4MFRA

Crystal structure of mycobacterium tuberculosis card
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
164
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords RNA polymerase-binding transcription factor CarD
total genus 44
structure length 164
sequence length 169
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mfrA02
4KBMB 2LT3A 4XAXB 4KMCA 4MFRA 4ILUA 4L5GA
chains in the Genus database with same CATH superfamily
1OEDA 2V6XA 4ERRA 5LMNT 5ETWA 1EZ3A 3K3OA 2A2FX 1M62A 2D0TA 2QVAA 4GOUA 4TWFA 5AQNB 3RKOA 4HFEA 4IL9A 1IBMT 3AE7A 3E22E 2X9XA 2XM1A 4JI4T 3AA7B 4FI5A 5FXZA 2CPTA 2LRLA 3FBLA 3UUXB 4IDOA 4ZXLA 2X9WA 5ADXL 1UUSA 1WR0A 3HKCE 3OYZA 2KNDA 2HN1A 2CXFA 2F4VT 3AXJA 4IE7A 3MK7C 2PG8A 3C4XA 4L0RA 2YDSA 4M1PA 1ZV4X 2H88A 3DP7A 2YINA 5E0OA 2LKGA 2MAWA 5F5WA 4QH4A 4IE6A 2VWAA 2Q9QD 3ETVA 1W09A 2CBJA 2CM0A 2HN2A 2YU1A 3L09A 3QK6A 5AQLB 2E9XC 4COFA 3FBZA 3LSVA 4UVAB 4EB6E 1E2AA 2LOSA 3C51A 2XSAA 2WDQA 3PUZF 4HFIA 5CA0E 5AFUL 4AIUA 2K24A 4I0UA 3AE6A 5L3CB 2I0MA 1KNRA 2B1EA 3N5LA 5J2TE 1HNZT 2OLTA 4IHJE 1ZHCA 3RGLA 1IJ6A 4JI2T 3PUWF 1ZEEA 2LSIA 3P7IA 3QOFA 2YDQA 2XAQB 3WAKA 3L3PA 1XNRT 3B13A 2WAUA 5ABGA 4A98A 4UIGA 2EHOA 1KFYA 3RX6A 4AISA 4O4HE 3AECA 3P4SA 4P1NA 4KHZF 3AAIA 3N9MA 2X68A 4ZOLE 5L3EB 4MALA 5LNKA 2IC6A 4KMCA 3JADA 4NUVA 3ANWA 4H9PC 2VK9A 4MFRA 5L2LA 2PBIA 4GK5E 3LDQB 4I4TE 3TLVA 4P09A 4DR2T 2W67A 3H3AA 4YSYA 2OV9A 2KWHA 2X0LB 3IA3A 2CHOA 3AE2A 2V1DB 1IAPA 2E2AA 3ZC1A 4LFCT 4A97A 3AEAA 4HWFA 4NXNT 4L5GA 5HWYA 4A5XA 4PNIA 4EV6A 3EHZA 1YQ4A 3HA4A 3SFDA 2D0UA 3VR9A 5HYAA 3CQCB 3U78A 2C5KT 5EZYE 4ZS3A 5FL0A 4X20E 2JQKA 4LF6T 4G2AA 4X1IE 5HEHA 5LBMA 2W61A 3MKDA 1D0YA 5LOVE 5CGMA 4DR4T 4U2ZA 4IDZA 2D5UA 5DJQC 3RYHE 4NPPA 3L39A 4WYVA 3CWZB 4EEDA 3NRYA 4I50E 4LMLA 4CN4A 4H9SE 4DNDA 4ADZA 4I55E 3PUGA 2ES0A 2LE8A 2VKDA 2NW7A 2WMNA 1SE7A 5TAOA 4YSZA 5IUXA 2PJQA 4X5TA 4CXXA 2UUCT 2E5LT 4QKNA 1UGOA 1MIYA 3PDYA 4TWDA 1QLBA 4HN9A 2X51A 1L0VA 5AQGB 2WU2A 4U33A 3L8RA 1U5PA 2V7IA 2XUEA 2DWGA 4TUYE 5LB7B 2XQ3A 5FY1A 1YXRA 3RIAA 5HEGA 4K0KT 4AKHA 2XQ6A 3E0ZA 3PJAJ 4ZI3C 3I0QA 1US7B 5JDNA 2VVNA 1KNZA 3UFEA 4YHHT 4ANJA 2H89A 1UX5A 2GK9A 3OBVE 1IBKT 3CX6B 2IAKA 5JVDE 2D2SA 2IHR1 2EHOC 2XQYA 3JC6D 4ISSA 3SRZA 4IDPA 3UT5E 4X62T 1I94T 5AQFB 4JI7T 3MXZA 3QB5K 5JR9B 5LYJE 2IC9A 3AA0B 2W0GA 3TKLB 1WFDA 1VCSA 3Q2MA 5AQPB 1QSDA 2ZLYA 2MBGA 3AEDA 5AQHB 4NXMT 3K8PC 5KXJA 3AE8A 4PK4A 4ZI7E 4JI0T 4IDQA 3UUBA 4AQFA 4H9RC 3A5XA 2L8KA 5L4EA 4IL4A 4U72A 4CI1B 2H7OA 3EUHA 4F8HA 4JEHB 3JC6C 4EGWA 4IDNA 5HXSA 1HF8A 1LRZA 4IE5A 4QWNB 3O1IA 3CQGB 3O4XE 4UVBB 5DABA 1JNZA 3CMLA 2WMOA 4YHJA 2ZM8A 4Z90A 5AQRB 2V5CA 2Z6EA 3P4QA 4AQGA 5LHHB 2I59A 3UU6A 3A8YC 4JV5T 3LFMA 2NR4A 2Y8DA 1J1JA 2NP9A 3EDUA 4GYSA 2VL0A 1W9RA 4XAXB 4ILCA 4BAYB 4DBRA 4KX6A 5HEUA 3O9XA 1XMQT 4GIWA 5L3BB 5AQQB 4UV9B 5C2TA 3ZN0B 1Z0PA 3O1HA 2FJBA 4JUYA 1NENA 3ZLIA 3RIFA 2LSKA 4DV6T 3NZPA 5IHYA 5CB4E 2IW5B 2VL8A 2CCQA 4CZZB 5LGTB 5KX5E 3RYFE 4QX7B 1N33T 1UURA 3HKEE 2W66A 1T8BA 4HFBA 3NBXX 4KHPT 2YK0A 4PAGA 4GK0E 3AVSA 2C5IT 1BR1A 3ABVA 3N2KE 3ZMUB 3I9WA 3OPCA 1I6ZA 2CHNA 4DMWA 1UCUA 4QHOA 2LJLA 4DR7T 2LM9A 3MA9A 3KBUA 3LK2B 5KDMC 3E08A 2J47A 1HFAA 2J62A 2ZM2A 3BK9A 4DV2T 3GWHA 3NWIA 4O4JE 3VR8A 1WLXA 3AE4A 2W00A 2WQYA 1ZP0A 2V8SV 5L47A 2K3WA 2W4XA 1D1CA 3ONXA 2NWBA 2K5BB 4IE4A 4MBQA 4OFZA 4YFSA 4HWCA 2DLRA 2A72A 3UUMA 4AXPA 2FJAA 3GN5A 2BBJA 3IF8B 2LOPA 1HX8A 1R8IA 2BG9A 4PK5A 1XMOT 1HNXT 5LJNA 4BJMA 2J4GA 3ZKRA 3FZLB 3MZKB 3BQIA 4IIJE 3T8OA 4HTEA 5FP3A 3S4UA 4EIWA 2WWUA 2W63A 4AQFC 5EK2A 1VOMA 3RHWA 1D1BA 1YKEB 2UUAT 4X66T 4JI1T 3F2EA 2V7MA 3J9X1 4YXDA 4TN7B 3SS1A 4U74A 2BKNA 4E7ZA 4YSXA 2CBIA 2LHRA 3NRXA 2QRXA 2FBWA 4H9NC 1G8XA 4O2BE 3ZSSA 3RQUA 4YJ2E 3ZJ1A 2ZMAA 3KFWX 1MNEA 2RPAA 4CXWA 5HWXA 1XDPA 2ACXA 3PU3A 3UU3A 5IWAT 5EK3A 1Z8UA 2JQHA 2KSRA 3NZQA 3C4WA 4LMJA 2VKHA 3G06A 2M6IA 5HXEA 3RF1A 1MIWA 3QC9A 5J0ZA 1LVFA 4OX9T 3LBXA 2YOEA 3N2GE 2DWKA 4HE8A 4TX5A 1GQEA 3RRWA 3RYCE 2MYSA 4DBQA 4YTPA 3VRAA 4IE0A 2WDVA 2R6GF 1NEKA 5JR9A 4PJNA 3UFGA 1HX1B 2E9XB 2V6YA 1N32T 3EI0A 3ONLC 4UF0A 3ZYMA 4AKIA 3AEFA 1T7SA 2JRKA 3GMIA 4H9QC 1XWMA 3RKGA 1YW0A 3ZCIA 2UU9T 4DIDB 3DTOA 3BQLA 3M3ZB 2EHOB 3PTRB 4QXBB 3U3IA 2BKOA 2UXBT 