4MFRA

Crystal structure of mycobacterium tuberculosis card
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
164
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase-binding transcription factor CarD
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 44
structure length 164
sequence length 169
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mfrA02
2LT3A 4KMCA 4MFRA 4KBMB 4ILUA 4L5GA 4XAXB
chains in the Genus database with same CATH superfamily
3BQIA 3W15B 2D0UA 4YSYA 2BKNA 2W2UA 2DL1A 3AE8A 3JC6D 4AI6A 2ZLYA 3LK3B 1UUSA 3BK9A 2BS3A 3AEAA 3VU7H 4ILUA 2HHHT 5JDNA 3UFGA 1FEWA 3AEBA 4FI5A 1T7SA 1XMOT 1U5PA 4MHCA 2HH7A 3PUYF 2DHRA 2ACZA 1VCSA 2B76A 3PUZF 5AQKB 1D1CA 5AQNB 2NTXA 3ZMVB 3N2OA 2V7IA 2V7MA 3M65A 2YDQA 4BAYB 2YK0A 4XAXB 4H9RC 3MK7C 1IZNB 5F5WA 3PTRB 4TX5A 4H63H 4CI3B 1J5ET 5JR9C 3LG7A 2JJ9A 2QA7A 2XQ5A 3GN5B 3RYFE 3ZN1B 2CCQA 4YY3T 2KLQA 4AQGA 2YN6A 3ZCIA 1N33T 1MIYA 3GA8A 3WAKA 3FZMB 1S35A 1JNZA 4PJNA 4DV7T 3K8PC 5AQOB 3JC6C 3KV4A 4EXTA 3B13A 4H9OC 3RC8A 4ZZCA 2EHOB 4TWFA 2V7KA 2ZM0A 5C2TA 2UXNB 4P1NA 5FNVE 2YU2A 3P4QA 2NW9A 4PAGA 4EV6A 2V6YB 4JI3T 4BJNA 3ZYMA 2W67A 3C4ZA 4L5GA 5ABFA 2D5UA 2DWGA 3ZSTA 2KSRA 3H3MA 2X9XA 1EZ3A 4EIWA 4K0UA 5HEGA 3RIUA 2HPLA 3A8YC 3KBTA 3O4XE 2M6IA 5KXJA 4P09A 1IJ6A 4JI1T 2CXDA 3CKDA 4B6XA 3CVRA 3C4XA 3AE7A 4HFIA 5JREA 3ZJ1A 4KHZF 4YHHT 2LHRA 3E0ZA 1XNQT 1B7TA 2WMNA 4OYJA 3RKGA 3IEEA 2H3RA 3AEDA 4ZI7E 1SUMB 4QXBB 5IUXA 4JBWF 1US7B 2XQAA 2LRKA 4JEHB 5EK2A 1BR2A 2DWKA 4QH4A 4TUYE 5L3FB 4IE0A 3HI2A 3ESLA 4H63V 1ZHCA 2UUBT 5FXZA 2H7VC 2X9HA 2KWHA 3KV6A 2XAJB 4QH5A 2J1DG 2IC9A 3AXJB 5FXVA 2BDEA 2JPFA 4CXXA 1W09A 1XMQT 4DR4T 3ANWB 2CHOA 2PG8A 4LFAT 1UK5A 4HFDA 4U33A 3TKLB 2W62A 4O4IE 3MXZA 4IGUA 2QVAA 3SS1A 3QC9A 3QNUA 1CUNA 4TWDA 1S94A 2X68A 4B3MT 2XUEA 2LEHA 2E5LT 1KNZA 5DQWA 3OJAA 2YKSA 4I55E 5FYMA 3F31A 4A56A 5LGNB 5JDGA 1LRZA 3CIRA 1ZP0A 3RIUC 4LF7T 5A1LA 5LBQB 4JYAT 1WYCA 5LJMA 2DCFA 2A3DA 1W0AA 4PK4A 2VURA 2PBIA 3TLVA 3OVUA 4UVAB 2KINB 4WZXA 4YT0A 4AIUA 4AQFA 4WBNE 3EI0A 5BMVE 4H9SE 1IAPA 5AQUB 4HWCA 4MLKA 4DIDB 1MMDA 3AA1B 5AQPB 4UELA 3RRWA 4IE5A 3AB3B 3RPUA 4JUYA 3PUXF 4EEBA 4WW0A 3ZJ2A 4EOZB 3AE6A 3K1SA 3T1HT 4O2BE 5FL0A 4HWHA 4JI7T 2MPKA 3PJAJ 2NR4A 3AE9A 3FXEB 1OXZA 3T1YT 2RP4A 4YTPA 4OK0A 2YU1A 2V7JA 5AQIB 4ZI3D 3ZT7A 4WNKA 2I0MA 2XAFB 1E1HB 3KV5A 5KX5E 3H37A 2FJBA 2Y48B 5F8PA 2LSGA 4LMJA 4PJLA 4AKHA 4KBMB 4QH1A 3Q5EA 3Q9DA 2LJLA 3R6NA 2N9DA 4TZ4C 3CQXC 1JNRA 4DV4T 1HNXT 3C50A 3SRZA 5LG3A 4PK6A 5ABGA 2XQ3A 2LE8A 2UXDT 2WDQA 3S4UA 3AAEB 3V5UA 3ETUA 5L47A 2CMRA 3RH3A 3BQKA 2VK9A 4PW8A 4HEAA 5JR9B 4IE4A 1L0VA 5AQHB 2CA5A 4A97A 2W66A 4QX7B 3L8RA 2A72A 2VKDA 2CLYC 4ZS2A 1N36T 5L3GB 2WCAA 2KMFA 3ZC1A 2OV9A 4X1IE 1W0BA 4AQFC 3TLSA 3AE2A 3I0OA 5HAXA 3K3OA 3NKZA 3SOLA 3UU3A 4XZCA 3HL6A 1NWMX 3EVYA 3ZMUB 3BQLA 5AQMB 2KWIB 4ZI3C 3NBXX 2XQ7A 5FXXA 5CA0E 4HFEA 3K3NA 5FKYA 5ABEA 1FJGT 2DNXA 2WDRA 4YFSA 1BR1A 4Z8XA 2I6HA 1YQ4A 2M6BA 3RX6A 4IDPA 4HWIB 4QXHB 5ABHA 1HG2A 4DO0A 5LP6E 2VKJA 3O1HA 4TV9E 2QYWA 5C3JA 3KVBA 3N9QA 5IWAT 3AECA 3SFEA 2UXXB 1Z8UA 4PNIA 2IMLA 1KFYA 5C8YE 4KMCA 3O1IA 1MNEA 5FMNA 2VQET 2E5VA 4HFCA 2LSKA 1UX5A 4ZOLE 3RQWA 3NZPA 1XWMA 2XQ8A 3VR9A 4H9NC 2H88A 2XHEB 3UUXB 4ASKA 4PK5A 3RKOA 5AQGB 3I9WA 5AQTB 5L3BB 5ADXL 4LF8T 1J5WA 2Z6EA 3TLTA 1FIOA 1H7CA 4DV1T 5JDMA 5AQVB 1HR0T 2DI4A 3AEEA 3HKBE 3FZKB 4CZZB 1HNWT 1G8XA 3FZHB 4U7YA 3GWHA 3UU5A 2X51A 4E7SA 4X1KE 3EABA 2HN1A 3QOFA 3RIFA 3AEGA 5ETWA 3MJXA 2MAWA 1YKHB 4Q25A 1I94T 2WMOA 5FP3A 4X1YE 2LOSA 4QXCB 2C5IT 1MNDA 3PE0A 5L4EA 3N2KE 4YLHA 4AXPA 3KV9A 3J9X1 2K9AA 4YTNA 5J1GA 3GMIA 2V5CA 1I6ZA 1V9DA 3UUMA 4NXNT 4IREA 5HWXA 3HKEE 3ONLC 5EK3A 3AE1A 4CN4A 2Y8DA 2YOEA 1WFDA 3CPZA 3ZKRA 1LKXA 5AQSB 4EAHA 5HXSA 5J2TE 3OBVE 4O4JE 1YKEB 1MIVA 4COFA 3C51A 2NOXA 3QUJA 4WYVA 1OWAA 3G06A 4PJJA 3LBXA 3AA0B 2LSJA 4X5TA 1FMWA 2NP9A 1MMAA 3OKQA 1HNZT 3CWZB 5DQVA 4DV2T 5JDFA 5HCMA 4DV0T 2ODUA 2OLTA 3CX7B 2JMHA 1UCUA 3P4PA 4P0AA 1KEYA 5LHIB 2ZM2A 5HEUA 3UU4A 1XNRT 4C91A 4F8HA 4YHJA 1OEDA 3J7Yq 3JADA 4UEMA 4ZS3A 3IBPA 2LM9A 3GN5A 3X1DA 3UU6A 4O4LE 2A2FX 4KP3C 3PUGA 3B5MA 5E0OA 1W9RA 3HKCE 2W0GA 3C98B 3JAFA 3KBUA 5IYZE 2ODVA 3FZFB 5FVKA 4DR1T 2MOZA 5JDLA 4PFOA 2PTFA 5HXCA 