4MFRA

Crystal structure of mycobacterium tuberculosis card
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
164
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase-binding transcription factor CarD
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 44
structure length 164
sequence length 169
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mfrA02
4MFRA 4XAXB 4ILUA 2LT3A 4KBMB 4L5GA 4KMCA
chains in the Genus database with same CATH superfamily
5LOVE 3UQ7A 3RX6A 2A2FX 4DNDA 2LSJA 5HXRA 4QX7B 4DV4T 2HPLA 3TLSA 2X9XA 4H9RC 2N2NA 3P50A 4EOZB 4WYVA 3ZMUB 3N2KE 4GKJT 4JBWF 4YFSA 1D1AA 3QB5K 1KNZA 1FMWA 3P7IA 3SWHA 2E9XC 1OXZA 5LXTE 3PUZF 5KX5E 2X67A 3ZKRA 2CLYB 3BQLA 1MIYA 3FZLB 3LG7A 3JC6D 1WCRA 2BBHA 4OHFA 4QXBB 2XQ9A 3LK3B 2ES0A 5JR9C 1D0ZA 5L3DB 3Q5EA 2XQ8A 1WRDA 3TKLB 4PJJA 2PJQA 1WFDA 3PUYF 5LB7B 2LKHA 1W9RA 4XAXB 2LHRA 2P9BA 4U2ZA 3ZJ1A 5C8YE 2X68A 4GYRA 3LDQB 3VRAA 1G73A 1OWAA 5LNKA 3GA8A 2CA5A 4ZHQE 2LJLA 2IAKA 3PUVF 5JDMA 3OYXA 2ODUA 3RI5A 2KT9A 2WDQA 3TLUA 1BR1A 4IE7A 3IEEA 2AXDS 4JYAT 3AA6B 1Y01A 2VKJA 3AAAB 4TX5A 4YSXA 3UT5E 3RHWA 4X65T 4H63H 3O1JA 2JIWA 3BQIA 2W0GA 1I94T 3E22E 4KP3C 5HEJA 3AEGA 5FYMA 2KWIB 2C5KT 3Q2MA 3AEEA 2PFVA 4DV0T 2RP4A 5IHYA 4GIWA 2BG9B 4U2YA 1J1JA 2IIUA 5HEOA 3I9WA 1D1CA 2A72A 3CKDA 1N36T 3RYFE 3FB2A 2X51A 1OEDC 1WLXA 3RYCE 4JI4T 2Q9QC 2RPAA 3RYHE 2X0LB 3OVUA 2CPTA 4I0UA 3IHRA 1BR2A 1N34T 4DUYT 4H9NC 2KZ7B 5BR8T 2M67A 2XAFB 5L3FB 3NZPA 2BKPA 4LMJA 2OLTA 3J7Yq 2FJDA 2YINA 3N9NA 4DR7T 2WZHA 1XNQT 4MLKA 2VL8A 4UVCB 2IUBA 3ZN0B 4H9OC 3E0ZA 4O4HE 4IDQA 5LJNA 1MIVA 1MNEA 3Q5WA 5FL1A 2JQQA 1VRBA 3SFDA 4TV9E 2K24A 4ERRA 4ZI7E 2VVNA 4HFEA 4I55E 5HWYA 5LBMA 3C50A 5L4EA 5CGMA 2XQ7A 4AI6A 3QUJA 5AQRB 4AKHA 4U7YA 4HFHA 3RF1A 1U5PA 3RQWA 2BG9E 2WCAA 3MK7C 3AAEB 3KDSE 2W4XA 1UUSA 4ZXLA 2BKNA 2JJ9A 5AQSB 2VVSA 2FUPA 3C64A 2WU5A 4DV5T 2XAHB 3RC3A 2LEHA 1VCSA 3O4XE 4O2BE 4CZZB 5KXJA 4P1NA 3RQUA 3KFWX 3ZMSB 4B3ST 4DMVA 4ASKA 1GQEA 3MA9A 3C51A 3F57A 2B76A 2XTLA 5ABEA 3W15B 1JNRA 3MACA 5L3EB 1T8BA 4LF5T 4ISSA 4O2AE 3N5LA 4DBRA 5CFBA 2VQET 3A5XA 5HCJA 4MFRA 1HG2A 3T1YT 2V8SV 1M7KA 4UV8B 5AFUL 1S35A 1NWMX 2CMRA 3JCFA 2Z6EA 1ZKEA 2MPKA 4UF0A 2UXXB 3Q9DA 5JVDE 2W61A 4X1KE 4HWFA 2XAJB 1BR0A 4ILAA 2H88A 3ONLC 1QSDA 1HX8A 2FJAA 4K0KT 3I0OA 4G63A 2A3DA 2IDOB 4LF7T 2WS3A 5LA6E 1HTJF 2B1EA 2K9AA 5AQNB 4U7IA 2XQ5A 3UFEA 1XMQT 3RYIE 1UX5A 3P4SA 3NZQA 4DMWA 3FZHB 1YW0A 4JI1T 5JQGE 4EYYR 2D0UA 1MNDA 2XSBA 2UXBT 1CUNA 4TZ4C 4NXMT 2MOZA 2CWOA 1KF6A 3PUWF 5BMVE 4KX6A 4CN1A 2Y48B 3AEFA 3KBUA 4A98A 4EAHA 3QK6A 2WWVA 4DR2T 1N32T 5FY1A 5HAXA 4J2CA 5JREA 2YKSA 3RKGA 5CJ5A 3OBVE 2BVMA 4ILBA 3PUXF 3ABVA 3O1IA 1L0VA 5LYJE 2CM0A 4UV9B 1SHZC 3NVOA 4DUZT 5DABA 3VKGA 3Q5XA 4PJLA 3P4RA 1YKEB 3UUBA 1IBLT 5AQQB 3PURA 3CQCB 2D2SA 3UQ4A 5ABGA 4CXWA 4DV7T 1D0XA 1FEWA 2XHEB 5CA1E 3PUQA 4QWNB 2ZM6T 3EAMA 3IBPA 3EHZA 2W00A 3F31A 2V7MA 4OFZA 4UXNB 5FXVA 3PV0F 4IHJE 3UU6A 2LSYA 3H3AA 2LM2A 4FI5A 2CXFA 5EK4A 1IJ5A 1W0BA 3NRYA 3ZPOA 1D0YA 2D5UA 5EK3A 2PBIA 3CX7B 3KV5A 3LBXB 5AQLB 4WZXA 5TAOA 2H7VC 5AQMB 3ETVA 1EZ3A 3FBLA 4EV6A 1UX4A 4HTEA 2MAWA 4YHJA 4K0UA 4AKIA 4LF6T 4YY3T 5H6QB 2BG9A 3LSVA 4QHOA 3EDVA 1YXRA 5LG4A 2V7IA 3U3IA 2KSRA 2DHRA 4TUYE 4PFOA 2DWKA 3KV6A 4IGUA 3B13A 5HXCA 4CI2B 4GKKT 2E9XB 4GYSA 4EB6E 5EK2A 4HFDA 2NTYA 2V7JA 5LMNT 1H7CA 2UXNB 4CI3B 3K8PC 2XAGB 1WR0A 5HXSA 3N9OA 1J5ET 5JTGA 4B3TT 4Q25A 3AXJB 2X0YA 5JR9B 3IA3A 4JEUB 1XNRT 4P09A 3OPCA 1FMVA 2YN6A 4DR6T 3NKZA 5HCMA 2EHOD 3RKOA 3A8YC 4AKGA 2KWHA 2BBJA 3ANWA 2XY8B 1T98A 5ETWA 4ZEYA 2XQYA 4UELA 5L3GB 1X79A 2X9HA 4JEHB 5L2LA 3ZSSA 3UU4A 4DV6T 1Z0PA 3PTRB 2BVLA 2BZBA 3NRXA 4HN9A 5LP6E 2V26A 4WW0A 4U33A 4YSYA 5AQPB 1J5WA 2WZIA 4LFBT 3RIUA 1WYBA 1SA0E 2YDQA 5AQFB 3HR0A 4DO0A 2V5CA 4Z8XA 2LHNA 4I43B 5DQWA 4TV8E 1KEYA 1MIWA 5ABHA 4A5XA 3PUGA 4LF4T 2DWGA 4YSZA 4V1Av 5LJMA 1MMNA 1HX1B 3UTKA 2X0HA 4HFCA 4AQFA 3ZYMA 4QXHB 4QH5A 3M65A 2WWUA 3PJAA 4HFIA 4EGWA 3AE7A 3LK2B 1OEDB 2CWYA 2WM9A 1FJGT 4UVAB 5ADXL 3RH3A 4E7ZA 5AQKB 5HYAA 2Q9QB 5AQJB 3Q5DA 5F8PA 3WI3A 1X9BA 2W2UA 4ILCA 4EZ4A 4ZI2C 5HWXA 3K3QC 3S4UA 2OA5A 2CBJA 3ZT5A 5DQVA 2CXLA 2HH7A 5F3JA 4TWFA 4IE0A 4LF8T 3EVYA 3N9PA 1HNWT 1HCIA 2X9WA 4KMCA 3ZSTA 3AE6A 3FHNA 