4MFRA

Crystal structure of mycobacterium tuberculosis card
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
164
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords RNA polymerase-binding transcription factor CarD
total genus 44
structure length 164
sequence length 169
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mfrA02
2LT3A 4KMCA 4MFRA 4ILUA 4KBMB 4XAXB 4L5GA
chains in the Genus database with same CATH superfamily
4DBQA 5GONE 5JDLA 2XAFB 3F31A 5HEOA 5LJNA 4JYAT 4H9NC 4EAHA 3FXDB 2JQQA 4I50E 3VR8A 4YTNA 5AQQB 5CFBA 1OEDA 2VKHA 3PUVF 1W0BA 3P50A 4TV8E 3P7IA 2LKHA 4ZI2D 3UFGA 5FP3A 4EGWA 4QH4A 4IE5A 2NWBA 4ISTA 3ZC1A 2PG8A 4I55E 2DWKA 2XZEA 5JDQA 2W00A 4HWIB 3IHRA 2L8KA 3RIUA 3SWHA 5JH7E 2LSKA 3JC6C 3J7Yq 1VOMA 2DLRA 3JCFA 1LVFA 2LSJA 4K0UA 1VCSA 4Z8XA 4DUYT 4JI1T 2IUBA 2WMOA 2YU1A 1KNPA 4U2ZA 3UU3A 3VHLA 4IGUA 4IL4A 5JDMA 4P0AA 2YK0A 1NWMX 2IMLA 4JI5T 5JDFA 2CEAA 2NOXA 3L09A 2K9AA 5LJMA 2XAGB 2A9UA 4P09A 3DTOA 5KXJA 1HF8A 3BQIA 2MOZA 3NWIA 3HKEE 4AKHA 3RGLA 4H9RC 4N78D 2X0YA 3AE9A 3ZKRA 3AAIA 4XAXB 5AQGB 4YJ2E 3E08A 2XQAA 3HI2A 2H3RA 3ZT7A 4COFA 4HE8A 3ZCIA 5CA1E 2JQKA 2R6GF 4XBFB 3AE5A 2HH7A 2V7JA 4TN7B 3CMLA 4DMWA 4DV4T 2ACXA 3AA0B 3Q9DA 4Z91A 2RP4A 2UUBT 3OYXA 2WMNA 3FZMB 3MZKB 3NRYA 4AI6A 2WBLA 2KZ7B 4YLHA 1LRZA 1UGOA 1YKEB 2CBIA 2HN1A 3LK2B 4UVBB 3UQ4A 4CI3B 2XQ7A 2E5VA 5HXSA 5AQNB 5L3FB 4HTEA 1E7PA 3HL6A 1WLXA 2WCAA 1KEYA 4TWFA 5FKYA 4BJMA 1MMAA 2X66A 3LG7A 5DABA 4DNDA 4EXTA 2E5LT 4CXWA 4X66T 2XAHB 3I0QA 1XWMA 2E9XD 2MTQA 1US7B 1T98A 3LJCA 4QXCB 4C90A 4O4JE 1XNQT 3RC8A 3VKGA 4MALA 3WAJA 2DI4A 2L3LA 2XM1A 4NPPA 2WY2A 3NZQA 4CN6A 5LBMA 2H88A 5HXEA 2I0MA 2V7MA 3H37A 4DV2T 2CWOA 2ZM0A 3KVBA 4FI5A 3BQLA 3ZEFB 5FVKA 3PE0A 2JMKA 4JI7T 3CPZA 2ZM2A 3KFWX 3GN5B 5C8YE 2VVSA 2C5JA 5L3DB 5LCYA 2ODVA 3UUNA 2PBIA 2X9YA 3K3NA 5H6RB 2WM9A 5HEHA 4HFCA 3P4WA 4MHCA 5HCMA 5LBQB 2XPKA 4HWDA 1IBLT 3AAEB 2BG9B 1ZV4X 3N9MA 3N9OA 4YHJA 5J2UE 2X68A 5L3GB 3AE3A 4QKNA 4J2CA 3OTOT 4PJMA 3AEDA 3PJAJ 1BR0A 1MNDA 5L4EA 2YDQA 2WWVA 2WAUA 1Y01A 3UU6A 2XQ3A 1UX4A 2C0SA 3H3AA 4WW0A 1D0YA 4ISSA 2IDOB 2KXPB 4ZOLE 2F4VT 4HFBA 3ZMZB 5KX5E 2XQ9A 3O1IA 4ILUA 4YT0A 2WB5A 3C51A 2UXNB 4WBOA 5FYMA 1XMOT 2BZBA 4G63A 3ZT5A 1VCTA 2X9WA 3JC6D 3CX8B 3AEGA 3H3MA 1OWAA 4X64T 3MK7C 2BDEA 3C4ZA 2WDVA 5IWAT 3RC3A 2H7VC 2VKJA 4PAGA 3N9QA 3U78A 2YDRA 3DJBA 2WS3A 3A5XA 2JMHA 2V6XA 4O8SA 2X0LB 3CIRA 4X20E 2MPKA 4XZCA 4PK5A 4X1KE 3ZN1B 4ZI2C 5TAOA 5LYJE 4GKJT 2A72A 3AA7B 3OJAA 5AQTB 4LF8T 5LHGB 4ZXLA 5J0ZA 4KBMB 2Q9QC 5AQHB 3RKOA 3K8PC 3T8OA 4H9QC 4AQFA 4IL9A 4U2YA 4ZS3A 4X62T 2NR4A 4EV6A 3TKLB 2EHOA 4P0BA 3ZJ2A 1GQEA 4AKLA 5LGNB 1QLBA 4YSXA 4NXMT 1S94A 4GYRA 3JADA 2LSIA 3KV9A 3RKGA 2V7IA 2W2UA 4L5GA 5AQFB 5M4YA 3DP7A 4Z90A 1HX8A 1T72A 1YQ3A 3KDSE 1MIVA 3ABVA 1FMWA 3KV4A 2XY8B 2DWGA 3AA1B 3EAMA 4UELA 4MFRA 3HR0A 2ZM6T 5ADXL 2M6IA 3MJXA 4DR6T 1FMVA 4GYSA 4DBRA 5AFUL 1D1AA 3PURA 3RIUC 4IDOA 1Z0PA 1E2AA 2QGSA 3GMIA 3PUYF 4MLKA 4OYKA 4U31A 2V6YA 3AE6A 3GA8A 3IEEA 4P1NA 5AQOB 4A97A 3PU8A 1UX5A 3AE2A 4A56A 4H9SE 1V9DA 3C4WA 3E22E 4I0UA 5JDHA 2YDSA 3B57A 5LXTE 2XUEA 1HX1B 4B3RT 3FZLB 2BBHA 4UR9A 4Q25A 1J1JA 2QA7A 3QOFA 1E1HB 3AVSA 3ETUA 1I94T 2VWAA 4B3ST 4KHPT 3QK6A 5HCJA 3EDUA 3UFEA 4ZHQE 4LFBT 1KNZA 1JNZA 2GK9A 5HXRA 3K1SA 4AQGA 3AEAA 1EZ3A 3JAFA 4PK4A 4YSZA 1BR1A 2FUPA 1HNZT 3FZKB 1B7TA 3N9LA 3ZJ1A 3QB5K 3IA3A 2ACZA 1NEKA 3UTKA 2BBJA 2KLQA 3BQKA 2Q9QB 3TLVA 1IAPA 2B1EA 3AVRA 5LB7B 2W62A 3AE8A 5DJQC 3WAKA 3KV5A 4YTPA 3UQ7A 3U3IA 5FXVA 2WDRA 4NUUA 2LT3A 4DR1T 3LBXB 2WWUA 4UV9B 1G73A 3I9YA 1G8XA 2WU2A 3CQCB 1ZEEA 5ABHA 2J47A 1MIWA 5ABEA 2BS3A 5E0OA 1VRBA 3Q5XA 3ETVA 3C4XA 3LK42 4KUMB 4QWNB 1MNEA 1D0ZA 1WRDA 2VL0A 3FB2A 2BS2A 3NBXX 5AQUB 3UUXB 3PUSA 4EEBA 4IE7A 4ZS2A 3J9X1 4A5XA 5IYZE 2FJEA 2ODUA 3NKZA 5CA0E 5KDMC 4NXNT 3PDYA 1D1CA 3HKBE 2WZHA 2YU2A 3B13A 4UXNB 1M7KA 3L8RA 4EEDA 1T7SA 2UXXB 1IZNB 1WCRA 2W66A 3K3OA 5DQVA 5LGUB 4U72A 4EOZB 2W67A 3AECA 4OYJA 5L3BB 5LHHB 1IBKT 1XDPA 4CI2B 2XQ8A 4F6RC 3P4RA 5FXWA 4AQYT 1XNRT 4DV1T 1HFAA 3I0OA 3UU8A 3PTRB 2WSSV 2WZIA 2V1DB 2W0GA 3EHZA 4ZZCA 3AB3B 4DV6T 3N2GE 1IBMT 2E8IA 2V5DA 2IW5B 2WQYA 3S4UA 2Y8DA 2LM2A 4HGAA 4JV5T 2YEVC 2BKNA 1LKXA 4X5TA 3ZCJA 5CGMA 2EHOC 