4MFRA

Crystal structure of mycobacterium tuberculosis card
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
164
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase-binding transcription factor CarD
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 44
structure length 164
sequence length 169
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mfrA02
4KBMB 4MFRA 4KMCA 4L5GA 4XAXB 4ILUA 2LT3A
chains in the Genus database with same CATH superfamily
1KNRA 1QSDA 2CPTA 3A7MA 5HWYA 4U7YA 5IHYA 3T8OA 2A9UA 4NUVA 4AQFA 5DJQC 3EVYA 3ZYMA 3EDVA 3RH3A 1KNPA 4G63A 4WBNE 4DR3T 3K3QC 3UULA 3PUWF 3MK7C 3OBVE 2PG8A 3R6NA 3UU8A 3IHRA 1UK5A 4QH1A 2FJDA 4ZXLA 4OHFA 4MHCA 2W66A 4EZHA 4O4HE 5KXJA 2XM2A 3UUXB 2CXLA 4JBWF 2VASA 2X66A 3H37A 3CQGB 3ZT6A 2XHEB 5TAOA 3PV0F 3ZT7A 4EIWA 4MLKA 3AA1B 3ANWA 2E9XC 1WYCA 2NW9A 4U31A 3O1JA 2EHOC 3KV5A 4TUYE 4A98A 5LMNT 2W4XA 4ZI3C 4AKHA 2BG9A 2FJAA 5AQKB 3FBZA 2IDOB 4EYUA 3PUZF 1M62A 3JAFA 5FXXA 3O1HA 4K0KT 1YW0A 4UVBB 3CX8B 3O1IA 3JADA 3RIFA 5JQGE 3ONJA 2XQYA 2V1DB 2LT3A 4GKKT 1WFDA 2I6HA 4YSYA 4JEHB 1V9DA 1U4QA 4ADZA 4O2BE 5FMNA 4MALA 2JQHA 4ZS3A 4O4JE 4B3ST 1L0VA 5LHGB 4U3CA 2V26A 1SE7A 4PNIA 2LSYA 3SS1A 3UQ7A 2OV9A 3C64A 1VRBA 3WAJA 4OYKA 1XDOA 5HEOA 4LFAT 5LBMA 2L9QA 4UR9A 1N32T 3K3OA 4HFIA 2NOXA 1XDPA 2R6GF 1MMAA 2A3DA 5HXCA 3AE9A 4TX5A 3RQUA 4KBMB 2OLTA 4ILBA 3RRWA 4KHZF 4QH4A 4DV1T 5C2TA 3PJAJ 3KV9A 3PU3A 3M65A 2FBWA 2IC9A 2CHOA 3DJBA 5JR9C 3SFDA 3FZKB 3ZJ1A 2NR4A 4UIGA 2WBLA 3ZYKA 4HFCA 5AQLB 5ABGA 5A1LA 5E0OA 4P09A 3ANWB 2VQFT 3OPCA 3UU5A 2BVLA 2DLRA 4EB6E 1W0AA 3ABVA 2BG9B 4QXCB 1OWAA 2NTXA 2WS3A 4PJLA 3NZQA 4X62T 4NXNT 3S4UA 1U5PA 4PJMA 2MYSA 3TLVA 4YSXA 2CEAA 1MIVA 5CB4E 3RF1A 1T72A 5FKYA 3AXJA 2DCFA 1FMWA 1KEYA 3TLUA 4GOUA 3N2KE 4PFOA 1YKEB 3KFWX 3V5SA 2C5IT 4KI0F 1T8BA 4HKAA 3WAKA 1ZKEA 1MIWA 1HX1B 5L3DB 3VR8A 5AQIB 3P4QA 3C50A 1CUNA 2WAUA 3RX6A 3QB5K 2VL0A 3F57A 4PW8A 5AQPB 2K3WA 4IE6A 3ONXA 2CXFA 3CK6A 5IYZE 3VKHA 1FMVA 2ODUA 2YEVC 3N2OA 1GQEA 3FZFB 1LRZA 2HN1A 5JRCB 3P4SA 1T98A 2VURA 2LM2A 5FY1A 3UUMA 2V7KA 4F8HA 3Q5WA 5C3JA 3LG7A 1S94A 2BKNA 1HS7A 4ISSA 2NW7A 3GN5A 2ES0A 4FI5A 4E7ZA 1ZHCA 2UXNB 2X0LB 5F8PA 5EK2A 2V7MA 1SA0E 1WR0A 4ZI2C 3C51A 2BVMA 5LOVE 1N33T 2V6XA 2BBJA 4WBOA 5LNKA 5BR8T 5L3BB 1HF8A 4COFA 2BS4A 3ZKRA 3PUSA 5FVLA 4HWIB 5GONE 2L3LA 5J2TE 2CHNA 4A56A 1H7CA 5AQQB 1WLXA 4JI0T 3C4WA 2LRLA 2ZMAA 5H6QB 1QLBA 3AEEA 2QYWA 1UCUA 2ZM2A 2IW5B 2XQ4A 4PFPA 3HKCE 4EAHA 2WY2A 3AEDA 2UUAT 5HEHA 4NIQA 4U33A 1XNRT 2WDQA 4IREA 1MIYA 2CM0A 4KP3C 4B3MT 4O4LE 2HPLA 4YJ2E 1D1CA 4YFSA 2YK0A 2CBIA 4X1YE 1E1HB 4DBRA 3RYIE 1JNRA 2YOEA 3QK6A 2YDRA 5L3EB 4B3TT 5KMGP 2NTYA 4KHPT 5EK3A 2F4VT 5FVKA 5JDQA 2M6BA 3N9QA 4LFCT 2J47A 5CA0E 4X20E 5JREA 3NZPA 5J1GA 4MFRA 2WDRA 4L9IA 4L0RA 3RLFF 2PFVA 3X1DA 2IC6A 3PURA 4HFVA 4CXYA 2XAFB 2H3RA 4GKJT 2PBIA 3GA8A 2GK9A 4DV3T 5JH7E 2XAJB 3GN5B 2J1DG 5L4HA 2LLYA 5IWAT 3C4XA 4DR5T 4DUYT 2XTLA 4XZCA 1XMQT 4X64T 5IUXA 2J4GA 3K1SA 4Z8XA 3ETVA 3OVUA 4NUUA 2LKGA 3MXZA 1N36T 2DWKA 4H63V 3W15B 3QC9A 2Q9QC 2LJLA 4X66T 3KVAA 3ZCIA 5L3GB 2WCAA 4AQGA 5FL0A 3NKZA 4DMVA 3PUQA 3E08A 2CE7A 4PJNA 1VCSA 3RKGA 1X9BA 3AE8A 2D0TA 5AQJB 3I9YA 4BJNA 2WZIA 3GWHA 3LJCA 3PUAA 5HYAA 1WYBA 4YXDA 2JJ9A 1MMGA 3AE5A 5JDFA 2C5JA 3RYCE 4M1PA 2K48A 1HFAA 3SFEA 2JQQA 4DV4T 2VKJA 4EEBA 2RPAA 2MPKA 4EOZB 3NRYA 1ZV4X 2LSIA 4U7IA 1M7KA 4AI6A 3CX6B 3RQWA 2WSSV 2XY8B 2WU5A 4CI1B 2V5DA 4Z91A 1HTJF 3MA9A 4I50E 2B1EA 4DVDA 1Y64B 2V7JA 2XQAA 5CFBA 2BKOA 3P7IA 3AAEB 4U72A 3AE2A 4DV0T 2Z6EA 3B13A 4H63H 3AECA 3EDUA 2W67A 2X0YA 3B5MA 3A8YC 3UU6A 1UUSA 1IJ5A 3PUVF 2BS2A 4V1Av 5L2LA 2CBJA 2VQET 1MNEA 4TZ4C 3RYFE 4HFDA 5EK4A 4JI2T 3PTRB 4LMJA 3I9WA 5FXWA 2HPJA 5BMVE 2X9HA 2WMNA 2UXDT 3UUBA 2QA7A 2XQ8A 2C5KT 2KXPB 2WWVA 2X9XA 2CLYC 2UU9T 1OEDE 5JDGA 2ZM8A 1XWMA 3TLWA 4QXBB 2LHNA 3VKGA 5AQVB 3TLTA 2LEHA 4IE4A 4QX8B 3UU3A 2WP9A 2V7IA 3AA0B 3RHWA 3ZC0A 3P4PA 2NP9A 1LKXA 2UUCT 4YTNA 3ZMTB 3N9MA 3O4XE 4ZI3D 4ZS2A 5JDMA 3F31A 5H6RB 2AXDS 5JRCA 2BKPA 5ADXL 3LDQB 5L4EA 4DR7T 2VK9A 4ZI7E 3JCFA 4XAXB 4ZEYA 3RGLA 5AQFB 4I55E 4L5GA 4JI3T 2N1GA 4DMWA 3RIAA 3EHZA 2UXCT 4I0UA 1D1BA 3AA7B 2W62A 2XQ3A 1OEDC 3PDYA 2N9DA 2KZ7B 2XSAA 4HWDA 2UUBT 3QUJA 4E7SA 2KWHA 