2CPTA

Solution structure of mit domain from human skd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
GSSGSSGMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar sorting protein 4b
publication title Solution structure of MIT domain from human SKD1
rcsb
source organism Homo sapiens
total genus 29
structure length 117
sequence length 117
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2cptA01
2JQ9A 2A9UA 2CRBA 4CN4A 3ZSTA 4U2YA 5CGMA 5CJ5A 3K1SA 2LRKA 5LB7B 4NIQA 2K3WA 4WZXA 3ZSSA 5FVKA 3ZT6A 2JQKA 2V6XA 4P1NA 1WFDA 4U7IA 3ZT5A 4CN6A 3EABA 4U31A 4A5XA 4CN1A 1WR0A 3ZT7A 2JQHA 2LRLA 4ZEYA 2DL1A 4U33A 2CPTA 2W2UA 4U2ZA 5FVLA 2V6YA 4U7YA 4IT4A 2WY2A 1YXRA 2XZEA 1WCRA 2MPKA 2WWVA 4U3CA 2V6YB 2RPAA
chains in the Genus database with same CATH superfamily
1MNDA 5JDQA 3EUHA 3ANWB 4UVBB 5HEJA 2Y8DA 3CX7B 4TNWA 2XAHB 4PW8A 2H7OA 5HEUA 2X67A 4UV9B 4HWIB 4PK6A 2UUAT 2C5KT 5DJQC 2E9XC 1MIVA 4N78D 3ESLA 4JI3T 3PTRB 2FUPA 5FKYA 3AA1B 1XMOT 2ODUA 4NUVA 2I59A 3KVBA 5LHHB 3RH3A 5JDMA 2VL8A 2D9DA 2FJAA 4EB6E 4ZI2C 5EK3A 4QH4A 1YQ4A 4ZS2A 3ZPOA 3UU4A 1XDPA 2ZM2A 1O3XA 4QH5A 4PNIA 4DMWA 5LOVE 5AQJB 1D1BA 2LHRA 2SPCA 4KHZF 4HN9A 5FXWA 1QLBA 2ZM0A 1J5WA 2KINB 1XDOA 2J1DG 3FZLB 2XASB 1FEWA 2V6YA 3ZMSB 2IIUA 3JADA 2QYWA 3NZPA 1WR6A 2WP9A 3NVOA 4ERRA 1KNPA 3N9QA 2N1GA 3AAEB 1FIOA 3FBZA 4XAXB 3I0OA 2KZ7B 4IT4A 1V9DA 5HEHA 2NW7A 4HWDA 1H7CA 2FJDA 5LHGB 5CGMA 3RKOA 5A1LA 2K3WA 5HXSA 2N9DA 5CA1E 5AQVB 3P4PA 4Z91A 3UQ7A 4AQYT 3AE3A 4O2BE 4JI7T 5LGTB 2XQ5A 3K3QC 3NKZA 5FY1A 2X68A 3AVRA 4MFRA 4CI2B 3ETUA 5CA0E 2B76A 1KK7A 2X0LB 4F8HA 2IUBA 4PJLA 2M6BA 3J9X1 4YJ2E 4MHCA 4DV1T 5HWYA 1JNRA 3ZYKA 4AKHA 3SFEA 4ZXLA 3RYHE 2M67A 2N2NA 2X66A 4BJNA 2XAGB 5LCYA 2XM1A 2A9UA 1IJ5A 3NWIA 4OYKA 3U3IA 2Z6EA 2NWBA 4E7ZA 4WW0A 5AQSB 4KBMB 5ABFB 3A8YC 3P4WA 2VWAA 3FXEB 3JAFA 3C50A 5H6QB 4AKLA 4YLHA 4EGWA 4IE7A 2ES0A 1VRBA 4JI0T 2WQYA 2PBIA 3Q5DA 3A7MA 1HG5A 4UF0B 3ZCJA 5LG3A 1WFDA 4YY3T 2LEHA 4TWHA 1T8BA 1YKEB 3RI5A 5LBMA 1Y64B 2IAKA 3AEGA 3K3OA 1ZP0A 4ILAA 5E0OA 4ISSA 4O4HE 2K48A 3O1IA 3UFEA 5C3JA 4TUYE 5LHIB 3GWHA 1D0XA 2XUEA 4ILUA 5LP6E 4EZ4A 1UUSA 5H6RB 4JYAT 3ONJA 4GYRA 3P8CD 2BVLA 1WR0A 4Q25A 2BG9A 2XSBA 3V5UA 3NRXA 3M65A 2NTXA 2R6GF 2L3LA 4DUZT 5JR9A 4O4JE 2WS3A 4UELA 5JH7E 1IBKT 4NPPA 1MMNA 5HEGA 3HA4A 4JEUB 2RA1A 2EHOB 3VRAA 3PV0F 4DUYT 2OA5A 2I0MA 2JQKA 3UU5A 2E2AA 4A5XA 4DV7T 2MTQA 3SOLA 3KV5A 1FMVA 5FXVA 1HX1B 4A97A 4KI0F 3Q5EA 1X79A 2PG8A 4IDZA 2V7MA 5J0ZA 2HPJA 3RIAA 3UUMA 1HNWT 4JLEA 5JDFA 5LYJE 3ZYLA 2IDOB 3AE6A 4AQGA 3HKCE 5AQHB 4CN6A 3JCFA 4COFA 2X0YA 2VK9A 2ZM8A 3FB2A 2W2UA 3I9YA 3LFMA 4DR4T 3AE1A 3N9OA 1M7KA 2BBJA 2CRBA 3MACA 2W4XA 2AXDS 2QVAA 2LSJA 5ABHA 2YOEA 2H7VC 5ADXL 3AAIA 4LF7T 3HR0A 3MKDA 2NTYA 4X5TA 2W62A 3QB5K 4TV9E 4DBQA 4HKAA 4I50E 5FY7A 4ZI3D 4X62T 3UQ4A 2X9YA 1BR0A 3GA8A 3AECA 4GK5E 2X9XA 