2CPTA

Solution structure of mit domain from human skd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
b'GSSGSSGMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar sorting protein 4b
molecule tags Protein transport
source organism Homo sapiens
publication title Solution structure of MIT domain from human SKD1
rcsb
total genus 29
structure length 117
sequence length 117
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2cptA01
2W2UA 2V6YA 2WY2A 2WWVA 3ZT7A 2JQKA 5FVKA 2JQ9A 4U31A 4U2YA 4CN6A 2RPAA 2MPKA 4A5XA 2DL1A 2CPTA 3EABA 4U7IA 2V6YB 5LB7B 4CN1A 1WFDA 4ZEYA 1WR0A 4P1NA 2A9UA 2LRLA 4U33A 4NIQA 2K3WA 3ZSSA 4CN4A 1YXRA 4IT4A 5CJ5A 2JQHA 4U2ZA 4WZXA 1WCRA 3K1SA 2V6XA 3ZT6A 3ZSTA 2LRKA 5FVLA 5CGMA 3ZT5A 4U3CA 4U7YA 2CRBA 2XZEA
chains in the Genus database with same CATH superfamily
2W2UA 1HTJF 2WDRA 2Q9QC 2YK0A 4ISTA 4JUYA 3F31A 5JDNA 4NXMT 1IZNB 4GKJT 1VCTA 2MTQA 3I9YA 1M62A 3BQIA 2OV9A 3B57A 2CWYA 3UUMA 3ZCIA 1HNXT 1T72A 1Y64B 1XMQT 3W15B 2YDSA 1IBMT 1AJ3A 1WR6A 2IDOB 3F2EA 3KBUA 1UCUA 4OYJA 3AA7B 2NTXA 5JR9A 3AE4A 2IW5B 5LP6E 2YEVC 3T8OA 1MIYA 4A97A 2VURA 3RC8A 1XNQT 4PK6A 3DTOA 4CN4A 4TUYE 3LFMA 4DO0A 5HXRA 2BG9A 1EZ3A 2J62A 2WU5A 4Q25A 1KK7A 2H88A 3BK9A 5DJQC 5EK2A 4EIWA 5ABHA 2D0UA 3UT5E 3PUZF 4ZZBA 2MBGA 5LG4A 1WYCA 3AEDA 5CGMA 2CM0A 1V9DA 2LHNA 3IBPA 3O9XA 5FY0A 3SOLA 1MMGA 3KV4A 2LM2A 2Q9QB 3KINB 1FJGT 4EOZB 4LFBT 3N5LA 1W0BA 2J1DG 2VKJA 2GK9A 4XZCA 1HS7A 3N9LA 2L3LA 3ZN0B 3QOFA 2X67A 3N2KE 2DL1A 3AE5A 1ZKEA 3C51A 4U7IA 5FP3A 4F8HA 3J7Yq 1HNZT 3AVRA 4ZXLA 2B1EA 1UUSA 3SS1A 1Z0PA 4BA9A 4BJMA 4X64T 3E22E 3EUHA 3PUVF 4U33A 4Z91A 3ZMVB 5DQVA 2FJAA 1LVFA 2K3WA 2OLTA 2C5JA 2I59A 4HWCA 4NUVA 1UX5A 2PTFA 3NZQA 4H9PC 4UELA 3E08A 2UUCT 1D1CA 1XZYA 5CJ5A 3IEEA 3LK42 3CQXC 5AQSB 5FMNA 1E1HB 2KZ7B 2YDRA 3HKEE 4UV9B 2X0LB 4HWDA 3ZYKA 2DNXA 3AAEB 4V1Av 1IBLT 2FJBA 2FBWA 3H3MA 4H9NC 3PUGA 1JNRA 2LSGA 2LRKA 1S94A 3VRBA 4EV6A 2UXCT 2XQ6A 5BR8T 3WAJA 2LOSA 3AXJA 1QSDA 1XDOA 2V6YA 4OYKA 4TV8E 2VKOA 1OEDC 3RGLA 2ZM8A 3UU8A 3FZMB 1Z8UA 2NR4A 5AQFB 2XM2A 4UXNB 2BG9E 3RIAA 4U31A 1VCSA 2K48A 2V1DB 3OKQA 4ZS3A 2XSAA 2V5CA 3LBXB 5FKYA 4TWFA 4MFRA 2IUBA 3C98B 4BJNA 4G63A 4LMLA 1D1AA 1SUMB 3C4ZA 5L3EB 4PNIA 3Q9DA 3D0TA 4NIQA 2LT3A 3P4RA 1SE7A 4KUMB 1KNPA 4K0KT 1SA0E 3K8PC 3Q5XA 5AQQB 2VL8A 4B3ST 1WCRA 2CXFA 2WQYA 5FXWA 3P4PA 2QGSA 4DV6T 3PUQA 3VU7H 2Q9QD 2X9WA 1ZV4X 5AQIB 2W62A 4COFA 3PU3A 4I55E 1ZHCA 3LJCA 4TNWA 3UQ4A 1YD8G 2WY2A 5ABFA 5IUXA 2OA5A 4PAGA 1HX8A 4HWIB 2XQYA 2PBIA 3HKCE 4UV8B 2XM1A 3TLVA 3I0OA 2VQET 2VKHA 2W63A 5HEOA 5CFBA 3AE1A 2M6BA 1CUNA 1WFDA 2KNDA 2CXLA 2KXPB 4XAXB 4DV1T 2A3DA 2CLYB 4HFEA 3B5MA 4G2AA 4X5TA 4YHJA 5FXZA 4DR3T 5H6QB 2XQ9A 4JI1T 4EZHA 3AE6A 1KNZA 3CX7B 4I0UA 2WWUA 4IDZA 1W9RA 4AQYT 3NRYA 2CXDA 2WB5A 2Z6EA 4EEDA 3AE3A 5HCMA 5F3JA 3LDQB 4U72A 5JDLA 5HXEA 2D9DA 3ZC1A 