2V6XA 2NW7A 3ZJ2A 2V7KA 2V6YB 2KLQA 3N9LA 3AE1A 5HEHA 4JI8T 4PK4A 3KV4A 3WAJA 3JAFA 1WYCA 4IE5A 3ZCIA 4IL9A 3QC9A 2NW8A 4UIGA 4KHPT 1VOMA 1YQ4A 4LMLA 2ZM8A 3QB5A 2YK0A 2PG8A 4IDNA 3I1AA 2EHOA 2NR4A 1N33T 2DNXA 1HR0T 2W63A 2W67A 5A1LA 5L3CB 3AEAA 2LRLA 4EEDA 3N2OA 1FIOA 3H3MA 3EABA 2F4VT 2BDEA 2KXPB 3CQXC 5HEGA 3R6NA 3L09A 2Y6XA 4NXNT 3CMLA 4JI3T 5EZYE 1CHUA 2MBGA 2WMNA 1JNZA 2CXDA 3AA0B 3PUSA 3MKDA 4DV3T 4ADZA 3TLVA 4AQYT 3SS1A 2JMKA 2H89A 3GWHA 3HL6A 2VKDA 2Y8DA 3RPUA 4LMKA 3D0TA 2KINB 1YQ3A 3ZT7A 4L0RA 3P4PA 2JQHA 4DR1T 2AE9A 4TNVA 5JRCA 1UGOA 1S94A 2XQAA 2WU2A 4U31A 2V7LA 2LOPA 4AQGA 2QRXA 2XM2A 3SFEA 3L39A 5CA0E 3AE2A 2UXCT 3ESLA 2K48A 5F5WA 3LBXA 4G2AA 2IW5B 3CVRA 3PU8A 4U74A 5C2TA 2WB5A 3OJAA 2L8KA 4LFAT 4A56A 3K3OA 2ODVA 2VURA 3GN5A 5FVKA 3B5MA 4M1PA 2HHHT 3P4QA 2RA1A 2BS2A 2J47A 2XASB 3DJBA 4YT0A 4DBQA 4ZI3C 5FP3A 3QOFA 3L8RA 3NBXX 4TN7B 2GK9A 4IIJE 2JQ9A 3HKEE 4H9SE 4O4LE 4JUYA 3MXZA 1IAPA 1ZP0A 3CPZA 5FXXA 4IDOA 2OV9A 4EYUA 2WBLA 1HF8A 2L3LA 4X66T 4JI5T 3C98B 1Y64B 4HWIB 3ONJA 3CIRA 3KVAA 3ZMTB 4YJ2E 3LK42 4CN4A 4PFPA 4QH4A 4AKRB 2VKHA 4GK5E 1B7TA 3RIFA 1XZYA 2FBWA 5JR9A 3UUNA 4UEMA 3NWIA 5AQOB 3DP7A 3M3ZB 5KMGP 5J1GA 2WY2A 3UULA 2QA7A 3AEDA 2NWBA 3C4ZA 2K5BB 3H37A 4EIWA 1KNPA 3JC6C 4BJMA 5LGTB 2W62A 5LHGB 2EHOC 2LRKA 4TNWA 5LHIB 3UUXB 3I0QA 1WR6A 5JDHA 4B3RT 4XBFB 3MJXA 1VCTA 5LMUT 1HNXT 3HI2A 2IC9A 3I9YA 1UK5A 4NUVA 4DR5T 2UUCT 2DI4A 1XDOA 2E5VA 1US7B 3KVBA 5FXZA 3AEBA 3IF8B 1V9DA 4YJ3E 4DV2T 4X1IE 4HEAA 3RRWA 1ZHCA 5AQIB 2LOSA 3FXEB 3HA4A 1UCUA 5HXEA 2J4GA 3FZKB 4HWCA 4NPPA 4AXPA 2VK9A 4H9PC 4PNIA 2DCFA 3ZN1B 2W66A 3BK9A 4PJNA 2VASA 1ZV4X 4DR4T 1XMOT 4C90A 4DV1T 2V1DB 2I59A 5ABFB 1MMGA 4XZCA 2IHR1 1E7PA 5HEUA 3VR8A 4QKNA 3O9XA 1IZNB 3B57A 1LKXA 3EDUA 2YDRA 1YD8G 4YTMA 1KFYA 3JADA 2QGSA 2LLYA 3R84B 1R8IA 3VU7H 2BKOA 3AE9A 3ETUA 5LCYA 4COFA 4O8SA 3ONXA 4QH1A 2UU9T 2MTQA 4YLHA 2KMFA 3ZLIA 5JDFA 4X62T 4IDPA 3TLWA 4Z91A 3OYZA 4U3CA 3U78A 5LGUB 3AVSA 2XZEA 5AQVB 2V6YA 4BAYB 4EZHA 3HKDE 4TWHA 1HG5A 2C5JA 5AQGB 3LFMA 3V5SA 5JH7E 5JDQA 2DL1A 2WMOA 5FVLA 2G0UA 3EUHA 4PK5A 3DTOA 2ZMAA 3BQKA 4JI7T 3JAEA 2UUBT 5LBQB 5JDGA 4JV5T 2CLYC 4MALA 1I6ZA 2PTFA 2XQ4A 2K3WA 2M6IA 2BS3A 4U72A 2M6BA 4HFVA 4DVDA 2X66A 4I50E 5AQHB 2WQYA 4PJMA 1IBMT 2NP9A 4ZZCA 2XSAA 1HNZT 2WDRA 3KBTA 2D0TA 3C4XA 4YTNA 2ZM2A 3T8OA 2E2AA 5C3JA 3F2EA 4A97A 4HGAA 3PU3A 4DIDB 4O4JE 1MMAA 3FZMB 5IYZE 4LFCT 5FMNA 1KK7A 3X1DA 3L3PA 2J62A 4CI1B 2YEVC 1AJ3A 5FY0A 3K3NA 2CHNA 2H7OA 4ZS2A 5LHHB 4L5GA 1SE7A 1XDPA 4OX9T 4AIUA 2XQ6A 3LJCA 2C5IT 4YHHT 3VRBA 4ILUA 4TWDA 1LVFA 5M4YA 3RIAA 3TLTA 2BG9C 5FNVE 4O4IE 1U4QA 3OTOT 2IMLA 5JDLA 1D1BA 1NEKA 2E9XD 3VR9A 3UU8A 4IREA 5FY7A 2SPCA 4IE4A 2LE8A 4I4TE 3C4WA 3KV9A 4DR3T 4GOUA 2JRKA 4AKLA 3MZKB 3N2GE 4NUUA 4JI0T 4HWHA 2LSKA 3GMIA 4H63V 3AA1B 3ANWB 2I6HA 2XUEA 2WP9A 3K1SA 4P0AA 4QX8B 2WDVA 1Z8UA 3QNUA 3N9MA 3CWZB 5GONE 3J9X1 1OEDE 2XAQB 2NTXA 2LT3A 5L4HA 3UFGA 5H6RB 2I0MA 1W09A 2LSGA 1IBKT 1E2AA 1ZEEA 1DU2A 3FXDB 4HWDA 2YOEA 4IL4A 4UR9A 5CB4E 4MHCA 4H9QC 2R6GF 2YDSA 4B3MT 3RIUC 5HXHA 1QUUA 3AB3B 3AAIA 4OYKA 4ZZBA 2NW9A 4CXXA 4X20E 3FBZA 5FKYA 4BJNA 1IJ6A 4ISTA 3ZT6A 4KHZF 4HE8A 3HKCE 3CQGB 3AE5A 3EI0A 4CXYA 4FJOA 2HPJA 4F6RC 5FXWA 4JI6T 4ZI2D 1LVKA 4AQFC 2A9UA 5FL0A 1G8XA 4KUMB 4X64T 2VQFT 3AE8A 1XWMA 2Q9QD 3CX6B 2ACZA 1O3XA 3RLFF 3UUMA 1HFAA 5AQTB 4P0BA 2XM1A 3OKQA 1MMDA 1ZOYA 2XPKA 3ZYLA 4KI0F 4L9IA 3G06A 3AVRA 4C91A 3A7MA 2CRBA 4YTPA 5ABFA 2DLRA 2H3RA 2YU1A 3N9QA 4ZS3A 4UVBB 4WBNE 2IC6A 3ZC1A 2CCQA 3PDYA 4PAGA 4OYJA 5J0ZA 2E9XA 3PJAJ 1E1HB 4GK0E 2VL0A 1BR4A 4EXTA 2LM9A 5L3BB 2VKOA 1QLBA 4BA9A 2E8IA 3ZMVB 3ZYKA 3FZFB 3RRCA 4KBMB 4F8HA 4YXDA 2JQKA 2N9DA 3CX8B 4WNKA 4HFBA 2WAUA 3AXJA 3VKHA 3RC8A 2EHOB 1LRZA 5L47A 2N1GA 3HKBE 4EEBA 2ZLYA 2E5LT 1HS7A 2QYWA 4IT4A 2MYSA 3AA7B 5AQUB 3SRZA 3ZCJA 4CQIA 2CHOA 3P4WA 2CE7A 3E08A 2ZM0A 3ZMZB 4AISA 5KDMC 4PK6A 2LSIA 1M62A 3VHLA 1W0AA 3ZC0A 4X1YE 5J2UE 5LGNB 4OK0A 1T7SA 2X9YA 3AECA 2FJEA 2VB6A 2JPFA 1SUMB 3CK6A 2C0SA 1UURA 2KNDA 3AE3A 2L9QA 3P8CD 2XQ3A 1KNRA 4LF9T 2QVAA 4B6XA 3T1HT 4E7SA 3O1HA 5JRCB 2HN1A 5IUXA 3KINB 5J2TE 1T72A 1NENA 4ANJA 5JDNA 3PE0A 5DJQC 2VWAA 4UF0B 2LKGA 3SOLA 2XJ7A 4JLEA 4N78D 5E0OA 3UU5A 4ZOLE 3RGLA 3WAKA 4MBQA 4HKAA 2ACXA 1OEDA 4IE6A 5LG3A 1YKHB 2D9DA 2BS4A 2Q9QA 4NIQA 2V5DA 3ZEFB 5IWAT 3UU3A 3GN5B 4IDZA 1NAFA 2JMHA 4QXCB 4JI2T 3V5UA 4ZI3D 4WBOA 2FJBA 4Z90A 3AE4A 4CN6A 4PW8A 2CEAA 2J1DG 2YU2A 2WSSV 2UXDT 4X5TA 3PUAA 2HN2A 2CBIA 2NOXA 2UUAT
