1HNXT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnxT00
1XMOT 4X64T 1HNXT 1N33T 4DV1T 4JI0T 4DUYT 3T1YT 2F4VT 5LMNT 4DUZT 4DR2T 1XMQT 4B3MT 4LF7T 4DV7T 4NXMT 1N32T 4DV6T 1N36T 4DR3T 2VQFT 1J5ET 4LF4T 2UXCT 2VQET 4DV5T 1IBMT 4K0KT 1N34T 4DR6T 4YY3T 4JI5T 4B3TT 4B3RT 4KHPT 1HNZT 4X66T 1HR0T 1XNRT 4GKKT 1IBKT 1IBLT 4DV3T 4DV0T 2ZM6T 4NXNT 2UUAT 1FJGT 2UUCT 3T1HT 4AQYT 4DR4T 5LMUT 4JI8T 4X62T 4DR5T 4JI6T 4JV5T 2UXBT 4JI1T 4YHHT 4LF6T 4LFBT 4DR7T 4LF9T 4X65T 4DV2T 4JYAT 4JI2T 4LFCT 4DR1T 2UU9T 4JI3T 4LFAT 4LF5T 4OX9T 1HNWT 3OTOT 2UUBT 5IWAT 2UXDT 4JI4T 4DV4T 4B3ST 2E5LT 4JI7T 5BR8T 4GKJT 1XNQT 2HHHT 1I94T 4LF8T
chains in the Genus database with same CATH superfamily
2FUPA 1IJ6A 2V7JA 1BR4A 3PU3A 4HFDA 3NWIA 4X64T 4ZZCA 1NENA 3Q5XA 3ZC1A 4AIUA 2N1GA 1Y64B 2BG9B 4EZ4A 5IUXA 5BMVE 3V5SA 4PJNA 4TZ4C 4ZZBA 5AQFB 4WBNE 1MMDA 4EXTA 5HEJA 3T1YT 3I0OA 3ABVA 3CWZB 1T8BA 2B76A 3AVRA 5ABHA 3Q5WA 2BKOA 5CJ5A 2H3RA 1J1JA 3Q9DA 4LF7T 4A56A 3TLTA 5JQGE 4IHJE 4UF0B 2L8KA 3PJAJ 3FBZA 3HKDE 2Q9QC 4ZI3C 3UFEA 2WQYA 4NXMT 2Z6EA 3CQCB 2WMNA 2MBGA 4DV6T 3N9MA 4QH1A 4PNIA 2IC6A 3AECA 3C50A 2A9UA 3AE1A 3C98B 1HX8A 1OEDE 2A3DA 4HFEA 2VQFT 4IDOA 4TV8E 2FJDA 5AQMB 5AQIB 4P1NA 4PK6A 2JQ9A 3RYHE 3L3PA 3I9YA 2VKJA 1MIYA 1VOMA 1LKXA 2VQET 3LBXA 2X67A 4Z90A 2WWVA 1UX5A 3DP7A 3ZKRA 4CXWA 4AQGA 4XZCA 2XJ7A 1X9BA 3N5LA 3A5XA 4YTNA 4I50E 2XQ3A 3O1JA 4K0KT 3E22E 2CRBA 4EZHA 4DR6T 2BG9E 2X0HA 2A72A 2LRLA 2XHEB 3PUGA 4YY3T 2ODVA 3K3OA 3FZHB 5A1LA 4FJOA 3F31A 4HWIB 4B3RT 3AXJA 1KFYA 1HNZT 4X66T 2LT3A 4JLEA 2XQ9A 2L3LA 4UXNB 1XNRT 2XAHB 5ABEA 2VL8A 5DQWA 4EEBA 5HWYA 3S4UA 3AB3B 3WAKA 2HPLA 1IBLT 2V6YB 2XSAA 3ONLC 3P4PA 1SA0E 4PAGA 4X5TA 3RLFF 5L3DB 1FJGT 2LM9A 2C5JA 3AE2A 5CGMA 4WZXA 1BR1A 2IMLA 2QVAA 2W62A 2RP4A 1B7TA 3AEBA 3HKCE 2JQHA 3KBUA 5LMUT 4CXYA 4JI8T 2PG8A 2KLQA 3WI3A 5C3JA 4DR5T 1J5WA 4UIGA 5AQTB 4IIJE 1FMVA 3RGLA 2UXBT 2MYSA 2X0YA 4LFBT 5F8PA 4AI6A 4TX5A 3KBTA 4ERRA 4YSXA 2JQQA 4NPPA 4U33A 3RX6A 3ZLIA 2NTYA 3AE3A 4IE7A 4G2AA 1KF6A 2KXPB 2LE8A 2NW7A 4QWNB 4WBOA 1U5PA 2W00A 4QX7B 1KNZA 3LK42 4YJ3E 3OTOT 2UUBT 3AE5A 3DJBA 1UCUA 2H7OA 2X9WA 2KINB 2SPCA 1R8IA 1XZYA 2VB6A 3B57A 2LHNA 3UFGA 4YT0A 3UU4A 3ZSSA 4H63H 4QXHB 5CA0E 3U3IA 3RRWA 5ADXL 2K3WA 2CEAA 2E5VA 4KUMB 2CCQA 5J2UE 3CX6B 1US7B 3N9PA 5FNVE 2VKDA 4O4JE 3SFDA 2Y48B 1WR0A 2BKPA 3FBLA 4B3ST 5BR8T 5LYJE 2DWGA 1NEKA 2K9AA 2XASB 3AE6A 4KMCA 3ZMSB 4ZHQE 2H89A 3AE8A 5FL0A 4A5XA 4O8SA 5HYAA 2D5UA 3A8YC 3N2KE 2D9DA 2LJLA 3UU6A 2QGSA 4KX6A 2HHHT 1I94T 4LF8T 3TKLB 4UVAB 3ZN1B 5L3GB 3OYZA 1YKEB 3FZKB 1MMNA 4TV9E 2WU2A 1ZP0A 1E7PA 2KSRA 1D1BA 4IDQA 4ZXLA 4C91A 1FEWA 4U2YA 5ABGA 4JV5T 2VL0A 3RKGA 1O3XA 3ZCIA 3ZJ2A 1HNXT 2LEHA 3L39A 4JI1T 4HFVA 4A97A 5AQRB 1G8XA 3LBXB 4EOZB 2IDOB 2JRKA 3ETUA 5LBMA 2JMHA 2E9XB 2ZM2A 3AAIA 4PFOA 4WW0A 5LCYA 3EABA 5LOVE 4AKGA 1Z0PA 4TWHA 2DHRA 5LMNT 4C90A 1V9DA 2KWIB 1XMQT 4HFIA 3EDVA 4BJNA 1OWAA 3CQGB 1NWMX 3L8RA 2LKHA 4LMKA 3UU8A 2W63A 1HG5A 3KINB 2JJ9A 