5FL1A 3AEBA 2JIWA 2CBJA 2YKSA 3MZKB 5KXJA 2K24A 3U78A 2W63A 2QRXA 2ZLYA 1OEDC 4LMLA 2K9AA 2LKGA 3L39A 2PJQA 3CKDA 3ZT6A 1KF6A 2GK9A 4ILCA 2DL1A 4CQIA 1E7PA 4WBNE 4DVDA 1D1AA 2A3DA 2LLYA 1NWMX 4U74A 1XZYA 2LRKA 2Q9QB 5AQOB 2IC9A 3EABA 2VQET 3P4SA 4CXYA 2V26A 4ZZCA 1T98A 4HWCA 3EAMA 4TWDA 2W0GA 3NZQA 4L0RA 5AQFB 2A2FX 1XNQT 3EVYA 1GQEA 2WU2A 3TKLB 4WNKA 2LE8A 4NUUA 5ABGA 4DNDA 1ZV4X 3UTKA 3IEEA 4EEBA 2L9QA 3PJAA 4H9OC 3CMLA 4OFZA 2BS4A 2XQ8A 3KINB 5HXCA 2CXDA 2XQ6A 3CX8B 3PUWF 2Y48B 4C91A 4I43B 4DV3T 2VKDA 4V1Av 4C90A 5LJMA 1E1HB 5JVDE 2JQQA 1FJGT 3C4ZA 1IJ6A 4AQFC 3FHNA 3S4UA 2VURA 5FXZA 4DV6T 2CCQA 3RYIE 3B5MA 3R6NA 2J47A 3MJXA 2WMOA 2C0SA 5FYMA 4HWFA 2VB6A 5GONE 3AE4A 4CN1A 3N2KE 2WWUA 5EZYE 3QUJA 1YQ3A 2CHNA 2JMKA 2XQYA 5LXTE 2FJEA 3AVSA 2E9XA 3ZYMA 1N36T 1S35A 2E5VA 2DWGA 3RIUC 2NR4A 4NXMT 3MK7C 3TLUA 2KWIB 1HS7A 3O4XE 3PDYA 3QNUA 1KNRA 2QA7A 1LKXA 3KFWX 3P4QA 3AXJB 3I0QA 3DJBA 4BJMA 3AAAB 2UXCT 2E5LT 3RYFE 2Q9QC 1U5PA 3ZMZB 3HI2A 2C5JA 2BKPA 3QOFA 4YTPA 3GN5A 3OVUA 1HG2A 4JEHB 3I1AA 4IE5A 4X1YE 4U33A 4ZI3C 2X0HA 2BVMA 2UXBT 1HX8A 4IL9A 3IF8B 5BMVE 2YINA 3OTOT 1MMDA 5F8PA 1UGOA 2MBGA 1J1JA 3PUSA 4G63A 1Z8UA 5IYZE 3BK9A 3KV6A 3AEDA 5LGNB 3BQIA 2JJ9A 2V6XA 3Q9DA 2XY8B 1WLXA 1D0ZA 2XQ7A 2LSYA 1JNZA 1UURA 4OK0A 3RQUA 3D0TA 4JI5T 2ACXA 4QWNB 4DV5T 5C2TA 3HL6A 2CE7A 4HWHA 5JREA 2D2SA 4PJJA 5FY0A 2WY2A 1WYBA 1T7SA 2VKOA 4IHJE 4LF5T 3K8PC 5KMGP 2BS2A 1UX4A 3DTOA 1N32T 4QKNA 3R84B 3W15B 4PK5A 1SE7A 4TN7B 4UV8B 3UUBA 4H9NC 1W9RA 3ANWA 4X64T 3AEEA 2WMNA 1FMWA 4QH1A 4P0BA 2G0UA 5FVKA 3CPZA 1IBLT 2XQAA 1NENA 4HFEA 3WI3A 1YKHB 2CBIA 4ADZA 4JI4T 1MIYA 3H3MA 3LBXB 4GK0E 3OKQA 4A56A 4EZHA 3ZT5A 4PJNA 2LRLA 3AE5A 2XSAA 3KVAA 3AA0B 4XZCA 4YT0A 4JI6T 4UXNB 2XQ9A 3PUXF 1SUMB 3IBPA 3ONXA 4CXWA 4DO0A 4PAGA 3RRWA 4IDQA 3V5SA 3HKDE 3AEAA 3T8OA 2DWKA 5HYAA 4BA9A 3IHRA 1E2AA 3PJAJ 2V7JA 2HN1A 3FXDB 2HHHT 4JUYA 2L8KA 3UU8A 4O2AE 3N2GE 1R8IA 2JQHA 2E8IA 2CWOA 2UXXB 3TLVA 1HFAA 4X65T 2V5DA 4AKIA 1KEYA 2NW8A 2IMLA 1VCSA 4J2CA 5L3DB 1XMQT 4AKGA 5JR9C 3Q5WA 1OEDB 3VU7H 2W67A 3O1JA 3GMIA 4UVAB 2LT3A 1I6ZA 3CQXC 1D0YA 1B7TA 4DR7T 4AISA 5CJ5A 3CIRA 4LFBT 1M62A 3SS1A 3ZLIA 2C5IT 4K0UA 2H89A 2VQFT 1IZNB 3ZC0A 1CUNA 5HEOA 3I9WA 4YJ3E 4K0KT 4YHJA 4HFBA 4UIGA 2MYSA 3CQCB 3FZKB 3N9LA 3ZC1A 5L2LA 4DR2T 3UU3A 2WAUA 4TNVA 4QXHB 2E9XD 4U2YA 3N9MA 3AE2A 2M6IA 5FL0A 5LBQB 2BS3A 4HFIA 5ABFA 4LFAT 5IHYA 2LJLA 3CX6B 2B1EA 2UUCT 3DP7A 4Z90A 1MIWA 2WZIA 3CVRA 4EOZB 2NP9A 4UF0A 3CWZB 1W0BA 5EK4A 3N5LA 3AE8A 4X1IE 5AQUB 3NRYA 5FVLA 2PTFA 2XAJB 1T72A 5HWXA 2IW5B 3KDSE 3OPCA 2ZM6T 3C51A 3PUYF 3JC6D 5AQPB 5L3FB 4P1NA 2X51A 4O8SA 4U31A 4H63H 4LFCT 2QGSA 2F4VT 1OWAA 2V8SV 3N9NA 3AA7B 3G06A 2YN6A 4ASKA 2LSGA 2OV9A 3QB5A 2LSKA 4KX6A 3QC9A 3ABVA 2NW9A 5HCJA 2JRKA 4LF6T 5L4HA 3ZEFB 2A72A 1VOMA 4I0UA 1YW0A 4KMCA 2V6YB 4EYUA 5CB4E 2WU5A 5LJNA 4YXDA 