chains in the Genus database with same CATH topology
2Y6XA 3K3NA 5LOVE 3CMLA 5EZYE 4J2CA 3RX6A 5JREA 2A2FX 2H7OA 2WMNA 2MBGA 2CXDA 3AA0B 4DNDA 2LSJA 3OBVE 4ZS2A 5HXRA 2BVMA 4QX7B 3PUSA 5LHHB 3MKDA 4L5GA 2HPLA 2X9XA 4H9RC 2N2NA 4ADZA 3O1IA 5LYJE 4EOZB 2CM0A 4UV9B 3SS1A 2JMKA 1SHZC 3GWHA 3HL6A 3LJCA 2C5IT 5DABA 2VKDA 2Y8DA 3VKGA 4ILUA 3Q5XA 3RPUA 3ZMUB 3N2KE 3D0TA 4PJLA 2KINB 1LVFA 4YFSA 4L0RA 5M4YA 1D1AA 1KNZA 1FMWA 1YKEB 3P7IA 3SWHA 5FNVE 5JRCA 2E9XC 4O4IE 1OXZA 5LXTE 1S94A 1U4QA 5KX5E 2X67A 3PURA 3CQCB 2CLYB 3BQLA 1MIYA 1D1BA 2D2SA 2V7LA 5JDLA 2LOPA 3LG7A 3JC6D 4AQGA 4CXWA 4OHFA 1D0XA 1FEWA 2XHEB 5CA1E 3PUQA 2E9XD 4QWNB 4QXBB 5FY7A 3IBPA 2SPCA 5CA0E 2W00A 3ESLA 2K48A 4IE4A 3F31A 2V7MA 2ES0A 2LE8A 3LBXA 3LK3B 5JR9C 4G2AA 4OFZA 4UXNB 4I4TE 1D0ZA 5L3DB 2IW5B 5FXVA 4IHJE 1WRDA 3CVRA 3PU8A 4U74A 3C4WA 2LSYA 3TKLB 3H3AA 3KV9A 4GOUA 4PJJA 2JRKA 2PJQA 4AKLA 4FI5A 3MZKB 3N2GE 4NUUA 2CXFA 5EK4A 1IJ5A 3OJAA 2L8KA 3NRYA 4A56A 4XAXB 3ZPOA 3K3OA 2ODVA 2LSKA 3GMIA 1D0YA 2D5UA 3GN5A 4H63V 3AA1B 2LHRA 5EK3A 2PBIA 3ANWB 3CX7B 3KV5A 3LBXB 4M1PA 2RA1A 2P9BA 2XUEA 3ZJ1A 5C8YE 2X68A 4P0AA 4QX8B 4GYRA 3N9MA 3CWZB 2XASB 5TAOA 2H7VC 3DJBA 5GONE 1G73A 3J9X1 1OWAA 4DBQA 3ETVA 1EZ3A 5LNKA 3FBLA 3GA8A 4ZI3C 5FP3A 2CA5A 3NBXX 1UX4A 4HTEA 4ZHQE 2LJLA 4TN7B 2IAKA 5JDMA 2XAQB 2NTXA 3OYXA 2LT3A 2ODUA 2GK9A 4YHJA 4K0UA 2KT9A 1BR1A 4IE7A 4AKIA 3IEEA 4IIJE 3HKEE 3AA6B 4H9SE 5H6RB 3AAAB 2VKJA 4O4LE 5H6QB 4TX5A 4JUYA 4QHOA 3EDVA 5LG4A 3MXZA 1IAPA 3CPZA 3UT5E 5FXXA 2LSGA 2V7IA 3U3IA 4EYUA 4H63H 2WBLA 3O1JA 3BQIA 2W0GA 1HF8A 2L3LA 3E22E 4KP3C 2DHRA 3C98B 3Q2MA 1Y64B 2C5KT 2KWIB 4TUYE 1ZEEA 4PFOA 5FYMA 2DWKA 2PFVA 3KV6A 2RP4A 4IGUA 3FXDB 3KVAA 5IHYA 3B13A 3ZMTB 3LK42 4YJ2E 5CB4E 4PFPA 5HXCA 4CI2B 4GIWA 4MHCA 2VKHA 4AKRB 4GK5E 4H9QC 1B7TA 2E9XB 5JR9A 3UUNA 4GYSA 4UEMA 4EB6E 5EK2A 5HXHA 3I9WA 1D1CA 1QUUA 2A72A 2NTYA 2V7JA 3AAIA 3AB3B 3DP7A 4OYKA 1H7CA 2UXNB 4CI3B 3K8PC 2XAGB 3CKDA 5J1GA 2NW9A 5HXSA 5KMGP 3UULA 4CXXA 4X20E 3FBZA 2QA7A 2NWBA 3FB2A 3N9OA 3C4ZA 3RYFE 2K5BB 3H37A 4BJNA 4EIWA 1IJ6A 2X51A 1WLXA 3JC6C 4ISTA 4BJMA 5LGTB 4HE8A 3HKCE 2W62A 3CQGB 5LHGB 4CXYA 2EHOC 3RYCE 5JR9B 4JEUB 4P09A 5LHIB 4FJOA 3UUXB 2HPJA 2Q9QC 3RYHE 2X0LB 3I0QA 1FMVA 4F6RC 5FXWA 4ZI2D 1LVKA 1WR6A 4AQFC 5JDHA 4XBFB 1G8XA 3MJXA 4KUMB 3IHRA 1BR2A 2EHOD 4H9NC 3HI2A 3RKOA 2KZ7B 2IC9A 3I9YA 4AKGA 2Q9QD 2M67A 2KWHA 2XAFB 4NUVA 2DI4A 3CX6B 3ANWA 1T98A 5ETWA 1O3XA 2XQYA 1US7B 3KVBA 5L3FB 3UUMA 4UELA 5L3GB 5FXZA 1HFAA 1X79A 2X9HA 3NZPA 3IF8B 4JEHB 4P0BA 5L2LA 1V9DA 4YJ3E 1Z0PA 3PTRB 3J7Yq 2BVLA 2YINA 3N9NA 1MMDA 3OKQA 2BZBA 3NRXA 4HN9A 4X1IE 4HEAA 4MLKA 5LP6E 2VL8A 2V26A 3RRWA 1ZHCA 4WW0A 3ZYLA 4L9IA 2LOSA 4UVCB 3FXEB 3HA4A 1UCUA 5HXEA 3ZN0B 4H9OC 3E0ZA 3AVRA 4O4HE 4C91A 5LJNA 1MIVA 1MNEA 3Q5WA 4AXPA 2VK9A 2DLRA 4H9PC 2JQQA 2H3RA 2YU1A 1WYBA 1SA0E 4PNIA 3N9QA 4ZS3A 4UVBB 2DCFA 4WBNE 1VRBA 3HR0A 2IC6A 4DO0A 4Z8XA 3ZN1B 3ZC1A 2LHNA 4TV9E 4I43B 5DQWA 4TV8E 3BK9A 2K24A 1MIWA 4ERRA 2CCQA 4PJNA 4ZI7E 2VASA 1ZV4X 3PUGA 3PDYA 4PAGA 4OYJA 4C90A 4I55E 5HWYA 5LBMA 2DWGA 2E9XA 2V1DB 3C50A 1E1HB 2I59A 1MMGA 4AI6A 4XZCA 4V1Av 3QUJA 4GK0E 5LJMA 1MMNA 1BR4A 3UTKA 4EXTA 4AKHA 2LM9A 5L3BB 1U5PA 2VKOA 4BA9A 4QKNA 4AQFA 3ZYMA 2E8IA 3ZMVB 4QXHB 3ZYKA 3M65A 3RRCA 3O9XA 3MK7C 2WWUA 1IZNB 3AAEB 3B57A 3KDSE 1LKXA 4KBMB 3EDUA 2N9DA 3CX8B 2JJ9A 3LK2B 1YD8G 4WNKA 2CWYA 2WM9A 3C64A 4UVAB 2WAUA 5ADXL 2QGSA 3VKHA 3R84B 3RC8A 3RH3A 2EHOB 2XAHB 3RC3A 3VU7H 4E7ZA 2LEHA 3ETUA 5LCYA 1LRZA 5HYAA 2Q9QB 3O4XE 2N1GA 3HKBE 4O2BE 4CZZB 4O8SA 2ZLYA 3ONXA 1HS7A 3KFWX 3ZMSB 4DMVA 5F8PA 2MYSA 3AA7B 3WI3A 4ASKA 2MTQA 4EZ4A 4YLHA 4ZI2C 5HWXA 3K3QC 2KMFA 3ZLIA 3MA9A 3C51A 3S4UA 5JDFA 3SRZA 3ZCJA 4CQIA 3F57A 2OA5A 2CE7A 3E08A 2ZM0A 3OYZA 3ZMZB 2XTLA 5KDMC 4PK6A 2LSIA 3U78A 3W15B 3VHLA 5LGUB 3ZC0A 3MACA 4X1YE 5DQVA 2CXLA 5L3EB 2HH7A 5F3JA 5J2UE 5LGNB 4OK0A 4ISSA 2X9YA 3AVSA 4IE0A 4O2AE 3N5LA 4DBRA 2VB6A 2JPFA 2C0SA 3A5XA 4MFRA 1HG2A 4BAYB 4EZHA 