2AXDS

Solution structure of the theta subunit of escherichia coli dna polymerase iii in complex with the epsilon subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the theta subunit of Escherichia coli DNA polymerase III in complex with the epsilon subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA polymerase III, theta subunit
total genus 22
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2axdS00
2XY8B 1SE7A 2AE9A 1DU2A 2IDOB 2AXDS
chains in the Genus database with same CATH superfamily
4I4TE 3ZC1A 4CXYA 2AE9A 4I0UA 1MMGA 2JPFA 3UU3A 3P4RA 2KSRA 5H6QB 5HXEA 1IZNB 3OYXA 2WAUA 4ZS3A 1HG5A 2X51A 2P9BA 2ACXA 5FL0A 3ZMUB 3I0QA 4ZZCA 2WMNA 3SFDA 5CA0E 2SPCA 3UQ4A 3ZYKA 5HXHA 5JQGE 5AQTB 3K3OA 2PFVA 2JQ9A 2WP9A 2OLTA 2YU1A 5EZYE 3KV9A 4HFBA 3NBXX 4PJJA 3RKGA 2CHOA 3KINB 3ZT5A 3FBZA 1SE7A 4LFAT 2N9DA 2BG9A 2XQ8A 2B76A 4JI3T 3ZEFB 4YHJA 3I1AA 2JQKA 3RX6A 4CN4A 3FXEB 2BBJA 4X65T 1SHZC 1T7SA 1YQ3A 4HFVA 4ZZBA 1ZOYA 5FVLA 4EXTA 5C3JA 1D0YA 4CN1A 2CXLA 2NWBA 2XAGB 4IHJE 3QB5K 4EOZB 4GOUA 1D0XA 2YU2A 3ZN0B 4CI1B 1SA0E 4U33A 2XM2A 4UV8B 4NIQA 1HTJF 2V7IA 3CQGB 1BR1A 3JC6D 5E0OA 5HEUA 3UU8A 3ZKRA 2FJDA 2WCAA 4EB6E 5FL1A 2EHOA 2KT9A 3H3AA 4KP3C 2IMLA 2V7KA 2PTFA 3CX6B 5HEOA 4AQFC 4U2ZA 4JI2T 2MTQA 1NWMX 2BDEA 2W62A 3EAMA 3QC9A 3RPUA 5LA6E 3SWHA 3LDQB 5HXRA 3ANWB 2Q9QA 1T8BA 4TV9E 3RQWA 4HTEA 3RRWA 2YKSA 2K5BB 4BAYB 2UUCT 4LF9T 2H7VC 4X5TA 4TN7B 2KZ7B 2V26A 3DJBA 3KV4A 4QHOA 4TUYE 3TLSA 2VQFT 1US7B 2W0GA 1OEDB 2ZLYA 3I9WA 2W63A 4GK5E 4DMVA 5FNVE 1R8IA 2BG9C 4Z91A 4KI0F 4HEAA 3AAEB 3OVUA 3N2OA 1BR4A 2Q9QB 4X66T 1IAPA 4LMJA 2XAFB 2IAKA 2DNXA 3UU5A 4NXNT 2UXBT 3A7MA 3I9YA 2BVMA 3ETVA 2EHOB 4HKAA 3ABVA 5L3DB 3MACA 3K1SA 4GKJT 4EZHA 3MXZA 4OYKA 5HWXA 3VHLA 1XMQT 5KMGP 2D0UA 4O4JE 1FIOA 5IWAT 2I59A 2XTLA 1E2AA 2HN2A 5LBMA 4EEDA 2L3LA 1KF6A 2JJ9A 2IHR1 4DBQA 4YTMA 3B13A 4DV1T 2XQ9A 1L0VA 4JI4T 3LG7A 1MNEA 4V1Av 4AQYT 3AE7A 1N33T 1KEYA 4KX6A 2MPKA 3V5UA 5IUXA 5IYZE 4AKLA 3N9NA 3P50A 3Q5DA 4DR6T 4WNKA 2L9QA 1QSDA 3HKEE 4X1KE 5JVDE 5AQIB 3O1JA 4CXWA 4GK0E 4OHFA 3LFMA 4ERRA 4UR9A 3G06A 2LSIA 3PTRB 4OK0A 4UVAB 1MIVA 2K3WA 4UV9B 2XHEB 5AQJB 3UFEA 4Q25A 4EAHA 3FZKB 3ZLIA 2KWHA 4C90A 4TNWA 3IHRA 2Z6EA 3C4ZA 4H9SE 3HL6A 3ONXA 3K3NA 4MLKA 5FYMA 3RF1A 3S4UA 4CZZB 2LKHA 4DV4T 4LF6T 4TV8E 2WWVA 3IEEA 3FZHB 4MBQA 4O4HE 3N5LA 5DQVA 5ABHA 4H9RC 1MNDA 4U74A 1XDPA 2WDQA 3ZYLA 3B5MA 3GN5A 2BKOA 2CHNA 4QH5A 5AQPB 4AISA 3UFGA 3PJAA 4CN6A 5JDNA 2VQET 2H7OA 3KBTA 3LSVA 3QK6A 2VL8A 4N78D 3P7IA 4JI7T 3RYFE 4EYYR 5HYAA 3I0OA 3VU7H 1I94T 3FZMB 3RIAA 4IL9A 4AKRB 3CKDA 1LVFA 1YKEB 2XQ6A 3EHZA 2H88A 5EK3A 5GONE 4LF8T 5LMUT 2IC6A 2LEHA 2MAWA 2V8SV 5KDMC 4IT4A 