1HNXT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnxT00
4JI3T 4JI0T 4YHHT 4JI7T 4YY3T 4GKJT 1N33T 4LF7T 1N32T 4NXNT 4DV5T 4OX9T 1J5ET 4DV1T 4DV3T 4DR4T 1HR0T 3T1HT 1HNXT 4JI2T 4DR3T 1XNRT 4DR5T 4B3TT 1XNQT 4LF9T 4LFBT 1HNZT 1XMOT 4KHPT 4DV4T 5IWAT 4X66T 2UUAT 4JI8T 4DUZT 2ZM6T 2VQET 2HHHT 1IBMT 2UUBT 3OTOT 4X64T 4LFCT 4JI1T 4DV2T 1I94T 5LMUT 4DUYT 4LF8T 1IBLT 1FJGT 2UXCT 4DR2T 4DV0T 2UU9T 4DR7T 4B3ST 4AQYT 4JYAT 4JI6T 4JI5T 1N34T 2E5LT 2F4VT 4X62T 1XMQT 4B3MT 4X65T 1IBKT 5BR8T 4LF4T 1HNWT 4K0KT 4GKKT 4DR1T 4NXMT 4DV7T 4JI4T 4B3RT 4DR6T 4JV5T 2VQFT 3T1YT 4LF6T 2UXDT 5LMNT 4LFAT 4DV6T 2UUCT 1N36T 4LF5T 2UXBT
chains in the Genus database with same CATH superfamily
2VK9A 4KI0F 3LK42 2BZBA 3KV4A 4JI7T 4TV8E 1M7KA 2EHOB 5ETWA 3AA0B 3E22E 5C2TA 5ABGA 3PUZF 4I0UA 2FUPA 4XAXB 4AISA 3E0ZA 5EK2A 2W67A 5LGNB 2FJEA 3AEBA 3FHNA 4HWDA 4DV5T 4UVBB 3KVAA 4ZS2A 3ZJ2A 1YQ3A 4DR4T 1E1HB 3UFEA 4UV8B 3CQCB 1HR0T 5A1LA 1HNXT 3CMLA 4YFSA 3JAFA 5L4HA 3HKCE 3UU8A 4OHFA 2YK0A 4ZZCA 5CFBA 1MIWA 4DR3T 1FMWA 2LE8A 2CXLA 4GYSA 4F6RC 1NAFA 4QX8B 3Q5DA 4QXHB 4ZS3A 3I9WA 2D0TA 5HXCA 2VB6A 3ZCIA 2C5KT 2XAHB 4HFDA 5HEJA 4HWHA 5JDGA 5JDMA 2NTYA 3AEDA 2FBWA 3Q5WA 5AQKB 3AE6A 2JRKA 2NW7A 1U5PA 3AEGA 1Y64B 3AE1A 4ILCA 4TV9E 1XMOT 3AVRA 4H9SE 1D0YA 2E5VA 1IJ6A 3O9XA 2XAGB 1U4QA 3DP7A 4TWHA 3WI3A 1VCSA 2ZLYA 5LJNA 2KINB 2YDRA 2BG9C 4YSZA 4IIJE 3VRBA 4AIUA 2RA1A 4OFZA 2HPLA 4QH5A 5AQNB 3TLVA 3AE5A 4O4LE 4Q25A 5AQHB 3Q5EA 3DTOA 3N9NA 4PAGA 5FMNA 4X64T 1IBMT 2V7JA 2WDRA 3MACA 3HR0A 3IBPA 3ZT7A 4ZOLE 2XSAA 4JBWF 5LXTE 3AEAA 1EZ3A 2XAFB 4U3CA 2YN6A 2H89A 3H3AA 4QH1A 3RHWA 1HX8A 2X51A 4A97A 4AXPA 4A5XA 1E7PA 3AXJA 4JLEA 4DR6T 4DUYT 4LF8T 5FY7A 4UIGA 4BAYB 1JNRA 1VRBA 1CHUA 3UU4A 3H3MA 4GYRA 1D0ZA 5J0ZA 2CCQA 2W66A 3QB5A 3ZMTB 4ERRA 5JR9C 3MXZA 4TUYE 2N9DA 1HS7A 5ADXL 3RQWA 1YXRA 3AA7B 2V7KA 1N34T 3AVSA 4IDZA 2CWYA 3SOLA 2CBJA 3N2KE 1O3XA 2AXDS 3K3NA 4TX5A 1WCRA 5FL0A 2VKOA 3P4QA 5C8YE 3VU7H 2BS3A 3DJBA 4Z90A 4X62T 3GA8A 2BDEA 5AQSB 2B1EA 2WU2A 3QUJA 3VR9A 2VKJA 5JDNA 2W61A 5LHIB 1IBKT 1LKXA 2NR4A 4HWFA 4EGWA 5BR8T 3S4UA 1KNRA 2XQ8A 2V7IA 3QB5K 3KV6A 2J1DG 1BR0A 3NZPA 3CQXC 4PJJA 3NRYA 5HCJA 4GKKT 2XAQB 2BVMA 5KMGP 3QC9A 2Q9QC 1D0XA 5IYZE 2W63A 3IA3A 2PG8A 4I43B 1KFYA 3UUXB 4DO0A 1OXZA 2J47A 4ILUA 2IC9A 4O8SA 4ZZBA 2GK9A 2HH7A 4DV7T 2X9YA 3KBTA 4HN9A 2YU2A 4HFIA 1T72A 1LVFA 5AQQB 5H6QB 2A3DA 4O2BE 3ZT6A 3ZEFB 4KBMB 2MTQA 2WCAA 1NENA 3PUVF 4U74A 2WU5A 2L9QA 2X9HA 2PTFA 3O1JA 4HGAA 3T1YT 2DWGA 3TKLB 4C91A 2EHOC 2KZ7B 4PFOA 2QYWA 5JRCB 3QK6A 5L3CB 4EEDA 3P8CD 2LM9A 4HFBA 5FY0A 2NWBA 4U2YA 5JDHA 4WYVA 1LVKA 1OEDE 3FZLB 3UU5A 5LJMA 1D1BA 4YHJA 4CN6A 4DBRA 2LHNA 4G63A 3HKDE 3NVOA 4WNKA 2UXNB 1FJGT 2I6HA 2KT9A 4LMJA 2MPKA 4V1Av 2XHEB 1QSDA 3O4XE 3VRAA 1Z8UA 5L47A 3JAEA 3UQ4A 4MFRA 2WAUA 4A56A 2W00A 3LDQB 4YLHA 2LKHA 3FZFB 4YY3T 3JCFA 4EB6E 4HWIB 3FB2A 2XM1A 4U72A 5ABFA 1D1AA 1N32T 2LHRA 5LGTB 4OYKA 4EYUA 1FEWA 5JDQA 3RIFA 3UU6A 2JMKA 4OX9T 2QGSA 