4EZHA 3PUXF 5H6RB 2IUBA 2UXXB 1IZNB 2AXDS 4UR9A 5LGNB 3VKHA 2XQ8A 1M7KA 2K48A 4O4LE 4QXHB 4TWHA 3CX7B 3KVBA 2A3DA 2Q9QA 4PFOA 4DVDA 4HWDA 4TZ4C 3PUAA 2CLYB 2N2NA 3KV5A 3Q5DA 1QUUA 2CA5A 2XZEA 3TLSA 4YTNA 5JREA 4B3TT 4DR6T 2MTQA 3P4PA 3JAFA 4Q25A 4ZI3D 1NAFA 3N9LA 4AKLA 1KNPA 4X64T 1E7PA 1ZKEA 2ACZA 2BG9C 1H7CA 2BG9B 4KI0F 1YD8G 5HXRA 1J5ET 2UXDT 2Q9QB 3PV0F 1V9DA 2ODVA 2X0HA 1J5WA 4HFVA 4CI3B 4ZI2D 2LKHA 2HHHT 2B76A 3P50A 4CN1A 2XPKA 3RH3A 4EZ4A 5HCJA 5IYZE 3KDSE 3IEEA 4PJLA 3RLFF 3I9YA 4JI8T 3PUSA 2XQ5A 1WRDA 3HKBE 4J2CA 3OKQA 4XZCA 5AQJB 2HH7A 3AA1B 3C4ZA 1JNRA 1MMAA 5LXTE 1HR0T 2BDEA 4UF0B 3CVRA 2HPJA 2XASB 2V6YB 5HEOA 1MMNA 2XAJB 5M4YA 4DUZT 1HG2A 5FXXA 1D0ZA 4LF8T 4EYYR 2XHEB 2CRBA 4LMKA 4AQYT 2WS3A 5FMNA 3AAEB 3RC3A 3VU7H 2H3RA 3C98B 2PTFA 4WBOA 3ZT5A 2C5JA 5JR9C 2NOXA 4MLKA 4UVCB 2WCAA 1FMVA 1MNDA 1W0BA 2W2UA 2FJEA 4YLHA 5FL1A 4PJJA 5JQGE 2V7LA 3TLUA 2HPLA 4XBFB 3ZYKA 5ABEA 2BVLA 2BS4A 5L3DB 5C3JA 2XQAA 4JLEA 4JI3T 1CUNA 3MACA 2JMHA 3PUQA 3A7MA 4X65T 1MMGA 2CE7A 2BVMA 1OWAA 3KINB 3OJAA 5LHIB 3M65A 2M67A 2JPFA 4LF4T 2C0SA 4LFAT 4B3RT 5JRCA 5L3FB 3T1YT 5F8PA 4H63V 5AQOB 3WI3A 4IGUA 5JH7E 1FMWA 5AQVB 1XNQT 3RC8A 1BR4A 1FJGT 2KXPB 5JDMA 2H7VC 3W15B 2Q9QC 2VKOA 4OK0A 3P4WA 5HXCA 3P4RA 3V5UA 2BBHA 1SUMB 2J1DG 2XAFB 2XQ7A 3AVRA 5CJ5A 5HXHA 4H9OC 3IBPA 3Q5XA 1T72A 1UK5A 2NTYA 3JCFA 3QB5A 3QUJA 4L9IA 4QX8B 5JDQA 5AQTB 2CEAA 4HEAA 2XAGB 2SPCA 1CHUA 4PW8A 3KV6A 1VRBA 3CQXC 4DV3T 2QYWA 3NVOA 3ZT6A 3R6NA 4JI6T 5LP6E 3ESLA 3HI2A 5LCYA 3I1AA 4DV5T 4IT4A 3AA6B 3VRBA 5L3GB 3UQ7A 5FXWA 2JMKA 1LKXA 2XY8B 2JJ9A 3BQKA 4ILAA 2ODUA 4P0BA 3LK3B 3AB3B 3H3MA 3AE9A 3AE3A 2WWVA 3FZKB 2BS3A 2OA5A 1HNWT 2VKJA 3K3NA 3PJAA 5ABFB 3RI5A 3T1HT 4U2YA 5JDGA 4ZEYA 4FJOA 3DJBA 3EVYA 2CWOA 2LSGA 3I0OA 3OYXA 3PU8A 4KP3C 3UU5A 2E5VA 3ANWB 3RIUA 2WP9A 4DR3T 1E1HB 5FY0A 2VQFT 2AE9A 4O2AE 4TV8E 4CN6A 1T98A 3ETUA 2JQQA 2DCFA 2X9YA 1BR2A 2I6HA 3AE5A 2L9QA 3FHNA 3OVUA 4Z91A 3ZN1B 4IREA 2X9HA 4F6RC 2M6BA 1YQ3A 3CK6A 3GN5B 1HTJF 2YU2A 3HL6A 1HG5A 3MJXA 4U31A 5HAXA 4AI6A 2W62A 2XQ9A 3OTOT 3Q5EA 2K9AA 3UQ4A 3KV9A 2IIUA 4ILBA 1X79A 2N9DA 2WSSV 5JDFA 5ABFA 2BZBA 2RA1A 4EXTA 3WAJA 2KINB 4CQIA 3J7Yq 2LEHA 4AKGA 4QXCB 3IHRA 4A56A 2UUBT 4OYKA 4YTMA 3ZT7A 4U3CA 1WCRA 4WW0A 3CIRA 4BJNA 1X9BA 2WBLA 5FXVA 1WYBA 5FVLA 1G73A 2LT3A 4QH5A 1MIVA 1O3XA 4G63A 3SFEA 4JBWF 1KEYA 5JDHA 2NTXA 3PURA 4N78D 3ZEFB 5LG3A 3SWHA 2P9BA 5HCMA 4DV4T 1OEDE 1XZYA 2VQET 2N1GA 5LG4A 2XM2A 2D9DA 3CPZA 2X67A 3VHLA 3HR0A 1MMDA 3R84B 5JTGA 4WBNE 1ZOYA 5HEJA 4ISTA 2LM2A 3KV4A 3GA8A 4KUMB 5AQUB 5FKYA 2BG9E 3EABA 4JI5T 3ZPOA 4ZS2A 2A9UA 3ONJA 4OYJA 1SHZC 4H63H 2CXLA 2LHNA 4QH1A 5CFBA 4JYAT 4JEUB 4HFHA 4EEBA 5CA1E 2XSBA 3UUNA 4NUUA 4V1Av 4O8SA 5A1LA 5LMUT 2UXCT 4HWIB 4CXYA 5FNVE 5JRCB 5LGUB 1IBLT 4PJMA 2FUPA 2CXDA 5ABHA 4ZZBA 2IDOB 3AE1A 3N9OA 4TNWA 4HWHA 5AQKB 4GKJT 4LF7T 2ZM0A 1BR0A 4UELA 1HCIA 4C91A 3RIUC 4YY3T 1DU2A 3ZMTB 2BS2A 4I43B 4B3ST 1D0XA 3H37A 3TLTA 2WM9A 2X66A 3F57A 2L3LA 3V5SA 2LSJA 3FZFB 1S94A 2LLYA 2YEVC 5AQSB 3ZJ2A 4ASKA 4EAHA 2X0YA 3B57A 3PUVF 5DQVA 5AQMB 2WZIA 4DV1T 4U7YA 2WDRA 3AEBA 4HFCA 4EOZB 5AQIB 3NKZA 2WB5A 2NW9A 5BMVE 3CKDA 4DMVA 3VKGA 2YDRA 1Y64B 3FZMB 4LF5T 3LJCA 1B7TA 2JIWA 2LSYA 5FVKA 2V5DA 3EDVA 3AXJB 1UX4A 5J1GA 5GONE 4K0UA 2FJDA 2V7KA 3X1DA 5DQWA 4CI2B 3ZMZB 2VVSA 2XAHB 3K3QC 5LHGB 4LF9T 2UXNB 5LJMA 4Z8XA 5L4HA 1S35A 4KBMB 4UEMA 3CX8B 2V7JA 4GKKT 3Q9DA 3N9PA 3RRCA 2MPKA 1IJ5A 3B5MA 2EHOD 1NWMX 3AAAB 2CLYC 2KLQA 4ILUA 1WR6A 4U7IA 4EYUA 2DL1A 3K1SA 1OEDC 3Q5WA 2LRKA 4YJ3E 2WZHA 2CMRA 2V26A 4ZI2C 4E7SA 1Y01A 4DV0T 1FEWA 1HS7A 3AEGA 2KMFA 4X1YE 2E9XD 4TV9E 1KF6A 2VB6A 2PFVA 3FB2A 3C50A 5EK4A 4DUYT 2ZM6T 3UU4A 3ZYLA 3ZC0A 3N9NA 1YKHB 5JDLA 2XTLA 5BR8T 3SOLA 1D1AA 4ZZCA 3RPUA 2BKPA 1WYCA 5LA6E 2Y6XA 2MOZA 5H6QB 3N9QA 2CWYA 3PE0A 3PUYF 4DV7T 4X1KE 2DI4A 2IMLA 3KVAA 3O1JA 2Y48B 2KZ7B 5FY7A 3UTKA 3UU8A 3FXDB 4GYRA 3EAMA 1KK7A 2YKSA 2G0UA 4ZHQE 2E9XA 3RQWA 4NIQA 4UV8B 3F31A 2VASA 3ZCJA 3TLWA 3FXEB 4PK6A 5LBQB 1XDOA 4HKAA 4MHCA 3LBXB 2WY2A 3HKDE 4PFPA 4YT0A 1N36T 1VCTA 4AKRB 2DHRA 2NW8A 2XJ7A 3ZSTA 4DR1T 2QA7A 2KWIB 3C64A 3ZMSB 4DO0A 4HGAA 1FIOA 1W0AA 3LG7A 1LVKA 3FZHB 4OHFA 3ZMVB 1OXZA 4P0AA 3N2OA 4HFDA 3JAEA 4WZXA 4B6XA 5F3JA 1OEDB 3P8CD 4B3MT 3UULA 3QNUA 4BA9A 5C8YE 2DNXA 4C90A 2JQ9A 3AEEA 2E8IA 2YN6A 3LK42 4DR5T 2KT9A 1SA0E 2XQ4A 4WNKA 1AJ3A 2RP4A 5J2UE 2QGSA 2VURA 3KBTA 4TNVA 1U4QA 5KMGP 4LFBT 5FYMA 4O4IE 1N34T 2WU5A 3RYIE 3D0TA 4UXNB