2LSKA 3N2OA 4H9QC 5JH7E 3C4WA 4WYVA 4DV7T 4ASKA 2J1DG 5FXZA 5LHIB 3C64A 2YDQA 3EAMA 1N36T 2K24A 1DU2A 4L5GA 3NRXA 5IHYA 3NRYA 5F3JA 4TNWA 3LK2B 2BDEA 1UURA 5FKYA 2WCAA 1ZOYA 1GQEA 3RI5A 1FIOA 4DMWA 2H7VC 4HEAA 4IDPA 5L3EB 4LF4T 3PU8A 4H9RC 5FXXA 5LJMA 2CHNA 2EHOD 1I6ZA 3UULA 4ZEYA 3DTOA 2ZMAA 3EUHA 2AXDS 4MLKA 4BJMA 3VKGA 3P8CD 4LF9T 3HR0A 1U4QA 2LSIA 2UXXB 3ZPOA 3I1AA 2YEVC 3QOFA 3N9OA 3PUVF 5CA1E 3N2GE 1OEDC 1FMWA 3PUQA 4AQFA 4CI2B 4CZZB 2WP9A 3JAFA 5LA6E 3ANWB 5E0OA 2I59A 5HXCA 4YTMA 3FHNA 4EGWA 5J0ZA 2IAKA 4LF6T 4AQYT 1OEDB 2RPAA 1ZKEA 1OEDA 3ESLA 3PDYA 4IDZA 4IREA 4P0AA 2B1EA 3OJAA 1E2AA 3ETVA 2E2AA 2YINA 5J2TE 1X79A 2WDRA 3RPUA 3ZCJA 4KHPT 3ONJA 2OA5A 3W15B 3ZN0B 4HFCA 4CI1B 2EHOC 1HR0T 4GKKT 2XPKA 3FZMB 4ISTA 4K0UA 2BG9C 3UTKA 5JRCB 2CMRA 2CWOA 2LSYA 3Q2MA 4IL9A 2WMOA 3AE7A 3NVOA 2V26A 5JVDE 2W4XA 5FL1A 4DV0T 4Z91A 2ZM6T 3V5UA 1M7KA 4NXNT 2KT9A 2FBWA 3TLSA 2UUAT 2BG9A 3ZJ1A 1KK7A 3FZLB 3KDSE 4IE5A 3T1HT 2JIWA 1WRDA 4DR4T 3X1DA 5AQQB 3ZMVB 5KDMC 4QH4A 3RHWA 3MKDA 3UQ4A 3AE4A 2AE9A 4X62T 3R6NA 1HCIA 1W09A 2P9BA 2JQKA 4O4HE 2DWKA 3A7MA 3FZFB 4HFBA 3NBXX 2XM2A 2BS3A 4PJJA 3ZSTA 5C2TA 2JMKA 3UT5E 3K3NA 4X1YE 3PJAA 4DNDA 1YQ4A 2E8IA 2QRXA 4AISA 4UV9B 5KMGP 5AQNB 3AA0B 2JPFA 2CBJA 2NW9A 2PJQA 4I55E 5HEHA 2CM0A 1YD8G 2LKGA 3C4XA 3H3AA 3ONXA 4IE4A 3JCFA 3VU7H 1XDPA 4O2AE 4YXDA 2Q9QD 3N9QA 5HAXA 4DVDA 4AKRB 4ZI3D 4DR1T 4QXCB 4LFAT 3N9NA 1AJ3A 1Y01A 2VKHA 2XSBA 3ANWA 4X1IE 4OX9T 3P50A 1HF8A 3PV0F 4YFSA 2WB5A 3RKOA 1D0YA 3IA3A 3VR9A 3U78A 3J9X1 4OYJA 4HGAA 5JR9B 2E9XA 2DNXA 4H9SE 4U7IA 4X1KE 2CXFA 1CHUA 1HX1B 3HI2A 4GOUA 5AQUB 1D1CA 3AVSA 4HWDA 1D0XA 3OBVE 2E5LT 4KBMB 2YU1A 4JI7T 4ZI2D 3VHLA 3AA6B 4YLHA 1KEYA 1XDOA 3BQKA 2ZLYA 3I9WA 4P0BA 4BAYB 3CX8B 2CHOA 2WAUA 2X9HA 4ISSA 4EAHA 3IHRA 1W9RA 4JEHB 2XAJB 3HKEE 3K1SA 5F5WA 5AQKB 2I0MA 3P7IA 4HWCA 4HE8A 4L9IA 4UELA 3LFMA 4Z8XA 5LNKA 2WZHA 2J4GA 2XQ8A 1VCSA 2HH7A 1KNPA 4PK4A 2ZM0A 3K8PC 4ILCA 4DIDB 4H63V 3RF1A 1KNRA 3AEFA 3KVAA 4ADZA 3UU5A 5JDLA 1J5ET 1JNZA 3GN5A 3JADA 4M1PA 2VVNA 4AQFC 1E1HB 2ES0A 2YKSA 1QLBA 2MAWA 3MK7C 4GYSA 4WNKA 5AQSB 2W66A 3CK6A 4TWFA 5L47A 2KWHA 1W0BA 4GK0E 5ABFA 1MIWA 1MNDA 1W0AA 3E0ZA 4DUZT 4X20E 2F4VT 3QUJA 1QUUA 3NZPA 3TLVA 3WAJA 1UGOA 2YU2A 2BVLA 3C51A 2WSSV 5JDNA 1WYCA 3PE0A 3GA8A 2XQ6A 1UX4A 2CPTA 1LVKA 2V8SV 4O4LE 2X9XA 3MACA 3PUYF 4FI5A 2K48A 3M3ZB 3UUXB 4ZI7E 5LP6E 3O9XA 2MPKA 2G0UA 2N2NA 3R84B 3O1IA 1JNRA 4UV8B 3VRBA 2LHRA 2ZM8A 3QC9A 3CKDA 3UQ7A 3SOLA 4E7ZA 4H9OC 3LJCA 5HXSA 2K5BB 4I4TE 3RRCA 1HS7A 2H88A 2DLRA 2UXCT 4LMJA 2QA7A 2V5DA 3AA1B 4CQIA 5JR9A 4DV5T 3JAEA 2VURA 3PUZF 3H3MA 3UU3A 2I6HA 3CMLA 4PFPA 1N34T 3RC8A 3KV9A 3H37A 4ILAA 1G73A 2LSJA 3P4SA 3I0QA 3QB5K 3BQIA 5LJNA 4J2CA 5LHGB 2BKNA 5GONE 3C4ZA 2CXLA 3MA9A 4MBQA 4O4IE 3J7Yq 4Q25A 1WYBA 2V7MA 2PTFA 1OXZA 3RYCE 4EB6E 5HWXA 2CLYC 5FXVA 1BR2A 5HXEA 3ZMZB 1IBKT 5LG4A 2OV9A 4TNVA 5H6QB 3ZEFB 2QYWA 2A2FX 4UVCB 4L0RA 2UXNB 2J47A 2NP9A 3GMIA 4UR9A 3EHZA 2XAQB 4KHZF 2PFVA 