5CJ5A 4EYUA 1XNRT 5LMNT 4LMLA 2GK9A 3NZQA 5JDMA 1IBMT 2IUBA 2KMFA 3RIUC 3LJCA 2LSYA 2J1DG 2LM9A 1BR2A 2Y8DA 4AIUA 5IHYA 4YTNA 5LGTB 2KNDA 4UVCB 4KMCA 3ONJA 3DTOA 5LB7B 4CI3B 2NTXA 3ANWA 3VRAA 3SS1A 3RQUA 3ZMZB 2LSJA 3O1IA 4B6XA 1G8XA 4QX7B 4ZHQE 2BS4A 1D1AA 2FBWA 5ADXL 2I6HA 2X9WA 2RPAA 3Q5WA 3J9X1 5AQVB 3T8OA 1X9BA 4DR3T 2CA5A 1FMVA 1B7TA 5HCMA 3AA7B 3C4XA 3SFEA 3P4WA 4DBRA 3R84B 4AXPA 5AQUB 1CHUA 2XM1A 2IW5B 2WS3A 3VRBA 4JI0T 3ZSSA 2N2NA 1J5ET 5LGNB 2IIUA 4HN9A 1UGOA 5JRCA 3AE1A 5AQFB 5L3EB 4AI6A 2XQYA 1NENA 2JQHA 2IDOB 5HEGA 2X68A 4OX9T 4MFRA 5ABEA 3P4SA 1GQEA 5TAOA 5LHGB 2Y6XA 3EDVA 5AQGB 4E7ZA 3RIFA 3QUJA 3SOLA 1YD8G 4GYSA 4JI5T 3HKCE 4JBWF 5AQHB 3TLVA 3KVAA 2EHOD 3PUSA 3RIUA 3AE5A 3FZFB 5JTGA 4B3RT 5J1GA 3L39A 2WDRA 3UUNA 1HNZT 4ILBA 3A5XA 2X0YA 1G73A 4I43B 2MOZA 1MIYA 2CLYC 3DP7A 3RLFF 3IA3A 3GMIA 4JI8T 4H9QC 2V5CA 4FI5A 4O2BE 2WDVA 3U78A 2NOXA 2YINA 3MZKB 4B3MT 2XZEA 2WSSV 3FHNA 5FXVA 2D0TA 5A1LA 4H9OC 2K24A 4BA9A 3MK7C 5AQLB 5JDQA 1IBKT 2VURA 2CBIA 3VKGA 3N9MA 3NVOA 3FZLB 3EDUA 2OV9A 5F3JA 5L3CB 4NXMT 5LXTE 1D1BA 4GIWA 4XBFB 5LHHB 4NUVA 4UXNB 3UULA 3ZSTA 4WBNE 5L3BB 3ZMVB 1OXZA 3AAIA 2FUPA 2B1EA 3AEEA 3HR0A 2C0SA 4HFIA 3HKDE 4KUMB 4QH1A 2MBGA 4EEBA 3UQ7A 3UU4A 1BR0A 4AKIA 3RGLA 1UUSA 3L8RA 3IF8B 4EV6A 3GN5B 3ZN1B 1I6ZA 4WBOA 2X0LB 1IJ5A 1JNRA 5J2UE 2CXDA 4PJMA 2UXDT 2CRBA 2WBLA 2WU2A 4UF0B 2KXPB 2VVSA 2E9XD 2JIWA 2M6IA 3VR9A 4BJMA 3CX7B 4IDOA 1WR0A 2A2FX 4TWHA 3K8PC 4IE0A 3Q5XA 5J0ZA 2AXDS 3A8YC 3CVRA 4O8SA 2ES0A 4YT0A 3NRXA 1VOMA 3N9OA 1T72A 1V9DA 2IC9A 5LJNA 3LK42 3PJAJ 1W09A 2XSBA 5DQWA 4DR7T 1HCIA 1ZV4X 2YDRA 2DWKA 4X1IE 1N32T 4XAXB 1OEDC 4IE4A 4NPPA 1D0ZA 4YSZA 3F2EA 4CXXA 1U5PA 4FJOA 5F8PA 4YXDA 5L47A 2W61A 1WYCA 2YOEA 2XASB 1AJ3A 2YN6A 1FMWA 2Q9QC 5FKYA 2X9HA 5FY0A 3RI5A 2Q9QD 4HFEA 4HFCA 4WW0A 3QB5A 5JR9C 1ZHCA 5LBQB 4DO0A 3C51A 5FY7A 1WLXA 3H3MA 1J1JA 4X62T 5F5WA 4IIJE 4LF7T 2C5KT 5DJQC 5LNKA 2D5UA 2ODVA 2JMHA 2HN1A 1D1CA 3PUWF 5JRCB 4O4LE 3T1HT 1J5WA 5LHIB 3EUHA 4LFBT 5AQRB 2H3RA 4DUYT 1YQ4A 3KBUA 2CM0A 4ANJA 2XUEA 2ZM6T 4DV5T 4P0AA 3E22E 1Z0PA 4JEUB 1W0AA 2XQ3A 4DR2T 2W2UA 4H9NC 5LP6E 3VKHA 3N9QA 4CI2B 3O1HA 2VWAA 3CK6A 1QUUA 4QXBB 3X1DA 4YSXA 2WB5A 4COFA 2BG9E 4IDNA 3AE4A 4X1YE 5AQSB 3ZCJA 2WZIA 1YKHB 2DWGA 2V5DA 1KK7A 1VCSA 3AB3B 1ZKEA 3AEDA 2VKDA 3MA9A 4I55E 4EZ4A 4GKKT 3ETUA 3L3PA 5LG4A 2KWIB 5LG3A 5EK2A 1HNWT 2LRLA 4H63V 3NZPA 5LCYA 2L8KA 3JCFA 2F4VT 2HPLA 1EZ3A 3FBLA 1NAFA 2XPKA 1Z8UA 3N9PA 4ZXLA 4C91A 2XQ7A 1YXRA 5FMNA 2X66A 2LHNA 2XAQB 4IREA 2YEVC 2A3DA 2CWOA 2ZM0A 1X79A 2WWUA 3KFWX 4EIWA 5LOVE 5HXCA 5LGUB 4DV3T 4L9IA 1W0BA 3PUQA 5JDFA 4DIDB 1S94A 1XWMA 4XZCA 2V6YB 1WRDA 4DUZT 2K48A 2DI4A 2ODUA 