1HNXT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnxT00
1HNWT 4NXMT 4DR7T 1XMQT 4DR2T 1HR0T 4JI1T 1N32T 4LF4T 1IBLT 2E5LT 2UUCT 4LF7T 4DV0T 4DV1T 4LF8T 4JV5T 4DUZT 4B3MT 4B3RT 2UXCT 4JI2T 1N34T 4DR5T 4AQYT 4DV4T 2ZM6T 4DV7T 4GKJT 1J5ET 1HNZT 4LFCT 4B3ST 4DR6T 2UUBT 4X62T 4X64T 4GKKT 4JI5T 1IBKT 3T1YT 4LFAT 5BR8T 2UXDT 2UU9T 2HHHT 4JYAT 4DUYT 5LMUT 4NXNT 4DR3T 1I94T 2VQFT 4DV3T 4DR1T 4X65T 3T1HT 1N36T 1XNQT 4DR4T 4LFBT 2F4VT 4DV6T 4KHPT 5IWAT 4JI8T 4K0KT 4JI7T 4YHHT 4LF9T 4JI4T 1HNXT 1XNRT 4B3TT 4JI0T 4JI6T 1IBMT 3OTOT 4OX9T 1N33T 4JI3T 2UXBT 2VQET 4DV5T 4DV2T 4X66T 2UUAT 4LF6T 5LMNT 4LF5T 1XMOT 1FJGT 4YY3T
chains in the Genus database with same CATH superfamily
3EABA 3EDVA 2YDRA 4YSYA 4PFOA 4ILAA 3UU8A 2LSKA 1BR0A 3PUXF 4YSZA 4EXTA 4Z90A 4U74A 2M6IA 2N2NA 4O8SA 2B1EA 4IE4A 5HXHA 3NZQA 2JMHA 5JRCA 2JPFA 4ZI2C 3MJXA 2X0YA 1JNRA 4HEAA 3ZYKA 4O4LE 4G63A 4HE8A 3ZN1B 2VVNA 3RYCE 1Y01A 4CZZB 1OEDC 1HNZT 2UXNB 1Y64B 3PU3A 3ZYLA 4H63H 3KV6A 2WM9A 4O4JE 5AQSB 2UXDT 3D0TA 4WNKA 4A5XA 2WBLA 2GK9A 2L8KA 4IDOA 5L4HA 3KVAA 4QKNA 1YW0A 2VK9A 4AKRB 4AQFA 5L3FB 2YOEA 3F2EA 2JIWA 3O9XA 3E08A 1KNPA 1JNZA 5FXXA 3ANWA 2UXBT 1VOMA 5LG3A 1IJ5A 2LEHA 3LK3B 3RF1A 4A56A 3DJBA 4QX8B 2LKHA 2PTFA 4DBQA 2CM0A 2WU2A 4QXBB 5EK3A 4HWIB 4AKIA 4IDQA 4YSXA 5FXZA 2JMKA 3QB5A 3WAKA 2H7OA 4ISSA 2V6XA 3EDUA 3VRBA 2BS4A 4QX7B 5F8PA 2Q9QB 1VCSA 2YK0A 2CBIA 4DVDA 2FJBA 3P7IA 3J9X1 4YTPA 2LSGA 3AEFA 5IUXA 1J5ET 1YQ3A 4BAYB 5HEHA 3AE7A 3TLUA 3P8CD 3MACA 2WZHA 2Q9QD 2UUBT 4I55E 4CN1A 5IHYA 3SOLA 2QYWA 3TLTA 5FYMA 3ZYMA 1T72A 5HAXA 2IUBA 2YN6A 4ZS2A 2W00A 5IYZE 1VRBA 3FZLB 4YXDA 3KBUA 1KNZA 3OKQA 4U72A 5JQGE 4WYVA 5HXEA 4IE7A 1OEDA 4PJNA 1HCIA 5AQTB 1Z8UA 2KNDA 2D2SA 4YY3T 3NWIA 2E9XD 2WDVA 4JEHB 3SRZA 1FMWA 3PUAA 4EOZB 2CCQA 2WS3A 2DCFA 2XM2A 4BA9A 3A7MA 5KXJA 2V7MA 5F5WA 4ZZBA 2CEAA 1MIWA 4Q25A 2K24A 5LGTB 2EHOC 2WAUA 4U2YA 5JH7E 2W63A 1DU2A 3AE3A 2NOXA 3TLWA 2ZM6T 3RQWA 1US7B 2XAFB 4HGAA 4G2AA 5L3BB 4LFCT 3FB2A 2IMLA 5J2TE 1CUNA 5HXSA 5H6QB 4O4IE 2D5UA 3L09A 4ZI2D 2QGSA 5AQUB 4ZHQE 4JI5T 1NENA 3P4QA 3V5SA 4QXCB 5LJNA 5CB4E 2UXXB 1QSDA 2CLYC 3C4XA 2LOPA 2E2AA 1U5PA 1N36T 3AEAA 1Z0PA 4WBOA 4KX6A 3UFEA 2CHOA 2M67A 4JI7T 2V5DA 2BZBA 4OHFA 4DBRA 1UX4A 3F31A 4IDZA 1L0VA 3TKLB 2IC9A 4ADZA 2XQ6A 2YEVC 4GK0E 5AQLB 2VQET 4DV5T 2P9BA 2XY8B 5DQWA 1T8BA 3GN5A 5KMGP 1FJGT 5FY7A 2NW9A 5C3JA 2I6HA 3I0QA 3ZLIA 5HXCA 2X66A 5JDQA 4JI1T 3P4PA 2ZM0A 3ZN0B 3ZJ1A 2VURA 4DV1T 3CQCB 3Q5DA 3AE6A 2LKGA 4DV4T 3PUYF 5L4EA 2N1GA 3A8YC 4QWNB 3SFEA 2ACZA 3B5MA 3CX6B 4QH1A 3UU5A 2XAJB 2BG9C 2XQ9A 2HH7A 1HS7A 4EYUA 4H9QC 4OYJA 2RA1A 4AKHA 5ABFB 2NR4A 1V9DA 3QOFA 3VR9A 3IEEA 2WZIA 3AA0B 2ES0A 3G06A 3I9YA 3Q5EA 2EHOA 3FZHB 4X65T 1XNQT 5KDMC 4MBQA 4F8HA 3ZSTA 3NZPA 2K9AA 4JI8T 4K0KT 2CE7A 1T7SA 1IJ6A 4IL4A 1N33T 2WMOA 5HEOA 2Y8DA 2MOZA 2X51A 3AAAB 4PK5A 3RGLA 2AXDS 1CHUA 3RC8A 1IAPA 4PJMA 4HFBA 2LLYA 4DR7T 1HG2A 3N2OA 5JDHA 5AQKB 3ETUA 3OYXA 5KX5E 5DQVA 2UUCT 5HYAA 1LRZA 