4KX6A 1XZYA 2B76A 3C4ZA 5HXRA 4UVAB 3ZC1A 3EUHA 2CWOA 3KBUA 2H3RA 3CWZB 2A72A 2XPKA 1DU2A 2I59A 1WRDA 4IGUA 2XQ3A 2MBGA 3AE9A 4X1KE 2HN1A 1R8IA 3AE4A 1KF6A 3NZQA 5AQOB 5FKYA 4YTNA 1WR6A 2A9UA 3UU3A 3JC6C 3OKQA 2NW9A 1XWMA 4B3TT 2Z6EA 3NRXA 2H88A 3CX8B 3ONLC 1XNQT 2V6YB 1OEDC 2WWVA 4NIQA 5ABEA 2CEAA 5F3JA 3CVRA 2NP9A 4WZXA 4QX7B 3UUNA 4AKHA 3SS1A 4PJMA 2C5JA 4CI3B 2X0LB 2V6XA 3D0TA 3ETVA 4TWFA 4AKIA 3RIAA 2LM2A 2RP4A 1XDPA 5IUXA 5FXZA 1KEYA 3RH3A 3ZC0A 4PK4A 3V5UA 4QXCB 1OEDB 4DV4T 2CM0A 5IWAT 3U3IA 2EHOD 4UELA 5EK4A 3WAKA 2Y48B 2CHNA 5CJ5A 2X68A 3C98B 5JDLA 2WSSV 4LMKA 5DABA 2LSJA 2CXFA 3C4XA 3RYFE 4UV9B 4EZ4A 5M4YA 2ZM6T 2HHHT 3OTOT 4ILBA 2NOXA 3A7MA 3EDUA 3N9OA 2XQ5A 2M67A 2E8IA 2Y8DA 1FMVA 4KUMB 3CX6B 2JQ9A 4X1YE 4LFCT 4IE7A 3EAMA 1V9DA 2I0MA 3I9YA 5LNKA 4WW0A 5JREA 1T7SA 1LRZA 1W0BA 1HX1B 4UF0A 4BJNA 4P0AA 2IC6A 3AECA 3QOFA 4HFEA 2EHOA 5AQPB 4ILAA 4U31A 4H9PC 3PV0F 1W9RA 5CB4E 3RIUC 2RPAA 3ZSTA 4DR7T 2D9DA 2MOZA 5FXWA 2WDQA 4IHJE 1NEKA 4L5GA 2CA5A 2X9WA 2MAWA 2XASB 4P0BA 4DIDB 2VKDA 2KWHA 2XQ4A 3OYXA 5HAXA 4CN4A 5FL1A 1HG5A 4JEUB 2KLQA 3C51A 1I6ZA 3VKHA 3AE8A 3I1AA 5FP3A 4IE0A 4ZEYA 4G2AA 2K48A 1ZEEA 3EDVA 3RQUA 3ZMSB 5LYJE 2C0SA 4JI8T 2KSRA 1YKHB 1ZHCA 2K24A 3ANWB 3PU8A 2LSKA 4WBOA 4YXDA 2H7OA 3PUSA 1US7B 3RI5A 2J62A 4O2AE 4YJ2E 5CGMA 4K0KT 1HNWT 2YEVC 5LG3A 1BR4A 2WM9A 5GONE 2KMFA 4X20E 4K0UA 4P09A 4MLKA 1H7CA 2UXCT 1HF8A 1QLBA 2A2FX 3IHRA 5FVLA 4AQFA 5EK3A 4EEBA 4DR1T 3M65A 2BKPA 2IIUA 3FXDB 3P4SA 3FBZA 3L09A 4COFA 4NUUA 1NWMX 3RRCA 3BK9A 3AEEA 4JI4T 2YU1A 3LBXA 1X9BA 3LK2B 2DI4A 1KNZA 4IT4A 5HEOA 2IHR1 2NTXA 4Z8XA 5JDFA 4DVDA 2HN2A 3AB3B 1MIVA 5LMNT 2LOPA 2L8KA 2PBIA 4DMVA 3N9LA 2BS2A 4LFAT 2L3LA 5LHGB 4DV6T 1VCTA 3PE0A 1MIYA 1HTJF 2ZM8A 4YJ3E 5BMVE 2LKGA 2XQ9A 4TN7B 1JNZA 1WLXA 1N36T 2JQHA 4ZI3D 2CLYC 4MALA 4E7ZA 4YT0A 3UUMA 2D2SA 3LG7A 3I0QA 5FY1A 5LCYA 3WAJA 1QUUA 4JI3T 1ZOYA 2V7MA 1Y01A 2CXDA 5L3BB 2E2AA 2XUEA 4PK5A 2BVLA 5E0OA 5ABHA 5HEHA 5DQVA 1N33T 4M1PA 1UURA 4DMWA 5ABFB 4TNWA 2J4GA 2K3WA 3ZMZB 2LT3A 5HXSA 3ZPOA 5L3GB 4J2CA 4DV1T 1J5ET 2AE9A 1SA0E 4EAHA 2DCFA 2CBIA 1MMDA 3UULA 5LP6E 2E9XC 3T1HT 3IEEA 2XY8B 4PJNA 4X5TA 3TLUA 4C90A 3BQKA 5EZYE 1GQEA 5HWXA 1SHZC 4MHCA 1HFAA 4AKRB 2WS3A 2H7VC 3CX7B 3LFMA 5L2LA 4XBFB 2WP9A 4H9NC 1IJ5A 4HWCA 3ZN0B 2V26A 1UX4A 2E9XB 1W0AA 3C50A 4JUYA 3TLTA 3F2EA 2CE7A 3O1HA 2ODVA 3K3QC 2XQ6A 3EABA 2Q9QA 1WYCA 1YKEB 4KHZF 4PK6A 3ZN1B 4CXXA 1YD8G 3VHLA 4ZI7E 1HNZT 3P4WA 3OBVE 2JQKA 2VKHA 3QNUA 5LB7B 5C3JA 2CLYB 2LRLA 3B57A 2BKNA 4O4HE 1MMGA 2Q9QB 4YTPA 1L0VA 1E2AA 4CZZB 4DBQA 2DNXA 3HI2A 3PU3A 3Q5XA 3KFWX 2FJAA 1S94A 1MMNA 2IAKA 5H6RB 4ZHQE 2M6IA 2JPFA 2OA5A 2OLTA 3PDYA 1D1CA 3F57A 3KVBA 4IL4A 3BQLA 1HCIA 2IDOB 5L3EB 3ESLA 3AE3A 2BG9B 2VURA 3C4WA 1SE7A 2G0UA 4EXTA 1J5WA 2LLYA 4HFHA 4U33A 2YDQA 5LA6E 4DV2T 2V7LA 3O1IA 1UUSA 4ADZA 2IUBA 2XJ7A 3NBXX 3OVUA 4HKAA 2ACXA 3RF1A 3I0OA 2W62A 5LOVE 5LMUT 2QVAA 3PTRB 2V5DA 4L9IA 3N2GE 3P4RA 4PJLA 1T98A 3NKZA 5DJQC 3K8PC 