1UGOA 2XZEA 1BR2A 3KBUA 4KUMB 2E9XB 2EHOB 5J0ZA 4ILCA 2VVNA 3FXEB 3LSVA 1VCTA 1J5WA 4P1NA 1B7TA 2HH7A 4OK0A 2X9WA 2H89A 3FZLB 3FHNA 3VU7H 3AE1A 2MBGA 2K5BB 5L47A 5LCYA 4H9RC 3J7Yq 2LSKA 3ZMSB 4C90A 3HR0A 4ILUA 3RRCA 2IMLA 4CI2B 4CN6A 4OYJA 5AQSB 1W9RA 4DO0A 3E22E 1BR0A 5LG3A 5HXEA 4YY3T 3UT5E 1NENA 4C91A 5ABFA 2KSRA 1BR1A 3AEGA 4KMCA 4CXXA 4X65T 3C4ZA 2PTFA 4ZZBA 2YU1A 5LP6E 3MZKB 3I0OA 2YU2A 4YJ3E 3CX7B 3VRBA 3TLSA 2KWIB 1YQ3A 4GIWA 5LB7B 4DR1T 2LOSA 5ABEA 1Y01A 3IBPA 3N9OA 2N2NA 3N5LA 1HG2A 2XM1A 2A72A 4HFEA 5CA1E 5L3CB 1UX5A 2VKDA 2LSJA 2V6YB 2AE9A 2HHHT 3K8PC 5F5WA 5KDMC 4AKIA 5LBQB 3OTOT 3ONLC 3RYHE 4ILAA 1X79A 4UVAB 3AE3A 1YD8G 3H3AA 1IBLT 2B76A 3OYXA 4PJJA 4EZ4A 5LHIB 1DU2A 3AEAA 3EABA 5DQWA 4B3RT 4BA9A 3LBXB 2BBHA 3AA6B 1SHZC 2DNXA 3ZC1A 4H9PC 2QVAA 2JRKA 4TN7B 4K0UA 4BJMA 1IJ6A 2C0SA 5LYJE 3NWIA 1KFYA 4J2CA 2VB6A 1Z0PA 3JAEA 4NPPA 3DP7A 3ZEFB 2D2SA 2KT9A 4F6RC 3AE4A 3LK3B 1D0XA 1WCRA 4ZI2D 2PJQA 2VVSA 4X1IE 2UXBT 3T1YT 5FY0A 1O3XA 1J5ET 4U2YA 2H7VC 2D9DA 2L8KA 2YDQA 3ZT5A 5C8YE 3RIUC 4YTPA 3IA3A 4AISA 5ABFB 5CJ5A 4LF4T 4IL9A 3Q5DA 2BS3A 4GYRA 4TV9E 5JTGA 3AE6A 4UELA 2JMHA 4LF9T 4LF8T 1LVFA 2CXDA 3BQKA 2KMFA 2XJ7A 4G2AA 4Q25A 4HFHA 3Q5EA 1I94T 2XAHB 3I1AA 5AQRB 2IUBA 3CQCB 1CHUA 2FJBA 4IDNA 3ZPOA 4HWFA 4TWFA 4UVCB 3ZSTA 3A5XA 3HL6A 5AFUL 1N34T 4A97A 4UF0B 3PUYF 4JYAT 4KX6A 5LG4A 3RPUA 4HGAA 4JI5T 4U2ZA 2XUEA 4YHHT 5JDNA 3MJXA 4X1KE 1LVKA 4Z90A 1HNWT 3EI0A 1UURA 5HEUA 2IHR1 3AVSA 3UFEA 2XSBA 5AQOB 2X68A 3QB5A 3SRZA 3CVRA 3JC6D 1FIOA 4IDZA 2FUPA 4EEDA 5LJNA 1JNZA 4FJOA 4WYVA 2ACZA 3D0TA 5LJMA 4IDQA 2W2UA 4P0AA 4CZZB 4TNWA 2LRKA 3NRXA 2HN2A 2IIUA 2YN6A 4CI3B 3P8CD 5HEJA 5JVDE 3CKDA 1HNZT 1NWMX 1HNXT 2VWAA 1W09A 1W0BA 4JLEA 4DIDB 4LFBT 2CCQA 5LXTE 2FJEA 5HCJA 3MACA 3AEFA 4LF6T 3PUXF 2LM9A 2CWOA 2XQ7A 3PU8A 5FYMA 2NW8A 4AQFC 3OKQA 3ZYLA 4JI8T 4X5TA 2JPFA 1G73A 1NAFA 3FZMB 4I43B 2ACXA 5FP3A 3KV4A 2K9AA 4DV2T 4DR2T 5LGTB 4IDOA 1D0ZA 3E0ZA 4O8SA 3CWZB 3ZLIA 4UEMA 3L8RA 1E2AA 3HKBE 4YT0A 3U3IA 3G06A 2E9XA 5AQHB 3AEBA 2UXXB 2W61A 2EHOA 2WB5A 4CQIA 2BG9C 5J2UE 5F3JA 2XQ5A 2G0UA 4HTEA 2IAKA 1HG5A 2QRXA 2H7OA 1QUUA 4ANJA 1T7SA 3UUNA 5HWXA 2JQKA 4PK5A 4UV9B 1KF6A 5HXSA 4YHJA 4JI6T 5AQNB 2Q9QB 4HFBA 1ZOYA 2X0HA 2W63A 2CA5A 3N9LA 3UQ4A 3ZSSA 3Q5XA 1SUMB 2WWUA 2DI4A 3KBTA 2RP4A 3KVBA 1MNDA 2H88A 1IBKT 4OFZA 4H9QC 1KK7A 4QH5A 2E9XD 3UFGA 5LHHB 2V5CA 3OJAA 2EHOD 4HN9A 4AXPA 4A5XA 5L3FB 2VL8A 2WQYA 5FL1A 3HKDE 5AQUB 2MAWA 5HEGA 2OA5A 3VR9A 2DHRA 4IE5A 2W00A 4ZZCA 4EYYR 3AAIA 4NXMT 3GMIA 4IGUA 3PUGA 4EGWA 3T1HT 1IZNB 1WR6A 2CWYA 2M6IA 4YTMA 2J62A 3CMLA 3K3NA 4DR6T 5LMUT 4CN1A 2ZM6T 2LHRA 4JI7T 3ZN0B 2E5LT 2YDSA 3NBXX 4U74A 2V6YA 4QHOA 1YQ4A 2LSGA 3AE7A 4TV8E 2XQ9A 1OEDA 1G8XA 1VOMA 3M3ZB 5JR9A 3J9X1 4PK6A 3C98B 3L3PA 1US7B 2P9BA 2WM9A 4DBQA 3BK9A 2KLQA 2VKHA 3ETUA 3RC8A 3ZMVB 3ESLA 4H9SE 3UU4A 3EAMA 4DV5T 2DL1A 4HE8A 1MMNA 1OXZA 3LBXA 5HXRA 4IE0A 3Q9DA 5FXZA 4GK5E 3N9PA 4IT4A 3PJAA 3ZN1B 3RC3A 3ZMZB 3I0QA 5FY7A 1WRDA 4TNVA 4DV7T 3RI5A 2BDEA 2WDVA 3SWHA 2QGSA 4DNDA 4ZOLE 5JDHA 2E8IA 2Y6XA 2MOZA 2JIWA 1BR4A 4JI4T 3CQXC 4YLHA 3BQLA 2RA1A 1NEKA 2CLYB 3V5UA 3B57A 3KV6A 3LK42 4CXWA 2X51A 4WZXA 4GYSA 3BQIA 4UXNB 4QXHB 5HAXA 2D5UA 4OX9T 2I59A 3VRAA 2V8SV 3EUHA 5DABA 4P0BA 3N2GE 3Q2MA 2CMRA 1YXRA 4IIJE 4AIUA 3QOFA 2W0GA 2JQ9A 1AJ3A 3NVOA 2DWGA 5AQTB 3VHLA 2X67A 1HCIA 4MBQA 4O2AE 4UF0A 5M4YA 1R8IA 2E5VA 4H9NC 1OEDB 4BAYB 4EXTA 2MTQA 5JR9B 5LGUB 1ZP0A 4IDPA 1XZYA 2XASB 4JUYA 2SPCA 5AQMB 3OYZA 2K24A 4QKNA 2JMKA 4ISTA 3L09A 1XMOT 4JEUB 3SOLA 2CRBA 3FXDB 2KNDA 1MMDA 2ZLYA 5KX5E 4JI1T 2XQ6A 3U78A 2WZHA 2Y8DA 3LFMA 2LE8A 5HXHA 3FB2A 1D1AA 1FJGT 4IL4A 4DUZT 3AXJB 4LMLA 4DV6T 2ODVA 1E7PA 4GK0E 1YKHB 2I0MA 4LMKA 3AB3B 4UV8B 3HKEE 3AAAB 1UX4A 2V7LA 4N78D 4AKLA 3HA4A 3TKLB 4WW0A 4TWHA 2LKHA 3IF8B 5LA6E 3RIUA 2XPKA 4QWNB 3N9NA 2KINB 4I4TE 3RKOA 5AQGB 5DQVA 2BZBA 4DR4T 1XNQT 1D0YA 3P4RA 3QNUA 4TWDA 3ZJ2A 3DTOA 3IEEA 4WNKA 5FNVE 1Z8UA 4PK4A 3MKDA 3WI3A 2ZM0A 4JV5T 2WMOA 4HWHA 4CN4A 2D0UA 3HI2A 4HEAA 3O9XA 4B6XA 2LOPA 3P4WA 4QX7B 3JC6C 1J1JA 1EZ3A 3AVRA 4AKGA 4LF5T 1S35A 5CGMA 4LF7T 2YKSA 3ZCJA 1ZEEA 4AQYT 2A2FX 3CPZA 3P50A 1FEWA 2XAGB 2Q9QA 4EV6A 4ZHQE 1IAPA 5EZYE 3H3MA 4ASKA 2X9YA 5ABHA 3R84B 4H9OC 2M67A 3KDSE 4AKRB 1HX8A 4YSZA 2E2AA 1IBMT 2Y48B 1I6ZA 4IHJE 2YINA 3UTKA 4IE7A 2VKOA 5JDLA 3ZMUB 4ERRA 3KINB 5LGNB 2BG9E 2NWBA 3LK2B 4HWCA 3FZHB 4XBFB 1HR0T 4O4IE 5FXVA 3PE0A 4PAGA 5HCMA 3CIRA 2XAQB 3L39A 2WU2A 5ETWA 3F2EA 1KNZA 3FBLA 2Q9QD