2ZM2A 3JADA 4CXXA 2EHOB 2QA7A 4AQGA 4TNWA 1WR0A 3V5UA 4B3RT 2E8IA 2KINB 4ILCA 4AQYT 1X79A 3ZT5A 3C98B 2XQ5A 3ZC0A 3H37A 3RYHE 4L9IA 2CXFA 5HEUA 3ZSSA 3VKHA 4P0BA 2V5CA 3ZC1A 4ERRA 2EHOD 5L3CB 4ZXLA 2XQ4A 5JDFA 2MYSA 4QH4A 4UVCB 3RH3A 3ZMUB 5DABA 3ETVA 4TZ4C 4GYSA 2N9DA 1AJ3A 3T8OA 3K1SA 1VCTA 5LMUT 2CLYB 1QLBA 4DV6T 1D1AA 4FJOA 5IWAT 2B76A 2C0SA 4HKAA 4GIWA 2XTLA 2I0MA 3LK2B 5AQNB 4OX9T 2NW8A 3UUMA 2AE9A 2BG9A 3P4RA 2H7VC 1D0YA 3H3MA 1BR1A 4OK0A 1HX8A 1HNWT 5L3EB 3K8PC 2E9XC 4TNVA 3EAMA 2JQKA 3RYIE 4JUYA 4LF4T 3RPUA 4ILBA 4AIUA 3AAIA 4GYRA 2BKOA 3PV0F 5ABGA 2BKPA 3PUQA 4JV5T 2NP9A 3N9MA 3AE9A 1D0XA 2J4GA 5HWXA 1HF8A 3RRWA 1M7KA 5FP3A 2XQAA 5ADXL 2BG9B 1H7CA 4HWFA 2W67A 2XQ3A 4B3ST 3WI3A 2NTYA 4U3CA 3P4WA 2W2UA 3T1YT 3UT5E 1W0AA 3HKDE 2LM2A 4CI2B 1LVFA 1M62A 1D1BA 3RHWA 1FMVA 4BJMA 1SA0E 2VQFT 3MA9A 4PJLA 4ZOLE 2BDEA 1FEWA 2LRKA 2BBJA 4JI4T 4JI0T 4XZCA 4E7SA 2LOSA 2X9YA 2YKSA 3QC9A 2VKJA 3N9LA 4HN9A 1J1JA 2Q9QA 2LJLA 3O1JA 4P0AA 4EEBA 3ESLA 4QXHB 4EYYR 2BS2A 2CXLA 5CFBA 1MMNA 5JVDE 3OJAA 4KMCA 3HL6A 3HKEE 2C5JA 2X0HA 2FUPA 3VR8A 2KSRA 2KXPB 3ZMTB 2R6GF 4HFVA 4HFHA 4U7IA 2A2FX 1MMGA 3UQ7A 4TX5A 3RX6A 5LA6E 2UXCT 4PAGA 4UR9A 4IDPA 3LJCA 3KVBA 5J0ZA 4I43B 4H63V 5ABEA 3CWZB 3VKGA 4LMLA 2XZEA 2FJEA 2CWOA 5FXVA 1WCRA 2BKNA 1SUMB 2E9XA 3KBTA 4H9OC 4MFRA 2UU9T 2HHHT 4TWFA 3EUHA 3SS1A 5ETWA 4NXNT 4BJNA 1I94T 5LYJE 2VASA 2LM9A 2XSAA 5LB7B 5A1LA 2LT3A 3VU7H 2CWYA 5AQFB 4PK6A 1HNXT 3OVUA 4JI6T 3OTOT 2W62A 3JCFA 4V1Av 3O1IA 4CN6A 3C51A 5LMNT 2ODVA 3K3OA 4X5TA 2E9XB 4OFZA 3BQKA 2VKHA 5EK2A 4X20E 4AI6A 5CA0E 2A9UA 4B3MT 4NUUA 5FXWA 2D0TA 1HFAA 5AQMB 2LE8A 1UUSA 4CXYA 3JAEA 3RQUA 2VL8A 2CA5A 2VKOA 3X1DA 4KUMB 2LHNA 4GOUA 3F57A 1BR2A 4DR3T 2X9WA 2OLTA 2ZMAA 2DNXA 2LSJA 5JTGA 3CMLA 3I1AA 5EK4A 5J1GA 4TN7B 1WFDA 5FKYA 2SPCA 3Q2MA 3NRXA 4YJ2E 4AISA 4M1PA 3MZKB 5FL1A 3ZT7A 3KFWX 1XMOT 2MPKA 2OA5A 3CKDA 3M3ZB 3ZMVB 3AE8A 5LGNB 1XMQT 5FVLA 3E22E 2L9QA 2LHRA 1UX5A 2XAHB 2ZM8A 2WMNA 1ZHCA 2JJ9A 4UV8B 1EZ3A 1KF6A 4MLKA 4MHCA 4EZ4A 5DJQC 5AQHB 3AAEB 5JDMA 3CIRA 4JI2T 3AB3B 1WRDA 3AVRA 2JRKA 5ABFA 2MBGA 4KHZF 5E0OA 3RKGA 4WZXA 4GKJT 3W15B 4ISTA 4KBMB 5L2LA 2KT9A 2G0UA 5LJMA 4COFA 2X67A 5LNKA 1UCUA 4OYKA 5FNVE 3RRCA 4UXNB 1G8XA 2DI4A 2XASB 3FHNA 2FJDA 1XDOA 1NAFA 2BVMA 2XJ7A 3NRYA 3GA8A 2E5VA 2DLRA 4K0UA 5L47A 4KI0F 2YINA 2IC6A 4O2BE 2VB6A 1ZV4X 3PJAJ 2V7IA 4IREA 4H9RC 2NWBA 2XQ8A 4C91A 2A3DA 3O1HA 4I50E 3CX8B 3PJAA 1UK5A 4UIGA 1SE7A 5LCYA 3ZJ2A 5HWYA 3MKDA 5H6RB 3AA6B 3U3IA 4DUZT 2WP9A 2K3WA 5FY0A 5JREA 4YJ3E 3OBVE 3CPZA 4ZS3A 4DR6T 4ASKA 3AECA 2VWAA 1X9BA 2FJAA 4NPPA 4QHOA 3O4XE 3U78A 4DR1T 1NEKA 3KV9A 5LOVE 3LK42 3Q9DA 3BQLA 1ZOYA 2F4VT 1W9RA 5CGMA 4EEDA 3ZMSB 3P50A 4F6RC 5ABHA 1XZYA 5AQJB 4PJJA 2I59A 5EZYE 1J5WA 3NVOA 3H3AA 4MALA 2PJQA 1ZKEA 4IE5A 2V26A 1WYCA 2WDQA 4EB6E 5LBMA 4ZI7E 3GWHA 1N32T 3LBXB 1IBLT 2IAKA 2C5KT 3PUVF 2PG8A 3B57A 2XPKA 5LG4A 4EIWA 3K3NA 3ZEFB 3HI2A 4DR5T 4X1YE 4PW8A 5HCMA 1S35A 3C4WA 4L0RA 4P09A 4B6XA 