3CQGB 5DQWA 5IUXA 4B3TT 2I6HA 3ZT6A 3RHWA 2BVMA 3IF8B 4FJOA 1KK7A 3N9PA 4UV8B 5AQVB 2NW7A 3AE1A 3ONXA 4LF4T 2FJDA 4JEUB 4CZZB 4JEHB 1XZYA 3LK3B 2IAKA 2CXLA 3FZHB 1ZOYA 1MMDA 2EHOB 2L9QA 3NZPA 5LA6E 4CXYA 4MBQA 4HFVA 5C3JA 4G2AA 3EI0A 3RH3A 4C91A 2YOEA 3CKDA 1CUNA 1SA0E 4L9IA 4U33A 5F3JA 5L2LA 5JQGE 1BR4A 3AE7A 2W63A 1H7CA 3KVAA 4H9OC 4KP3C 4BA9A 4PK6A 5ABGA 2K5BB 1N32T 2XSBA 3AA6B 1HNXT 4DVDA 2K24A 4TWHA 5HEGA 1HR0T 2JIWA 4U3CA 4PNIA 3Q2MA 5F8PA 4O2AE 2H7OA 3AEEA 1T8BA 3OPCA 3RYIE 2LEHA 1R8IA 1UCUA 3P4SA 2NP9A 2V7LA 4YSYA 4QXHB 1SE7A 2W4XA 4HWCA 4DO0A 4EZ4A 2WU5A 1NAFA 4IDZA 3UT5E 5JRCA 2Y6XA 3MA9A 3ZMVB 4TV9E 1Z8UA 1ZKEA 3PU3A 4L0RA 4E7ZA 4TZ4C 4HFIA 4AQFC 5FY0A 2E9XA 2XJ7A 1YKHB 2YINA 1WYBA 2IIUA 3M65A 2UXCT 4YJ3E 3C98B 3T1HT 1KNRA 2KSRA 3HA4A 4YXDA 1YQ4A 5ABFB 5JDNA 4LF7T 4TUYE 2V6YB 1UK5A 2V7KA 4AXPA 2CCQA 2LRLA 3PUAA 3T1YT 2P9BA 5L4HA 4DIDB 2LE8A 3VKHA 5HEJA 2Y48B 2JPFA 2E2AA 2LSYA 2BS4A 1X79A 2G0UA 2CM0A 2XSAA 1KF6A 3CX7B 5L47A 2UXDT 5AQSB 2Q9QD 2CPTA 4O4LE 5KMGP 3A7MA 4CN4A 2XQYA 2X0HA 2ZLYA 2W61A 4WZXA 2VK9A 2UUCT 3N2OA 3ZC0A 5BR8T 4U74A 2VB6A 3AEFA 4ZI3C 2XHEB 5L3CB 2KNDA 4IDQA 3ZLIA 5JRCB 4AKIA 2ZM8A 2C5IT 1OEDB 2V5CA 2RA1A 3TLSA 1O3XA 3ONJA 5H6QB 4CI1B 5HYAA 5LGTB 3W15B 2CHNA 2VASA 3I1AA 1OXZA 4HKAA 4WYVA 5FNVE 5J1GA 1XMQT 4H63V 2AE9A 2BKOA 2IC9A 5FY7A 5HXHA 3SFEA 1N34T 3OKQA 3QC9A 3LFMA 5HEUA 4ZZBA 3PV0F 3RQUA 2HHHT 3ZYKA 2NW9A 3ZN0B 2LHNA 2OLTA 3QUJA 4UVAB 3RQWA 2IC6A 4DR5T 2MYSA 3NVOA 2DNXA 3PUQA 1Y64B 5JR9B 2NTXA 1BR2A 4TNWA 5FL0A 3ZMTB 2QVAA 4X65T 2CXFA 2C5KT 4JI4T 4BJNA 1YD8G 1ZHCA 2AXDS 2LOPA 3RX6A 4ERRA 2VQET 4TWDA 1WR6A 3NRXA 4KMCA 4U7YA 4AISA 4ILAA 3O9XA 4LF9T 4V1Av 2XTLA 4IT4A 2XAQB 2VL8A 4X1YE 4CN1A 2RPAA 4AIUA 2D2SA 1JNRA 1W09A 2CA5A 3AE4A 3C50A 3K3QC 3SFDA 2CLYB 2XQ5A 4M1PA 2CRBA 4OK0A 2IHR1 3GWHA 4HFDA 3V5SA 4HFHA 5HAXA 3HKDE 1FJGT 4OX9T 3PUGA 1U4QA 3VR9A 1YW0A 5J2TE 1SHZC 1UUSA 2V8SV 3KBTA 3RIAA 3P8CD 4A98A 2X9XA 4UIGA 1WFDA 2LHRA 3ZSSA 1D1BA 4GIWA 4OFZA 3ZPOA 2VQFT 4O2BE 4IDNA 3QB5A 5EZYE 3I9WA 2X9HA 4BAYB 3OBVE 2PFVA 3ONLC 3VRAA 4ANJA 1AJ3A 4DMVA 3F57A 3HKCE 4IIJE 2CE7A 2E9XC 2JQ9A 4PJNA 4YFSA 3R6NA 2CHOA 1I6ZA 2EHOD 4NUVA 2N9DA 4H9PC 3SRZA 3CQXC 5AQLB 4O4HE 3CVRA 5AQRB 3O1JA 3ZYMA 4EB6E 1IJ5A 4IHJE 1HCIA 5LG4A 4QHOA 3FBLA 3RF1A 2K48A 5CB4E 5BMVE 4U7IA 3P4PA 4DV5T 5JR9A 4JUYA 2H89A 3PUXF 4EYUA 1SUMB 4PJJA 3MXZA 4HWHA 3ZMSB 3D0TA 2QRXA 3UUBA 5JDGA 3SS1A 3ZMUB 4F8HA 1M62A 1N33T 3OVUA 3RYHE 3UULA 5C2TA 1KFYA 3N2KE 2DL1A 2I59A 2Q9QA 4PJLA 5CJ5A 4DR7T 4DR4T 1N36T 4JI6T 2N2NA 3EDVA 3FHNA 4PFOA 3R84B 4YHHT 3CX6B 4LMJA 1XDOA 4YTMA 4DV7T 3B5MA 2JRKA 3EVYA 5JREA 3VU7H 2UUAT 1J5WA 5FY1A 3WI3A 3MKDA 4UEMA 4QX7B 2NTYA 2CMRA 1HTJF 2QYWA 2HPLA 3N9NA 2FBWA 4IE4A 3LDQB 5FXZA 4GK5E 2LLYA 3KBUA 3RYCE 1UURA 4GOUA 4KHZF 2WDQA 3UU4A 3N5LA 2KINB 2OA5A 1FIOA 1ZP0A 2VKOA 3G06A 3L3PA 4ZI3D 3OYZA 2D9DA 4WBNE 2VURA 5LP6E 3QNUA 3FXEB 1D0XA 3C64A 2J4GA 4JI8T 3TLUA 5FXXA 3RLFF 3L39A 3Q5WA 3RYFE 5EK2A 2BG9A 4PFPA 3Q5DA 4DV3T 2BVLA 4LF6T 3UUMA 4EIWA 3RRWA 4IREA 4OHFA 4UVCB 1L0VA 2E9XB 3RPUA 2V26A 5EK4A 2K3WA 4LMKA 3ZYLA 2BG9C 2LRKA 2PTFA 3CK6A 3Q5EA 4HEAA 3A8YC 4CQIA 1NENA 3TLWA 2LJLA 3V5UA 4LFCT 2DHRA 4H63H 3ESLA 1MIYA 3RRCA 5LOVE 2CWYA 1MMNA 3X1DA 3P4QA 4KX6A 3F2EA 4B6XA 4YY3T 1DU2A 2LM9A 3EABA 5JVDE 5HWXA 2YN6A 1HNWT 2X67A 2FJBA 3AXJA 5HXCA 1QUUA 1FEWA 2KMFA 5EK3A 3ANWA 2XQ6A 3VRBA 4ADZA 3O4XE 4QH1A 4ASKA 3LBXA 3PUWF 1WYCA 3KINB 5IHYA 2J1DG 5FL1A 4KI0F 2MAWA 3AXJB 4IDPA 4GK0E 2LOSA 4QX8B 1W0AA 3BK9A 2LKGA 4QH5A 5ETWA 3RIFA 2KWIB 3UU5A 5LG3A 4DR3T 1IJ6A 5LMNT 1J5ET 4ILBA 2BG9E 2N1GA 2X51A 2PJQA 3SOLA 4I43B 4DV0T 1U5PA 4ZI7E 4WNKA 2SPCA 3ZSTA 4CXXA 4DUZT 2XAJB 4EYYR 2LSGA 3KV6A 4AKGA 2DCFA 4PW8A 1X9BA 3IBPA 3O1HA 5AQJB 2VKDA 4LMLA 5FMNA 4QXBB 1WR0A 2YKSA 2J62A 4UF0A 4LFAT 1CHUA 2D0UA 3FBZA 2CXDA 2D0TA 1MMGA 4O4IE 3MACA 4LF5T 2XASB 1YXRA 1OEDE 5FVLA 4DR2T 2MBGA 4I4TE 4HN9A 4JI0T 3E0ZA 2JJ9A 3LSVA 4X1IE 4GKKT 4NIQA 1OEDC 2A3DA 2VVNA 3RI5A 4JI3T 4HWFA 2JQHA 4UF0B 1W9RA 5L3EB 5LHIB 3GN5A 5JTGA 2OV9A 3AEBA 4TX5A 4E7SA 5ABFA 4B3MT 2HPJA 2WP9A 4K0KT 3PUZF 2CLYC 1QSDA 1S35A 4IE0A 2FJAA 1HS7A 5F5WA 4EZHA 5AQPB 2UU9T 2UXBT 1LVKA 1HG2A 2M6BA 3JAEA 3M3ZB 2BKPA 2HN2A 4TNVA 4IE6A 3FZFB 5AQKB 4AKRB 2XM2A 4ZEYA 1HG5A 3PJAA 2KT9A 2KWHA 3CWZB 2CBJA 4HFEA 2Z6EA 2M67A 2A2FX 4ILCA 5HWYA 4JI2T 3TLTA 3AAAB 2ES0A 3ANWB 2XQ4A 2D5UA 2ZMAA 3EUHA 2NW8A 5AQMB 5LMUT 5JR9C 4JLEA 5AQIB 5A1LA 5LNKA 4JBWF 2B76A
