1HNXT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnxT00
4JI2T 4LFAT 4GKJT 2E5LT 4YY3T 2UXCT 2VQET 4AQYT 4JI7T 4DV4T 1HR0T 4JV5T 1XMOT 1N34T 3OTOT 1J5ET 2VQFT 4DV7T 4JYAT 4DV2T 4DV6T 4JI4T 4X62T 4JI0T 4OX9T 1I94T 4DR5T 4B3ST 1N32T 4JI5T 3T1HT 4DR7T 2UUBT 4B3MT 4DUZT 1HNWT 2UU9T 4JI6T 4B3TT 2HHHT 1XMQT 4B3RT 2F4VT 1HNXT 1N36T 4LF8T 4K0KT 4LF6T 4X64T 4DUYT 4X65T 1IBMT 2UXBT 4NXMT 3T1YT 4GKKT 4LF4T 4JI3T 4DR4T 4X66T 1IBLT 4LF7T 1N33T 5BR8T 4DV1T 4LF9T 4LFBT 1XNQT 1HNZT 4DR1T 4DV3T 4DV0T 4NXNT 4DR3T 4JI1T 5LMUT 5LMNT 1IBKT 4DR6T 1XNRT 1FJGT 2UUAT 4DV5T 4KHPT 4YHHT 2ZM6T 5IWAT 2UXDT 2UUCT 4LF5T 4LFCT 4DR2T 4JI8T
chains in the Genus database with same CATH superfamily
2PFVA 3ZN1B 4LMLA 2C0SA 4UV8B 4HFEA 2EHOA 2XAFB 2ODVA 3NKZA 3JCFA 3PUZF 2JJ9A 2EHOD 2NR4A 5LGTB 1HR0T 2BVLA 4U7YA 3AE9A 2ACXA 4JV5T 3LBXA 3TKLB 3R6NA 4LMJA 4NUUA 1VCTA 5L4HA 3AE2A 1I94T 3HL6A 2I6HA 3ZJ1A 3L3PA 5LYJE 4AI6A 1HG2A 1HS7A 3FZFB 4U72A 5LXTE 2UU9T 3NZQA 4HWHA 3ZLIA 2AE9A 4E7ZA 3RIAA 2WB5A 3AA0B 2UXBT 3P4WA 4H9RC 2CLYC 1UCUA 1BR1A 4QXBB 4UR9A 3K3NA 3RH3A 4JI1T 2KWHA 2XM1A 5LMUT 2BS4A 4QH1A 2UUAT 5FY0A 4KI0F 1D0YA 4KP3C 2XAJB 2PBIA 4XBFB 1UGOA 2JQHA 3ETUA 2WP9A 3AEDA 4DVDA 2M6IA 5ABFA 3ZSSA 3PE0A 2LRLA 5FMNA 5L3GB 1FMVA 3A5XA 5AQJB 5L2LA 4JI7T 2LE8A 2FJAA 3PJAA 4X1IE 5HWYA 3OYZA 5TAOA 2XQYA 1J5ET 4HE8A 3WAKA 1XZYA 3PTRB 2NWBA 2VL0A 4U7IA 2WAUA 2D5UA 2WDVA 3SRZA 4L5GA 2W00A 3MK7C 2H7VC 4JI5T 2YK0A 3ZCJA 3PUYF 4HGAA 3LK3B 1HNWT 2NW8A 2X0HA 4LF8T 3C50A 5LJNA 2W4XA 2BG9E 1QSDA 4O4IE 3RYFE 2BZBA 3RQWA 1G73A 4YXDA 5HCMA 3B57A 3BQIA 5IHYA 5LCYA 1X9BA 3ZYMA 3H3AA 3AAAB 4O2AE 5FNVE 5AQTB 5JDNA 3AEEA 2M6BA 3P4SA 2SPCA 3ZCIA 3FXEB 3L8RA 2UXDT 3SOLA 2VKOA 1D0XA 5C2TA 3EDUA 3O1IA 4UVBB 3SS1A 4GYSA 5DJQC 2KT9A 3CX8B 5AQVB 3C4ZA 2E5LT 1HX1B 4GOUA 3U3IA 2XY8B 3N9LA 4HFHA 2X51A 4IIJE 3FZMB 4YSZA 5HXEA 3ABVA 3TLWA 1R8IA 3TLTA 3RHWA 4HFDA 2XQ9A 2CEAA 1MIVA 3UTKA 2L3LA 2EHOC 3FZLB 4X1YE 5IUXA 3AE7A 4FI5A 3GN5B 5J1GA 4DBQA 2XQAA 3I0QA 3KVAA 4JEHB 2X67A 4UF0A 2NTXA 2CBJA 1T98A 3ONJA 2VKHA 1G8XA 3P4PA 3TLSA 4TNWA 1NEKA 4K0KT 2WWVA 4QX8B 3Q5WA 2FJDA 2LSYA 2K48A 3N5LA 4TWHA 5AFUL 3GWHA 2A3DA 3LK42 1GQEA 1I6ZA 3EAMA 3NZPA 3OVUA 2UXXB 2H88A 3NRXA 3ONLC 4NPPA 4IHJE 2XUEA 4K0UA 4WW0A 3HR0A 4ZS2A 2CPTA 2DHRA 3QC9A 1WFDA 3OYXA 2BBJA 3H3MA 1VRBA 5KX5E 3N2OA 4EGWA 1BR4A 5F3JA 1Y64B 4GYRA 5LBQB 2CXDA 3QB5A 3BQKA 3UQ4A 3LG7A 4YTMA 2MPKA 5EZYE 4QH5A 4DV4T 4IL9A 1SE7A 3PUAA 2V5DA 2XAHB 3KINB 3F2EA 3CVRA 2WU5A 4DV6T 5CJ5A 4O4HE 3RI5A 1OEDA 1NAFA 4YHJA 2DI4A 5GONE 2R6GF 4IGUA 4CI3B 4HTEA 1MNDA 4LMKA 2FBWA 4H9NC 1Y01A 3EDVA 4AKHA 2W62A 4JI6T 4HWCA 1KNPA 5LG3A 1CUNA 2F4VT 5JDGA 2X66A 2K24A 5HEHA 2FUPA 4L9IA 1YKHB 5AQOB 4NXMT 3QK6A 3LK2B 3RLFF 2PJQA 3VKGA 4IE7A 4A56A 3NRYA 4ISTA 2XSAA 4DV1T 3HKCE 2XQ3A 4YTPA 1IBKT 5JRCA 3FBLA 4IL4A 2CXLA 4CXWA 2QGSA 3QOFA 3G06A 3L39A 2JIWA 5FVKA 1WYCA 3MACA 1MMAA 4P1NA 3VHLA 2D0TA 4X20E 3Q9DA 3RC8A 4H9PC 2XJ7A 3OBVE 4MHCA 2JRKA 3A7MA 