2BBHA 2HN1A 3RC3A 5FXWA 1HG2A 5AQHB 2UUCT 4DBQA 2NR4A 3KFWX 4V1Av 4COFA 5L3BB 4EYYR 1XWMA 4DO0A 2VK9A 4CXXA 5ABFB 5HEGA 4JI6T 1WCRA 4QKNA 3QNUA 3RYIE 5JRCA 4UEMA 2V6YA 3MZKB 3EI0A 4ZS2A 4CI3B 4PK5A 2XQYA 5JDFA 4EYUA 5JTGA 4OFZA 2XAFB 2D2SA 3G06A 3TLWA 2LLYA 3OPCA 4EEDA 4HWFA 2Y8DA 4YHHT 4DR7T 5JDGA 4X65T 3AXJB 2NOXA 2BS4A 2W61A 2X0LB 4LFCT 2FJEA 3NZQA 4AKLA 2L9QA 3M65A 4B6XA 3IEEA 4CN1A 3SRZA 2UU9T 2V5CA 4JI3T 4GIWA 3LDQB 3RQUA 4LF5T 1SHZC 3AA7B 3ZT5A 1HNWT 3RIFA 3AE9A 1T98A 3GN5B 1ZV4X 2WDQA 3PTRB 1ZEEA 2UXDT 4CN6A 3AAAB 4YJ2E 3F57A 2C0SA 5HCMA 4AKIA 5JDHA 5KXJA 1ZHCA 2CXDA 3PUSA 2WS3A 2Y6XA 3OYXA 3ZC0A 2YN6A 1EZ3A 2IIUA 4BA9A 5AFUL 3SWHA 1XNQT 3E08A 4GKJT 1H7CA 1WR6A 2WWUA 3AAEB 3EDUA 1MMAA 1MMGA 3GWHA 4GK5E 4TWDA 3SFEA 4OK0A 3VR8A 2CBIA 4U31A 4A98A 2NTXA 2XQ4A 5FMNA 3ZYMA 3L09A 3MXZA 5EZYE 5LBQB 5FY7A 3OVUA 2CWYA 4ILUA 1XMOT 2CE7A 3O4XE 5LHHB 4JBWF 2V1DB 5DJQC 3ZMTB 4GYRA 4PW8A 4KP3C 4NIQA 3LSVA 2N9DA 3N9LA 3P4RA 4ZS3A 5J1GA 1T7SA 1N33T 4IE6A 1M62A 4DV1T 2WBLA 3RYFE 5EK4A 4JI0T 4QHOA 4DUYT 4CN4A 3BK9A 3AEEA 4ILBA 1YKHB 5IYZE 4ANJA 4DR2T 2LRKA 1WLXA 2IHR1 3Q5EA 2NWBA 4HKAA 4N78D 2E9XC 2VVSA 4B3MT 3JC6D 1MIVA 3O1HA 2IW5B 2YDRA 1MNEA 4IGUA 5HEOA 3UUBA 1UK5A 2X66A 4YTPA 5FYMA 1VRBA 2J62A 2LM2A 5HEUA 5AQVB 2V7IA 3ZMUB 2WU5A 1IZNB 5LGUB 1N32T 5TAOA 5FVKA 2W0GA 5AQLB 5ETWA 4DR3T 3RIUA 4O2BE 5HCJA 5LG3A 3FXDB 3CX7B 4G63A 2XUEA 5L4EA 2OLTA 2BS2A 3OKQA 4PJLA 1Z8UA 4HTEA 5JR9C 2C5IT 3HKBE 4YHJA 2W67A 3PUXF 2WY2A 3AEAA 4TN7B 3RIUC 2HPJA 4JUYA 4YSZA 2R6GF 2VWAA 2VASA 3EVYA 2V6XA 4QX8B 5CFBA 3JC6C 5JDQA 3VKHA 4KI0F 1D0ZA 2D0UA 4ZI2C 2XQ7A 1IBMT 3LG7A 4AXPA 3IF8B 4HFHA 1S94A 2MOZA 3CPZA 3Q5DA 4PJMA 3RH3A 2BZBA 2M67A 1QSDA 5H6RB 3SS1A 1WFDA 2C5KT 3B13A 3T8OA 3BQLA 3LK3B 4QXBB 4U7YA 5CB4E 2KMFA 2DCFA 2XZEA 2XQ5A 2PBIA 4MFRA 2EHOA 2EHOB 3CIRA 4JI5T 2X9YA 4B3TT 1VCTA 1SUMB 3FB2A 1HTJF 4MHCA 5HXRA 2ACZA 2D0TA 3VRAA 1NAFA 2VKOA 2DL1A 3P4QA 2XTLA 3PUAA 5EK3A 2V7KA 5L3FB 2IC9A 2XQAA 2RA1A 2M6IA 5HXHA 3PURA 5L3CB 2MTQA 3AEDA 4OHFA 4DV3T 3QB5A 2KZ7B 2ODUA 2XY8B 5LXTE 3K3QC 2M6BA 2WM9A 4NUVA 4XAXB 5L4HA 4UVBB 3ZT7A 5AQOB 2GK9A 2W2UA 1YQ3A 4HN9A 4IDNA 4JEUB 4U2ZA 5FVLA 3AEGA 4U3CA 3HL6A 4H9PC 5FY1A 2CA5A 1YW0A 3B5MA 3KV4A 4HWHA 2Q9QB 4OYKA 2IUBA 2LOPA 4U72A 5AQGB 1UUSA 2YDSA 5DABA 3QK6A 2WZIA 4UF0A 3UUNA 3HA4A 5FP3A 4I43B 3F2EA 4DBRA 2FJBA 3MJXA 4IT4A 5AQJB 4NUUA 1T72A 5LB7B 4DMVA 3CQXC 3KVBA 2E9XD 2KNDA 4TUYE 5DQVA 4QH5A 1SE7A 4MALA 3ZYLA 3PUWF 4JI2T 3FXEB 3KV6A 4DV2T 4JYAT 2XAGB 5IWAT 3ZT6A 5EK2A 1IJ5A 2X68A 2BBJA 2YOEA 3RIAA 2WDVA 5KX5E 3UUMA 1D1AA 4EIWA 2HN2A 1LVFA 4E7SA 5JREA 4AKHA 4IE0A 4IL4A 5LGTB 2LSGA 3IBPA 1BR0A 1IAPA 2NW8A 4I0UA 4F6RC 4ZOLE 1CUNA 2DI4A 4U74A 4YSYA 4JI4T 1S35A 3NKZA 3RQWA 2BVMA 2Q9QA 2V7LA 4H9NC 4P09A 5FY0A 4F8HA 5M4YA 5L2LA 4DV4T 3CVRA 1YXRA 2FJAA 4EV6A 2YK0A 3KV5A 5LGNB 4XBFB 1LRZA 3ZYKA 3TLUA 1HFAA 2CLYB 2X51A 2LOSA 5JDMA 4LMLA 1L0VA 3P4WA 3D0TA 2XM1A 2ACXA 5C8YE 5AQPB