3EHZA 1IBMT 1M62A 4DV5T 3PUWF 3RI5A 2H89A 3VRAA 2XM1A 4YSZA 2NTYA 4U2YA 2LKHA 1E2AA 4JI8T 4NUUA 1T98A 2V6YA 4DV6T 2JQQA 2X67A 4HE8A 5JRCA 1KNRA 5L3DB 5FY0A 5HEHA 1QSDA 2I59A 3MACA 2C5JA 2CPTA 3DTOA 2BZBA 4TWHA 2WAUA 4BJMA 2E2AA 5H6RB 3PU3A 3D0TA 4B3RT 4YJ3E 1Z0PA 2J62A 4I43B 3ZT5A 5HYAA 2E9XA 4TN7B 2CWYA 2VVNA 3PUVF 2P9BA 4DMVA 4IE7A 1MMNA 3P4SA 5LGUB 1G73A 3Q5WA 2E9XD 3ZEFB 4UXNB 1OEDC 1E7PA 1GQEA 1XDOA 4QKNA 3N9PA 2XM2A 4OYKA 3I1AA 2X9YA 3I0QA 2AXDS 3Q5XA 4H9QC 1UX4A 4CN6A 1KK7A 4LFCT 4FJOA 5KDMC 2FUPA 3AVRA 3C4WA 1HS7A 2FJDA 3B57A 2VWAA 1VCTA 4GOUA 1OEDE 2YDSA 2X0LB 4EZHA 4EZ4A 3ZMZB 4X65T 4OHFA 3IF8B 2BBHA 3UFEA 1IBKT 4O8SA 3AE3A 4U31A 4P0BA 1QUUA 2E8IA 5LHHB 2BG9A 3OYZA 4TV8E 3MKDA 5AQLB 4EYUA 3HKDE 1WYBA 4IHJE 5CGMA 4AKLA 4U7IA 5LHGB 1LVFA 4GKKT 4AQYT 3VKGA 1DU2A 4Z90A 2IAKA 4HFVA 4B3ST 4JLEA 1SHZC 3UUNA 2E9XC 5LMNT 3PUQA 2LRLA 4X62T 3L39A 2WS3A 2W00A 3ZLIA 2L9QA 1YW0A 2CRBA 2WWVA 3RYHE 3UTKA 4JI6T 4DNDA 3WAJA 2Y6XA 2LM2A 2F4VT 3UU8A 4I0UA 2SPCA 4IL4A 4DUYT 4JEUB 1WRDA 2K48A 3WI3A 1HF8A 1R8IA 3EDUA 2XAHB 3V5SA 1Y64B 1VOMA 2BKPA 3N9OA 4DV3T 4HWDA 4G63A 4LFBT 2WM9A 2W61A 5HXHA 1LVKA 1T72A 4QWNB 2BVLA 3NRYA 2N2NA 4KI0F 5JVDE 5LA6E 3LJCA 5L4HA 4DR3T 4HGAA 2UU9T 4KUMB 4LMLA 4NPPA 2BG9C 4IE6A 3UUBA 1MIWA 1NAFA 3ZN0B 2FJEA 1D1BA 4ILAA 2JRKA 2FJAA 1HCIA 4YXDA 4HN9A 4DUZT 3E08A 3PURA 2NW7A 4YTMA 4HWFA 1UURA 4ZZBA 2XASB 4IDOA 2Q9QA 5HWYA 3ONJA 2LOPA 4LF9T 3O9XA 4JV5T 2BG9E 3VRBA 3AAAB 2Q9QD 2M67A 4ERRA 3R84B 3CQGB 2XTLA 4U74A 1D0XA 3CX8B 3UQ7A 3MZKB 4CI1B 1IBLT 3O1JA 3UT5E 2BS4A 3AE5A 4I4TE 2IC6A 1ZOYA 2JQKA 3E22E 1IJ5A 4AKGA 2LHNA 3A5XA 4QX8B 5BR8T 5FL1A 5J2UE 4DR2T 4ISSA 2C0SA 2WZHA 2JQ9A 3PDYA 2LSIA 2V5DA 2ES0A 3KVAA 3C64A 3DJBA 4E7ZA 2L8KA 3LBXB 1O3XA 4B3TT 1KF6A 4EGWA 2ZM8A 4CXWA 4JI4T 1U4QA 2XQYA 2G0UA 5FY7A 3FXDB 5AQJB 4ADZA 4GIWA 1VRBA 2K5BB 3RGLA 4DR6T 2CBJA 4A98A 2XY8B 5ABFB 5J0ZA 4X66T 3MA9A 1J1JA 4LF4T 4J2CA 3M3ZB 2VL8A 3N9MA 5L3CB 4A5XA 2WBLA 3ZYLA 3AA7B 3KINB 4H9PC 2J47A 4U3CA 1OEDB 2Q9QC 1SA0E 2W4XA 4ZXLA 4UF0A 3CQCB 3EDVA 3N5LA 3LK42 3KFWX 5HCJA 2IDOB 5LB7B 5LG4A 2UUCT 2HN2A 2K24A 5LMUT 2UUAT 3SWHA 3NRXA 2XAQB 3ZMSB 1ZV4X 2D2SA 1CHUA 2J4GA 4UV8B 5CJ5A 4K0KT 3N9NA 2AE9A 4IL9A 2IIUA 1BR0A 2JIWA 4DBRA 2VB6A 2WDVA 2K3WA 3F2EA 3JCFA 3QK6A 3IA3A 1HG5A 3PJAA 2FBWA 2KXPB 3PUSA 4C90A 4ISTA 5H6QB 3P4WA 3SFDA 1XDPA 4GK5E 2V26A 4XBFB 5LXTE 3VKHA 2XZEA 1Y01A 5AQRB 5JRCB 3QB5A 2WU5A 3P50A 2XQ6A 2WSSV 3ZSSA 2YEVC 1QLBA 2GK9A 1AJ3A 2JMKA 2PJQA 1T8BA 1NEKA 5HEJA 2L3LA 2V7LA 3EAMA 2XJ7A 3UQ4A 3RRCA 5FXWA 4Z91A 4TNVA 2E9XB 4JI5T 2KT9A 2ACXA 3ONXA 4IDZA 3TLUA 5FY1A 5HEOA 1YXRA 3F57A 4LMKA 4M1PA 5LOVE 2CEAA 1HX1B 2HPJA 4JI0T 5HXEA 3RIAA 5EK4A 2B1EA 5L3EB 2CLYB 2CE7A 2BBJA 2XQ4A 2EHOA 5CFBA 1SE7A 2V6XA 4HKAA 5EZYE 2VQFT 4CI2B 3FZLB 4LF5T 2EHOD 3LDQB 5FVLA 3AE4A 2C5KT 5IHYA 2RPAA 3RHWA 3Q2MA 5AFUL 2ZMAA 4MFRA 2WU2A 3FBZA 4NIQA 2V8SV 2CXFA 3FB2A 2IHR1 1M7KA 4GYRA 2BG9B 5JTGA 1X9BA 2X9WA 5LJNA 2CBIA 5JDQA 4GK0E 2WB5A 4U2ZA 2VASA 1UGOA 1MMGA 2LKGA 4U72A 2LT3A 4F6RC 1ZKEA 2W63A 3N9LA 2PFVA 1HX8A 1D0ZA 4UIGA 4UVCB 2BS2A 2CXLA 5L2LA 4DVDA 2RA1A 4ZI2D 3AAIA 5LGTB 3P8CD 2LLYA 3AXJA 1D0YA 5F3JA 3CX6B 3QB5K 3ANWA 4LF6T 2VL0A 3VR8A 1HTJF 4O4HE 4UR9A 4DBQA 2CWOA 2DLRA 4OFZA 3RQUA 2EHOC 2IW5B 1WR0A 1D1AA 4EEDA 2XAGB 3PV0F 4DMWA 3RF1A 2XSBA 3ABVA 5AQFB 4AKIA 2NWBA 4ZHQE 4BA9A 3RC3A 4L0RA 4IDQA 2IUBA 1FMVA 3L3PA 1HFAA 2D0TA 3PUAA 2MBGA 2BVMA 3ZMTB 5DJQC 3PU8A 3CMLA 4CXYA 3JAEA 3OPCA 5CA1E 1N34T 2QRXA 4ILBA 4L9IA 3RLFF 4MBQA 4DR7T 3UULA 3KDSE 2XPKA 3ZC0A 2KNDA 2WZIA 2VVSA 3HA4A 4GKJT 3LSVA 4PJMA 1YQ3A 4OX9T 2WP9A 3ZCJA 3ZT6A 4HFBA 5LYJE 3NZQA 4KX6A 4ZEYA 3LFMA 3HR0A 4ILCA 3LK2B 2XQ9A 4NXMT 4ZI2C 5LBMA 5AQQB 4UV9B 2Q9QB 4X20E 3A7MA 2MTQA 2WQYA 4N78D 5M4YA 5KMGP 4KHPT 2JQHA 2UXCT 3RYIE 3VHLA 2MYSA 2KZ7B 1NENA 5GONE 3CK6A 2LSYA 4AISA 3L09A 2CHNA 4UVBB 1ZEEA 2UXBT 1WLXA 2H7OA 2VKOA 5JH7E 2D9DA 3ZYKA 2WWUA 3TLWA 4HFHA 3U3IA 1XZYA 4EYYR 3AA6B 3EUHA 4I50E 1WR6A 4IIJE 5LCYA 4QHOA 3T8OA 4MALA 4DR5T 2ZM6T 4HTEA 4NUVA 2CM0A 4AKRB 2A9UA 2XSAA 1X79A 4IT4A 3FBLA 3I9YA 3OYXA 3NWIA 2BKOA 4TNWA 2R6GF 2V1DB 5JR9A 3OTOT 4O2AE 4PFPA 3IHRA 4CN1A 1N32T 1YD8G 3P4RA 4JI2T 2YDRA 2OA5A 2WY2A 1BR4A 3DP7A 3RYCE 4YSXA 3FHNA 3K3QC 3U78A 2QGSA 3NVOA 3AVSA 3N2GE 3ETVA 4ANJA 3H3AA 3Q5DA 5LNKA 2YINA 3AEFA 2VKHA 1KNPA 5CB4E 4EB6E 4X64T 5JQGE 4CQIA 4V1Av 5DABA 5HXRA 2X0YA 2X66A 4YJ2E 1WCRA 4IDNA 3P7IA 2N1GA 4GYSA 5TAOA 4WBOA 4UF0B 2NW8A 5JDHA 4G2AA 2X0HA 3ZPOA