3VHLA 1W09A 2JMHA 3KV9A 3C98B 4JBWF 2EHOA 2NOXA 2CM0A 2XHEB 1UCUA 2FBWA 5LG4A 2KSRA 4ISTA 3N9PA 1LVFA 4JI8T 3LK3B 3ZN1B 3OYZA 3O9XA 3TLSA 1OEDE 3RF1A 5HXEA 3ZJ2A 3M3ZB 4GKKT 5C8YE 3VKHA 1CHUA 1ZKEA 3CQGB 1XWMA 3B57A 4DR1T 3SFDA 3K3NA 1DU2A 2P9BA 3AE9A 4A98A 1LVKA 1WYCA 2CHOA 3F2EA 2CEAA 1ZHCA 5FMNA 1W0AA 2WBLA 3ZMVB 4LF4T 3RKGA 4ZOLE 4CN4A 2DI4A 1OXZA 3ONLC 3B13A 3FZMB 4KHPT 2XQ4A 2YK0A 2X9WA 4QX7B 4DR6T 3O1HA 4BAYB 1BR1A 5L3CB 3TLWA 4AIUA 1NAFA 2LM9A 2RPAA 3Q2MA 3AE7A 3ETVA 4IDPA 4AQFA 2CLYB 3SRZA 3AA6B 3LK42 4P0AA 2VVSA 5JDLA 4U2ZA 1HNZT 2LHNA 2CXFA 4U7YA 2XZEA 3VR9A 5HXHA 2UXNB 2JQ9A 3KBTA 5AQRB 5L3BB 5LMUT 2W00A 2W66A 3UFGA 3UUXB 2BKNA 2K5BB 4H9PC 4DV2T 1MNEA 2FJBA 4M1PA 4KP3C 4DV0T 4QXBB 1IAPA 3X1DA 4UEMA 4CZZB 3VR8A 1AJ3A 5JDHA 2D0UA 1X9BA 2I6HA 2DNXA 2RP4A 3RIUA 5AQTB 3K1SA 4O4LE 2CA5A 4OX9T 2HN2A 4AI6A 4QX8B 3RLFF 2HPLA 3JC6C 2MPKA 4EAHA 4U3CA 2V5CA 4YSZA 4B3TT 5HAXA 2Q9QA 4HGAA 4IE4A 2D5UA 4DMVA 3PUZF 4YHHT 3E0ZA 1Y01A 4GYSA 5JQGE 1QUUA 3LK2B 2LOSA 1N34T 3J7Yq 3BQKA 5AQQB 5J1GA 2BG9B 2MAWA 1ZEEA 3UULA 5ABEA 5DABA 2PFVA 3PU8A 4JI1T 2BBHA 2OLTA 2WDVA 4TZ4C 5F3JA 4YSXA 2W61A 4HFVA 3LDQB 2CMRA 2WDQA 2MOZA 3RGLA 5JR9B 1BR2A 2YDQA 2V1DB 2H3RA 3L3PA 4HE8A 4QXCB 4HFDA 4YTNA 4ZS3A 3FZHB 4HFHA 5F5WA 3RC8A 3PU3A 4WZXA 3PE0A 4ZEYA 4EYYR 2V7LA 4LMKA 2H88A 2LSIA 3ZKRA 2CLYC 1HTJF 4PK4A 3LG7A 5JTGA 1UK5A 4OHFA 4HFCA 2VKJA 5IWAT 5JDNA 4ANJA 4NIQA 5L47A 1U4QA 3RHWA 2YDRA 4DIDB 4WYVA 1HF8A 3NBXX 3ZMTB 5JRCB 1SA0E 3RC3A 2WWVA 4KUMB 4ZI7E 5IUXA 4I55E 3P7IA 4DBRA 3P50A 4TX5A 2WSSV 3IA3A 1I94T 4B3MT 1US7B 4MALA 1G8XA 2IHR1 3C64A 2XAFB 1HCIA 3EI0A 4F6RC 3N2OA 1WRDA 3UT5E 5EK2A 2XJ7A 3KBUA 1Z0PA 4PFOA 2WCAA 5AQNB 4P09A 5AQIB 4CXXA 4XBFB 3AXJA 4DV4T 2Y6XA 4HTEA 4I4TE 2X9HA 2VASA 3AEFA 2EHOD 3C4XA 5CFBA 3PUQA 3ZSTA 2BDEA 3FBLA 3UU6A 3T1HT 5AFUL 2XQ3A 3E22E 2LOPA 2BG9C 3MXZA 4LMJA 4IIJE 3L09A 2WZHA 3RRCA 3VRBA 2ACZA 4JV5T 5ETWA 3UUNA 2HH7A 2KT9A 4QHOA 3HKEE 2WM9A 3KV4A 1MMGA 3RYCE 3ZMUB 4H9QC 3SWHA 1YXRA 2BZBA 2XAQB 3F57A 1QSDA 1L0VA 1HR0T 3ZCIA 4U72A 5LGUB 4IREA 3WAKA 3MA9A 3PUAA 4ILBA 4G2AA 4FJOA 5DQVA 2J4GA 4FI5A 5DQWA 4U7IA 4IDNA 4EXTA 5JDGA 4LF8T 2WDRA 2J62A 2BG9E 1UX5A 1KFYA 1ZOYA 4CI3B 2KWHA 3RQWA 4L9IA 5LNKA 1XNRT 3EDUA 5J2UE 2KLQA 4DR3T 2DHRA 4GKJT 3EDVA 5KX5E 5FXXA 2XTLA 2YU1A 2UXDT 5FNVE 4LF9T 2LKHA 2UUBT 4PFPA 5AQLB 4AKRB 5JRCA 4WBOA 3HKBE 4H63V 2XM2A 2V7KA 2KNDA 4ZI2D 3LBXA 3PUGA 1HNXT 2DLRA 4B3RT 5HCMA 5AQKB 4ZZBA 2YU2A 4Z8XA 2ODVA 2V7IA 1S94A 3LSVA 3RX6A 1EZ3A 1YD8G 4MLKA 5L4EA 4EIWA 4ZHQE 4UVCB 5L3GB 1NEKA 2Q9QD 2KMFA 2XPKA 2CPTA 1G73A 3Q5XA 4CI1B 4O4IE 1IBMT 3JAEA 5M4YA 2VL0A 3RPUA 4IGUA 2VVNA 2E9XB 1VCTA 3ZJ1A 1MMAA 3C4WA 5L3EB 5BR8T 2CXLA 3RIFA 5J2TE 1SHZC 3OJAA 4TV8E 4PJMA 3EHZA 4YTMA 5HXRA 5AQGB 4MBQA 3T1YT 3P4RA 2LM2A 4L5GA 5FP3A 3PURA 1OEDA 4OYJA 4HEAA 2EHOC 4UR9A 3GN5B 2JPFA 3LJCA 