1XWMA 3MK7C 4X1IE 4ANJA 4AKGA 4J2CA 4HFEA 1B7TA 4PNIA 3OYZA 4UELA 1IBKT 3IBPA 5AQIB 4AKLA 4U7YA 2Z6EA 5AQRB 1LVKA 3B13A 5JR9B 4UF0A 3CQGB 3CVRA 4DR4T 2X0LB 2XQYA 4HWHA 3ZT6A 1GQEA 3FZFB 2W0GA 2IHR1 3RKOA 2W61A 2YU2A 1MMAA 1E1HB 4N78D 3RC3A 4DV2T 2X9XA 1O3XA 4X66T 3GMIA 4YHJA 3RIAA 5LXTE 1HG5A 2OV9A 2H89A 4WW0A 3N9OA 2KLQA 2MTQA 3KDSE 1HR0T 2LRLA 2XSBA 1YD8G 2Y6XA 5AQVB 4Z8XA 2WQYA 4DV0T 2VVSA 4UF0B 3UTKA 5FL0A 1LKXA 3LDQB 2V7LA 3JAFA 4ZI3C 4U33A 1R8IA 3HA4A 3RLFF 4UV9B 3EVYA 5FY1A 4WBNE 1WLXA 4CI3B 2DWGA 2JQHA 3I9WA 3N9QA 2V7KA 2V6YA 4DV7T 5JDLA 3N2GE 3ONXA 1WYBA 4C90A 3ONJA 4X64T 2BBHA 4CXWA 5JRCB 1YQ4A 3QNUA 1ZP0A 2A72A 1D0ZA 1BR4A 3ONLC 5LBQB 1YKEB 2DL1A 1W09A 1UGOA 3UU3A 4IE0A 4JBWF 3KV5A 4EGWA 3PUGA 3PUWF 3N5LA 2V6YB 1MIVA 4LF6T 4LF5T 3HR0A 2WCAA 4TV8E 4EAHA 5HXRA 2CPTA 4XBFB 2HPLA 3VHLA 4ILUA 2HPJA 4IIJE 3ANWB 2YDQA 1OEDE 2J47A 4CQIA 2HN2A 3FZKB 2NTXA 4KP3C 3BK9A 2XQ7A 4HFIA 3AEEA 3ABVA 4IE6A 4IL9A 3Q5XA 2WDRA 3ZPOA 4H9NC 4YTMA 3AE4A 3AXJA 5L3DB 3UUBA 4TWHA 5AQPB 3BQIA 3LG7A 3JC6C 3RIUC 3KINB 2NW7A 2X9HA 1KNRA 3C4ZA 4H9PC 3AEGA 5CJ5A 5C8YE 5LHHB 4DMWA 2CBJA 4JYAT 1KEYA 1YXRA 4AXPA 3PDYA 4DV3T 3AE2A 3AA1B 3CK6A 4A98A 3A5XA 3TLVA 2KWHA 4LFBT 4PFPA 2BS3A 5F3JA 1YKHB 5JDNA 2WSSV 2J62A 4YTNA 2YU1A 1G73A 1IBMT 2XUEA 3QUJA 2IDOB 1U4QA 3AXJB 2L3LA 2CXDA 3RIFA 4IHJE 4DO0A 3C64A 4O2AE 3OPCA 5HCJA 4YLHA 1E2AA 3I0OA 2W66A 2WB5A 4NXMT 2W4XA 2H3RA 4ZZCA 2IW5B 4DR2T 4E7ZA 3RYFE 3L8RA 3FBZA 1OEDB 2ACXA 4PK4A 4IT4A 3SWHA 2YDSA 5LHGB 4LF8T 2V1DB 3DP7A 2D0UA 2C5IT 3UFGA 3CQXC 3PE0A 5LP6E 3MXZA 2K48A 3IHRA 3CX7B 1KK7A 1IZNB 2ODUA 4ZI3D 1SHZC 3DTOA 4GKKT 2J1DG 3UU4A 3K3QC 4LMKA 3ZCIA 4P1NA 1KFYA 5L3GB 3UULA 2WWVA 2DHRA 4JLEA 1NWMX 2IIUA 3FBLA 3N2KE 3J7Yq 4JEUB 3R6NA 1UURA 4DNDA 4KHPT 3N9NA 2CMRA 3M65A 4L5GA 5AFUL 2JQ9A 4LF9T 4B3TT 3VRAA 3PU8A 4JI3T 3IF8B 5JR9C 2KWIB 5AQOB 3RIUA 1HX1B 2UUAT 4Z91A 3AEDA 5TAOA 2WWUA 1MMDA 2CHNA 3L3PA 3NKZA 3PUZF 1QUUA 4DMVA 4LF7T 3ZMZB 2KZ7B 4A97A 3GN5B 2PFVA 2D9DA 3AA7B 1W0BA 3Q5WA 2H88A 3SFDA 2XHEB 3UU6A 5HEGA 1MNEA 1D1CA 5FMNA 3EHZA 4X62T 2DWKA 5M4YA 3UUNA 3FXDB 3FXEB 4YT0A 4LFAT 4HTEA 4DUYT 4EZHA 4NIQA 4IGUA 3WAJA 4EV6A 3S4UA 4I4TE 4NUVA 4LMJA 3JC6D 1XDPA 3RI5A 3T1HT 2ZLYA 2KMFA 3AE5A 5J2UE 3KV4A 3PUSA 3AE1A 4YHHT 3N9PA 1XNRT 4I0UA 2HN1A 3LBXA 3PURA 2QRXA 2Y48B 3ZKRA 2V7JA 1WR6A 3E0ZA 2K5BB 2RP4A 5HEJA 2QVAA 4HWCA 2M6BA 5LGUB 1S94A 4H9SE 4IDNA 5CA1E 3HKBE 3UUXB 2JQQA 1OWAA 4YFSA 2PBIA 2WU5A 5C2TA 3HKCE 5BMVE 2XM1A 3LFMA 2E5LT 2FBWA 2BG9E 3L39A 4TUYE 3LSVA 4HFCA 4TV9E 4FI5A 2X68A 1OXZA 3UQ4A 4HWDA 5LHIB 4X1KE 5AQGB 2Q9QC 3TLSA 4GK5E 5GONE 4AQFC 1N34T 2LSYA 4O4HE 5JR9A 4XAXB 4DIDB 1T98A 1MIYA 4CN4A 4U31A 4U2ZA 4UEMA 4HFDA 3P4SA 2XAGB 3ZCJA 2LSIA 3NBXX 2MAWA 3AVSA 3PTRB 5BR8T 4UVBB 3QB5K 4CI1B 3C50A 4UVAB 3R84B 1FIOA 3EI0A 2BVLA 5AQQB 4ZEYA 2VKDA 1I6ZA 1E7PA 5FVKA 2XAQB 2RPAA 3AEBA 3IA3A 4QH5A 2VL0A 1MNDA 1ZEEA 2WY2A 2V8SV 5JDGA 2CRBA 3FZMB 3QK6A 4TWDA 1HTJF