chains in the Genus database with same CATH topology
3AAIA 5JDQA 1QSDA 3GMIA 3C4ZA 3N9QA 4IGUA 5HWYA 3PUGA 5CA0E 5IHYA 1IZNB 3T8OA 1WR6A 2CWYA 4X20E 5JREA 4NUVA 3NZPA 2YU1A 5J1GA 5LP6E 4AQFA 5DJQC 3CMLA 3EVYA 3K3NA 3MZKB 3I0OA 2YU2A 3EDVA 3CX7B 4YJ3E 3RH3A 3ZYMA 4MFRA 4G63A 2KWIB 4WBNE 3K3QC 4GIWA 3UULA 2LHRA 3MK7C 4L9IA 3ZN0B 4L0RA 2LOSA 3OBVE 2PG8A 3NBXX 3R6NA 4U74A 2PFVA 3IBPA 3N9OA 2N2NA 2IC6A 3PURA 3N5LA 4HFVA 3IHRA 1HG2A 4CXYA 2XAFB 2A72A 2H3RA 5CA1E 4QHOA 2PBIA 4OHFA 4MHCA 5L3CB 1UX5A 3GA8A 2GK9A 4EZHA 2LSGA 4TV8E 4O4HE 1G8XA 1VOMA 5JR9A 3J9X1 3UUXB 2CXLA 2XAJB 3GN5B 2J1DG 2VASA 2X66A 5JH7E 2VKDA 3H37A 4PK6A 3C98B 2LSJA 3CQGB 2XHEB 5TAOA 3L3PA 3C4XA 1US7B 2P9BA 2WM9A 3K8PC 4EIWA 4MLKA 3AA1B 4DBQA 3ANWA 5KDMC 3BK9A 4AKIA 2KLQA 2XTLA 2VKHA 2E9XC 1WYCA 3ETUA 2NW9A 5LBQB 4XZCA 3O1JA 3RC8A 3ZMVB 3ESLA 4H9SE 2EHOC 3KV5A 4TUYE 4AKHA 4ZI3C 3RYHE 1X79A 4Z8XA 3ETVA 3FBZA 4NUUA 4HE8A 4UVAB 1MMNA 1OXZA 1YD8G 3H3AA 3LBXA 3MXZA 3OYXA 5HXRA 4PJJA 4EYUA 2DWKA 4EZ4A 4IE0A 4H63V 5LHIB 3Q9DA 5FXZA 3W15B 3QC9A 2Q9QC 2LJLA 4GK5E 5DQWA 5FXXA 3N9PA 3O1HA 3KVAA 1YW0A 4UVBB 3ZCIA 5L3GB 4BA9A 3CX8B 3LBXB 3AA6B 3ZN1B 3RC3A 4AQGA 1SHZC 3O1IA 3I0QA 2DNXA 5FY7A 3ZMZB 1WRDA 3ZC1A 4H9PC 3SWHA 2BDEA 4DMVA 2QGSA 2JRKA 4TN7B 4DNDA 4K0UA 3PUQA 3E08A 2CE7A 4ZOLE 2E8IA 5JDHA 4PJNA 4BJMA 1IJ6A 2C0SA 2Y6XA 5LYJE 5JQGE 2MOZA 4J2CA 2VB6A 1Z0PA 2D0TA 2XQYA 1BR4A 2V1DB 3I9YA 3CQXC 2LT3A 4BJNA 3GWHA 4YLHA 3DP7A 3BQLA 3LJCA 2RA1A 3PUAA 2CLYB 5HYAA 3ZEFB 2D2SA 3V5UA 4JEHB 1V9DA 3B57A 1U4QA 1WYBA 2KT9A 4F6RC 2JJ9A 3KV6A 3LK42 4ADZA 1MMGA 4O2BE 4CXWA 2X51A 5FMNA 4MALA 3LK3B 1D0XA 5JDFA 4ZS3A 4ZI2D 2PJQA 4X1IE 2C5JA 4GYSA 3BQIA 4O4JE 3RYCE 4M1PA 2K48A 5LHGB 5FY0A 1O3XA 1HFAA 2JQQA 4QXHB 4UXNB 2H7VC 2V26A 5HAXA 2D5UA 2VKJA 2L8KA 4PNIA 2LSYA 2I59A 3SS1A 4EOZB 5C8YE 3NRYA 3C64A 1ZV4X 1VRBA 3EUHA 3WAJA 2LSIA 4OYKA 5DABA 4P0BA 3N2GE 3Q2MA 4AI6A 2CMRA 3CX6B 4IIJE 4GYRA 4TV9E 2WSSV 4UELA 4CI1B 2JMHA 5LBMA 2L9QA 1LVFA 2CXDA 3BQKA 1HTJF 2W0GA 3K3OA 3MA9A 1AJ3A 4I50E 2NOXA 1MMAA 2B1EA 2A3DA 2KMFA 4G2AA 2DWGA 5HXCA 3VHLA 4TX5A 4DVDA 1Y64B 2X67A 2V7JA 4KBMB 1HCIA 4MBQA 3RRWA 3P7IA 2XAHB 3KV9A 4O2AE 3I1AA 3PU3A 4UF0A 5M4YA 3M65A 2IC9A 3CQCB 3AAEB 4U72A 3DJBA 4H9NC 5JR9C 4BAYB 4EXTA 3ZPOA 2MTQA 5JR9B 2Z6EA 3B13A 4UVCB 3A5XA 3HL6A 5AFUL 3ZJ1A 5LGUB 4UIGA 4H63H 2WBLA 2XASB 4UF0B 3ZYKA 3EDUA 2SPCA 4JUYA 5A1LA 5E0OA 4P09A 3OYZA 5LG4A 3ANWB 2K24A 4QKNA 2JMKA 4ISTA 3RPUA 1IJ5A 3L09A 4JEUB 2BVLA 4V1Av 5L2LA 2DLRA 4HGAA 4EB6E 3SOLA 1MNEA 3FXDB 4TZ4C 3RYFE 4QXCB 1OWAA 5EK4A 2KNDA 2XUEA 3PTRB 1MMDA 2NTXA 2ZLYA 5KX5E 4PJLA 3NZQA 3S4UA 3MJXA 3I9WA 5FXWA 1U5PA 3U78A 2HPJA 5JDNA 4X1KE 1LVKA 2Y8DA 4PJMA 5BMVE 2MYSA 2X9HA 2CEAA 1MIVA 5CB4E 3LFMA 2LE8A 2WMNA 2DCFA 2QA7A 1FMWA 5HXHA 3AVSA 3FB2A 3UFEA 2C5KT 2X68A 2KXPB 1D1AA 3N2KE 4GOUA 2X9XA 2CLYC 3SRZA 4PFOA 1YKEB 3KFWX 3CVRA 3V5SA 3JC6D 1FIOA 2ZM8A 5JDGA 2C5IT 4IDZA 5LJNA 2ODVA 4QXBB 2LHNA 4FJOA 3VKGA 4GK0E 3WAKA 1YKHB 3D0TA 4HKAA 1ZKEA 1MIWA 2LEHA 4IE4A 4QX8B 5LJMA 5L3DB 3AB3B 4UV8B 2V7IA 4P0AA 3AA0B 3HKEE 3ZC0A 3AAAB 2NP9A 1UX4A 4CZZB 3NRXA 1LKXA 2V7LA 3C50A 1CUNA 4CI3B 2WAUA 3P8CD 4N78D 4AKLA 3HA4A 3ZMTB 5JVDE 3CKDA 3RX6A 3TKLB 1NWMX 4WW0A 3N9MA 3O4XE 4ZI3D 4ZS2A 2VWAA 3F57A 4PW8A 4JLEA 5JDMA 3F31A 3IF8B 5H6RB 5LA6E 5JRCA 2CCQA 4IE6A 5LXTE 3ONXA 2CXFA 5ADXL 5IYZE 3VKHA 1FMVA 3MACA 4QWNB 2ODUA 2YEVC 3N9NA 2KINB 4I4TE 3N2OA 2LM9A 3RKOA 2CWOA 3PU8A 5FYMA 2VK9A 2NW8A 5DQVA 2BZBA 1LRZA 4AQFC 4ZI7E 3OKQA 3ZYLA 5JRCB 4XAXB 1D0YA 1T98A 2JPFA 4I55E 3ZJ2A 3DTOA 4L5GA 1G73A 5FY1A 2N1GA 3IEEA 1NAFA 4WNKA 3UUMA 2V7KA 5FNVE 4I43B 2ACXA 3Q5WA 4PK4A 3MKDA 4DMWA 3WI3A 5FP3A 3LG7A 1S94A 3KV4A 1D1BA 2K9AA 2ZM0A 1HS7A 3AA7B 4ISSA 2WMOA 2NW7A 2W62A 5LGTB 2D0UA 3HI2A 4HEAA 1D0ZA 3O9XA 3E0ZA 4O8SA 3GN5A 2ES0A 4FI5A 3PDYA 2N9DA 4B6XA 4E7ZA 1ZHCA 3CWZB 3ZLIA 2LOPA 4QX7B 4UEMA 3JC6C 2KZ7B 2UXNB 2X0LB 5F8PA 3HKBE 3U3IA 2V7MA 5EK2A 1SA0E 1EZ3A 3AVRA 4ZI2C 4AKGA 3QUJA 