chains in the Genus database with same CATH topology
4ERRA 5ETWA 1EZ3A 3K3OA 2A2FX 4GOUA 2D0TA 3RKOA 3E22E 2X9XA 3AA7B 4FI5A 5FXZA 3FBLA 3UUXB 5ADXL 5J2UE 2X9WA 3OYZA 3HKCE 2KNDA 2CXFA 4IE7A 3MK7C 2PG8A 3C4XA 4L0RA 4M1PA 1ZV4X 3DP7A 2YINA 5E0OA 4IE6A 2VWAA 2Q9QD 3ETVA 2CM0A 2YU1A 3L09A 3QK6A 2E9XC 3FBZA 4UVAB 4EB6E 2LOSA 3C51A 5CA0E 5AFUL 2K24A 5L3CB 2B1EA 3N5LA 5J2TE 4IHJE 1ZHCA 1IJ6A 1ZEEA 2LSIA 3P7IA 3WAKA 2XAQB 3L3PA 3B13A 2WAUA 4UIGA 2EHOA 3RX6A 4O4HE 3AAIA 3N9MA 4ZOLE 5L3EB 4MALA 2IC6A 4KMCA 4NUVA 3ANWA 4H9PC 2VK9A 4MFRA 5L2LA 2PBIA 4GK5E 4I4TE 4P09A 3H3AA 2KWHA 2X0LB 3ZC1A 2V1DB 1IAPA 4L5GA 5HWYA 4PNIA 3HA4A 2D0UA 5HYAA 3CQCB 3U78A 2C5KT 5EZYE 4ZS3A 4X20E 4G2AA 4X1IE 5LBMA 2W61A 3MKDA 1D0YA 5LOVE 4IDZA 2D5UA 5DJQC 3RYHE 3CWZB 3NRYA 4I50E 4H9SE 4DNDA 4ADZA 4I55E 3PUGA 2ES0A 2LE8A 2VKDA 2NW7A 2WMNA 5TAOA 2PJQA 4CXXA 4QKNA 1MIYA 3PDYA 4HN9A 2X51A 1U5PA 2V7IA 2XUEA 2DWGA 4TUYE 5A1LA 5FY1A 4AKHA 3E0ZA 4ZI3C 3I0QA 1US7B 5JDNA 3UFEA 4ANJA 1UX5A 2GK9A 3OBVE 3CX6B 2IAKA 5JVDE 2D2SA 3JC6D 2EHOC 2XQYA 4ISSA 3SRZA 3UT5E 3MXZA 5JR9B 5LYJE 2IC9A 3AA0B 2W0GA 3TKLB 3Q2MA 2MBGA 1QSDA 2ZLYA 3K8PC 4PK4A 4ZI7E 4AQFA 5LNKA 4H9RC 3A5XA 2L8KA 4U72A 4CI1B 2H7OA 3EUHA 4JEHB 3JC6C 5HXSA 1HF8A 1LRZA 4IE5A 4QWNB 3O1IA 3CQGB 3O4XE 4UVBB 5DABA 3CMLA 2WMOA 4YHJA 2ZM8A 4AQGA 2Z6EA 5LHHB 2I59A 3LFMA 2Y8DA 3EDUA 2NP9A 4GYSA 4XAXB 4BAYB 4DBRA 3O9XA 4GIWA 5L3BB 4UV9B 3ZN0B 1Z0PA 3O1HA 4JUYA 3ZLIA 2LSKA 3NZPA 5IHYA 5CB4E 2IW5B 2VL8A 2CCQA 4CZZB 5LGTB 5KX5E 3RYFE 4QX7B 3HKEE 3NBXX 2YK0A 4PAGA 4GK0E 3AVSA 2C5IT 1BR1A 3N2KE 3ZMUB 3I9WA 4DMWA 1UCUA 4QHOA 2LJLA 2LM9A 3MA9A 3KBUA 3LK2B 5KDMC 3E08A 1HFAA 2ZM2A 3BK9A 3GWHA 4O4JE 1WLXA 2W00A 3ONXA 4OFZA 1D1CA 4IE4A 2NWBA 2K5BB 4MBQA 4YFSA 3ZEFB 2DLRA 2A72A 3UUMA 4AXPA 3GN5A 3IF8B 2LOPA 1HX8A 4PK5A 4BJMA 3MZKB 3BQIA 4IIJE 3T8OA 4HTEA 5FP3A 3S4UA 4EIWA 2WWUA 2W63A 4AQFC 5EK2A 1VOMA 1D1BA 1YKEB 3F2EA 2V7MA 3J9X1 4TN7B 3SS1A 4U74A 4E7ZA 2LHRA 3NRXA 4H9NC 4YJ2E 1G8XA 4O2BE 3ZJ1A 2ZMAA 3KFWX 1MNEA 4CXWA 5HWXA 2ACXA 3PU3A 5EK3A 3NZQA 3C4WA 2VKHA 5HXEA 1MIWA 3QC9A 1LVFA 3LBXA 3N2GE 2DWKA 4HE8A 4TX5A 3RRWA 3RYCE 4DBQA 2MYSA 1KNZA 4IE0A 5JR9A 4PJNA 2E9XB 4UF0A 3ZYMA 4AKIA 2JRKA 3GMIA 4H9QC 3ZCIA 1YW0A 3DTOA 3BQLA 2EHOB 3PTRB 4QXBB 3U3IA 4EZHA 5H6RB 2UXXB 1IZNB 5LGNB 3VKHA 2K48A 4O4LE 4QXHB 3CX7B 3KVBA 2A3DA 2Q9QA 4PFOA 4TZ4C 3PUAA 2CLYB 2N2NA 3KV5A 1QUUA 2CA5A 5JREA 2MTQA 4ZI3D 1NAFA 3N9LA 4AKLA 1ZKEA 1H7CA 1YD8G 5HXRA 2Q9QB 1V9DA 2ODVA 4HFVA 4CI3B 4ZI2D 3RH3A 4EZ4A 5IYZE 3KDSE 3IEEA 4PJLA 3I9YA 3PUSA 4J2CA 1WRDA 3HKBE 4DVDA 3OKQA 4XZCA 2HH7A 3AA1B 3C4ZA 1MMAA 5LXTE 2BDEA 4UF0B 3CVRA 2HPJA 2XASB 1MMNA 2XAJB 5M4YA 1HG2A 5FXXA 1D0ZA 4EYYR 2XHEB 5FMNA 3AAEB 3RC3A 3VU7H 2H3RA 3C98B 4WBOA 2C5JA 5JR9C 2NOXA 4MLKA 4UVCB 1FMVA 1MNDA 4YLHA 5JQGE 4XBFB 4PJJA 2V7LA 2HPLA 3ZYKA 2BVLA 4JLEA 1CUNA 3MACA 2JMHA 3PUQA 1MMGA 2CE7A 2BVMA 1OWAA 3KINB 3OJAA 5LHIB 3M65A 2M67A 2JPFA 5JRCA 2C0SA 5L3FB 5F8PA 4H63V 3WI3A 4IGUA 5JH7E 1FMWA 3RC8A 1BR4A 2KXPB 2H7VC 3W15B 2Q9QC 2VKOA 4OK0A 5HXCA 3V5UA 2J1DG 2XAFB 5HXHA 3AVRA 4H9OC 3IBPA 3Q5XA 4L9IA 4QX8B 2NTYA 3ZC0A 3QUJA 5JDQA 2CEAA 4HEAA 2XAGB 2SPCA 4PW8A 3KV6A 1VRBA 3CQXC 3R6NA 5LP6E 3ESLA 3HI2A 5LCYA 3I1AA 3AA6B 5L3GB 5FXWA 2JMKA 1LKXA 3BQKA 2JJ9A 4P0BA 5L3DB 2ODUA 3LK3B 3AB3B 2OA5A 2VKJA 3K3NA 5JDGA 4FJOA 3DJBA 3EVYA 2CWOA 2LSGA 3I0OA 3OYXA 3PU8A 4KP3C 3ANWB 1E1HB 5FY0A 4O2AE 4TV8E 1T98A 3ETUA 2JQQA 2DCFA 2X9YA 1BR2A 3FHNA 3ZN1B 2L9QA 2X9HA 4F6RC 3GN5B 1HTJF 2YU2A 3HL6A 1HG5A 3MJXA 4AI6A 5HAXA 2W62A 2K9AA 3KV9A 1X79A 2N9DA 2WSSV 5JDFA 2BZBA 2RA1A 4EXTA 3WAJA 2KINB 4CQIA 3J7Yq 2LEHA 4AKGA 4QXCB 3IHRA 4A56A 4OYKA 4WW0A 4BJNA 2WBLA 5FXVA 1WYBA 1G73A 2LT3A 1MIVA 1O3XA 4G63A 5JDHA 2NTXA 3PURA 4N78D 3SWHA 2P9BA 2N1GA 5LG4A 3CPZA 2X67A 3VHLA 3HR0A 1MMDA 3R84B 4WBNE 4ISTA 3KV4A 3GA8A 4KUMB 3ZPOA 4ZS2A 4OYJA 1SHZC 4H63H 2CXLA 2LHNA 4JEUB 5CA1E 3UUNA 4NUUA 4V1Av 4O8SA 4CXYA 5FNVE 5JRCB 5LGUB 4PJMA 2CXDA 3N9OA 2ZM0A 1BR0A 