 2X0HA 1S35A 4HWIB 3MA9A 4AKGA 5LXTE 1D1BA 5CFBA 2NWBA 4B6XA 4ZI3D 1US7B 4B3RT 1MNEA 4NUUA 3ZSSA 4QH5A 5HCMA 3P4SA 4YJ2E 4AXPA 4I55E 3RKGA 1X9BA 3T1YT 3TKLB 4O8SA 2X9HA 3L8RA 3NVOA 4JI3T 4YSYA 1YKEB 3I0OA 3HKDE 3JC6C 4IDZA 4ILCA 3JADA 2WU5A 2B76A 4P0BA 4HFEA 4LFBT 4XAXB 2K3WA 2YU1A 3SS1A 4IREA 2X9YA 4EYYR 3BK9A 4HFDA 2ZM0A 2LLYA 2WMNA 5HEJA 2DLRA 2KLQA 2Y48B 3AE6A 3CX6B 4ANJA 3O1JA 2FUPA 3VU7H 3UUBA 2BG9B 4YXDA 1CUNA 3PE0A 4JBWF 3QOFA 4GK0E 4H9RC 3Q9DA 3C51A 1E2AA 4O4HE 1KNZA 4FI5A 4KI0F 4AKRB 2K48A 3O1IA 2LSIA 2LOPA 5JR9A 4IDPA 4TWHA 1WFDA 4GIWA 1T98A 4X1YE 4ZZBA 5AQOB 1T7SA 2WS3A 1NAFA 3PV0F 4H9SE 1IZNB 2K5BB 3N9QA 3WI3A 2LM9A 3AECA 1HR0T 3GMIA 5LJMA 4KHPT 1I6ZA 1KNPA 2W00A 3VHLA 2UXCT 1E1HB 1WYCA 2BZBA 1D1AA 1WCRA 2LSKA 2D2SA 3F57A 5J2TE 2W4XA 5FXXA 3HKCE 2BKNA 1OEDC 4TUYE 3OPCA 3NZPA 3FZKB 2PBIA 2E9XA 5ABGA 4DR2T 2W0GA 3PUSA 2RA1A 5AQKB 3PJAJ 3KFWX 2YKSA 3ZYMA 3RLFF 2LSYA 2QRXA 5TAOA 4CN6A 5E0OA 3M3ZB 3FZMB 3U3IA 1LVFA 1OXZA 2XTLA 2CXFA 2X68A 4TN7B 3K8PC 3WAKA 3TLSA 4TNWA 5IHYA 3RHWA 2YOEA 4EGWA 4AIUA 3B57A 3Q5WA 1QSDA 4HWHA 3UU8A 3HKEE 3AAEB 2X66A 3WAJA 2I6HA 3R84B 3D0TA 5LG3A 2C0SA 3N2KE 5JDQA 4YTPA 3B13A 4UF0B 5JTGA 5FXWA 2YDSA 1W0BA 5HXEA 2CLYC 4U2ZA 4ILBA 4YT0A 3UFGA 4QH1A 5JDMA 3E08A 2OA5A 3PUWF 3I0QA 3KV4A 2Q9QC 2XSBA 1XMOT 5H6RB 5BR8T 1MIWA 4HTEA 2MBGA 3F2EA 2V7JA 4DV7T 5IWAT 4HFHA 5HEGA 5ABEA 4EB6E 3NZQA 2BKOA 4ILUA 1MNDA 3KV5A 1ZKEA 2NTXA 4X1IE 4DMWA 2FJBA 3AEDA 3T8OA 4ZEYA 3GWHA 2KNDA 4PJMA 3L09A 1XZYA 2V7KA 2E5VA 1Z0PA 2R6GF 3N9LA 5LGUB 4ERRA 3CMLA 4ADZA 3Q5XA 4TNVA 3AEFA 3EABA 2VWAA 5JRCA 1UCUA 2W61A 3CWZB 4UXNB 2UXNB 5F8PA 4YHHT 4Z8XA 3K3QC 3UT5E 2YDRA 5LBQB 4DUYT 5ETWA 4IHJE 5LCYA 3FZFB 3UUMA 3CX7B 2CEAA 2BS2A 5F3JA 3ZSTA 2PTFA 5C3JA 5JDGA 2ZLYA 1OEDA 2PG8A 2BBHA 4WBOA 5C8YE 3LK2B 4DV5T 5FY0A 2NW7A 4PFOA 5AQHB 3C4WA 4Q25A 2V7MA 3RRWA 4HEAA 4Z90A 4EZ4A 3TLVA 1XMQT 5HWXA 2XY8B 4HFBA 2X9XA 1MMAA 2UUAT 4LF7T 1SA0E 5CJ5A 1YQ4A 3QC9A 4CXWA 5AQVB 2N1GA 3C50A 4GKJT 2ZM8A 3OTOT 2AE9A 2M67A 3TLUA 4TV8E 3TLWA 4QKNA 3G06A 4K0UA 2LHRA 3ZMSB 2EHOD 2ODUA 3UULA 2BS4A 4A97A 4JI6T 4UR9A 2L3LA 2LM2A 3K1SA 4HFVA 4KHZF 3VRAA 2Z6EA 3AE4A 2YN6A 4ZI3C 2Q9QA 4YFSA 3KV6A 3CVRA 3CQGB 2XAHB 1WR0A 3ZMVB 1JNRA 5AQJB 2PFVA 2VL0A 2XSAA 3HL6A 4JEUB 4AKHA 2W63A 3AA1B 2KINB 