3C51A 2BVMA 1S35A 2E9XA 5LOVE 3ZCJA 2UXXB 4E7SA 1ZEEA 2W61A 2EHOA 2A2FX 2KWHA 4WBOA 5LNKA 4CQIA 5J2UE 3CPZA 5F3JA 5L3BB 1HF8A 2G0UA 4HTEA 2IAKA 1BR2A 1FEWA 1HG5A 2XAGB 3PUSA 2H7OA 3KBUA 1QUUA 4ANJA 4KUMB 2E9XB 5GONE 2L3LA 5J2TE 4A56A 1H7CA 3UUNA 5HWXA 2Q9QA 2EHOB 4PK5A 1WLXA 4ZHQE 3FXEB 1IAPA 5EZYE 4UV9B 3C4WA 1B7TA 2HH7A 4OK0A 5H6QB 2ZMAA 5HXSA 4YHJA 2X9WA 1UCUA 2Q9QB 4ASKA 2ZM2A 2IW5B 4PFPA 2X9YA 3HKCE 3FHNA 3VU7H 4EAHA 2W63A 3R84B 2CA5A 2MBGA 4H9OC 3N9LA 2M67A 2K5BB 3KDSE 4AKRB 1HX8A 5LCYA 4H9RC 3J7Yq 2LSKA 3Q5XA 3ZMSB 4C90A 3HR0A 4ILUA 2Y48B 2WWUA 2DI4A 3KBTA 3RRCA 2RP4A 4CI2B 3KVBA 1MIYA 1MNDA 4IHJE 2CM0A 2YINA 3UTKA 4OYJA 4IE7A 2VKOA 4OFZA 4DO0A 5JDLA 4KP3C 4H9QC 4O4LE 3ZMUB 4ERRA 1KK7A 2HPLA 3E22E 3KINB 4YJ2E 5LGNB 2E9XD 1D1CA 1BR0A 2NWBA 4YFSA 3LK2B 5LHHB 3OJAA 2EHOD 4HN9A 2YK0A 4XBFB 4AXPA 4O4IE 5HXEA 5FXVA 4X1YE 1E1HB 3PE0A 4DBRA 5L3FB 2VL8A 4PAGA 3RYIE 3HKDE 3UT5E 2XAQB 2OA5A 3QK6A 4C91A 5ETWA 5L3EB 3F2EA 1BR1A 1KNZA 3FBLA 2DHRA 2Q9QD 4IE5A 4KMCA 5KMGP 2NTYA 2W00A 4CXXA 5EK3A 4EYYR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBM B;  4MFR A;  4KMC A;  4L5G A;  4XAX B;  4ILU A;  2LT3 A; 
#chains in the Genus database with same CATH topology
 1KNR A;  1QSD A;  2CPT A;  3A7M A;  5HWY A;  4U7Y A;  5IHY A;  3T8O A;  2A9U A;  4NUV A;  4AQF A;  5DJQ C;  3EVY A;  3ZYM A;  3EDV A;  3RH3 A;  1KNP A;  4G63 A;  4WBN E;  4DR3 T;  3K3Q C;  3UUL A;  3PUW F;  3MK7 C;  3OBV E;  2PG8 A;  3R6N A;  3UU8 A;  3IHR A;  1UK5 A;  4QH1 A;  2FJD A;  4ZXL A;  4OHF A;  4MHC A;  2W66 A;  4EZH A;  4O4H E;  5KXJ A;  2XM2 A;  3UUX B;  2CXL A;  4JBW F;  2VAS A;  2X66 A;  3H37 A;  3CQG B;  3ZT6 A;  2XHE B;  5TAO A;  3PV0 F;  3ZT7 A;  4EIW A;  4MLK A;  3AA1 B;  3ANW A;  2E9X C;  1WYC A;  2NW9 A;  4U31 A;  3O1J A;  2EHO C;  3KV5 A;  4TUY E;  4A98 A;  5LMN T;  2W4X A;  4ZI3 C;  4AKH A;  2BG9 A;  2FJA A;  5AQK B;  3FBZ A;  2IDO B;  4EYU A;  3PUZ F;  1M62 A;  3JAF A;  5FXX A;  3O1H A;  4K0K T;  1YW0 A;  4UVB B;  3CX8 B;  3O1I A;  3JAD A;  3RIF A;  5JQG E;  3ONJ A;  2XQY A;  2V1D B;  2LT3 A;  4GKK T;  1WFD A;  2I6H A;  4YSY A;  4JEH B;  1V9D A;  1U4Q A;  4ADZ A;  4O2B E;  5FMN A;  4MAL A;  2JQH A;  4ZS3 A;  4O4J E;  4B3S T;  1L0V A;  5LHG B;  4U3C A;  2V26 A;  1SE7 A;  4PNI A;  2LSY A;  3SS1 A;  3UQ7 A;  2OV9 A;  3C64 A;  1VRB A;  3WAJ A;  4OYK A;  1XDO A;  5HEO A;  4LFA T;  5LBM A;  2L9Q A;  4UR9 A;  1N32 T;  3K3O A;  4HFI A;  2NOX A;  1XDP A;  2R6G F;  1MMA A;  2A3D A;  5HXC A;  3AE9 A;  4TX5 A;  3RQU A;  4KBM B;  2OLT A;  4ILB A;  3RRW A;  4KHZ F;  4QH4 A;  4DV1 T;  5C2T A;  3PJA J;  3KV9 A;  3PU3 A;  3M65 A;  2FBW A;  2IC9 A;  2CHO A;  3DJB A;  5JR9 C;  3SFD A;  3FZK B;  3ZJ1 A;  2NR4 A;  4UIG A;  2WBL A;  3ZYK A;  4HFC A;  5AQL B;  5ABG A;  5A1L A;  5E0O A;  4P09 A;  3ANW B;  2VQF T;  3OPC A;  3UU5 A;  2BVL A;  2DLR A;  4EB6 E;  1W0A A;  3ABV A;  2BG9 B;  4QXC B;  1OWA A;  2NTX A;  2WS3 A;  4PJL A;  3NZQ A;  4X62 T;  4NXN T;  3S4U A;  1U5P A;  4PJM A;  2MYS A;  3TLV A;  4YSX A;  2CEA A;  1MIV A;  5CB4 E;  3RF1 A;  1T72 A;  5FKY A;  3AXJ A;  2DCF A;  1FMW A;  1KEY A;  3TLU A;  4GOU A;  3N2K E;  4PFO A;  1YKE B;  3KFW X;  3V5S A;  2C5I T;  4KI0 F;  1T8B A;  4HKA A;  3WAK A;  1ZKE A;  1MIW A;  1HX1 B;  5L3D B;  3VR8 A;  5AQI B;  3P4Q A;  3C50 A;  1CUN A;  2WAU A;  3RX6 A;  3QB5 K;  2VL0 A;  3F57 A;  4PW8 A;  5AQP B;  2K3W A;  4IE6 A;  3ONX A;  2CXF A;  3CK6 A;  5IYZ E;  3VKH A;  1FMV A;  2ODU A;  2YEV C;  3N2O A;  1GQE A;  3FZF B;  1LRZ A;  2HN1 A;  5JRC B;  3P4S A;  1T98 A;  2VUR A;  2LM2 A;  5FY1 A;  3UUM A;  2V7K A;  4F8H A;  3Q5W A;  5C3J A;  3LG7 A;  1S94 A;  2BKN A;  1HS7 A;  4ISS A;  2NW7 A;  3GN5 A;  2ES0 A;  4FI5 A;  4E7Z A;  1ZHC A;  2UXN B;  2X0L B;  5F8P A;  5EK2 A;  2V7M A;  1SA0 E;  1WR0 A;  4ZI2 C;  3C51 A;  2BVM A;  5LOV E;  1N33 T;  2V6X A;  2BBJ A;  4WBO A;  5LNK A;  5BR8 T;  5L3B B;  1HF8 A;  4COF A;  2BS4 A;  3ZKR A;  3PUS A;  5FVL A;  4HWI B;  5GON E;  2L3L A;  5J2T E;  2CHN A;  4A56 A;  1H7C A;  5AQQ B;  1WLX A;  4JI0 T;  3C4W A;  2LRL A;  2ZMA A;  5H6Q B;  1QLB A;  3AEE A;  2QYW A;  1UCU A;  2ZM2 A;  2IW5 B;  2XQ4 A;  4PFP A;  3HKC E;  4EAH A;  2WY2 A;  3AED