2BG9A 2YKSA 2XTLA 4EOZB 1BR2A 1J1JA 3FXEB 1G73A 1KK7A 4MBQA 2UU9T 1M62A 3JC6D 1ZV4X 2PFVA 4OYJA 4GOUA 4AQYT 4JYAT 4EYYR 2V1DB 4I50E 3FZKB 2ES0A 4QH4A 4QKNA 5FXXA 3UT5E 2XSBA 3LK3B 4P1NA 2X0HA 3PJAA 2E5LT 3FZHB 4FI5A 1FIOA 3ZLIA 5JQGE 4IDOA 2LSYA 2BS4A 3RYCE 2IMLA 3KV9A 3MJXA 3R84B 2WY2A 2JIWA 3P7IA 4IREA 3PUQA 3W15B 4E7SA 2ODUA 3CIRA 3AAEB 5LBMA 4NPPA 4NUVA 1ZKEA 3PJAJ 4LF4T 2JQQA 2K9AA 2QRXA 5J2UE 1BR1A 5FYMA 5J1GA 4ZI3C 2PJQA 2NW8A 3RIUA 3RYHE 5J2TE 4CQIA 2XZEA 2E9XA 3U78A 4H63V 3TLSA 2WWUA 4IL9A 1UX5A 2WB5A 2LOSA 3HKEE 3K1SA 4XZCA 4O4JE 2YINA 4GK5E 2VVNA 5HCMA 4CI2B 4F8HA 4NXMT 4GIWA 1W09A 4HTEA 5AQJB 5FXVA 4B3RT 4GK0E 5HEGA 4ZI2D 4JV5T 3JADA 4IE6A 4YSYA 3MA9A 2WMNA 3OYZA 2OV9A 3T8OA 2V8SV 1YQ4A 2WZHA 3PUWF 1YW0A 3ZYKA 4LF6T 2ZM0A 3EHZA 2UXDT 3OPCA 5HXHA 4B6XA 2E9XD 1AJ3A 2BKOA 4LMLA 4OK0A 3H37A 3KINB 2CHOA 4Z91A 4ZI2C 3SFDA 4U2ZA 2XQYA 4ZXLA 2HPJA 3RGLA 3BQIA 2N2NA 1T8BA 3ZYMA 2LEHA 3GMIA 3B5MA 3KDSE 3PUXF 3NWIA 4BA9A 5LBQB 2YOEA 4IE5A 4JI0T 3HKBE 4U7IA 3B13A 4CN1A 4YHHT 2KNDA 2C5IT 3PURA 3MZKB 3ZMVB 4JEHB 4EV6A 4HEAA 4X66T 4GKJT 5JR9B 1UGOA 3MKDA 4HFCA 4IDPA 3ZT5A 3RLFF 1IAPA 3AA6B 5FVKA 2ZM2A 4LF7T 4QWNB 2BG9E 4ANJA 4UVCB 2KXPB 4NXNT 4QXBB 3LBXB 3F31A 3ZJ1A 4PNIA 2DLRA 5AQGB 2W4XA 3ONJA 4ISSA 5KX5E 4DV3T 3N2OA 1CUNA 2WBLA 3G06A 3L8RA 5L4EA 4AKGA 2Y6XA 3A5XA 1X79A 3IF8B 4IDQA 4JI2T 2LSGA 1XNRT 5AFUL 5LGUB 5L3DB 2BBHA 2CMRA 4HE8A 4EZHA 2WDVA 4DR5T 3RC8A 4UEMA 3ABVA 3MK7C 5AQUB 3TLWA 2WQYA 2XQ7A 3K3OA 4FJOA 2ZMAA 4CXYA 2W0GA 4LF9T 4H9RC 4H9QC 4UXNB 3AXJB 4IDNA 4LFBT 2LSIA 4HFVA 3CKDA 3RX6A 1VOMA 2KWIB 4KHPT 1UCUA 3N9PA 2ACZA 2JMHA 3HA4A 3EVYA 5LG4A 4X1IE 4QHOA 3RKGA 3N9QA 3SWHA 3GN5B 2UUAT 4AI6A 2DHRA 2X67A 3RPUA 2LRKA 4PW8A 4DUZT 1MNEA 3RRWA 3P4PA 4H63H 3A8YC 4YTMA 1ZP0A 2Q9QD 5AQVB 3ZYLA 5JH7E 2VQET 2UUBT 5JRCA 5TAOA 1MNDA 5AQLB 3ZMUB 3KV5A 3GN5A 3LJCA 3RYIE 2X0YA 5AQFB 1KNPA 4AQGA 3AAAB 3Q2MA 5L3FB 3N5LA 3X1DA 3N9MA 4JI1T 2IW5B 5JR9A 4I4TE 1I94T 2VASA 3VR8A 4L0RA 1SUMB 1IBLT 3V5SA 3CPZA 1HG2A 3FZMB 4KP3C 2XM2A 3R6NA 4DR2T 1WFDA 3Q9DA 4DV0T 2FJBA 2JJ9A 2N1GA 2SPCA 2WZIA 2YDSA 4H9OC 4B3ST 3OJAA 5KDMC 2LJLA 4UR9A 2FJDA 3SRZA 3CK6A 5LHHB 4JI6T 5F5WA 3ZKRA 4JI5T 3GWHA 3HL6A 2F4VT 4TNVA 2CPTA 2V5CA 5JVDE 4AQFC 4U7YA 4EIWA 1MMAA 1XMQT 1WR0A 2R6GF 3RC3A 3UQ7A 4B3MT 3UUBA 4BJMA 4N78D 1IZNB 4PFPA 1OEDA 2DWKA 3ZSSA 3AE2A 5DQWA 1S35A 1WYBA 4X65T 4O4IE 5CA1E 2P9BA 2VVSA 2MYSA 2XAJB 3UFGA 5HYAA 3AA1B 2D0UA 5AQMB 4DNDA 5HWYA 3AEFA 2VWAA 2DL1A 5JTGA 2X66A 3M3ZB 1UK5A 2V6YA 5F8PA 3RKOA 4WBNE 2M6BA 2K5BB 3EI0A 3P50A 3PUGA 5AQTB 3CQGB 4ASKA 4CXWA 2BBJA 3E08A 4CI1B 3AAIA 3ETUA 3ZCJA 5CA0E 2QA7A 2D5UA 3L3PA 4UF0B 5HEUA 5AQIB 4YSXA 5FNVE 3LSVA 3PUAA 4IE4A 5IHYA 2WMOA 4ISTA 3ANWA 5AQRB 3AE7A 3PUYF 4I55E 3SFEA 2VQFT 3J9X1 3FBLA 1Z0PA 1OWAA 3UTKA 2VL8A 1G8XA 4TWDA 4A98A 2UUCT 3ONXA 4TZ4C 2XQAA 3C64A 5HXEA 4LF5T 1B7TA 4KMCA 3VKGA 2VL0A 4AKLA 1XDOA 5KXJA 2UXXB 2X9XA 2W2UA 2CRBA 3J7Yq 2UXBT 3L39A