4UELA 1HCIA 4C91A 3ZMTB 4I43B 3H37A 1D0XA 2WM9A 2X66A 3F57A 2L3LA 3V5SA 2LSJA 1S94A 2YEVC 3ZJ2A 4ASKA 4EAHA 3B57A 5DQVA 4EOZB 2NW9A 5BMVE 3CKDA 4DMVA 3VKGA 1Y64B 3LJCA 1B7TA 2LSYA 3EDVA 1UX4A 5J1GA 5GONE 4K0UA 2V7KA 5DQWA 4CI2B 3ZMZB 2XAHB 3K3QC 5LHGB 2UXNB 5LJMA 4Z8XA 1S35A 4KBMB 4UEMA 3CX8B 2V7JA 3Q9DA 3N9PA 3RRCA 4ILUA 1IJ5A 5JDMA 2EHOD 1NWMX 3AAAB 2CLYC 2KLQA 4EYUA 1WR6A 3Q5WA 4YJ3E 2CMRA 2V26A 4ZI2C 4E7SA 1HS7A 1FEWA 4X1YE 2KMFA 2E9XD 4TV9E 2VB6A 2PFVA 3FB2A 3C50A 5EK4A 3ZYLA 3N9NA 1YKHB 5JDLA 2XTLA 3SOLA 1D1AA 3RPUA 1WYCA 5LA6E 2Y6XA 2MOZA 5H6QB 3N9QA 2CWYA 3PE0A 4X1KE 2DI4A 3KVAA 3O1JA 3UTKA 2Y48B 2KZ7B 5FY7A 5LJNA 3FXDB 4GYRA 1KK7A 2G0UA 4ZHQE 2E9XA 4UV8B 3F31A 2VASA 3ZCJA 3FXEB 4PK6A 5LBQB 4HKAA 4MHCA 3LBXB 3HKDE 4PFPA 4AKRB 2DHRA 2NW8A 2QA7A 2KWIB 3C64A 3ZMSB 4DO0A 4HGAA 1FIOA 3LG7A 1LVKA 4OHFA 3ZMVB 1OXZA 4P0AA 3N2OA 4B6XA 5F3JA 3P8CD 3UULA 4BA9A 5C8YE 2DNXA 4C90A 2E8IA 3LK42 2KT9A 1SA0E 4WNKA 1AJ3A 2RP4A 2QGSA 3KBTA 5KMGP 1U4QA 5FYMA 4O4IE 2X68A 3RYIE 3D0TA 4UXNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBM B;  2LT3 A;  4XAX B;  4KMC A;  4MFR A;  4ILU A;  4L5G A; 
#chains in the Genus database with same CATH topology
 1OED A;  2V6X A;  4ERR A;  5LMN T;  5ETW A;  1EZ3 A;  3K3O A;  2A2F X;  1M62 A;  2D0T A;  2QVA A;  4GOU A;  4TWF A;  5AQN B;  3RKO A;  4HFE A;  4IL9 A;  1IBM T;  3AE7 A;  3E22 E;  2X9X A;  2XM1 A;  4JI4 T;  3AA7 B;  4FI5 A;  5FXZ A;  2CPT A;  2LRL A;  3FBL A;  3UUX B;  4IDO A;  4ZXL A;  2X9W A;  5ADX L;  1UUS A;  1WR0 A;  3HKC E;  3OYZ A;  2KND A;  2HN1 A;  2CXF A;  2F4V T;  3AXJ A;  4IE7 A;  3MK7 C;  2PG8 A;  3C4X A;  4L0R A;  2YDS A;  4M1P A;  1ZV4 X;  2H88 A;  3DP7 A;  2YIN A;  5E0O A;  2LKG A;  2MAW A;  5F5W A;  4QH4 A;  4IE6 A;  2VWA A;  2Q9Q D;  3ETV A;  1W09 A;  2CBJ A;  2CM0 A;  2HN2 A;  2YU1 A;  3L09 A;  3QK6 A;  5AQL B;  2E9X C;  4COF A;  3FBZ A;  3LSV A;  4UVA B;  4EB6 E;  1E2A A;  2LOS A;  3C51 A;  2XSA A;  2WDQ A;  3PUZ F;  4HFI A;  5CA0 E;  5AFU L;  4AIU A;  2K24 A;  4I0U A;  3AE6 A;  5L3C B;  2I0M A;  1KNR A;  2B1E A;  3N5L A;  5J2T E;  1HNZ T;  2OLT A;  4IHJ E;  1ZHC A;  3RGL A;  1IJ6 A;  4JI2 T;  3PUW F;  1ZEE A;  2LSI A;  3P7I A;  3QOF A;  2YDQ A;  2XAQ B;  3WAK A;  3L3P A;  1XNR T;  3B13 A;  2WAU A;  5ABG A;  4A98 A;  4UIG A;  2EHO A;  1KFY A;  3RX6 A;  4AIS A;  4O4H E;  3AEC A;  3P4S A;  4P1N A;  4KHZ F;  3AAI A;  3N9M A;  2X68 A;  4ZOL E;  5L3E B;  4MAL A;  5LNK A;  2IC6 A;  4KMC A;  3JAD A;  4NUV A;  3ANW A;  4H9P C;  2VK9 A;  4MFR A;  5L2L A;  2PBI A;  4GK5 E;  3LDQ B;  4I4T E;  3TLV A;  4P09 A;  4DR2 T;  2W67 A;  3H3A A;  4YSY A;  2OV9 A;  2KWH A;  2X0L B;  3IA3 A;  2CHO A;  3AE2 A;  2V1D B;  1IAP A;  2E2A A;  3ZC1 A;  4LFC T;  4A97 A;  3AEA A;  4HWF A;  4NXN T;  4L5G A;  5HWY A;  4A5X A;  4PNI A;  4EV6 A;  3EHZ A;  1YQ4 A;  3HA4 A;  3SFD A;  2D0U A;  3VR9 A;  5HYA A;  3CQC B;  3U78 A;  2C5K T;  5EZY E;  4ZS3 A;  5FL0 A;  4X20 E;  2JQK A;  4LF6 T;  4G2A A;  4X1I E;  5HEH A;  5LBM A;  2W61 A;  3MKD A;  1D0Y A;  5LOV E;  5CGM A;  4DR4 T;  4U2Z A;  4IDZ A;  2D5U A;  5DJQ C;  3RYH E;  4NPP A;  3L39 A;  4WYV A;  3CWZ B;  4EED A;  3NRY A;  4I50 E;  4LML A;  4CN4 A;  4H9S E;  4DND A;  4ADZ A;  4I55 E;  3PUG A;  2ES0 A;  2LE8 A;  2VKD A;  2NW7 A;  2WMN A;  1SE7 A;  5TAO A;  4YSZ A;  5IUX A;  2PJQ A;  4X5T A;  4CXX A;  2UUC T;  2E5L T;  4QKN A;  1UGO A;  1MIY A;  3PDY A;  4TWD A;  1QLB A;  4HN9 A;  2X51 A;  1L0V A;  5AQG B;  2WU2 A;  4U33 A;  3L8R A;  1U5P A;  2V7I A;  2XUE A;  2DWG A;  4TUY E;  5LB7 B;  2XQ3 A;  5FY1 A;  1YXR A;  3RIA A;  5HEG A;  4K0K T;  4AKH A;  2XQ6 A;  3E0Z A;  3PJA J;  4ZI3 C;  3I0Q A;  1US7 B;  5JDN A;  2VVN A;  1KNZ A;  3UFE A;  4YHH T;  4ANJ A;  2H89 A;  1UX5 A;  2GK9 A;  3OBV E;  1IBK T;  3CX6 B;  2IAK A;  5JVD E;  2D2S A;  2IHR 1;  2EHO C;  2XQY A;  3JC6 D;  4ISS A;  3SRZ A;  4IDP A;  3UT5 E;  4X62 T;  1I94 T;  5AQF B;  4JI7 T;  3MXZ A;  3QB5 K;  5JR9 B;  5LYJ E;  2IC9 A;  3AA0 B;  2W0G A;  3TKL B;  1WFD A;  1VCS A;  3Q2M A;  5AQP B;  1QSD A;  2ZLY A;  2MBG A;  3AED A;  5AQH B;  4NXM T;  3K8P C;  5KXJ A;  3AE8 A;  4PK4 A;  4ZI7 E;  4JI0 T;  4IDQ A;  3UUB A;  4AQF A;  4H9R C;  