4QXHB 5KMGP 4JUYA 2BKOA 4F6RC 4TWFA 3RKOA 4DNDA 3CK6A 1CHUA 2JQQA 5LB7B 2K5BB 4KMCA 4UXNB 2LOSA 3AAEB 2ACZA 2VURA 4B3MT 2MOZA 5AQNB 5F5WA 4B3TT 4O8SA 2HHHT 3HKBE 3FZKB 2YDRA 3PJAJ 1E1HB 5CA1E 1IBMT 4GK0E 3N9PA 4U31A 5L3FB 4QKNA 3ZC1A 3CIRA 3KVBA 3VRAA 3KV6A 4LFBT 1HNZT 4DR1T 3VRBA 4DR6T 3ZT5A 3AEBA 1SA0E 5HEJA 2Y8DA 1UX4A 3RYIE 4ZHQE 2X9HA 2BS3A 1D0ZA 5JREA 3ZYLA 2BVMA 4IDPA 1FIOA 4ANJA 4EYYR 2D9DA 4YLHA 4TX5A 4YJ2E 3PUQA 5LA6E 4PNIA 4IE0A 4M1PA 5JVDE 2UXCT 1ZHCA 3PV0F 5JTGA 3KV9A 5JR9B 2IDOB 3DJBA 3ZT6A 5J2TE 3FHNA 1N34T 5HXHA 3EHZA 3FB2A 2XQ7A 3Q2MA 2CHNA 3L09A 5HCJA 2LSGA 3TLVA 5FVLA 4HFVA 5JDMA 5AQKB 4AISA 4DBRA 3K8PC 4B3RT 1VCSA 2ES0A 1HNXT 3P4RA 2NP9A 2V6YB 4OYJA 1OEDE 5JH7E 1OEDC 3UU3A 5L3DB 3AAIA 2W2UA 3O9XA 3P8CD 2W67A 4UEMA 5CA0E 2IIUA 2YU2A 2YN6A 5LHIB 3LDQB 2BKNA 2E9XB 2CXFA 1LVFA 1WRDA 1V9DA 3IEEA 2IMLA 4HN9A 2XAGB 4L0RA 3WAJA 4JEUB 3PUXF 4BA9A 5AQFB 4TZ4C 1YD8G 1UURA 3ZMTB 2LM9A 2RPAA 5HAXA 4OFZA 4EOZB 2ZMAA 2XZEA 2CLYB 3IF8B 4EB6E 2L9QA 2LSIA 2XQ6A 3UUBA 5LBMA 2V5CA 4MALA 3AE8A 3OPCA 5FXXA 2QYWA 4ZI7E 2JMKA 3NWIA 4O2BE 5HEUA 3ZSTA 2DWGA 2NTYA 4G2AA 2LEHA 2IC9A 4IDNA 3I0OA 5ABEA 1UX5A 2IUBA 5J2UE 3D0TA 1DU2A 1SHZC 4JI3T 4X66T 4PJNA 4O4LE 4A5XA 3N2KE 3RKGA 5FY7A 4IE6A 4N78D 3UU6A 3DTOA 4DIDB 4HFBA 1XNRT 4BJNA 4AKGA 2H89A 2HN1A 5CFBA 1KNRA 3AE5A 3HKEE 4NIQA 3AXJA 2XQ8A 1MMDA 4ERRA 5LGNB 4TNVA 3KV4A 3N9NA 4F8HA 3ANWB 1W09A 5L47A 2WMOA 2OLTA 1EZ3A 2WDQA 1O3XA 2NW9A 5HXRA 2A9UA 5FXVA 5CGMA 2VQET 3C98B 3ESLA 4IREA 2BG9B 2WMNA 4CN1A 2H3RA 2E2AA 5KDMC 3OTOT 2WZIA 2FJBA 3B5MA 3PUSA 3V5SA 1XDOA 1L0VA 5AQMB 4JI0T 3LFMA 2KWIB 5FXWA 2KINB 1T7SA 1S94A 1N32T 3BQLA 2MBGA 2NOXA 4J2CA 2D2SA 1Z0PA 4GK5E 5JDLA 2Q9QA 2B1EA 1D1AA 4EAHA 5DQWA 1MNEA 4X5TA 5JQGE 2QA7A 4QXCB 3VR8A 2LRKA 2Q9QD 3IA3A 2N2NA 3PU8A 1S35A 2CE7A 4E7SA 4ILUA 4PW8A 2KLQA 4I4TE 3CKDA 2I0MA 2JQ9A 4FJOA 2CWYA 4PFPA 3RPUA 4LF9T 2JMHA 2BDEA 3P7IA 2A72A 3C51A 4H9OC 1NWMX 3VU7H 1LKXA 3GA8A 3K3OA 3AVSA 2EHOB 1IJ5A 4CQIA 2XTLA 2XQ4A 2D0UA 3HA4A 3RF1A 4UV9B 3C4WA 2CBIA 5HYAA 3AE1A 3LBXB 1AJ3A 3TLUA 3IHRA 4HFIA 4IT4A 4EEDA 4MBQA 3AVRA 2LOPA 1XMOT 3CX6B 2CRBA 1D1CA 1FMWA 2CHOA 3H37A 4X62T 1UUSA 2E5VA 3ZMVB 4HKAA 3C4XA 3ZT7A 4IE5A 5LHHB 2UUBT 4COFA 1ZV4X 4MFRA 2J4GA 3UU5A 5LJMA 2I59A 4CXYA 2YDSA 2V7MA 3ZYKA 2WDRA 4JBWF 1HTJF 3KFWX 3VKHA 4YSYA 1HFAA 4ZI2D 3W15B 3UT5E 2WM9A 2UXNB 3J7Yq 4HEAA 2V8SV 2HPLA 2MYSA 3EABA 1T8BA 2L8KA 4QX7B 5FP3A 2OA5A 2E9XD 5ABFB 4HFCA 4H9SE 2YINA 4HWIB 3RYHE 4LFCT 4H63V 1UK5A 4B6XA 4ZI3D 2ZM2A 3O1HA 3PUVF 2C5IT 4ZS3A 1SUMB 1BR2A 3U78A 3AECA 4EXTA 3AEFA 2E8IA 2QVAA 3VR9A 5AQHB 3SFEA 3AEGA 3UFGA 4YSXA 3AA7B 3RC3A 4BJMA 5CB4E 3AA1B 5ABGA 2DWKA 3JADA 4UIGA 5HEGA 5AQSB 2MTQA 5EK3A 4BAYB 3P4QA 4LF6T 2QRXA 3FZHB 1E2AA 5ETWA 2Y48B 4XZCA 3P50A 3SFDA 5IYZE 4LF4T 2C5JA 4DMWA 2Q9QC 1KK7A 1XNQT 4H9QC 1W9RA 2LKGA 2IAKA 4DR3T 1KFYA 4ZEYA 4HWFA 2WS3A 1FJGT 2YKSA 4YHHT 3UUMA 4C90A 4UELA 4CXXA 4QWNB 2YDQA 3I9WA 3ZEFB 3JAFA 2V1DB 4LFAT 3PURA 