chains in the Genus database with same CATH topology
1HNWT 4NXMT 4DR7T 1XMQT 4DR2T 1HR0T 4JI1T 1N32T 4LF4T 1IBLT 2E5LT 2UUCT 4LF7T 4DV0T 4DV1T 4LF8T 4JV5T 4DUZT 4B3MT 4B3RT 2UXCT 4JI2T 1N34T 4DR5T 4AQYT 4DV4T 2ZM6T 4DV7T 4GKJT 1J5ET 1HNZT 4LFCT 4B3ST 4DR6T 2UUBT 4X62T 4X64T 4GKKT 4JI5T 1IBKT 3T1YT 4LFAT 5BR8T 2UXDT 2UU9T 2HHHT 4JYAT 4DUYT 5LMUT 4NXNT 4DR3T 1I94T 2VQFT 4DV3T 4DR1T 4X65T 3T1HT 1N36T 1XNQT 4DR4T 4LFBT 2F4VT 4DV6T 4KHPT 5IWAT 4JI8T 4K0KT 4JI7T 4YHHT 4LF9T 4JI4T 1HNXT 1XNRT 4B3TT 4JI0T 4JI6T 1IBMT 3OTOT 4OX9T 1N33T 4JI3T 2UXBT 2VQET 4DV5T 4DV2T 4X66T 2UUAT 4LF6T 5LMNT 4LF5T 1XMOT 1FJGT 4YY3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW T;  4NXM T;  4DR7 T;  1XMQ T;  4DR2 T;  1HR0 T;  4JI1 T;  1N32 T;  4LF4 T;  1IBL T;  2E5L T;  2UUC T;  4LF7 T;  4DV0 T;  4DV1 T;  4LF8 T;  4JV5 T;  4DUZ T;  4B3M T;  4B3R T;  2UXC T;  4JI2 T;  1N34 T;  4DR5 T;  4AQY T;  4DV4 T;  2ZM6 T;  4DV7 T;  4GKJ T;  1J5E T;  1HNZ T;  4LFC T;  4B3S T;  4DR6 T;  2UUB T;  4X62 T;  4X64 T;  4GKK T;  4JI5 T;  1IBK T;  3T1Y T;  4LFA T;  5BR8 T;  2UXD T;  2UU9 T;  2HHH T;  4JYA T;  4DUY T;  5LMU T;  4NXN T;  4DR3 T;  1I94 T;  2VQF T;  4DV3 T;  4DR1 T;  4X65 T;  3T1H T;  1N36 T;  1XNQ T;  4DR4 T;  4LFB T;  2F4V T;  4DV6 T;  4KHP T;  5IWA T;  4JI8 T;  4K0K T;  4JI7 T;  4YHH T;  4LF9 T;  4JI4 T;  1HNX T;  1XNR T;  4B3T T;  4JI0 T;  4JI6 T;  1IBM T;  3OTO T;  4OX9 T;  1N33 T;  4JI3 T;  2UXB T;  2VQE T;  4DV5 T;  4DV2 T;  4X66 T;  2UUA T;  4LF6 T;  5LMN T;  4LF5 T;  1XMO T;  1FJG T;  4YY3 T; 
#chains in the Genus database with same CATH topology
 3EAB A;  3EDV A;  2YDR A;  4YSY A;  4PFO A;  4ILA A;  3UU8 A;  2LSK A;  1BR0 A;  3PUX F;  4YSZ A;  4EXT A;  4Z90 A;  4U74 A;  2M6I A;  2N2N A;  4O8S A;  2B1E A;  4IE4 A;  5HXH A;  3NZQ A;  2JMH A;  5JRC A;  2JPF A;  4ZI2 C;  3MJX A;  2X0Y A;  1JNR A;  4HEA A;  3ZYK A;  4O4L E;  4G63 A;  4HE8 A;  3ZN1 B;  2VVN A;  3RYC E;  1Y01 A;  4CZZ B;  1OED C;  1HNZ T;  2UXN B;  1Y64 B;  3PU3 A;  3ZYL A;  4H63 H;  3KV6 A;  2WM9 A;  4O4J E;  5AQS B;  2UXD T;  3D0T A;  4WNK A;  4A5X A;  2WBL A;  2GK9 A;  2L8K A;  4IDO A;  5L4H A;  3KVA A;  4QKN A;  1YW0 A;  2VK9 A;  4AKR B;  4AQF A;  5L3F B;  2YOE A;  3F2E A;  2JIW A;  3O9X A;  3E08 A;  1KNP A;  1JNZ A;  5FXX A;  3ANW A;  2UXB T;  1VOM A;  5LG3 A;  1IJ5 A;  2LEH A;  3LK3 B;  3RF1 A;  4A56 A;  3DJB A;  4QX8 B;  2LKH A;  2PTF A;  4DBQ A;  2CM0 A;  2WU2 A;  4QXB B;  5EK3 A;  4HWI B;  4AKI A;  4IDQ A;  4YSX A;  5FXZ A;  2JMK A;  3QB5 A;  3WAK A;  2H7O A;  4ISS A;  2V6X A;  3EDU A;  3VRB A;  2BS4 A;  4QX7 B;  5F8P A;  2Q9Q B;  1VCS A;  2YK0 A;  2CBI A;  4DVD A;  2FJB A;  3P7I A;  3J9X 1;  4YTP A;  2LSG A;  3AEF A;  5IUX A;  1J5E T;  1YQ3 A;  4BAY B;  5HEH A;  3AE7 A;  3TLU A;  3P8C D;  3MAC A;  2WZH A;  2Q9Q D;  2UUB T;  4I55 E;  4CN1 A;  5IHY A;  3SOL A;  2QYW A;  3TLT A;  5FYM A;  3ZYM A;  1T72 A;  5HAX A;  2IUB A;  2YN6 A;  4ZS2 A;  2W00 A;  5IYZ E;  1VRB A;  3FZL