3EVYA 3HKDE 2KNDA 1HG5A 3N9PA 2C5JA 2L9QA 3P8CD 3LFMA 4UV8B 1HCIA 2X9WA 3V5SA 1S35A 5AFUL 4KMCA 5JH7E 4B6XA 5JDQA 1NWMX 2CMRA 4E7SA 2WMOA 2Z6EA 3FHNA 2G0UA 2NW7A 3O1HA 1ZKEA 3ZJ2A 2V7KA 4UF0A 2KLQA 2UXXB 3EUHA 5JRCB 4PK5A 3DTOA 3N9LA 2ZMAA 3Q9DA 5JVDE 3BQKA 3KINB 2W61A 4X1KE 4PK4A 5J2TE 2XAJB 5LBQB 5JDGA 3KV4A 2CLYC 3WAJA 1BR0A 4MALA 1WYCA 4IE5A 3ZCIA 4ANJA 1QSDA 1HX8A 4U72A 5JDNA 3PE0A 3QC9A 5DJQC 2NW8A 4UIGA 2VWAA 3I0OA 4G63A 4UF0B 1VOMA 2A3DA 4HFVA 2ZM8A 4DVDA 3SOLA 4JLEA 4N78D 5E0OA 4ZOLE 2X66A 2YK0A 4MBQA 4HKAA 3WAKA 2ACXA 2PG8A 5LA6E 4I50E 3I1AA 1HTJF 2B1EA 4PJMA 4IE6A 2NP9A 1YKHB 2EHOA 2K9AA 3KBTA 2D0TA 2Q9QA 3C4XA 3UFEA 3RYIE 1UX5A 3ZEFB 3NZQA 4DMWA 2ZM2A 1YW0A 2DNXA 5JQGE 3T8OA 4EYYR 2W63A 3F2EA 3GN5B 5A1LA 2D0UA 4IDZA 1NAFA 1MNDA 1CUNA 4TZ4C 2JMHA 5L3CB 2MOZA 2CWOA 4HGAA 3PU3A 4QXCB 3V5UA 4ZI3D 4WBOA 5BMVE 3N2OA 4O4JE 1FIOA 2Y48B 1MMAA 5IYZE 2BDEA 4PW8A 5FMNA 3KBUA 1KK7A 2CEAA 2J1DG 2YU2A 2WSSV 3QK6A 4EAHA 3L3PA 4CI1B 2KXPB 3CQXC 2YEVC 3PUAA 1AJ3A 2NOXA 5FY1A 5FY0A 5HAXA 3R6NA 3L09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFR A;  4XAX B;  4ILU A;  2LT3 A;  4KBM B;  4L5G A;  4KMC A; 
#chains in the Genus database with same CATH topology
 5LOV E;  3UQ7 A;  3RX6 A;  2A2F X;  4DND A;  2LSJ A;  5HXR A;  4QX7 B;  4DV4 T;  2HPL A;  3TLS A;  2X9X A;  4H9R C;  2N2N A;  3P50 A;  4EOZ B;  4WYV A;  3ZMU B;  3N2K E;  4GKJ T;  4JBW F;  4YFS A;  1D1A A;  3QB5 K;  1KNZ A;  1FMW A;  3P7I A;  3SWH A;  2E9X C;  1OXZ A;  5LXT E;  3PUZ F;  5KX5 E;  2X67 A;  3ZKR A;  2CLY B;  3BQL A;  1MIY A;  3FZL B;  3LG7 A;  3JC6 D;  1WCR A;  2BBH A;  4OHF A;  4QXB B;  2XQ9 A;  3LK3 B;  2ES0 A;  5JR9 C;  1D0Z A;  5L3D B;  3Q5E A;  2XQ8 A;  1WRD A;  3TKL B;  4PJJ A;  2PJQ A;  1WFD A;  3PUY F;  5LB7 B;  2LKH A;  1W9R A;  4XAX B;  2LHR A;  2P9B A;  4U2Z A;  3ZJ1 A;  5C8Y E;  2X68 A;  4GYR A;  3LDQ B;  3VRA A;  1G73 A;  1OWA A;  5LNK A;  3GA8 A;  2CA5 A;  4ZHQ E;  2LJL A;  2IAK A;  3PUV F;  5JDM A;  3OYX A;  2ODU A;  3RI5 A;  2KT9 A;  2WDQ A;  3TLU A;  1BR1 A;  4IE7 A;  3IEE A;  2AXD S;  4JYA T;  3AA6 B;  1Y01 A;  2VKJ A;  3AAA B;  4TX5 A;  4YSX A;  3UT5 E;  3RHW A;  4X65 T;  4H63 H;  3O1J A;  2JIW A;  3BQI A;  2W0G A;  1I94 T;  3E22 E;  4KP3 C;  5HEJ A;  3AEG A;  5FYM A;  2KWI B;  2C5K T;  3Q2M A;  3AEE A;  2PFV A;  4DV0 T;  2RP4 A;  5IHY A;  4GIW A;  2BG9 B;  4U2Y A;  1J1J A;  2IIU A;  5HEO A;  3I9W A;  1D1C A;  2A72 A;  3CKD A;  1N36 T;  3RYF E;  3FB2 A;  2X51 A;  1OED C;  1WLX A;  3RYC E;  4JI4 T;  2Q9Q C;  2RPA A;  3RYH E;  2X0L B;  3OVU A;  2CPT A;  4I0U A;  3IHR A;  1BR2 A;  1N34 T;  4DUY T;  4H9N C;  2KZ7 B;  5BR8 T;  2M67 A;  2XAF B;  5L3F B;  3NZP A;  2BKP A;  4LMJ A;  2OLT A;  3J7Y q;  2FJD A;  2YIN A;  3N9N A;  4DR7 T;  2WZH A;  1XNQ T;  4MLK A;  2VL8 A;  4UVC B;  2IUB A;  3ZN0 B;  4H9O C;  3E0Z A;  4O4H E;  4IDQ A;  5LJN A;  1MIV A;  1MNE A;  3Q5W A;  5FL1 A;  2JQQ A;  1VRB A;  3SFD A;  4TV9 E;  2K24 A;  4ERR A;  4ZI7 E;  2VVN A;  4HFE A;  4I55 E;  5HWY A;  5LBM A;  3C50 A;  5L4E A;  5CGM A;  2XQ7 A;  4AI6 A;  3QUJ A;  5AQR B;  4AKH A;  4U7Y A;  4HFH A;  3RF1 A;  1U5P A;  3RQW A;  2BG9 E;  2WCA A;  3MK7 C;  3AAE B;  3KDS E;  2W4X A;  1UUS A;  4ZXL A;  2BKN A;  2JJ9 A;  5AQS B;  2VVS A;  2FUP A;  3C64 A;  2WU5 A;  4DV5 T;  2XAH B;  3RC3 A;  2LEH A;  1VCS A;  3O4X E;  4O2B E;  4CZZ B;  5KXJ A;  4P1N A;  3RQU A;  3KFW X;  3ZMS B;  4B3S T;  4DMV A;  4ASK A;  1GQE A;  3MA9 A;  3C51 A;  3F57 A;  2B76 A;  2XTL A;  5ABE A;  3W15 B;  1JNR A;  3MAC A;  5L3E B;  1T8B A;  4LF5 T;  4ISS A;  4O2A E;  3N5L A;  4DBR A;  5CFB A;  2VQE T;  3A5X A;  5HCJ A;  4MFR A;  1HG2 A;  3T1Y T;  2V8S V;  1M7K A;  4UV8 B;  5AFU L;  1S35 A;  1NWM X;  2CMR A;  3JCF A;  2Z6E A;  1ZKE A;  2MPK A;  4UF0 A;  2UXX B;  3Q9D A;  5JVD E;  2W61 A;  4X1K E;  4HWF A;  2XAJ B;  1BR0 A;  4ILA A;  2H88 A;  3ONL C;  1QSD A;  1HX8 A;  2FJA A;  4K0K T;  3I0O A;  4G63 A;  2A3D A;  2IDO B;  4LF7 T;  2WS3 A;  5LA6 E;  1HTJ F;  2B1E A;  2K9A A;  5AQN B;  4U7I A;  2XQ5 A;  3UFE A;  1XMQ T;  3RYI E;  1UX5 A;  3P4S A;  3NZQ A;  4DMW A;  3FZH B;  1YW0 A;  4JI1 T;  5JQG E;  4EYY R;  2D0U A;  1MND A;  2XSB A;  2UXB T;  1CUN