chains in the Genus database with same CATH topology
4JI3T 4JI0T 4YHHT 4JI7T 4YY3T 4GKJT 1N33T 4LF7T 1N32T 4NXNT 4DV5T 4OX9T 1J5ET 4DV1T 4DV3T 4DR4T 1HR0T 3T1HT 1HNXT 4JI2T 4DR3T 1XNRT 4DR5T 4B3TT 1XNQT 4LF9T 4LFBT 1HNZT 1XMOT 4KHPT 4DV4T 5IWAT 4X66T 2UUAT 4JI8T 4DUZT 2ZM6T 2VQET 2HHHT 1IBMT 2UUBT 3OTOT 4X64T 4LFCT 4JI1T 4DV2T 1I94T 5LMUT 4DUYT 4LF8T 1IBLT 1FJGT 2UXCT 4DR2T 4DV0T 2UU9T 4DR7T 4B3ST 4AQYT 4JYAT 4JI6T 4JI5T 1N34T 2E5LT 2F4VT 4X62T 1XMQT 4B3MT 4X65T 1IBKT 5BR8T 4LF4T 1HNWT 4K0KT 4GKKT 4DR1T 4NXMT 4DV7T 4JI4T 4B3RT 4DR6T 4JV5T 2VQFT 3T1YT 4LF6T 2UXDT 5LMNT 4LFAT 4DV6T 2UUCT 1N36T 4LF5T 2UXBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 T;  4JI0 T;  4YHH T;  4JI7 T;  4YY3 T;  4GKJ T;  1N33 T;  4LF7 T;  1N32 T;  4NXN T;  4DV5 T;  4OX9 T;  1J5E T;  4DV1 T;  4DV3 T;  4DR4 T;  1HR0 T;  3T1H T;  1HNX T;  4JI2 T;  4DR3 T;  1XNR T;  4DR5 T;  4B3T T;  1XNQ T;  4LF9 T;  4LFB T;  1HNZ T;  1XMO T;  4KHP T;  4DV4 T;  5IWA T;  4X66 T;  2UUA T;  4JI8 T;  4DUZ T;  2ZM6 T;  2VQE T;  2HHH T;  1IBM T;  2UUB T;  3OTO T;  4X64 T;  4LFC T;  4JI1 T;  4DV2 T;  1I94 T;  5LMU T;  4DUY T;  4LF8 T;  1IBL T;  1FJG T;  2UXC T;  4DR2 T;  4DV0 T;  2UU9 T;  4DR7 T;  4B3S T;  4AQY T;  4JYA T;  4JI6 T;  4JI5 T;  1N34 T;  2E5L T;  2F4V T;  4X62 T;  1XMQ T;  4B3M T;  4X65 T;  1IBK T;  5BR8 T;  4LF4 T;  1HNW T;  4K0K T;  4GKK T;  4DR1 T;  4NXM T;  4DV7 T;  4JI4 T;  4B3R T;  4DR6 T;  4JV5 T;  2VQF T;  3T1Y T;  4LF6 T;  2UXD T;  5LMN T;  4LFA T;  4DV6 T;  2UUC T;  1N36 T;  4LF5 T;  2UXB T; 
#chains in the Genus database with same CATH topology
 2VK9 A;  4KI0 F;  3LK4 2;  2BZB A;  3KV4 A;  4JI7 T;  4TV8 E;  1M7K A;  2EHO B;  5ETW A;  3AA0 B;  3E22 E;  5C2T A;  5ABG A;  3PUZ F;  4I0U A;  2FUP A;  4XAX B;  4AIS A;  3E0Z A;  5EK2 A;  2W67 A;  5LGN B;  2FJE A;  3AEB A;  3FHN A;  4HWD A;  4DV5 T;  4UVB B;  3KVA A;  4ZS2 A;  3ZJ2 A;  1YQ3 A;  4DR4 T;  1E1H B;  3UFE A;  4UV8 B;  3CQC B;  1HR0 T;  5A1L A;  1HNX T;  3CML A;  4YFS A;  3JAF A;  5L4H A;  3HKC E;  3UU8 A;  4OHF A;  2YK0 A;  4ZZC A;  5CFB A;  1MIW A;  4DR3 T;  1FMW A;  2LE8 A;  2CXL A;  4GYS A;  4F6R C;  1NAF A;  4QX8 B;  3Q5D A;  4QXH B;  4ZS3 A;  3I9W A;  2D0T A;  5HXC A;  2VB6 A;  3ZCI A;  2C5K T;  2XAH B;  4HFD A;  5HEJ A;  4HWH A;  5JDG A;  5JDM A;  2NTY A;  3AED A;  2FBW A;  3Q5W A;  5AQK B;  3AE6 A;  2JRK A;  2NW7 A;  1U5P A;  3AEG A;  1Y64 B;  3AE1 A;  4ILC A;  4TV9 E;  1XMO T;  3AVR A;  4H9S E;  1D0Y A;  2E5V A;  1IJ6 A;  3O9X A;  2XAG B;  1U4Q A;  3DP7 A;  4TWH A;  3WI3 A;  1VCS A;  2ZLY A;  5LJN A;  2KIN B;  2YDR A;  2BG9 C;  4YSZ A;  4IIJ E;  3VRB A;  4AIU A;  2RA1 A;  4OFZ A;  2HPL A;  4QH5 A;  5AQN B;  3TLV A;  3AE5 A;  4O4L E;  4Q25 A;  5AQH B;  3Q5E A;  3DTO A;  3N9N A;  4PAG A;  5FMN A;  4X64 T;  1IBM T;  2V7J A;  2WDR A;  3MAC A;  3HR0 A;  3IBP A;  3ZT7 A;  4ZOL E;  2XSA A;  4JBW F;  5LXT E;  3AEA A;  1EZ3 A;  2XAF B;  4U3C A;  2YN6 A;  2H89 A;  3H3A A;  4QH1 A;  3RHW