2BVLA 2V7JA 4QXBB 2PG8A 2CHOA 3AE2A 5FXXA 3HKBE 3RIFA 4X62T 4O4IE 1W0AA 5DABA 4C91A 2IMLA 4UVAB 4QXCB 4DV2T 2V7MA 3JC6D 5HWXA 2H7VC 2ES0A 2W67A 3ONLC 3OJAA 3TLTA 2X9HA 1BR0A 3RIUA 3NWIA 4OHFA 5L4HA 4U7YA 2XAFB 2XPKA 3A5XA 3ZMUB 3MKDA 1X79A 4ZI3D 4UIGA 3VRAA 4FJOA 3C50A 4MBQA 2X9YA 5LGUB 2JIWA 2IAKA 2DWGA 1XDPA 2ZLYA 3C4XA 5LBQB 3FZHB 5FL1A 5HEHA 4HEAA 2DLRA 2V7IA 2WBLA 2XSBA 5IWAT 4HKAA 4ZI3C 4DUZT 1ZEEA 2ACZA 4UVBB 2JQHA 4HWFA 5LOVE 5HEUA 4LMJA 3N9PA 1XMOT 3ZC0A 2LOPA 1OEDB 3QNUA 1SHZC 5LHIB 4YT0A 2CBIA 2LJLA 3ZSTA 3LSVA 3UU5A 5LJMA 4YHHT 2EHOC 3AE8A 4OK0A 4DV3T 5CA0E 5AQUB 4X20E 3R84B 3PUSA 2L8KA 4M1PA 2KWHA 2UXXB 3T1HT 3OVUA 2UUBT 2JJ9A 3AE9A 2D0TA 5FY1A 3K3OA 1LVKA 4EGWA 4B3MT 1IJ5A 4O4JE 4Z8XA 2JQ9A 3ZJ2A 5ABEA 1CHUA 2XQAA 3CPZA 5JDGA 3ZN1B 2YDQA 1I94T 4DMVA 4PJJA 5JVDE 1MIWA 2WDVA 3VHLA 5LGTB 3WAKA 4TN7B 3FXDB 3KV9A 3AA6B 5EZYE 2IIUA 3ZYMA 4ERRA 3Q2MA 4E7ZA 4IE5A 4K0UA 5JRCA 1HCIA 3GMIA 4H9SE 4ADZA 2UXDT 2ZM6T 1E7PA 3FZLB 4O4LE 2FUPA 4OFZA 4DBQA 3KFWX 5FNVE 4YSZA 4JI8T 5HEGA 4I50E 3CX6B 4U3CA 3HA4A 3KV6A 4H9RC 5JRCB 3QC9A 3SRZA 2XUEA 4AIUA 3SFEA 4AQFA 5HYAA 3KV5A 1N33T 2PJQA 4YSYA 4ISSA 5AQTB 1DU2A 1Y01A 5FVKA 1BR1A 2BDEA 4DNDA 5C8YE 4DR7T 2FJEA 4L0RA 5EK4A 3RYFE 2CA5A 2KINB 4EEBA 2BVMA 4CN1A 3LG7A 1X9BA 1J5ET 4F6RC 4UR9A 1MMNA 3CQGB 4X65T 4JV5T 3PTRB 3M3ZB 1HFAA 3RH3A 1LKXA 2N9DA 3ONJA 4LF6T 3AA1B 3PE0A 4DV0T 2BBJA 2VVNA 1G8XA 1KFYA 5AQLB 5ABGA 4X1YE 4JI4T 3T1YT 1YKHB 5AQHB 1GQEA 3RQUA 4AKHA 2C5KT 3HL6A 4PFOA 5JH7E 1UX4A 3ONXA 5L4EA 4GYRA 3LK3B 4MALA 2CBJA 1KF6A 3H3AA 3PURA 1KEYA 2WMOA 2XQ8A 3WI3A 3CVRA 4GIWA 1BR2A 2BKNA 4FI5A 2E5VA 2M67A 2BG9B 1UURA 2XQ7A 4H9OC 4P09A 5DQWA 3AE7A 2BS2A 2KMFA 3K3QC 4HGAA 4J2CA 4MLKA 2W0GA 2WMNA 5J1GA 2L9QA 2KLQA 2N1GA 2B76A 4KI0F 4U74A 2VKDA 4DUYT 3JAEA 3PUWF 3IHRA 3OYXA 4HE8A 4PFPA 3SFDA 3Q5EA 4ZEYA 4JI0T 3S4UA 4NUUA 5AQKB 2IC6A 3NRXA 2A9UA 2WP9A 3A8YC 3AEAA 4CQIA 5L3GB 4YY3T 2HPJA 5FY7A 2E9XB 4LF4T 4PJLA 2MAWA 5HAXA 1NWMX 3RRWA 1E2AA 3ANWB 2QVAA 3AAIA 4YTNA 1N32T 2NWBA 4QH4A 3DJBA 1IAPA 4IE0A 2CRBA 4DR6T 1QLBA 3HKDE 4AQFC 3B13A 4HFVA 5AQMB 2UUAT 5JDMA 3UULA 2QYWA 3IF8B 1WRDA 5JQGE 2CLYC 4DV7T 4QXHB 4LFCT 4JI6T 2XAQB 4N78D 2AE9A 4HWHA 4QX8B 3MA9A 2K24A 2WM9A 2JQQA 3PJAJ 2LEHA 3X1DA 3ZMTB 5AQNB 3RX6A 4ZI2C 3JCFA 2Q9QA 2DCFA 2Y6XA 3OYZA 4EYUA 3GN5A 4H63H 4IHJE 4P0BA 4U2YA 4OX9T 2XAGB 2XASB 3EABA 5AFUL 3RYCE 3RF1A 3N2GE 4X1IE 3AAAB 5LMUT 2N2NA 5LA6E 3FZFB 1I6ZA 4P1NA 4IE6A 2QA7A 5JR9C 4PK5A 2A72A 5HWYA 3P4QA 1HG5A 1NAFA 3ZSSA 2G0UA 5AQGB 2BG9C 2V8SV 3L09A 3MK7C 3PDYA 1FIOA 3MXZA 2V7LA 3SWHA 3K1SA 3V5UA 5IHYA 5JTGA 5KX5E 2HHHT 2BKPA 3FBZA 3ZT6A 3AB3B 2XHEB 2WU2A 4TWHA 5AQJB 2X51A 3CQCB 3MJXA 4IE4A 4LMKA 5FVLA 3TLSA 4P0AA 2UXBT 2F4VT 3M65A 2XZEA 4JEUB 1FMVA 5L47A 1S35A 3CKDA 1QUUA 4QH1A 3UFEA 5LGNB 2ODVA 3ANWA 4A5XA 2E5LT 4NXNT 4DVDA 5LMNT 2PFVA 2D2SA 3ZJ1A 