chains in the Genus database with same CATH topology
1XMOT 4X64T 1HNXT 1N33T 4DV1T 4JI0T 4DUYT 3T1YT 2F4VT 5LMNT 4DUZT 4DR2T 1XMQT 4B3MT 4LF7T 4DV7T 4NXMT 1N32T 4DV6T 1N36T 4DR3T 2VQFT 1J5ET 4LF4T 2UXCT 2VQET 4DV5T 1IBMT 4K0KT 1N34T 4DR6T 4YY3T 4JI5T 4B3TT 4B3RT 4KHPT 1HNZT 4X66T 1HR0T 1XNRT 4GKKT 1IBKT 1IBLT 4DV3T 4DV0T 2ZM6T 4NXNT 2UUAT 1FJGT 2UUCT 3T1HT 4AQYT 4DR4T 5LMUT 4JI8T 4X62T 4DR5T 4JI6T 4JV5T 2UXBT 4JI1T 4YHHT 4LF6T 4LFBT 4DR7T 4LF9T 4X65T 4DV2T 4JYAT 4JI2T 4LFCT 4DR1T 2UU9T 4JI3T 4LFAT 4LF5T 4OX9T 1HNWT 3OTOT 2UUBT 5IWAT 2UXDT 4JI4T 4DV4T 4B3ST 2E5LT 4JI7T 5BR8T 4GKJT 1XNQT 2HHHT 1I94T 4LF8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO T;  4X64 T;  1HNX T;  1N33 T;  4DV1 T;  4JI0 T;  4DUY T;  3T1Y T;  2F4V T;  5LMN T;  4DUZ T;  4DR2 T;  1XMQ T;  4B3M T;  4LF7 T;  4DV7 T;  4NXM T;  1N32 T;  4DV6 T;  1N36 T;  4DR3 T;  2VQF T;  1J5E T;  4LF4 T;  2UXC T;  2VQE T;  4DV5 T;  1IBM T;  4K0K T;  1N34 T;  4DR6 T;  4YY3 T;  4JI5 T;  4B3T T;  4B3R T;  4KHP T;  1HNZ T;  4X66 T;  1HR0 T;  1XNR T;  4GKK T;  1IBK T;  1IBL T;  4DV3 T;  4DV0 T;  2ZM6 T;  4NXN T;  2UUA T;  1FJG T;  2UUC T;  3T1H T;  4AQY T;  4DR4 T;  5LMU T;  4JI8 T;  4X62 T;  4DR5 T;  4JI6 T;  4JV5 T;  2UXB T;  4JI1 T;  4YHH T;  4LF6 T;  4LFB T;  4DR7 T;  4LF9 T;  4X65 T;  4DV2 T;  4JYA T;  4JI2 T;  4LFC T;  4DR1 T;  2UU9 T;  4JI3 T;  4LFA T;  4LF5 T;  4OX9 T;  1HNW T;  3OTO T;  2UUB T;  5IWA T;  2UXD T;  4JI4 T;  4DV4 T;  4B3S T;  2E5L T;  4JI7 T;  5BR8 T;  4GKJ T;  1XNQ T;  2HHH T;  1I94 T;  4LF8 T; 
#chains in the Genus database with same CATH topology
 2FUP A;  1IJ6 A;  2V7J A;  1BR4 A;  3PU3 A;  4HFD A;  3NWI A;  4X64 T;  4ZZC A;  1NEN A;  3Q5X A;  3ZC1 A;  4AIU A;  2N1G A;  1Y64 B;  2BG9 B;  4EZ4 A;  5IUX A;  5BMV E;  3V5S A;  4PJN A;  4TZ4 C;  4ZZB A;  5AQF B;  4WBN E;  1MMD A;  4EXT A;  5HEJ A;  3T1Y T;  3I0O A;  3ABV A;  3CWZ B;  1T8B A;  2B76 A;  3AVR A;  5ABH A;  3Q5W A;  2BKO A;  5CJ5 A;  2H3R A;  1J1J A;  3Q9D A;  4LF7 T;  4A56 A;  3TLT A;  5JQG E;  4IHJ E;  4UF0 B;  2L8K A;  3PJA J;  3FBZ A;  3HKD E;  2Q9Q C;  4ZI3 C;  3UFE A;  2WQY A;  4NXM T;  2Z6E A;  3CQC B;  2WMN A;  2MBG A;  4DV6 T;  3N9M A;  4QH1 A;  4PNI A;  2IC6 A;  3AEC A;  3C50 A;  2A9U A;  3AE1 A;  3C98 B;  1HX8 A;  1OED E;  2A3D A;  4HFE A;  2VQF T;  4IDO A;  4TV8 E;  2FJD A;  5AQM B;  5AQI B;  4P1N A;  4PK6 A;  2JQ9 A;  3RYH E;  3L3P A;  3I9Y A;  2VKJ A;  1MIY A;  1VOM A;  1LKX A;  2VQE T;  3LBX A;  2X67 A;  4Z90 A;  2WWV A;  1UX5 A;  3DP7 A;  3ZKR A;  4CXW A;  4AQG A;  4XZC A;  2XJ7 A;  1X9B A;  3N5L A;  3A5X A;  4YTN A;  4I50 E;  2XQ3 A;  3O1J A;  4K0K T;  3E22 E;  2CRB A;  4EZH A;  4DR6 T;  2BG9 E;  2X0H A;  2A72 A;  2LRL A;  2XHE B;  3PUG A;  4YY3 T;  2ODV A;  3K3O A;  3FZH B;  5A1L A;  4FJO A;  3F31 A;  4HWI B;  4B3R T;  3AXJ A;  1KFY A;  1HNZ T;  4X66 T;  2LT3 A;  4JLE A;  2XQ9 A;  2L3L A;  4UXN B;  1XNR T;  2XAH B;  5ABE A;  2VL8 A;  5DQW A;  4EEB A;  5HWY A;  3S4U