3A5X A;  2L8K A;  5L4E A;  4IL4 A;  4U72 A;  4CI1 B;  2H7O A;  3EUH A;  4F8H A;  4JEH B;  3JC6 C;  4EGW A;  4IDN A;  5HXS A;  1HF8 A;  1LRZ A;  4IE5 A;  4QWN B;  3O1I A;  3CQG B;  3O4X E;  4UVB B;  5DAB A;  1JNZ A;  3CML A;  2WMO A;  4YHJ A;  2ZM8 A;  4Z90 A;  5AQR B;  2V5C A;  2Z6E A;  3P4Q A;  4AQG A;  5LHH B;  2I59 A;  3UU6 A;  3A8Y C;  4JV5 T;  3LFM A;  2NR4 A;  2Y8D A;  1J1J A;  2NP9 A;  3EDU A;  4GYS A;  2VL0 A;  1W9R A;  4XAX B;  4ILC A;  4BAY B;  4DBR A;  4KX6 A;  5HEU A;  3O9X A;  1XMQ T;  4GIW A;  5L3B B;  5AQQ B;  4UV9 B;  5C2T A;  3ZN0 B;  1Z0P A;  3O1H A;  2FJB A;  4JUY A;  1NEN A;  3ZLI A;  3RIF A;  2LSK A;  4DV6 T;  3NZP A;  5IHY A;  5CB4 E;  2IW5 B;  2VL8 A;  2CCQ A;  4CZZ B;  5LGT B;  5KX5 E;  3RYF E;  4QX7 B;  1N33 T;  1UUR A;  3HKE E;  2W66 A;  1T8B A;  4HFB A;  3NBX X;  4KHP T;  2YK0 A;  4PAG A;  4GK0 E;  3AVS A;  2C5I T;  1BR1 A;  3ABV A;  3N2K E;  3ZMU B;  3I9W A;  3OPC A;  1I6Z A;  2CHN A;  4DMW A;  1UCU A;  4QHO A;  2LJL A;  4DR7 T;  2LM9 A;  3MA9 A;  3KBU A;  3LK2 B;  5KDM C;  3E08 A;  2J47 A;  1HFA A;  2J62 A;  2ZM2 A;  3BK9 A;  4DV2 T;  3GWH A;  3NWI A;  4O4J E;  3VR8 A;  1WLX A;  3AE4 A;  2W00 A;  2WQY A;  1ZP0 A;  2V8S V;  5L47 A;  2K3W A;  2W4X A;  1D1C A;  3ONX A;  2NWB A;  2K5B B;  4IE4 A;  4MBQ A;  4OFZ A;  4YFS A;  4HWC A;  2DLR A;  2A72 A;  3UUM A;  4AXP A;  2FJA A;  3GN5 A;  2BBJ A;  3IF8 B;  2LOP A;  1HX8 A;  1R8I A;  2BG9 A;  4PK5 A;  1XMO T;  1HNX T;  5LJN A;  4BJM A;  2J4G A;  3ZKR A;  3FZL B;  3MZK B;  3BQI A;  4IIJ E;  3T8O A;  4HTE A;  5FP3 A;  3S4U A;  4EIW A;  2WWU A;  2W63 A;  4AQF C;  5EK2 A;  1VOM A;  3RHW A;  1D1B A;  1YKE B;  2UUA T;  4X66 T;  4JI1 T;  3F2E A;  2V7M A;  3J9X 1;  4YXD A;  4TN7 B;  3SS1 A;  4U74 A;  2BKN A;  4E7Z A;  4YSX A;  2CBI A;  2LHR A;  3NRX A;  2QRX A;  2FBW A;  4H9N C;  1G8X A;  4O2B E;  3ZSS A;  3RQU A;  4YJ2 E;  3ZJ1 A;  2ZMA A;  3KFW X;  1MNE A;  2RPA A;  4CXW A;  5HWX A;  1XDP A;  2ACX A;  3PU3 A;  3UU3 A;  5IWA T;  5EK3 A;  1Z8U A;  2JQH A;  2KSR A;  3NZQ A;  3C4W A;  4LMJ A;  2VKH A;  3G06 A;  2M6I A;  5HXE A;  3RF1 A;  1MIW A;  3QC9 A;  5J0Z A;  1LVF A;  4OX9 T;  3LBX A;  2YOE A;  3N2G E;  2DWK A;  4HE8 A;  4TX5 A;  1GQE A;  3RRW A;  3RYC E;  2MYS A;  4DBQ A;  4YTP A;  3VRA A;  4IE0 A;  2WDV A;  2R6G F;  1NEK A;  5JR9 A;  4PJN A;  3UFG A;  1HX1 B;  2E9X B;  2V6Y A;  1N32 T;  3EI0 A;  3ONL C;  4UF0 A;  3ZYM A;  4AKI A;  3AEF A;  1T7S A;  2JRK A;  3GMI A;  4H9Q C;  1XWM A;  3RKG A;  1YW0 A;  3ZCI A;  2UU9 T;  4DID B;  3DTO A;  3BQL A;  3M3Z B;  2EHO B;  3PTR B;  4QXB B;  3U3I A;  2BKO A;  2UXB T;  4EZH A;  3PUX F;  5H6R B;  2IUB A;  2UXX B;  1IZN B;  2AXD S;  4UR9 A;  5LGN B;  3VKH A;  2XQ8 A;  1M7K A;  2K48 A;  4O4L E;  4QXH B;  4TWH A;  3CX7 B;  3KVB A;  2A3D A;  2Q9Q A;  4PFO A;  4DVD A;  4HWD A;  4TZ4 C;  3PUA A;  2CLY B;  2N2N A;  3KV5 A;  3Q5D A;  1QUU A;  2CA5 A;  2XZE A;  3TLS A;  4YTN A;  5JRE A;  4B3T T;  4DR6 T;  2MTQ A;  3P4P A;  3JAF A;  4Q25 A;  4ZI3 D;  1NAF A;  3N9L A;  4AKL A;  1KNP A;  4X64 T;  1E7P A;  1ZKE A;  2ACZ A;  2BG9 C;  1H7C A;  2BG9 B;  4KI0 F;  1YD8 G;  5HXR A;  1J5E T;  2UXD T;  2Q9Q B;  3PV0 F;  1V9D A;  2ODV A;  2X0H A;  1J5W A;  4HFV A;  4CI3 B;  4ZI2 D;  2LKH A;  2HHH T;  2B76 A;  3P50 A;  4CN1 A;  2XPK A;  3RH3 A;  4EZ4 A;  5HCJ A;  5IYZ E;  3KDS E;  3IEE A;  4PJL A;  3RLF F;  3I9Y A;  4JI8 T;  3PUS A;  2XQ5 A;  1WRD A;  3HKB E;  4J2C A;  3OKQ A;  4XZC A;  5AQJ B;  2HH7 A;  3AA1 B;  3C4Z A;  1JNR A;  1MMA A;  5LXT E;  1HR0 T;  2BDE A;  4UF0 B;  3CVR A;  2HPJ A;  2XAS B;  2V6Y B;  5HEO A;  1MMN A;  2XAJ B;  5M4Y A;  4DUZ T;  1HG2 A;  5FXX A;  1D0Z A;  4LF8 T;  4EYY R;  2XHE B;  2CRB A;  4LMK A;  4AQY T;  2WS3 A;  5FMN A;  3AAE B;  3RC3 A;  3VU7 H;  2H3R A;  3C98 B;  2PTF A;  4WBO A;  3ZT5 A;  2C5J A;  5JR9 C;  2NOX A;  4MLK A;  4UVC B;  2WCA A;  1FMV A;  1MND A;  1W0B A;  2W2U A;  2FJE A;  4YLH A;  5FL1 A;  4PJJ A;  5JQG E;  2V7L A;  3TLU A;  2HPL A;  4XBF B;  3ZYK A;  5ABE A;  2BVL A;  2BS4 A;  5L3D B;  5C3J A;  2XQA A;  4JLE A;  4JI3 T;  1CUN A;  3MAC A;  2JMH A;  3PUQ A;  3A7M A;  4X65 T;  1MMG A;  2CE7 A;  2BVM A;  1OWA A;  3KIN B;  3OJA A;  