2P9BA 3AEEA 3NVOA 1FEWA 4QH5A 3O1HA 1YQ4A 3P4SA 4DR2T 4KP3C 4HFCA 3FXEB 5ADXL 1YXRA 2E9XC 4UF0A 3J9X1 3UQ7A 3VKGA 3QUJA 3RIUC 4WW0A 2LKGA 2WS3A 2WDQA 2NP9A 3O1JA 1R8IA 2JPFA 1N34T 3QK6A 1MNDA 2CHNA 4AKLA 2LSJA 2WZHA 3A7MA 3EDUA 3PU8A 3HR0A 5CA1E 3FZKB 5AQRB 4DV4T 4DR5T 3JADA 3OPCA 3ZT5A 1HNWT 4PW8A 5HXHA 4CXXA 2VWAA 3Q5WA 5GONE 1OEDA 3KVAA 4QWNB 2JQKA 1D1BA 3GWHA 4O4HE 3RLFF 5LYJE 2WZIA 3TKLB 2X9XA 2YU1A 3N2OA 4HN9A 3UU4A 4CXWA 4X66T 2CCQA 4EXTA 1YQ3A 1UGOA 1M7KA 2AXDS 2E9XA 2YINA 2H7OA 4JLEA 5JDFA 2ZM0A 2NW8A 2VASA 3EHZA 5A1LA 4KHPT 3L8RA 3CMLA 1WR0A 4HFIA 3RI5A 2CMRA 4CXYA 4IDOA 3VKHA 3ZLIA 4E7SA 2D5UA 3VR9A 1ZOYA 3ZPOA 2I0MA 3FBLA 4JI7T 2XY8B 3C64A 3K3NA 4PJMA 2M6IA 4YTPA 5LJNA 1VRBA 2ACXA 1XNRT 4L9IA 4AKGA 4JI3T 5LBMA 4HTEA 2KT9A 3RKOA 3ZMZB 2E8IA 4EZ4A 4LF8T 2DHRA 2CEAA 2JRKA 4AISA 4ZI2D 2ZMAA 2NTYA 3ZYLA 1N36T 3MZKB 2HH7A 2BS4A 4IL4A 5FYMA 3NBXX 5C2TA 3ABVA 3EVYA 5HXSA 5AQOB 4ZOLE 1WLXA 2Y48B 3EAMA 1WYBA 5F8PA 3DP7A 5LXTE 5J2TE 2LSYA 1XWMA 2CE7A 2WAUA 2X68A 2YOEA 2YU2A 3CWZB 4L5GA 4GK5E 2H89A 3EDVA 4O8SA 1MMAA 4IGUA 4KBMB 5LB7B 3F57A 5FXVA 5CB4E 5J2UE 2RA1A 2KWIB 4LFAT 4Z90A 2ODUA 3QB5A 3GN5B 2V5DA 3CX8B 4XBFB 4ANJA 5TAOA 3NZPA 1T98A 3PUAA 4O2AE 4YFSA 5LHHB 3OBVE 3UUXB 2VB6A 4DR4T 4TX5A 2RP4A 4WZXA 4WBNE 2H3RA 4IL9A 2V6XA 4DR1T 1D0XA 2C5IT 3BQLA 2LLYA 3P7IA 1HG2A 5H6RB 3H37A 4AXPA 1LRZA 4DMWA 3E0ZA 4I4TE 3ESLA 3RYIE 3AEFA 3FHNA 3UU3A 2BKOA 4EAHA 4JYAT 2LSIA 3I0QA 3GA8A 2XQ5A 4QKNA 3P50A 2LKHA 2EHOD 3UUBA 2LHRA 3PJAA 3RKGA 2W00A 4AQGA 2MOZA 2XTLA 3MACA 3QB5K 3RHWA 1O3XA 3ETVA 4GYSA 4H9QC 5L3CB 4DBRA 2WCAA 3G06A 3NKZA 1KNRA 2LRLA 3N9OA 3CK6A 3BQKA 3IA3A 3N9NA 4PJNA 3U78A 3R6NA 3ZCJA 2YN6A 1MMDA 4H63V 4B3RT 4KMCA 2J4GA 1US7B 2X0YA 3JC6C 3AEBA 3VR8A 3AXJB 4IREA 2FJDA 4CI3B 1J5WA 2HN1A 1ZP0A 2EHOA 3I1AA 4ILAA 2VQFT 5KMGP 3N9MA 2JMHA 2QRXA 5JR9B 5EK3A 3FB2A 1HR0T 3ETUA 2LSKA 4O2BE 1UK5A 3LBXA 4TWDA 2WWVA 5JREA 2A2FX 3UU6A 1B7TA 4A56A 3TLWA 2NW9A 2MPKA 3KBTA 3L3PA 4ZS2A 2V6YB 5L3FB 3KDSE 2K9AA 1IBKT 2UU9T 5IYZE 3O4XE 4NPPA 4GK0E 3Q5DA 1OEDE 4WYVA 3ZMSB 4QHOA 4ZHQE 2UXNB 2XAHB 5KXJA 4EYYR 2V26A 2XAJB 5BMVE 4JI5T 2CWOA 3AECA 3P4WA 4YLHA 2NOXA 1IJ6A 4A98A 1YKEB 1OXZA 4ILUA 4ILBA 1U5PA 4YJ3E 4ASKA 2EHOB 4IDQA 4BAYB 2SPCA 3O1IA 1BR4A 4I43B 1T8BA 1H7CA 2JMKA 2Y8DA 4WBOA 4DIDB 4EB6E 1HF8A 1HX1B 2VVSA 3JAFA 3RC3A 3UTKA 2W61A 3ZEFB 3AA0B 4DV5T 4ZZCA 5JDHA 5ETWA 2ZM2A 1NEKA 2HPLA 1YW0A 2CPTA 3KVBA 4UVCB 1JNZA 3UUNA 5L3BB 5LHGB 4C90A 1OWAA 2KSRA 1D0YA 4CI2B 4UEMA 3P8CD 4B6XA 3PV0F 4MHCA 3UFGA 4ZI7E 2X66A 4B3TT 2LM9A 2DWKA 5E0OA 4AI6A 4JBWF 4KX6A 3C4WA 5L3DB 2J47A 5KDMC 3AEGA 2NW7A 3OTOT 3RPUA 4HFBA 4YJ2E 3EI0A 2E9XD 3TLUA 5HXCA 2XJ7A 4KHZF 3PUXF 5LNKA 3AVSA 2WSSV 4TZ4C 4LF9T 1G73A 3RQWA 2C0SA 4IDPA 2K5BB 3N9QA 4JI2T 1NENA 2DI4A 2V7KA 3HI2A 4WNKA 1MNEA 4JEHB 3ZT7A 4YSXA 4YXDA 5ABFB 3RRCA 3LK2B 3V5SA 