A;  4TZ4 C;  4NXM T;  2MOZ A;  2CWO A;  1KF6 A;  3PUW F;  5BMV E;  4KX6 A;  4CN1 A;  2Y48 B;  3AEF A;  3KBU A;  4A98 A;  4EAH A;  3QK6 A;  2WWV A;  4DR2 T;  1N32 T;  5FY1 A;  5HAX A;  4J2C A;  5JRE A;  2YKS A;  3RKG A;  5CJ5 A;  3OBV E;  2BVM A;  4ILB A;  3PUX F;  3ABV A;  3O1I A;  1L0V A;  5LYJ E;  2CM0 A;  4UV9 B;  1SHZ C;  3NVO A;  4DUZ T;  5DAB A;  3VKG A;  3Q5X A;  4PJL A;  3P4R A;  1YKE B;  3UUB A;  1IBL T;  5AQQ B;  3PUR A;  3CQC B;  2D2S A;  3UQ4 A;  5ABG A;  4CXW A;  4DV7 T;  1D0X A;  1FEW A;  2XHE B;  5CA1 E;  3PUQ A;  4QWN B;  2ZM6 T;  3EAM A;  3IBP A;  3EHZ A;  2W00 A;  3F31 A;  2V7M A;  4OFZ A;  4UXN B;  5FXV A;  3PV0 F;  4IHJ E;  3UU6 A;  2LSY A;  3H3A A;  2LM2 A;  4FI5 A;  2CXF A;  5EK4 A;  1IJ5 A;  1W0B A;  3NRY A;  3ZPO A;  1D0Y A;  2D5U A;  5EK3 A;  2PBI A;  3CX7 B;  3KV5 A;  3LBX B;  5AQL B;  4WZX A;  5TAO A;  2H7V C;  5AQM B;  3ETV A;  1EZ3 A;  3FBL A;  4EV6 A;  1UX4 A;  4HTE A;  2MAW A;  4YHJ A;  4K0U A;  4AKI A;  4LF6 T;  4YY3 T;  5H6Q B;  2BG9 A;  3LSV A;  4QHO A;  3EDV A;  1YXR A;  5LG4 A;  2V7I A;  3U3I A;  2KSR A;  2DHR A;  4TUY E;  4PFO A;  2DWK A;  3KV6 A;  4IGU A;  3B13 A;  5HXC A;  4CI2 B;  4GKK T;  2E9X B;  4GYS A;  4EB6 E;  5EK2 A;  4HFD A;  2NTY A;  2V7J A;  5LMN T;  1H7C A;  2UXN B;  4CI3 B;  3K8P C;  2XAG B;  1WR0 A;  5HXS A;  3N9O A;  1J5E T;  5JTG A;  4B3T T;  4Q25 A;  3AXJ B;  2X0Y A;  5JR9 B;  3IA3 A;  4JEU B;  1XNR T;  4P09 A;  3OPC A;  1FMV A;  2YN6 A;  4DR6 T;  3NKZ A;  5HCM A;  2EHO D;  3RKO A;  3A8Y C;  4AKG A;  2KWH A;  2BBJ A;  3ANW A;  2XY8 B;  1T98 A;  5ETW A;  4ZEY A;  2XQY A;  4UEL A;  5L3G B;  1X79 A;  2X9H A;  4JEH B;  5L2L A;  3ZSS A;  3UU4 A;  4DV6 T;  1Z0P A;  3PTR B;  2BVL A;  2BZB A;  3NRX A;  4HN9 A;  5LP6 E;  2V26 A;  4WW0 A;  4U33 A;  4YSY A;  5AQP B;  1J5W A;  2WZI A;  4LFB T;  3RIU A;  1WYB A;  1SA0 E;  2YDQ A;  5AQF B;  3HR0 A;  4DO0 A;  2V5C A;  4Z8X A;  2LHN A;  4I43 B;  5DQW A;  4TV8 E;  1KEY A;  1MIW A;  5ABH A;  4A5X A;  3PUG A;  4LF4 T;  2DWG A;  4YSZ A;  4V1A v;  5LJM A;  1MMN A;  1HX1 B;  3UTK A;  2X0H A;  4HFC A;  4AQF A;  3ZYM A;  4QXH B;  4QH5 A;  3M65 A;  2WWU A;  3PJA A;  4HFI A;  4EGW A;  3AE7 A;  3LK2 B;  1OED B;  2CWY A;  2WM9 A;  1FJG T;  4UVA B;  5ADX L;  3RH3 A;  4E7Z A;  5AQK B;  5HYA A;  2Q9Q B;  5AQJ B;  3Q5D A;  5F8P A;  3WI3 A;  1X9B A;  2W2U A;  4ILC A;  4EZ4 A;  4ZI2 C;  5HWX A;  3K3Q C;  3S4U A;  2OA5 A;  2CBJ A;  3ZT5 A;  5DQV A;  2CXL A;  2HH7 A;  5F3J A;  4TWF A;  4IE0 A;  4LF8 T;  3EVY A;  3N9P A;  1HNW T;  1HCI A;  2X9W A;  4KMC A;  3ZST A;  3AE6 A;  3FHN A;  2V6X A;  2NW7 A;  3ZJ2 A;  2V7K A;  2V6Y B;  2KLQ A;  3N9L A;  3AE1 A;  5HEH A;  4JI8 T;  4PK4 A;  3KV4 A;  3WAJ A;  3JAF A;  1WYC A;  4IE5 A;  3ZCI A;  4IL9 A;  3QC9 A;  2NW8 A;  4UIG A;  4KHP T;  1VOM A;  1YQ4 A;  4LML A;  2ZM8 A;  3QB5 A;  2YK0 A;  2PG8 A;  4IDN A;  3I1A A;  2EHO A;  2NR4 A;  1N33 T;  2DNX A;  1HR0 T;  2W63 A;  2W67 A;  5A1L A;  5L3C B;  3AEA A;  2LRL A;  4EED A;  3N2O A;  1FIO A;  3H3M A;  3EAB A;  2F4V T;  2BDE A;  2KXP B;  3CQX C;  5HEG A;  3R6N A;  3L09 A;  2Y6X A;  4NXN T;  3CML A;  4JI3 T;  5EZY E;  1CHU A;  2MBG A;  2WMN A;  1JNZ A;  2CXD A;  3AA0 B;  3PUS A;  3MKD A;  4DV3 T;  4ADZ A;  3TLV A;  4AQY T;  3SS1 A;  2JMK A;  2H89 A;  3GWH A;  3HL6 A;  2VKD A;  2Y8D A;  3RPU A;  4LMK A;  3D0T A;  2KIN B;  1YQ3 A;  3ZT7 A;  4L0R A;  3P4P A;  2JQH A;  4DR1 T;  2AE9 A;  4TNV A;  5JRC A;  1UGO A;  1S94 A;  2XQA A;  2WU2 A;  4U31 A;  2V7L A;  2LOP A;  4AQG A;  2QRX A;  2XM2 A;  3SFE A;  3L39 A;  5CA0 E;  3AE2 A;  2UXC T;  3ESL A;  2K48 A;  5F5W A;  3LBX A;  4G2A A;  2IW5 B;  3CVR A;  3PU8 A;  4U74 A;  5C2T A;  2WB5 A;  3OJA A;  2L8K A;  4LFA T;  4A56 A;  3K3O A;  2ODV A;  2VUR A;  3GN5 A;  5FVK A;  3B5M A;  4M1P A;  2HHH T;  3P4Q A;  2RA1 A;  2BS2 A;  2J47 A;  2XAS B;  3DJB A;  4YT0 A;  4DBQ A;  4ZI3 C;  5FP3 A;  3QOF A;  3L8R A;  3NBX X;  4TN7 B;  2GK9 A;  4IIJ E;  2JQ9 A;  3HKE E;  4H9S E;  4O4L E;  4JUY A;  3MXZ A;  1IAP A;  1ZP0 A;  3CPZ A;  5FXX A;  4IDO A;  2OV9 A;  4EYU A;  2WBL A;  1HF8 A;  2L3L A;  4X66 T;  4JI5 T;  3C98 B;  1Y64 B;  4HWI B;  3ONJ A;  3CIR A;  3KVA A;  3ZMT B;  4YJ2 E;  