4EV6A 1LRZA 4H9SE 2ZMAA 4B3ST 2VKHA 4H9RC 3PUVF 5TAOA 2IC6A 4IDOA 3WAJA 3ZSSA 4DR5T 2YDSA 3ZT7A 3E08A 3F31A 2D0TA 1KNZA 4AXPA 1WCRA 4YSYA 3VKGA 2WB5A 4X1KE 4JI2T 3H37A 3L8RA 2DCFA 4IL4A 4IE0A 5LB7B 4E7SA 4EEDA 2BKOA 5KDMC 3CK6A 3H3AA 1BR4A 4B6XA 2CWYA 3A5XA 4GOUA 3AB3B 1J5ET 4NXNT 3TLTA 2UU9T 2KXPB 3OYXA 5AQMB 4IE6A 4YFSA 3OBVE 2AE9A 4X20E 3FZFB 3ZN0B 3QK6A 3BQLA 2YEVC 4TWFA 4GIWA 5LMNT 1D1CA 5LA6E 1N33T 4X66T
chains in the Genus database with same CATH topology
2JQ9A 2A9UA 2CRBA 4CN4A 3ZSTA 4U2YA 5CGMA 5CJ5A 3K1SA 2LRKA 5LB7B 4NIQA 2K3WA 4WZXA 3ZSSA 5FVKA 3ZT6A 2JQKA 2V6XA 4P1NA 1WFDA 4U7IA 3ZT5A 4CN6A 3EABA 4U31A 4A5XA 4CN1A 1WR0A 3ZT7A 2JQHA 2LRLA 4ZEYA 2DL1A 4U33A 2CPTA 2W2UA 4U2ZA 5FVLA 2V6YA 4U7YA 4IT4A 2WY2A 1YXRA 2XZEA 1WCRA 2MPKA 2WWVA 4U3CA 2V6YB 2RPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQ9 A;  2A9U A;  2CRB A;  4CN4 A;  3ZST A;  4U2Y A;  5CGM A;  5CJ5 A;  3K1S A;  2LRK A;  5LB7 B;  4NIQ A;  2K3W A;  4WZX A;  3ZSS A;  5FVK A;  3ZT6 A;  2JQK A;  2V6X A;  4P1N A;  1WFD A;  4U7I A;  3ZT5 A;  4CN6 A;  3EAB A;  4U31 A;  4A5X A;  4CN1 A;  1WR0 A;  3ZT7 A;  2JQH A;  2LRL A;  4ZEY A;  2DL1 A;  4U33 A;  2CPT A;  2W2U A;  4U2Z A;  5FVL A;  2V6Y A;  4U7Y A;  4IT4 A;  2WY2 A;  1YXR A;  2XZE A;  1WCR A;  2MPK A;  2WWV A;  4U3C A;  2V6Y B;  2RPA A; 
#chains in the Genus database with same CATH topology
 1MND A;  5JDQ A;  3EUH A;  3ANW B;  4UVB B;  5HEJ A;  2Y8D A;  3CX7 B;  4TNW A;  2XAH B;  4PW8 A;  2H7O A;  5HEU A;  2X67 A;  4UV9 B;  4HWI B;  4PK6 A;  2UUA T;  2C5K T;  5DJQ C;  2E9X C;  1MIV A;  4N78 D;  3ESL A;  4JI3 T;  3PTR B;  2FUP A;  5FKY A;  3AA1 B;  1XMO T;  2ODU A;  4NUV A;  2I59 A;  3KVB A;  5LHH B;  3RH3 A;  5JDM A;  2VL8 A;  2D9D A;  2FJA A;  4EB6 E;  4ZI2 C;  5EK3 A;  4QH4 A;  1YQ4 A;  4ZS2 A;  3ZPO A;  3UU4 A;  1XDP A;  2ZM2 A;  1O3X A;  4QH5 A;  4PNI A;  4DMW A;  5LOV E;  5AQJ B;  1D1B A;  2LHR A;  2SPC A;  4KHZ F;  4HN9 A;  5FXW A;  1QLB A;  2ZM0 A;  1J5W A;  2KIN B;  1XDO A;  2J1D G;  3FZL B;  2XAS B;  1FEW A;  2V6Y A;  3ZMS B;  2IIU A;  3JAD A;  2QYW A;  3NZP A;  1WR6 A;  2WP9 A;  3NVO A;  4ERR A;  1KNP A;  3N9Q A;  2N1G A;  3AAE B;  1FIO A;  3FBZ A;  4XAX B;  3I0O A;  2KZ7 B;  4IT4 A;  1V9D A;  5HEH A;  2NW7 A;  4HWD A;  1H7C A;  2FJD A;  5LHG B;  5CGM A;  3RKO A;  5A1L A;  2K3W A;  5HXS A;  2N9D A;  5CA1 E;  5AQV B;  3P4P A;  4Z91 A;  3UQ7 A;  4AQY T;  3AE3 A;  4O2B E;  4JI7 T;  5LGT B;  2XQ5 A;  3K3Q C;  3NKZ A;  5FY1 A;  2X68 A;  3AVR A;  4MFR A;  4CI2 B;  3ETU A;  5CA0 E;  2B76 A;  1KK7 A;  2X0L B;  4F8H A;  2IUB A;  4PJL A;  2M6B A;  3J9X 1;  4YJ2 E;  4MHC A;  4DV1 T;  5HWY A;  1JNR A;  3ZYK A;  4AKH A;  3SFE A;  4ZXL A;  3RYH E;  2M67 A;  2N2N A;  2X66 A;  4BJN A;  2XAG B;  5LCY A;  2XM1 A;  2A9U A;  1IJ5 A;  3NWI A;  4OYK A;  3U3I A;  2Z6E A;  2NWB