A;  1HX8 A;  2X51 A;  4A97 A;  4AXP A;  4A5X A;  1E7P A;  3AXJ A;  4JLE A;  4DR6 T;  4DUY T;  4LF8 T;  5FY7 A;  4UIG A;  4BAY B;  1JNR A;  1VRB A;  1CHU A;  3UU4 A;  3H3M A;  4GYR A;  1D0Z A;  5J0Z A;  2CCQ A;  2W66 A;  3QB5 A;  3ZMT B;  4ERR A;  5JR9 C;  3MXZ A;  4TUY E;  2N9D A;  1HS7 A;  5ADX L;  3RQW A;  1YXR A;  3AA7 B;  2V7K A;  1N34 T;  3AVS A;  4IDZ A;  2CWY A;  3SOL A;  2CBJ A;  3N2K E;  1O3X A;  2AXD S;  3K3N A;  4TX5 A;  1WCR A;  5FL0 A;  2VKO A;  3P4Q A;  5C8Y E;  3VU7 H;  2BS3 A;  3DJB A;  4Z90 A;  4X62 T;  3GA8 A;  2BDE A;  5AQS B;  2B1E A;  2WU2 A;  3QUJ A;  3VR9 A;  2VKJ A;  5JDN A;  2W61 A;  5LHI B;  1IBK T;  1LKX A;  2NR4 A;  4HWF A;  4EGW A;  5BR8 T;  3S4U A;  1KNR A;  2XQ8 A;  2V7I A;  3QB5 K;  3KV6 A;  2J1D G;  1BR0 A;  3NZP A;  3CQX C;  4PJJ A;  3NRY A;  5HCJ A;  4GKK T;  2XAQ B;  2BVM A;  5KMG P;  3QC9 A;  2Q9Q C;  1D0X A;  5IYZ E;  2W63 A;  3IA3 A;  2PG8 A;  4I43 B;  1KFY A;  3UUX B;  4DO0 A;  1OXZ A;  2J47 A;  4ILU A;  2IC9 A;  4O8S A;  4ZZB A;  2GK9 A;  2HH7 A;  4DV7 T;  2X9Y A;  3KBT A;  4HN9 A;  2YU2 A;  4HFI A;  1T72 A;  1LVF A;  5AQQ B;  5H6Q B;  2A3D A;  4O2B E;  3ZT6 A;  3ZEF B;  4KBM B;  2MTQ A;  2WCA A;  1NEN A;  3PUV F;  4U74 A;  2WU5 A;  2L9Q A;  2X9H A;  2PTF A;  3O1J A;  4HGA A;  3T1Y T;  2DWG A;  3TKL B;  4C91 A;  2EHO C;  2KZ7 B;  4PFO A;  2QYW A;  5JRC B;  3QK6 A;  5L3C B;  4EED A;  3P8C D;  2LM9 A;  4HFB A;  5FY0 A;  2NWB A;  4U2Y A;  5JDH A;  4WYV A;  1LVK A;  1OED E;  3FZL B;  3UU5 A;  5LJM A;  1D1B A;  4YHJ A;  4CN6 A;  4DBR A;  2LHN A;  4G63 A;  3HKD E;  3NVO A;  4WNK A;  2UXN B;  1FJG T;  2I6H A;  2KT9 A;  4LMJ A;  2MPK A;  4V1A v;  2XHE B;  1QSD A;  3O4X E;  3VRA A;  1Z8U A;  5L47 A;  3JAE A;  3UQ4 A;  4MFR A;  2WAU A;  4A56 A;  2W00 A;  3LDQ B;  4YLH A;  2LKH A;  3FZF B;  4YY3 T;  3JCF A;  4EB6 E;  4HWI B;  3FB2 A;  2XM1 A;  4U72 A;  5ABF A;  1D1A A;  1N32 T;  2LHR A;  5LGT B;  4OYK A;  4EYU A;  1FEW A;  5JDQ A;  3RIF A;  3UU6 A;  2JMK A;  4OX9 T;  2QGS A;  4KX6 A;  1XZY A;  2B76 A;  3C4Z A;  5HXR A;  4UVA B;  3ZC1 A;  3EUH A;  2CWO A;  3KBU A;  2H3R A;  3CWZ B;  2A72 A;  2XPK A;  1DU2 A;  2I59 A;  1WRD A;  4IGU A;  2XQ3 A;  2MBG A;  3AE9 A;  4X1K E;  2HN1 A;  1R8I A;  3AE4 A;  1KF6 A;  3NZQ A;  5AQO B;  5FKY A;  4YTN A;  1WR6 A;  2A9U A;  3UU3 A;  3JC6 C;  3OKQ A;  2NW9 A;  1XWM A;  4B3T T;  2Z6E A;  3NRX A;  2H88 A;  3CX8 B;  3ONL C;  1XNQ T;  2V6Y B;  1OED C;  2WWV A;  4NIQ A;  5ABE A;  2CEA A;  5F3J A;  3CVR A;  2NP9 A;  4WZX A;  4QX7 B;  3UUN A;  4AKH A;  3SS1 A;  4PJM A;  2C5J A;  4CI3 B;  2X0L B;  2V6X A;  3D0T A;  3ETV A;  4TWF A;  4AKI A;  3RIA A;  2LM2 A;  2RP4 A;  1XDP A;  5IUX A;  5FXZ A;  1KEY A;  3RH3 A;  3ZC0 A;  4PK4 A;  3V5U A;  4QXC B;  1OED B;  4DV4 T;  2CM0 A;  5IWA T;  3U3I A;  2EHO D;  4UEL A;  5EK4 A;  3WAK A;  2Y48 B;  2CHN A;  5CJ5 A;  2X68 A;  3C98 B;  5JDL A;  2WSS V;  4LMK A;  5DAB A;  2LSJ A;  2CXF A;  3C4X A;  3RYF E;  