3LK4 2;  4CN4 A;  4PFP A;  4QH4 A;  4AKR B;  2VKH A;  4GK5 E;  1B7T A;  3RIF A;  1XZY A;  2FBW A;  5JR9 A;  3UUN A;  4UEM A;  3NWI A;  5AQO B;  3DP7 A;  3M3Z B;  5KMG P;  5J1G A;  2WY2 A;  3UUL A;  2QA7 A;  3AED A;  2NWB A;  3C4Z A;  2K5B B;  3H37 A;  4EIW A;  1KNP A;  3JC6 C;  4BJM A;  5LGT B;  2W62 A;  5LHG B;  2EHO C;  2LRK A;  4TNW A;  5LHI B;  3UUX B;  3I0Q A;  1WR6 A;  5JDH A;  4B3R T;  4XBF B;  3MJX A;  1VCT A;  5LMU T;  1HNX T;  3HI2 A;  2IC9 A;  3I9Y A;  1UK5 A;  4NUV A;  4DR5 T;  2UUC T;  2DI4 A;  1XDO A;  2E5V A;  1US7 B;  3KVB A;  5FXZ A;  3AEB A;  3IF8 B;  1V9D A;  4YJ3 E;  4DV2 T;  4X1I E;  4HEA A;  3RRW A;  1ZHC A;  5AQI B;  2LOS A;  3FXE B;  3HA4 A;  1UCU A;  5HXE A;  2J4G A;  3FZK B;  4HWC A;  4NPP A;  4AXP A;  2VK9 A;  4H9P C;  4PNI A;  2DCF A;  3ZN1 B;  2W66 A;  3BK9 A;  4PJN A;  2VAS A;  1ZV4 X;  4DR4 T;  1XMO T;  4C90 A;  4DV1 T;  2V1D B;  2I59 A;  5ABF B;  1MMG A;  4XZC A;  2IHR 1;  1E7P A;  5HEU A;  3VR8 A;  4QKN A;  3O9X A;  1IZN B;  3B57 A;  1LKX A;  3EDU A;  2YDR A;  1YD8 G;  4YTM A;  1KFY A;  3JAD A;  2QGS A;  2LLY A;  3R84 B;  1R8I A;  3VU7 H;  2BKO A;  3AE9 A;  3ETU A;  5LCY A;  4COF A;  4O8S A;  3ONX A;  4QH1 A;  2UU9 T;  2MTQ A;  4YLH A;  2KMF A;  3ZLI A;  5JDF A;  4X62 T;  4IDP A;  3TLW A;  4Z91 A;  3OYZ A;  4U3C A;  3U78 A;  5LGU B;  3AVS A;  2XZE A;  5AQV B;  2V6Y A;  4BAY B;  4EZH A;  3HKD E;  4TWH A;  1HG5 A;  2C5J A;  5AQG B;  3LFM A;  3V5S A;  5JH7 E;  5JDQ A;  2DL1 A;  2WMO A;  5FVL A;  2G0U A;  3EUH A;  4PK5 A;  3DTO A;  2ZMA A;  3BQK A;  4JI7 T;  3JAE A;  2UUB T;  5LBQ B;  5JDG A;  4JV5 T;  2CLY C;  4MAL A;  1I6Z A;  2PTF A;  2XQ4 A;  2K3W A;  2M6I A;  2BS3 A;  4U72 A;  2M6B A;  4HFV A;  4DVD A;  2X66 A;  4I50 E;  5AQH B;  2WQY A;  4PJM A;  1IBM T;  2NP9 A;  4ZZC A;  2XSA A;  1HNZ T;  2WDR A;  3KBT A;  2D0T A;  3C4X A;  4YTN A;  2ZM2 A;  3T8O A;  2E2A A;  5C3J A;  3F2E A;  4A97 A;  4HGA A;  3PU3 A;  4DID B;  4O4J E;  1MMA A;  3FZM B;  5IYZ E;  4LFC T;  5FMN A;  1KK7 A;  3X1D A;  3L3P A;  2J62 A;  4CI1 B;  2YEV C;  1AJ3 A;  5FY0 A;  3K3N A;  2CHN A;  2H7O A;  4ZS2 A;  5LHH B;  4L5G A;  1SE7 A;  1XDP A;  4OX9 T;  4AIU A;  2XQ6 A;  3LJC A;  2C5I T;  4YHH T;  3VRB A;  4ILU A;  4TWD A;  1LVF A;  5M4Y A;  3RIA A;  3TLT A;  2BG9 C;  5FNV E;  4O4I E;  1U4Q A;  3OTO T;  2IML A;  5JDL A;  1D1B A;  1NEK A;  2E9X D;  3VR9 A;  3UU8 A;  4IRE A;  5FY7 A;  2SPC A;  4IE4 A;  2LE8 A;  4I4T E;  3C4W A;  3KV9 A;  4DR3 T;  4GOU A;  2JRK A;  4AKL A;  3MZK B;  3N2G E;  4NUU A;  4JI0 T;  4HWH A;  2LSK A;  3GMI A;  4H63 V;  3AA1 B;  3ANW B;  2I6H A;  2XUE A;  2WP9 A;  3K1S A;  4P0A A;  4QX8 B;  2WDV A;  1Z8U A;  3QNU A;  3N9M A;  3CWZ B;  5GON E;  3J9X 1;  1OED E;  2XAQ B;  2NTX A;  2LT3 A;  5L4H A;  3UFG A;  5H6R B;  2I0M A;  1W09 A;  2LSG A;  1IBK T;  1E2A A;  1ZEE A;  1DU2 A;  3FXD B;  4HWD A;  2YOE A;  4IL4 A;  4UR9 A;  5CB4 E;  4MHC A;  4H9Q C;  2R6G F;  2YDS A;  4B3M T;  3RIU C;  5HXH A;  1QUU A;  3AB3 B;  3AAI A;  4OYK A;  4ZZB A;  2NW9 A;  4CXX A;  4X20 E;  3FBZ A;  5FKY A;  4BJN A;  1IJ6 A;  4IST A;  3ZT6 A;  4KHZ F;  4HE8 A;  3HKC E;  3CQG B;  3AE5 A;  3EI0 A;  4CXY A;  4FJO A;  2HPJ A;  4F6R C;  5FXW A;  4JI6 T;  4ZI2 D;  1LVK A;  4AQF C;  2A9U A;  5FL0 A;  1G8X A;  4KUM B;  4X64 T;  2VQF T;  3AE8 A;  1XWM A;  2Q9Q D;  3CX6 B;  2ACZ A;  1O3X A;  3RLF F;  3UUM A;  1HFA A;  5AQT B;  4P0B A;  2XM1 A;  3OKQ A;  1MMD A;  1ZOY A;  2XPK A;  3ZYL A;  4KI0 F;  4L9I A;  3G06 A;  3AVR A;  4C91 A;  3A7M A;  2CRB A;  4YTP A;  5ABF A;  2DLR A;  2H3R A;  2YU1 A;  3N9Q A;  4ZS3 A;  4UVB B;  4WBN E;  2IC6 A;  3ZC1 A;  2CCQ A;  3PDY A;  4PAG A;  4OYJ A;  5J0Z A;  2E9X A;  3PJA J;  1E1H B;  4GK0 E;  2VL0 A;  1BR4 A;  4EXT A;  2LM9 A;  5L3B B;  2VKO A;  1QLB A;  4BA9 A;  2E8I A;  3ZMV B;  3ZYK A;  3FZF B;  3RRC A;  4KBM B;  4F8H A;  4YXD A;  2JQK A;  2N9D A;  3CX8 B;  4WNK A;  4HFB A;  2WAU A;  3AXJ A;  3VKH A;  3RC8 A;  2EHO B;  1LRZ A;  5L47 A;  2N1G A;  3HKB E;  4EEB A;  2ZLY A;  2E5L T;  1HS7 A;  2QYW A;  4IT4 A;  2MYS A;  3AA7 B;  5AQU B;  3SRZ A;  3ZCJ A;  4CQI A;  2CHO A;  3P4W A;  2CE7 A;  3E08 A;  2ZM0 A;  3ZMZ B;  4AIS A;  5KDM C;  4PK6 A;  