A;  4E7Z A;  4WW0 A;  5AQS B;  4KBM B;  5ABF B;  3A8Y C;  3P4W A;  2VWA A;  3FXE B;  3JAF A;  3C50 A;  5H6Q B;  4AKL A;  4YLH A;  4EGW A;  4IE7 A;  2ES0 A;  1VRB A;  4JI0 T;  2WQY A;  2PBI A;  3Q5D A;  3A7M A;  1HG5 A;  4UF0 B;  3ZCJ A;  5LG3 A;  1WFD A;  4YY3 T;  2LEH A;  4TWH A;  1T8B A;  1YKE B;  3RI5 A;  5LBM A;  1Y64 B;  2IAK A;  3AEG A;  3K3O A;  1ZP0 A;  4ILA A;  5E0O A;  4ISS A;  4O4H E;  2K48 A;  3O1I A;  3UFE A;  5C3J A;  4TUY E;  5LHI B;  3GWH A;  1D0X A;  2XUE A;  4ILU A;  5LP6 E;  4EZ4 A;  1UUS A;  5H6R B;  4JYA T;  3ONJ A;  4GYR A;  3P8C D;  2BVL A;  1WR0 A;  4Q25 A;  2BG9 A;  2XSB A;  3V5U A;  3NRX A;  3M65 A;  2NTX A;  2R6G F;  2L3L A;  4DUZ T;  5JR9 A;  4O4J E;  2WS3 A;  4UEL A;  5JH7 E;  1IBK T;  4NPP A;  1MMN A;  5HEG A;  3HA4 A;  4JEU B;  2RA1 A;  2EHO B;  3VRA A;  3PV0 F;  4DUY T;  2OA5 A;  2I0M A;  2JQK A;  3UU5 A;  2E2A A;  4A5X A;  4DV7 T;  2MTQ A;  3SOL A;  3KV5 A;  1FMV A;  5FXV A;  1HX1 B;  4A97 A;  4KI0 F;  3Q5E A;  1X79 A;  2PG8 A;  4IDZ A;  2V7M A;  5J0Z A;  2HPJ A;  3RIA A;  3UUM A;  1HNW T;  4JLE A;  5JDF A;  5LYJ E;  3ZYL A;  2IDO B;  3AE6 A;  4AQG A;  3HKC E;  5AQH B;  4CN6 A;  3JCF A;  4COF A;  2X0Y A;  2VK9 A;  2ZM8 A;  3FB2 A;  2W2U A;  3I9Y A;  3LFM A;  4DR4 T;  3AE1 A;  3N9O A;  1M7K A;  2BBJ A;  2CRB A;  3MAC A;  2W4X A;  2AXD S;  2QVA A;  2LSJ A;  5ABH A;  2YOE A;  2H7V C;  5ADX L;  3AAI A;  4LF7 T;  3HR0 A;  3MKD A;  2NTY A;  4X5T A;  2W62 A;  3QB5 K;  4TV9 E;  4DBQ A;  4HKA A;  4I50 E;  5FY7 A;  4ZI3 D;  4X62 T;  3UQ4 A;  2X9Y A;  1BR0 A;  3GA8 A;  3AEC A;  4GK5 E;  2X9X A;  5FL1 A;  3AEB A;  2JIW A;  2CBJ A;  2YKS A;  3MZK B;  5KXJ A;  2K24 A;  3U78 A;  2W63 A;  2QRX A;  2ZLY A;  1OED C;  4LML A;  2K9A A;  2LKG A;  3L39 A;  2PJQ A;  3CKD A;  3ZT6 A;  1KF6 A;  2GK9 A;  4ILC A;  2DL1 A;  4CQI A;  1E7P A;  4WBN E;  4DVD A;  1D1A A;  2A3D A;  2LLY A;  1NWM X;  4U74 A;  1XZY A;  2LRK A;  2Q9Q B;  5AQO B;  2IC9 A;  3EAB A;  2VQE T;  3P4S A;  4CXY A;  2V26 A;  4ZZC A;  1T98 A;  4HWC A;  3EAM A;  4TWD A;  2W0G A;  3NZQ A;  4L0R A;  5AQF B;  2A2F X;  1XNQ T;  3EVY A;  1GQE A;  2WU2 A;  3TKL B;  4WNK A;  2LE8 A;  4NUU A;  5ABG A;  4DND A;  1ZV4 X;  3UTK A;  3IEE A;  4EEB A;  2L9Q A;  3PJA A;  4H9O C;  3CML A;  4OFZ A;  2BS4 A;  2XQ8 A;  3KIN B;  5HXC A;  2CXD A;  2XQ6 A;  3CX8 B;  3PUW F;  2Y48 B;  4C91 A;  4I43 B;  4DV3 T;  2VKD A;  4V1A v;  4C90 A;  5LJM A;  1E1H B;  5JVD E;  2JQQ A;  1FJG T;  3C4Z A;  1IJ6 A;  4AQF C;  3FHN A;  3S4U A;  2VUR A;  5FXZ A;  4DV6 T;  2CCQ A;  3RYI E;  3B5M A;  3R6N A;  2J47 A;  3MJX A;  2WMO A;  2C0S A;  5FYM A;  4HWF A;  2VB6 A;  5GON E;  3AE4 A;  4CN1 A;  3N2K E;  2WWU A;  5EZY E;  3QUJ A;  1YQ3 A;  2CHN A;  2JMK A;  2XQY A;  5LXT E;  2FJE A;  3AVS A;  2E9X A;  3ZYM A;  1N36 T;  1S35 A;  2E5V A;  2DWG A;  3RIU C;  