2X67A 4KHZF 2YK0A 4NUUA 5AQOB 5J2TE 3PUXF 5FXXA 4A5XA 1VRBA 3AEBA 3CWZB 2E9XA 4K0UA 5JDGA 4DR1T 2OA5A 2BKNA 2XJ7A 4ZI7E 2UU9T 4F6RC 3FB2A 3JADA 3RKOA 1N36T 2X0HA 2N1GA 3LBXA 3MKDA 2VK9A 3AVRA 2EHOC 2XSAA 4TWDA 1QLBA 2DLRA 4PNIA 3AEFA 4ZI2D 2V1DB 2WMOA 5JDHA 2UUBT 2CLYB 3CQCB 5HCJA 4PK4A 2W00A 3RYHE 2LSKA 4LFCT 4HWHA 2LM2A 2W66A 2DCFA 4ZI3C 2XQ4A 1WCRA 2NTYA 4B3ST 3AAAB 5C8YE 1ZEEA 3UTKA 2QYWA 2LOSA 2V7JA 3N9LA 3O4XE 2V7LA 1FJGT 4HFHA 2VB6A 3RHWA 3VR8A 2PJQA 3BQLA 1LVKA 3H37A 4JUYA 2LJLA 3OPCA 5JR9B 3BQKA 1NEKA 4B3TT 4ISSA 1UCUA 2BS3A 1IJ6A 2BVLA 3HKBE 3IBPA 4JI1T 1KNRA 4U3CA 2LE8A 3JAEA 3ONLC 3Q5EA 3PUVF 3EABA 2JMKA 3LBXB 4IE7A 4IE6A 4YJ3E 2VKHA 5H6RB 5HEHA 2X9XA 4A97A 3NWIA 4DV2T 2UXCT 2DL1A 1M62A 4IE5A 4U7YA 2LHRA 4TNVA 3RYIE 3MJXA 3AVSA 3AEGA 2CWYA 2LSGA 2RA1A 3ZT6A 4UVBB 2CMRA 5FVKA 2DHRA 3D0TA 4PFPA 3WI3A 4HWFA 1HNXT 4Z90A 3Q9DA 2VVNA 4BJNA 2QRXA 3GWHA 3LK3B 4EGWA 5L3GB 4I50E 3OJAA 3PUGA 2J62A 2ACZA 2UXNB 2ZMAA 1XMOT 4UF0A 1S35A 2X9YA 3F31A 4U7IA 1HFAA 3OBVE 3U3IA 5CFBA 5JREA 3PUAA 2FJAA 3AA1B 5JR9A 4CQIA 5L4EA 2XQ5A 2R6GF 3R6NA 1CUNA 3UUBA 2I0MA 2QVAA 2NR4A 4IDQA 4ILUA 3GA8A 5DABA 3TLWA 2E5LT 4YHHT 3UT5E 4GYRA 4KBMB 2MYSA 1KNZA 3V5SA 4ASKA 4ILCA 1Y01A 4E7SA 5CB4E 2NW8A 5HWYA 1SUMB 4U72A 5KX5E 1XNQT 2LLYA 3ZT7A 3ZJ2A 4ZEYA 2D9DA 5AQNB 3C50A 4QX8B 3KVBA 3LK2B 2BKPA 4H63H 5JDLA 1DU2A 3OYZA 5HAXA 4ISTA 1MIWA 3FXDB 4HWIB 4PW8A 1N34T 3TLTA 4LF5T 2W67A 1KNPA 4A98A 4G63A 2E2AA 4JYAT 2M6BA 3RYCE 3AECA 1XDOA 4TX5A 2NW9A 2A9UA 4JV5T 1HX8A 3QOFA 2V6YA 4O2AE 2WZHA 5CA1E 1UURA 4PJNA 3CQXC 3ZMTB 4PFOA 3CPZA 4QKNA 1MMAA 3UUXB 4YTPA 5ABFA 4PAGA 3AA0B 2C5IT 3AE3A 2CE7A 5FP3A 5AQQB 1HF8A 2CEAA 2J4GA 4JLEA 2XY8B 3OKQA 4U2YA 4F8HA 1OWAA 5FXZA 2LT3A 4OFZA 2YDSA 3WAJA 2VL0A 1WR6A 4LMKA 4YSYA 5KXJA 4K0KT 2HPJA 2XQAA 3JC6C 1MMNA 3SRZA 3KV5A 4QH4A 1LRZA 1H7CA 2A72A 2VKOA 3C98B 2LRKA 3JAFA 3E0ZA 4QXCB 3RC3A 2BZBA 3RRCA 3W15B 1HG2A 5L2LA 5L3FB 3HA4A 3PUYF 3C64A 2FJBA 3PDYA 2C5JA 5FXWA 4TWFA 4ZS2A 5ABGA 4MHCA 4ZI2C 2NP9A 1MMDA 4PK6A 5C2TA 4DV6T 2V7MA 5JH7E 2J47A 4DMWA 2CPTA 3T1YT 3AE8A 3PE0A 4AQFA 3AE2A 3ZCIA 4X64T 3ZMSB 3B57A 3PUZF 4UIGA 3F57A 2PBIA 3TKLB 2CXFA 4IDZA 4O4IE 2UUAT 5HXSA 2Y48B 3NRYA 3P4QA 5BR8T 4P09A 2HHHT 3P8CD 5L4HA 3TLUA 3L09A 5ETWA 1W9RA 3ZJ1A 5LJMA 2E5VA 4J2CA 4MALA 3AEAA 4PJLA 1YW0A 1WFDA 1ZP0A 4UEMA 4X20E 3BQIA 4TZ4C 4JEHB 1LKXA 3PURA 4YJ2E 3O9XA 4DR5T 2E9XB 2UXXB 4WZXA 5ABFB 5CGMA 4AQGA 2VKJA 1T98A 3BK9A 1E7PA 2LKGA 2QGSA 3P4PA 2PG8A 3HI2A 3AXJB 2XAJB 3NKZA 1E1HB 3KV6A 4PK5A 3J7Yq 2JRKA 2WY2A 2ZM8A 4HFDA 2QA7A 2E8IA 3CIRA 4AKGA 3M3ZB 2CBJA 2WM9A 3M65A 4JI6T 3AE6A 1UX4A 3EVYA 2JQQA 5AFUL 3KDSE 2G0UA 3PV0F 4HE8A 4HWDA 2BS2A 