chains in the Genus database with same CATH topology
4DBQA 5GONE 5JDLA 2XAFB 3F31A 5LJNA 4H9NC 4EAHA 3FXDB 2JQQA 4I50E 2VKHA 3P7IA 4ZI2D 5FP3A 4IE5A 2NWBA 4ISTA 3ZC1A 2PG8A 4I55E 2DWKA 5JDQA 2W00A 5JH7E 3IHRA 2L8KA 3SWHA 2LSKA 3JC6C 3J7Yq 1VOMA 2DLRA 1LVFA 2LSJA 4K0UA 4Z8XA 2WMOA 2YU1A 3VHLA 4IGUA 4P0AA 5JDMA 2YK0A 1NWMX 5JDFA 2CEAA 2NOXA 3L09A 2K9AA 5LJMA 2XAGB 4P09A 3DTOA 1HF8A 3BQIA 2MOZA 4AKHA 3HKEE 4H9RC 4N78D 3AAIA 4XAXB 4YJ2E 3E08A 3HI2A 2H3RA 4HE8A 3ZCIA 5CA1E 4XBFB 2HH7A 2V7JA 4TN7B 3CMLA 4DMWA 2ACXA 3AA0B 3Q9DA 2RP4A 3OYXA 2WMNA 3MZKB 3NRYA 4AI6A 2WBLA 2KZ7B 4YLHA 1LRZA 1YKEB 4CI3B 3LK2B 4UVBB 5HXSA 5L3FB 4HTEA 3HL6A 1WLXA 4BJMA 4EXTA 1MMAA 2X66A 3LG7A 5DABA 4DNDA 4CXWA 2XAHB 3I0QA 2E9XD 2MTQA 1US7B 1T98A 3LJCA 4QXCB 4C90A 4O4JE 3RC8A 3VKGA 4MALA 3WAJA 2DI4A 2L3LA 3NZQA 5LBMA 5HXEA 2V7MA 3H37A 2CWOA 2ZM0A 3KVBA 4FI5A 3BQLA 3ZEFB 3PE0A 2JMKA 3CPZA 2ZM2A 3KFWX 3GN5B 5C8YE 2C5JA 5L3DB 5LCYA 2ODVA 3UUNA 2PBIA 2X9YA 3K3NA 5H6RB 2WM9A 4MHCA 5LBQB 3AAEB 3N9OA 1ZV4X 3N9MA 5L3GB 4YHJA 5J2UE 2X68A 4QKNA 4J2CA 4PJMA 1BR0A 1MNDA 2WAUA 3H3AA 1UX4A 2C0SA 4WW0A 1D0YA 4ISSA 2KXPB 4ZOLE 3ZMZB 5KX5E 3O1IA 4ILUA 3C51A 2UXNB 4WBOA 5FYMA 2BZBA 4G63A 2X9WA 3JC6D 3CX8B 1OWAA 3MK7C 2BDEA 3C4ZA 3RC3A 2H7VC 2VKJA 4PAGA 3N9QA 3U78A 3DJBA 3A5XA 2JMHA 4O8SA 2X0LB 4X20E 4XZCA 3ZN1B 4ZI2C 4PK5A 4X1KE 5TAOA 5LYJE 2A72A 3AA7B 3OJAA 5LHGB 4KBMB 2Q9QC 3RKOA 3K8PC 3T8OA 4H9QC 4AQFA 4ZS3A 5LGNB 3TKLB 2EHOA 4P0BA 3ZJ2A 4AKLA 1S94A 4GYRA 3KV9A 2LSIA 2V7IA 4L5GA 5M4YA 3DP7A 1HX8A 3KDSE 4TV8E 1MIVA 3KV4A 1FMWA 4UELA 2DWGA 3AA1B 4MFRA 3HR0A 5ADXL 3MJXA 1FMVA 4GYSA 4DBRA 5AFUL 1D1AA 3PURA 1Z0PA 3GMIA 2QGSA 4MLKA 1KNZA 4OYKA 3GA8A 3IEEA 3PU8A 1UX5A 4A56A 4H9SE 1V9DA 3C4WA 3E22E 5JDHA 3B57A 5LXTE 2XUEA 2QA7A 1E1HB 3AVSA 3ETUA 2VWAA 3QK6A 3EDUA 3UFEA 4ZHQE 2GK9A 5HXRA 4AQGA 1EZ3A 4PK4A 1BR1A 1B7TA 3N9LA 3ZJ1A 3UTKA 2KLQA 3BQKA 2Q9QB 1IAPA 2B1EA 3AVRA 2W62A 5DJQC 3WAKA 3KV5A 3U3IA 5FXVA 4NUUA 2LT3A 3LBXB 2WWUA 4UV9B 1G73A 3I9YA 1G8XA 3CQCB 1ZEEA 1MIWA 5E0OA 1VRBA 3Q5XA 3ETVA 3C4XA 3LK42 4KUMB 4QWNB 1MNEA 1D0ZA 1WRDA 3FB2A 3NBXX 3UUXB 5J2TE 3PUSA 4IE7A 4ZS2A 3J9X1 5IYZE 2ODUA 5CA0E 5KDMC 3PDYA 1D1CA 3HKBE 2YU2A 3B13A 4UXNB 2UXXB 1IZNB 3K3OA 5DQVA 5LGUB 4U72A 4EOZB 4OYJA 5L3BB 5LHHB 4F6RC 4CI2B 5FXWA 1HFAA 3I0OA 3PTRB 2WSSV 2V1DB 2W0GA 3AB3B 3N2GE 2E8IA 2IW5B 3S4UA 2Y8DA 4HGAA 2YEVC 1LKXA 3ZCJA 2EHOC 3CQGB 5DQWA 2BVMA 3IF8B 4FJOA 1KK7A 3N9PA 4UV8B 2NW7A 3ONXA 4JEUB 4CZZB 4JEHB 3LK3B 2IAKA 2CXLA 1MMDA 2EHOB 2L9QA 3NZPA 5LA6E 4CXYA 4MBQA 4HFVA 4G2AA 3RH3A 4C91A 3CKDA 4L9IA 1CUNA 1SA0E 5F3JA 5L2LA 5JQGE 1BR4A 3KVAA 2W63A 1H7CA 4H9OC 4KP3C 4BA9A 4PK6A 2K5BB 3AA6B 4DVDA 2K24A 4PNIA 3Q2MA 5F8PA 4O2AE 2H7OA 3RYIE 2LEHA 1UCUA 2NP9A 2V7LA 4CI1B 4QXHB 4EZ4A 5KMGP 4DO0A 3UT5E 1NAFA 4IDZA 5JRCA 2Y6XA 3MA9A 3ZMVB 4TV9E 1ZKEA 3PU3A 4L0RA 4E7ZA 4TZ4C 4AQFC 5FY0A 2E9XA 1YKHB 2YINA 1WYBA 3M65A 4YJ3E 3C98B 3HA4A 5JDNA 4TUYE 2V7KA 4AXPA 2CCQA 3PUAA 2P9BA 2LE8A 3VKHA 2Y48B 2JPFA 2LSYA 1X79A 2G0UA 2CM0A 3CX7B 2Q9QD 4O4LE 2XQYA 2ZLYA 2W61A 2VK9A 3N2OA 3ZC0A 4U74A 2VB6A 4ZI3C 2XHEB 5L3CB 2KNDA 3ZLIA 5JRCB 4AKIA 2ZM8A 2C5IT 2RA1A 1O3XA 5H6QB 5HYAA 5LGTB 3W15B 2VASA 3I1AA 5FNVE 1OXZA 4HKAA 5J1GA 4H63V 2IC9A 5FY7A 5HXHA 3OKQA 3QC9A 3LFMA 3ZYKA 2NW9A 3ZN0B 2LHNA 3QUJA 4UVAB 2IC6A 2MYSA 2DNXA 3PUQA 1Y64B 5JR9B 2NTXA 1BR2A 3ZMTB 2CXFA 2C5KT 4BJNA 1YD8G 1ZHCA 2LOPA 3RX6A 4ERRA 1WR6A 3NRXA 4KMCA 3O9XA 4V1Av 2XTLA 2XAQB 2VL8A 4X1YE 2D2SA 3C50A 3K3QC 2CA5A 2CLYB 4M1PA 4OK0A 3GWHA 3V5SA 5HAXA 3HKDE 3PUGA 1U4QA 1YW0A 1SHZC 3KBTA 3P8CD 2X9XA 4UIGA 2LHRA 1D1BA 4GIWA 4OFZA 3ZPOA 4O2BE 5EZYE 3I9WA 2X9HA 4BAYB 3OBVE 2PFVA 4ANJA 1AJ3A 4DMVA 3F57A 3HKCE 4IIJE 2CE7A 2E9XC 4PJNA 4YFSA 3R6NA 2EHOD 4NUVA 2N9DA 4H9PC 3SRZA 3CQXC 4O4HE 3CVRA 3O1JA 3ZYMA 4EB6E 1IJ5A 4IHJE 1HCIA 5LG4A 4QHOA 3FBLA 2K48A 5CB4E 5BMVE 5JR9A 4JUYA 4EYUA 4PJJA 3MXZA 3ZMSB 3D0TA 5JDGA 3SS1A 3ZMUB 3RYHE 3UULA 3N2KE 2I59A 2Q9QA 4PJLA 2N2NA 3EDVA 