5LHI B;  3M65 A;  2M67 A;  2JPF A;  4LF4 T;  2C0S A;  4LFA T;  4B3R T;  5JRC A;  5L3F B;  3T1Y T;  5F8P A;  4H63 V;  5AQO B;  3WI3 A;  4IGU A;  5JH7 E;  1FMW A;  5AQV B;  1XNQ T;  3RC8 A;  1BR4 A;  1FJG T;  2KXP B;  5JDM A;  2H7V C;  3W15 B;  2Q9Q C;  2VKO A;  4OK0 A;  3P4W A;  5HXC A;  3P4R A;  3V5U A;  2BBH A;  1SUM B;  2J1D G;  2XAF B;  2XQ7 A;  3AVR A;  5CJ5 A;  5HXH A;  4H9O C;  3IBP A;  3Q5X A;  1T72 A;  1UK5 A;  2NTY A;  3JCF A;  3QB5 A;  3QUJ A;  4L9I A;  4QX8 B;  5JDQ A;  5AQT B;  2CEA A;  4HEA A;  2XAG B;  2SPC A;  1CHU A;  4PW8 A;  3KV6 A;  1VRB A;  3CQX C;  4DV3 T;  2QYW A;  3NVO A;  3ZT6 A;  3R6N A;  4JI6 T;  5LP6 E;  3ESL A;  3HI2 A;  5LCY A;  3I1A A;  4DV5 T;  4IT4 A;  3AA6 B;  3VRB A;  5L3G B;  3UQ7 A;  5FXW A;  2JMK A;  1LKX A;  2XY8 B;  2JJ9 A;  3BQK A;  4ILA A;  2ODU A;  4P0B A;  3LK3 B;  3AB3 B;  3H3M A;  3AE9 A;  3AE3 A;  2WWV A;  3FZK B;  2BS3 A;  2OA5 A;  1HNW T;  2VKJ A;  3K3N A;  3PJA A;  5ABF B;  3RI5 A;  3T1H T;  4U2Y A;  5JDG A;  4ZEY A;  4FJO A;  3DJB A;  3EVY A;  2CWO A;  2LSG A;  3I0O A;  3OYX A;  3PU8 A;  4KP3 C;  3UU5 A;  2E5V A;  3ANW B;  3RIU A;  2WP9 A;  4DR3 T;  1E1H B;  5FY0 A;  2VQF T;  2AE9 A;  4O2A E;  4TV8 E;  4CN6 A;  1T98 A;  3ETU A;  2JQQ A;  2DCF A;  2X9Y A;  1BR2 A;  2I6H A;  3AE5 A;  2L9Q A;  3FHN A;  3OVU A;  4Z91 A;  3ZN1 B;  4IRE A;  2X9H A;  4F6R C;  2M6B A;  1YQ3 A;  3CK6 A;  3GN5 B;  1HTJ F;  2YU2 A;  3HL6 A;  1HG5 A;  3MJX A;  4U31 A;  5HAX A;  4AI6 A;  2W62 A;  2XQ9 A;  3OTO T;  3Q5E A;  2K9A A;  3UQ4 A;  3KV9 A;  2IIU A;  4ILB A;  1X79 A;  2N9D A;  2WSS V;  5JDF A;  5ABF A;  2BZB A;  2RA1 A;  4EXT A;  3WAJ A;  2KIN B;  4CQI A;  3J7Y q;  2LEH A;  4AKG A;  4QXC B;  3IHR A;  4A56 A;  2UUB T;  4OYK A;  4YTM A;  3ZT7 A;  4U3C A;  1WCR A;  4WW0 A;  3CIR A;  4BJN A;  1X9B A;  2WBL A;  5FXV A;  1WYB A;  5FVL A;  1G73 A;  2LT3 A;  4QH5 A;  1MIV A;  1O3X A;  4G63 A;  3SFE A;  4JBW F;  1KEY A;  5JDH A;  2NTX A;  3PUR A;  4N78 D;  3ZEF B;  5LG3 A;  3SWH A;  2P9B A;  5HCM A;  4DV4 T;  1OED E;  1XZY A;  2VQE T;  2N1G A;  5LG4 A;  2XM2 A;  2D9D A;  3CPZ A;  2X67 A;  3VHL A;  3HR0 A;  1MMD A;  3R84 B;  5JTG A;  4WBN E;  1ZOY A;  5HEJ A;  4IST A;  2LM2 A;  3KV4 A;  3GA8 A;  4KUM B;  5AQU B;  5FKY A;  2BG9 E;  3EAB A;  4JI5 T;  3ZPO A;  4ZS2 A;  2A9U A;  3ONJ A;  4OYJ A;  1SHZ C;  4H63 H;  2CXL A;  2LHN A;  4QH1 A;  5CFB A;  4JYA T;  4JEU B;  4HFH A;  4EEB A;  5CA1 E;  2XSB A;  3UUN A;  4NUU A;  4V1A v;  4O8S A;  5A1L A;  5LMU T;  2UXC T;  4HWI B;  4CXY A;  5FNV E;  5JRC B;  5LGU B;  1IBL T;  4PJM A;  2FUP A;  2CXD A;  5ABH A;  4ZZB A;  2IDO B;  3AE1 A;  3N9O A;  4TNW A;  4HWH A;  5AQK B;  4GKJ T;  4LF7 T;  2ZM0 A;  1BR0 A;  4UEL A;  1HCI A;  4C91 A;  3RIU C;  4YY3 T;  1DU2 A;  3ZMT B;  2BS2 A;  4I43 B;  4B3S T;  1D0X A;  3H37 A;  3TLT A;  2WM9 A;  2X66 A;  3F57 A;  2L3L A;  3V5S A;  2LSJ A;  3FZF B;  1S94 A;  2LLY A;  2YEV C;  5AQS B;  3ZJ2 A;  4ASK A;  4EAH A;  2X0Y A;  3B57 A;  3PUV F;  5DQV A;  5AQM B;  2WZI A;  4DV1 T;  4U7Y A;  2WDR A;  3AEB A;  4HFC A;  4EOZ B;  5AQI B;  3NKZ A;  2WB5 A;  2NW9 A;  5BMV E;  3CKD A;  4DMV A;  3VKG A;  2YDR A;  1Y64 B;  3FZM B;  4LF5 T;  3LJC A;  1B7T A;  2JIW A;  2LSY A;  5FVK A;  2V5D A;  3EDV A;  3AXJ B;  1UX4 A;  5J1G A;  5GON E;  4K0U A;  2FJD A;  2V7K A;  3X1D A;  5DQW A;  4CI2 B;  3ZMZ B;  2VVS A;  2XAH B;  3K3Q C;  5LHG B;  4LF9 T;  2UXN B;  5LJM A;  4Z8X A;  5L4H A;  1S35 A;  4KBM B;  4UEM A;  3CX8 B;  2V7J A;  4GKK T;  3Q9D A;  3N9P A;  3RRC A;  2MPK A;  1IJ5 A;  3B5M A;  2EHO D;  1NWM X;  3AAA B;  2CLY C;  2KLQ A;  4ILU A;  1WR6 A;  4U7I A;  4EYU A;  2DL1 A;  3K1S A;  1OED C;  3Q5W A;  2LRK A;  4YJ3 E;  2WZH A;  2CMR A;  2V26 A;  4ZI2 C;  4E7S A;  1Y01 A;  4DV0 T;  1FEW A;  1HS7 A;  3AEG A;  2KMF A;  4X1Y E;  2E9X D;  4TV9 E;  1KF6 A;  2VB6 A;  2PFV A;  3FB2 A;  3C50 A;  5EK4 A;  4DUY T;  2ZM6 T;  3UU4 A;  3ZYL A;  3ZC0 A;  3N9N A;  1YKH B;  5JDL A;  2XTL A;  5BR8 T;  3SOL A;  1D1A A;  4ZZC A;  3RPU A;  2BKP A;  1WYC A;  5LA6 E;  2Y6X A;  2MOZ A;  5H6Q B;  3N9Q A;  2CWY A;  3PE0 A;  3PUY F;  4DV7 T;  4X1K E;  2DI4 A;  2IML A;  3KVA A;  3O1J A;  2Y48 B;  2KZ7 B;  5FY7 A;  