A;  3AB3 B;  3WAK A;  2HPL A;  1IBL T;  2V6Y B;  2XSA A;  3ONL C;  3P4P A;  1SA0 E;  4PAG A;  4X5T A;  3RLF F;  5L3D B;  1FJG T;  2LM9 A;  2C5J A;  3AE2 A;  5CGM A;  4WZX A;  1BR1 A;  2IML A;  2QVA A;  2W62 A;  2RP4 A;  1B7T A;  3AEB A;  3HKC E;  2JQH A;  3KBU A;  5LMU T;  4CXY A;  4JI8 T;  2PG8 A;  2KLQ A;  3WI3 A;  5C3J A;  4DR5 T;  1J5W A;  4UIG A;  5AQT B;  4IIJ E;  1FMV A;  3RGL A;  2UXB T;  2MYS A;  2X0Y A;  4LFB T;  5F8P A;  4AI6 A;  4TX5 A;  3KBT A;  4ERR A;  4YSX A;  2JQQ A;  4NPP A;  4U33 A;  3RX6 A;  3ZLI A;  2NTY A;  3AE3 A;  4IE7 A;  4G2A A;  1KF6 A;  2KXP B;  2LE8 A;  2NW7 A;  4QWN B;  4WBO A;  1U5P A;  2W00 A;  4QX7 B;  1KNZ A;  3LK4 2;  4YJ3 E;  3OTO T;  2UUB T;  3AE5 A;  3DJB A;  1UCU A;  2H7O A;  2X9W A;  2KIN B;  2SPC A;  1R8I A;  1XZY A;  2VB6 A;  3B57 A;  2LHN A;  3UFG A;  4YT0 A;  3UU4 A;  3ZSS A;  4H63 H;  4QXH B;  5CA0 E;  3U3I A;  3RRW A;  5ADX L;  2K3W A;  2CEA A;  2E5V A;  4KUM B;  2CCQ A;  5J2U E;  3CX6 B;  1US7 B;  3N9P A;  5FNV E;  2VKD A;  4O4J E;  3SFD A;  2Y48 B;  1WR0 A;  2BKP A;  3FBL A;  4B3S T;  5BR8 T;  5LYJ E;  2DWG A;  1NEK A;  2K9A A;  2XAS B;  3AE6 A;  4KMC A;  3ZMS B;  4ZHQ E;  2H89 A;  3AE8 A;  5FL0 A;  4A5X A;  4O8S A;  5HYA A;  2D5U A;  3A8Y C;  3N2K E;  2D9D A;  2LJL A;  3UU6 A;  2QGS A;  4KX6 A;  2HHH T;  1I94 T;  4LF8 T;  3TKL B;  4UVA B;  3ZN1 B;  5L3G B;  3OYZ A;  1YKE B;  3FZK B;  1MMN A;  4TV9 E;  2WU2 A;  1ZP0 A;  1E7P A;  2KSR A;  1D1B A;  4IDQ A;  4ZXL A;  4C91 A;  1FEW A;  4U2Y A;  5ABG A;  4JV5 T;  2VL0 A;  3RKG A;  1O3X A;  3ZCI A;  3ZJ2 A;  1HNX T;  2LEH A;  3L39 A;  4JI1 T;  4HFV A;  4A97 A;  5AQR B;  1G8X A;  3LBX B;  4EOZ B;  2IDO B;  2JRK A;  3ETU A;  5LBM A;  2JMH A;  2E9X B;  2ZM2 A;  3AAI A;  4PFO A;  4WW0 A;  5LCY A;  3EAB A;  5LOV E;  4AKG A;  1Z0P A;  4TWH A;  2DHR A;  5LMN T;  4C90 A;  1V9D A;  2KWI B;  1XMQ T;  4HFI A;  3EDV A;  4BJN A;  1OWA A;  3CQG B;  1NWM X;  3L8R A;  2LKH A;  4LMK A;  3UU8 A;  2W63 A;  1HG5 A;  3KIN B;  2JJ9 A;  2LSK A;  3N2O A;  4H9Q C;  5JH7 E;  3C4W A;  4WYV A;  4DV7 T;  4ASK A;  2J1D G;  5FXZ A;  5LHI B;  3C64 A;  2YDQ A;  3EAM A;  1N36 T;  2K24 A;  1DU2 A;  4L5G A;  3NRX A;  5IHY A;  3NRY A;  5F3J A;  4TNW A;  3LK2 B;  2BDE A;  1UUR A;  5FKY A;  2WCA A;  1ZOY A;  1GQE A;  3RI5 A;  1FIO A;  4DMW A;  2H7V C;  4HEA A;  4IDP A;  5L3E B;  4LF4 T;  3PU8 A;  4H9R C;  5FXX A;  5LJM A;  2CHN A;  2EHO D;  1I6Z A;  3UUL A;  4ZEY A;  3DTO A;  2ZMA A;  3EUH A;  2AXD S;  4MLK A;  4BJM A;  3VKG A;  3P8C D;  4LF9 T;  3HR0 A;  1U4Q A;  2LSI A;  2UXX B;  3ZPO A;  3I1A A;  2YEV C;  3QOF A;  3N9O A;  3PUV F;  5CA1 E;  3N2G E;  1OED C;  1FMW A;  3PUQ A;  4AQF A;  4CI2 B;  4CZZ B;  2WP9 A;  3JAF A;  5LA6 E;  3ANW B;  5E0O A;  2I59 A;  5HXC A;  4YTM A;  3FHN A;  4EGW A;  5J0Z A;  2IAK A;  4LF6 T;  4AQY T;  1OED B;  2RPA A;  1ZKE A;  1OED A;  3ESL A;  3PDY A;  4IDZ A;  4IRE A;  4P0A A;  2B1E A;  3OJA A;  1E2A A;  3ETV A;  