5L3CB 2X9YA 1OXZA 5JDHA 2DLRA 2V7JA 1BR0A 3UU4A 3UULA 4IDQA 4PK6A 4EEBA 2VWAA 3M65A 2IC6A 4CI1B 1E7PA 2CM0A 4UF0B 1X79A 1IAPA 4DR5T 1HF8A 1WYBA 3AE4A 4DUZT 3QUJA 3E0ZA 4ZZBA 2DL1A 2V7KA 3Q5DA 3GN5A 4PJJA 4AKIA 4WBOA 2W0GA 1ZKEA 2WZHA 4AQGA 3ZMUB 2YU1A 3T1YT 3QNUA 4TWDA 4EIWA 4Z91A 5FXZA 2KMFA 5LHGB 4O4JE 4NXNT 2V26A 5KXJA 4ZI2C 3S4UA 3F31A 4A98A 5M4YA 4CN4A 2W66A 2RA1A 4KHZF 2JQKA 5IWAT 1H7CA 2XASB 4CZZB 2WQYA 2LLYA 3AE6A 1NENA 2K3WA 2WCAA 5LP6E 5AQLB 4JI2T 4YT0A 2E9XC 2YEVC 4U74A 5L4EA 1ZEEA 2VKDA 3EI0A 4U2YA 5FYMA 3ZMSB 2VL8A 5F8PA 3I9YA 3UU8A 3ZPOA 2V6XA 3NVOA 3RRWA 1OEDB 3AB3B 4IDZA 4ZI3C 3UUXB 2WBLA 1QLBA 5C3JA 3T8OA 2VQFT 4AXPA 1KEYA 4JI4T 1OWAA 2X0LB 1US7B 4NUVA 2BS2A 3RRCA 4I0UA 1JNRA 2V7IA 4EZHA 3PUWF 4AQFC 1WCRA 3C64A 3A8YC 1W0AA 3FBZA 2VKJA 1XMQT 3ZKRA 4ILAA 2XHEB 3FXDB 2BKPA 2LJLA 4YJ3E 2KNDA 3CPZA 4I43B 2K9AA 2H7OA 4P0AA 5JRCB 3PDYA 5HEOA 4YFSA 2X68A 5JDFA 4AKLA 3RIFA 4X1KE 3CMLA 4H63H 4C91A 4DV5T 3N9MA 4U33A 2KXPB 2C5KT 2XM2A 2NW7A 4TN7B 4GKJT 3KDSE 3WI3A 4UVAB 3CWZB 2N1GA 4P09A 4PK4A 1Z8UA 5A1LA 4DO0A 4YY3T 3RIUC 2P9BA 3CX7B 5LOVE 3NBXX 1MIWA 4AKRB 1J1JA 3MZKB 2WY2A 2MAWA 3CQXC 4ISSA 4OX9T 4KBMB 5LNKA 4DMVA 2BG9C 4DR7T 2J62A 1VOMA 4ZZCA 4Z90A 3ETVA 1D1BA 3HKDE 3AE3A 3JC6D 3EVYA 4WYVA 2HH7A 3F57A 2ODUA 4OHFA 1KF6A 4CN6A 2OV9A 3RQUA 2VVSA 3R84B 1T72A 3Q5XA 2Z6EA 4I55E 3LSVA 5C8YE 4LF7T 2A2FX 5LMNT 5LGUB 4ADZA 5ABHA 1MMNA 2VVNA 4V1Av 2J47A 2XQ5A 1IJ6A 4TV8E 4MLKA 3N9OA 1W0BA 4JI8T 2W61A 3Q5EA 2IHR1 5J0ZA 2FJEA 5AQGB 2V7LA 1LVKA 2CMRA 2CA5A 1M62A 2HN2A 2WU2A 5H6RB 3UFEA 3GMIA 2KZ7B 5BMVE 2LT3A 3MJXA 5FL1A 5JR9A 2PG8A 5L3EB 1HCIA 3LJCA 4EYUA 4TUYE 3T1HT 4IDOA 3ZMZB 4PFOA 3MXZA 3K3QC 5FY1A 1M7KA 4A97A 3PU3A 4KX6A 4X65T 4G63A 4ZOLE 3O1JA 2V6YA 3OJAA 1YQ3A 5HXCA 5FKYA 5EK2A 1N33T 3AEAA 2X0YA 4DV0T 2WSSV 1HX8A 3KV5A 3SWHA 5EK4A 1HG5A 3IBPA 1J5WA 1U5PA 4KHPT 5ADXL 2ZM8A 2ZM6T 3BK9A 2UUCT 4HWDA 4JLEA 4DR2T 1ZOYA 2E9XA 3CQGB 1ZP0A 1XDPA 3KBUA 3B13A 3CQCB 4P0BA 1IZNB 4AQYT 2LKHA 4QHOA 2BBHA 4XAXB 3ZJ2A 5HWXA 1U4QA 2HPJA 2LSJA 4AIUA 1YXRA 2N9DA 2VK9A 2J1DG 4PAGA 1MMGA 2IW5B 4PJMA 4JYAT 2W63A 4U2ZA 4DV2T 3JAEA 2ZM0A 2XSBA 5AQUB 4I50E 3ZC0A 4AQFA 3X1DA 5AQRB 4Z8XA 4WZXA 4WNKA 4TV9E 4IE4A 1WR6A 3RGLA 1XWMA 2GK9A 4DUYT 3N2GE 4WBNE 4YTNA 3JC6C 3K1SA 4KUMB 1IBLT 2PTFA 3AXJB 4DV3T 5DQVA 3N9QA 3ONXA 4QH4A 3J9X1 3QB5K 1WR0A 3RX6A 3ZN0B 3M3ZB 1KNZA 4UVCB 1YKEB 2XPKA 4U3CA 5AQQB 4LF5T 4OYKA 1WLXA 2ZLYA 3PUGA 5E0OA 4GIWA 1MIYA 4PK5A 5LG4A 2LSKA 4ILCA 2YOEA 1LRZA 2B76A 3RIUA 2LHNA 3EUHA 4CI2B 5FL0A 3HI2A 3ANWA 2CCQA 1JNZA 2RP4A 4ASKA 2LHRA 3MKDA 3KBTA 5H6QB 4EZ4A 1YW0A 4DV7T 4PJLA 1FEWA 3OKQA 3E22E 1YQ4A 2Q9QB 2BG9A 3AA6B 5AQPB 2VB6A 4OK0A 5DABA 4ZXLA 4B3ST 2DCFA 5JDQA 3UUNA 5L3BB 2KSRA 2DNXA 2LM2A 1N36T 2CWOA 4Q25A 5JR9C 2X9WA 4X64T 2AXDS 2JPFA 5HXSA 2G0UA 3UQ7A 4GKKT 2WWUA 4EV6A 4DR4T 3E08A 2M67A 2Y6XA 3DP7A 5BR8T 2X9XA 2VASA 3V5UA 3O4XE 3I1AA 3RYCE 3MA9A 5AQIB 2XAQB 1B7TA 1QUUA 4ILBA