3FHNA 4PFOA 3R84B 3CX6B 2JRKA 3EVYA 5JREA 3VU7H 5FY1A 3WI3A 3MKDA 4UEMA 4QX7B 2NTYA 2CMRA 1HTJF 2HPLA 3N9NA 4IE4A 5FXZA 4GK5E 3KBUA 3RYCE 4GOUA 3N5LA 2KINB 2OA5A 1FIOA 2VKOA 3L3PA 4ZI3D 3OYZA 4WBNE 5LP6E 3FXEB 1D0XA 3C64A 5FXXA 3Q5WA 3RYFE 5EK2A 4PFPA 2BVLA 3UUMA 4EIWA 3RRWA 4OHFA 4UVCB 2E9XB 3RPUA 2V26A 5EK4A 3ZYLA 4HEAA 4CQIA 2LJLA 3V5UA 2DHRA 4H63H 3ESLA 1MIYA 3RRCA 5LOVE 2CWYA 1MMNA 3F2EA 4B6XA 2LM9A 5JVDE 5HWXA 2X67A 5HXCA 1QUUA 1FEWA 2KMFA 5EK3A 3ANWA 4ADZA 3O4XE 4ASKA 3LBXA 1WYCA 3KINB 5IHYA 2J1DG 4GK0E 2LOSA 4QX8B 3BK9A 5ETWA 2KWIB 1IJ6A 2N1GA 2X51A 2PJQA 3SOLA 4I43B 1U5PA 4ZI7E 4WNKA 2SPCA 4CXXA 2XAJB 4EYYR 2LSGA 3KV6A 4AKGA 2DCFA 4PW8A 5FMNA 3IBPA 3O1HA 2VKDA 4QXBB 4UF0A 2D0UA 3FBZA 2CXDA 2D0TA 1MMGA 4O4IE 3MACA 2XASB 2MBGA 4I4TE 4HN9A 3E0ZA 2JJ9A 4X1IE 2A3DA 4UF0B 5L3EB 5LHIB 3GN5A 4TX5A 4E7SA 2HPJA 4IE0A 2CLYC 1QSDA 1S35A 1HS7A 4EZHA 1LVKA 1HG2A 4IE6A 4AKRB 1HG5A 2KT9A 2KWHA 3CWZB 5HWYA 2Z6EA 2M67A 2A2FX 3AAAB 2ES0A 3ANWB 2ZMAA 2D5UA 3EUHA 2NW8A 5JR9C 4JLEA 5A1LA 5LNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT3 A;  4KMC A;  4MFR A;  4ILU A;  4KBM B;  4XAX B;  4L5G A; 
#chains in the Genus database with same CATH topology
 4DBQ A;  5GON E;  5JDL A;  2XAF B;  3F31 A;  5HEO A;  5LJN A;  4JYA T;  4H9N C;  4EAH A;  3FXD B;  2JQQ A;  4I50 E;  3VR8 A;  4YTN A;  5AQQ B;  5CFB A;  1OED A;  2VKH A;  3PUV F;  1W0B A;  3P50 A;  4TV8 E;  3P7I A;  2LKH A;  4ZI2 D;  3UFG A;  5FP3 A;  4EGW A;  4QH4 A;  4IE5 A;  2NWB A;  4IST A;  3ZC1 A;  2PG8 A;  4I55 E;  2DWK A;  2XZE A;  5JDQ A;  2W00 A;  4HWI B;  3IHR A;  2L8K A;  3RIU A;  3SWH A;  5JH7 E;  2LSK A;  3JC6 C;  3J7Y q;  1VOM A;  2DLR A;  3JCF A;  1LVF A;  2LSJ A;  4K0U A;  1VCS A;  4Z8X A;  4DUY T;  4JI1 T;  2IUB A;  2WMO A;  2YU1 A;  1KNP A;  4U2Z A;  3UU3 A;  3VHL A;  4IGU A;  4IL4 A;  5JDM A;  4P0A A;  2YK0 A;  1NWM X;  2IML A;  4JI5 T;  5JDF A;  2CEA A;  2NOX A;  3L09 A;  2K9A A;  5LJM A;  2XAG B;  2A9U A;  4P09 A;  3DTO A;  5KXJ A;  1HF8 A;  3BQI A;  2MOZ A;  3NWI A;  3HKE E;  4AKH A;  3RGL A;  4H9R C;  4N78 D;  2X0Y A;  3AE9 A;  3ZKR A;  3AAI A;  4XAX B;  5AQG B;  4YJ2 E;  3E08 A;  2XQA A;  3HI2 A;  2H3R A;  3ZT7 A;  4COF A;  4HE8 A;  3ZCI A;  5CA1 E;  2JQK A;  2R6G F;  4XBF B;  3AE5 A;  2HH7 A;  2V7J A;  4TN7 B;  3CML A;  4DMW A;  4DV4 T;  2ACX A;  3AA0 B;  3Q9D A;  4Z91 A;  2RP4 A;  2UUB T;  3OYX A;  2WMN A;  3FZM B;  3MZK B;  3NRY A;  4AI6 A;  2WBL A;  2KZ7 B;  4YLH A;  1LRZ A;  1UGO A;  1YKE B;  2CBI A;  2HN1 A;  3LK2 B;  4UVB B;  3UQ4 A;  4CI3 B;  2XQ7 A;  2E5V A;  5HXS A;  5AQN B;  5L3F B;  4HTE A;  1E7P A;  3HL6 A;  1WLX A;  2WCA A;  1KEY A;  4TWF A;  5FKY A;  4BJM A;  1MMA A;  2X66 A;  3LG7 A;  5DAB A;  4DND A;  4EXT A;  2E5L T;  4CXW A;  4X66 T;  2XAH B;  3I0Q A;  1XWM A;  2E9X D;  2MTQ A;  1US7 B;  1T98 A;  3LJC A;  4QXC B;  4C90 A;  4O4J E;  1XNQ T;  3RC8 A;  3VKG A;  4MAL A;  3WAJ A;  2DI4 A;  2L3L A;  2XM1 A;  4NPP A;  2WY2 A;  3NZQ A;  4CN6 A;  5LBM A;  2H88 A;  5HXE A;  2I0M A;  2V7M A;  3H37 A;  4DV2 T;  2CWO A;  2ZM0 A;  3KVB A;  4FI5 A;  3BQL A;  3ZEF B;  5FVK A;  3PE0 A;  2JMK A;  4JI7 T;  3CPZ A;  2ZM2 A;  3KFW X;  3GN5 B;  5C8Y E;  2VVS A;  2C5J A;  5L3D B;  5LCY A;  2ODV A;  3UUN A;  2PBI A;  2X9Y A;  3K3N A;  5H6R B;  2WM9 A;  5HEH A;  4HFC A;  3P4W A;  4MHC A;  5HCM A;  5LBQ B;  2XPK A;  4HWD A;  1IBL T;  3AAE B;  2BG9 B;  1ZV4 X;  3N9M A;  3N9O A;  4YHJ A;  5J2U E;  2X68 A;  5L3G B;  3AE3 A;  4QKN A;  4J2C A;  3OTO T;  4PJM A;  3AED A;  3PJA J;  1BR0 A;  1MND A;  5L4E A;  2YDQ A;  2WWV A;  2WAU A;  1Y01 A;  3UU6 A;  2XQ3 A;  1UX4 A;  2C0S A;  3H3A A;  4WW0 A;  1D0Y A;  4ISS A;  2IDO B;  2KXP B;  4ZOL E;  2F4V T;  4HFB A;  3ZMZ B;  5KX5 E;  2XQ9 A;  3O1I A;  4ILU A;  4YT0 A;  2WB5 A;  3C51 A;  2UXN B;  4WBO A;  5FYM A;  1XMO T;  2BZB A;  4G63 A;  3ZT5 A;  1VCT A;  2X9W A;  3JC6 D;  3CX8 B;  3AEG A;  3H3M A;  1OWA A;  4X64 T;  3MK7 C;  2BDE A;  3C4Z A;  2WDV A;  5IWA T;  3RC3 A;  2H7V C;  2VKJ A;  4PAG A;  3N9Q A;  3U78 A;  2YDR A;  3DJB A;  2WS3 A;  3A5X A;  2JMH A;  2V6X A;  4O8S A;  2X0L B;  3CIR A;  4X20 E;  2MPK A;  4XZC A;  4PK5 A;  4X1K E;  3ZN1 B;  4ZI2 C;  5TAO A;  