1MIVA 1VOMA 2VK9A 2IC9A 5F5WA 4AKRB 2RPAA 2YKSA 2BBHA 4CZZB 4CN6A 3L39A 4IIJE 2VL0A 2W4XA 5FL0A 3U3IA 1U4QA 4LF7T 2XQ3A 4GKKT 4GOUA 4IE7A 1D0ZA 1FMWA 4ILCA 3RYHE 2R6GF 4LF5T 4CI1B 3PUYF 2BZBA 4YTMA 4X1KE 5HCJA 5J0ZA 1W09A 2I6HA 4IT4A 2IHR1 2W66A 4PK4A 4IDNA 4U2ZA 4UF0B 5LCYA 5AQVB 5AQPB 2BS3A 3ZKRA 3CIRA 4HFHA 1T7SA 1L0VA 5HEJA 5LG3A 2MYSA 4QX7B 4TNVA 1J1JA 5M4YA 2E2AA 4AKIA 2LE8A 4TV9E 2X0HA 5L2LA 3I9WA 5C3JA 4HFDA 5JDQA 2HN2A 2XQ4A
chains in the Genus database with same CATH topology
2W2UA 2V6YA 2WY2A 2WWVA 3ZT7A 2JQKA 5FVKA 2JQ9A 4U31A 4U2YA 4CN6A 2RPAA 2MPKA 4A5XA 2DL1A 2CPTA 3EABA 4U7IA 2V6YB 5LB7B 4CN1A 1WFDA 4ZEYA 1WR0A 4P1NA 2A9UA 2LRLA 4U33A 4NIQA 2K3WA 3ZSSA 4CN4A 1YXRA 4IT4A 5CJ5A 2JQHA 4U2ZA 4WZXA 1WCRA 3K1SA 2V6XA 3ZT6A 3ZSTA 2LRKA 5FVLA 5CGMA 3ZT5A 4U3CA 4U7YA 2CRBA 2XZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2U A;  2V6Y A;  2WY2 A;  2WWV A;  3ZT7 A;  2JQK A;  5FVK A;  2JQ9 A;  4U31 A;  4U2Y A;  4CN6 A;  2RPA A;  2MPK A;  4A5X A;  2DL1 A;  2CPT A;  3EAB A;  4U7I A;  2V6Y B;  5LB7 B;  4CN1 A;  1WFD A;  4ZEY A;  1WR0 A;  4P1N A;  2A9U A;  2LRL A;  4U33 A;  4NIQ A;  2K3W A;  3ZSS A;  4CN4 A;  1YXR A;  4IT4 A;  5CJ5 A;  2JQH A;  4U2Z A;  4WZX A;  1WCR A;  3K1S A;  2V6X A;  3ZT6 A;  3ZST A;  2LRK A;  5FVL A;  5CGM A;  3ZT5 A;  4U3C A;  4U7Y A;  2CRB A;  2XZE A; 
#chains in the Genus database with same CATH topology
 2W2U A;  1HTJ F;  2WDR A;  2Q9Q C;  2YK0 A;  4IST A;  4JUY A;  3F31 A;  5JDN A;  4NXM T;  1IZN B;  4GKJ T;  1VCT A;  2MTQ A;  3I9Y A;  1M62 A;  3BQI A;  2OV9 A;  3B57 A;  2CWY A;  3UUM A;  3ZCI A;  1HNX T;  1T72 A;  1Y64 B;  1XMQ T;  3W15 B;  2YDS A;  1IBM T;  1AJ3 A;  1WR6 A;  2IDO B;  3F2E A;  3KBU A;  1UCU A;  4OYJ A;  3AA7 B;  2NTX A;  5JR9 A;  3AE4 A;  2IW5 B;  5LP6 E;  2YEV C;  3T8O A;  1MIY A;  4A97 A;  2VUR A;  3RC8 A;  1XNQ T;  4PK6 A;  3DTO A;  4CN4 A;  4TUY E;  3LFM A;  4DO0 A;  5HXR A;  2BG9 A;  1EZ3 A;  2J62 A;  2WU5 A;  4Q25 A;  1KK7 A;  2H88 A;  3BK9 A;  5DJQ C;  5EK2 A;  4EIW A;  5ABH A;  2D0U A;  3UT5 E;  3PUZ F;  4ZZB A;  2MBG A;  5LG4 A;  1WYC A;  3AED A;  5CGM A;  2CM0 A;  1V9D A;  2LHN A;  3IBP A;  3O9X A;  5FY0 A;  3SOL A;  1MMG A;  3KV4 A;  2LM2 A;  2Q9Q B;  3KIN B;  1FJG T;  4EOZ B;  4LFB T;  3N5L A;  1W0B A;  2J1D G;  2VKJ A;  2GK9 A;  4XZC A;  1HS7 A;  3N9L A;  2L3L A;  3ZN0 B;  3QOF A;  2X67 A;  3N2K E;  2DL1 A;  3AE5 A;  1ZKE A;  3C51 A;  4U7I A;  5FP3 A;  4F8H A;  3J7Y q;  1HNZ T;  3AVR A;  4ZXL A;  2B1E A;  1UUS A;  3SS1 A;  1Z0P A;  4BA9 A;  4BJM A;  4X64 T;  3E22 E;  3EUH A;  3PUV F;  4U33 A;  4Z91 A;  3ZMV B;  5DQV A;  2FJA A;  1LVF A;  2K3W A;  2OLT A;  2C5J A;  2I59 A;  4HWC A;  4NUV A;  1UX5 A;  2PTF A;  3NZQ A;  4H9P C;  4UEL A;  3E08 A;  2UUC T;  1D1C A;  1XZY A;  5CJ5 A;  3IEE A;  3LK4 2;  3CQX C;  5AQS B;  5FMN A;  1E1H