A;  2UUA T;  5HEH A;  4NIQ A;  4U33 A;  1XNR T;  2WDQ A;  4IRE A;  1MIY A;  2CM0 A;  4KP3 C;  4B3M T;  4O4L E;  2HPL A;  4YJ2 E;  1D1C A;  4YFS A;  2YK0 A;  2CBI A;  4X1Y E;  1E1H B;  4DBR A;  3RYI E;  1JNR A;  2YOE A;  3QK6 A;  2YDR A;  5L3E B;  4B3T T;  5KMG P;  2NTY A;  4KHP T;  5EK3 A;  2F4V T;  5FVK A;  5JDQ A;  2M6B A;  3N9Q A;  4LFC T;  2J47 A;  5CA0 E;  4X20 E;  5JRE A;  3NZP A;  5J1G A;  4MFR A;  2WDR A;  4L9I A;  4L0R A;  3RLF F;  2PFV A;  3X1D A;  2IC6 A;  3PUR A;  4HFV A;  4CXY A;  2XAF B;  2H3R A;  4GKJ T;  2PBI A;  3GA8 A;  2GK9 A;  4DV3 T;  5JH7 E;  2XAJ B;  3GN5 B;  2J1D G;  5L4H A;  2LLY A;  5IWA T;  3C4X A;  4DR5 T;  4DUY T;  2XTL A;  4XZC A;  1XMQ T;  4X64 T;  5IUX A;  2J4G A;  3K1S A;  4Z8X A;  3ETV A;  3OVU A;  4NUU A;  2LKG A;  3MXZ A;  1N36 T;  2DWK A;  4H63 V;  3W15 B;  3QC9 A;  2Q9Q C;  2LJL A;  4X66 T;  3KVA A;  3ZCI A;  5L3G B;  2WCA A;  4AQG A;  5FL0 A;  3NKZ A;  4DMV A;  3PUQ A;  3E08 A;  2CE7 A;  4PJN A;  1VCS A;  3RKG A;  1X9B A;  3AE8 A;  2D0T A;  5AQJ B;  3I9Y A;  4BJN A;  2WZI A;  3GWH A;  3LJC A;  3PUA A;  5HYA A;  1WYB A;  4YXD A;  2JJ9 A;  1MMG A;  3AE5 A;  5JDF A;  2C5J A;  3RYC E;  4M1P A;  2K48 A;  1HFA A;  3SFE A;  2JQQ A;  4DV4 T;  2VKJ A;  4EEB A;  2RPA A;  2MPK A;  4EOZ B;  3NRY A;  1ZV4 X;  2LSI A;  4U7I A;  1M7K A;  4AI6 A;  3CX6 B;  3RQW A;  2WSS V;  2XY8 B;  2WU5 A;  4CI1 B;  2V5D A;  4Z91 A;  1HTJ F;  3MA9 A;  4I50 E;  2B1E A;  4DVD A;  1Y64 B;  2V7J A;  2XQA A;  5CFB A;  2BKO A;  3P7I A;  3AAE B;  4U72 A;  3AE2 A;  4DV0 T;  2Z6E A;  3B13 A;  4H63 H;  3AEC A;  3EDU A;  2W67 A;  2X0Y A;  3B5M A;  3A8Y C;  3UU6 A;  1UUS A;  1IJ5 A;  3PUV F;  2BS2 A;  4V1A v;  5L2L A;  2CBJ A;  2VQE T;  1MNE A;  4TZ4 C;  3RYF E;  4HFD A;  5EK4 A;  4JI2 T;  3PTR B;  4LMJ A;  3I9W A;  5FXW A;  2HPJ A;  5BMV E;  2X9H A;  2WMN A;  2UXD T;  3UUB A;  2QA7 A;  2XQ8 A;  2C5K T;  2KXP B;  2WWV A;  2X9X A;  2CLY C;  2UU9 T;  1OED E;  5JDG A;  2ZM8 A;  1XWM A;  3TLW A;  4QXB B;  2LHN A;  3VKG A;  5AQV B;  3TLT A;  2LEH A;  4IE4 A;  4QX8 B;  3UU3 A;  2WP9 A;  2V7I A;  3AA0 B;  3RHW A;  3ZC0 A;  3P4P A;  2NP9 A;  1LKX A;  2UUC T;  4YTN A;  3ZMT B;  3N9M A;  3O4X E;  4ZI3 D;  4ZS2 A;  5JDM A;  3F31 A;  5H6R B;  2AXD S;  5JRC A;  2BKP A;  5ADX L;  3LDQ B;  5L4E A;  4DR7 T;  2VK9 A;  4ZI7 E;  3JCF A;  4XAX B;  4ZEY A;  3RGL A;  5AQF B;  4I55 E;  4L5G A;  4JI3 T;  2N1G A;  4DMW A;  3RIA A;  3EHZ A;  2UXC T;  4I0U A;  1D1B A;  3AA7 B;  2W62 A;  2XQ3 A;  1OED C;  3PDY A;  2N9D A;  2KZ7 B;  2XSA A;  4HWD A;  2UUB T;  3QUJ A;  4E7S A;  2KWH A;  1UGO A;  2XZE A;  1BR2 A;  3KBU A;  4KUM B;  2E9X B;  2EHO B;  5J0Z A;  4ILC A;  2VVN A;  3FXE B;  3LSV A;  1VCT A;  1J5W A;  4P1N A;  1B7T A;  2HH7 A;  4OK0 A;  2X9W A;  2H89 A;  3FZL B;  3FHN A;  3VU7 H;  3AE1 A;  2MBG A;  2K5B B;  5L47 A;  5LCY A;  4H9R C;  3J7Y q;  2LSK A;  3ZMS B;  4C90 A;  3HR0 A;  4ILU A;  3RRC A;  2IML A;  4CI2 B;  4CN6 A;  4OYJ A;  5AQS B;  1W9R A;  4DO0 A;  3E22 E;  1BR0 A;  5LG3 A;  5HXE A;  4YY3 T;  3UT5 E;  1NEN A;  4C91 A;  5ABF A;  2KSR A;  1BR1 A;  3AEG A;  4KMC A;  4CXX A;  4X65 T;  3C4Z A;  2PTF A;  4ZZB A;  2YU1 A;  5LP6 E;  3MZK B;  3I0O A;  2YU2 A;  4YJ3 E;  3CX7 B;  3VRB A;  3TLS A;  2KWI B;  1YQ3 A;  4GIW A;  5LB7 B;  4DR1 T;  2LOS A;  5ABE A;  1Y01 A;  3IBP A;  3N9O A;  2N2N A;  3N5L A;  1HG2 A;  2XM1 A;  2A72 A;  4HFE A;  5CA1 E;  5L3C B;  1UX5 A;  2VKD A;  2LSJ A;  2V6Y B;  2AE9 A;  2HHH T;  3K8P C;  5F5W A;  5KDM C;  4AKI A;  5LBQ B;  3OTO T;  3ONL C;  3RYH E;  4ILA A;  1X79 A;  4UVA B;  3AE3 A;  1YD8 G;  3H3A A;  1IBL T;  2B76 A;  3OYX A;  4PJJ A;  4EZ4 A;  5LHI B;  1DU2 A;  3AEA A;  3EAB A;  5DQW A;  4B3R T;  4BA9 A;  3LBX B;  2BBH A;  3AA6 B;  1SHZ C;  2DNX A;  3ZC1 A;  4H9P C;  2QVA A;  2JRK A;  4TN7 B;  4K0U A;  4BJM A;  1IJ6 A;  2C0S A;  5LYJ E;  3NWI A;  1KFY A;  4J2C A;  2VB6 A;  1Z0P A;  3JAE A;  4NPP A;  3DP7 A;  3ZEF B;  2D2S A;  2KT9 A;  4F6R C;  3AE4 A;  3LK3 B;  1D0X A;  1WCR A;  4ZI2 D;  2PJQ A;  2VVS A;  4X1I E;  2UXB T;  3T1Y T;  5FY0 A;  1O3X A;  1J5E T;  4U2Y A;  2H7V C;  2D9D A;  2L8K A;  2YDQ A;  3ZT5 A;  5C8Y E;  3RIU C;  4YTP A;  3IA3 A;  4AIS A;  