2NR4 A;  4NXM T;  3MK7 C;  3TLU A;  2KWI B;  1HS7 A;  3O4X E;  3PDY A;  3QNU A;  1KNR A;  2QA7 A;  1LKX A;  3KFW X;  3P4Q A;  3AXJ B;  3I0Q A;  3DJB A;  4BJM A;  3AAA B;  2UXC T;  2E5L T;  3RYF E;  2Q9Q C;  1U5P A;  3ZMZ B;  3HI2 A;  2C5J A;  2BKP A;  3QOF A;  4YTP A;  3GN5 A;  3OVU A;  1HG2 A;  4JEH B;  3I1A A;  4IE5 A;  4X1Y E;  4U33 A;  4ZI3 C;  2X0H A;  2BVM A;  2UXB T;  1HX8 A;  4IL9 A;  3IF8 B;  5BMV E;  2YIN A;  3OTO T;  1MMD A;  5F8P A;  1UGO A;  2MBG A;  1J1J A;  3PUS A;  4G63 A;  1Z8U A;  5IYZ E;  3BK9 A;  3KV6 A;  3AED A;  5LGN B;  3BQI A;  2JJ9 A;  2V6X A;  3Q9D A;  2XY8 B;  1WLX A;  1D0Z A;  2XQ7 A;  2LSY A;  1JNZ A;  1UUR A;  4OK0 A;  3RQU A;  3D0T A;  4JI5 T;  2ACX A;  4QWN B;  4DV5 T;  5C2T A;  3HL6 A;  2CE7 A;  4HWH A;  5JRE A;  2D2S A;  4PJJ A;  5FY0 A;  2WY2 A;  1WYB A;  1T7S A;  2VKO A;  4IHJ E;  4LF5 T;  3K8P C;  5KMG P;  2BS2 A;  1UX4 A;  3DTO A;  1N32 T;  4QKN A;  3R84 B;  3W15 B;  4PK5 A;  1SE7 A;  4TN7 B;  4UV8 B;  3UUB A;  4H9N C;  1W9R A;  3ANW A;  4X64 T;  3AEE A;  2WMN A;  1FMW A;  4QH1 A;  4P0B A;  2G0U A;  5FVK A;  3CPZ A;  1IBL T;  2XQA A;  1NEN A;  4HFE A;  3WI3 A;  1YKH B;  2CBI A;  4ADZ A;  4JI4 T;  1MIY A;  3H3M A;  3LBX B;  4GK0 E;  3OKQ A;  4A56 A;  4EZH A;  3ZT5 A;  4PJN A;  2LRL A;  3AE5 A;  2XSA A;  3KVA A;  3AA0 B;  4XZC A;  4YT0 A;  4JI6 T;  4UXN B;  2XQ9 A;  3PUX F;  1SUM B;  3IBP A;  3ONX A;  4CXW A;  4DO0 A;  4PAG A;  3RRW A;  4IDQ A;  3V5S A;  3HKD E;  3AEA A;  3T8O A;  2DWK A;  5HYA A;  4BA9 A;  3IHR A;  1E2A A;  3PJA J;  2V7J A;  2HN1 A;  3FXD B;  2HHH T;  4JUY A;  2L8K A;  3UU8 A;  4O2A E;  3N2G E;  1R8I A;  2JQH A;  2E8I A;  2CWO A;  2UXX B;  3TLV A;  1HFA A;  4X65 T;  2V5D A;  4AKI A;  1KEY A;  2NW8 A;  2IML A;  1VCS A;  4J2C A;  5L3D B;  1XMQ T;  4AKG A;  5JR9 C;  3Q5W A;  1OED B;  3VU7 H;  2W67 A;  3O1J A;  3GMI A;  4UVA B;  2LT3 A;  1I6Z A;  3CQX C;  1D0Y A;  1B7T A;  4DR7 T;  4AIS A;  5CJ5 A;  3CIR A;  4LFB T;  1M62 A;  3SS1 A;  3ZLI A;  2C5I T;  4K0U A;  2H89 A;  2VQF T;  1IZN B;  3ZC0 A;  1CUN A;  5HEO A;  3I9W A;  4YJ3 E;  4K0K T;  4YHJ A;  4HFB A;  4UIG A;  2MYS A;  3CQC B;  3FZK B;  3N9L A;  3ZC1 A;  5L2L A;  4DR2 T;  3UU3 A;  2WAU A;  4TNV A;  4QXH B;  2E9X D;  4U2Y A;  3N9M A;  3AE2 A;  2M6I A;  5FL0 A;  5LBQ B;  2BS3 A;  4HFI A;  5ABF A;  4LFA T;  5IHY A;  2LJL A;  3CX6 B;  2B1E A;  2UUC T;  3DP7 A;  4Z90 A;  1MIW A;  2WZI A;  3CVR A;  4EOZ B;  2NP9 A;  4UF0 A;  3CWZ B;  1W0B A;  5EK4 A;  3N5L A;  3AE8 A;  4X1I E;  5AQU B;  3NRY A;  5FVL A;  2PTF A;  2XAJ B;  1T72 A;  5HWX A;  2IW5 B;  3KDS E;  3OPC A;  2ZM6 T;  3C51 A;  3PUY F;  3JC6 D;  5AQP B;  5L3F B;  4P1N A;  2X51 A;  4O8S A;  4U31 A;  4H63 H;  4LFC T;  2QGS A;  2F4V T;  1OWA A;  2V8S V;  3N9N A;  3AA7 B;  3G06 A;  2YN6 A;  4ASK A;  2LSG A;  2OV9 A;  3QB5 A;  2LSK A;  