2E2A A;  2YIN A;  5J2T E;  1X79 A;  2WDR A;  3RPU A;  3ZCJ A;  4KHP T;  3ONJ A;  2OA5 A;  3W15 B;  3ZN0 B;  4HFC A;  4CI1 B;  2EHO C;  1HR0 T;  4GKK T;  2XPK A;  3FZM B;  4IST A;  4K0U A;  2BG9 C;  3UTK A;  5JRC B;  2CMR A;  2CWO A;  2LSY A;  3Q2M A;  4IL9 A;  2WMO A;  3AE7 A;  3NVO A;  2V26 A;  5JVD E;  2W4X A;  5FL1 A;  4DV0 T;  4Z91 A;  2ZM6 T;  3V5U A;  1M7K A;  4NXN T;  2KT9 A;  2FBW A;  3TLS A;  2UUA T;  2BG9 A;  3ZJ1 A;  1KK7 A;  3FZL B;  3KDS E;  4IE5 A;  3T1H T;  2JIW A;  1WRD A;  4DR4 T;  3X1D A;  5AQQ B;  3ZMV B;  5KDM C;  4QH4 A;  3RHW A;  3MKD A;  3UQ4 A;  3AE4 A;  2AE9 A;  4X62 T;  3R6N A;  1HCI A;  1W09 A;  2P9B A;  2JQK A;  4O4H E;  2DWK A;  3A7M A;  3FZF B;  4HFB A;  3NBX X;  2XM2 A;  2BS3 A;  4PJJ A;  3ZST A;  5C2T A;  2JMK A;  3UT5 E;  3K3N A;  4X1Y E;  3PJA A;  4DND A;  1YQ4 A;  2E8I A;  2QRX A;  4AIS A;  4UV9 B;  5KMG P;  5AQN B;  3AA0 B;  2JPF A;  2CBJ A;  2NW9 A;  2PJQ A;  4I55 E;  5HEH A;  2CM0 A;  1YD8 G;  2LKG A;  3C4X A;  3H3A A;  3ONX A;  4IE4 A;  3JCF A;  3VU7 H;  1XDP A;  4O2A E;  4YXD A;  2Q9Q D;  3N9Q A;  5HAX A;  4DVD A;  4AKR B;  4ZI3 D;  4DR1 T;  4QXC B;  4LFA T;  3N9N A;  1AJ3 A;  1Y01 A;  2VKH A;  2XSB A;  3ANW A;  4X1I E;  4OX9 T;  3P50 A;  1HF8 A;  3PV0 F;  4YFS A;  2WB5 A;  3RKO A;  1D0Y A;  3IA3 A;  3VR9 A;  3U78 A;  3J9X 1;  4OYJ A;  4HGA A;  5JR9 B;  2E9X A;  2DNX A;  4H9S E;  4U7I A;  4X1K E;  2CXF A;  1CHU A;  1HX1 B;  3HI2 A;  4GOU A;  5AQU B;  1D1C A;  3AVS A;  4HWD A;  1D0X A;  3OBV E;  2E5L T;  4KBM B;  2YU1 A;  4JI7 T;  4ZI2 D;  3VHL A;  3AA6 B;  4YLH A;  1KEY A;  1XDO A;  3BQK A;  2ZLY A;  3I9W A;  4P0B A;  4BAY B;  3CX8 B;  2CHO A;  2WAU A;  2X9H A;  4ISS A;  4EAH A;  3IHR A;  1W9R A;  4JEH B;  2XAJ B;  3HKE E;  3K1S A;  5F5W A;  5AQK B;  2I0M A;  3P7I A;  4HWC A;  4HE8 A;  4L9I A;  4UEL A;  3LFM A;  4Z8X A;  5LNK A;  2WZH A;  2J4G A;  2XQ8 A;  1VCS A;  2HH7 A;  1KNP A;  4PK4 A;  2ZM0 A;  3K8P C;  4ILC A;  4DID B;  4H63 V;  3RF1 A;  1KNR A;  3AEF A;  3KVA A;  4ADZ A;  3UU5 A;  5JDL A;  1J5E T;  1JNZ A;  3GN5 A;  3JAD A;  4M1P A;  2VVN A;  4AQF C;  1E1H B;  2ES0 A;  2YKS A;  1QLB A;  2MAW A;  3MK7 C;  4GYS A;  4WNK A;  5AQS B;  2W66 A;  3CK6 A;  4TWF A;  5L47 A;  2KWH A;  1W0B A;  4GK0 E;  5ABF A;  1MIW A;  1MND A;  1W0A A;  3E0Z A;  4DUZ T;  4X20 E;  2F4V T;  3QUJ A;  1QUU A;  3NZP A;  3TLV A;  3WAJ A;  1UGO A;  2YU2 A;  2BVL A;  3C51 A;  2WSS V;  5JDN A;  1WYC A;  3PE0 A;  3GA8 A;  2XQ6 A;  1UX4 A;  2CPT A;  1LVK A;  2V8S V;  4O4L E;  2X9X A;  3MAC A;  3PUY F;  4FI5 A;  2K48 A;  3M3Z B;  3UUX B;  4ZI7 E;  5LP6 E;  3O9X A;  2MPK A;  2G0U A;  2N2N A;  3R84 B;  3O1I A;  1JNR A;  4UV8 B;  3VRB A;  2LHR A;  2ZM8 A;  3QC9 A;  3CKD A;  3UQ7 A;  3SOL A;  4E7Z A;  4H9O C;  3LJC A;  5HXS A;  2K5B B;  4I4T E;  3RRC A;  1HS7 A;  2H88 A;  2DLR A;  2UXC T;  4LMJ A;  2QA7 A;  2V5D A;  3AA1 B;  4CQI A;  5JR9 A;  4DV5 T;  3JAE A;  2VUR A;  3PUZ F;  3H3M A;  3UU3 