B;  2KZ7 B;  2YDR A;  3HKE E;  4UV9 B;  2X0L B;  4HWD A;  3ZYK A;  2DNX A;  3AAE B;  4V1A v;  1IBL T;  2FJB A;  2FBW A;  3H3M A;  4H9N C;  3PUG A;  1JNR A;  2LSG A;  2LRK A;  1S94 A;  3VRB A;  4EV6 A;  2UXC T;  2XQ6 A;  5BR8 T;  3WAJ A;  2LOS A;  3AXJ A;  1QSD A;  1XDO A;  2V6Y A;  4OYK A;  4TV8 E;  2VKO A;  1OED C;  3RGL A;  2ZM8 A;  3UU8 A;  3FZM B;  1Z8U A;  2NR4 A;  5AQF B;  2XM2 A;  4UXN B;  2BG9 E;  3RIA A;  4U31 A;  1VCS A;  2K48 A;  2V1D B;  3OKQ A;  4ZS3 A;  2XSA A;  2V5C A;  3LBX B;  5FKY A;  4TWF A;  4MFR A;  2IUB A;  3C98 B;  4BJN A;  4G63 A;  4LML A;  1D1A A;  1SUM B;  3C4Z A;  5L3E B;  4PNI A;  3Q9D A;  3D0T A;  4NIQ A;  2LT3 A;  3P4R A;  1SE7 A;  4KUM B;  1KNP A;  4K0K T;  1SA0 E;  3K8P C;  3Q5X A;  5AQQ B;  2VL8 A;  4B3S T;  1WCR A;  2CXF A;  2WQY A;  5FXW A;  3P4P A;  2QGS A;  4DV6 T;  3PUQ A;  3VU7 H;  2Q9Q D;  2X9W A;  1ZV4 X;  5AQI B;  2W62 A;  4COF A;  3PU3 A;  4I55 E;  1ZHC A;  3LJC A;  4TNW A;  3UQ4 A;  1YD8 G;  2WY2 A;  5ABF A;  5IUX A;  2OA5 A;  4PAG A;  1HX8 A;  4HWI B;  2XQY A;  2PBI A;  3HKC E;  4UV8 B;  2XM1 A;  3TLV A;  3I0O A;  2VQE T;  2VKH A;  2W63 A;  5HEO A;  5CFB A;  3AE1 A;  2M6B A;  1CUN A;  1WFD A;  2KND A;  2CXL A;  2KXP B;  4XAX B;  4DV1 T;  2A3D A;  2CLY B;  4HFE A;  3B5M A;  4G2A A;  4X5T A;  4YHJ A;  5FXZ A;  4DR3 T;  5H6Q B;  2XQ9 A;  4JI1 T;  4EZH A;  3AE6 A;  1KNZ A;  3CX7 B;  4I0U A;  2WWU A;  4IDZ A;  1W9R A;  4AQY T;  3NRY A;  2CXD A;  2WB5 A;  2Z6E A;  4EED A;  3AE3 A;  5HCM A;  5F3J A;  3LDQ B;  4U72 A;  5JDL A;  5HXE A;  2D9D A;  3ZC1 A;  2BVL A;  2V7J A;  4QXB B;  2PG8 A;  2CHO A;  3AE2 A;  5FXX A;  3HKB E;  3RIF A;  4X62 T;  4O4I E;  1W0A A;  5DAB A;  4C91 A;  2IML A;  4UVA B;  4QXC B;  4DV2 T;  2V7M A;  3JC6 D;  5HWX A;  2H7V C;  2ES0 A;  2W67 A;  3ONL C;  3OJA A;  3TLT A;  2X9H A;  1BR0 A;  3RIU A;  3NWI A;  4OHF A;  5L4H A;  4U7Y A;  2XAF B;  2XPK A;  3A5X A;  3ZMU B;  3MKD A;  1X79 A;  4ZI3 D;  4UIG A;  3VRA A;  4FJO A;  3C50 A;  4MBQ A;  2X9Y A;  5LGU B;  2JIW A;  2IAK A;  2DWG A;  1XDP A;  2ZLY A;  3C4X A;  5LBQ B;  3FZH B;  5FL1 A;  5HEH A;  4HEA A;  2DLR A;  2V7I A;  2WBL A;  2XSB A;  5IWA T;  4HKA A;  4ZI3 C;  4DUZ T;  1ZEE A;  2ACZ A;  4UVB B;  2JQH A;  4HWF A;  5LOV E;  5HEU A;  4LMJ A;  3N9P A;  1XMO T;  3ZC0 A;  2LOP A;  1OED B;  3QNU A;  1SHZ C;  5LHI B;  4YT0 A;  2CBI A;  2LJL A;  3ZST A;  3LSV A;  3UU5 A;  5LJM A;  4YHH T;  2EHO C;  3AE8 A;  4OK0 A;  4DV3 T;  5CA0 E;  5AQU B;  4X20 E;  3R84 B;  3PUS A;  2L8K A;  4M1P A;  2KWH A;  2UXX B;  3T1H T;  3OVU A;  2UUB T;  2JJ9 A;  3AE9 A;  2D0T A;  5FY1 A;  3K3O A;  1LVK A;  4EGW A;  4B3M T;  1IJ5 A;  4O4J E;  4Z8X A;  2JQ9 A;  3ZJ2 A;  5ABE A;  1CHU A;  2XQA A;  3CPZ A;  5JDG A;  3ZN1 B;  2YDQ A;  1I94 T;  4DMV A;  4PJJ A;  5JVD E;  1MIW A;  2WDV A;  3VHL A;  5LGT B;  3WAK