chains in the Genus database with same CATH topology
4JI2T 4LFAT 4GKJT 2E5LT 4YY3T 2UXCT 2VQET 4AQYT 4JI7T 4DV4T 1HR0T 4JV5T 1XMOT 1N34T 3OTOT 1J5ET 2VQFT 4DV7T 4JYAT 4DV2T 4DV6T 4JI4T 4X62T 4JI0T 4OX9T 1I94T 4DR5T 4B3ST 1N32T 4JI5T 3T1HT 4DR7T 2UUBT 4B3MT 4DUZT 1HNWT 2UU9T 4JI6T 4B3TT 2HHHT 1XMQT 4B3RT 2F4VT 1HNXT 1N36T 4LF8T 4K0KT 4LF6T 4X64T 4DUYT 4X65T 1IBMT 2UXBT 4NXMT 3T1YT 4GKKT 4LF4T 4JI3T 4DR4T 4X66T 1IBLT 4LF7T 1N33T 5BR8T 4DV1T 4LF9T 4LFBT 1XNQT 1HNZT 4DR1T 4DV3T 4DV0T 4NXNT 4DR3T 4JI1T 5LMUT 5LMNT 1IBKT 4DR6T 1XNRT 1FJGT 2UUAT 4DV5T 4KHPT 4YHHT 2ZM6T 5IWAT 2UXDT 2UUCT 4LF5T 4LFCT 4DR2T 4JI8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 T;  4LFA T;  4GKJ T;  2E5L T;  4YY3 T;  2UXC T;  2VQE T;  4AQY T;  4JI7 T;  4DV4 T;  1HR0 T;  4JV5 T;  1XMO T;  1N34 T;  3OTO T;  1J5E T;  2VQF T;  4DV7 T;  4JYA T;  4DV2 T;  4DV6 T;  4JI4 T;  4X62 T;  4JI0 T;  4OX9 T;  1I94 T;  4DR5 T;  4B3S T;  1N32 T;  4JI5 T;  3T1H T;  4DR7 T;  2UUB T;  4B3M T;  4DUZ T;  1HNW T;  2UU9 T;  4JI6 T;  4B3T T;  2HHH T;  1XMQ T;  4B3R T;  2F4V T;  1HNX T;  1N36 T;  4LF8 T;  4K0K T;  4LF6 T;  4X64 T;  4DUY T;  4X65 T;  1IBM T;  2UXB T;  4NXM T;  3T1Y T;  4GKK T;  4LF4 T;  4JI3 T;  4DR4 T;  4X66 T;  1IBL T;  4LF7 T;  1N33 T;  5BR8 T;  4DV1 T;  4LF9 T;  4LFB T;  1XNQ T;  1HNZ T;  4DR1 T;  4DV3 T;  4DV0 T;  4NXN T;  4DR3 T;  4JI1 T;  5LMU T;  5LMN T;  1IBK T;  4DR6 T;  1XNR T;  1FJG T;  2UUA T;  4DV5 T;  4KHP T;  4YHH T;  2ZM6 T;  5IWA T;  2UXD T;  2UUC T;  4LF5 T;  4LFC T;  4DR2 T;  4JI8 T; 
#chains in the Genus database with same CATH topology
 2PFV A;  3ZN1 B;  4LML A;  2C0S A;  4UV8 B;  4HFE A;  2EHO A;  2XAF B;  2ODV A;  3NKZ A;  3JCF A;  3PUZ F;  2JJ9 A;  2EHO D;  2NR4 A;  5LGT B;  1HR0 T;  2BVL A;  4U7Y A;  3AE9 A;  2ACX A;  4JV5 T;  3LBX A;  3TKL B;  3R6N A;  4LMJ A;  4NUU A;  1VCT A;  5L4H A;  3AE2 A;  1I94 T;  3HL6 A;  2I6H A;  3ZJ1 A;  3L3P A;  5LYJ E;  4AI6 A;  1HG2 A;  1HS7 A;  3FZF B;  4U72 A;  5LXT E;  2UU9 T;  3NZQ A;  4HWH A;  3ZLI A;  2AE9 A;  4E7Z A;  3RIA A;  2WB5 A;  3AA0 B;  2UXB T;  3P4W A;  4H9R C;  2CLY C;  1UCU A;  1BR1 A;  4QXB B;  4UR9 A;  3K3N A;  3RH3 A;  4JI1 T;  2KWH A;  2XM1 A;  5LMU T;  2BS4 A;  4QH1 A;  2UUA T;  5FY0 A;  4KI0 F;  1D0Y A;  4KP3 C;  2XAJ B;  2PBI A;  4XBF B;  1UGO A;  2JQH A;  3ETU A;  2WP9 A;  3AED A;  4DVD A;  2M6I A;  5ABF A;  3ZSS A;  3PE0 A;  2LRL A;  5FMN A;  5L3G B;  1FMV A;  3A5X A;  5AQJ B;  5L2L A;  4JI7 T;  2LE8 A;  2FJA A;  3PJA A;  4X1I E;  5HWY A;  3OYZ A;  5TAO A;  2XQY A;  1J5E T;  4HE8 A;  3WAK A;  1XZY A;  3PTR B;  2NWB A;  2VL0 A;  4U7I A;  2WAU A;  2D5U A;  2WDV A;  3SRZ A;  4L5G A;  2W00 A;  3MK7 C;  2H7V C;  4JI5 T;  2YK0 A;  3ZCJ A;  3PUY F;  4HGA A;  3LK3 B;  1HNW T;  2NW8 A;  2X0H A;  4LF8 T;  3C50 A;  5LJN A;  2W4X A;  2BG9 E;  1QSD A;  4O4I E;  3RYF E;  2BZB A;  3RQW A;  1G73 A;  4YXD A;  5HCM A;  3B57 A;  3BQI A;  5IHY A;  5LCY A;  1X9B A;  3ZYM A;  3H3A A;  3AAA