B;  4YXD A;  3KBU A;  1KNZ A;  3OKQ A;  4U72 A;  5JQG E;  4WYV A;  5HXE A;  4IE7 A;  1OED A;  4PJN A;  1HCI A;  5AQT B;  1Z8U A;  2KND A;  2D2S A;  4YY3 T;  3NWI A;  2E9X D;  2WDV A;  4JEH B;  3SRZ A;  1FMW A;  3PUA A;  4EOZ B;  2CCQ A;  2WS3 A;  2DCF A;  2XM2 A;  4BA9 A;  3A7M A;  5KXJ A;  2V7M A;  5F5W A;  4ZZB A;  2CEA A;  1MIW A;  4Q25 A;  2K24 A;  5LGT B;  2EHO C;  2WAU A;  4U2Y A;  5JH7 E;  2W63 A;  1DU2 A;  3AE3 A;  2NOX A;  3TLW A;  2ZM6 T;  3RQW A;  1US7 B;  2XAF B;  4HGA A;  4G2A A;  5L3B B;  4LFC T;  3FB2 A;  2IML A;  5J2T E;  1CUN A;  5HXS A;  5H6Q B;  4O4I E;  2D5U A;  3L09 A;  4ZI2 D;  2QGS A;  5AQU B;  4ZHQ E;  4JI5 T;  1NEN A;  3P4Q A;  3V5S A;  4QXC B;  5LJN A;  5CB4 E;  2UXX B;  1QSD A;  2CLY C;  3C4X A;  2LOP A;  2E2A A;  1U5P A;  1N36 T;  3AEA A;  1Z0P A;  4WBO A;  4KX6 A;  3UFE A;  2CHO A;  2M67 A;  4JI7 T;  2V5D A;  2BZB A;  4OHF A;  4DBR A;  1UX4 A;  3F31 A;  4IDZ A;  1L0V A;  3TKL B;  2IC9 A;  4ADZ A;  2XQ6 A;  2YEV C;  4GK0 E;  5AQL B;  2VQE T;  4DV5 T;  2P9B A;  2XY8 B;  5DQW A;  1T8B A;  3GN5 A;  5KMG P;  1FJG T;  5FY7 A;  2NW9 A;  5C3J A;  2I6H A;  3I0Q A;  3ZLI A;  5HXC A;  2X66 A;  5JDQ A;  4JI1 T;  3P4P A;  2ZM0 A;  3ZN0 B;  3ZJ1 A;  2VUR A;  4DV1 T;  3CQC B;  3Q5D A;  3AE6 A;  2LKG A;  4DV4 T;  3PUY F;  5L4E A;  2N1G A;  3A8Y C;  4QWN B;  3SFE A;  2ACZ A;  3B5M A;  3CX6 B;  4QH1 A;  3UU5 A;  2XAJ B;  2BG9 C;  2XQ9 A;  2HH7 A;  1HS7 A;  4EYU A;  4H9Q C;  4OYJ A;  2RA1 A;  4AKH A;  5ABF B;  2NR4 A;  1V9D A;  3QOF A;  3VR9 A;  3IEE A;  2WZI A;  3AA0 B;  2ES0 A;  3G06 A;  3I9Y A;  3Q5E A;  2EHO A;  3FZH B;  4X65 T;  1XNQ T;  5KDM C;  4MBQ A;  4F8H A;  3ZST A;  3NZP A;  2K9A A;  4JI8 T;  4K0K T;  2CE7 A;  1T7S A;  1IJ6 A;  4IL4 A;  1N33 T;  2WMO A;  5HEO A;  2Y8D A;  2MOZ A;  2X51 A;  3AAA B;  4PK5 A;  3RGL A;  2AXD S;  1CHU A;  3RC8 A;  1IAP A;  4PJM A;  4HFB A;  2LLY A;  4DR7 T;  1HG2 A;  3N2O A;  5JDH A;  5AQK B;  3ETU A;  3OYX A;  5KX5 E;  5DQV A;  2UUC T;  5HYA A;  1LRZ A;  2ZM2 A;  3JAD A;  4CXX A;  2EHO B;  2QA7 A;  4AQG A;  4TNW A;  1WR0 A;  3V5U A;  4B3R T;  2E8I A;  2KIN B;  4ILC A;  4AQY T;  1X79 A;  3ZT5 A;  3C98 B;  2XQ5 A;  3ZC0 A;  3H37 A;  3RYH E;  4L9I A;  2CXF A;  5HEU A;  3ZSS A;  3VKH A;  4P0B A;  2V5C A;  3ZC1 A;  4ERR A;  2EHO D;  5L3C B;  4ZXL A;  2XQ4 A;  5JDF A;  2MYS A;  4QH4 A;  4UVC B;  3RH3 A;  3ZMU B;  5DAB A;  3ETV A;  4TZ4 C;  4GYS A;  2N9D A;  1AJ3 A;  3T8O A;  3K1S A;  1VCT A;  5LMU T;  2CLY B;  1QLB A;  4DV6 T;  1D1A A;  4FJO A;  5IWA T;  2B76 A;  2C0S A;  4HKA A;  4GIW A;  2XTL A;  2I0M A;  3LK2 B;  5AQN B;  4OX9 T;  2NW8 A;  3UUM A;  2AE9 A;  2BG9 A;  3P4R A;  2H7V C;  1D0Y A;  3H3M A;  1BR1 A;  4OK0 A;  1HX8 A;  1HNW T;  5L3E B;  3K8P C;  2E9X C;  4TNV A;  3EAM A;  2JQK A;  3RYI E;  4JUY A;  4LF4 T;  3RPU A;  4ILB A;  4AIU A;  3AAI A;  4GYR A;  2BKO A;  3PV0 F;  5ABG A;  2BKP A;  3PUQ A;  4JV5 T;  2NP9 A;  3N9M A;  3AE9 A;  1D0X A;  