5AQTB 4LFAT 4ZXLA 2GK9A 3BQKA 1LRZA 2CWOA 4HGAA 4A5XA 4X65T 3P4RA 4KP3C 2DWGA 3EUHA 5GONE 4X64T 4DR1T 4ZI2D 3ZMZB 4QXBB 1OWAA 1JNZA 3I9YA 2V5DA 4EIWA 3AXJB 1AJ3A 4IDOA 4LF8T 5JVDE 4X66T 2A72A 4IDQA 5AQGB 4CI3B 1N34T 4ZOLE 5L4EA 2DCFA 4I50E 3HI2A 3KVBA 1HX8A 4IL9A 3OYXA 3RX6A 4IE4A 1YXRA 2WCAA 5JQGE 4HWCA 4CXYA 5ABFB 3RF1A 4H9PC 2ACZA 4U2YA 1KFYA 3GN5A 3PTRB 2IHR1 3CX8B 1J5ET 4PK5A 3OJAA 5HWYA 3ONJA 5EZYE 5HXCA 3KV9A 3A5XA 3IEEA 3PUQA 3UUNA 3L3PA 5LHHB 2QVAA 3ZN1B 2XQ7A 4X5TA 5FVKA 3LK3B 3MK7C 3ZYKA 3ZT5A 3LBXB 2V8SV 4B3TT 2WWVA 3P4PA 5CA0E 5BMVE 1U4QA 3P4WA 4UVBB 3N9MA 3C4XA 4IE6A 5L47A 4COFA 2CBIA 5DQWA 3CPZA 2QA7A 1M62A 4DNDA 5L3DB 3C98B 4AQGA 2VQFT 2BG9E 3UU3A 3T1HT 3VRBA 3CK6A 4PAGA 2VKJA 1J1JA 4JEHB 3KBTA 4MALA 2IAKA 2LJLA 3LFMA 4YJ3E 2XQ4A 5LMUT 4ZI7E 4LF6T 4GK5E 4WNKA 2V7LA 2HPJA 1CHUA 2VKOA 5L3GB 1VOMA 2LKGA 2X0LB 2IC6A 2NR4A 3RPUA 2MYSA 3JAEA 4AQFA 3UU6A 2WSSV 3ANWA 1XWMA 1SHZC 4QH4A 1H7CA 1E7PA 2UXXB 2CHOA 5JDNA 4YY3T 2CMRA 3O1HA 2JJ9A 4HKAA 2XQ5A 2SPCA 5EK2A 4C91A 3UU4A 2PJQA 5FNVE 3VKHA 2VL8A 3AE8A 2HN1A 4O4LE 1HG2A 2VURA 2YU2A 4JLEA 1VCTA 3AE2A 3OKQA 4DV1T 2KWHA 1T8BA 2CHNA 2H3RA 5J0ZA 2IW5B 3UQ7A 3FZLB 4LF5T 5H6QB 2FJEA 2LRLA 3B5MA 1W09A 3ZCJA 3MACA 2P9BA 3Q5DA 3M65A 5DQVA 3P8CD 2H7VC 4OK0A 3K3NA 2JQKA 3VR9A 5HEUA 1BR2A 2MOZA 4ASKA 1YW0A 5CGMA 3J7Yq 4YHJA 2X9WA 2NW9A 4PJNA 4UIGA 2WDQA 4LMJA 1ZOYA 4DIDB 3EI0A 4DVDA 2A3DA 2E9XB 3RGLA 1XNRT 2RP4A 2WZIA 5L3FB 2HPLA 2XZEA 5AQFB 3CIRA 3LG7A 3UTKA 4UEMA 2WDVA 4ZS2A 2XM2A 4CQIA 5FXVA 4EYUA 3ZMUB 2CM0A 3RIAA 4UV8B 4BAYB 3AA0B 4AISA 5L2LA 4U33A 2IUBA 3PUAA 1WLXA 4YSXA 3AB3B 3ZJ1A 4PW8A 4EOZB 3ZC1A 5FY7A 4JUYA 2D0UA 2LSGA 4NUVA 2J47A 2E5LT 5KDMC 3NRYA 2WZHA 4H9OC 2XAGB 1IBKT 4ISTA 3P4QA 3MJXA 3UUXB 4IIJE 3O4XE 3R6NA 1YKHB 4EAHA 3I9WA 2HHHT 4G2AA 3RYHE 5FL0A 4BJMA 1IJ5A 3Q5EA 2UUCT 4B3MT 1UK5A 4IL4A 2I59A 3SWHA 5KXJA 2NOXA 2LSJA 5C2TA 2V26A 1XDPA 2J4GA 2X51A 2EHOC 3UQ4A 5HXSA 3P50A 4TWFA 4EEDA 2Y8DA 1NEKA 3C64A 3NKZA 4ISSA 2E2AA 2WMOA 2W67A 2F4VT 1LKXA 5FYMA 2ES0A 2V6XA 4QX8B 2C5IT 3IA3A 3HKBE 4JI0T 2J62A 3PU3A 4IE0A 4AKIA 4V1Av 3FBZA 2YK0A 3AVRA 4U72A 3FXDB 3AEBA 1SUMB 1J5WA 3P7IA 2CA5A 5JRCB 2W66A 2KSRA 2UU9T 2XQAA 3DTOA 5A1LA 1DU2A 1OEDE 3AAIA 2VKDA
chains in the Genus database with same CATH topology