5ABF B;  5CJ5 A;  4LF4 T;  4IL9 A;  3Q5D A;  2BS3 A;  4GYR A;  4TV9 E;  5JTG A;  3AE6 A;  4UEL A;  2JMH A;  4LF9 T;  4LF8 T;  1LVF A;  2CXD A;  3BQK A;  2KMF A;  2XJ7 A;  4G2A A;  4Q25 A;  4HFH A;  3Q5E A;  1I94 T;  2XAH B;  3I1A A;  5AQR B;  2IUB A;  3CQC B;  1CHU A;  2FJB A;  4IDN A;  3ZPO A;  4HWF A;  4TWF A;  4UVC B;  3ZST A;  3A5X A;  3HL6 A;  5AFU L;  1N34 T;  4A97 A;  4UF0 B;  3PUY F;  4JYA T;  4KX6 A;  5LG4 A;  3RPU A;  4HGA A;  4JI5 T;  4U2Z A;  2XUE A;  4YHH T;  5JDN A;  3MJX A;  4X1K E;  1LVK A;  4Z90 A;  1HNW T;  3EI0 A;  1UUR A;  5HEU A;  2IHR 1;  3AVS A;  3UFE A;  2XSB A;  5AQO B;  2X68 A;  3QB5 A;  3SRZ A;  3CVR A;  3JC6 D;  1FIO A;  4IDZ A;  2FUP A;  4EED A;  5LJN A;  1JNZ A;  4FJO A;  4WYV A;  2ACZ A;  3D0T A;  5LJM A;  4IDQ A;  2W2U A;  4P0A A;  4CZZ B;  4TNW A;  2LRK A;  3NRX A;  2HN2 A;  2IIU A;  2YN6 A;  4CI3 B;  3P8C D;  5HEJ A;  5JVD E;  3CKD A;  1HNZ T;  1NWM X;  1HNX T;  2VWA A;  1W09 A;  1W0B A;  4JLE A;  4DID B;  4LFB T;  2CCQ A;  5LXT E;  2FJE A;  5HCJ A;  3MAC A;  3AEF A;  4LF6 T;  3PUX F;  2LM9 A;  2CWO A;  2XQ7 A;  3PU8 A;  5FYM A;  2NW8 A;  4AQF C;  3OKQ A;  3ZYL A;  4JI8 T;  4X5T A;  2JPF A;  1G73 A;  1NAF A;  3FZM B;  4I43 B;  2ACX A;  5FP3 A;  3KV4 A;  2K9A A;  4DV2 T;  4DR2 T;  5LGT B;  4IDO A;  1D0Z A;  3E0Z A;  4O8S A;  3CWZ B;  3ZLI A;  4UEM A;  3L8R A;  1E2A A;  3HKB E;  4YT0 A;  3U3I A;  3G06 A;  2E9X A;  5AQH B;  3AEB A;  2UXX B;  2W61 A;  2EHO A;  2WB5 A;  4CQI A;  2BG9 C;  5J2U E;  5F3J A;  2XQ5 A;  2G0U A;  4HTE A;  2IAK A;  1HG5 A;  2QRX A;  2H7O A;  1QUU A;  4ANJ A;  1T7S A;  3UUN A;  5HWX A;  2JQK A;  4PK5 A;  4UV9 B;  1KF6 A;  5HXS A;  4YHJ A;  4JI6 T;  5AQN B;  2Q9Q B;  4HFB A;  1ZOY A;  2X0H A;  2W63 A;  2CA5 A;  3N9L A;  3UQ4 A;  3ZSS A;  3Q5X A;  1SUM B;  2WWU A;  2DI4 A;  3KBT A;  2RP4 A;  3KVB A;  1MND A;  2H88 A;  1IBK T;  4OFZ A;  4H9Q C;  1KK7 A;  4QH5 A;  2E9X D;  3UFG A;  5LHH B;  2V5C A;  3OJA A;  2EHO D;  4HN9 A;  4AXP A;  4A5X A;  5L3F B;  2VL8 A;  2WQY A;  5FL1 A;  3HKD E;  5AQU B;  2MAW A;  5HEG A;  2OA5 A;  3VR9 A;  2DHR A;  4IE5 A;  2W00 A;  4ZZC A;  4EYY R;  3AAI A;  4NXM T;  3GMI A;  4IGU A;  3PUG A;  4EGW A;  3T1H T;  1IZN B;  1WR6 A;  2CWY A;  2M6I A;  4YTM A;  2J62 A;  3CML A;  3K3N A;  4DR6 T;  5LMU T;  4CN1 A;  2ZM6 T;  2LHR A;  4JI7 T;  3ZN0 B;  2E5L T;  2YDS A;  3NBX X;  4U74 A;  2V6Y A;  4QHO A;  1YQ4 A;  2LSG A;  3AE7 A;  4TV8 E;  2XQ9 A;  1OED A;  1G8X A;  1VOM A;  3M3Z B;  5JR9 A;  3J9X 1;  4PK6 A;  3C98 B;  3L3P A;  1US7 B;  2P9B A;  2WM9 A;  4DBQ A;  3BK9 A;  2KLQ A;  2VKH A;  3ETU A;  3RC8 A;  3ZMV B;  3ESL A;  4H9S E;  3UU4 A;  3EAM A;  4DV5 T;  2DL1 A;  4HE8 A;  1MMN A;  1OXZ A;  3LBX A;  5HXR A;  4IE0 A;  3Q9D A;  5FXZ A;  4GK5 E;  3N9P A;  4IT4 A;  3PJA A;  3ZN1 B;  3RC3 A;  3ZMZ B;  3I0Q A;  5FY7 A;  1WRD A;  4TNV A;  4DV7 T;  3RI5 A;  2BDE A;  2WDV A;  3SWH A;  2QGS A;  4DND A;  4ZOL E;  5JDH A;  2E8I A;  2Y6X A;  2MOZ A;  2JIW A;  1BR4 A;  4JI4 T;  3CQX C;  4YLH A;  3BQL A;  2RA1 A;  1NEK A;  2CLY B;  3V5U A;  3B57 A;  3KV6 A;  3LK4 2;  4CXW A;  2X51 A;  4WZX A;  4GYS A;  3BQI A;  4UXN B;  4QXH B;  5HAX A;  2D5U A;  4OX9 T;  2I59 A;  3VRA A;  2V8S V;  3EUH A;  5DAB A;  4P0B A;  3N2G E;  3Q2M A;  2CMR A;  1YXR A;  4IIJ E;  4AIU A;  3QOF A;  2W0G A;  2JQ9 A;  1AJ3 A;  3NVO A;  2DWG A;  5AQT B;  3VHL A;  2X67 A;  1HCI A;  4MBQ A;  4O2A E;  4UF0 A;  5M4Y A;  1R8I A;  2E5V A;  4H9N C;  1OED B;  4BAY B;  4EXT A;  2MTQ A;  5JR9 B;  5LGU B;  1ZP0 A;  4IDP A;  1XZY A;  2XAS B;  4JUY A;  2SPC A;  5AQM B;  3OYZ A;  2K24 A;  4QKN A;  2JMK A;  4IST A;  3L09 A;  1XMO T;  4JEU B;  3SOL A;  2CRB A;  3FXD B;  2KND A;  1MMD A;  2ZLY A;  5KX5 E;  4JI1 T;  2XQ6 A;  3U78 A;  2WZH A;  2Y8D A;  3LFM A;  2LE8 A;  5HXH A;  3FB2 A;  1D1A A;  1FJG T;  4IL4 A;  4DUZ T;  3AXJ B;  4LML A;  4DV6 T;  2ODV A;  1E7P A;  4GK0 E;  1YKH B;  2I0M A;  4LMK A;  3AB3 B;  4UV8 B;  3HKE E;  3AAA B;  1UX4 A;  2V7L A;  4N78 D;  4AKL A;  3HA4 A;  3TKL B;  4WW0 A;  4TWH A;  2LKH A;  3IF8 B;  5LA6 E;  3RIU A;  2XPK A;  4QWN B;  3N9N A;  2KIN B;  4I4T E;  3RKO A;  5AQG B;  5DQV A;  2BZB A;  4DR4 T;  1XNQ T;  1D0Y A;  3P4R