A;  4TN7 B;  3FXD B;  3KV9 A;  3AA6 B;  5EZY E;  2IIU A;  3ZYM A;  4ERR A;  3Q2M A;  4E7Z A;  4IE5 A;  4K0U A;  5JRC A;  1HCI A;  3GMI A;  4H9S E;  4ADZ A;  2UXD T;  2ZM6 T;  1E7P A;  3FZL B;  4O4L E;  2FUP A;  4OFZ A;  4DBQ A;  3KFW X;  5FNV E;  4YSZ A;  4JI8 T;  5HEG A;  4I50 E;  3CX6 B;  4U3C A;  3HA4 A;  3KV6 A;  4H9R C;  5JRC B;  3QC9 A;  3SRZ A;  2XUE A;  4AIU A;  3SFE A;  4AQF A;  5HYA A;  3KV5 A;  1N33 T;  2PJQ A;  4YSY A;  4ISS A;  5AQT B;  1DU2 A;  1Y01 A;  5FVK A;  1BR1 A;  2BDE A;  4DND A;  5C8Y E;  4DR7 T;  2FJE A;  4L0R A;  5EK4 A;  3RYF E;  2CA5 A;  2KIN B;  4EEB A;  2BVM A;  4CN1 A;  3LG7 A;  1X9B A;  1J5E T;  4F6R C;  4UR9 A;  1MMN A;  3CQG B;  4X65 T;  4JV5 T;  3PTR B;  3M3Z B;  1HFA A;  3RH3 A;  1LKX A;  2N9D A;  3ONJ A;  4LF6 T;  3AA1 B;  3PE0 A;  4DV0 T;  2BBJ A;  2VVN A;  1G8X A;  1KFY A;  5AQL B;  5ABG A;  4X1Y E;  4JI4 T;  3T1Y T;  1YKH B;  5AQH B;  1GQE A;  3RQU A;  4AKH A;  2C5K T;  3HL6 A;  4PFO A;  5JH7 E;  1UX4 A;  3ONX A;  5L4E A;  4GYR A;  3LK3 B;  4MAL A;  2CBJ A;  1KF6 A;  3H3A A;  3PUR A;  1KEY A;  2WMO A;  2XQ8 A;  3WI3 A;  3CVR A;  4GIW A;  1BR2 A;  2BKN A;  4FI5 A;  2E5V A;  2M67 A;  2BG9 B;  1UUR A;  2XQ7 A;  4H9O C;  4P09 A;  5DQW A;  3AE7 A;  2BS2 A;  2KMF A;  3K3Q C;  4HGA A;  4J2C A;  4MLK A;  2W0G A;  2WMN A;  5J1G A;  2L9Q A;  2KLQ A;  2N1G A;  2B76 A;  4KI0 F;  4U74 A;  2VKD A;  4DUY T;  3JAE A;  3PUW F;  3IHR A;  3OYX A;  4HE8 A;  4PFP A;  3SFD A;  3Q5E A;  4ZEY A;  4JI0 T;  3S4U A;  4NUU A;  5AQK B;  2IC6 A;  3NRX A;  2A9U A;  2WP9 A;  3A8Y C;  3AEA A;  4CQI A;  5L3G B;  4YY3 T;  2HPJ A;  5FY7 A;  2E9X B;  4LF4 T;  4PJL A;  2MAW A;  5HAX A;  1NWM X;  3RRW A;  1E2A A;  3ANW B;  2QVA A;  3AAI A;  4YTN A;  1N32 T;  2NWB A;  4QH4 A;  3DJB A;  1IAP A;  4IE0 A;  2CRB A;  4DR6 T;  1QLB A;  3HKD E;  4AQF C;  3B13 A;  4HFV A;  5AQM B;  2UUA T;  5JDM A;  3UUL A;  2QYW A;  3IF8 B;  1WRD A;  5JQG E;  2CLY C;  4DV7 T;  4QXH B;  4LFC T;  4JI6 T;  2XAQ B;  4N78 D;  2AE9 A;  4HWH A;  4QX8 B;  3MA9 A;  2K24 A;  2WM9 A;  2JQQ A;  3PJA J;  2LEH A;  3X1D A;  3ZMT B;  5AQN B;  3RX6 A;  4ZI2 C;  3JCF A;  2Q9Q A;  2DCF A;  2Y6X A;  3OYZ A;  4EYU A;  3GN5 A;  4H63 H;  4IHJ E;  4P0B A;  4U2Y A;  4OX9 T;  2XAG B;  2XAS B;  3EAB A;  5AFU L;  3RYC E;  3RF1 A;  3N2G E;  4X1I E;  3AAA B;  5LMU T;  2N2N A;  5LA6 E;  3FZF B;  1I6Z A;  4P1N A;  4IE6 A;  2QA7 A;  5JR9 C;  4PK5 A;  2A72 A;  5HWY A;  3P4Q A;  1HG5 A;  1NAF A;  3ZSS A;  2G0U A;  5AQG B;  2BG9 C;  2V8S V;  3L09 A;  3MK7 C;  3PDY A;  1FIO A;  3MXZ A;  2V7L A;  3SWH A;  3K1S A;  3V5U A;  5IHY A;  5JTG A;  5KX5 E;  2HHH T;  2BKP A;  3FBZ A;  3ZT6 A;  3AB3 B;  2XHE B;  2WU2 A;  4TWH A;  5AQJ B;  2X51 A;  3CQC B;  3MJX A;  4IE4 A;  4LMK A;  5FVL A;  3TLS A;  4P0A A;  2UXB T;  2F4V T;  3M65 A;  2XZE A;  4JEU B;  1FMV A;  