chains in the Genus database with same CATH topology
3Q5WA 3BQIA 2V26A 4XBFB 3W15B 2D0UA 4QX7B 2A72A 2VKDA 2CLYC 2E9XD 3JC6D 4UXNB 4ZS2A 3ZEFB 5L3GB 5LXTE 3VKHA 4AI6A 2ZLYA 2KMFA 5JRCB 3ZC1A 4X1IE 4AQFC 3LK3B 3BK9A 4QKNA 3N9PA 3VU7H 4ILUA 2WSSV 3I0OA 5HAXA 2YEVC 5JDNA 3K3OA 4OYKA 2GK9A 1AJ3A 2JMKA 3I1AA 2X9YA 1FEWA 3I0QA 2PJQA 4FI5A 3Q5XA 3SOLA 4H9QC 1UX4A 4XZCA 3HL6A 1NWMX 2L3LA 2V7LA 3EVYA 3ZMUB 1U5PA 1KK7A 4MHCA 2HH7A 2DHRA 4FJOA 5KDMC 3AVRA 3RRCA 3C4WA 5FXWA 1HS7A 3BQLA 3B57A 2VWAA 2E9XB 4GOUA 1D1CA 2KWIB 4ZI3C 2KT9A 2NTXA 2ACXA 3ONXA 2X0LB 3NBXX 4IDZA 3ZMVB 4EZHA 5FY1A 4EZ4A 3N2OA 5FXXA 5CA0E 2V7IA 3F57A 2V7MA 4M1PA 5LOVE 3K3NA 2CEAA 3ZMZB 3M65A 2DNXA 4OHFA 3IF8B 2HPJA 4BAYB 5HXEA 4YFSA 2YK0A 4XAXB 1BR1A 3UFEA 5EK4A 4H9RC 3MK7C 4Z8XA 1IZNB 2B1EA 4O8SA 5L3EB 2CLYB 3PTRB 4TX5A 4H63H 3RX6A 2CE7A 4CI3B 5JR9C 4P0BA 1QUUA 2E8IA 2EHOA 4QXHB 3LG7A 2JJ9A 5LHHB 1HG2A 4HKAA 4DO0A 5LP6E 2QA7A 5EZYE 2VKJA 3OYZA 3O1HA 3GN5B 4TV9E 4TV8E 3MKDA 3RYFE 4CI2B 3ZN1B 3HKDE 4EYUA 1WYBA 2CCQA 3KVBA 3N9QA 2EHOD 2KLQA 4AQGA 2UXXB 4IHJE 2C5KT 4PNIA 3ZCIA 5IHYA 1LVFA 4AKLA 5LHGB 3Q2MA 1MIYA 3GA8A 3WAKA 5AFUL 1S35A 5C8YE 3VKGA 4KMCA 3O1IA 2IAKA 1MNEA 2ZMAA 4HFVA 4PJNA 5FMNA 2LSKA 3K8PC 4JLEA 1SHZC 1UX5A 3UUNA 4ZOLE 3NZPA 2E9XC 4MFRA 3JC6C 3FBZA 3KV4A 3PUQA 4EXTA 4H9NC 2XHEB 3UUXB 2CXFA 3FB2A 4ASKA 2W00A 3B13A 4PK5A 4H9OC 3ZLIA 3RC8A 2EHOB 3RKOA 3I9WA 2L9QA 2V7KA 4GYRA 2ZM0A 5L3BB 5ADXL 1YW0A 2Z6EA 2UXNB 5FNVE 3RYHE 3UTKA 2YU2A 2NW9A 1FIOA 1H7CA 4DNDA 4PAGA 3WAJA 2Y6XA 5JDMA 2X9WA 5LJNA 4BJNA 3ZYMA 5JDQA 2SPCA 4JEUB 3C4ZA 2DI4A 4GK0E 4L5GA 2D5UA 1WRDA 2DWGA 3HKBE 2VASA 4GK5E 2K48A 3WI3A 4CZZB 1HF8A 1G8XA 2X9XA 1MMGA 1EZ3A 4EIWA 4K0UA 3GWHA 4U72A 2HPLA 2LT3A 3O4XE 3KBTA 4F6RC 1ZKEA 2X51A 4P09A 4E7SA 3EDUA 4X1KE 2W63A 2XAHB 2PFVA 3N9LA 1IJ6A 1HX8A 3V5SA 1D0ZA 2CXDA 3CKDA 4UIGA 4UVCB 4B6XA 1Y64B 3CVRA 3C4XA 2CXLA 1VOMA 3N9OA 5ETWA 5JREA 5L2LA 4DVDA 2RA1A 3ZJ1A 4ZI2D 3MJXA 3AAIA 5LGTB 4G63A 3P8CD 2WM9A 1YKHB 1D0YA 2W61A 2LHRA 5HXHA 5F3JA 3CX6B 3E0ZA 2WMOA 5FP3A 3ANWA 4X1YE 1B7TA 2LOSA 1LVKA 2WMNA 4QXCB 4OYJA 2C5IT 1MNDA 3PE0A 4QWNB 1HTJF 2BVLA 3IEEA 3NRYA 3N2KE 2H3RA 4O4HE 4YLHA 4AXPA 2N2NA 3KV9A 4ZI7E 3J9X1 5JVDE 5LA6E 4DBQA 2CWOA 3LJCA 4HGAA 4QXBB 2DLRA 2K9AA 4OFZA 5J1GA 3GMIA 2EHOC 2IW5B 4KUMB 1US7B 1V9DA 3UUMA 5HWXA 3HKEE 1D1AA 4JEHB 5EK3A 5EK2A 1BR2A 2DWKA 2Y8DA 2XAGB 4IE6A 4TUYE 4DMWA 1MIWA 1NAFA 3CPZA 4IE0A 3ZN0B 5L3FB 3HI2A 1D1BA 3ESLA 2JRKA 4H63V 1LKXA 4AKIA 2NWBA 1ZHCA 1HCIA 4EAHA 4ZHQE 5HXSA 5J2TE 4BA9A 3OBVE 5FXZA 4HN9A 2H7VC 4L0RA 3RC3A 2X9HA 2KWHA 3KV6A 2XAJB 3E08A 1FMVA 2J1DG 3L3PA 4O4JE 1HFAA 3PURA 2D0TA 1YKEB 1MIVA 2IC9A 2NW7A 3C51A 2NOXA 5FXVA 2BDEA 2JPFA 2XASB 3PUAA 4CXXA 3QUJA 2Q9QA 3ANWB 5HWYA 2MBGA 2PG8A 2BVMA 3ZMTB 2LOPA 5DJQC 1OWAA 3PU8A 4PJJA 3TKLB 3O9XA 3CMLA 2W62A 4CXYA 4O4IE 3MXZA 4IGUA 3SS1A 5CA1E 3AAAB 3LBXA 2Q9QD 3AA0B 3QC9A 2M67A 2LSJA 4L9IA 4ERRA 3R84B 4MBQA 3CQGB 2XTLA 3UULA 1CUNA 3KDSE 4U74A 1S94A 1D0XA 3CX8B 2X68A 3ZC0A 2KNDA 3MZKB 2XUEA 4CI1B 1FMWA 2LEHA 2NP9A 3HA4A 3O1JA 5DQWA 3UT5E 4PJMA 1KNZA 3OJAA 1MMAA 4I4TE 3OKQA 2IC6A 4I55E 3F31A 3CWZB 5DQVA 5FYMA 4A56A 3ZCJA 3E22E 5LGNB 1IJ5A 5JDGA 1LRZA 4AKGA 2LHNA 5LYJE 3A5XA 3NZQA 4QX8B 5JDFA 3LFMA 5A1LA 3HR0A 2ODUA 5LBQB 3CX7B 3LK2B 5J2UE 2JMHA 4ISSA 1UCUA 4ZI2C 5LBMA 2C0SA 1WYCA 4UV9B 5LJMA 2DCFA 3PDYA 2LSIA 2Q9QB 2A3DA 4P0AA 4X20E 5LHIB 2MTQA 2ZM2A 4N78D 5M4YA 4PK4A 2ES0A 3KVAA 3C64A 5KMGP 4C91A 2PBIA 3DJBA 3RYIE 4E7ZA 2L8KA 3LBXB 4YHJA 1O3XA 4UVAB 2KINB 2MYSA 2KZ7B 3VHLA 3J7Yq 5GONE 2LSYA 3L09A 4UVBB 2ZM8A 4AQFA 1ZEEA 4CXWA 1WLXA 2H7OA 2VKOA 4UEMA 4ZS3A 4WBNE 3IBPA 2LM9A 5JH7E 5BMVE 1U4QA 2XQYA 3GN5A 2G0UA 5FY7A 3ZYKA 3FXDB 2WWUA 4O4LE 4H9SE 2A2FX 1IAPA 3U3IA 4KP3C 3AA6B 1VRBA 2K5BB 4GIWA 4ADZA 4EYYR 3PUGA 4MLKA 1MMDA 3EUHA 5E0OA 3AA1B 4I50E 1WR6A 4IIJE 5LCYA 4QHOA 3T8OA 4UELA 3MA9A 4MALA 3RRWA 4IE5A 3AB3B 3RPUA 4JUYA 4HTEA 4J2CA 4NUVA 2CM0A 2VL8A 3N9MA 4WW0A 3HKCE 