A;  2I6H A;  3CML A;  4PFP A;  1N34 T;  3RC8 A;  3KV9 A;  3H37 A;  4ILA A;  1G73 A;  2LSJ A;  3P4S A;  3I0Q A;  3QB5 K;  3BQI A;  5LJN A;  4J2C A;  5LHG B;  2BKN A;  5GON E;  3C4Z A;  2CXL A;  3MA9 A;  4MBQ A;  4O4I E;  3J7Y q;  4Q25 A;  1WYB A;  2V7M A;  2PTF A;  1OXZ A;  3RYC E;  4EB6 E;  5HWX A;  2CLY C;  5FXV A;  1BR2 A;  5HXE A;  3ZMZ B;  1IBK T;  5LG4 A;  2OV9 A;  4TNV A;  5H6Q B;  3ZEF B;  2QYW A;  2A2F X;  4UVC B;  4L0R A;  2UXN B;  2J47 A;  2NP9 A;  3GMI A;  4UR9 A;  3EHZ A;  2XAQ B;  4KHZ F;  2PFV A;  2BBH A;  2HN1 A;  3RC3 A;  5FXW A;  1HG2 A;  5AQH B;  2UUC T;  4DBQ A;  2NR4 A;  3KFW X;  4V1A v;  4COF A;  5L3B B;  4EYY R;  1XWM A;  4DO0 A;  2VK9 A;  4CXX A;  5ABF B;  5HEG A;  4JI6 T;  1WCR A;  4QKN A;  3QNU A;  3RYI E;  5JRC A;  4UEM A;  2V6Y A;  3MZK B;  3EI0 A;  4ZS2 A;  4CI3 B;  4PK5 A;  2XQY A;  5JDF A;  4EYU A;  5JTG A;  4OFZ A;  2XAF B;  2D2S A;  3G06 A;  3TLW A;  2LLY A;  3OPC A;  4EED A;  4HWF A;  2Y8D A;  4YHH T;  4DR7 T;  5JDG A;  4X65 T;  3AXJ B;  2NOX A;  2BS4 A;  2W61 A;  2X0L B;  4LFC T;  2FJE A;  3NZQ A;  4AKL A;  2L9Q A;  3M65 A;  4B6X A;  3IEE A;  4CN1 A;  3SRZ A;  2UU9 T;  2V5C A;  4JI3 T;  4GIW A;  3LDQ B;  3RQU A;  4LF5 T;  1SHZ C;  3AA7 B;  3ZT5 A;  1HNW T;  3RIF A;  3AE9 A;  1T98 A;  3GN5 B;  1ZV4 X;  2WDQ A;  3PTR B;  1ZEE A;  2UXD T;  4CN6 A;  3AAA B;  4YJ2 E;  3F57 A;  2C0S A;  5HCM A;  4AKI A;  5JDH A;  5KXJ A;  1ZHC A;  2CXD A;  3PUS A;  2WS3 A;  2Y6X A;  3OYX A;  3ZC0 A;  2YN6 A;  1EZ3 A;  2IIU A;  4BA9 A;  5AFU L;  3SWH A;  1XNQ T;  3E08 A;  4GKJ T;  1H7C A;  1WR6 A;  2WWU A;  3AAE B;  3EDU A;  1MMA A;  1MMG A;  3GWH A;  4GK5 E;  4TWD A;  3SFE A;  4OK0 A;  3VR8 A;  2CBI A;  4U31 A;  4A98 A;  2NTX A;  2XQ4 A;  5FMN A;  3ZYM A;  3L09 A;  3MXZ A;  5EZY E;  5LBQ B;  5FY7 A;  3OVU A;  2CWY A;  4ILU A;  1XMO T;  2CE7 A;  3O4X E;  5LHH B;  4JBW F;  2V1D B;  5DJQ C;  3ZMT B;  4GYR A;  4PW8 A;  4KP3 C;  4NIQ A;  3LSV A;  2N9D A;  3N9L A;  3P4R A;  4ZS3 A;  5J1G A;  1T7S A;  1N33 T;  4IE6 A;  1M62 A;  4DV1 T;  2WBL A;  3RYF E;  5EK4 A;  4JI0 T;  4QHO A;  4DUY T;  4CN4 A;  3BK9 A;  3AEE A;  4ILB A;  1YKH B;  5IYZ E;  4ANJ A;  4DR2 T;  2LRK A;  1WLX A;  2IHR 1;  3Q5E A;  2NWB A;  4HKA A;  4N78 D;  2E9X C;  2VVS A;  4B3M T;  3JC6 D;  1MIV A;  3O1H A;  2IW5 B;  2YDR A;  1MNE A;  4IGU A;  5HEO A;  3UUB A;  1UK5 A;  2X66 A;  4YTP A;  5FYM A;  1VRB A;  2J62 A;  2LM2 A;  5HEU A;  5AQV B;  2V7I A;  3ZMU B;  2WU5 A;  1IZN B;  5LGU B;  1N32 T;  5TAO A;  5FVK A;  2W0G A;  5AQL B;  5ETW A;  4DR3 T;  3RIU A;  4O2B E;  5HCJ A;  5LG3 A;  3FXD B;  3CX7 B;  4G63 A;  2XUE A;  5L4E A;  2OLT A;  2BS2 A;  3OKQ A;  4PJL A;  1Z8U A;  4HTE A;  5JR9 C;  2C5I T;  3HKB E;  4YHJ A;  2W67 A;  3PUX F;  2WY2 A;  3AEA A;  4TN7 B;  3RIU C;  2HPJ A;  4JUY A;  4YSZ A;  2R6G F;  2VWA A;  2VAS A;  3EVY A;  2V6X A;  4QX8 B;  5CFB A;  3JC6 C;  5JDQ A;  3VKH A;  4KI0 F;  1D0Z A;  2D0U A;  4ZI2 C;  2XQ7 A;  