5LYJ E;  4GKJ T;  2A72 A;  3AA7 B;  3OJA A;  5AQT B;  4LF8 T;  5LHG B;  4ZXL A;  5J0Z A;  4KBM B;  2Q9Q C;  5AQH B;  3RKO A;  3K8P C;  3T8O A;  4H9Q C;  4AQF A;  4IL9 A;  4U2Y A;  4ZS3 A;  4X62 T;  2NR4 A;  4EV6 A;  3TKL B;  2EHO A;  4P0B A;  3ZJ2 A;  1GQE A;  4AKL A;  5LGN B;  1QLB A;  4YSX A;  4NXM T;  1S94 A;  4GYR A;  3JAD A;  2LSI A;  3KV9 A;  3RKG A;  2V7I A;  2W2U A;  4L5G A;  5AQF B;  5M4Y A;  3DP7 A;  4Z90 A;  1HX8 A;  1T72 A;  1YQ3 A;  3KDS E;  1MIV A;  3ABV A;  1FMW A;  3KV4 A;  2XY8 B;  2DWG A;  3AA1 B;  3EAM A;  4UEL A;  4MFR A;  3HR0 A;  2ZM6 T;  5ADX L;  2M6I A;  3MJX A;  4DR6 T;  1FMV A;  4GYS A;  4DBR A;  5AFU L;  1D1A A;  3PUR A;  3RIU C;  4IDO A;  1Z0P A;  1E2A A;  2QGS A;  3GMI A;  3PUY F;  4MLK A;  4OYK A;  4U31 A;  2V6Y A;  3AE6 A;  3GA8 A;  3IEE A;  4P1N A;  5AQO B;  4A97 A;  3PU8 A;  1UX5 A;  3AE2 A;  4A56 A;  4H9S E;  1V9D A;  3C4W A;  3E22 E;  4I0U A;  5JDH A;  2YDS A;  3B57 A;  5LXT E;  2XUE A;  1HX1 B;  4B3R T;  3FZL B;  2BBH A;  4UR9 A;  4Q25 A;  1J1J A;  2QA7 A;  3QOF A;  1E1H B;  3AVS A;  3ETU A;  1I94 T;  2VWA A;  4B3S T;  4KHP T;  3QK6 A;  5HCJ A;  3EDU A;  3UFE A;  4ZHQ E;  4LFB T;  1KNZ A;  1JNZ A;  2GK9 A;  5HXR A;  3K1S A;  4AQG A;  3AEA A;  1EZ3 A;  3JAF A;  4PK4 A;  4YSZ A;  1BR1 A;  2FUP A;  1HNZ T;  3FZK B;  1B7T A;  3N9L A;  3ZJ1 A;  3QB5 K;  3IA3 A;  2ACZ A;  1NEK A;  3UTK A;  2BBJ A;  2KLQ A;  3BQK A;  2Q9Q B;  3TLV A;  1IAP A;  2B1E A;  3AVR A;  5LB7 B;  2W62 A;  3AE8 A;  5DJQ C;  3WAK A;  3KV5 A;  4YTP A;  3UQ7 A;  3U3I A;  5FXV A;  2WDR A;  4NUU A;  2LT3 A;  4DR1 T;  3LBX B;  2WWU A;  4UV9 B;  1G73 A;  3I9Y A;  1G8X A;  2WU2 A;  3CQC B;  1ZEE A;  5ABH A;  2J47 A;  1MIW A;  5ABE A;  2BS3 A;  5E0O A;  1VRB A;  3Q5X A;  3ETV A;  3C4X A;  3LK4 2;  4KUM B;  4QWN B;  1MNE A;  1D0Z A;  1WRD A;  2VL0 A;  3FB2 A;  2BS2 A;  3NBX X;  5AQU B;  3UUX B;  3PUS A;  4EEB A;  4IE7 A;  4ZS2 A;  3J9X 1;  4A5X A;  5IYZ E;  2FJE A;  2ODU A;  3NKZ A;  5CA0 E;  5KDM C;  4NXN T;  3PDY A;  1D1C A;  3HKB E;  2WZH A;  2YU2 A;  3B13 A;  4UXN B;  1M7K A;  3L8R A;  4EED A;  1T7S A;  2UXX B;  1IZN B;  1WCR A;  2W66 A;  3K3O A;  5DQV A;  5LGU B;  4U72 A;  4EOZ B;  2W67 A;  3AEC A;  4OYJ A;  5L3B B;  5LHH B;  1IBK T;  1XDP A;  4CI2 B;  2XQ8 A;  4F6R C;  3P4R A;  5FXW A;  4AQY T;  1XNR T;  4DV1 T;  1HFA A;  3I0O A;  3UU8 A;  3PTR B;  2WSS V;  2WZI A;  2V1D B;  2W0G A;  3EHZ A;  4ZZC A;  3AB3 B;  4DV6 T;  3N2G E;  1IBM T;  2E8I A;  2V5D A;  2IW5 B;  2WQY A;  3S4U A;  2Y8D A;  2LM2 A;  4HGA A;  4JV5 T;  2YEV C;  2BKN A;  1LKX A;  4X5T A;  3ZCJ A;  5CGM A;  2EHO C;  3CQG B;  5DQW A;  5IUX A;  4B3T T;  2I6H A;  3ZT6 A;  3RHW A;  2BVM A;  3IF8 B;  4FJO A;  1KK7 A;  3N9P A;  4UV8 B;  5AQV B;  2NW7 A;  3AE1 A;  3ONX A;  4LF4 T;  2FJD A;  4JEU B;  4CZZ B;  4JEH B;  1XZY A;  3LK3 B;  2IAK A;  2CXL A;  3FZH B;  1ZOY A;  1MMD A;  2EHO B;  2L9Q A;  3NZP A;  5LA6 E;  4CXY A;  4MBQ A;  4HFV A;  5C3J A;  4G2A A;  3EI0 A;  3RH3 A;  4C91 A;  2YOE A;  3CKD A;  1CUN A;  1SA0 E;  4L9I A;  4U33 A;  5F3J A;  5L2L A;  5JQG E;  1BR4 A;  3AE7 A;  2W63 A;  1H7C A;  3KVA A;  4H9O C;  4KP3 C;  4BA9 A;  4PK6 A;  5ABG A;  2K5B B;  1N32 T;  2XSB A;  3AA6 B;  1HNX T;  4DVD A;  2K24 A;  4TWH A;  5HEG A;  1HR0 T;  2JIW A;  4U3C A;  4PNI A;  3Q2M A;  5F8P A;  4O2A E;  2H7O A;  3AEE A;  1T8B A;  3OPC A;  3RYI E;  2LEH A;  1R8I A;  1UCU A;  3P4S A;  2NP9 A;  2V7L A;  4YSY A;  4QXH B;  1SE7 A;  2W4X A;  4HWC A;  4DO0 A;  4EZ4 A;  2WU5 A;  1NAF A;  4IDZ A;  3UT5 E;  5JRC A;  2Y6X A;  3MA9 A;  3ZMV B;  4TV9 E;  1Z8U A;  1ZKE A;  3PU3 A;  4L0R A;  4E7Z A;  4TZ4 C;  4HFI A;  4AQF C;  5FY0 A;  2E9X A;  2XJ7 A;  1YKH B;  2YIN A;  1WYB A;  2IIU A;  3M65 A;  2UXC T;  4YJ3 E;  3C98 B;  3T1H T;  1KNR A;  2KSR A;  3HA4 A;  4YXD A;  1YQ4 A;  5ABF B;  5JDN A;  4LF7 T;  4TUY E;  2V6Y B;  1UK5 A;  2V7K A;  4AXP A;  2CCQ A;  2LRL A;  3PUA A;  3T1Y T;  2P9B A;  5L4H A;  4DID B;  2LE8 A;  3VKH A;  5HEJ A;  2Y48 B;  2JPF A;  2E2A A;  2LSY A;  2BS4 A;  1X79 A;  2G0U A;  2CM0 A;  2XSA A;  1KF6 A;  3CX7 B;  5L47 A;  2UXD T;  5AQS B;  2Q9Q D;  2CPT A;  4O4L E;  5KMG P;  3A7M A;  4CN4 A;  2XQY A;  2X0H A;  