A;  3QNU A;  4TWD A;  3ZJ2 A;  3DTO A;  3IEE A;  4WNK A;  5FNV E;  1Z8U A;  4PK4 A;  3MKD A;  3WI3 A;  2ZM0 A;  4JV5 T;  2WMO A;  4HWH A;  4CN4 A;  2D0U A;  3HI2 A;  4HEA A;  3O9X A;  4B6X A;  2LOP A;  3P4W A;  4QX7 B;  3JC6 C;  1J1J A;  1EZ3 A;  3AVR A;  4AKG A;  4LF5 T;  1S35 A;  5CGM A;  4LF7 T;  2YKS A;  3ZCJ A;  1ZEE A;  4AQY T;  2A2F X;  3CPZ A;  3P50 A;  1FEW A;  2XAG B;  2Q9Q A;  4EV6 A;  4ZHQ E;  1IAP A;  5EZY E;  3H3M A;  4ASK A;  2X9Y A;  5ABH A;  3R84 B;  4H9O C;  2M67 A;  3KDS E;  4AKR B;  1HX8 A;  4YSZ A;  2E2A A;  1IBM T;  2Y48 B;  1I6Z A;  4IHJ E;  2YIN A;  3UTK A;  4IE7 A;  2VKO A;  5JDL A;  3ZMU B;  4ERR A;  3KIN B;  5LGN B;  2BG9 E;  2NWB A;  3LK2 B;  4HWC A;  3FZH B;  4XBF B;  1HR0 T;  4O4I E;  5FXV A;  3PE0 A;  4PAG A;  5HCM A;  3CIR A;  2XAQ B;  3L39 A;  2WU2 A;  5ETW A;  3F2E A;  1KNZ A;  3FBL A;  2Q9Q D; 
#chains in the Genus database with same CATH homology
 3AAI A;  5JDQ A;  1QSD A;  3GMI A;  3C4Z A;  3N9Q A;  4IGU A;  5HWY A;  3PUG A;  5CA0 E;  5IHY A;  1IZN B;  3T8O A;  1WR6 A;  2CWY A;  4X20 E;  5JRE A;  4NUV A;  3NZP A;  2YU1 A;  5J1G A;  5LP6 E;  4AQF A;  5DJQ C;  3CML A;  3EVY A;  3K3N A;  3MZK B;  3I0O A;  2YU2 A;  3EDV A;  3CX7 B;  4YJ3 E;  3RH3 A;  3ZYM A;  4MFR A;  4G63 A;  2KWI B;  4WBN E;  3K3Q C;  4GIW A;  3UUL A;  2LHR A;  3MK7 C;  4L9I A;  3ZN0 B;  4L0R A;  2LOS A;  3OBV E;  2PG8 A;  3NBX X;  3R6N A;  4U74 A;  2PFV A;  3IBP A;  3N9O A;  2N2N A;  2IC6 A;  3PUR A;  3N5L A;  4HFV A;  3IHR A;  1HG2 A;  4CXY A;  2XAF B;  2A72 A;  2H3R A;  5CA1 E;  4QHO A;  2PBI A;  4OHF A;  4MHC A;  5L3C B;  1UX5 A;  3GA8 A;  2GK9 A;  4EZH A;  2LSG A;  4TV8 E;  4O4H E;  1G8X A;  1VOM A;  5JR9 A;  3J9X 1;  3UUX B;  2CXL A;  2XAJ B;  3GN5 B;  2J1D G;  2VAS A;  2X66 A;  5JH7 E;  2VKD A;  3H37 A;  4PK6 A;  3C98 B;  2LSJ A;  3CQG B;  2XHE B;  5TAO A;  3L3P A;  3C4X A;  1US7 B;  2P9B A;  2WM9 A;  3K8P C;  4EIW A;  4MLK A;  3AA1 B;  4DBQ A;  3ANW A;  5KDM C;  3BK9 A;  4AKI A;  2KLQ A;  2XTL A;  2VKH A;  2E9X C;  1WYC A;  3ETU A;  2NW9 A;  5LBQ B;  4XZC A;  3O1J A;  3RC8 A;  3ZMV B;  3ESL A;  4H9S E;  2EHO C;  3KV5 A;  4TUY E;  4AKH A;  4ZI3 C;  3RYH E;  1X79 A;  4Z8X A;  3ETV A;  3FBZ A;  4NUU A;  4HE8 A;  4UVA B;  1MMN A;  1OXZ A;  1YD8 G;  3H3A A;  3LBX A;  3MXZ A;  3OYX A;  5HXR A;  4PJJ A;  4EYU A;  2DWK A;  4EZ4 A;  4IE0 A;  4H63 V;  5LHI B;  3Q9D A;  5FXZ A;  3W15 B;  3QC9 A;  2Q9Q C;  2LJL A;  4GK5 E;  5DQW A;  5FXX A;  3N9P A;  3O1H A;  3KVA A;  1YW0 A;  4UVB B;  3ZCI A;  5L3G B;  4BA9 A;  3CX8 B;  3LBX B;  3AA6 B;  3ZN1 B;  3RC3 A;  4AQG A;  1SHZ C;  3O1I A;  3I0Q A;  2DNX A;  5FY7 A;  3ZMZ B;  1WRD A;  3ZC1 A;  4H9P C;  3SWH A;  2BDE A;  4DMV A;  2QGS A;  2JRK A;  4TN7 B;  4DND A;  4K0U A;  3PUQ A;  3E08 A;  2CE7 A;  4ZOL E;  2E8I A;  5JDH A;  4PJN A;  4BJM A;  1IJ6 A;  2C0S A;  2Y6X A;  5LYJ E;  5JQG E;  2MOZ A;  4J2C A;  2VB6 A;  1Z0P A;  2D0T A;  2XQY A;  1BR4 A;  2V1D B;  3I9Y A;  3CQX C;  2LT3 A;  4BJN A;  3GWH A;  4YLH A;  3DP7 A;  3BQL A;  3LJC A;  2RA1 A;  3PUA A;  2CLY B;  5HYA A;  3ZEF B;  2D2S A;  3V5U A;  4JEH B;  1V9D A;  3B57 A;  1U4Q A;  1WYB A;  2KT9 A;  4F6R C;  2JJ9 A;  3KV6 A;  3LK4 2;  4ADZ A;  1MMG A;  4O2B E;  4CXW A;  2X51 A;  5FMN A;  4MAL A;  3LK3 B;  1D0X A;  5JDF A;  4ZS3 A;  4ZI2 D;  2PJQ A;  4X1I E;  2C5J A;  4GYS A;  3BQI A;  4O4J E;  3RYC E;  4M1P A;  2K48 A;  5LHG B;  5FY0 A;  1O3X A;  1HFA A;  2JQQ A;  4QXH B;  4UXN B;  2H7V C;  2V26 A;  5HAX A;  2D5U A;  2VKJ A;  2L8K A;  4PNI A;  2LSY A;  2I59 A;  3SS1 A;  4EOZ B;  5C8Y E;  3NRY A;  3C64 A;  1ZV4 X;  1VRB A;  3EUH A;  3WAJ A;  2LSI A;  4OYK A;  5DAB A;  4P0B A;  3N2G E;  3Q2M A;  4AI6 A;  2CMR A;  3CX6 B;  4IIJ E;  4GYR A;  4TV9 E;  2WSS V;  4UEL A;  4CI1 B;  2JMH A;  5LBM A;  2L9Q A;  1LVF A;  2CXD A;  3BQK A;  1HTJ F;  2W0G A;  3K3O A;  3MA9 A;  1AJ3 A;  4I50 E;  2NOX A;  1MMA A;  2B1E A;  2A3D A;  2KMF A;  4G2A A;  2DWG A;  5HXC A;  3VHL A;  4TX5 A;  4DVD A;  1Y64 B;  2X67 A;  2V7J A;  4KBM B;  1HCI A;  4MBQ A;  3RRW A;  3P7I A;  2XAH B;  3KV9 A;  4O2A E;  3I1A A;  3PU3 A;  4UF0 A;  5M4Y A;  3M65 A;  2IC9 A;  3CQC B;  3AAE B;  4U72 A;  3DJB A;  4H9N