3N2GE 5AQKB 1KFYA 2HH7A 2VASA 1OEDA 1JNZA 2BBHA 4OYJA 5AQMB 3AXJA 4G2AA 1M7KA 2WQYA 3PU8A 4WYVA 1XZYA 2XAHB 4ZOLE 2K9AA 4M1PA 4IL4A 3CMLA 3OTOT 4Z8XA 2V6XA 1O3XA 4YY3T 1UK5A 3K3QC 4IDPA 4ZI3D 2W4XA 4ILAA 2WU5A 4LF4T 2FJEA 2D2SA 5HEJA 2CCQA 4AKHA 5M4YA 3ZC0A 1FEWA 1HX1B 2H89A 3E08A 2M67A 2NW7A 4L5GA 4P1NA 5LYJE 1HR0T 5FY1A 4YFSA 3UUMA 4DR4T 2KINB 1IBLT 4IGUA 2LOPA 2ZM2A 3CX8B 4QXHB 4HGAA 4UELA 4DNDA 3WAKA 1U4QA 1UX5A 1OEDE 3RH3A 3ZPOA 4DV0T 2KLQA 3RC8A 2BG9B 3AA6B 2RP4A 3QNUA 4QWNB 3C4WA 4A56A 4ADZA 4DVDA 3Q2MA 4HWCA 4YLHA 2E9XC 1VCTA 4L0RA 4P0BA 5EK4A 1HS7A 3ZYMA 5BMVE 3ESLA 3PU3A 4H9PC 3UU6A 1WYBA 4KHPT 1Y64B 3N2KE 4DV7T 2YDQA 4U31A 3EI0A 3AE9A
chains in the Genus database with same CATH topology
2XY8B 1SE7A 2AE9A 1DU2A 2IDOB 2AXDS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XY8 B;  1SE7 A;  2AE9 A;  1DU2 A;  2IDO B;  2AXD S; 
#chains in the Genus database with same CATH topology
 4I4T E;  3ZC1 A;  4CXY A;  2AE9 A;  4I0U A;  1MMG A;  2JPF A;  3UU3 A;  3P4R A;  2KSR A;  5H6Q B;  5HXE A;  1IZN B;  3OYX A;  2WAU A;  4ZS3 A;  1HG5 A;  2X51 A;  2P9B A;  2ACX A;  5FL0 A;  3ZMU B;  3I0Q A;  4ZZC A;  2WMN A;  3SFD A;  5CA0 E;  2SPC A;  3UQ4 A;  3ZYK A;  5HXH A;  5JQG E;  5AQT B;  3K3O A;  2PFV A;  2JQ9 A;  2WP9 A;  2OLT A;  2YU1 A;  5EZY E;  3KV9 A;  4HFB A;  3NBX X;  4PJJ A;  3RKG A;  2CHO A;  3KIN B;  3ZT5 A;  3FBZ A;  1SE7 A;  4LFA T;  2N9D A;  2BG9 A;  2XQ8 A;  2B76 A;  4JI3 T;  3ZEF B;  4YHJ A;  3I1A A;  2JQK A;  3RX6 A;  4CN4 A;  3FXE B;  2BBJ A;  4X65 T;  1SHZ C;  1T7S A;  1YQ3 A;  4HFV A;  4ZZB A;  1ZOY A;  5FVL A;  4EXT A;  5C3J A;  1D0Y A;  4CN1 A;  2CXL A;  2NWB A;  2XAG B;  4IHJ E;  3QB5 K;  4EOZ B;  4GOU A;  1D0X A;  2YU2 A;  3ZN0 B;  4CI1 B;  1SA0 E;  4U33 A;  2XM2 A;  4UV8 B;  4NIQ A;  1HTJ F;  2V7I A;  3CQG B;  1BR1 A;  3JC6 D;  5E0O A;  5HEU A;  3UU8 A;  3ZKR A;  2FJD A;  2WCA A;  4EB6 E;  5FL1 A;  2EHO A;  2KT9 A;  3H3A A;  4KP3 C;  2IML A;  2V7K A;  2PTF A;  3CX6 B;  5HEO A;  4AQF C;  4U2Z A;  4JI2 T;  2MTQ A;  1NWM X;  2BDE A;  2W62 A;  3EAM A;  3QC9 A;  3RPU A;  5LA6 E;  3SWH A;  3LDQ B;  5HXR A;  3ANW B;  2Q9Q A;  1T8B A;  4TV9 E;  3RQW A;  4HTE A;  3RRW A;  2YKS A;  2K5B B;  4BAY B;  2UUC T;  4LF9 T;  2H7V C;  4X5T A;  4TN7 B;  2KZ7 B;  2V26 A;  3DJB A;  3KV4 A;  4QHO A;  4TUY E;  3TLS A;  2VQF T;  1US7 B;  2W0G A;  1OED B;  2ZLY A;  3I9W A;  2W63 A;  4GK5 E;  4DMV A;  5FNV E;  1R8I A;  2BG9 C;  4Z91 A;  4KI0 F;  4HEA A;  3AAE B;  3OVU A;  3N2O A;  1BR4 A;  2Q9Q B;  4X66 T;  1IAP A;  4LMJ A;  2XAF B;  2IAK A;  2DNX A;  3UU5 A;  4NXN T;  2UXB T;  3A7M A;  3I9Y A;  2BVM A;  3ETV A;  2EHO B;  4HKA