2ZLY A;  2W61 A;  4WZX A;  2VK9 A;  2UUC T;  3N2O A;  3ZC0 A;  5BR8 T;  4U74 A;  2VB6 A;  3AEF A;  4ZI3 C;  2XHE B;  5L3C B;  2KND A;  4IDQ A;  3ZLI A;  5JRC B;  4AKI A;  2ZM8 A;  2C5I T;  1OED B;  2V5C A;  2RA1 A;  3TLS A;  1O3X A;  3ONJ A;  5H6Q B;  4CI1 B;  5HYA A;  5LGT B;  3W15 B;  2CHN A;  2VAS A;  3I1A A;  1OXZ A;  4HKA A;  4WYV A;  5FNV E;  5J1G A;  1XMQ T;  4H63 V;  2AE9 A;  2BKO A;  2IC9 A;  5FY7 A;  5HXH A;  3SFE A;  1N34 T;  3OKQ A;  3QC9 A;  3LFM A;  5HEU A;  4ZZB A;  3PV0 F;  3RQU A;  2HHH T;  3ZYK A;  2NW9 A;  3ZN0 B;  2LHN A;  2OLT A;  3QUJ A;  4UVA B;  3RQW A;  2IC6 A;  4DR5 T;  2MYS A;  3NVO A;  2DNX A;  3PUQ A;  1Y64 B;  5JR9 B;  2NTX A;  1BR2 A;  4TNW A;  5FL0 A;  3ZMT B;  2QVA A;  4X65 T;  2CXF A;  2C5K T;  4JI4 T;  4BJN A;  1YD8 G;  1ZHC A;  2AXD S;  2LOP A;  3RX6 A;  4ERR A;  2VQE T;  4TWD A;  1WR6 A;  3NRX A;  4KMC A;  4U7Y A;  4AIS A;  4ILA A;  3O9X A;  4LF9 T;  4V1A v;  2XTL A;  4IT4 A;  2XAQ B;  2VL8 A;  4X1Y E;  4CN1 A;  2RPA A;  4AIU A;  2D2S A;  1JNR A;  1W09 A;  2CA5 A;  3AE4 A;  3C50 A;  3K3Q C;  3SFD A;  2CLY B;  2XQ5 A;  4M1P A;  2CRB A;  4OK0 A;  2IHR 1;  3GWH A;  4HFD A;  3V5S A;  4HFH A;  5HAX A;  3HKD E;  1FJG T;  4OX9 T;  3PUG A;  1U4Q A;  3VR9 A;  1YW0 A;  5J2T E;  1SHZ C;  1UUS A;  2V8S V;  3KBT A;  3RIA A;  3P8C D;  4A98 A;  2X9X A;  4UIG A;  1WFD A;  2LHR A;  3ZSS A;  1D1B A;  4GIW A;  4OFZ A;  3ZPO A;  2VQF T;  4O2B E;  4IDN A;  3QB5 A;  5EZY E;  3I9W A;  2X9H A;  4BAY B;  3OBV E;  2PFV A;  3ONL C;  3VRA A;  4ANJ A;  1AJ3 A;  4DMV A;  3F57 A;  3HKC E;  4IIJ E;  2CE7 A;  2E9X C;  2JQ9 A;  4PJN A;  4YFS A;  3R6N A;  2CHO A;  1I6Z A;  2EHO D;  4NUV A;  2N9D A;  4H9P C;  3SRZ A;  3CQX C;  5AQL B;  4O4H E;  3CVR A;  5AQR B;  3O1J A;  3ZYM A;  4EB6 E;  1IJ5 A;  4IHJ E;  1HCI A;  5LG4 A;  4QHO A;  3FBL A;  3RF1 A;  2K48 A;  5CB4 E;  5BMV E;  4U7I A;  3P4P A;  4DV5 T;  5JR9 A;  4JUY A;  2H89 A;  3PUX F;  4EYU A;  1SUM B;  4PJJ A;  3MXZ A;  4HWH A;  3ZMS B;  3D0T A;  2QRX A;  3UUB A;  5JDG A;  3SS1 A;  3ZMU B;  4F8H A;  1M62 A;  1N33 T;  3OVU A;  3RYH E;  3UUL A;  5C2T A;  1KFY A;  3N2K E;  2DL1 A;  2I59 A;  2Q9Q A;  4PJL A;  5CJ5 A;  4DR7 T;  4DR4 T;  1N36 T;  4JI6 T;  2N2N A;  3EDV A;  3FHN A;  4PFO A;  3R84 B;  4YHH T;  3CX6 B;  4LMJ A;  1XDO A;  4YTM A;  4DV7 T;  3B5M A;  2JRK A;  3EVY A;  5JRE A;  3VU7 H;  2UUA T;  1J5W A;  5FY1 A;  3WI3 A;  3MKD A;  4UEM A;  4QX7 B;  2NTY A;  2CMR A;  1HTJ F;  2QYW A;  2HPL A;  3N9N A;  2FBW A;  4IE4 A;  3LDQ B;  5FXZ A;  4GK5 E;  2LLY A;  3KBU A;  3RYC E;  1UUR A;  4GOU A;  4KHZ F;  2WDQ A;  3UU4 A;  3N5L A;  2KIN B;  2OA5 A;  1FIO A;  1ZP0 A;  2VKO A;  3G06 A;  3L3P A;  4ZI3 D;  3OYZ A;  2D9D A;  4WBN E;  2VUR A;  5LP6 E;  3QNU A;  3FXE B;  1D0X A;  3C64 A;  2J4G A;  4JI8 T;  3TLU A;  5FXX A;  3RLF F;  3L39 A;  3Q5W A;  3RYF E;  5EK2 A;  2BG9 A;  4PFP A;  3Q5D A;  4DV3 T;  2BVL A;  4LF6 T;  3UUM A;  4EIW A;  3RRW A;  4IRE A;  4OHF A;  4UVC B;  1L0V A;  2E9X B;  3RPU A;  2V26 A;  5EK4 A;  2K3W A;  4LMK A;  3ZYL A;  2BG9 C;  2LRK A;  2PTF A;  3CK6 A;  3Q5E A;  4HEA A;  3A8Y C;  4CQI A;  1NEN A;  3TLW A;  2LJL A;  3V5U A;  4LFC T;  2DHR A;  4H63 H;  3ESL A;  1MIY A;  3RRC A;  5LOV E;  2CWY A;  1MMN A;  3X1D A;  3P4Q A;  4KX6 A;  3F2E A;  4B6X A;  4YY3 T;  1DU2 A;  2LM9 A;  3EAB A;  5JVD E;  5HWX A;  2YN6 A;  1HNW T;  2X67 A;  2FJB A;  3AXJ A;  5HXC A;  1QUU A;  1FEW A;  2KMF A;  5EK3 A;  3ANW A;  2XQ6 A;  3VRB A;  4ADZ A;  3O4X E;  4QH1 A;  4ASK A;  3LBX A;  3PUW F;  1WYC A;  3KIN B;  5IHY A;  2J1D G;  5FL1 A;  4KI0 F;  2MAW A;  3AXJ B;  4IDP A;  4GK0 E;  2LOS A;  4QX8 B;  1W0A A;  3BK9 A;  2LKG A;  4QH5 A;  5ETW A;  3RIF A;  2KWI B;  3UU5 A;  5LG3 A;  4DR3 T;  1IJ6 A;  5LMN T;  1J5E T;  4ILB A;  2BG9 E;  2N1G A;  2X51 A;  2PJQ A;  3SOL A;  4I43 B;  4DV0 T;  1U5P A;  4ZI7 E;  4WNK A;  2SPC A;  3ZST A;  4CXX A;  4DUZ T;  2XAJ B;  4EYY R;  2LSG A;  3KV6 A;  4AKG A;  2DCF A;  4PW8 A;  1X9B A;  3IBP A;  3O1H A;  5AQJ B;  2VKD A;  4LML A;  5FMN A;  4QXB B;  1WR0 A;  2YKS A;  2J62 A;  4UF0 A;  4LFA T;  1CHU A;  2D0U A;  3FBZ A;  2CXD A;  2D0T A;  1MMG A;  4O4I E;  3MAC A;  4LF5 T;  2XAS B;  