3ZJ2A 2W0GA 5L3CB 3C98B 4EOZB 4AKRB 4O2BE 3KBUA 5IYZE 1X79A 2ODVA 2WBLA 2MOZA 5JDLA 3ZYLA 4PFOA 3AA7B 3KINB 4H9PC 5HXCA 3FXEB 1OXZA 2RP4A 3FBLA 2YU1A 3I9YA 4OK0A 3OYXA 2V7JA 2Q9QC 4ZI3D 1SA0E 2NTYA 4WNKA 2XAFB 1E1HB 3KV5A 5KX5E 3H37A 2V1DB 4UF0A 3CQCB 3EDVA 3N5LA 2Y48B 5JR9A 5F8PA 3LK42 2LSGA 3KFWX 4PJLA 4O2AE 4AKHA 4NUUA 1T98A 4PFPA 3IHRA 4KBMB 2JQQA 2X67A 5LG4A 3Q9DA 4HE8A 1YD8G 2LJLA 5JRCA 2K24A 3R6NA 2N9DA 2OA5A 3SWHA 5L3DB 1BR4A 3DP7A 3NRXA 4TZ4C 3CQXC 3FHNA 5FY0A 3RYCE 3K3QC 3U78A 1QSDA 2QGSA 2I59A 3AVSA 3MACA 2C5JA 2XAQB 3N2GE 3ZMSB 1ZV4X 2D2SA 3C50A 3ETVA 3SRZA 3DTOA 4ANJA 3H3AA 4UV8B 2BZBA 5LNKA 4PK6A 2WAUA 2YINA 4BJMA 2VKHA 2LE8A 5H6RB 5CB4E 4EB6E 3N9NA 3S4UA 3AAEB 5JQGE 1BR0A 3V5UA 3ETUA 3PU3A 3D0TA 4V1Av 5DABA 4CQIA 4YJ3E 4DBRA 5HXRA 2VB6A 2X66A 2CMRA 3RH3A 4YJ2E 1Z0PA 3F2EA 3QK6A 3BQKA 4I43B 5HYAA 2E9XA 2VK9A 3P7IA 2CWYA 4TN7B 4PW8A 1HG5A 2N1GA 2P9BA 4GYSA 5TAOA 4HEAA 4WBOA 4DMVA 2KXPB 4UF0B 2NW8A 4IE7A 1MMNA 3PUSA 4C90A 5JR9B 5JDHA 4ISTA 1G73A 5H6QB 5LGUB 4G2AA 4IE4A 3ZPOA 2CA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT3 A;  4KMC A;  4MFR A;  4KBM B;  4ILU A;  4L5G A;  4XAX B; 
#chains in the Genus database with same CATH topology
 3BQI A;  3W15 B;  2D0U A;  4YSY A;  2BKN A;  2W2U A;  2DL1 A;  3AE8 A;  3JC6 D;  4AI6 A;  2ZLY A;  3LK3 B;  1UUS A;  3BK9 A;  2BS3 A;  3AEA A;  3VU7 H;  4ILU A;  2HHH T;  5JDN A;  3UFG A;  1FEW A;  3AEB A;  4FI5 A;  1T7S A;  1XMO T;  1U5P A;  4MHC A;  2HH7 A;  3PUY F;  2DHR A;  2ACZ A;  1VCS A;  2B76 A;  3PUZ F;  5AQK B;  1D1C A;  5AQN B;  2NTX A;  3ZMV B;  3N2O A;  2V7I A;  2V7M A;  3M65 A;  2YDQ A;  4BAY B;  2YK0 A;  4XAX B;  4H9R C;  3MK7 C;  1IZN B;  5F5W A;  3PTR B;  4TX5 A;  4H63 H;  4CI3 B;  1J5E T;  5JR9 C;  3LG7 A;  2JJ9 A;  2QA7 A;  2XQ5 A;  3GN5 B;  3RYF E;  3ZN1 B;  2CCQ A;  4YY3 T;  2KLQ A;  4AQG A;  2YN6 A;  3ZCI A;  1N33 T;  1MIY A;  3GA8 A;  3WAK A;  3FZM B;  1S35 A;  1JNZ A;  4PJN A;  4DV7 T;  3K8P C;  5AQO B;  3JC6 C;  3KV4 A;  4EXT A;  3B13 A;  4H9O C;  3RC8 A;  4ZZC A;  2EHO B;  4TWF A;  2V7K A;  2ZM0 A;  5C2T A;  2UXN B;  4P1N A;  5FNV E;  2YU2 A;  3P4Q A;  2NW9 A;  4PAG A;  4EV6 A;  2V6Y B;  4JI3 T;  4BJN A;  3ZYM A;  2W67 A;  3C4Z A;  4L5G A;  5ABF A;  2D5U A;  2DWG A;  3ZST A;  2KSR A;  3H3M A;  2X9X A;  1EZ3 A;  4EIW A;  4K0U A;  5HEG A;  3RIU A;  2HPL A;  3A8Y C;  3KBT A;  3O4X E;  2M6I A;  5KXJ A;  4P09 A;  1IJ6 A;  4JI1 T;  2CXD A;  3CKD A;  4B6X A;  3CVR A;  3C4X A;  3AE7 A;  4HFI A;  5JRE A;  3ZJ1 A;  4KHZ F;  4YHH T;  2LHR A;  3E0Z A;  1XNQ T;  1B7T A;  2WMN A;  4OYJ A;  3RKG A;  3IEE A;  2H3R A;  3AED A;  4ZI7 E;  1SUM B;  4QXB B;  5IUX A;  4JBW F;  1US7 B;  2XQA A;  2LRK A;  4JEH B;  5EK2 A;  1BR2 A;  2DWK A;  4QH4 A;  4TUY E;  5L3F B;  4IE0 A;  3HI2 A;  3ESL A;  4H63 V;  1ZHC A;  2UUB T;  5FXZ A;  2H7V C;  2X9H A;  2KWH A;  3KV6 A;  2XAJ B;  4QH5 A;  2J1D G;  2IC9 A;  3AXJ B;  5FXV A;  2BDE A;  2JPF A;  4CXX A;  1W09 A;  1XMQ T;  4DR4 T;  3ANW B;  2CHO A;  2PG8 A;  4LFA T;  1UK5 A;  4HFD A;  4U33 A;  3TKL B;  2W62 A;  4O4I E;  3MXZ A;  4IGU A;  2QVA A;  3SS1 A;  3QC9 A;  3QNU A;  1CUN A;  4TWD A;  1S94 A;  2X68 A;  4B3M T;  2XUE A;  2LEH A;  2E5L T;  1KNZ A;  5DQW A;  3OJA A;  2YKS A;  4I55 E;  5FYM A;  3F31 A;  4A56 A;  5LGN B;  5JDG A;  1LRZ A;  3CIR A;  1ZP0 A;  3RIU C;  4LF7 T;  5A1L A;  5LBQ B;  4JYA T;  1WYC A;  5LJM A;  2DCF A;  2A3D A;  1W0A A;  4PK4 A;  2VUR A;  2PBI A;  3TLV A;  3OVU A;  4UVA B;  2KIN B;  4WZX A;  4YT0 A;  4AIU A;  4AQF A;  4WBN E;  3EI0 A;  5BMV E;  4H9S E;  1IAP A;  5AQU B;  4HWC A;  4MLK A;  4DID B;  1MMD A;  3AA1 B;  5AQP B;  4UEL A;  3RRW A;  4IE5 A;  3AB3 B;  3RPU A;  4JUY A;  3PUX F;  4EEB A;  4WW0 A;  3ZJ2 A;  4EOZ B;  3AE6 A;  3K1S A;  3T1H T;  4O2B E;  5FL0 A;  4HWH A;  4JI7 T;  2MPK A;  3PJA J;  2NR4 A;  3AE9 A;  3FXE B;  1OXZ A;  3T1Y T;  2RP4 A;  4YTP A;  4OK0 A;  2YU1 A;  2V7J A;  5AQI B;  4ZI3 D;  3ZT7 A;  4WNK A;  2I0M A;  2XAF B;  1E1H B;  3KV5 A;  5KX5 E;  3H37 A;  2FJB A;  2Y48 B;  5F8P A;  2LSG A;  4LMJ A;  4PJL A;  4AKH A;  4KBM B;  4QH1 A;  3Q5E A;  3Q9D A;  2LJL A;  3R6N A;  2N9D A;  4TZ4 C;  3CQX C;  1JNR A;  4DV4 T;  1HNX