4WZXA 5FVKA 4U2ZA 3K1SA 2V6YB 4CN6A 2RPAA 1WCRA 4U7IA 2MPKA 2DL1A 3ZT5A 5FVLA 2LRKA 2V6XA 2W2UA 5LB7B 3ZT7A 3ZSTA 4NIQA 2LRLA 2JQ9A 2WY2A 2V6YA 2CPTA 2JQKA 4P1NA 3EABA 4CN4A 4ZEYA 3ZT6A 4U33A 2WWVA 2JQHA 2XZEA 1YXRA 4U7YA 4A5XA 1WR0A 4CN1A 3ZSSA 5CJ5A 2A9UA 4U31A 5CGMA 4U3CA 2CRBA 4U2YA 4IT4A 1WFDA 2K3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZX A;  5FVK A;  4U2Z A;  3K1S A;  2V6Y B;  4CN6 A;  2RPA A;  1WCR A;  4U7I A;  2MPK A;  2DL1 A;  3ZT5 A;  5FVL A;  2LRK A;  2V6X A;  2W2U A;  5LB7 B;  3ZT7 A;  3ZST A;  4NIQ A;  2LRL A;  2JQ9 A;  2WY2 A;  2V6Y A;  2CPT A;  2JQK A;  4P1N A;  3EAB A;  4CN4 A;  4ZEY A;  3ZT6 A;  4U33 A;  2WWV A;  2JQH A;  2XZE A;  1YXR A;  4U7Y A;  4A5X A;  1WR0 A;  4CN1 A;  3ZSS A;  5CJ5 A;  2A9U A;  4U31 A;  5CGM A;  4U3C A;  2CRB A;  4U2Y A;  4IT4 A;  1WFD A;  2K3W A; 
#chains in the Genus database with same CATH topology
 4YLH A;  2NTY A;  2UXD T;  4ZI2 C;  2CXL A;  3RQU A;  1OED B;  2WU2 A;  3JAF A;  4NIQ A;  4CN4 A;  4FJO A;  4P1N A;  3KVA A;  4OHF A;  5JDH A;  4JI4 T;  5AQU B;  2HN2 A;  2BG9 C;  2KMF A;  2IIU A;  3E0Z A;  5AFU L;  4JI5 T;  2XQ8 A;  4JV5 T;  4XBF B;  3RIU C;  5EK3 A;  3CQC B;  3QNU A;  2VB6 A;  5LYJ E;  3PDY A;  2IDO B;  2B1E A;  4DBQ A;  4DV0 T;  2UXB T;  2ZM2 A;  4UV9 B;  3EAM A;  2QGS A;  5L3B B;  3SRZ A;  3DJB A;  1BR1 A;  1R8I A;  2L9Q A;  4UEL A;  5IYZ E;  4CN1 A;  1IBM T;  2ZMA A;  4JI1 T;  1HNX T;  3N9N A;  3RYC E;  4KBM B;  4IGU A;  4PFP A;  3S4U A;  2XUE A;  4DR3 T;  5FVL A;  5FKY A;  3L39 A;  3IBP A;  3IHR A;  5FMN A;  4TZ4 C;  5LHI B;  4O4I E;  3I1A A;  2XQY A;  2IC9 A;  3W15 B;  1ZP0 A;  3ONX A;  1N36 T;  1BR4 A;  4U7I A;  1Y01 A;  4IDN A;  2XAQ B;  2V6Y A;  2CLY B;  4EV6 A;  1KF6 A;  2V5C A;  2XHE B;  1O3X A;  1UUS A;  4HE8 A;  1XDO A;  3OVU A;  4K0K T;  3ZEF B;  4TX5 A;  3LDQ B;  3RQW A;  2Q9Q B;  4KMC A;  2D9D A;  1VCS A;  1HFA A;  3EVY A;  5AQS B;  3RI5 A;  5HCJ A;  4E7S A;  2LE8 A;  3NRX A;  2WWU A;  2K24 A;  3V5U A;  2EHO A;  3RC3 A;  4A56 A;  2VK9 A;  2FBW A;  3PU8 A;  4A98 A;  2E9X C;  3HA4 A;  1NEN A;  2MTQ A;  4C90 A;  5DAB A;  2JPF A;  2V7I A;  4HWD A;  5HXR A;  4OX9 T;  2H7O A;  3FB2 A;  4DR4 T;  3F31 A;  4DV6 T;  4U74 A;  4DR5 T;  2ODV A;  2WB5 A;  3PUG A;  1UX5 A;  1Y64 B;  2XAJ B;  3N2O