3UTK A;  3UU8 A;  3FXD B;  4GYR A;  3EAM A;  1KK7 A;  2YKS A;  2G0U A;  4ZHQ E;  2E9X A;  3RQW A;  4NIQ A;  4UV8 B;  3F31 A;  2VAS A;  3ZCJ A;  3TLW A;  3FXE B;  4PK6 A;  5LBQ B;  1XDO A;  4HKA A;  4MHC A;  3LBX B;  2WY2 A;  3HKD E;  4PFP A;  4YT0 A;  1N36 T;  1VCT A;  4AKR B;  2DHR A;  2NW8 A;  2XJ7 A;  3ZST A;  4DR1 T;  2QA7 A;  2KWI B;  3C64 A;  3ZMS B;  4DO0 A;  4HGA A;  1FIO A;  1W0A A;  3LG7 A;  1LVK A;  3FZH B;  4OHF A;  3ZMV B;  1OXZ A;  4P0A A;  3N2O A;  4HFD A;  3JAE A;  4WZX A;  4B6X A;  5F3J A;  1OED B;  3P8C D;  4B3M T;  3UUL A;  3QNU A;  4BA9 A;  5C8Y E;  2DNX A;  4C90 A;  2JQ9 A;  3AEE A;  2E8I A;  2YN6 A;  3LK4 2;  4DR5 T;  2KT9 A;  1SA0 E;  2XQ4 A;  4WNK A;  1AJ3 A;  2RP4 A;  5J2U E;  2QGS A;  2VUR A;  3KBT A;  4TNV A;  1U4Q A;  5KMG P;  4LFB T;  5FYM A;  4O4I E;  1N34 T;  2WU5 A;  3RYI E;  3D0T A;  4UXN B; 
#chains in the Genus database with same CATH homology
 4ERR A;  5ETW A;  1EZ3 A;  3K3O A;  2A2F X;  4GOU A;  2D0T A;  3RKO A;  3E22 E;  2X9X A;  3AA7 B;  4FI5 A;  5FXZ A;  3FBL A;  3UUX B;  5ADX L;  5J2U E;  2X9W A;  3OYZ A;  3HKC E;  2KND A;  2CXF A;  4IE7 A;  3MK7 C;  2PG8 A;  3C4X A;  4L0R A;  4M1P A;  1ZV4 X;  3DP7 A;  2YIN A;  5E0O A;  4IE6 A;  2VWA A;  2Q9Q D;  3ETV A;  2CM0 A;  2YU1 A;  3L09 A;  3QK6 A;  2E9X C;  3FBZ A;  4UVA B;  4EB6 E;  2LOS A;  3C51 A;  5CA0 E;  5AFU L;  2K24 A;  5L3C B;  2B1E A;  3N5L A;  5J2T E;  4IHJ E;  1ZHC A;  1IJ6 A;  1ZEE A;  2LSI A;  3P7I A;  3WAK A;  2XAQ B;  3L3P A;  3B13 A;  2WAU A;  4UIG A;  2EHO A;  3RX6 A;  4O4H E;  3AAI A;  3N9M A;  4ZOL E;  5L3E B;  4MAL A;  2IC6 A;  4KMC A;  4NUV A;  3ANW A;  4H9P C;  2VK9 A;  4MFR A;  5L2L A;  2PBI A;  4GK5 E;  4I4T E;  4P09 A;  3H3A A;  2KWH A;  2X0L B;  3ZC1 A;  2V1D B;  1IAP A;  4L5G A;  5HWY A;  4PNI A;  3HA4 A;  2D0U A;  5HYA A;  3CQC B;  3U78 A;  2C5K T;  5EZY E;  4ZS3 A;  4X20 E;  4G2A A;  4X1I E;  5LBM A;  2W61 A;  3MKD A;  1D0Y A;  5LOV E;  4IDZ A;  2D5U A;  5DJQ C;  3RYH E;  3CWZ B;  3NRY A;  4I50 E;  4H9S E;  4DND A;  4ADZ A;  4I55 E;  3PUG A;  2ES0 A;  2LE8 A;  2VKD A;  2NW7 A;  2WMN A;  5TAO A;  2PJQ A;  4CXX A;  4QKN A;  1MIY A;  3PDY A;  4HN9 A;  2X51 A;  1U5P A;  2V7I A;  2XUE A;  2DWG A;  4TUY E;  5A1L A;  5FY1 A;  4AKH A;  3E0Z A;  4ZI3 C;  3I0Q A;  1US7 B;  5JDN A;  3UFE A;  4ANJ A;  1UX5 A;  2GK9 A;  3OBV E;  3CX6 B;  2IAK A;  5JVD E;  2D2S A;  3JC6 D;  2EHO C;  2XQY A;  4ISS A;  3SRZ A;  3UT5 E;  3MXZ A;  5JR9 B;  5LYJ E;  2IC9 A;  3AA0 B;  2W0G A;  3TKL B;  3Q2M A;  2MBG A;  1QSD A;  2ZLY A;  3K8P C;  4PK4 A;  4ZI7 E;  4AQF A;  5LNK A;  4H9R C;  3A5X A;  2L8K A;  4U72 A;  4CI1 B;  2H7O A;  3EUH A;  4JEH B;  3JC6 C;  5HXS A;  1HF8 A;  1LRZ A;  4IE5 A;  4QWN B;  3O1I A;  3CQG B;  3O4X E;  4UVB B;  5DAB A;  3CML A;  2WMO A;  4YHJ A;  2ZM8 A;  4AQG A;  2Z6E A;  5LHH B;  2I59 A;  3LFM A;  2Y8D A;  3EDU A;  2NP9 A;  4GYS A;  4XAX B;  4BAY B;  4DBR A;  3O9X A;  4GIW A;  5L3B B;  4UV9 B;  3ZN0 B;  1Z0P A;  3O1H A;  4JUY A;  3ZLI A;  2LSK A;  3NZP A;  5IHY A;  5CB4 E;  2IW5 B;  2VL8 A;  2CCQ A;  4CZZ B;  5LGT B;  5KX5 E;  3RYF E;  4QX7 B;  3HKE E;  3NBX X;  2YK0 A;  4PAG A;  4GK0 E;  3AVS A;  2C5I T;  1BR1 A;  3N2K E;  3ZMU B;  3I9W A;  4DMW A;  1UCU A;  4QHO A;  2LJL A;  2LM9 A;  3MA9 A;  3KBU A;  3LK2 B;  5KDM C;  3E08 A;  1HFA A;  2ZM2 A;  3BK9 A;  3GWH A;  4O4J E;  1WLX A;  2W00 A;  3ONX A;  4OFZ A;  1D1C A;  4IE4 A;  2NWB A;  2K5B B;  4MBQ A;  4YFS A;  3ZEF B;  2DLR A;  2A72 A;  3UUM A;  4AXP A;  3GN5 A;  3IF8 B;  2LOP A;  1HX8 A;  4PK5 A;  4BJM A;  3MZK B;  3BQI A;  4IIJ E;  3T8O A;  4HTE A;  5FP3 A;  3S4U A;  4EIW A;  2WWU A;  2W63 A;  4AQF C;  5EK2 A;  1VOM A;  1D1B A;  1YKE B;  3F2E A;  2V7M A;  3J9X 1;  4TN7 B;  3SS1 A;  4U74 A;  4E7Z A;  2LHR A;  3NRX A;  4H9N C;  4YJ2 E;  1G8X A;  4O2B E;  3ZJ1 A;  2ZMA A;  3KFW X;  1MNE A;  4CXW A;  5HWX A;  2ACX A;  3PU3 A;  5EK3 A;  3NZQ A;  3C4W A;  2VKH A;  5HXE A;  1MIW A;  3QC9 A;  1LVF A;  3LBX A;  3N2G E;  2DWK A;  4HE8 A;  4TX5 A;  3RRW A;  3RYC E;  4DBQ A;  2MYS A;  1KNZ A;  4IE0 A;  5JR9 A;  4PJN A;  2E9X B;  4UF0 A;  3ZYM A;  4AKI A;  2JRK A;  3GMI A;  4H9Q C;  3ZCI A;  1YW0 A;  3DTO