T;  3C50 A;  3SRZ A;  5LG3 A;  4PK6 A;  5ABG A;  2XQ3 A;  2LE8 A;  2UXD T;  2WDQ A;  3S4U A;  3AAE B;  3V5U A;  3ETU A;  5L47 A;  2CMR A;  3RH3 A;  3BQK A;  2VK9 A;  4PW8 A;  4HEA A;  5JR9 B;  4IE4 A;  1L0V A;  5AQH B;  2CA5 A;  4A97 A;  2W66 A;  4QX7 B;  3L8R A;  2A72 A;  2VKD A;  2CLY C;  4ZS2 A;  1N36 T;  5L3G B;  2WCA A;  2KMF A;  3ZC1 A;  2OV9 A;  4X1I E;  1W0B A;  4AQF C;  3TLS A;  3AE2 A;  3I0O A;  5HAX A;  3K3O A;  3NKZ A;  3SOL A;  3UU3 A;  4XZC A;  3HL6 A;  1NWM X;  3EVY A;  3ZMU B;  3BQL A;  5AQM B;  2KWI B;  4ZI3 C;  3NBX X;  2XQ7 A;  5FXX A;  5CA0 E;  4HFE A;  3K3N A;  5FKY A;  5ABE A;  1FJG T;  2DNX A;  2WDR A;  4YFS A;  1BR1 A;  4Z8X A;  2I6H A;  1YQ4 A;  2M6B A;  3RX6 A;  4IDP A;  4HWI B;  4QXH B;  5ABH A;  1HG2 A;  4DO0 A;  5LP6 E;  2VKJ A;  3O1H A;  4TV9 E;  2QYW A;  5C3J A;  3KVB A;  3N9Q A;  5IWA T;  3AEC A;  3SFE A;  2UXX B;  1Z8U A;  4PNI A;  2IML A;  1KFY A;  5C8Y E;  4KMC A;  3O1I A;  1MNE A;  5FMN A;  2VQE T;  2E5V A;  4HFC A;  2LSK A;  1UX5 A;  4ZOL E;  3RQW A;  3NZP A;  1XWM A;  2XQ8 A;  3VR9 A;  4H9N C;  2H88 A;  2XHE B;  3UUX B;  4ASK A;  4PK5 A;  3RKO A;  5AQG B;  3I9W A;  5AQT B;  5L3B B;  5ADX L;  4LF8 T;  1J5W A;  2Z6E A;  3TLT A;  1FIO A;  1H7C A;  4DV1 T;  5JDM A;  5AQV B;  1HR0 T;  2DI4 A;  3AEE A;  3HKB E;  3FZK B;  4CZZ B;  1HNW T;  1G8X A;  3FZH B;  4U7Y A;  3GWH A;  3UU5 A;  2X51 A;  4E7S A;  4X1K E;  3EAB A;  2HN1 A;  3QOF A;  3RIF A;  3AEG A;  5ETW A;  3MJX A;  2MAW A;  1YKH B;  4Q25 A;  1I94 T;  2WMO A;  5FP3 A;  4X1Y E;  2LOS A;  4QXC B;  2C5I T;  1MND A;  3PE0 A;  5L4E A;  3N2K E;  4YLH A;  4AXP A;  3KV9 A;  3J9X 1;  2K9A A;  4YTN A;  5J1G A;  3GMI A;  2V5C A;  1I6Z A;  1V9D A;  3UUM A;  4NXN T;  4IRE A;  5HWX A;  3HKE E;  3ONL C;  5EK3 A;  3AE1 A;  4CN4 A;  2Y8D A;  2YOE A;  1WFD A;  3CPZ A;  3ZKR A;  1LKX A;  5AQS B;  4EAH A;  5HXS A;  5J2T E;  3OBV E;  4O4J E;  1YKE B;  1MIV A;  4COF A;  3C51 A;  2NOX A;  3QUJ A;  4WYV A;  1OWA A;  3G06 A;  4PJJ A;  3LBX A;  3AA0 B;  2LSJ A;  4X5T A;  1FMW A;  2NP9 A;  1MMA A;  3OKQ A;  1HNZ T;  3CWZ B;  5DQV A;  4DV2 T;  5JDF A;  5HCM A;  4DV0 T;  2ODU A;  2OLT A;  3CX7 B;  2JMH A;  1UCU A;  3P4P A;  4P0A A;  1KEY A;  5LHI B;  2ZM2 A;  5HEU A;  3UU4 A;  1XNR T;  4C91 A;  4F8H A;  4YHJ A;  1OED A;  3J7Y q;  3JAD A;  4UEM A;  4ZS3 A;  3IBP A;  2LM9 A;  3GN5 A;  3X1D A;  3UU6 A;  4O4L E;  2A2F X;  4KP3 C;  3PUG A;  3B5M A;  5E0O A;  1W9R A;  3HKC E;  2W0G A;  3C98 B;  3JAF A;  3KBU A;  5IYZ E;  2ODV A;  3FZF B;  5FVK A;  4DR1 T;  2MOZ A;  5JDL A;  4PFO A;  2PTF A;  5HXC A;  3EHZ A;  1IBM T;  1M62 A;  4DV5 T;  3PUW F;  3RI5 A;  2H89 A;  3VRA A;  2XM1 A;  4YSZ A;  2NTY A;  4U2Y A;  2LKH A;  1E2A A;  4JI8 T;  4NUU A;  1T98 A;  2V6Y A;  4DV6 T;  2JQQ A;  2X67 A;  4HE8 A;  5JRC A;  1KNR A;  5L3D B;  5FY0 A;  5HEH A;  1QSD A;  2I59 A;  3MAC A;  2C5J A;  2CPT A;  3DTO A;  2BZB A;  4TWH A;  2WAU A;  4BJM A;  2E2A A;  5H6R B;  3PU3 A;  3D0T A;  4B3R T;  4YJ3 E;  1Z0P A;  2J62 A;  4I43 B;  3ZT5 A;  5HYA A;  2E9X A;  4TN7 B;  2CWY A;  2VVN A;  3PUV F;  2P9B A;  4DMV A;  4IE7 A;  1MMN A;  3P4S A;  5LGU B;  1G73 A;  3Q5W A;  2E9X D;  3ZEF B;  4UXN B;  1OED C;  1E7P A;  1GQE A;  1XDO A;  4QKN A;  3N9P A;  2XM2 A;  4OYK A;  3I1A A;  2X9Y A;  3I0Q A;  2AXD S;  3Q5X A;  4H9Q C;  1UX4 A;  4CN6 A;  1KK7 A;  4LFC T;  4FJO A;  5KDM C;  2FUP A;  3AVR A;  3C4W A;  1HS7 A;  2FJD A;  3B57 A;  2VWA A;  1VCT A;  4GOU A;  1OED E;  2YDS A;  2X0L B;  4EZH A;  4EZ4 A;  3ZMZ B;  4X65 T;  4OHF A;  3IF8 B;  2BBH A;  3UFE A;  1IBK T;  4O8S A;  3AE3 A;  4U31 A;  4P0B A;  1QUU A;  2E8I A;  5LHH B;  2BG9 A;  3OYZ A;  4TV8 E;  3MKD A;  5AQL B;  4EYU A;  3HKD E;  1WYB A;  4IHJ E;  5CGM A;  4AKL A;  4U7I A;  5LHG B;  1LVF A;  4GKK T;  4AQY T;  3VKG A;  1DU2 A;  4Z90 A;  2IAK A;  4HFV A;  4B3S T;  4JLE A;  1SHZ C;  3UUN A;  2E9X C;  5LMN T;  3PUQ A;  2LRL A;  4X62 T;  3L39 A;  2WS3 A;  2W00 A;  3ZLI A;  2L9Q A;  1YW0 A;  2CRB A;  2WWV A;  3RYH E;  3UTK A;  4JI6 T;  4DND A;  3WAJ A;  2Y6X A;  2LM2 A;  2F4V T;  3UU8 A;  4I0U A;  2SPC A;  4IL4 A;  4DUY T;  4JEU B;  1WRD A;  2K48 A;  3WI3 A;  1HF8 A;  1R8I A;  3EDU A;  2XAH B;  