A;  2CRB A;  3U78 A;  3OBV E;  1WRD A;  2OLT A;  3ETV A;  3H3M A;  2DL1 A;  1XNQ T;  3ABV A;  3AE3 A;  5HEO A;  4YTN A;  2CCQ A;  4GKK T;  4MBQ A;  2M6I A;  3GN5 B;  1V9D A;  3MXZ A;  4AKL A;  3AEA A;  1HX1 B;  4XZC A;  2D5U A;  2BDE A;  3DP7 A;  3JCF A;  1D1C A;  5HYA A;  2BBJ A;  2BG9 A;  4GOU A;  1YD8 G;  3EDU A;  1WR6 A;  2X0Y A;  1B7T A;  5JDL A;  3RIU A;  5LGT B;  1MIY A;  3V5S A;  3ZJ2 A;  1T72 A;  3UFE A;  3AE9 A;  4DMV A;  3BQL A;  3LSV A;  2KXP B;  2H89 A;  5LOV E;  2MAW A;  2RPA A;  5LGN B;  4LMK A;  5LG4 A;  2C5K T;  2LT3 A;  5AQN B;  5L3C B;  3ZC0 A;  4YTM A;  4NXM T;  3AE7 A;  4CI1 B;  4OFZ A;  3N5L A;  4AI6 A;  2E9X D;  4HFI A;  4PJJ A;  4JYA T;  5AQR B;  2CXD A;  2LEH A;  3QB5 A;  2W2U A;  3ZT7 A;  3CQX C;  3ZKR A;  2XPK A;  3QB5 K;  1MMD A;  2JQH A;  4ZS3 A;  5F5W A;  5LMN T;  2VVN A;  1HTJ F;  4H63 H;  5AQM B;  5LHG B;  1FEW A;  4DO0 A;  5HXH A;  5JR9 B;  3RH3 A;  2WAU A;  2A9U A;  2LHN A;  2CWY A;  1ZV4 X;  3Q2M A;  4MHC A;  4GYS A;  1M7K A;  3AEE A;  5LB7 B;  2WQY A;  5FL1 A;  2VKH A;  3ANW B;  4N78 D;  3JC6 D;  3PUR A;  3ZCI A;  4AQY T;  4HWF A;  1GQE A;  4KUM B;  3AE1 A;  4H63 V;  2JIW A;  4EXT A;  2JQQ A;  2D0T A;  1UGO A;  2YIN A;  4BA9 A;  4CI2 B;  2BKP A;  1FJG T;  3OYZ A;  3SOL A;  2CBJ A;  3NWI A;  1SE7 A;  4P09 A;  4JI2 T;  4UF0 A;  2WDR A;  3FHN A;  3ESL A;  1UUR A;  4OYK A;  1BR0 A;  4E7Z A;  4MLK A;  3KIN B;  4QWN B;  4O2A E;  5J1G A;  4O2B E;  2XJ7 A;  1Z8U A;  2WBL A;  3ZN0 B;  4MFR A;  2L8K A;  4TV9 E;  5LP6 E;  3PUY F;  5LJN A;  3H3A A;  2E8I A;  2XAF B;  3N9P A;  1KNR A;  2J1D G;  2XQ9 A;  5L3E B;  4UVA B;  5JRE A;  4CZZ B;  4YSZ A;  3FXE B;  5AQL B;  2M6B A;  2LOS A;  3ETU A;  4I0U A;  4IE5 A;  3N2G E;  1KK7 A;  1S94 A;  2WY2 A;  3KBU A;  1IJ6 A;  4H9N C;  3PUV F;  4U7Y A;  1D0Y A;  4DR7 T;  1FMV A;  5HAX A;  3RYI E;  2W62 A;  4L0R A;  2C5J A;  3FBL A;  4QX7 B;  2ZM6 T;  4L9I A;  5CB4 E;  3SFD A;  2FJD A;  4PNI A;  3AE5 A;  1HF8 A;  4UVC B;  3IF8 B;  4ZZC A;  3MKD A;  2FJA A;  2XQ6 A;  2YEV C;  1N32 T;  3N9O A;  4JI8 T;  2JMH A;  4DBR A;  4EZH A;  4NXN T;  5ABH A;  5LNK A;  1ZHC A;  3MZK B;  4CXX A;  1G73 A;  1LVK A;  1MMN A;  4PJL A;  2X67 A;  4LML A;  4OYJ A;  4F8H A;  4HN9 A;  4O4J E;  3ZYL A;  2G0U A;  4LF9 T;  3ZMT B;  