2J4G A;  5HWX A;  1HF8 A;  3RRW A;  1M7K A;  5FP3 A;  2XQA A;  5ADX L;  2BG9 B;  1H7C A;  4HWF A;  2W67 A;  2XQ3 A;  4B3S T;  3WI3 A;  2NTY A;  4U3C A;  3P4W A;  2W2U A;  3T1Y T;  3UT5 E;  1W0A A;  3HKD E;  2LM2 A;  4CI2 B;  1LVF A;  1M62 A;  1D1B A;  3RHW A;  1FMV A;  4BJM A;  1SA0 E;  2VQF T;  3MA9 A;  4PJL A;  4ZOL E;  2BDE A;  1FEW A;  2LRK A;  2BBJ A;  4JI4 T;  4JI0 T;  4XZC A;  4E7S A;  2LOS A;  2X9Y A;  2YKS A;  3QC9 A;  2VKJ A;  3N9L A;  4HN9 A;  1J1J A;  2Q9Q A;  2LJL A;  3O1J A;  4P0A A;  4EEB A;  3ESL A;  4QXH B;  4EYY R;  2BS2 A;  2CXL A;  5CFB A;  1MMN A;  5JVD E;  3OJA A;  4KMC A;  3HL6 A;  3HKE E;  2C5J A;  2X0H A;  2FUP A;  3VR8 A;  2KSR A;  2KXP B;  3ZMT B;  2R6G F;  4HFV A;  4HFH A;  4U7I A;  2A2F X;  1MMG A;  3UQ7 A;  4TX5 A;  3RX6 A;  5LA6 E;  2UXC T;  4PAG A;  4UR9 A;  4IDP A;  3LJC A;  3KVB A;  5J0Z A;  4I43 B;  4H63 V;  5ABE A;  3CWZ B;  3VKG A;  4LML A;  2XZE A;  2FJE A;  2CWO A;  5FXV A;  1WCR A;  2BKN A;  1SUM B;  2E9X A;  3KBT A;  4H9O C;  4MFR A;  2UU9 T;  2HHH T;  4TWF A;  3EUH A;  3SS1 A;  5ETW A;  4NXN T;  4BJN A;  1I94 T;  5LYJ E;  2VAS A;  2LM9 A;  2XSA A;  5LB7 B;  5A1L A;  2LT3 A;  3VU7 H;  2CWY A;  5AQF B;  4PK6 A;  1HNX T;  3OVU A;  4JI6 T;  3OTO T;  2W62 A;  3JCF A;  4V1A v;  3O1I A;  4CN6 A;  3C51 A;  5LMN T;  2ODV A;  3K3O A;  4X5T A;  2E9X B;  4OFZ A;  3BQK A;  2VKH A;  5EK2 A;  4X20 E;  4AI6 A;  5CA0 E;  2A9U A;  4B3M T;  4NUU A;  5FXW A;  2D0T A;  1HFA A;  5AQM B;  2LE8 A;  1UUS A;  4CXY A;  3JAE A;  3RQU A;  2VL8 A;  2CA5 A;  2VKO A;  3X1D A;  4KUM B;  2LHN A;  4GOU A;  3F57 A;  1BR2 A;  4DR3 T;  2X9W A;  2OLT A;  2ZMA A;  2DNX A;  2LSJ A;  5JTG A;  3CML A;  3I1A A;  5EK4 A;  5J1G A;  4TN7 B;  1WFD A;  5FKY A;  2SPC A;  3Q2M A;  3NRX A;  4YJ2 E;  4AIS A;  4M1P A;  3MZK B;  5FL1 A;  3ZT7 A;  3KFW X;  1XMO T;  2MPK A;  2OA5 A;  3CKD A;  3M3Z B;  3ZMV B;  3AE8 A;  5LGN B;  1XMQ T;  5FVL A;  3E22 E;  2L9Q A;  2LHR A;  1UX5 A;  2XAH B;  2ZM8 A;  2WMN A;  1ZHC A;  2JJ9 A;  4UV8 B;  1EZ3 A;  1KF6 A;  4MLK A;  4MHC A;  4EZ4 A;  5DJQ C;  5AQH B;  3AAE B;  5JDM A;  3CIR A;  4JI2 T;  3AB3 B;  1WRD A;  3AVR A;  2JRK A;  5ABF A;  2MBG A;  4KHZ F;  5E0O A;  3RKG A;  4WZX A;  4GKJ T;  3W15 B;  4IST A;  4KBM B;  5L2L A;  2KT9 A;  2G0U A;  5LJM A;  4COF A;  2X67 A;  5LNK A;  1UCU A;  4OYK A;  5FNV E;  3RRC A;  4UXN B;  1G8X A;  2DI4 A;  2XAS B;  3FHN A;  2FJD A;  1XDO A;  1NAF A;  2BVM A;  2XJ7 A;  3NRY A;  3GA8 A;  2E5V A;  2DLR A;  4K0U A;  5L47 A;  4KI0 F;  2YIN A;  2IC6 A;  4O2B E;  2VB6 A;  1ZV4 X;  3PJA J;  2V7I A;  4IRE A;  4H9R C;  2NWB A;  2XQ8 A;  4C91 A;  2A3D A;  3O1H A;  4I50 E;  3CX8 B;  3PJA A;  1UK5 A;  4UIG A;  1SE7 A;  5LCY A;  3ZJ2 A;  5HWY A;  3MKD A;  5H6R B;  3AA6 B;  3U3I A;  4DUZ T;  2WP9 A;  2K3W A;  5FY0 A;  5JRE A;  4YJ3 E;  3OBV E;  3CPZ A;  4ZS3 A;  4DR6 T;  4ASK A;  3AEC A;  2VWA A;  1X9B A;  2FJA A;  4NPP A;  4QHO A;  3O4X E;  3U78 A;  4DR1 