1YXR A;  1OED E;  5FVL A;  4DR2 T;  2MBG A;  4I4T E;  4HN9 A;  4JI0 T;  3E0Z A;  2JJ9 A;  3LSV A;  4X1I E;  4GKK T;  4NIQ A;  1OED C;  2A3D A;  2VVN A;  3RI5 A;  4JI3 T;  4HWF A;  2JQH A;  4UF0 B;  1W9R A;  5L3E B;  5LHI B;  3GN5 A;  5JTG A;  2OV9 A;  3AEB A;  4TX5 A;  4E7S A;  5ABF A;  4B3M T;  2HPJ A;  2WP9 A;  4K0K T;  3PUZ F;  2CLY C;  1QSD A;  1S35 A;  4IE0 A;  2FJA A;  1HS7 A;  5F5W A;  4EZH A;  5AQP B;  2UU9 T;  2UXB T;  1LVK A;  1HG2 A;  2M6B A;  3JAE A;  3M3Z B;  2BKP A;  2HN2 A;  4TNV A;  4IE6 A;  3FZF B;  5AQK B;  4AKR B;  2XM2 A;  4ZEY A;  1HG5 A;  3PJA A;  2KT9 A;  2KWH A;  3CWZ B;  2CBJ A;  4HFE A;  2Z6E A;  2M67 A;  2A2F X;  4ILC A;  5HWY A;  4JI2 T;  3TLT A;  3AAA B;  2ES0 A;  3ANW B;  2XQ4 A;  2D5U A;  2ZMA A;  3EUH A;  2NW8 A;  5AQM B;  5LMU T;  5JR9 C;  4JLE A;  5AQI B;  5A1L A;  5LNK A;  4JBW F;  2B76 A; 
#chains in the Genus database with same CATH homology
 4DBQ A;  5GON E;  5JDL A;  2XAF B;  3F31 A;  5LJN A;  4H9N C;  4EAH A;  3FXD B;  2JQQ A;  4I50 E;  2VKH A;  3P7I A;  4ZI2 D;  5FP3 A;  4IE5 A;  2NWB A;  4IST A;  3ZC1 A;  2PG8 A;  4I55 E;  2DWK A;  5JDQ A;  2W00 A;  5JH7 E;  3IHR A;  2L8K A;  3SWH A;  2LSK A;  3JC6 C;  3J7Y q;  1VOM A;  2DLR A;  1LVF A;  2LSJ A;  4K0U A;  4Z8X A;  2WMO A;  2YU1 A;  3VHL A;  4IGU A;  4P0A A;  5JDM A;  2YK0 A;  1NWM X;  5JDF A;  2CEA A;  2NOX A;  3L09 A;  2K9A A;  5LJM A;  2XAG B;  4P09 A;  3DTO A;  1HF8 A;  3BQI A;  2MOZ A;  4AKH A;  3HKE E;  4H9R C;  4N78 D;  3AAI A;  4XAX B;  4YJ2 E;  3E08 A;  3HI2 A;  2H3R A;  4HE8 A;  3ZCI A;  5CA1 E;  4XBF B;  2HH7 A;  2V7J A;  4TN7 B;  3CML A;  4DMW A;  2ACX A;  3AA0 B;  3Q9D A;  2RP4 A;  3OYX A;  2WMN A;  3MZK B;  3NRY A;  4AI6 A;  2WBL A;  2KZ7 B;  4YLH A;  1LRZ A;  1YKE B;  4CI3 B;  3LK2 B;  4UVB B;  5HXS A;  5L3F B;  4HTE A;  3HL6 A;  1WLX A;  4BJM A;  4EXT A;  1MMA A;  2X66 A;  3LG7 A;  5DAB A;  4DND A;  4CXW A;  2XAH B;  3I0Q A;  2E9X D;  2MTQ A;  1US7 B;  1T98 A;  3LJC A;  4QXC B;  4C90 A;  4O4J E;  3RC8 A;  3VKG A;  4MAL A;  3WAJ A;  2DI4 A;  2L3L A;  3NZQ A;  5LBM A;  5HXE A;  2V7M A;  3H37 A;  2CWO A;  2ZM0 A;  3KVB A;  4FI5 A;  3BQL A;  3ZEF B;  3PE0 A;  2JMK A;  3CPZ A;  2ZM2 A;  3KFW X;  3GN5 B;  5C8Y E;  2C5J A;  5L3D B;  5LCY A;  2ODV A;  3UUN A;  2PBI A;  2X9Y A;  3K3N A;  5H6R B;  2WM9 A;  4MHC A;  5LBQ B;  3AAE B;  3N9O A;  1ZV4 X;  3N9M A;  5L3G B;  4YHJ A;  5J2U E;  2X68 A;  4QKN A;  4J2C A;  4PJM A;  1BR0 A;  1MND A;  2WAU A;  3H3A A;  1UX4 A;  2C0S A;  4WW0 A;  1D0Y A;  4ISS A;  2KXP B;  4ZOL E;  3ZMZ B;  5KX5 E;  3O1I A;  4ILU A;  3C51 A;  2UXN B;  4WBO A;  5FYM A;  2BZB A;  4G63 A;  2X9W A;  3JC6 D;  3CX8 B;  1OWA A;  3MK7 C;  2BDE A;  3C4Z A;  3RC3 A;  2H7V C;  2VKJ A;  4PAG A;  3N9Q A;  3U78 A;  3DJB A;  3A5X A;  2JMH A;  4O8S A;  2X0L B;  4X20 E;  4XZC A;  3ZN1 B;  4ZI2 C;  4PK5 A;  4X1K E;  5TAO A;  5LYJ E;  2A72 A;  3AA7 B;  3OJA A;  5LHG B;  4KBM B;  2Q9Q C;  3RKO A;  3K8P C;  3T8O A;  4H9Q C;  4AQF A;  4ZS3 A;  5LGN B;  3TKL B;  2EHO A;  4P0B A;  3ZJ2 A;  4AKL A;  1S94 A;  4GYR A;  3KV9 A;  2LSI A;  2V7I A;  4L5G A;  5M4Y A;  3DP7 A;  1HX8 A;  3KDS E;  4TV8 E;  1MIV A;  3KV4 A;  1FMW A;  4UEL A;  2DWG A;  3AA1 B;  4MFR A;  3HR0 A;  5ADX L;  3MJX A;  1FMV A;  4GYS A;  4DBR A;  5AFU L;  1D1A A;  3PUR A;  1Z0P A;  3GMI A;  2QGS A;  4MLK A;  1KNZ A;  4OYK A;  3GA8 A;  3IEE A;  3PU8 A;  1UX5 A;  4A56 A;  4H9S E;  1V9D A;  3C4W A;  3E22 E;  5JDH A;  3B57 A;  5LXT E;  2XUE A;  2QA7 A;  1E1H B;  3AVS A;  3ETU A;  2VWA A;  3QK6 A;  3EDU A;  3UFE A;  4ZHQ E;  2GK9 A;  5HXR A;  4AQG A;  1EZ3 A;  4PK4 A;  1BR1 A;  1B7T A;  3N9L A;  3ZJ1 A;  3UTK A;  2KLQ A;  3BQK A;  2Q9Q B;  1IAP A;  2B1E A;  3AVR A;  2W62 A;  5DJQ C;  3WAK A;  3KV5 A;  3U3I A;  5FXV A;  4NUU A;  2LT3 A;  3LBX B;  2WWU A;  4UV9 B;  1G73 A;  3I9Y A;  1G8X A;  3CQC B;  1ZEE A;  1MIW A;  5E0O A;  1VRB A;  3Q5X A;  3ETV A;  3C4X A;  3LK4 2;  4KUM B;  4QWN B;  1MNE A;  1D0Z A;  1WRD A;  3FB2 A;  3NBX X;  3UUX B;  5J2T E;  3PUS A;  4IE7 A;  4ZS2 A;  3J9X 1;  5IYZ E;  2ODU A;  5CA0 E;  5KDM C;  3PDY A;  1D1C A;  3HKB E;  2YU2 A;  3B13 A;  4UXN B;  2UXX B;  1IZN B;  3K3O A;  5DQV