B;  4O2A E;  5FNV E;  5AQT B;  5JDN A;  3AEE A;  2M6B A;  3P4S A;  2SPC A;  3ZCI A;  3FXE B;  3L8R A;  2UXD T;  3SOL A;  2VKO A;  1D0X A;  5C2T A;  3EDU A;  3O1I A;  4UVB B;  3SS1 A;  4GYS A;  5DJQ C;  2KT9 A;  3CX8 B;  5AQV B;  3C4Z A;  2E5L T;  1HX1 B;  4GOU A;  3U3I A;  2XY8 B;  3N9L A;  4HFH A;  2X51 A;  4IIJ E;  3FZM B;  4YSZ A;  5HXE A;  3ABV A;  3TLW A;  1R8I A;  3TLT A;  3RHW A;  4HFD A;  2XQ9 A;  2CEA A;  1MIV A;  3UTK A;  2L3L A;  2EHO C;  3FZL B;  4X1Y E;  5IUX A;  3AE7 A;  4FI5 A;  3GN5 B;  5J1G A;  4DBQ A;  2XQA A;  3I0Q A;  3KVA A;  4JEH B;  2X67 A;  4UF0 A;  2NTX A;  2CBJ A;  1T98 A;  3ONJ A;  2VKH A;  1G8X A;  3P4P A;  3TLS A;  4TNW A;  1NEK A;  4K0K T;  2WWV A;  4QX8 B;  3Q5W A;  2FJD A;  2LSY A;  2K48 A;  3N5L A;  4TWH A;  5AFU L;  3GWH A;  2A3D A;  3LK4 2;  1GQE A;  1I6Z A;  3EAM A;  3NZP A;  3OVU A;  2UXX B;  2H88 A;  3NRX A;  3ONL C;  4NPP A;  4IHJ E;  2XUE A;  4K0U A;  4WW0 A;  3HR0 A;  4ZS2 A;  2CPT A;  2DHR A;  3QC9 A;  1WFD A;  3OYX A;  2BBJ A;  3H3M A;  1VRB A;  5KX5 E;  3N2O A;  4EGW A;  1BR4 A;  5F3J A;  1Y64 B;  4GYR A;  5LBQ B;  2CXD A;  3QB5 A;  3BQK A;  3UQ4 A;  3LG7 A;  4YTM A;  2MPK A;  5EZY E;  4QH5 A;  4DV4 T;  4IL9 A;  1SE7 A;  3PUA A;  2V5D A;  2XAH B;  3KIN B;  3F2E A;  3CVR A;  2WU5 A;  4DV6 T;  5CJ5 A;  4O4H E;  3RI5 A;  1OED A;  1NAF A;  4YHJ A;  2DI4 A;  5GON E;  2R6G F;  4IGU A;  4CI3 B;  4HTE A;  1MND A;  4LMK A;  2FBW A;  4H9N C;  1Y01 A;  3EDV A;  4AKH A;  2W62 A;  4JI6 T;  4HWC A;  1KNP A;  5LG3 A;  1CUN A;  2F4V T;  5JDG A;  2X66 A;  2K24 A;  5HEH A;  2FUP A;  4L9I A;  1YKH B;  5AQO B;  4NXM T;  3QK6 A;  3LK2 B;  3RLF F;  2PJQ A;  3VKG A;  4IE7 A;  4A56 A;  3NRY A;  4IST A;  2XSA A;  4DV1 T;  3HKC E;  2XQ3 A;  4YTP A;  1IBK T;  5JRC A;  3FBL A;  4IL4 A;  2CXL A;  4CXW A;  2QGS A;  3QOF A;  3G06 A;  3L39 A;  2JIW A;  5FVK A;  1WYC A;  3MAC A;  1MMA A;  4P1N A;  3VHL A;  2D0T A;  4X20 E;  3Q9D A;  3RC8 A;  4H9P C;  2XJ7 A;  3OBV E;  4MHC A;  2JRK A;  3A7M A;  4QXH B;  5KMG P;  4JUY A;  2BKO A;  4F6R C;  4TWF A;  3RKO A;  4DND A;  3CK6 A;  1CHU A;  2JQQ A;  5LB7 B;  2K5B B;  4KMC A;  4UXN B;  2LOS A;  3AAE B;  2ACZ A;  2VUR A;  4B3M T;  2MOZ A;  5AQN B;  5F5W A;  4B3T T;  4O8S A;  2HHH T;  3HKB E;  3FZK B;  2YDR A;  3PJA J;  1E1H B;  5CA1 E;  1IBM T;  4GK0 E;  3N9P A;  4U31 A;  5L3F B;  4QKN A;  3ZC1 A;  3CIR A;  3KVB A;  3VRA A;  3KV6 A;  4LFB T;  1HNZ T;  4DR1 T;  3VRB A;  4DR6 T;  3ZT5 A;  3AEB A;  1SA0 E;  5HEJ A;  2Y8D A;  1UX4 A;  3RYI E;  4ZHQ E;  2X9H A;  2BS3 A;  1D0Z A;  5JRE A;  3ZYL A;  2BVM A;  4IDP A;  1FIO A;  4ANJ A;  4EYY R;  2D9D A;  4YLH A;  4TX5 A;  4YJ2 E;  3PUQ A;  5LA6 E;  4PNI A;  4IE0 A;  4M1P A;  5JVD E;  2UXC T;  1ZHC A;  3PV0 F;  5JTG A;  3KV9 A;  5JR9 B;  2IDO B;  3DJB A;  3ZT6 A;  5J2T E;  3FHN A;  1N34 T;  5HXH A;  3EHZ A;  3FB2 A;  2XQ7 A;  3Q2M A;  2CHN A;  3L09 A;  5HCJ A;  2LSG A;  3TLV A;  5FVL A;  4HFV A;  5JDM A;  