T;  1NEK A;  3KV9 A;  5LOV E;  3LK4 2;  3Q9D A;  3BQL A;  1ZOY A;  2F4V T;  1W9R A;  5CGM A;  4EED A;  3ZMS B;  3P50 A;  4F6R C;  5ABH A;  1XZY A;  5AQJ B;  4PJJ A;  2I59 A;  5EZY E;  1J5W A;  3NVO A;  3H3A A;  4MAL A;  2PJQ A;  1ZKE A;  4IE5 A;  2V26 A;  1WYC A;  2WDQ A;  4EB6 E;  5LBM A;  4ZI7 E;  3GWH A;  1N32 T;  3LBX B;  1IBL T;  2IAK A;  2C5K T;  3PUV F;  2PG8 A;  3B57 A;  2XPK A;  5LG4 A;  4EIW A;  3K3N A;  3ZEF B;  3HI2 A;  4DR5 T;  4X1Y E;  4PW8 A;  5HCM A;  1S35 A;  3C4W A;  4L0R A;  4P09 A;  4B6X A;  1XWM A;  3MK7 C;  4X1I E;  4ANJ A;  4AKG A;  4J2C A;  4HFE A;  1B7T A;  4PNI A;  3OYZ A;  4UEL A;  1IBK T;  3IBP A;  5AQI B;  4AKL A;  4U7Y A;  2Z6E A;  5AQR B;  1LVK A;  3B13 A;  5JR9 B;  4UF0 A;  3CQG B;  3CVR A;  4DR4 T;  2X0L B;  2XQY A;  4HWH A;  3ZT6 A;  1GQE A;  3FZF B;  2W0G A;  2IHR 1;  3RKO A;  2W61 A;  2YU2 A;  1MMA A;  1E1H B;  4N78 D;  3RC3 A;  4DV2 T;  2X9X A;  1O3X A;  4X66 T;  3GMI A;  4YHJ A;  3RIA A;  5LXT E;  1HG5 A;  2OV9 A;  2H89 A;  4WW0 A;  3N9O A;  2KLQ A;  2MTQ A;  3KDS E;  1HR0 T;  2LRL A;  2XSB A;  1YD8 G;  2Y6X A;  5AQV B;  4Z8X A;  2WQY A;  4DV0 T;  2VVS A;  4UF0 B;  3UTK A;  5FL0 A;  1LKX A;  3LDQ B;  2V7L A;  3JAF A;  4ZI3 C;  4U33 A;  1R8I A;  3HA4 A;  3RLF F;  4UV9 B;  3EVY A;  5FY1 A;  4WBN E;  1WLX A;  4CI3 B;  2DWG A;  2JQH A;  3I9W A;  3N9Q A;  2V7K A;  2V6Y A;  4DV7 T;  5JDL A;  3N2G E;  3ONX A;  1WYB A;  4C90 A;  3ONJ A;  4X64 T;  2BBH A;  4CXW A;  5JRC B;  1YQ4 A;  3QNU A;  1ZP0 A;  2A72 A;  1D0Z A;  1BR4 A;  3ONL C;  5LBQ B;  1YKE B;  2DL1 A;  1W09 A;  1UGO A;  3UU3 A;  4IE0 A;  4JBW F;  3KV5 A;  4EGW A;  3PUG A;  3PUW F;  3N5L A;  2V6Y B;  1MIV A;  4LF6 T;  4LF5 T;  3HR0 A;  2WCA A;  4TV8 E;  4EAH A;  5HXR A;  2CPT A;  4XBF B;  2HPL A;  3VHL A;  4ILU A;  2HPJ A;  4IIJ E;  3ANW B;  2YDQ A;  1OED E;  2J47 A;  4CQI A;  2HN2 A;  3FZK B;  2NTX A;  4KP3 C;  3BK9 A;  2XQ7 A;  4HFI A;  3AEE A;  3ABV A;  4IE6 A;  4IL9 A;  3Q5X A;  2WDR A;  3ZPO A;  4H9N C;  4YTM A;  3AE4 A;  3AXJ A;  5L3D B;  3UUB A;  4TWH A;  5AQP B;  3BQI A;  3LG7 A;  3JC6 C;  3RIU C;  3KIN B;  2NW7 A;  2X9H A;  1KNR A;  3C4Z A;  4H9P C;  3AEG A;  5CJ5 A;  5C8Y E;  5LHH B;  4DMW A;  2CBJ A;  4JYA T;  1KEY A;  1YXR A;  4AXP A;  3PDY A;  4DV3 T;  3AE2 A;  3AA1 B;  3CK6 A;  4A98 A;  3A5X A;  3TLV A;  2KWH A;  4LFB T;  4PFP A;  2BS3 A;  5F3J A;  1YKH B;  5JDN A;  2WSS V;  2J62 A;  4YTN A;  2YU1 A;  1G73 A;  1IBM T;  2XUE A;  3QUJ A;  2IDO B;  1U4Q A;  3AXJ B;  2L3L A;  2CXD A;  3RIF A;  4IHJ E;  4DO0 A;  3C64 A;  4O2A E;  3OPC A;  5HCJ A;  4YLH A;  1E2A A;  3I0O A;  2W66 A;  2WB5 A;  4NXM T;  2W4X A;  2H3R A;  4ZZC A;  2IW5 B;  4DR2 T;  4E7Z A;  3RYF E;  3L8R A;  3FBZ A;  1OED B;  2ACX A;  4PK4 A;  4IT4 A;  3SWH A;  2YDS A;  5LHG B;  4LF8 T;  2V1D B;  3DP7 A;  2D0U A;  2C5I T;  3UFG A;  3CQX C;  3PE0 A;  5LP6 E;  3MXZ A;  2K48 A;  3IHR A;  3CX7 B;  1KK7 A;  1IZN B;  2ODU A;  4ZI3 D;  1SHZ C;  