5L47 A;  1S35 A;  3CKD A;  1QUU A;  4QH1 A;  3UFE A;  5LGN B;  2ODV A;  3ANW A;  4A5X A;  2E5L T;  4NXN T;  4DVD A;  5LMN T;  2PFV A;  2D2S A;  3ZJ1 A;  2P9B A;  3AEE A;  3NVO A;  1FEW A;  4QH5 A;  3O1H A;  1YQ4 A;  3P4S A;  4DR2 T;  4KP3 C;  4HFC A;  3FXE B;  5ADX L;  1YXR A;  2E9X C;  4UF0 A;  3J9X 1;  3UQ7 A;  3VKG A;  3QUJ A;  3RIU C;  4WW0 A;  2LKG A;  2WS3 A;  2WDQ A;  2NP9 A;  3O1J A;  1R8I A;  2JPF A;  1N34 T;  3QK6 A;  1MND A;  2CHN A;  4AKL A;  2LSJ A;  2WZH A;  3A7M A;  3EDU A;  3PU8 A;  3HR0 A;  5CA1 E;  3FZK B;  5AQR B;  4DV4 T;  4DR5 T;  3JAD A;  3OPC A;  3ZT5 A;  1HNW T;  4PW8 A;  5HXH A;  4CXX A;  2VWA A;  3Q5W A;  5GON E;  1OED A;  3KVA A;  4QWN B;  2JQK A;  1D1B A;  3GWH A;  4O4H E;  3RLF F;  5LYJ E;  2WZI A;  3TKL B;  2X9X A;  2YU1 A;  3N2O A;  4HN9 A;  3UU4 A;  4CXW A;  4X66 T;  2CCQ A;  4EXT A;  1YQ3 A;  1UGO A;  1M7K A;  2AXD S;  2E9X A;  2YIN A;  2H7O A;  4JLE A;  5JDF A;  2ZM0 A;  2NW8 A;  2VAS A;  3EHZ A;  5A1L A;  4KHP T;  3L8R A;  3CML A;  1WR0 A;  4HFI A;  3RI5 A;  2CMR A;  4CXY A;  4IDO A;  3VKH A;  3ZLI A;  4E7S A;  2D5U A;  3VR9 A;  1ZOY A;  3ZPO A;  2I0M A;  3FBL A;  4JI7 T;  2XY8 B;  3C64 A;  3K3N A;  4PJM A;  2M6I A;  4YTP A;  5LJN A;  1VRB A;  2ACX A;  1XNR T;  4L9I A;  4AKG A;  4JI3 T;  5LBM A;  4HTE A;  2KT9 A;  3RKO A;  3ZMZ B;  2E8I A;  4EZ4 A;  4LF8 T;  2DHR A;  2CEA A;  2JRK A;  4AIS A;  4ZI2 D;  2ZMA A;  2NTY A;  3ZYL A;  1N36 T;  3MZK B;  2HH7 A;  2BS4 A;  4IL4 A;  5FYM A;  3NBX X;  5C2T A;  3ABV A;  3EVY A;  5HXS A;  5AQO B;  4ZOL E;  1WLX A;  2Y48 B;  3EAM A;  1WYB A;  5F8P A;  3DP7 A;  5LXT E;  5J2T E;  2LSY A;  1XWM A;  2CE7 A;  2WAU A;  2X68 A;  2YOE A;  2YU2 A;  3CWZ B;  4L5G A;  4GK5 E;  2H89 A;  3EDV A;  4O8S A;  1MMA A;  4IGU A;  4KBM B;  5LB7 B;  3F57 A;  5FXV A;  5CB4 E;  5J2U E;  2RA1 A;  2KWI B;  4LFA T;  4Z90 A;  2ODU A;  3QB5 A;  3GN5 B;  2V5D A;  3CX8 B;  4XBF B;  4ANJ A;  5TAO A;  3NZP A;  1T98 A;  3PUA A;  4O2A E;  4YFS A;  5LHH B;  3OBV E;  3UUX B;  2VB6 A;  4DR4 T;  4TX5 A;  2RP4 A;  4WZX A;  4WBN E;  2H3R A;  4IL9 A;  2V6X A;  4DR1 T;  1D0X A;  2C5I T;  3BQL A;  2LLY A;  3P7I A;  1HG2 A;  5H6R B;  3H37 A;  4AXP A;  1LRZ A;  4DMW A;  3E0Z A;  4I4T E;  3ESL A;  3RYI E;  3AEF A;  3FHN A;  3UU3 A;  2BKO A;  4EAH A;  4JYA T;  2LSI A;  3I0Q A;  3GA8 A;  2XQ5 A;  4QKN A;  3P50 A;  2LKH A;  2EHO D;  3UUB A;  2LHR A;  3PJA A;  3RKG A;  2W00 A;  4AQG A;  2MOZ A;  2XTL A;  3MAC A;  3QB5 K;  3RHW A;  1O3X A;  3ETV A;  4GYS A;  4H9Q C;  5L3C B;  4DBR A;  2WCA A;  3G06 A;  3NKZ A;  1KNR A;  2LRL A;  3N9O A;  3CK6 A;  3BQK A;  3IA3 A;  3N9N A;  4PJN A;  3U78 A;  3R6N A;  3ZCJ A;  2YN6 A;  1MMD A;  4H63 V;  4B3R T;  4KMC A;  2J4G A;  1US7 B;  2X0Y A;  3JC6 C;  3AEB A;  3VR8 A;  3AXJ B;  4IRE A;  2FJD A;  4CI3 B;  1J5W A;  2HN1 A;  1ZP0 A;  2EHO