5AQK B;  4AIS A;  4DBR A;  3K8P C;  4B3R T;  1VCS A;  2ES0 A;  1HNX T;  3P4R A;  2NP9 A;  2V6Y B;  4OYJ A;  1OED E;  5JH7 E;  1OED C;  3UU3 A;  5L3D B;  3AAI A;  2W2U A;  3O9X A;  3P8C D;  2W67 A;  4UEM A;  5CA0 E;  2IIU A;  2YU2 A;  2YN6 A;  5LHI B;  3LDQ B;  2BKN A;  2E9X B;  2CXF A;  1LVF A;  1WRD A;  1V9D A;  3IEE A;  2IML A;  4HN9 A;  2XAG B;  4L0R A;  3WAJ A;  4JEU B;  3PUX F;  4BA9 A;  5AQF B;  4TZ4 C;  1YD8 G;  1UUR A;  3ZMT B;  2LM9 A;  2RPA A;  5HAX A;  4OFZ A;  4EOZ B;  2ZMA A;  2XZE A;  2CLY B;  3IF8 B;  4EB6 E;  2L9Q A;  2LSI A;  2XQ6 A;  3UUB A;  5LBM A;  2V5C A;  4MAL A;  3AE8 A;  3OPC A;  5FXX A;  2QYW A;  4ZI7 E;  2JMK A;  3NWI A;  4O2B E;  5HEU A;  3ZST A;  2DWG A;  2NTY A;  4G2A A;  2LEH A;  2IC9 A;  4IDN A;  3I0O A;  5ABE A;  1UX5 A;  2IUB A;  5J2U E;  3D0T A;  1DU2 A;  1SHZ C;  4JI3 T;  4X66 T;  4PJN A;  4O4L E;  4A5X A;  3N2K E;  3RKG A;  5FY7 A;  4IE6 A;  4N78 D;  3UU6 A;  3DTO A;  4DID B;  4HFB A;  1XNR T;  4BJN A;  4AKG A;  2H89 A;  2HN1 A;  5CFB A;  1KNR A;  3AE5 A;  3HKE E;  4NIQ A;  3AXJ A;  2XQ8 A;  1MMD A;  4ERR A;  5LGN B;  4TNV A;  3KV4 A;  3N9N A;  4F8H A;  3ANW B;  1W09 A;  5L47 A;  2WMO A;  2OLT A;  1EZ3 A;  2WDQ A;  1O3X A;  2NW9 A;  5HXR A;  2A9U A;  5FXV A;  5CGM A;  2VQE T;  3C98 B;  3ESL A;  4IRE A;  2BG9 B;  2WMN A;  4CN1 A;  2H3R A;  2E2A A;  5KDM C;  3OTO T;  2WZI A;  2FJB A;  3B5M A;  3PUS A;  3V5S A;  1XDO A;  1L0V A;  5AQM B;  4JI0 T;  3LFM A;  2KWI B;  5FXW A;  2KIN B;  1T7S A;  1S94 A;  1N32 T;  3BQL A;  2MBG A;  2NOX A;  4J2C A;  2D2S A;  1Z0P A;  4GK5 E;  5JDL A;  2Q9Q A;  2B1E A;  1D1A A;  4EAH A;  5DQW A;  1MNE A;  4X5T A;  5JQG E;  2QA7 A;  4QXC B;  3VR8 A;  2LRK A;  2Q9Q D;  3IA3 A;  2N2N A;  3PU8 A;  1S35 A;  2CE7 A;  4E7S A;  4ILU A;  4PW8 A;  2KLQ A;  4I4T E;  3CKD A;  2I0M A;  2JQ9 A;  4FJO A;  2CWY A;  4PFP A;  3RPU A;  4LF9 T;  2JMH A;  2BDE A;  3P7I A;  2A72 A;  3C51 A;  4H9O C;  1NWM X;  3VU7 H;  1LKX A;  3GA8 A;  3K3O A;  3AVS A;  2EHO B;  1IJ5 A;  4CQI A;  2XTL A;  2XQ4 A;  2D0U A;  3HA4 A;  3RF1 A;  4UV9 B;  3C4W A;  2CBI A;  5HYA A;  3AE1 A;  3LBX B;  1AJ3 A;  3TLU A;  3IHR A;  4HFI A;  4IT4 A;  4EED A;  4MBQ A;  3AVR A;  2LOP A;  1XMO T;  3CX6 B;  2CRB A;  1D1C A;  1FMW A;  2CHO A;  3H37 A;  4X62 T;  1UUS A;  2E5V A;  3ZMV B;  4HKA A;  3C4X A;  3ZT7 A;  4IE5 A;  5LHH B;  2UUB T;  4COF A;  1ZV4 X;  4MFR A;  2J4G A;  3UU5 A;  5LJM A;  2I59 A;  4CXY A;  2YDS A;  2V7M A;  3ZYK A;  2WDR A;  4JBW F;  1HTJ F;  3KFW X;  3VKH A;  4YSY A;  1HFA A;  4ZI2 D;  3W15 B;  3UT5 E;  2WM9 A;  2UXN B;  3J7Y q;  4HEA A;  2V8S V;  2HPL A;  2MYS A;  3EAB A;  1T8B A;  2L8K A;  4QX7 B;  5FP3 A;  2OA5 A;  2E9X D;  5ABF B;  4HFC A;  4H9S E;  2YIN A;  4HWI B;  3RYH E;  4LFC T;  4H63 V;  1UK5 A;  4B6X A;  4ZI3 D;  2ZM2 A;  3O1H A;  3PUV F;  2C5I T;  4ZS3 A;  1SUM B;  1BR2 A;  3U78 A;  3AEC A;  4EXT A;  3AEF A;  2E8I A;  2QVA A;  3VR9 A;  5AQH B;  3SFE A;  3AEG