2BVM A;  2DNX A;  2JMK A;  1IBL T;  2KT9 A;  1HNZ T;  1ZEE A;  1HNW T;  3J9X 1;  3RYF E;  1WYB A;  5DJQ C;  3QUJ A;  3PUZ F;  1HS7 A;  1D0Z A;  5LBM A;  5JDF A;  4J2C A;  3VKG A;  4X1K E;  1IAP A;  1QUU A;  5HEH A;  2XAS B;  1U5P A;  2H88 A;  2K9A A;  3BQI A;  2VAS A;  4DV4 T;  3AA6 B;  3PJA A;  2UUB T;  2CE7 A;  4DV2 T;  2Q9Q D;  2ACX A;  4GYR A;  5ADX L;  4L5G A;  4PK4 A;  2N2N A;  2VVS A;  4WBN E;  3ZLI A;  2JRK A;  3GA8 A;  4I43 B;  4DR6 T;  4H9Q C;  3RKO A;  2A2F X;  3QK6 A;  4WZX A;  5KX5 E;  3AAA B;  1I94 T;  3X1D A;  2XQ3 A;  3AVS A;  3EHZ A;  3ONL C;  5L4H A;  4X20 E;  1HG5 A;  1HCI A;  4P0A A;  3E22 E;  3SFE A;  3O9X A;  1W9R A;  1KEY A;  3K3O A;  4PK6 A;  3AA7 B;  4JI7 T;  3KDS E;  1D0X A;  2MPK A;  3A8Y C;  1X79 A;  4QHO A;  2JQ9 A;  3AEG A;  3UU5 A;  2IML A;  3LJC A;  4I4T E;  1G8X A;  2VQE T;  3ZPO A;  3RC8 A;  4IE7 A;  5FXZ A;  2YDQ A;  4DUZ T;  4DV3 T;  2DHR A;  4TWD A;  1L0V A;  5JR9 C;  2DI4 A;  3HR0 A;  5M4Y A;  3RIF A;  1VRB A;  2HH7 A;  4KX6 A;  4G63 A;  4NPP A;  2XM1 A;  2CPT A;  5EK4 A;  3ZT6 A;  2DWK A;  4WW0 A;  5IUX A;  2BS3 A;  4HFC A;  4QXC B;  2BVL A;  3AXJ A;  4U3C A;  4AQF C;  3C4Z A;  4IT4 A;  4B3S T;  4EEB A;  3RRC A;  2AXD S;  2QYW A;  3TLT A;  5JH7 E;  4LFC T;  2NW8 A;  3NBX X;  5AQP B;  3FZH B;  1N33 T;  1FMW A;  2I0M A;  4ILA A;  2N9D A;  4QXH B;  4WYV A;  5ABF A;  1MMG A;  3CKD A;  2V6Y B;  5KMG P;  3VR8 A;  4LF4 T;  4F6R C;  5AQQ B;  4Z91 A;  2OV9 A;  4U31 A;  3PUX F;  1MIV A;  1YQ3 A;  2WP9 A;  5LA6 E;  1QLB A;  2NP9 A;  2V1D B;  5CA1 E;  5AQI B;  2LRK A;  1W0A A;  4X62 T;  2KZ7 B;  4M1P A;  3H37 A;  1NWM X;  1UX4 A;  3LBX A;  2LKH A;  5FY1 A;  4BJN A;  3A7M A;  4ZHQ E;  2Y6X A;  1FIO A;  2KWI B;  3LK4 2;  5J2U E;  5FP3 A;  1EZ3 A;  3EDV A;  2EHO B;  2WM9 A;  2X0H A;  1S35 A;  4HWI B;  3MA9 A;  4AKG A;  5LXT E;  1D1B A;  5CFB A;  2NWB A;  4B6X A;  4ZI3 D;  1US7 B;  4B3R T;  1MNE A;  4NUU A;  3ZSS A;  4QH5 A;  5HCM A;  3P4S A;  4YJ2 E;  4AXP A;  4I55 E;  3RKG A;  1X9B A;  3T1Y T;  3TKL B;  4O8S A;  2X9H A;  3L8R A;  3NVO A;  4JI3 T;  4YSY A;  1YKE B;  3I0O A;  3HKD E;  3JC6 C;  4IDZ A;  4ILC A;  3JAD A;  2WU5 A;  2B76 A;  4P0B A;  4HFE A;  4LFB T;  4XAX B;  2K3W A;  2YU1 A;  3SS1 A;  4IRE A;  2X9Y A;  4EYY R;  3BK9 A;  4HFD