3V5S A;  1Y64 B;  1VOM A;  2BKP A;  3N9O A;  4DV3 T;  4HWD A;  4G63 A;  4LFB T;  2WM9 A;  2W61 A;  5HXH A;  1LVK A;  1T72 A;  4QWN B;  2BVL A;  3NRY A;  2N2N A;  4KI0 F;  5JVD E;  5LA6 E;  3LJC A;  5L4H A;  4DR3 T;  4HGA A;  2UU9 T;  4KUM B;  4LML A;  4NPP A;  2BG9 C;  4IE6 A;  3UUB A;  1MIW A;  1NAF A;  3ZN0 B;  2FJE A;  1D1B A;  4ILA A;  2JRK A;  2FJA A;  1HCI A;  4YXD A;  4HN9 A;  4DUZ T;  3E08 A;  3PUR A;  2NW7 A;  4YTM A;  4HWF A;  1UUR A;  4ZZB A;  2XAS B;  4IDO A;  2Q9Q A;  5HWY A;  3ONJ A;  2LOP A;  4LF9 T;  3O9X A;  4JV5 T;  2BG9 E;  3VRB A;  3AAA B;  2Q9Q D;  2M67 A;  4ERR A;  3R84 B;  3CQG B;  2XTL A;  4U74 A;  1D0X A;  3CX8 B;  3UQ7 A;  3MZK B;  4CI1 B;  1IBL T;  3O1J A;  3UT5 E;  2BS4 A;  3AE5 A;  4I4T E;  2IC6 A;  1ZOY A;  2JQK A;  3E22 E;  1IJ5 A;  4AKG A;  2LHN A;  3A5X A;  4QX8 B;  5BR8 T;  5FL1 A;  5J2U E;  4DR2 T;  4ISS A;  2C0S A;  2WZH A;  2JQ9 A;  3PDY A;  2LSI A;  2V5D A;  2ES0 A;  3KVA A;  3C64 A;  3DJB A;  4E7Z A;  2L8K A;  3LBX B;  1O3X A;  4B3T T;  1KF6 A;  4EGW A;  2ZM8 A;  4CXW A;  4JI4 T;  1U4Q A;  2XQY A;  2G0U A;  5FY7 A;  3FXD B;  5AQJ B;  4ADZ A;  4GIW A;  1VRB A;  2K5B B;  3RGL A;  4DR6 T;  2CBJ A;  4A98 A;  2XY8 B;  5ABF B;  5J0Z A;  4X66 T;  3MA9 A;  1J1J A;  4LF4 T;  4J2C A;  3M3Z B;  2VL8 A;  3N9M A;  5L3C B;  4A5X A;  2WBL A;  3ZYL A;  3AA7 B;  3KIN B;  4H9P C;  2J47 A;  4U3C A;  1OED B;  2Q9Q C;  1SA0 E;  2W4X A;  4ZXL A;  4UF0 A;  3CQC B;  3EDV A;  3N5L A;  3LK4 2;  3KFW X;  5HCJ A;  2IDO B;  5LB7 B;  5LG4 A;  2UUC T;  2HN2 A;  2K24 A;  5LMU T;  2UUA T;  3SWH A;  3NRX A;  2XAQ B;  3ZMS B;  1ZV4 X;  2D2S A;  1CHU A;  2J4G A;  4UV8 B;  5CJ5 A;  4K0K T;  3N9N A;  2AE9 A;  4IL9 A;  2IIU A;  1BR0 A;  2JIW A;  4DBR A;  2VB6 A;  2WDV A;  2K3W A;  3F2E A;  3JCF A;  3QK6 A;  3IA3 A;  1HG5 A;  3PJA A;  2FBW A;  2KXP B;  3PUS A;  4C90 A;  4IST A;  5H6Q B;  3P4W A;  3SFD A;  1XDP A;  4GK5 E;  2V26 A;  4XBF B;  5LXT E;  3VKH A;  2XZE A;  1Y01 A;  5AQR B;  5JRC B;  3QB5 A;  2WU5 A;  3P50 A;  2XQ6 A;  2WSS V;  3ZSS A;  2YEV C;  1QLB A;  2GK9 A;  1AJ3 A;  2JMK A;  2PJQ A;  1T8B A;  1NEK A;  5HEJ A;  2L3L A;  2V7L A;  3EAM A;  2XJ7 A;  3UQ4 A;  3RRC A;  5FXW A;  4Z91 A;  4TNV A;  2E9X B;  4JI5 T;  2KT9 A;  2ACX A;  3ONX A;  4IDZ A;  3TLU A;  5FY1 A;  5HEO A;  1YXR A;  3F57 A;  4LMK A;  4M1P A;  5LOV E;  2CEA A;  1HX1 B;  2HPJ A;  4JI0 T;  5HXE A;  3RIA A;  5EK4 A;  2B1E A;  5L3E B;  2CLY B;  2CE7 A;  2BBJ A;  2XQ4 A;  2EHO A;  5CFB A;  1SE7 A;  2V6X A;  4HKA A;  5EZY E;  2VQF T;  4CI2 B;  3FZL B;  4LF5 T;  2EHO D;  3LDQ B;  5FVL A;  3AE4 A;  2C5K T;  5IHY A;  2RPA A;  3RHW A;  3Q2M A;  5AFU L;  2ZMA A;  4MFR A;  2WU2 A;  3FBZ A;  4NIQ A;  2V8S V;  2CXF A;  3FB2 A;  2IHR 1;  1M7K A;  4GYR A;  2BG9 B;  5JTG A;  1X9B A;  2X9W A;  5LJN A;  2CBI A;  5JDQ A;  4GK0 E;  2WB5 A;  4U2Z A;  2VAS A;  1UGO A;  1MMG A;  2LKG A;  4U72 A;  2LT3 A;  4F6R C;  1ZKE A;  2W63 A;  3N9L A;  2PFV A;  1HX8 A;  1D0Z A;  4UIG A;  4UVC B;  2BS2 A;  2CXL A;  5L2L A;  4DVD A;  2RA1 A;  4ZI2 D;  3AAI A;  5LGT B;  3P8C D;  2LLY A;  3AXJ A;  1D0Y A;  5F3J A;  3CX6 B;  3QB5 K;  3ANW A;  4LF6 T;  2VL0 A;  3VR8 A;  1HTJ F;  4O4H E;  4UR9 A;  4DBQ A;  2CWO A;  2DLR A;  4OFZ A;  3RQU A;  2EHO C;  2IW5 B;  1WR0 A;  1D1A A;  4EED A;  2XAG B;  3PV0 F;  4DMW A;  3RF1 A;  2XSB A;  3ABV A;  5AQF B;  4AKI A;  2NWB A;  4ZHQ E;  4BA9 A;  3RC3 A;  4L0R A;  4IDQ A;  2IUB A;  1FMV A;  3L3P A;  1HFA A;  2D0T A;  3PUA A;  2MBG A;  2BVM A;  3ZMT B;  5DJQ C;  3PU8 A;  3CML A;  4CXY A;  3JAE A;  3OPC A;  5CA1 E;  1N34 T;  2QRX A;  4ILB A;  4L9I A;  3RLF F;  4MBQ A;  4DR7 T;  3UUL A;  3KDS E;  2XPK A;  3ZC0 A;  2KND A;  2WZI A;  2VVS A;  3HA4 A;  4GKJ T;  3LSV A;  4PJM A;  1YQ3 A;  4OX9 T;  2WP9 A;  3ZCJ A;  3ZT6 A;  4HFB A;  5LYJ E;  3NZQ A;  4KX6 A;  4ZEY A;  3LFM A;  3HR0 A;  4ILC A;  3LK2 B;  2XQ9 A;  4NXM T;  4ZI2 C;  5LBM A;  5AQQ B;  4UV9 B;  2Q9Q B;  4X20 E;  3A7M A;  2MTQ A;  2WQY A;  4N78 D;  5M4Y A;  5KMG P;  4KHP T;  2JQH A;  2UXC T;  3RYI E;  3VHL A;  2MYS A;  2KZ7 B;  1NEN A;  5GON E;  3CK6 A;  2LSY A;  4AIS A;  3L09 A;  2CHN A;  4UVB B;  1ZEE A;  2UXB T;  1WLX A;  2H7O A;  