4KX6 A;  3QC9 A;  3ABV A;  2NW9 A;  5HCJ A;  2JRK A;  4LF6 T;  5L4H A;  3ZEF B;  2A72 A;  1VOM A;  4I0U A;  1YW0 A;  4KMC A;  2V6Y B;  4EYU A;  5CB4 E;  2WU5 A;  5LJN A;  4YXD A;  3VHL A;  1W09 A;  2JMH A;  3KV9 A;  3C98 B;  4JBW F;  2EHO A;  2NOX A;  2CM0 A;  2XHE B;  1UCU A;  2FBW A;  5LG4 A;  2KSR A;  4IST A;  3N9P A;  1LVF A;  4JI8 T;  3LK3 B;  3ZN1 B;  3OYZ A;  3O9X A;  3TLS A;  1OED E;  3RF1 A;  5HXE A;  3ZJ2 A;  3M3Z B;  4GKK T;  5C8Y E;  3VKH A;  1CHU A;  1ZKE A;  3CQG B;  1XWM A;  3B57 A;  4DR1 T;  3SFD A;  3K3N A;  1DU2 A;  2P9B A;  3AE9 A;  4A98 A;  1LVK A;  1WYC A;  2CHO A;  3F2E A;  2CEA A;  1ZHC A;  5FMN A;  1W0A A;  2WBL A;  3ZMV B;  4LF4 T;  3RKG A;  4ZOL E;  4CN4 A;  2DI4 A;  1OXZ A;  3ONL C;  3B13 A;  3FZM B;  4KHP T;  2XQ4 A;  2YK0 A;  2X9W A;  4QX7 B;  4DR6 T;  3O1H A;  4BAY B;  1BR1 A;  5L3C B;  3TLW A;  4AIU A;  1NAF A;  2LM9 A;  2RPA A;  3Q2M A;  3AE7 A;  3ETV A;  4IDP A;  4AQF A;  2CLY B;  3SRZ A;  3AA6 B;  3LK4 2;  4P0A A;  2VVS A;  5JDL A;  4U2Z A;  1HNZ T;  2LHN A;  2CXF A;  4U7Y A;  2XZE A;  3VR9 A;  5HXH A;  2UXN B;  2JQ9 A;  3KBT A;  5AQR B;  5L3B B;  5LMU T;  2W00 A;  2W66 A;  3UFG A;  3UUX B;  2BKN A;  2K5B B;  4H9P C;  4DV2 T;  1MNE A;  2FJB A;  4M1P A;  4KP3 C;  4DV0 T;  4QXB B;  1IAP A;  3X1D A;  4UEM A;  4CZZ B;  3VR8 A;  1AJ3 A;  5JDH A;  2D0U A;  1X9B A;  2I6H A;  2DNX A;  2RP4 A;  3RIU A;  5AQT B;  3K1S A;  4O4L E;  2CA5 A;  4OX9 T;  2HN2 A;  4AI6 A;  4QX8 B;  3RLF F;  2HPL A;  3JC6 C;  2MPK A;  4EAH A;  4U3C A;  2V5C A;  4YSZ A;  4B3T T;  5HAX A;  2Q9Q A;  4HGA A;  4IE4 A;  2D5U A;  4DMV A;  3PUZ F;  4YHH T;  3E0Z A;  1Y01 A;  4GYS A;  5JQG E;  1QUU A;  3LK2 B;  2LOS A;  1N34 T;  3J7Y q;  3BQK A;  5AQQ B;  5J1G A;  2BG9 B;  2MAW A;  1ZEE A;  3UUL A;  5ABE A;  5DAB A;  2PFV A;  3PU8 A;  4JI1 T;  2BBH A;  2OLT A;  2WDV A;  4TZ4 C;  5F3J A;  4YSX A;  2W61 A;  4HFV A;  3LDQ B;  2CMR A;  2WDQ A;  2MOZ A;  3RGL A;  5JR9 B;  1BR2 A;  2YDQ A;  2V1D B;  2H3R A;  3L3P A;  4HE8 A;  4QXC B;  4HFD A;  4YTN A;  4ZS3 A;  3FZH B;  4HFH A;  5F5W A;  3RC8 A;  3PU3 A;  4WZX A;  3PE0 A;  4ZEY A;  4EYY R;  2V7L A;  4LMK A;  2H88 A;  2LSI A;  3ZKR A;  2CLY C;  1HTJ F;  4PK4 A;  3LG7 A;  5JTG A;  1UK5 A;  4OHF A;  4HFC A;  2VKJ A;  5IWA T;  5JDN A;  4ANJ A;  4NIQ A;  5L47 A;  1U4Q A;  3RHW A;  2YDR A;  4DID B;  4WYV A;  1HF8 A;  3NBX X;  3ZMT B;  5JRC B;  1SA0 E;  3RC3 A;  2WWV A;  4KUM B;  4ZI7 E;  5IUX A;  4I55 E;  3P7I A;  4DBR A;  3P50 A;  4TX5 A;  2WSS V;  3IA3 A;  1I94 T;  4B3M T;  1US7 B;  4MAL A;  1G8X A;  2IHR 1;  3C64 A;  2XAF B;  1HCI A;  3EI0 A;  4F6R C;  3N2O A;  1WRD A;  3UT5 E;  5EK2 A;  2XJ7 A;  3KBU A;  1Z0P A;  4PFO A;  2WCA A;  5AQN B;  4P09 A;  5AQI B;  4CXX A;  4XBF B;  3AXJ A;  4DV4 T;  2Y6X A;  4HTE A;  4I4T E;  2X9H A;  2VAS A;  3AEF A;  2EHO D;  