2LSI A;  1M62 A;  3VHL A;  1W0A A;  3ZC0 A;  4X1Y E;  5J2U E;  5LGN B;  4OK0 A;  1T7S A;  2X9Y A;  3AEC A;  2FJE A;  2VB6 A;  2JPF A;  1SUM B;  3CK6 A;  2C0S A;  1UUR A;  2KND A;  3AE3 A;  2L9Q A;  3P8C D;  2XQ3 A;  1KNR A;  4LF9 T;  2QVA A;  4B6X A;  3T1H T;  4E7S A;  3O1H A;  5JRC B;  2HN1 A;  5IUX A;  3KIN B;  5J2T E;  1T72 A;  1NEN A;  4ANJ A;  5JDN A;  3PE0 A;  5DJQ C;  2VWA A;  4UF0 B;  2LKG A;  3SOL A;  2XJ7 A;  4JLE A;  4N78 D;  5E0O A;  3UU5 A;  4ZOL E;  3RGL A;  3WAK A;  4MBQ A;  4HKA A;  2ACX A;  1OED A;  4IE6 A;  5LG3 A;  1YKH B;  2D9D A;  2BS4 A;  2Q9Q A;  4NIQ A;  2V5D A;  3ZEF B;  5IWA T;  3UU3 A;  3GN5 B;  4IDZ A;  1NAF A;  2JMH A;  4QXC B;  4JI2 T;  3V5U A;  4ZI3 D;  4WBO A;  2FJB A;  4Z90 A;  3AE4 A;  4CN6 A;  4PW8 A;  2CEA A;  2J1D G;  2YU2 A;  2WSS V;  2UXD T;  4X5T A;  3PUA A;  2HN2 A;  2CBI A;  2NOX A;  2UUA T; 
#chains in the Genus database with same CATH homology
 2Y6X A;  3K3N A;  5LOV E;  3CML A;  5EZY E;  4J2C A;  3RX6 A;  5JRE A;  2A2F X;  2H7O A;  2WMN A;  2MBG A;  2CXD A;  3AA0 B;  4DND A;  2LSJ A;  3OBV E;  4ZS2 A;  5HXR A;  2BVM A;  4QX7 B;  3PUS A;  5LHH B;  3MKD A;  4L5G A;  2HPL A;  2X9X A;  4H9R C;  2N2N A;  4ADZ A;  3O1I A;  5LYJ E;  4EOZ B;  2CM0 A;  4UV9 B;  3SS1 A;  2JMK A;  1SHZ C;  3GWH A;  3HL6 A;  3LJC A;  2C5I T;  5DAB A;  2VKD A;  2Y8D A;  3VKG A;  4ILU A;  3Q5X A;  3RPU A;  3ZMU B;  3N2K E;  3D0T A;  4PJL A;  2KIN B;  1LVF A;  4YFS A;  4L0R A;  5M4Y A;  1D1A A;  1KNZ A;  1FMW A;  1YKE B;  3P7I A;  3SWH A;  5FNV E;  5JRC A;  2E9X C;  4O4I E;  1OXZ A;  5LXT E;  1S94 A;  1U4Q A;  5KX5 E;  2X67 A;  3PUR A;  3CQC B;  2CLY B;  3BQL A;  1MIY A;  1D1B A;  2D2S A;  2V7L A;  5JDL A;  2LOP A;  3LG7 A;  3JC6 D;  4AQG A;  4CXW A;  4OHF A;  1D0X A;  1FEW A;  2XHE B;  5CA1 E;  3PUQ A;  2E9X D;  4QWN B;  4QXB B;  5FY7 A;  3IBP A;  2SPC A;  5CA0 E;  2W00 A;  3ESL A;  2K48 A;  4IE4 A;  3F31 A;  2V7M A;  2ES0 A;  2LE8 A;  3LBX A;  3LK3 B;  5JR9 C;  4G2A A;  4OFZ A;  4UXN B;  4I4T E;  1D0Z A;  5L3D B;  2IW5 B;  5FXV A;  4IHJ E;  1WRD A;  3CVR A;  3PU8 A;  4U74 A;  3C4W A;  2LSY A;  3TKL B;  3H3A A;  3KV9 A;  4GOU A;  4PJJ A;  2JRK A;  2PJQ A;  4AKL A;  4FI5 A;  3MZK B;  3N2G E;  4NUU A;  2CXF A;  5EK4 A;  1IJ5 A;  3OJA A;  2L8K A;  3NRY A;  4A56 A;  4XAX B;  3ZPO A;  3K3O A;  2ODV A;  2LSK A;  3GMI A;  1D0Y A;  2D5U A;  3GN5 A;  4H63 V;  3AA1 B;  2LHR A;  5EK3 A;  2PBI A;  3ANW B;  3CX7 B;  3KV5 A;  3LBX B;  4M1P A;  2RA1 A;  2P9B A;  2XUE A;  3ZJ1 A;  5C8Y E;  2X68 A;  4P0A A;  4QX8 B;  4GYR A;  3N9M A;  3CWZ B;  2XAS B;  5TAO A;  2H7V C;  3DJB A;  5GON E;  1G73 A;  3J9X 1;  1OWA A;  4DBQ A;  3ETV A;  1EZ3 A;  5LNK A;  3FBL A;  3GA8 A;  4ZI3 C;  5FP3 A;  2CA5 A;  3NBX X;  1UX4 A;  4HTE A;  4ZHQ E;  2LJL A;  4TN7 B;  2IAK A;  5JDM A;  2XAQ B;  2NTX A;  3OYX A;  2LT3 A;  2ODU A;  2GK9 A;  4YHJ A;  4K0U A;  2KT9 A;  1BR1 A;  4IE7 A;  4AKI A;  3IEE A;  4IIJ E;  3HKE E;  3AA6 B;  4H9S E;  5H6R B;  3AAA B;  2VKJ A;  4O4L E;  5H6Q B;  4TX5 A;  4JUY A;  4QHO A;  3EDV A;  5LG4 A;  3MXZ A;  1IAP A;  3CPZ A;  3UT5 E;  5FXX A;  2LSG A;  2V7I A;  3U3I A;  4EYU A;  4H63 H;  2WBL A;  3O1J A;  3BQI A;  2W0G A;  1HF8 A;  2L3L A;  3E22 E;  4KP3 C;  2DHR A;  3C98 B;  3Q2M A;  1Y64 B;  2C5K T;  2KWI B;  4TUY E;  1ZEE A;  4PFO A;  5FYM A;  2DWK A;  2PFV A;  3KV6 A;  2RP4 A;  4IGU A;  3FXD B;  3KVA A;  5IHY A;  3B13 A;  3ZMT B;  3LK4 2;  4YJ2 E;  5CB4 E;  4PFP A;  5HXC A;  4CI2 B;  4GIW A;  4MHC A;  2VKH A;  4AKR B;  4GK5 E;  4H9Q C;  1B7T A;  2E9X B;  5JR9 A;  3UUN A;  4GYS A;  4UEM A;  4EB6 E;  5EK2 A;  5HXH A;  3I9W A;  1D1C A;  1QUU A;  2A72 A;  2NTY A;  2V7J A;  3AAI A;  3AB3 B;  3DP7 A;  4OYK A;  1H7C A;  2UXN B;  4CI3 B;  3K8P C;  2XAG B;  3CKD A;  5J1G A;  2NW9 A;  5HXS A;  5KMG P;  3UUL A;  4CXX A;  4X20 E;  3FBZ A;  2QA7 A;  2NWB A;  3FB2 A;  3N9O A;  3C4Z A;  3RYF E;  2K5B B;  3H37 A;  4BJN A;  4EIW A;  1IJ6 A;  2X51 A;  1WLX A;  3JC6 C;  4IST A;  4BJM A;  5LGT B;  4HE8 A;  3HKC E;  2W62 A;  3CQG B;  5LHG B;  4CXY A;  2EHO C;  3RYC E;  5JR9 B;  4JEU B;  4P09 A;  5LHI B;  4FJO A;  3UUX B;  2HPJ A;  2Q9Q C;  3RYH E;  2X0L B;  3I0Q A;  1FMV A;  4F6R