4UV9 B;  4EZ4 A;  5M4Y A;  2ZM6 T;  2HHH T;  3OTO T;  4ILB A;  2NOX A;  3A7M A;  3EDU A;  3N9O A;  2XQ5 A;  2M67 A;  2E8I A;  2Y8D A;  1FMV A;  4KUM B;  3CX6 B;  2JQ9 A;  4X1Y E;  4LFC T;  4IE7 A;  3EAM A;  1V9D A;  2I0M A;  3I9Y A;  5LNK A;  4WW0 A;  5JRE A;  1T7S A;  1LRZ A;  1W0B A;  1HX1 B;  4UF0 A;  4BJN A;  4P0A A;  2IC6 A;  3AEC A;  3QOF A;  4HFE A;  2EHO A;  5AQP B;  4ILA A;  4U31 A;  4H9P C;  3PV0 F;  1W9R A;  5CB4 E;  3RIU C;  2RPA A;  3ZST A;  4DR7 T;  2D9D A;  2MOZ A;  5FXW A;  2WDQ A;  4IHJ E;  1NEK A;  4L5G A;  2CA5 A;  2X9W A;  2MAW A;  2XAS B;  4P0B A;  4DID B;  2VKD A;  2KWH A;  2XQ4 A;  3OYX A;  5HAX A;  4CN4 A;  5FL1 A;  1HG5 A;  4JEU B;  2KLQ A;  3C51 A;  1I6Z A;  3VKH A;  3AE8 A;  3I1A A;  5FP3 A;  4IE0 A;  4ZEY A;  4G2A A;  2K48 A;  1ZEE A;  3EDV A;  3RQU A;  3ZMS B;  5LYJ E;  2C0S A;  4JI8 T;  2KSR A;  1YKH B;  1ZHC A;  2K24 A;  3ANW B;  3PU8 A;  2LSK A;  4WBO A;  4YXD A;  2H7O A;  3PUS A;  1US7 B;  3RI5 A;  2J62 A;  4O2A E;  4YJ2 E;  5CGM A;  4K0K T;  1HNW T;  2YEV C;  5LG3 A;  1BR4 A;  2WM9 A;  5GON E;  2KMF A;  4X20 E;  4K0U A;  4P09 A;  4MLK A;  1H7C A;  2UXC T;  1HF8 A;  1QLB A;  2A2F X;  3IHR A;  5FVL A;  4AQF A;  5EK3 A;  4EEB A;  4DR1 T;  3M65 A;  2BKP A;  2IIU A;  3FXD B;  3P4S A;  3FBZ A;  3L09 A;  4COF A;  4NUU A;  1NWM X;  3RRC A;  3BK9 A;  3AEE A;  4JI4 T;  2YU1 A;  3LBX A;  1X9B A;  3LK2 B;  2DI4 A;  1KNZ A;  4IT4 A;  5HEO A;  2IHR 1;  2NTX A;  4Z8X A;  5JDF A;  4DVD A;  2HN2 A;  3AB3 B;  1MIV A;  5LMN T;  2LOP A;  2L8K A;  2PBI A;  4DMV A;  3N9L A;  2BS2 A;  4LFA T;  2L3L A;  5LHG B;  4DV6 T;  1VCT A;  3PE0 A;  1MIY A;  1HTJ F;  2ZM8 A;  4YJ3 E;  5BMV E;  2LKG A;  2XQ9 A;  4TN7 B;  1JNZ A;  1WLX A;  1N36 T;  2JQH A;  4ZI3 D;  2CLY C;  4MAL A;  4E7Z A;  4YT0 A;  3UUM A;  2D2S A;  3LG7 A;  3I0Q A;  5FY1 A;  5LCY A;  3WAJ A;  1QUU A;  4JI3 T;  1ZOY A;  2V7M A;  1Y01 A;  2CXD A;  5L3B B;  2E2A A;  2XUE A;  4PK5 A;  2BVL A;  5E0O A;  5ABH A;  5HEH A;  5DQV A;  1N33 T;  4M1P A;  1UUR A;  4DMW A;  5ABF B;  4TNW A;  2J4G A;  2K3W A;  3ZMZ B;  2LT3 A;  5HXS A;  3ZPO A;  5L3G B;  4J2C A;  4DV1 T;  1J5E T;  2AE9 A;  1SA0 E;  4EAH A;  2DCF A;  2CBI A;  1MMD A;  3UUL A;  5LP6 E;  2E9X C;  3T1H T;  3IEE A;  2XY8 B;  4PJN A;  4X5T A;  3TLU A;  4C90 A;  3BQK A;  5EZY E;  1GQE A;  5HWX A;  1SHZ C;  4MHC A;  1HFA A;  4AKR B;  2WS3 A;  2H7V C;  3CX7 B;  3LFM A;  5L2L A;  4XBF B;  2WP9 A;  4H9N C;  1IJ5 A;  4HWC A;  3ZN0 B;  2V26 A;  1UX4 A;  2E9X B;  1W0A A;  3C50 A;  4JUY A;  3TLT A;  3F2E A;  2CE7 A;  3O1H A;  2ODV A;  3K3Q C;  2XQ6 A;  3EAB A;  2Q9Q A;  1WYC A;  1YKE B;  4KHZ F;  4PK6 A;  3ZN1 B;  4CXX A;  1YD8 G;  3VHL A;  4ZI7 E;  1HNZ T;  3P4W A;  3OBV E;  2JQK A;  2VKH A;  3QNU A;  5LB7 B;  5C3J A;  2CLY B;  2LRL A;  3B57 A;  2BKN A;  4O4H E;  1MMG A;  2Q9Q B;  4YTP A;  1L0V A;  1E2A A;  4CZZ B;  4DBQ A;  2DNX A;  3HI2 A;  3PU3 A;  3Q5X A;  3KFW X;  2FJA A;  1S94 A;  1MMN