A;  5LGU B;  4U72 A;  4EOZ B;  4OYJ A;  5L3B B;  5LHH B;  4F6R C;  4CI2 B;  5FXW A;  1HFA A;  3I0O A;  3PTR B;  2WSS V;  2V1D B;  2W0G A;  3AB3 B;  3N2G E;  2E8I A;  2IW5 B;  3S4U A;  2Y8D A;  4HGA A;  2YEV C;  1LKX A;  3ZCJ A;  2EHO C;  3CQG B;  5DQW A;  2BVM A;  3IF8 B;  4FJO A;  1KK7 A;  3N9P A;  4UV8 B;  2NW7 A;  3ONX A;  4JEU B;  4CZZ B;  4JEH B;  3LK3 B;  2IAK A;  2CXL A;  1MMD A;  2EHO B;  2L9Q A;  3NZP A;  5LA6 E;  4CXY A;  4MBQ A;  4HFV A;  4G2A A;  3RH3 A;  4C91 A;  3CKD A;  4L9I A;  1CUN A;  1SA0 E;  5F3J A;  5L2L A;  5JQG E;  1BR4 A;  3KVA A;  2W63 A;  1H7C A;  4H9O C;  4KP3 C;  4BA9 A;  4PK6 A;  2K5B B;  3AA6 B;  4DVD A;  2K24 A;  4PNI A;  3Q2M A;  5F8P A;  4O2A E;  2H7O A;  3RYI E;  2LEH A;  1UCU A;  2NP9 A;  2V7L A;  4CI1 B;  4QXH B;  4EZ4 A;  5KMG P;  4DO0 A;  3UT5 E;  1NAF A;  4IDZ A;  5JRC A;  2Y6X A;  3MA9 A;  3ZMV B;  4TV9 E;  1ZKE A;  3PU3 A;  4L0R A;  4E7Z A;  4TZ4 C;  4AQF C;  5FY0 A;  2E9X A;  1YKH B;  2YIN A;  1WYB A;  3M65 A;  4YJ3 E;  3C98 B;  3HA4 A;  5JDN A;  4TUY E;  2V7K A;  4AXP A;  2CCQ A;  3PUA A;  2P9B A;  2LE8 A;  3VKH A;  2Y48 B;  2JPF A;  2LSY A;  1X79 A;  2G0U A;  2CM0 A;  3CX7 B;  2Q9Q D;  4O4L E;  2XQY A;  2ZLY A;  2W61 A;  2VK9 A;  3N2O A;  3ZC0 A;  4U74 A;  2VB6 A;  4ZI3 C;  2XHE B;  5L3C B;  2KND A;  3ZLI A;  5JRC B;  4AKI A;  2ZM8 A;  2C5I T;  2RA1 A;  1O3X A;  5H6Q B;  5HYA A;  5LGT B;  3W15 B;  2VAS A;  3I1A A;  5FNV E;  1OXZ A;  4HKA A;  5J1G A;  4H63 V;  2IC9 A;  5FY7 A;  5HXH A;  3OKQ A;  3QC9 A;  3LFM A;  3ZYK A;  2NW9 A;  3ZN0 B;  2LHN A;  3QUJ A;  4UVA B;  2IC6 A;  2MYS A;  2DNX A;  3PUQ A;  1Y64 B;  5JR9 B;  2NTX A;  1BR2 A;  3ZMT B;  2CXF A;  2C5K T;  4BJN A;  1YD8 G;  1ZHC A;  2LOP A;  3RX6 A;  4ERR A;  1WR6 A;  3NRX A;  4KMC A;  3O9X A;  4V1A v;  2XTL A;  2XAQ B;  2VL8 A;  4X1Y E;  2D2S A;  3C50 A;  3K3Q C;  2CA5 A;  2CLY B;  4M1P A;  4OK0 A;  3GWH A;  3V5S A;  5HAX A;  3HKD E;  3PUG A;  1U4Q A;  1YW0 A;  1SHZ C;  3KBT A;  3P8C D;  2X9X A;  4UIG A;  2LHR A;  1D1B A;  4GIW A;  4OFZ A;  3ZPO A;  4O2B E;  5EZY E;  3I9W A;  2X9H A;  4BAY B;  3OBV E;  2PFV A;  4ANJ A;  1AJ3 A;  4DMV A;  3F57 A;  3HKC E;  4IIJ E;  2CE7 A;  2E9X C;  4PJN A;  4YFS A;  3R6N A;  2EHO D;  4NUV A;  2N9D A;  4H9P C;  3SRZ A;  3CQX C;  4O4H E;  3CVR A;  3O1J A;  3ZYM A;  4EB6 E;  1IJ5 A;  4IHJ E;  1HCI A;  5LG4 A;  4QHO A;  3FBL A;  2K48 A;  5CB4 E;  5BMV E;  5JR9 A;  4JUY A;  4EYU A;  4PJJ A;  3MXZ A;  3ZMS B;  3D0T A;  5JDG A;  3SS1 A;  3ZMU B;  3RYH E;  3UUL A;  3N2K E;  2I59 A;  2Q9Q A;  4PJL A;  2N2N A;  3EDV A;  3FHN A;  4PFO A;  3R84 B;  3CX6 B;  2JRK A;  3EVY A;  5JRE A;  3VU7 H;  5FY1 A;  3WI3 A;  3MKD A;  4UEM A;  4QX7 B;  2NTY A;  2CMR A;  1HTJ F;  2HPL A;  3N9N A;  4IE4 A;  5FXZ A;  4GK5 E;  3KBU A;  3RYC E;  4GOU A;  3N5L A;  2KIN B;  2OA5 A;  1FIO A;  2VKO A;  3L3P A;  4ZI3 D;  3OYZ A;  4WBN E;  5LP6 E;  3FXE B;  1D0X A;  3C64 A;  5FXX A;  3Q5W A;  3RYF E;  5EK2 A;  4PFP A;  2BVL A;  3UUM A;  4EIW A;  3RRW A;  4OHF A;  4UVC B;  2E9X B;  3RPU A;  2V26 A;  5EK4 A;  3ZYL A;  4HEA A;  4CQI A;  2LJL A;  3V5U A;  2DHR A;  4H63 H;  3ESL A;  1MIY A;  3RRC A;  5LOV E;  2CWY A;  1MMN A;  3F2E A;  4B6X A;  2LM9 A;  5JVD E;  5HWX A;  2X67 A;  5HXC A;  1QUU A;  1FEW A;  2KMF A;  5EK3 A;  3ANW A;  4ADZ A;  3O4X E;  4ASK A;  3LBX A;  1WYC A;  3KIN B;  5IHY A;  2J1D G;  4GK0 E;  2LOS A;  4QX8 B;  3BK9 A;  5ETW A;  2KWI B;  1IJ6 A;  2N1G A;  2X51 A;  2PJQ A;  3SOL A;  4I43 B;  1U5P A;  4ZI7 E;  4WNK A;  2SPC A;  4CXX A;  2XAJ B;  4EYY R;  2LSG A;  3KV6 A;  4AKG A;  2DCF A;  4PW8 A;  5FMN A;  3IBP A;  3O1H A;  2VKD A;  4QXB B;  4UF0 A;  2D0U A;  3FBZ A;  2CXD A;  2D0T A;  1MMG A;  4O4I E;  3MAC A;  2XAS B;  2MBG A;  4I4T E;  4HN9 A;  3E0Z A;  2JJ9 A;  4X1I E;  2A3D A;  4UF0 B;  5L3E B;  5LHI B;  3GN5 A;  4TX5 A;  4E7S A;  2HPJ A;  4IE0 A;  2CLY C;  1QSD A;  1S35 A;  1HS7 A;  4EZH A;  1LVK A;  1HG2 A;  4IE6 A;  4AKR B;  1HG5 A;  2KT9 A;  2KWH A;  3CWZ B;  5HWY A;  2Z6E A;  2M67 A;  2A2F X;  3AAA B;  2ES0 A;  3ANW B;  2ZMA A;  2D5U A;  3EUH A;  2NW8 A;  5JR9 C;  4JLE A;  5A1L A;  5LNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...