A;  3ABV A;  5L3D B;  3MAC A;  3K1S A;  4GKJ T;  4EZH A;  3MXZ A;  4OYK A;  5HWX A;  3VHL A;  1XMQ T;  5KMG P;  2D0U A;  4O4J E;  1FIO A;  5IWA T;  2I59 A;  2XTL A;  1E2A A;  2HN2 A;  5LBM A;  4EED A;  2L3L A;  1KF6 A;  2JJ9 A;  2IHR 1;  4DBQ A;  4YTM A;  3B13 A;  4DV1 T;  2XQ9 A;  1L0V A;  4JI4 T;  3LG7 A;  1MNE A;  4V1A v;  4AQY T;  3AE7 A;  1N33 T;  1KEY A;  4KX6 A;  2MPK A;  3V5U A;  5IUX A;  5IYZ E;  4AKL A;  3N9N A;  3P50 A;  3Q5D A;  4DR6 T;  4WNK A;  2L9Q A;  1QSD A;  3HKE E;  4X1K E;  5JVD E;  5AQI B;  3O1J A;  4CXW A;  4GK0 E;  4OHF A;  3LFM A;  4ERR A;  4UR9 A;  3G06 A;  2LSI A;  3PTR B;  4OK0 A;  4UVA B;  1MIV A;  2K3W A;  4UV9 B;  2XHE B;  5AQJ B;  3UFE A;  4Q25 A;  4EAH A;  3FZK B;  3ZLI A;  2KWH A;  4C90 A;  4TNW A;  3IHR A;  2Z6E A;  3C4Z A;  4H9S E;  3HL6 A;  3ONX A;  3K3N A;  4MLK A;  5FYM A;  3RF1 A;  3S4U A;  4CZZ B;  2LKH A;  4DV4 T;  4LF6 T;  4TV8 E;  2WWV A;  3IEE A;  3FZH B;  4MBQ A;  4O4H E;  3N5L A;  5DQV A;  5ABH A;  4H9R C;  1MND A;  4U74 A;  1XDP A;  2WDQ A;  3ZYL A;  3B5M A;  3GN5 A;  2BKO A;  2CHN A;  4QH5 A;  5AQP B;  4AIS A;  3UFG A;  3PJA A;  4CN6 A;  5JDN A;  2VQE T;  2H7O A;  3KBT A;  3LSV A;  3QK6 A;  2VL8 A;  4N78 D;  3P7I A;  4JI7 T;  3RYF E;  4EYY R;  5HYA A;  3I0O A;  3VU7 H;  1I94 T;  3FZM B;  3RIA A;  4IL9 A;  4AKR B;  3CKD A;  1LVF A;  1YKE B;  2XQ6 A;  3EHZ A;  2H88 A;  5EK3 A;  5GON E;  4LF8 T;  5LMU T;  2IC6 A;  2LEH A;  2MAW A;  2V8S V;  5KDM C;  4IT4 A;  5CJ5 A;  4EYU A;  1XNR T;  5LMN T;  4LML A;  2GK9 A;  3NZQ A;  5JDM A;  1IBM T;  2IUB A;  2KMF A;  3RIU C;  3LJC A;  2LSY A;  2J1D G;  2LM9 A;  1BR2 A;  2Y8D A;  4AIU A;  5IHY A;  4YTN A;  5LGT B;  2KND A;  4UVC B;  4KMC A;  3ONJ A;  3DTO A;  5LB7 B;  4CI3 B;  2NTX A;  3ANW A;  3VRA A;  3SS1 A;  3RQU A;  3ZMZ B;  2LSJ A;  3O1I A;  4B6X A;  1G8X A;  4QX7 B;  4ZHQ E;  2BS4 A;  1D1A A;  2FBW A;  5ADX L;  2I6H A;  2X9W A;  2RPA A;  3Q5W A;  3J9X 1;  5AQV B;  3T8O A;  1X9B A;  4DR3 T;  2CA5 A;  1FMV A;  1B7T A;  5HCM A;  3AA7 B;  3C4X A;  3SFE A;  3P4W A;  4DBR A;  3R84 B;  4AXP A;  5AQU B;  1CHU A;  2XM1 A;  2IW5 B;  2WS3 A;  3VRB A;  4JI0 T;  3ZSS A;  2N2N A;  1J5E T;  5LGN B;  2IIU A;  4HN9 A;  1UGO A;  5JRC A;  3AE1 A;  5AQF B;  5L3E B;  4AI6 A;  2XQY A;  1NEN A;  2JQH A;  2IDO B;  5HEG A;  2X68 A;  4OX9 T;  4MFR A;  5ABE A;  3P4S A;  1GQE A;  5TAO A;  5LHG B;  2Y6X A;  3EDV A;  5AQG B;  4E7Z A;  3RIF A;  3QUJ A;  3SOL A;  1YD8 G;  4GYS A;  4JI5 T;  3HKC E;  4JBW F;  5AQH B;  3TLV A;  3KVA A;  2EHO D;  3PUS A;  3RIU A;  3AE5 A;  3FZF B;  5JTG A;  4B3R T;  5J1G A;  3L39 A;  2WDR A;  3UUN A;  1HNZ T;  4ILB A;  3A5X A;  2X0Y A;  