2VKO A;  5JH7 E;  2D9D A;  3ZYK A;  2WWU A;  3TLW A;  4HFH A;  3U3I A;  1XZY A;  4EYY R;  3AA6 B;  3EUH A;  4I50 E;  1WR6 A;  4IIJ E;  5LCY A;  4QHO A;  3T8O A;  4MAL A;  4DR5 T;  2ZM6 T;  4HTE A;  4NUV A;  2CM0 A;  4AKR B;  2A9U A;  2XSA A;  1X79 A;  4IT4 A;  3FBL A;  3I9Y A;  3OYX A;  3NWI A;  2BKO A;  4TNW A;  2R6G F;  2V1D B;  5JR9 A;  3OTO T;  4O2A E;  4PFP A;  3IHR A;  4CN1 A;  1N32 T;  1YD8 G;  3P4R A;  4JI2 T;  2YDR A;  2OA5 A;  2WY2 A;  1BR4 A;  3DP7 A;  3RYC E;  4YSX A;  3FHN A;  3K3Q C;  3U78 A;  2QGS A;  3NVO A;  3AVS A;  3N2G E;  3ETV A;  4ANJ A;  3H3A A;  3Q5D A;  5LNK A;  2YIN A;  3AEF A;  2VKH A;  1KNP A;  5CB4 E;  4EB6 E;  4X64 T;  5JQG E;  4CQI A;  4V1A v;  5DAB A;  5HXR A;  2X0Y A;  2X66 A;  4YJ2 E;  1WCR A;  4IDN A;  3P7I A;  2N1G A;  4GYS A;  5TAO A;  4WBO A;  4UF0 B;  2NW8 A;  5JDH A;  4G2A A;  2X0H A;  3ZPO A; 
#chains in the Genus database with same CATH homology
 3Q5W A;  3BQI A;  2V26 A;  4XBF B;  3W15 B;  2D0U A;  4QX7 B;  2A72 A;  2VKD A;  2CLY C;  2E9X D;  3JC6 D;  4UXN B;  4ZS2 A;  3ZEF B;  5L3G B;  5LXT E;  3VKH A;  4AI6 A;  2ZLY A;  2KMF A;  5JRC B;  3ZC1 A;  4X1I E;  4AQF C;  3LK3 B;  3BK9 A;  4QKN A;  3N9P A;  3VU7 H;  4ILU A;  2WSS V;  3I0O A;  5HAX A;  2YEV C;  5JDN A;  3K3O A;  4OYK A;  2GK9 A;  1AJ3 A;  2JMK A;  3I1A A;  2X9Y A;  1FEW A;  3I0Q A;  2PJQ A;  4FI5 A;  3Q5X A;  3SOL A;  4H9Q C;  1UX4 A;  4XZC A;  3HL6 A;  1NWM X;  2L3L A;  2V7L A;  3EVY A;  3ZMU B;  1U5P A;  1KK7 A;  4MHC A;  2HH7 A;  2DHR A;  4FJO A;  5KDM C;  3AVR A;  3RRC A;  3C4W A;  5FXW A;  1HS7 A;  3BQL A;  3B57 A;  2VWA A;  2E9X B;  4GOU A;  1D1C A;  2KWI B;  4ZI3 C;  2KT9 A;  2NTX A;  2ACX A;  3ONX A;  2X0L B;  3NBX X;  4IDZ A;  3ZMV B;  4EZH A;  5FY1 A;  4EZ4 A;  3N2O A;  5FXX A;  5CA0 E;  2V7I A;  3F57 A;  2V7M A;  4M1P A;  5LOV E;  3K3N A;  2CEA A;  3ZMZ B;  3M65 A;  2DNX A;  4OHF A;  3IF8 B;  2HPJ A;  4BAY B;  5HXE A;  4YFS A;  2YK0 A;  4XAX B;  1BR1 A;  3UFE A;  5EK4 A;  4H9R C;  3MK7 C;  4Z8X A;  1IZN B;  2B1E A;  4O8S A;  5L3E B;  2CLY B;  3PTR B;  4TX5 A;  4H63 H;  3RX6 A;  2CE7 A;  4CI3 B;  5JR9 C;  4P0B A;  1QUU A;  2E8I A;  2EHO A;  4QXH B;  3LG7 A;  2JJ9 A;  5LHH B;  1HG2 A;  4HKA A;  4DO0 A;  5LP6 E;  2QA7 A;  5EZY E;  2VKJ A;  3OYZ A;  3O1H A;  3GN5 B;  4TV9 E;  4TV8 E;  3MKD A;  3RYF E;  4CI2 B;  3ZN1 B;  3HKD E;  4EYU A;  1WYB A;  2CCQ A;  3KVB A;  3N9Q A;  2EHO D;  2KLQ A;  4AQG A;  2UXX B;  4IHJ E;  2C5K T;  4PNI A;  3ZCI A;  5IHY A;  1LVF A;  4AKL A;  5LHG B;  3Q2M A;  1MIY A;  3GA8 A;  3WAK A;  5AFU L;  1S35 A;  5C8Y E;  3VKG A;  4KMC A;  3O1I A;  2IAK A;  1MNE A;  2ZMA A;  4HFV A;  4PJN A;  5FMN A;  2LSK A;  3K8P C;  4JLE A;  1SHZ C;  1UX5 A;  3UUN A;  4ZOL E;  3NZP A;  2E9X C;  4MFR A;  3JC6 C;  3FBZ A;  3KV4 A;  3PUQ A;  4EXT A;  4H9N C;  2XHE B;  3UUX B;  2CXF A;  3FB2 A;  4ASK A;  2W00 A;  3B13 A;  4PK5 A;  4H9O C;  3ZLI A;  3RC8 A;  2EHO B;  3RKO A;  3I9W A;  2L9Q A;  2V7K A;  4GYR A;  2ZM0 A;  5L3B B;  5ADX L;  1YW0 A;  2Z6E A;  2UXN B;  5FNV E;  3RYH E;  3UTK A;  2YU2 A;  2NW9 A;  1FIO A;  1H7C A;  4DND A;  4PAG A;  3WAJ A;  2Y6X A;  5JDM A;  2X9W A;  5LJN A;  4BJN A;  3ZYM A;  5JDQ A;  2SPC A;  4JEU B;  3C4Z A;  2DI4 A;  4GK0 E;  4L5G A;  2D5U A;  1WRD A;  2DWG A;  3HKB E;  2VAS A;  4GK5 E;  2K48 A;  3WI3 A;  4CZZ B;  1HF8 A;  1G8X A;  2X9X A;  1MMG A;  1EZ3 A;  4EIW A;  4K0U A;  3GWH A;  4U72 A;  2HPL A;  2LT3 A;  3O4X E;  3KBT A;  4F6R C;  1ZKE A;  2X51 A;  4P09 A;  4E7S A;  3EDU A;  4X1K E;  2W63 A;  2XAH B;  2PFV A;  3N9L A;  1IJ6 A;  1HX8 A;  3V5S A;  1D0Z A;  2CXD A;  3CKD A;  4UIG A;  4UVC B;  4B6X A;  1Y64 B;  3CVR A;  3C4X A;  2CXL A;  1VOM A;  3N9O A;  5ETW A;  5JRE A;  5L2L A;  4DVD A;  2RA1 A;  3ZJ1 A;  4ZI2 D;  3MJX A;  3AAI A;  5LGT B;  4G63 A;  3P8C D;  2WM9 A;  1YKH B;  1D0Y A;  2W61 A;  2LHR A;  5HXH A;  5F3J A;  3CX6 B;  3E0Z A;  2WMO A;  5FP3 A;  3ANW A;  4X1Y E;  1B7T A;  2LOS A;  1LVK A;  2WMN A;  4QXC B;  4OYJ A;  2C5I T;  1MND A;  3PE0 A;  4QWN B;  1HTJ F;  2BVL A;  3IEE A;  3NRY A;  3N2K E;  2H3R A;  4O4H E;  4YLH A;  4AXP A;  2N2N A;  3KV9 A;  4ZI7 E;  3J9X 1;  5JVD E;  5LA6 E;  4DBQ A;  2CWO A;  3LJC