1IBM T;  3LG7 A;  4AXP A;  3IF8 B;  4HFH A;  1S94 A;  2MOZ A;  3CPZ A;  3Q5D A;  4PJM A;  3RH3 A;  2BZB A;  2M67 A;  1QSD A;  5H6R B;  3SS1 A;  1WFD A;  2C5K T;  3B13 A;  3T8O A;  3BQL A;  3LK3 B;  4QXB B;  4U7Y A;  5CB4 E;  2KMF A;  2DCF A;  2XZE A;  2XQ5 A;  2PBI A;  4MFR A;  2EHO A;  2EHO B;  3CIR A;  4JI5 T;  2X9Y A;  4B3T T;  1VCT A;  1SUM B;  3FB2 A;  1HTJ F;  4MHC A;  5HXR A;  2ACZ A;  2D0T A;  3VRA A;  1NAF A;  2VKO A;  2DL1 A;  3P4Q A;  2XTL A;  3PUA A;  5EK3 A;  2V7K A;  5L3F B;  2IC9 A;  2XQA A;  2RA1 A;  2M6I A;  5HXH A;  3PUR A;  5L3C B;  2MTQ A;  3AED A;  4OHF A;  4DV3 T;  3QB5 A;  2KZ7 B;  2ODU A;  2XY8 B;  5LXT E;  3K3Q C;  2M6B A;  2WM9 A;  4NUV A;  4XAX B;  5L4H A;  4UVB B;  3ZT7 A;  5AQO B;  2GK9 A;  2W2U A;  1YQ3 A;  4HN9 A;  4IDN A;  4JEU B;  4U2Z A;  5FVL A;  3AEG A;  4U3C A;  3HL6 A;  4H9P C;  5FY1 A;  2CA5 A;  1YW0 A;  3B5M A;  3KV4 A;  4HWH A;  2Q9Q B;  4OYK A;  2IUB A;  2LOP A;  4U72 A;  5AQG B;  1UUS A;  2YDS A;  5DAB A;  3QK6 A;  2WZI A;  4UF0 A;  3UUN A;  3HA4 A;  5FP3 A;  4I43 B;  3F2E A;  4DBR A;  2FJB A;  3MJX A;  4IT4 A;  5AQJ B;  4NUU A;  1T72 A;  5LB7 B;  4DMV A;  3CQX C;  3KVB A;  2E9X D;  2KND A;  4TUY E;  5DQV A;  4QH5 A;  1SE7 A;  4MAL A;  3ZYL A;  3PUW F;  4JI2 T;  3FXE B;  3KV6 A;  4DV2 T;  4JYA T;  2XAG B;  5IWA T;  3ZT6 A;  5EK2 A;  1IJ5 A;  2X68 A;  2BBJ A;  2YOE A;  3RIA A;  2WDV A;  5KX5 E;  3UUM A;  1D1A A;  4EIW A;  2HN2 A;  1LVF A;  4E7S A;  5JRE A;  4AKH A;  4IE0 A;  4IL4 A;  5LGT B;  2LSG A;  3IBP A;  1BR0 A;  1IAP A;  2NW8 A;  4I0U A;  4F6R C;  4ZOL E;  1CUN A;  2DI4 A;  4U74 A;  4YSY A;  4JI4 T;  1S35 A;  3NKZ A;  3RQW A;  2BVM A;  2Q9Q A;  2V7L A;  4H9N C;  4P09 A;  5FY0 A;  4F8H A;  5M4Y A;  5L2L A;  4DV4 T;  3CVR A;  1YXR A;  2FJA A;  4EV6 A;  2YK0 A;  3KV5 A;  5LGN B;  4XBF B;  1LRZ A;  3ZYK A;  3TLU A;  1HFA A;  2CLY B;  2X51 A;  2LOS A;  5JDM A;  4LML A;  1L0V A;  3P4W A;  3D0T A;  2XM1 A;  2ACX A;  5C8Y E;  5AQP B; 
#chains in the Genus database with same CATH homology
 1XMO T;  4X64 T;  1HNX T;  1N33 T;  4DV1 T;  4JI0 T;  4DUY T;  3T1Y T;  2F4V T;  5LMN T;  4DUZ T;  4DR2 T;  1XMQ T;  4B3M T;  4LF7 T;  4DV7 T;  4NXM T;  1N32 T;  4DV6 T;  1N36 T;  4DR3 T;  2VQF T;  1J5E T;  4LF4 T;  2UXC T;  2VQE T;  4DV5 T;  1IBM T;  4K0K T;  1N34 T;  4DR6 T;  4YY3 T;  4JI5 T;  4B3T T;  4B3R T;  4KHP T;  1HNZ T;  4X66 T;  1HR0 T;  1XNR T;  4GKK T;  1IBK T;  1IBL T;  4DV3 T;  4DV0 T;  2ZM6 T;  4NXN T;  2UUA T;  1FJG T;  2UUC T;  3T1H T;  4AQY T;  4DR4 T;  5LMU T;  4JI8 T;  4X62 T;  4DR5 T;  4JI6 T;  4JV5 T;  2UXB T;  4JI1 T;  4YHH T;  4LF6 T;  4LFB T;  4DR7 T;  4LF9 T;  4X65 T;  4DV2 T;  4JYA T;  4JI2 T;  4LFC T;  4DR1 T;  2UU9 T;  4JI3 T;  4LFA T;  4LF5 T;  4OX9 T;  1HNW T;  3OTO T;  2UUB T;  5IWA T;  2UXD T;  4JI4 T;  4DV4 T;  4B3S T;  2E5L T;  4JI7 T;  5BR8 T;  4GKJ T;  1XNQ T;  2HHH T;  1I94 T;  4LF8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...