A;  3UFG A;  4YSX A;  3AA7 B;  3RC3 A;  4BJM A;  5CB4 E;  3AA1 B;  5ABG A;  2DWK A;  3JAD A;  4UIG A;  5HEG A;  5AQS B;  2MTQ A;  5EK3 A;  4BAY B;  3P4Q A;  4LF6 T;  2QRX A;  3FZH B;  1E2A A;  5ETW A;  2Y48 B;  4XZC A;  3P50 A;  3SFD A;  5IYZ E;  4LF4 T;  2C5J A;  4DMW A;  2Q9Q C;  1KK7 A;  1XNQ T;  4H9Q C;  1W9R A;  2LKG A;  2IAK A;  4DR3 T;  1KFY A;  4ZEY A;  4HWF A;  2WS3 A;  1FJG T;  2YKS A;  4YHH T;  3UUM A;  4C90 A;  4UEL A;  4CXX A;  4QWN B;  2YDQ A;  3I9W A;  3ZEF B;  3JAF A;  2V1D B;  4LFA T;  3PUR A;  5L3C B;  2X9Y A;  1OXZ A;  5JDH A;  2DLR A;  2V7J A;  1BR0 A;  3UU4 A;  3UUL A;  4IDQ A;  4PK6 A;  4EEB A;  2VWA A;  3M65 A;  2IC6 A;  4CI1 B;  1E7P A;  2CM0 A;  4UF0 B;  1X79 A;  1IAP A;  4DR5 T;  1HF8 A;  1WYB A;  3AE4 A;  4DUZ T;  3QUJ A;  3E0Z A;  4ZZB A;  2DL1 A;  2V7K A;  3Q5D A;  3GN5 A;  4PJJ A;  4AKI A;  4WBO A;  2W0G A;  1ZKE A;  2WZH A;  4AQG A;  3ZMU B;  2YU1 A;  3T1Y T;  3QNU A;  4TWD A;  4EIW A;  4Z91 A;  5FXZ A;  2KMF A;  5LHG B;  4O4J E;  4NXN T;  2V26 A;  5KXJ A;  4ZI2 C;  3S4U A;  3F31 A;  4A98 A;  5M4Y A;  4CN4 A;  2W66 A;  2RA1 A;  4KHZ F;  2JQK A;  5IWA T;  1H7C A;  2XAS B;  4CZZ B;  2WQY A;  2LLY A;  3AE6 A;  1NEN A;  2K3W A;  2WCA A;  5LP6 E;  5AQL B;  4JI2 T;  4YT0 A;  2E9X C;  2YEV C;  4U74 A;  5L4E A;  1ZEE A;  2VKD A;  3EI0 A;  4U2Y A;  5FYM A;  3ZMS B;  2VL8 A;  5F8P A;  3I9Y A;  3UU8 A;  3ZPO A;  2V6X A;  3NVO A;  3RRW A;  1OED B;  3AB3 B;  4IDZ A;  4ZI3 C;  3UUX B;  2WBL A;  1QLB A;  5C3J A;  3T8O A;  2VQF T;  4AXP A;  1KEY A;  4JI4 T;  1OWA A;  2X0L B;  1US7 B;  4NUV A;  2BS2 A;  3RRC A;  4I0U A;  1JNR A;  2V7I A;  4EZH A;  3PUW F;  4AQF C;  1WCR A;  3C64 A;  3A8Y C;  1W0A A;  3FBZ A;  2VKJ A;  1XMQ T;  3ZKR A;  4ILA A;  2XHE B;  3FXD B;  2BKP A;  2LJL A;  4YJ3 E;  2KND A;  3CPZ A;  4I43 B;  2K9A A;  2H7O A;  4P0A A;  5JRC B;  3PDY A;  5HEO A;  4YFS A;  2X68 A;  5JDF A;  4AKL A;  3RIF A;  4X1K E;  3CML A;  4H63 H;  4C91 A;  4DV5 T;  3N9M A;  4U33 A;  2KXP B;  2C5K T;  2XM2 A;  2NW7 A;  4TN7 B;  4GKJ T;  3KDS E;  3WI3 A;  4UVA B;  3CWZ B;  2N1G A;  4P09 A;  4PK4 A;  1Z8U A;  5A1L A;  4DO0 A;  4YY3 T;  3RIU C;  2P9B A;  3CX7 B;  5LOV E;  3NBX X;  1MIW A;  4AKR B;  1J1J A;  3MZK B;  2WY2 A;  2MAW A;  3CQX C;  4ISS A;  4OX9 T;  4KBM B;  5LNK A;  4DMV A;  2BG9 C;  4DR7 T;  2J62 A;  1VOM A;  4ZZC A;  4Z90 A;  3ETV A;  1D1B A;  3HKD E;  3AE3 A;  3JC6 D;  3EVY A;  4WYV A;  2HH7 A;  3F57 A;  2ODU A;  4OHF A;  1KF6 A;  4CN6 A;  2OV9 A;  3RQU A;  2VVS A;  3R84 B;  1T72 A;  3Q5X A;  2Z6E A;  4I55 E;  3LSV A;  5C8Y E;  4LF7 T;  2A2F X;  5LMN T;  5LGU B;  4ADZ A;  5ABH A;  1MMN A;  2VVN A;  4V1A v;  2J47 A;  2XQ5 A;  1IJ6 A;  4TV8 E;  4MLK A;  3N9O A;  1W0B A;  4JI8 T;  2W61 A;  3Q5E A;  2IHR 1;  5J0Z A;  2FJE A;  5AQG B;  2V7L A;  1LVK A;  2CMR A;  2CA5 A;  1M62 A;  2HN2 A;  2WU2 A;  5H6R B;  3UFE A;  3GMI A;  2KZ7 B;  5BMV E;  2LT3 A;  3MJX A;  5FL1 A;  5JR9 A;  2PG8 A;  