A;  2IAK A;  5H6R B;  4ZHQ E;  2M6I A;  2JPF A;  2OA5 A;  2OLT A;  3PDY A;  1D1C A;  3F57 A;  3KVB A;  4IL4 A;  3BQL A;  1HCI A;  2IDO B;  5L3E B;  3ESL A;  3AE3 A;  2BG9 B;  2VUR A;  3C4W A;  1SE7 A;  2G0U A;  4EXT A;  1J5W A;  2LLY A;  4HFH A;  4U33 A;  2YDQ A;  5LA6 E;  4DV2 T;  2V7L A;  3O1I A;  1UUS A;  4ADZ A;  2IUB A;  2XJ7 A;  3NBX X;  3OVU A;  4HKA A;  2ACX A;  3RF1 A;  3I0O A;  2W62 A;  5LOV E;  5LMU T;  2QVA A;  3PTR B;  2V5D A;  4L9I A;  3N2G E;  3P4R A;  4PJL A;  1T98 A;  3NKZ A;  5DJQ C;  3K8P C;  2BG9 A;  2YKS A;  2XTL A;  4EOZ B;  1BR2 A;  1J1J A;  3FXE B;  1G73 A;  1KK7 A;  4MBQ A;  2UU9 T;  1M62 A;  3JC6 D;  1ZV4 X;  2PFV A;  4OYJ A;  4GOU A;  4AQY T;  4JYA T;  4EYY R;  2V1D B;  4I50 E;  3FZK B;  2ES0 A;  4QH4 A;  4QKN A;  5FXX A;  3UT5 E;  2XSB A;  3LK3 B;  4P1N A;  2X0H A;  3PJA A;  2E5L T;  3FZH B;  4FI5 A;  1FIO A;  3ZLI A;  5JQG E;  4IDO A;  2LSY A;  2BS4 A;  3RYC E;  2IML A;  3KV9 A;  3MJX A;  3R84 B;  2WY2 A;  2JIW A;  3P7I A;  4IRE A;  3PUQ A;  3W15 B;  4E7S A;  2ODU A;  3CIR A;  3AAE B;  5LBM A;  4NPP A;  4NUV A;  1ZKE A;  3PJA J;  4LF4 T;  2JQQ A;  2K9A A;  2QRX A;  5J2U E;  1BR1 A;  5FYM A;  5J1G A;  4ZI3 C;  2PJQ A;  2NW8 A;  3RIU A;  3RYH E;  5J2T E;  4CQI A;  2XZE A;  2E9X A;  3U78 A;  4H63 V;  3TLS A;  2WWU A;  4IL9 A;  1UX5 A;  2WB5 A;  2LOS A;  3HKE E;  3K1S A;  4XZC A;  4O4J E;  2YIN A;  4GK5 E;  2VVN A;  5HCM A;  4CI2 B;  4F8H A;  4NXM T;  4GIW A;  1W09 A;  4HTE A;  5AQJ B;  5FXV A;  4B3R T;  4GK0 E;  5HEG A;  4ZI2 D;  4JV5 T;  3JAD A;  4IE6 A;  4YSY A;  3MA9 A;  2WMN A;  3OYZ A;  2OV9 A;  3T8O A;  2V8S V;  1YQ4 A;  2WZH A;  3PUW F;  1YW0 A;  3ZYK A;  4LF6 T;  2ZM0 A;  3EHZ A;  2UXD T;  3OPC A;  5HXH A;  4B6X A;  2E9X D;  1AJ3 A;  2BKO A;  4LML A;  4OK0 A;  3H37 A;  3KIN B;  2CHO A;  4Z91 A;  4ZI2 C;  3SFD A;  4U2Z A;  2XQY A;  4ZXL A;  2HPJ A;  3RGL A;  3BQI A;  2N2N A;  1T8B A;  3ZYM A;  2LEH A;  3GMI A;  3B5M A;  3KDS E;  3PUX F;  3NWI A;  4BA9 A;  5LBQ B;  2YOE A;  4IE5 A;  4JI0 T;  3HKB E;  4U7I A;  3B13 A;  4CN1 A;  4YHH T;  2KND A;  2C5I T;  3PUR A;  3MZK B;  3ZMV B;  4JEH B;  4EV6 A;  4HEA A;  4X66 T;  4GKJ T;  5JR9 B;  1UGO A;  3MKD A;  4HFC A;  4IDP A;  3ZT5 A;  3RLF F;  1IAP A;  3AA6 B;  5FVK A;  2ZM2 A;  4LF7 T;  4QWN B;  2BG9 E;  4ANJ A;  4UVC B;  2KXP B;  4NXN T;  4QXB B;  3LBX B;  3F31 A;  3ZJ1 A;  4PNI A;  2DLR A;  5AQG B;  2W4X A;  3ONJ A;  4ISS A;  5KX5 E;  4DV3 T;  3N2O A;  1CUN A;  2WBL A;  3G06 A;  3L8R A;  5L4E A;  4AKG A;  2Y6X A;  3A5X A;  1X79 A;  3IF8 B;  4IDQ A;  4JI2 T;  2LSG A;  1XNR T;  5AFU L;  5LGU B;  5L3D B;  2BBH A;  2CMR A;  4HE8 A;  4EZH A;  2WDV A;  4DR5 T;  3RC8 A;  4UEM A;  3ABV A;  3MK7 C;  5AQU B;  3TLW A;  2WQY A;  2XQ7 A;  3K3O A;  4FJO A;  2ZMA A;  4CXY A;  2W0G A;  4LF9 T;  4H9R C;  4H9Q C;  4UXN B;  3AXJ B;  4IDN A;  4LFB T;  2LSI A;  4HFV A;  3CKD A;  3RX6 A;  1VOM A;  2KWI B;  4KHP T;  1UCU A;  3N9P A;  2ACZ A;  