A;  3I1A A;  4ILA A;  2VQF T;  5KMG P;  3N9M A;  2JMH A;  2QRX A;  5JR9 B;  5EK3 A;  3FB2 A;  1HR0 T;  3ETU A;  2LSK A;  4O2B E;  1UK5 A;  3LBX A;  4TWD A;  2WWV A;  5JRE A;  2A2F X;  3UU6 A;  1B7T A;  4A56 A;  3TLW A;  2NW9 A;  2MPK A;  3KBT A;  3L3P A;  4ZS2 A;  2V6Y B;  5L3F B;  3KDS E;  2K9A A;  1IBK T;  2UU9 T;  5IYZ E;  3O4X E;  4NPP A;  4GK0 E;  3Q5D A;  1OED E;  4WYV A;  3ZMS B;  4QHO A;  4ZHQ E;  2UXN B;  2XAH B;  5KXJ A;  4EYY R;  2V26 A;  2XAJ B;  5BMV E;  4JI5 T;  2CWO A;  3AEC A;  3P4W A;  4YLH A;  2NOX A;  1IJ6 A;  4A98 A;  1YKE B;  1OXZ A;  4ILU A;  4ILB A;  1U5P A;  4YJ3 E;  4ASK A;  2EHO B;  4IDQ A;  4BAY B;  2SPC A;  3O1I A;  1BR4 A;  4I43 B;  1T8B A;  1H7C A;  2JMK A;  2Y8D A;  4WBO A;  4DID B;  4EB6 E;  1HF8 A;  1HX1 B;  2VVS A;  3JAF A;  3RC3 A;  3UTK A;  2W61 A;  3ZEF B;  3AA0 B;  4DV5 T;  4ZZC A;  5JDH A;  5ETW A;  2ZM2 A;  1NEK A;  2HPL A;  1YW0 A;  2CPT A;  3KVB A;  4UVC B;  1JNZ A;  3UUN A;  5L3B B;  5LHG B;  4C90 A;  1OWA A;  2KSR A;  1D0Y A;  4CI2 B;  4UEM A;  3P8C D;  4B6X A;  3PV0 F;  4MHC A;  3UFG A;  4ZI7 E;  2X66 A;  4B3T T;  2LM9 A;  2DWK A;  5E0O A;  4AI6 A;  4JBW F;  4KX6 A;  3C4W A;  5L3D B;  2J47 A;  5KDM C;  3AEG A;  2NW7 A;  3OTO T;  3RPU A;  4HFB A;  4YJ2 E;  3EI0 A;  2E9X D;  3TLU A;  5HXC A;  2XJ7 A;  4KHZ F;  3PUX F;  5LNK A;  3AVS A;  2WSS V;  4TZ4 C;  4LF9 T;  1G73 A;  3RQW A;  2C0S A;  4IDP A;  2K5B B;  3N9Q A;  4JI2 T;  1NEN A;  2DI4 A;  2V7K A;  3HI2 A;  4WNK A;  1MNE A;  4JEH B;  3ZT7 A;  4YSX A;  4YXD A;  5ABF B;  3RRC A;  3LK2 B;  3V5S A;  1MIV A;  1VOM A;  2VK9 A;  2IC9 A;  5F5W A;  4AKR B;  2RPA A;  2YKS A;  2BBH A;  4CZZ B;  4CN6 A;  3L39 A;  4IIJ E;  2VL0 A;  2W4X A;  5FL0 A;  3U3I A;  1U4Q A;  4LF7 T;  2XQ3 A;  4GKK T;  4GOU A;  4IE7 A;  1D0Z A;  1FMW A;  4ILC A;  3RYH E;  2R6G F;  4LF5 T;  4CI1 B;  3PUY F;  2BZB A;  4YTM A;  4X1K E;  5HCJ A;  5J0Z A;  1W09 A;  2I6H A;  4IT4 A;  2IHR 1;  2W66 A;  4PK4 A;  4IDN A;  4U2Z A;  4UF0 B;  5LCY A;  5AQV B;  5AQP B;  2BS3 A;  3ZKR A;  3CIR A;  4HFH A;  1T7S A;  1L0V A;  5HEJ A;  5LG3 A;  2MYS A;  4QX7 B;  4TNV A;  1J1J A;  5M4Y A;  2E2A A;  4AKI A;  2LE8 A;  4TV9 E;  2X0H A;  5L2L A;  3I9W A;  5C3J A;  4HFD A;  5JDQ A;  2HN2 A;  2XQ4 A; 
#chains in the Genus database with same CATH homology
 2W2U A;  2V6Y A;  2WY2 A;  2WWV A;  3ZT7 A;  2JQK A;  5FVK A;  2JQ9 A;  4U31 A;  4U2Y A;  4CN6 A;  2RPA A;  2MPK A;  4A5X A;  2DL1 A;  2CPT A;  3EAB A;  4U7I A;  2V6Y B;  5LB7 B;  4CN1 A;  1WFD A;  4ZEY A;  1WR0 A;  4P1N A;  2A9U A;  2LRL A;  4U33 A;  4NIQ A;  2K3W A;  3ZSS A;  4CN4 A;  1YXR A;  4IT4 A;  5CJ5 A;  2JQH A;  4U2Z A;  4WZX A;  1WCR A;  3K1S A;  2V6X A;  3ZT6 A;  3ZST A;  2LRK A;  5FVL A;  5CGM A;  3ZT5 A;  4U3C A;  4U7Y A;  2CRB A;  2XZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...