C;  5JR9 C;  4BAY B;  4EXT A;  3ZPO A;  2MTQ A;  5JR9 B;  2Z6E A;  3B13 A;  4UVC B;  3A5X A;  3HL6 A;  5AFU L;  3ZJ1 A;  5LGU B;  4UIG A;  4H63 H;  2WBL A;  2XAS B;  4UF0 B;  3ZYK A;  3EDU A;  2SPC A;  4JUY A;  5A1L A;  5E0O A;  4P09 A;  3OYZ A;  5LG4 A;  3ANW B;  2K24 A;  4QKN A;  2JMK A;  4IST A;  3RPU A;  1IJ5 A;  3L09 A;  4JEU B;  2BVL A;  4V1A v;  5L2L A;  2DLR A;  4HGA A;  4EB6 E;  3SOL A;  1MNE A;  3FXD B;  4TZ4 C;  3RYF E;  4QXC B;  1OWA A;  5EK4 A;  2KND A;  2XUE A;  3PTR B;  1MMD A;  2NTX A;  2ZLY A;  5KX5 E;  4PJL A;  3NZQ A;  3S4U A;  3MJX A;  3I9W A;  5FXW A;  1U5P A;  3U78 A;  2HPJ A;  5JDN A;  4X1K E;  1LVK A;  2Y8D A;  4PJM A;  5BMV E;  2MYS A;  2X9H A;  2CEA A;  1MIV A;  5CB4 E;  3LFM A;  2LE8 A;  2WMN A;  2DCF A;  2QA7 A;  1FMW A;  5HXH A;  3AVS A;  3FB2 A;  3UFE A;  2C5K T;  2X68 A;  2KXP B;  1D1A A;  3N2K E;  4GOU A;  2X9X A;  2CLY C;  3SRZ A;  4PFO A;  1YKE B;  3KFW X;  3CVR A;  3V5S A;  3JC6 D;  1FIO A;  2ZM8 A;  5JDG A;  2C5I T;  4IDZ A;  5LJN A;  2ODV A;  4QXB B;  2LHN A;  4FJO A;  3VKG A;  4GK0 E;  3WAK A;  1YKH B;  3D0T A;  4HKA A;  1ZKE A;  1MIW A;  2LEH A;  4IE4 A;  4QX8 B;  5LJM A;  5L3D B;  3AB3 B;  4UV8 B;  2V7I A;  4P0A A;  3AA0 B;  3HKE E;  3ZC0 A;  3AAA B;  2NP9 A;  1UX4 A;  4CZZ B;  3NRX A;  1LKX A;  2V7L A;  3C50 A;  1CUN A;  4CI3 B;  2WAU A;  3P8C D;  4N78 D;  4AKL A;  3HA4 A;  3ZMT B;  5JVD E;  3CKD A;  3RX6 A;  3TKL B;  1NWM X;  4WW0 A;  3N9M A;  3O4X E;  4ZI3 D;  4ZS2 A;  2VWA A;  3F57 A;  4PW8 A;  4JLE A;  5JDM A;  3F31 A;  3IF8 B;  5H6R B;  5LA6 E;  5JRC A;  2CCQ A;  4IE6 A;  5LXT E;  3ONX A;  2CXF A;  5ADX L;  5IYZ E;  3VKH A;  1FMV A;  3MAC A;  4QWN B;  2ODU A;  2YEV C;  3N9N A;  2KIN B;  4I4T E;  3N2O A;  2LM9 A;  3RKO A;  2CWO A;  3PU8 A;  5FYM A;  2VK9 A;  2NW8 A;  5DQV A;  2BZB A;  1LRZ A;  4AQF C;  4ZI7 E;  3OKQ A;  3ZYL A;  5JRC B;  4XAX B;  1D0Y A;  1T98 A;  2JPF A;  4I55 E;  3ZJ2 A;  3DTO A;  4L5G A;  1G73 A;  5FY1 A;  2N1G A;  3IEE A;  1NAF A;  4WNK A;  3UUM A;  2V7K A;  5FNV E;  4I43 B;  2ACX A;  3Q5W A;  4PK4 A;  3MKD A;  4DMW A;  3WI3 A;  5FP3 A;  3LG7 A;  1S94 A;  3KV4 A;  1D1B A;  2K9A A;  2ZM0 A;  1HS7 A;  3AA7 B;  4ISS A;  2WMO A;  2NW7 A;  2W62 A;  5LGT B;  2D0U A;  3HI2 A;  4HEA A;  1D0Z A;  3O9X A;  3E0Z A;  4O8S A;  3GN5 A;  2ES0 A;  4FI5 A;  3PDY A;  2N9D A;  4B6X A;  4E7Z A;  1ZHC A;  3CWZ B;  3ZLI A;  2LOP A;  4QX7 B;  4UEM A;  3JC6 C;  2KZ7 B;  2UXN B;  2X0L B;  5F8P A;  3HKB E;  3U3I A;  2V7M A;  5EK2 A;  1SA0 E;  1EZ3 A;  3AVR A;  4ZI2 C;  4AKG A;  3QUJ A;  3C51 A;  2BVM A;  1S35 A;  2E9X A;  5LOV E;  3ZCJ A;  2UXX B;  4E7S A;  1ZEE A;  2W61 A;  2EHO A;  2A2F X;  2KWH A;  4WBO A;  5LNK A;  4CQI A;  5J2U E;  3CPZ A;  5F3J A;  5L3B B;  1HF8 A;  2G0U A;  4HTE A;  2IAK A;  1BR2 A;  1FEW A;  1HG5 A;  2XAG B;  3PUS A;  2H7O A;  3KBU A;  1QUU A;  4ANJ A;  4KUM B;  2E9X B;  5GON E;  2L3L A;  5J2T E;  4A56 A;  1H7C A;  3UUN A;  5HWX A;  2Q9Q A;  2EHO B;  4PK5 A;  1WLX A;  4ZHQ E;  3FXE B;  1IAP A;  5EZY E;  4UV9 B;  3C4W A;  1B7T A;  2HH7 A;  4OK0 A;  5H6Q B;  2ZMA A;  5HXS A;  4YHJ A;  2X9W A;  1UCU A;  2Q9Q B;  4ASK A;  2ZM2 A;  2IW5 B;  4PFP A;  2X9Y A;  3HKC E;  3FHN A;  3VU7 H;  4EAH A;  2W63 A;  3R84 B;  2CA5 A;  2MBG A;  4H9O C;  3N9L A;  2M67 A;  2K5B B;  3KDS E;  4AKR B;  1HX8 A;  5LCY A;  4H9R C;  3J7Y q;  2LSK A;  3Q5X A;  3ZMS B;  4C90 A;  3HR0 A;  4ILU A;  2Y48 B;  2WWU A;  2DI4 A;  3KBT A;  3RRC A;  2RP4 A;  4CI2 B;  3KVB A;  1MIY A;  1MND A;  4IHJ E;  2CM0 A;  2YIN A;  3UTK A;  4OYJ A;  4IE7 A;  2VKO A;  4OFZ A;  4DO0 A;  5JDL A;  4KP3 C;  4H9Q C;  4O4L E;  3ZMU B;  4ERR A;  1KK7 A;  2HPL A;  3E22 E;  3KIN B;  4YJ2 E;  5LGN B;  2E9X D;  1D1C A;  1BR0 A;  2NWB A;  4YFS A;  3LK2 B;  5LHH B;  3OJA A;  2EHO D;  4HN9 A;  2YK0 A;  4XBF B;  4AXP A;  4O4I E;  5HXE A;  5FXV A;  4X1Y E;  1E1H B;  3PE0 A;  4DBR A;  5L3F B;  2VL8 A;  4PAG A;  3RYI E;  3HKD E;  3UT5 E;  2XAQ B;  2OA5 A;  3QK6 A;  4C91 A;  5ETW A;  5L3E B;  3F2E A;  1BR1 A;  1KNZ A;  3FBL A;  2DHR A;  2Q9Q D;  4IE5 A;  4KMC A;  5KMG P;  2NTY A;  2W00 A;  4CXX A;  5EK3 A;  4EYY R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...