2JMH A;  3HA4 A;  3EVY A;  5LG4 A;  4X1I E;  4QHO A;  3RKG A;  3N9Q A;  3SWH A;  3GN5 B;  2UUA T;  4AI6 A;  2DHR A;  2X67 A;  3RPU A;  2LRK A;  4PW8 A;  4DUZ T;  1MNE A;  3RRW A;  3P4P A;  4H63 H;  3A8Y C;  4YTM A;  1ZP0 A;  2Q9Q D;  5AQV B;  3ZYL A;  5JH7 E;  2VQE T;  2UUB T;  5JRC A;  5TAO A;  1MND A;  5AQL B;  3ZMU B;  3KV5 A;  3GN5 A;  3LJC A;  3RYI E;  2X0Y A;  5AQF B;  1KNP A;  4AQG A;  3AAA B;  3Q2M A;  5L3F B;  3N5L A;  3X1D A;  3N9M A;  4JI1 T;  2IW5 B;  5JR9 A;  4I4T E;  1I94 T;  2VAS A;  3VR8 A;  4L0R A;  1SUM B;  1IBL T;  3V5S A;  3CPZ A;  1HG2 A;  3FZM B;  4KP3 C;  2XM2 A;  3R6N A;  4DR2 T;  1WFD A;  3Q9D A;  4DV0 T;  2FJB A;  2JJ9 A;  2N1G A;  2SPC A;  2WZI A;  2YDS A;  4H9O C;  4B3S T;  3OJA A;  5KDM C;  2LJL A;  4UR9 A;  2FJD A;  3SRZ A;  3CK6 A;  5LHH B;  4JI6 T;  5F5W A;  3ZKR A;  4JI5 T;  3GWH A;  3HL6 A;  2F4V T;  4TNV A;  2CPT A;  2V5C A;  5JVD E;  4AQF C;  4U7Y A;  4EIW A;  1MMA A;  1XMQ T;  1WR0 A;  2R6G F;  3RC3 A;  3UQ7 A;  4B3M T;  3UUB A;  4BJM A;  4N78 D;  1IZN B;  4PFP A;  1OED A;  2DWK A;  3ZSS A;  3AE2 A;  5DQW A;  1S35 A;  1WYB A;  4X65 T;  4O4I E;  5CA1 E;  2P9B A;  2VVS A;  2MYS A;  2XAJ B;  3UFG A;  5HYA A;  3AA1 B;  2D0U A;  5AQM B;  4DND A;  5HWY A;  3AEF A;  2VWA A;  2DL1 A;  5JTG A;  2X66 A;  3M3Z B;  1UK5 A;  2V6Y A;  5F8P A;  3RKO A;  4WBN E;  2M6B A;  2K5B B;  3EI0 A;  3P50 A;  3PUG A;  5AQT B;  3CQG B;  4ASK A;  4CXW A;  2BBJ A;  3E08 A;  4CI1 B;  3AAI A;  3ETU A;  3ZCJ A;  5CA0 E;  2QA7 A;  2D5U A;  3L3P A;  4UF0 B;  5HEU A;  5AQI B;  4YSX A;  5FNV E;  3LSV A;  3PUA A;  4IE4 A;  5IHY A;  2WMO A;  4IST A;  3ANW A;  5AQR B;  3AE7 A;  3PUY F;  4I55 E;  3SFE A;  2VQF T;  3J9X 1;  3FBL A;  1Z0P A;  1OWA A;  3UTK A;  2VL8 A;  1G8X A;  4TWD A;  4A98 A;  2UUC T;  3ONX A;  4TZ4 C;  2XQA A;  3C64 A;  5HXE A;  4LF5 T;  1B7T A;  4KMC A;  3VKG A;  2VL0 A;  4AKL A;  1XDO A;  5KXJ A;  2UXX B;  2X9X A;  2W2U A;  2CRB A;  3J7Y q;  2UXB T;  3L39 A; 
#chains in the Genus database with same CATH homology
 4JI3 T;  4JI0 T;  4YHH T;  4JI7 T;  4YY3 T;  4GKJ T;  1N33 T;  4LF7 T;  1N32 T;  4NXN T;  4DV5 T;  4OX9 T;  1J5E T;  4DV1 T;  4DV3 T;  4DR4 T;  1HR0 T;  3T1H T;  1HNX T;  4JI2 T;  4DR3 T;  1XNR T;  4DR5 T;  4B3T T;  1XNQ T;  4LF9 T;  4LFB T;  1HNZ T;  1XMO T;  4KHP T;  4DV4 T;  5IWA T;  4X66 T;  2UUA T;  4JI8 T;  4DUZ T;  2ZM6 T;  2VQE T;  2HHH T;  1IBM T;  2UUB T;  3OTO T;  4X64 T;  4LFC T;  4JI1 T;  4DV2 T;  1I94 T;  5LMU T;  4DUY T;  4LF8 T;  1IBL T;  1FJG T;  2UXC T;  4DR2 T;  4DV0 T;  2UU9 T;  4DR7 T;  4B3S T;  4AQY T;  4JYA T;  4JI6 T;  4JI5 T;  1N34 T;  2E5L T;  2F4V T;  4X62 T;  1XMQ T;  4B3M T;  4X65 T;  1IBK T;  5BR8 T;  4LF4 T;  1HNW T;  4K0K T;  4GKK T;  4DR1 T;  4NXM T;  4DV7 T;  4JI4 T;  4B3R T;  4DR6 T;  4JV5 T;  2VQF T;  3T1Y T;  4LF6 T;  2UXD T;  5LMN T;  4LFA T;  4DV6 T;  2UUC T;  1N36 T;  4LF5 T;  2UXB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...