1G73 A;  4I43 B;  2MOZ A;  1MIY A;  2CLY C;  3DP7 A;  3RLF F;  3IA3 A;  3GMI A;  4JI8 T;  4H9Q C;  2V5C A;  4FI5 A;  4O2B E;  2WDV A;  3U78 A;  2NOX A;  2YIN A;  3MZK B;  4B3M T;  2XZE A;  2WSS V;  3FHN A;  5FXV A;  2D0T A;  5A1L A;  4H9O C;  2K24 A;  4BA9 A;  3MK7 C;  5AQL B;  5JDQ A;  1IBK T;  2VUR A;  2CBI A;  3VKG A;  3N9M A;  3NVO A;  3FZL B;  3EDU A;  2OV9 A;  5F3J A;  5L3C B;  4NXM T;  5LXT E;  1D1B A;  4GIW A;  4XBF B;  5LHH B;  4NUV A;  4UXN B;  3UUL A;  3ZST A;  4WBN E;  5L3B B;  3ZMV B;  1OXZ A;  3AAI A;  2FUP A;  2B1E A;  3AEE A;  3HR0 A;  2C0S A;  4HFI A;  3HKD E;  4KUM B;  4QH1 A;  2MBG A;  4EEB A;  3UQ7 A;  3UU4 A;  1BR0 A;  4AKI A;  3RGL A;  1UUS A;  3L8R A;  3IF8 B;  4EV6 A;  3GN5 B;  3ZN1 B;  1I6Z A;  4WBO A;  2X0L B;  1IJ5 A;  1JNR A;  5J2U E;  2CXD A;  4PJM A;  2UXD T;  2CRB A;  2WBL A;  2WU2 A;  4UF0 B;  2KXP B;  2VVS A;  2E9X D;  2JIW A;  2M6I A;  3VR9 A;  4BJM A;  3CX7 B;  4IDO A;  1WR0 A;  2A2F X;  4TWH A;  3K8P C;  4IE0 A;  3Q5X A;  5J0Z A;  2AXD S;  3A8Y C;  3CVR A;  4O8S A;  2ES0 A;  4YT0 A;  3NRX A;  1VOM A;  3N9O A;  1T72 A;  1V9D A;  2IC9 A;  5LJN A;  3LK4 2;  3PJA J;  1W09 A;  2XSB A;  5DQW A;  4DR7 T;  1HCI A;  1ZV4 X;  2YDR A;  2DWK A;  4X1I E;  1N32 T;  4XAX B;  1OED C;  4IE4 A;  4NPP A;  1D0Z A;  4YSZ A;  3F2E A;  4CXX A;  1U5P A;  4FJO A;  5F8P A;  4YXD A;  5L47 A;  2W61 A;  1WYC A;  2YOE A;  2XAS B;  1AJ3 A;  2YN6 A;  1FMW A;  2Q9Q C;  5FKY A;  2X9H A;  5FY0 A;  3RI5 A;  2Q9Q D;  4HFE A;  4HFC A;  4WW0 A;  3QB5 A;  5JR9 C;  1ZHC A;  5LBQ B;  4DO0 A;  3C51 A;  5FY7 A;  1WLX A;  3H3M A;  1J1J A;  4X62 T;  5F5W A;  4IIJ E;  4LF7 T;  2C5K T;  5DJQ C;  5LNK A;  2D5U A;  2ODV A;  2JMH A;  2HN1 A;  1D1C A;  3PUW F;  5JRC B;  4O4L E;  3T1H T;  1J5W A;  5LHI B;  3EUH A;  4LFB T;  5AQR B;  2H3R A;  4DUY T;  1YQ4 A;  3KBU A;  2CM0 A;  4ANJ A;  2XUE A;  2ZM6 T;  4DV5 T;  4P0A A;  3E22 E;  1Z0P A;  4JEU B;  1W0A A;  2XQ3 A;  4DR2 T;  2W2U A;  4H9N C;  5LP6 E;  3VKH A;  3N9Q A;  4CI2 B;  3O1H A;  2VWA A;  3CK6 A;  1QUU A;  4QXB B;  3X1D A;  4YSX A;  2WB5 A;  4COF A;  2BG9 E;  4IDN A;  3AE4 A;  4X1Y E;  5AQS B;  3ZCJ A;  2WZI A;  1YKH B;  2DWG A;  2V5D A;  1KK7 A;  1VCS A;  3AB3 B;  1ZKE A;  3AED A;  2VKD A;  3MA9 A;  4I55 E;  4EZ4 A;  4GKK T;  3ETU A;  3L3P A;  5LG4 A;  2KWI B;  5LG3 A;  5EK2 A;  1HNW T;  2LRL A;  4H63 V;  3NZP A;  5LCY A;  2L8K A;  3JCF A;  2F4V T;  2HPL A;  1EZ3 A;  3FBL A;  1NAF A;  2XPK A;  1Z8U A;  3N9P A;  4ZXL A;  4C91 A;  2XQ7 A;  1YXR A;  5FMN A;  2X66 A;  2LHN A;  2XAQ B;  4IRE A;  2YEV C;  2A3D A;  2CWO A;  2ZM0 A;  1X79 A;  2WWU A;  3KFW X;  4EIW A;  5LOV E;  5HXC A;  5LGU