A;  4HGA A;  4QXB B;  2DLR A;  2K9A A;  4OFZ A;  5J1G A;  3GMI A;  2EHO C;  2IW5 B;  4KUM B;  1US7 B;  1V9D A;  3UUM A;  5HWX A;  3HKE E;  1D1A A;  4JEH B;  5EK3 A;  5EK2 A;  1BR2 A;  2DWK A;  2Y8D A;  2XAG B;  4IE6 A;  4TUY E;  4DMW A;  1MIW A;  1NAF A;  3CPZ A;  4IE0 A;  3ZN0 B;  5L3F B;  3HI2 A;  1D1B A;  3ESL A;  2JRK A;  4H63 V;  1LKX A;  4AKI A;  2NWB A;  1ZHC A;  1HCI A;  4EAH A;  4ZHQ E;  5HXS A;  5J2T E;  4BA9 A;  3OBV E;  5FXZ A;  4HN9 A;  2H7V C;  4L0R A;  3RC3 A;  2X9H A;  2KWH A;  3KV6 A;  2XAJ B;  3E08 A;  1FMV A;  2J1D G;  3L3P A;  4O4J E;  1HFA A;  3PUR A;  2D0T A;  1YKE B;  1MIV A;  2IC9 A;  2NW7 A;  3C51 A;  2NOX A;  5FXV A;  2BDE A;  2JPF A;  2XAS B;  3PUA A;  4CXX A;  3QUJ A;  2Q9Q A;  3ANW B;  5HWY A;  2MBG A;  2PG8 A;  2BVM A;  3ZMT B;  2LOP A;  5DJQ C;  1OWA A;  3PU8 A;  4PJJ A;  3TKL B;  3O9X A;  3CML A;  2W62 A;  4CXY A;  4O4I E;  3MXZ A;  4IGU A;  3SS1 A;  5CA1 E;  3AAA B;  3LBX A;  2Q9Q D;  3AA0 B;  3QC9 A;  2M67 A;  2LSJ A;  4L9I A;  4ERR A;  3R84 B;  4MBQ A;  3CQG B;  2XTL A;  3UUL A;  1CUN A;  3KDS E;  4U74 A;  1S94 A;  1D0X A;  3CX8 B;  2X68 A;  3ZC0 A;  2KND A;  3MZK B;  2XUE A;  4CI1 B;  1FMW A;  2LEH A;  2NP9 A;  3HA4 A;  3O1J A;  5DQW A;  3UT5 E;  4PJM A;  1KNZ A;  3OJA A;  1MMA A;  4I4T E;  3OKQ A;  2IC6 A;  4I55 E;  3F31 A;  3CWZ B;  5DQV A;  5FYM A;  4A56 A;  3ZCJ A;  3E22 E;  5LGN B;  1IJ5 A;  5JDG A;  1LRZ A;  4AKG A;  2LHN A;  5LYJ E;  3A5X A;  3NZQ A;  4QX8 B;  5JDF A;  3LFM A;  5A1L A;  3HR0 A;  2ODU A;  5LBQ B;  3CX7 B;  3LK2 B;  5J2U E;  2JMH A;  4ISS A;  1UCU A;  4ZI2 C;  5LBM A;  2C0S A;  1WYC A;  4UV9 B;  5LJM A;  2DCF A;  3PDY A;  2LSI A;  2Q9Q B;  2A3D A;  4P0A A;  4X20 E;  5LHI B;  2MTQ A;  2ZM2 A;  4N78 D;  5M4Y A;  4PK4 A;  2ES0 A;  3KVA A;  3C64 A;  5KMG P;  4C91 A;  2PBI A;  3DJB A;  3RYI E;  4E7Z A;  2L8K A;  3LBX B;  4YHJ A;  1O3X A;  4UVA B;  2KIN B;  2MYS A;  2KZ7 B;  3VHL A;  3J7Y q;  5GON E;  2LSY A;  3L09 A;  4UVB B;  2ZM8 A;  4AQF A;  1ZEE A;  4CXW A;  1WLX A;  2H7O A;  2VKO A;  4UEM A;  4ZS3 A;  4WBN E;  3IBP A;  2LM9 A;  5JH7 E;  5BMV E;  1U4Q A;  2XQY A;  3GN5 A;  2G0U A;  5FY7 A;  3ZYK A;  3FXD B;  2WWU A;  4O4L E;  4H9S E;  2A2F X;  1IAP A;  3U3I A;  4KP3 C;  3AA6 B;  1VRB A;  2K5B B;  4GIW A;  4ADZ A;  4EYY R;  3PUG A;  4MLK A;  1MMD A;  3EUH A;  5E0O A;  3AA1 B;  4I50 E;  1WR6 A;  4IIJ E;  5LCY A;  4QHO A;  3T8O A;  4UEL A;  3MA9 A;  4MAL A;  3RRW A;  4IE5 A;  3AB3 B;  3RPU A;  4JUY A;  4HTE A;  4J2C A;  4NUV A;  2CM0 A;  2VL8 A;  3N9M A;  4WW0 A;  3HKC E;  3ZJ2 A;  2W0G A;  5L3C B;  3C98 B;  4EOZ B;  4AKR B;  4O2B E;  3KBU A;  5IYZ E;  1X79 A;  2ODV A;  2WBL A;  2MOZ A;  5JDL A;  3ZYL A;  4PFO A;  3AA7 B;  3KIN B;  4H9P C;  5HXC A;  3FXE B;  1OXZ A;  2RP4 A;  3FBL A;  2YU1 A;  3I9Y A;  4OK0 A;  3OYX A;  2V7J A;  2Q9Q C;  4ZI3 D;  1SA0 E;  2NTY A;  4WNK A;  2XAF B;  1E1H B;  3KV5 A;  5KX5 E;  3H37 A;  2V1D B;  4UF0 A;  3CQC B;  3EDV A;  3N5L A;  2Y48 B;  5JR9 A;  5F8P A;  3LK4 2;  2LSG A;  3KFW X;  4PJL A;  4O2A E;  4AKH A;  4NUU A;  1T98 A;  4PFP A;  3IHR A;  4KBM B;  2JQQ A;  2X67 A;  5LG4 A;  3Q9D A;  4HE8 A;  1YD8 G;  2LJL A;  5JRC A;  2K24 A;  3R6N A;  2N9D A;  2OA5 A;  3SWH A;  5L3D B;  1BR4 A;  3DP7 A;  3NRX A;  4TZ4 C;  3CQX C;  3FHN A;  5FY0 A;  3RYC E;  3K3Q C;  3U78 A;  1QSD A;  2QGS A;  2I59 A;  3AVS A;  3MAC A;  2C5J A;  2XAQ B;  3N2G E;  3ZMS B;  1ZV4 X;  2D2S A;  3C50 A;  3ETV A;  3SRZ A;  3DTO A;  4ANJ A;  3H3A A;  4UV8 B;  2BZB A;  5LNK A;  4PK6 A;  2WAU A;  2YIN A;  4BJM A;  2VKH A;  2LE8 A;  5H6R B;  5CB4 E;  4EB6 E;  3N9N A;  3S4U A;  3AAE B;  5JQG E;  1BR0 A;  3V5U A;  3ETU A;  3PU3 A;  3D0T A;  4V1A v;  5DAB A;  4CQI A;  4YJ3 E;  4DBR A;  5HXR A;  2VB6 A;  2X66 A;  2CMR A;  3RH3 A;  4YJ2 E;  1Z0P A;  3F2E A;  3QK6 A;  3BQK A;  4I43 B;  5HYA A;  2E9X A;  2VK9 A;  3P7I A;  2CWY A;  4TN7 B;  4PW8 A;  1HG5 A;  2N1G A;  2P9B A;  4GYS A;  5TAO A;  4HEA A;  4WBO A;  4DMV A;  2KXP B;  4UF0 B;  2NW8 A;  4IE7 A;  1MMN A;  3PUS A;  4C90 A;  5JR9 B;  5JDH A;  4IST A;  1G73 A;  5H6Q B;  5LGU B;  4G2A A;  4IE4 A;  3ZPO A;  2CA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...