A;  2ZM0 A;  2LLY A;  2WMN A;  5HEJ A;  2DLR A;  2KLQ A;  2Y48 B;  3AE6 A;  3CX6 B;  4ANJ A;  3O1J A;  2FUP A;  3VU7 H;  3UUB A;  2BG9 B;  4YXD A;  1CUN A;  3PE0 A;  4JBW F;  3QOF A;  4GK0 E;  4H9R C;  3Q9D A;  3C51 A;  1E2A A;  4O4H E;  1KNZ A;  4FI5 A;  4KI0 F;  4AKR B;  2K48 A;  3O1I A;  2LSI A;  2LOP A;  5JR9 A;  4IDP A;  4TWH A;  1WFD A;  4GIW A;  1T98 A;  4X1Y E;  4ZZB A;  5AQO B;  1T7S A;  2WS3 A;  1NAF A;  3PV0 F;  4H9S E;  1IZN B;  2K5B B;  3N9Q A;  3WI3 A;  2LM9 A;  3AEC A;  1HR0 T;  3GMI A;  5LJM A;  4KHP T;  1I6Z A;  1KNP A;  2W00 A;  3VHL A;  2UXC T;  1E1H B;  1WYC A;  2BZB A;  1D1A A;  1WCR A;  2LSK A;  2D2S A;  3F57 A;  5J2T E;  2W4X A;  5FXX A;  3HKC E;  2BKN A;  1OED C;  4TUY E;  3OPC A;  3NZP A;  3FZK B;  2PBI A;  2E9X A;  5ABG A;  4DR2 T;  2W0G A;  3PUS A;  2RA1 A;  5AQK B;  3PJA J;  3KFW X;  2YKS A;  3ZYM A;  3RLF F;  2LSY A;  2QRX A;  5TAO A;  4CN6 A;  5E0O A;  3M3Z B;  3FZM B;  3U3I A;  1LVF A;  1OXZ A;  2XTL A;  2CXF A;  2X68 A;  4TN7 B;  3K8P C;  3WAK A;  3TLS A;  4TNW A;  5IHY A;  3RHW A;  2YOE A;  4EGW A;  4AIU A;  3B57 A;  3Q5W A;  1QSD A;  4HWH A;  3UU8 A;  3HKE E;  3AAE B;  2X66 A;  3WAJ A;  2I6H A;  3R84 B;  3D0T A;  5LG3 A;  2C0S A;  3N2K E;  5JDQ A;  4YTP A;  3B13 A;  4UF0 B;  5JTG A;  5FXW A;  2YDS A;  1W0B A;  5HXE A;  2CLY C;  4U2Z A;  4ILB A;  4YT0 A;  3UFG A;  4QH1 A;  5JDM A;  3E08 A;  2OA5 A;  3PUW F;  3I0Q A;  3KV4 A;  2Q9Q C;  2XSB A;  1XMO T;  5H6R B;  5BR8 T;  1MIW A;  4HTE A;  2MBG A;  3F2E A;  2V7J A;  4DV7 T;  5IWA T;  4HFH A;  5HEG A;  5ABE A;  4EB6 E;  3NZQ A;  2BKO A;  4ILU A;  1MND A;  3KV5 A;  1ZKE A;  2NTX A;  4X1I E;  4DMW A;  2FJB A;  3AED A;  3T8O A;  4ZEY A;  3GWH A;  2KND A;  4PJM A;  3L09 A;  1XZY A;  2V7K A;  2E5V A;  1Z0P A;  2R6G F;  3N9L A;  5LGU B;  4ERR A;  3CML A;  4ADZ A;  3Q5X A;  4TNV A;  3AEF A;  3EAB A;  2VWA A;  5JRC A;  1UCU A;  2W61 A;  3CWZ B;  4UXN B;  2UXN B;  5F8P A;  4YHH T;  4Z8X A;  3K3Q C;  3UT5 E;  2YDR A;  5LBQ B;  4DUY T;  5ETW A;  4IHJ E;  5LCY A;  3FZF B;  3UUM A;  3CX7 B;  2CEA A;  2BS2 A;  5F3J A;  3ZST A;  2PTF A;  5C3J A;  5JDG A;  2ZLY A;  1OED A;  2PG8 A;  2BBH A;  4WBO A;  5C8Y E;  3LK2 B;  4DV5 T;  5FY0 A;  2NW7 A;  4PFO A;  5AQH B;  3C4W A;  4Q25 A;  2V7M A;  3RRW A;  