B;  4DV3 T;  4L9I A;  1W0B A;  3PUQ A;  5JDF A;  4DID B;  1S94 A;  1XWM A;  4XZC A;  2V6Y B;  1WRD A;  4DUZ T;  2K48 A;  2DI4 A;  2ODU A;  2X67 A;  4KHZ F;  2YK0 A;  4NUU A;  5AQO B;  5J2T E;  3PUX F;  5FXX A;  4A5X A;  1VRB A;  3AEB A;  3CWZ B;  2E9X A;  4K0U A;  5JDG A;  4DR1 T;  2OA5 A;  2BKN A;  2XJ7 A;  4ZI7 E;  2UU9 T;  4F6R C;  3FB2 A;  3JAD A;  3RKO A;  1N36 T;  2X0H A;  2N1G A;  3LBX A;  3MKD A;  2VK9 A;  3AVR A;  2EHO C;  2XSA A;  4TWD A;  1QLB A;  2DLR A;  4PNI A;  3AEF A;  4ZI2 D;  2V1D B;  2WMO A;  5JDH A;  2UUB T;  2CLY B;  3CQC B;  5HCJ A;  4PK4 A;  2W00 A;  3RYH E;  2LSK A;  4LFC T;  4HWH A;  2LM2 A;  2W66 A;  2DCF A;  4ZI3 C;  2XQ4 A;  1WCR A;  2NTY A;  4B3S T;  3AAA B;  5C8Y E;  1ZEE A;  3UTK A;  2QYW A;  2LOS A;  2V7J A;  3N9L A;  3O4X E;  2V7L A;  1FJG T;  4HFH A;  2VB6 A;  3RHW A;  3VR8 A;  2PJQ A;  3BQL A;  1LVK A;  3H37 A;  4JUY A;  2LJL A;  3OPC A;  5JR9 B;  3BQK A;  1NEK A;  4B3T T;  4ISS A;  1UCU A;  2BS3 A;  1IJ6 A;  2BVL A;  3HKB E;  3IBP A;  4JI1 T;  1KNR A;  4U3C A;  2LE8 A;  3JAE A;  3ONL C;  3Q5E A;  3PUV F;  3EAB A;  2JMK A;  3LBX B;  4IE7 A;  4IE6 A;  4YJ3 E;  2VKH A;  5H6R B;  5HEH A;  2X9X A;  4A97 A;  3NWI A;  4DV2 T;  2UXC T;  2DL1 A;  1M62 A;  4IE5 A;  4U7Y A;  2LHR A;  4TNV A;  3RYI E;  3MJX A;  3AVS A;  3AEG A;  2CWY A;  2LSG A;  2RA1 A;  3ZT6 A;  4UVB B;  2CMR A;  5FVK A;  2DHR A;  3D0T A;  4PFP A;  3WI3 A;  4HWF A;  1HNX T;  4Z90 A;  3Q9D A;  2VVN A;  4BJN A;  2QRX A;  3GWH A;  3LK3 B;  4EGW A;  5L3G B;  4I50 E;  3OJA A;  3PUG A;  2J62 A;  2ACZ A;  2UXN B;  2ZMA A;  1XMO T;  4UF0 A;  1S35 A;  2X9Y A;  3F31 A;  4U7I A;  1HFA A;  3OBV E;  3U3I A;  5CFB A;  5JRE A;  3PUA A;  2FJA A;  3AA1 B;  5JR9 A;  4CQI A;  5L4E A;  2XQ5 A;  2R6G F;  3R6N A;  1CUN A;  3UUB A;  2I0M A;  2QVA A;  2NR4 A;  4IDQ A;  4ILU A;  3GA8 A;  5DAB A;  3TLW A;  2E5L T;  4YHH T;  3UT5 E;  4GYR A;  4KBM B;  2MYS A;  1KNZ A;  3V5S A;  4ASK A;  4ILC A;  1Y01 A;  4E7S A;  5CB4 E;  2NW8 A;  5HWY A;  1SUM B;  4U72 A;  5KX5 E;  1XNQ T;  2LLY A;  3ZT7 A;  3ZJ2 A;  4ZEY A;  2D9D A;  5AQN B;  3C50 A;  4QX8 B;  3KVB A;  3LK2 B;  2BKP A;  4H63 H;  5JDL A;  1DU2 A;  3OYZ A;  5HAX A;  4IST A;  1MIW A;  3FXD B;  4HWI B;  4PW8 A;  1N34 T;  3TLT A;  4LF5 T;  2W67 A;  1KNP A;  4A98 A;  4G63 A;  2E2A A;  4JYA T;  2M6B A;  3RYC E;  3AEC A;  1XDO A;  4TX5 A;  2NW9 A;  2A9U A;  4JV5 T;  1HX8 A;  3QOF A;  2V6Y A;  4O2A E;  2WZH A;  5CA1 E;  1UUR A;  4PJN A;  3CQX C;  3ZMT B;  4PFO A;  3CPZ A;  4QKN A;  1MMA A;  3UUX B;  4YTP A;  5ABF A;  4PAG A;  3AA0 B;  2C5I T;  3AE3 A;  2CE7 A;  5FP3 A;  5AQQ B;  1HF8 A;  2CEA A;  2J4G A;  4JLE