A;  3BQL A;  2EHO B;  3PTR B;  4QXB B;  3U3I A;  4EZH A;  5H6R B;  2UXX B;  1IZN B;  5LGN B;  3VKH A;  2K48 A;  4O4L E;  4QXH B;  3CX7 B;  3KVB A;  2A3D A;  2Q9Q A;  4PFO A;  4TZ4 C;  3PUA A;  2CLY B;  2N2N A;  3KV5 A;  1QUU A;  2CA5 A;  5JRE A;  2MTQ A;  4ZI3 D;  1NAF A;  3N9L A;  4AKL A;  1ZKE A;  1H7C A;  1YD8 G;  5HXR A;  2Q9Q B;  1V9D A;  2ODV A;  4HFV A;  4CI3 B;  4ZI2 D;  3RH3 A;  4EZ4 A;  5IYZ E;  3KDS E;  3IEE A;  4PJL A;  3I9Y A;  3PUS A;  4J2C A;  1WRD A;  3HKB E;  4DVD A;  3OKQ A;  4XZC A;  2HH7 A;  3AA1 B;  3C4Z A;  1MMA A;  5LXT E;  2BDE A;  4UF0 B;  3CVR A;  2HPJ A;  2XAS B;  1MMN A;  2XAJ B;  5M4Y A;  1HG2 A;  5FXX A;  1D0Z A;  4EYY R;  2XHE B;  5FMN A;  3AAE B;  3RC3 A;  3VU7 H;  2H3R A;  3C98 B;  4WBO A;  2C5J A;  5JR9 C;  2NOX A;  4MLK A;  4UVC B;  1FMV A;  1MND A;  4YLH A;  5JQG E;  4XBF B;  4PJJ A;  2V7L A;  2HPL A;  3ZYK A;  2BVL A;  4JLE A;  1CUN A;  3MAC A;  2JMH A;  3PUQ A;  1MMG A;  2CE7 A;  2BVM A;  1OWA A;  3KIN B;  3OJA A;  5LHI B;  3M65 A;  2M67 A;  2JPF A;  5JRC A;  2C0S A;  5L3F B;  5F8P A;  4H63 V;  3WI3 A;  4IGU A;  5JH7 E;  1FMW A;  3RC8 A;  1BR4 A;  2KXP B;  2H7V C;  3W15 B;  2Q9Q C;  2VKO A;  4OK0 A;  5HXC A;  3V5U A;  2J1D G;  2XAF B;  5HXH A;  3AVR A;  4H9O C;  3IBP A;  3Q5X A;  4L9I A;  4QX8 B;  2NTY A;  3ZC0 A;  3QUJ A;  5JDQ A;  2CEA A;  4HEA A;  2XAG B;  2SPC A;  4PW8 A;  3KV6 A;  1VRB A;  3CQX C;  3R6N A;  5LP6 E;  3ESL A;  3HI2 A;  5LCY A;  3I1A A;  3AA6 B;  5L3G B;  5FXW A;  2JMK A;  1LKX A;  3BQK A;  2JJ9 A;  4P0B A;  5L3D B;  2ODU A;  3LK3 B;  3AB3 B;  2OA5 A;  2VKJ A;  3K3N A;  5JDG A;  4FJO A;  3DJB A;  3EVY A;  2CWO A;  2LSG A;  3I0O A;  3OYX A;  3PU8 A;  4KP3 C;  3ANW B;  1E1H B;  5FY0 A;  4O2A E;  4TV8 E;  1T98 A;  3ETU A;  2JQQ A;  2DCF A;  2X9Y A;  1BR2 A;  3FHN A;  3ZN1 B;  2L9Q A;  2X9H A;  4F6R C;  3GN5 B;  1HTJ F;  2YU2 A;  3HL6 A;  1HG5 A;  3MJX A;  4AI6 A;  5HAX A;  2W62 A;  2K9A A;  3KV9 A;  1X79 A;  2N9D A;  2WSS V;  5JDF A;  2BZB A;  2RA1 A;  4EXT A;  3WAJ A;  2KIN B;  4CQI A;  3J7Y q;  2LEH A;  4AKG A;  4QXC B;  3IHR A;  4A56 A;  4OYK A;  4WW0 A;  4BJN A;  2WBL A;  5FXV A;  1WYB A;  1G73 A;  2LT3 A;  1MIV A;  1O3X A;  4G63 A;  5JDH A;  2NTX A;  3PUR A;  4N78 D;  3SWH A;  2P9B A;  2N1G A;  5LG4 A;  3CPZ A;  2X67 A;  3VHL A;  3HR0 A;  1MMD A;  3R84 B;  4WBN E;  4IST A;  3KV4 A;  3GA8 A;  4KUM B;  3ZPO A;  4ZS2 A;  4OYJ A;  1SHZ C;  4H63 H;  2CXL A;  2LHN A;  4JEU B;  5CA1 E;  3UUN A;  4NUU A;  4V1A v;  4O8S A;  4CXY A;  5FNV E;  5JRC B;  5LGU B;  4PJM A;  2CXD A;  3N9O A;  2ZM0 A;  1BR0 A;  4UEL A;  1HCI A;  4C91 A;  3ZMT B;  4I43 B;  3H37 A;  1D0X A;  2WM9 A;  2X66 A;  3F57 A;  2L3L A;  3V5S A;  2LSJ A;  1S94 A;  2YEV C;  3ZJ2 A;  4ASK A;  4EAH A;  3B57 A;  5DQV A;  4EOZ B;  2NW9 A;  5BMV E;  3CKD A;  4DMV A;  3VKG A;  1Y64 B;  3LJC A;  1B7T A;  2LSY A;  3EDV A;  1UX4 A;  5J1G A;  5GON E;  4K0U A;  2V7K A;  5DQW A;  4CI2 B;  3ZMZ B;  2XAH B;  3K3Q C;  5LHG B;  2UXN B;  5LJM A;  4Z8X A;  1S35 A;  4KBM B;  4UEM A;  3CX8 B;  2V7J A;  3Q9D A;  3N9P A;  3RRC A;  4ILU A;  1IJ5 A;  5JDM A;  2EHO D;  1NWM X;  3AAA B;  2CLY C;  2KLQ A;  4EYU A;  1WR6 A;  3Q5W A;  4YJ3 E;  2CMR A;  2V26 A;  4ZI2 C;  4E7S A;  1HS7 A;  1FEW A;  4X1Y E;  2KMF A;  2E9X D;  4TV9 E;  2VB6 A;  2PFV A;  3FB2 A;  3C50 A;  5EK4 A;  3ZYL A;  3N9N A;  1YKH B;  5JDL A;  2XTL A;  3SOL A;  1D1A A;  3RPU A;  1WYC A;  5LA6 E;  2Y6X A;  2MOZ A;  5H6Q B;  3N9Q A;  2CWY A;  3PE0 A;  4X1K E;  2DI4 A;  3KVA A;  3O1J A;  3UTK A;  2Y48 B;  2KZ7 B;  5FY7 A;  5LJN A;  3FXD B;  4GYR A;  1KK7 A;  2G0U A;  4ZHQ E;  2E9X A;  4UV8 B;  3F31 A;  2VAS A;  3ZCJ A;  3FXE B;  4PK6 A;  5LBQ B;  4HKA A;  4MHC A;  3LBX B;  3HKD E;  4PFP A;  4AKR B;  2DHR A;  2NW8 A;  2QA7 A;  2KWI B;  3C64 A;  3ZMS B;  4DO0 A;  4HGA A;  1FIO A;  3LG7 A;  1LVK A;  4OHF A;  3ZMV B;  1OXZ A;  4P0A A;  3N2O A;  4B6X A;  5F3J A;  3P8C D;  3UUL A;  4BA9 A;  5C8Y E;  2DNX A;  4C90 A;  2E8I A;  3LK4 2;  2KT9 A;  1SA0 E;  4WNK A;  1AJ3 A;  2RP4 A;  2QGS A;  3KBT A;  5KMG P;  1U4Q A;  5FYM A;  4O4I E;  2X68 A;  3RYI E;  3D0T A;  4UXN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...