4HEA A;  4Z90 A;  4EZ4 A;  3TLV A;  1XMQ T;  5HWX A;  2XY8 B;  4HFB A;  2X9X A;  1MMA A;  2UUA T;  4LF7 T;  1SA0 E;  5CJ5 A;  1YQ4 A;  3QC9 A;  4CXW A;  5AQV B;  2N1G A;  3C50 A;  4GKJ T;  2ZM8 A;  3OTO T;  2AE9 A;  2M67 A;  3TLU A;  4TV8 E;  3TLW A;  4QKN A;  3G06 A;  4K0U A;  2LHR A;  3ZMS B;  2EHO D;  2ODU A;  3UUL A;  2BS4 A;  4A97 A;  4JI6 T;  4UR9 A;  2L3L A;  2LM2 A;  3K1S A;  4HFV A;  4KHZ F;  3VRA A;  2Z6E A;  3AE4 A;  2YN6 A;  4ZI3 C;  2Q9Q A;  4YFS A;  3KV6 A;  3CVR A;  3CQG B;  2XAH B;  1WR0 A;  3ZMV B;  1JNR A;  5AQJ B;  2PFV A;  2VL0 A;  2XSA A;  3HL6 A;  4JEU B;  4AKH A;  2W63 A;  3AA1 B;  2KIN B;  5AQT B;  4LFA T;  4ZXL A;  2GK9 A;  3BQK A;  1LRZ A;  2CWO A;  4HGA A;  4A5X A;  4X65 T;  3P4R A;  4KP3 C;  2DWG A;  3EUH A;  5GON E;  4X64 T;  4DR1 T;  4ZI2 D;  3ZMZ B;  4QXB B;  1OWA A;  1JNZ A;  3I9Y A;  2V5D A;  4EIW A;  3AXJ B;  1AJ3 A;  4IDO A;  4LF8 T;  5JVD E;  4X66 T;  2A72 A;  4IDQ A;  5AQG B;  4CI3 B;  1N34 T;  4ZOL E;  5L4E A;  2DCF A;  4I50 E;  3HI2 A;  3KVB A;  1HX8 A;  4IL9 A;  3OYX A;  3RX6 A;  4IE4 A;  1YXR A;  2WCA A;  5JQG E;  4HWC A;  4CXY A;  5ABF B;  3RF1 A;  4H9P C;  2ACZ A;  4U2Y A;  1KFY A;  3GN5 A;  3PTR B;  2IHR 1;  3CX8 B;  1J5E T;  4PK5 A;  3OJA A;  5HWY A;  3ONJ A;  5EZY E;  5HXC A;  3KV9 A;  3A5X A;  3IEE A;  3PUQ A;  3UUN A;  3L3P A;  5LHH B;  2QVA A;  3ZN1 B;  2XQ7 A;  4X5T A;  5FVK A;  3LK3 B;  3MK7 C;  3ZYK A;  3ZT5 A;  3LBX B;  2V8S V;  4B3T T;  2WWV A;  3P4P A;  5CA0 E;  5BMV E;  1U4Q A;  3P4W A;  4UVB B;  3N9M A;  3C4X A;  4IE6 A;  5L47 A;  4COF A;  2CBI A;  5DQW A;  3CPZ A;  2QA7 A;  1M62 A;  4DND A;  5L3D B;  3C98 B;  4AQG A;  2VQF T;  2BG9 E;  3UU3 A;  3T1H T;  3VRB A;  3CK6 A;  4PAG A;  2VKJ A;  1J1J A;  4JEH B;  3KBT A;  4MAL A;  2IAK A;  2LJL A;  3LFM A;  4YJ3 E;  2XQ4 A;  5LMU T;  4ZI7 E;  4LF6 T;  4GK5 E;  4WNK A;  2V7L A;  2HPJ A;  1CHU A;  2VKO A;  5L3G B;  1VOM A;  2LKG A;  2X0L B;  2IC6 A;  2NR4 A;  3RPU A;  2MYS A;  3JAE A;  4AQF A;  3UU6 A;  2WSS V;  3ANW A;  1XWM A;  1SHZ C;  4QH4 A;  1H7C A;  1E7P A;  2UXX B;  2CHO A;  5JDN A;  4YY3 T;  2CMR A;  3O1H A;  2JJ9 A;  4HKA A;  2XQ5 A;  2SPC A;  5EK2 A;  4C91 A;  3UU4 A;  2PJQ A;  5FNV E;  3VKH A;  2VL8 A;  3AE8 A;  2HN1 A;  4O4L E;  1HG2 A;  2VUR A;  