A;  2XY8 B;  3OKQ A;  4U2Y A;  4F8H A;  1OWA A;  5FXZ A;  2LT3 A;  4OFZ A;  2YDS A;  3WAJ A;  2VL0 A;  1WR6 A;  4LMK A;  4YSY A;  5KXJ A;  4K0K T;  2HPJ A;  2XQA A;  3JC6 C;  1MMN A;  3SRZ A;  3KV5 A;  4QH4 A;  1LRZ A;  1H7C A;  2A72 A;  2VKO A;  3C98 B;  2LRK A;  3JAF A;  3E0Z A;  4QXC B;  3RC3 A;  2BZB A;  3RRC A;  3W15 B;  1HG2 A;  5L2L A;  5L3F B;  3HA4 A;  3PUY F;  3C64 A;  2FJB A;  3PDY A;  2C5J A;  5FXW A;  4TWF A;  4ZS2 A;  5ABG A;  4MHC A;  4ZI2 C;  2NP9 A;  1MMD A;  4PK6 A;  5C2T A;  4DV6 T;  2V7M A;  5JH7 E;  2J47 A;  4DMW A;  2CPT A;  3T1Y T;  3AE8 A;  3PE0 A;  4AQF A;  3AE2 A;  3ZCI A;  4X64 T;  3ZMS B;  3B57 A;  3PUZ F;  4UIG A;  3F57 A;  2PBI A;  3TKL B;  2CXF A;  4IDZ A;  4O4I E;  2UUA T;  5HXS A;  2Y48 B;  3NRY A;  3P4Q A;  5BR8 T;  4P09 A;  2HHH T;  3P8C D;  5L4H A;  3TLU A;  3L09 A;  5ETW A;  1W9R A;  3ZJ1 A;  5LJM A;  2E5V A;  4J2C A;  4MAL A;  3AEA A;  4PJL A;  1YW0 A;  1WFD A;  1ZP0 A;  4UEM A;  4X20 E;  3BQI A;  4TZ4 C;  4JEH B;  1LKX A;  3PUR A;  4YJ2 E;  3O9X A;  4DR5 T;  2E9X B;  2UXX B;  4WZX A;  5ABF B;  5CGM A;  4AQG A;  2VKJ A;  1T98 A;  3BK9 A;  1E7P A;  2LKG A;  2QGS A;  3P4P A;  2PG8 A;  3HI2 A;  3AXJ B;  2XAJ B;  3NKZ A;  1E1H B;  3KV6 A;  4PK5 A;  3J7Y q;  2JRK A;  2WY2 A;  2ZM8 A;  4HFD A;  2QA7 A;  2E8I A;  3CIR A;  4AKG A;  3M3Z B;  2CBJ A;  2WM9 A;  3M65 A;  4JI6 T;  3AE6 A;  1UX4 A;  3EVY A;  2JQQ A;  5AFU L;  3KDS E;  2G0U A;  3PV0 F;  4HE8 A;  4HWD A;  2BS2 A;  3N2G E;  5AQK B;  1KFY A;  2HH7 A;  2VAS A;  1OED A;  1JNZ A;  2BBH A;  4OYJ A;  5AQM B;  3AXJ A;  4G2A A;  1M7K A;  2WQY A;  3PU8 A;  4WYV A;  1XZY A;  2XAH B;  4ZOL E;  2K9A A;  4M1P A;  4IL4 A;  3CML A;  3OTO T;  4Z8X A;  2V6X A;  1O3X A;  4YY3 T;  1UK5 A;  3K3Q C;  4IDP A;  4ZI3 D;  2W4X A;  4ILA A;  2WU5 A;  4LF4 T;  2FJE A;  2D2S A;  5HEJ A;  2CCQ A;  4AKH A;  5M4Y A;  3ZC0 A;  1FEW A;  1HX1 B;  2H89 A;  3E08 A;  2M67 A;  2NW7 A;  4L5G A;  4P1N A;  5LYJ E;  1HR0 T;  5FY1 A;  4YFS A;  3UUM A;  4DR4 T;  2KIN B;  1IBL T;  4IGU A;  2LOP A;  2ZM2 A;  3CX8 B;  4QXH B;  4HGA A;  4UEL A;  4DND A;  3WAK A;  1U4Q A;  1UX5 A;  1OED E;  3RH3 A;  3ZPO A;  4DV0 T;  2KLQ A;  3RC8 A;  2BG9 B;  3AA6 B;  2RP4 A;  3QNU A;  4QWN B;  3C4W A;  4A56 A;  4ADZ A;  4DVD A;  3Q2M A;  4HWC A;  4YLH A;  2E9X C;  1VCT A;  4L0R A;  4P0B A;  5EK4 A;  1HS7 A;  3ZYM A;  5BMV E;  3ESL A;  3PU3 A;  4H9P C;  3UU6 A;  1WYB A;  4KHP T;  1Y64 B;  3N2K E;  4DV7 T;  2YDQ A;  4U31 A;  3EI0 A;  3AE9 A; 
#chains in the Genus database with same CATH homology
 2XY8 B;  1SE7 A;  2AE9 A;  1DU2 A;  2IDO B;  2AXD S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...