5L3E B;  1HCI A;  3LJC A;  4EYU A;  4TUY E;  3T1H T;  4IDO A;  3ZMZ B;  4PFO A;  3MXZ A;  3K3Q C;  5FY1 A;  1M7K A;  4A97 A;  3PU3 A;  4KX6 A;  4X65 T;  4G63 A;  4ZOL E;  3O1J A;  2V6Y A;  3OJA A;  1YQ3 A;  5HXC A;  5FKY A;  5EK2 A;  1N33 T;  3AEA A;  2X0Y A;  4DV0 T;  2WSS V;  1HX8 A;  3KV5 A;  3SWH A;  5EK4 A;  1HG5 A;  3IBP A;  1J5W A;  1U5P A;  4KHP T;  5ADX L;  2ZM8 A;  2ZM6 T;  3BK9 A;  2UUC T;  4HWD A;  4JLE A;  4DR2 T;  1ZOY A;  2E9X A;  3CQG B;  1ZP0 A;  1XDP A;  3KBU A;  3B13 A;  3CQC B;  4P0B A;  1IZN B;  4AQY T;  2LKH A;  4QHO A;  2BBH A;  4XAX B;  3ZJ2 A;  5HWX A;  1U4Q A;  2HPJ A;  2LSJ A;  4AIU A;  1YXR A;  2N9D A;  2VK9 A;  2J1D G;  4PAG A;  1MMG A;  2IW5 B;  4PJM A;  4JYA T;  2W63 A;  4U2Z A;  4DV2 T;  3JAE A;  2ZM0 A;  2XSB A;  5AQU B;  4I50 E;  3ZC0 A;  4AQF A;  3X1D A;  5AQR B;  4Z8X A;  4WZX A;  4WNK A;  4TV9 E;  4IE4 A;  1WR6 A;  3RGL A;  1XWM A;  2GK9 A;  4DUY T;  3N2G E;  4WBN E;  4YTN A;  3JC6 C;  3K1S A;  4KUM B;  1IBL T;  2PTF A;  3AXJ B;  4DV3 T;  5DQV A;  3N9Q A;  3ONX A;  4QH4 A;  3J9X 1;  3QB5 K;  1WR0 A;  3RX6 A;  3ZN0 B;  3M3Z B;  1KNZ A;  4UVC B;  1YKE B;  2XPK A;  4U3C A;  5AQQ B;  4LF5 T;  4OYK A;  1WLX A;  2ZLY A;  3PUG A;  5E0O A;  4GIW A;  1MIY A;  4PK5 A;  5LG4 A;  2LSK A;  4ILC A;  2YOE A;  1LRZ A;  2B76 A;  3RIU A;  2LHN A;  3EUH A;  4CI2 B;  5FL0 A;  3HI2 A;  3ANW A;  2CCQ A;  1JNZ A;  2RP4 A;  4ASK A;  2LHR A;  3MKD A;  3KBT A;  5H6Q B;  4EZ4 A;  1YW0 A;  4DV7 T;  4PJL A;  1FEW A;  3OKQ A;  3E22 E;  1YQ4 A;  2Q9Q B;  2BG9 A;  3AA6 B;  5AQP B;  2VB6 A;  4OK0 A;  5DAB A;  4ZXL A;  4B3S T;  2DCF A;  5JDQ A;  3UUN A;  5L3B B;  2KSR A;  2DNX A;  2LM2 A;  1N36 T;  2CWO A;  4Q25 A;  5JR9 C;  2X9W A;  4X64 T;  2AXD S;  2JPF A;  5HXS A;  2G0U A;  3UQ7 A;  4GKK T;  2WWU A;  4EV6 A;  4DR4 T;  3E08 A;  2M67 A;  2Y6X A;  3DP7 A;  5BR8 T;  2X9X A;  2VAS A;  3V5U A;  3O4X E;  3I1A A;  3RYC E;  3MA9 A;  5AQI B;  2XAQ B;  1B7T A;  1QUU A;  4ILB A; 
#chains in the Genus database with same CATH homology
 4JI2 T;  4LFA T;  4GKJ T;  2E5L T;  4YY3 T;  2UXC T;  2VQE T;  4AQY T;  4JI7 T;  4DV4 T;  1HR0 T;  4JV5 T;  1XMO T;  1N34 T;  3OTO T;  1J5E T;  2VQF T;  4DV7 T;  4JYA T;  4DV2 T;  4DV6 T;  4JI4 T;  4X62 T;  4JI0 T;  4OX9 T;  1I94 T;  4DR5 T;  4B3S T;  1N32 T;  4JI5 T;  3T1H T;  4DR7 T;  2UUB T;  4B3M T;  4DUZ T;  1HNW T;  2UU9 T;  4JI6 T;  4B3T T;  2HHH T;  1XMQ T;  4B3R T;  2F4V T;  1HNX T;  1N36 T;  4LF8 T;  4K0K T;  4LF6 T;  4X64 T;  4DUY T;  4X65 T;  1IBM T;  2UXB T;  4NXM T;  3T1Y T;  4GKK T;  4LF4 T;  4JI3 T;  4DR4 T;  4X66 T;  1IBL T;  4LF7 T;  1N33 T;  5BR8 T;  4DV1 T;  4LF9 T;  4LFB T;  1XNQ T;  1HNZ T;  4DR1 T;  4DV3 T;  4DV0 T;  4NXN T;  4DR3 T;  4JI1 T;  5LMU T;  5LMN T;  1IBK T;  4DR6 T;  1XNR T;  1FJG T;  2UUA T;  4DV5 T;  4KHP T;  4YHH T;  2ZM6 T;  5IWA T;  2UXD T;  2UUC T;  4LF5 T;  4LFC T;  4DR2 T;  4JI8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...