3DTO A;  4GKK T;  2J1D G;  3UU4 A;  3K3Q C;  4LMK A;  3ZCI A;  4P1N A;  1KFY A;  5L3G B;  3UUL A;  2WWV A;  2DHR A;  4JLE A;  1NWM X;  2IIU A;  3FBL A;  3N2K E;  3J7Y q;  4JEU B;  3R6N A;  1UUR A;  4DND A;  4KHP T;  3N9N A;  2CMR A;  3M65 A;  4L5G A;  5AFU L;  2JQ9 A;  4LF9 T;  4B3T T;  3VRA A;  3PU8 A;  4JI3 T;  3IF8 B;  5JR9 C;  2KWI B;  5AQO B;  3RIU A;  1HX1 B;  2UUA T;  4Z91 A;  3AED A;  5TAO A;  2WWU A;  1MMD A;  2CHN A;  3L3P A;  3NKZ A;  3PUZ F;  1QUU A;  4DMV A;  4LF7 T;  3ZMZ B;  2KZ7 B;  4A97 A;  3GN5 B;  2PFV A;  2D9D A;  3AA7 B;  1W0B A;  3Q5W A;  2H88 A;  3SFD A;  2XHE B;  3UU6 A;  5HEG A;  1MNE A;  1D1C A;  5FMN A;  3EHZ A;  4X62 T;  2DWK A;  5M4Y A;  3UUN A;  3FXD B;  3FXE B;  4YT0 A;  4LFA T;  4HTE A;  4DUY T;  4EZH A;  4NIQ A;  4IGU A;  3WAJ A;  4EV6 A;  3S4U A;  4I4T E;  4NUV A;  4LMJ A;  3JC6 D;  1XDP A;  3RI5 A;  3T1H T;  2ZLY A;  2KMF A;  3AE5 A;  5J2U E;  3KV4 A;  3PUS A;  3AE1 A;  4YHH T;  3N9P A;  1XNR T;  4I0U A;  2HN1 A;  3LBX A;  3PUR A;  2QRX A;  2Y48 B;  3ZKR A;  2V7J A;  1WR6 A;  3E0Z A;  2K5B B;  2RP4 A;  5HEJ A;  2QVA A;  4HWC A;  2M6B A;  5LGU B;  1S94 A;  4H9S E;  4IDN A;  5CA1 E;  3HKB E;  3UUX B;  2JQQ A;  1OWA A;  4YFS A;  2PBI A;  2WU5 A;  5C2T A;  3HKC E;  5BMV E;  2XM1 A;  3LFM A;  2E5L T;  2FBW A;  2BG9 E;  3L39 A;  4TUY E;  3LSV A;  4HFC A;  4TV9 E;  4FI5 A;  2X68 A;  1OXZ A;  3UQ4 A;  4HWD A;  5LHI B;  4X1K E;  5AQG B;  2Q9Q C;  3TLS A;  4GK5 E;  5GON E;  4AQF C;  1N34 T;  2LSY A;  4O4H E;  5JR9 A;  4XAX B;  4DID B;  1T98 A;  1MIY A;  4CN4 A;  4U31 A;  4U2Z A;  4UEM A;  4HFD A;  3P4S A;  2XAG B;  3ZCJ A;  2LSI A;  3NBX X;  2MAW A;  3AVS A;  3PTR B;  5BR8 T;  4UVB B;  3QB5 K;  4CI1 B;  3C50 A;  4UVA B;  3R84 B;  1FIO A;  3EI0 A;  2BVL A;  5AQQ B;  4ZEY A;  2VKD A;  1I6Z A;  1E7P A;  5FVK A;  2XAQ B;  2RPA A;  3AEB A;  3IA3 A;  4QH5 A;  2VL0 A;  1MND A;  1ZEE A;  2WY2 A;  2V8S V;  5JDG A;  2CRB A;  3FZM B;  3QK6 A;  4TWD A;  1HTJ F; 
#chains in the Genus database with same CATH homology
 1HNW T;  4NXM T;  4DR7 T;  1XMQ T;  4DR2 T;  1HR0 T;  4JI1 T;  1N32 T;  4LF4 T;  1IBL T;  2E5L T;  2UUC T;  4LF7 T;  4DV0 T;  4DV1 T;  4LF8 T;  4JV5 T;  4DUZ T;  4B3M T;  4B3R T;  2UXC T;  4JI2 T;  1N34 T;  4DR5 T;  4AQY T;  4DV4 T;  2ZM6 T;  4DV7 T;  4GKJ T;  1J5E T;  1HNZ T;  4LFC T;  4B3S T;  4DR6 T;  2UUB T;  4X62 T;  4X64 T;  4GKK T;  4JI5 T;  1IBK T;  3T1Y T;  4LFA T;  5BR8 T;  2UXD T;  2UU9 T;  2HHH T;  4JYA T;  4DUY T;  5LMU T;  4NXN T;  4DR3 T;  1I94 T;  2VQF T;  4DV3 T;  4DR1 T;  4X65 T;  3T1H T;  1N36 T;  1XNQ T;  4DR4 T;  4LFB T;  2F4V T;  4DV6 T;  4KHP T;  5IWA T;  4JI8 T;  4K0K T;  4JI7 T;  4YHH T;  4LF9 T;  4JI4 T;  1HNX T;  1XNR T;  4B3T T;  4JI0 T;  4JI6 T;  1IBM T;  3OTO T;  4OX9 T;  1N33 T;  4JI3 T;  2UXB T;  2VQE T;  4DV5 T;  4DV2 T;  4X66 T;  2UUA T;  4LF6 T;  5LMN T;  4LF5 T;  1XMO T;  1FJG T;  4YY3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...