2YU2 A;  4JLE A;  1VCT A;  3AE2 A;  3OKQ A;  4DV1 T;  2KWH A;  1T8B A;  2CHN A;  2H3R A;  5J0Z A;  2IW5 B;  3UQ7 A;  3FZL B;  4LF5 T;  5H6Q B;  2FJE A;  2LRL A;  3B5M A;  1W09 A;  3ZCJ A;  3MAC A;  2P9B A;  3Q5D A;  3M65 A;  5DQV A;  3P8C D;  2H7V C;  4OK0 A;  3K3N A;  2JQK A;  3VR9 A;  5HEU A;  1BR2 A;  2MOZ A;  4ASK A;  1YW0 A;  5CGM A;  3J7Y q;  4YHJ A;  2X9W A;  2NW9 A;  4PJN A;  4UIG A;  2WDQ A;  4LMJ A;  1ZOY A;  4DID B;  3EI0 A;  4DVD A;  2A3D A;  2E9X B;  3RGL A;  1XNR T;  2RP4 A;  2WZI A;  5L3F B;  2HPL A;  2XZE A;  5AQF B;  3CIR A;  3LG7 A;  3UTK A;  4UEM A;  2WDV A;  4ZS2 A;  2XM2 A;  4CQI A;  5FXV A;  4EYU A;  3ZMU B;  2CM0 A;  3RIA A;  4UV8 B;  4BAY B;  3AA0 B;  4AIS A;  5L2L A;  4U33 A;  2IUB A;  3PUA A;  1WLX A;  4YSX A;  3AB3 B;  3ZJ1 A;  4PW8 A;  4EOZ B;  3ZC1 A;  5FY7 A;  4JUY A;  2D0U A;  2LSG A;  4NUV A;  2J47 A;  2E5L T;  5KDM C;  3NRY A;  2WZH A;  4H9O C;  2XAG B;  1IBK T;  4IST A;  3P4Q A;  3MJX A;  3UUX B;  4IIJ E;  3O4X E;  3R6N A;  1YKH B;  4EAH A;  3I9W A;  2HHH T;  4G2A A;  3RYH E;  5FL0 A;  4BJM A;  1IJ5 A;  3Q5E A;  2UUC T;  4B3M T;  1UK5 A;  4IL4 A;  2I59 A;  3SWH A;  5KXJ A;  2NOX A;  2LSJ A;  5C2T A;  2V26 A;  1XDP A;  2J4G A;  2X51 A;  2EHO C;  3UQ4 A;  5HXS A;  3P50 A;  4TWF A;  4EED A;  2Y8D A;  1NEK A;  3C64 A;  3NKZ A;  4ISS A;  2E2A A;  2WMO A;  2W67 A;  2F4V T;  1LKX A;  5FYM A;  2ES0 A;  2V6X A;  4QX8 B;  2C5I T;  3IA3 A;  3HKB E;  4JI0 T;  2J62 A;  3PU3 A;  4IE0 A;  4AKI A;  4V1A v;  3FBZ A;  2YK0 A;  3AVR A;  4U72 A;  3FXD B;  3AEB A;  1SUM B;  1J5W A;  3P7I A;  2CA5 A;  5JRC B;  2W66 A;  2KSR A;  2UU9 T;  2XQA A;  3DTO A;  5A1L A;  1DU2 A;  1OED E;  3AAI A;  2VKD A; 
#chains in the Genus database with same CATH homology
 4WZX A;  5FVK A;  4U2Z A;  3K1S A;  2V6Y B;  4CN6 A;  2RPA A;  1WCR A;  4U7I A;  2MPK A;  2DL1 A;  3ZT5 A;  5FVL A;  2LRK A;  2V6X A;  2W2U A;  5LB7 B;  3ZT7 A;  3ZST A;  4NIQ A;  2LRL A;  2JQ9 A;  2WY2 A;  2V6Y A;  2CPT A;  2JQK A;  4P1N A;  3EAB A;  4CN4 A;  4ZEY A;  3ZT6 A;  4U33 A;  2WWV A;  2JQH A;  2XZE A;  1YXR A;  4U7Y A;  4A5X A;  1WR0 A;  4CN1 A;  3ZSS A;  5CJ5 A;  2A9U A;  4U31 A;  5CGM A;  4U3C A;  2CRB A;  4U2Y A;  4IT4 A;  1WFD A;  2K3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...