3C4X A;  5CFB A;  3PUQ A;  3ZST A;  2BDE A;  3FBL A;  3UU6 A;  3T1H T;  5AFU L;  2XQ3 A;  3E22 E;  2LOP A;  2BG9 C;  3MXZ A;  4LMJ A;  4IIJ E;  3L09 A;  2WZH A;  3RRC A;  3VRB A;  2ACZ A;  4JV5 T;  5ETW A;  3UUN A;  2HH7 A;  2KT9 A;  4QHO A;  3HKE E;  2WM9 A;  3KV4 A;  1MMG A;  3RYC E;  3ZMU B;  4H9Q C;  3SWH A;  1YXR A;  2BZB A;  2XAQ B;  3F57 A;  1QSD A;  1L0V A;  1HR0 T;  3ZCI A;  4U72 A;  5LGU B;  4IRE A;  3WAK A;  3MA9 A;  3PUA A;  4ILB A;  4G2A A;  4FJO A;  5DQV A;  2J4G A;  4FI5 A;  5DQW A;  4U7I A;  4IDN A;  4EXT A;  5JDG A;  4LF8 T;  2WDR A;  2J62 A;  2BG9 E;  1UX5 A;  1KFY A;  1ZOY A;  4CI3 B;  2KWH A;  3RQW A;  4L9I A;  5LNK A;  1XNR T;  3EDU A;  5J2U E;  2KLQ A;  4DR3 T;  2DHR A;  4GKJ T;  3EDV A;  5KX5 E;  5FXX A;  2XTL A;  2YU1 A;  2UXD T;  5FNV E;  4LF9 T;  2LKH A;  2UUB T;  4PFP A;  5AQL B;  4AKR B;  5JRC A;  4WBO A;  3HKB E;  4H63 V;  2XM2 A;  2V7K A;  2KND A;  4ZI2 D;  3LBX A;  3PUG A;  1HNX T;  2DLR A;  4B3R T;  5HCM A;  5AQK B;  4ZZB A;  2YU2 A;  4Z8X A;  2ODV A;  2V7I A;  1S94 A;  3LSV A;  3RX6 A;  1EZ3 A;  1YD8 G;  4MLK A;  5L4E A;  4EIW A;  4ZHQ E;  4UVC B;  5L3G B;  1NEK A;  2Q9Q D;  2KMF A;  2XPK A;  2CPT A;  1G73 A;  3Q5X A;  4CI1 B;  4O4I E;  1IBM T;  3JAE A;  5M4Y A;  2VL0 A;  3RPU A;  4IGU A;  2VVN A;  2E9X B;  1VCT A;  3ZJ1 A;  1MMA A;  3C4W A;  5L3E B;  5BR8 T;  2CXL A;  3RIF A;  5J2T E;  1SHZ C;  3OJA A;  4TV8 E;  4PJM A;  3EHZ A;  4YTM A;  5HXR A;  5AQG B;  4MBQ A;  3T1Y T;  3P4R A;  2LM2 A;  4L5G A;  5FP3 A;  3PUR A;  1OED A;  4OYJ A;  4HEA A;  2EHO C;  4UR9 A;  3GN5 B;  2JPF A;  3LJC A;  4EV6 A;  1LRZ A;  4H9S E;  2ZMA A;  4B3S T;  2VKH A;  4H9R C;  3PUV F;  5TAO A;  2IC6 A;  4IDO A;  3WAJ A;  3ZSS A;  4DR5 T;  2YDS A;  3ZT7 A;  3E08 A;  3F31 A;  2D0T A;  1KNZ A;  4AXP A;  1WCR A;  4YSY A;  3VKG A;  2WB5 A;  4X1K E;  4JI2 T;  3H37 A;  3L8R A;  2DCF A;  4IL4 A;  4IE0 A;  5LB7 B;  4E7S A;  4EED A;  2BKO A;  5KDM C;  3CK6 A;  3H3A A;  1BR4 A;  4B6X A;  2CWY A;  3A5X A;  4GOU A;  3AB3 B;  1J5E T;  4NXN T;  3TLT A;  2UU9 T;  2KXP B;  3OYX A;  5AQM B;  4IE6 A;  4YFS A;  3OBV E;  2AE9 A;  4X20 E;  3FZF B;  3ZN0 B;  3QK6 A;  3BQL A;  2YEV C;  4TWF A;  4GIW A;  5LMN T;  1D1C A;  5LA6 E;  1N33 T;  4X66 T; 
#chains in the Genus database with same CATH homology
 2JQ9 A;  2A9U A;  2CRB A;  4CN4 A;  3ZST A;  4U2Y A;  5CGM A;  5CJ5 A;  3K1S A;  2LRK A;  5LB7 B;  4NIQ A;  2K3W A;  4WZX A;  3ZSS A;  5FVK A;  3ZT6 A;  2JQK A;  2V6X A;  4P1N A;  1WFD A;  4U7I A;  3ZT5 A;  4CN6 A;  3EAB A;  4U31 A;  4A5X A;  4CN1 A;  1WR0 A;  3ZT7 A;  2JQH A;  2LRL A;  4ZEY A;  2DL1 A;  4U33 A;  2CPT A;  2W2U A;  4U2Z A;  5FVL A;  2V6Y A;  4U7Y A;  4IT4 A;  2WY2 A;  1YXR A;  2XZE A;  1WCR A;  2MPK A;  2WWV A;  4U3C A;  2V6Y B;  2RPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...