C;  5FXW A;  4ZI2 D;  1LVK A;  1WR6 A;  4AQF C;  5JDH A;  4XBF B;  1G8X A;  3MJX A;  4KUM B;  3IHR A;  1BR2 A;  2EHO D;  4H9N C;  3HI2 A;  3RKO A;  2KZ7 B;  2IC9 A;  3I9Y A;  4AKG A;  2Q9Q D;  2M67 A;  2KWH A;  2XAF B;  4NUV A;  2DI4 A;  3CX6 B;  3ANW A;  1T98 A;  5ETW A;  1O3X A;  2XQY A;  1US7 B;  3KVB A;  5L3F B;  3UUM A;  4UEL A;  5L3G B;  5FXZ A;  1HFA A;  1X79 A;  2X9H A;  3NZP A;  3IF8 B;  4JEH B;  4P0B A;  5L2L A;  1V9D A;  4YJ3 E;  1Z0P A;  3PTR B;  3J7Y q;  2BVL A;  2YIN A;  3N9N A;  1MMD A;  3OKQ A;  2BZB A;  3NRX A;  4HN9 A;  4X1I E;  4HEA A;  4MLK A;  5LP6 E;  2VL8 A;  2V26 A;  3RRW A;  1ZHC A;  4WW0 A;  3ZYL A;  4L9I A;  2LOS A;  4UVC B;  3FXE B;  3HA4 A;  1UCU A;  5HXE A;  3ZN0 B;  4H9O C;  3E0Z A;  3AVR A;  4O4H E;  4C91 A;  5LJN A;  1MIV A;  1MNE A;  3Q5W A;  4AXP A;  2VK9 A;  2DLR A;  4H9P C;  2JQQ A;  2H3R A;  2YU1 A;  1WYB A;  1SA0 E;  4PNI A;  3N9Q A;  4ZS3 A;  4UVB B;  2DCF A;  4WBN E;  1VRB A;  3HR0 A;  2IC6 A;  4DO0 A;  4Z8X A;  3ZN1 B;  3ZC1 A;  2LHN A;  4TV9 E;  4I43 B;  5DQW A;  4TV8 E;  3BK9 A;  2K24 A;  1MIW A;  4ERR A;  2CCQ A;  4PJN A;  4ZI7 E;  2VAS A;  1ZV4 X;  3PUG A;  3PDY A;  4PAG A;  4OYJ A;  4C90 A;  4I55 E;  5HWY A;  5LBM A;  2DWG A;  2E9X A;  2V1D B;  3C50 A;  1E1H B;  2I59 A;  1MMG A;  4AI6 A;  4XZC A;  4V1A v;  3QUJ A;  4GK0 E;  5LJM A;  1MMN A;  1BR4 A;  3UTK A;  4EXT A;  4AKH A;  2LM9 A;  5L3B B;  1U5P A;  2VKO A;  4BA9 A;  4QKN A;  4AQF A;  3ZYM A;  2E8I A;  3ZMV B;  4QXH B;  3ZYK A;  3M65 A;  3RRC A;  3O9X A;  3MK7 C;  2WWU A;  1IZN B;  3AAE B;  3B57 A;  3KDS E;  1LKX A;  4KBM B;  3EDU A;  2N9D A;  3CX8 B;  2JJ9 A;  3LK2 B;  1YD8 G;  4WNK A;  2CWY A;  2WM9 A;  3C64 A;  4UVA B;  2WAU A;  5ADX L;  2QGS A;  3VKH A;  3R84 B;  3RC8 A;  3RH3 A;  2EHO B;  2XAH B;  3RC3 A;  3VU7 H;  4E7Z A;  2LEH A;  3ETU A;  5LCY A;  1LRZ A;  5HYA A;  2Q9Q B;  3O4X E;  2N1G A;  3HKB E;  4O2B E;  4CZZ B;  4O8S A;  2ZLY A;  3ONX A;  1HS7 A;  3KFW X;  3ZMS B;  4DMV A;  5F8P A;  2MYS A;  3AA7 B;  3WI3 A;  4ASK A;  2MTQ A;  4EZ4 A;  4YLH A;  4ZI2 C;  5HWX A;  3K3Q C;  2KMF A;  3ZLI A;  3MA9 A;  3C51 A;  3S4U A;  5JDF A;  3SRZ A;  3ZCJ A;  4CQI A;  3F57 A;  2OA5 A;  2CE7 A;  3E08 A;  2ZM0 A;  3OYZ A;  3ZMZ B;  2XTL A;  5KDM C;  4PK6 A;  2LSI A;  3U78 A;  3W15 B;  3VHL A;  5LGU B;  3ZC0 A;  3MAC A;  4X1Y E;  5DQV A;  2CXL A;  5L3E B;  2HH7 A;  5F3J A;  5J2U E;  5LGN B;  4OK0 A;  4ISS A;  2X9Y A;  3AVS A;  4IE0 A;  4O2A E;  3N5L A;  4DBR A;  2VB6 A;  2JPF A;  2C0S A;  3A5X A;  4MFR A;  1HG2 A;  4BAY B;  4EZH A;  3EVY A;  3HKD E;  2KND A;  1HG5 A;  3N9P A;  2C5J A;  2L9Q A;  3P8C D;  3LFM A;  4UV8 B;  1HCI A;  2X9W A;  3V5S A;  1S35 A;  5AFU L;  4KMC A;  5JH7 E;  4B6X A;  5JDQ A;  1NWM X;  2CMR A;  4E7S A;  2WMO A;  2Z6E A;  3FHN A;  2G0U A;  2NW7 A;  3O1H A;  1ZKE A;  3ZJ2 A;  2V7K A;  4UF0 A;  2KLQ A;  2UXX B;  3EUH A;  5JRC B;  4PK5 A;  3DTO A;  3N9L A;  2ZMA A;  3Q9D A;  5JVD E;  3BQK A;  3KIN B;  2W61 A;  4X1K E;  4PK4 A;  5J2T E;  2XAJ B;  5LBQ B;  5JDG A;  3KV4 A;  2CLY C;  3WAJ A;  1BR0 A;  4MAL A;  1WYC A;  4IE5 A;  3ZCI A;  4ANJ A;  1QSD A;  1HX8 A;  4U72 A;  5JDN A;  3PE0 A;  3QC9 A;  5DJQ C;  2NW8 A;  4UIG A;  2VWA A;  3I0O A;  4G63 A;  4UF0 B;  1VOM A;  2A3D A;  4HFV A;  2ZM8 A;  4DVD A;  3SOL A;  4JLE A;  4N78 D;  5E0O A;  4ZOL E;  2X66 A;  2YK0 A;  4MBQ A;  4HKA A;  3WAK A;  2ACX A;  2PG8 A;  5LA6 E;  4I50 E;  3I1A A;  1HTJ F;  2B1E A;  4PJM A;  4IE6 A;  2NP9 A;  1YKH B;  2EHO A;  2K9A A;  3KBT A;  2D0T A;  2Q9Q A;  3C4X A;  3UFE A;  3RYI E;  1UX5 A;  3ZEF B;  3NZQ A;  4DMW A;  2ZM2 A;  1YW0 A;  2DNX A;  5JQG E;  3T8O A;  4EYY R;  2W63 A;  3F2E A;  3GN5 B;  5A1L A;  2D0U A;  4IDZ A;  1NAF A;  1MND A;  1CUN A;  4TZ4 C;  2JMH A;  5L3C B;  2MOZ A;  2CWO A;  4HGA A;  3PU3 A;  4QXC B;  3V5U A;  4ZI3 D;  4WBO A;  5BMV E;  3N2O A;  4O4J E;  1FIO A;  2Y48 B;  1MMA A;  5IYZ E;  2BDE A;  4PW8 A;  5FMN A;  3KBU A;  1KK7 A;  2CEA A;  2J1D G;  2YU2 A;  2WSS V;  3QK6 A;  4EAH A;  3L3P A;  4CI1 B;  2KXP B;  3CQX C;  2YEV C;  3PUA A;  1AJ3 A;  2NOX A;  5FY1 A;  5FY0 A;  5HAX A;  3R6N A;  3L09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...