2AXDS

Solution structure of the theta subunit of escherichia coli dna polymerase iii in complex with the epsilon subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III, theta subunit
publication title Structure of the theta subunit of Escherichia coli DNA polymerase III in complex with the epsilon subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 22
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2axdS00
2AXDS 2AE9A 1SE7A 2IDOB 1DU2A 2XY8B
chains in the Genus database with same CATH superfamily
2LOPA 4HFHA 4DBRA 5LA6E 3Q2MA 5JREA 1X9BA 3ZMZB 3AE7A 2XQ7A 3K3NA 3RYCE 2W63A 1UX4A 1OEDA 1U5PA 4J2CA 2Q9QA 2MOZA 2A2FX 5LXTE 3AB3B 4CI2B 2BS3A 4NUUA 4X62T 3J7Yq 4TWFA 5LHIB 4CN6A 3EI0A 2BKNA 3O1HA 5FVLA 5FY7A 2IMLA 3ANWB 2WS3A 2C0SA 3I9YA 3RIUA 3ETVA 4EEDA 2KLQA 3ZT5A 5JDGA 3AEBA 2EHOC 3MACA 1IBKT 4IE7A 2J62A 5LCYA 2I59A 4AQFA 3NZPA 5L3FB 4A5XA 3ONJA 4ZI7E 4L5GA 2YEVC 4UR9A 4IDZA 2CMRA 5AQUB 1KNZA 5KX5E 1HX1B 1YQ4A 3FZLB 4JI7T 3ZYMA 3P4RA 4AQFC 3K3QC 3LSVA 3CIRA 3UFEA 5ABFB 4A97A 5AQLB 2PJQA 2LEHA 1S35A 3C4WA 3ZT6A 2VASA 2KNDA 2FUPA 2VQET 4TX5A 2VKDA 1D0YA 3O1IA 1V9DA 4BJNA 2W2UA 1BR0A 4CI1B 3ZC1A 4TV8E 2L9QA 4U3CA 5JTGA 4U7YA 4X1YE 5HXEA 5FY1A 2XQYA 3SWHA 2E5VA 2OLTA 2M6BA 1IBLT 4PK6A 4U7IA 5JRCA 3N2KE 5HAXA 4IT4A 1ZHCA 5H6QB 5CA0E 4ZI3C 2VQFT 2HPJA 3O1JA 1ZEEA 1WCRA 4DR4T 3AVRA 3O9XA 2V5DA 2DLRA 1S94A 3PUSA 2M6IA 3ONXA 2YDSA 1BR1A 3PJAJ 2H7VC 2W62A 5LYJE 5FVKA 2OV9A 2B76A 2BG9A 4Z91A 2VURA 4IL4A 1MMGA 3PUWF 3LK2B 4WW0A 2XAQB 4UEMA 2WCAA 2UUBT 3T8OA 5E0OA 3AVSA 1US7B 3S4UA 3Q5WA 4O2BE 3UU8A 3SFEA 5KDMC 3Q5XA 3UTKA 2KMFA 2V8SV 5FXVA 2JIWA 5LNKA 3HKEE 2XSAA 2BG9E 4H9NC 3UT5E 1FMVA 3KFWX 5AQQB 4QXBB 5CA1E 4NPPA 1KNRA 4PFPA 2ACZA 2J1DG 1D0ZA 1NEKA 4EB6E 4DUZT 2A72A 4LMKA 3BQLA 4JI8T 3WAJA 2XAGB 4L9IA 2XQ3A 2CEAA 3FBZA 3PJAA 2JRKA 4TZ4C 2D5UA 2QYWA 2PFVA 2CLYC 3CWZB 1MIVA 5C2TA 3CQXC 3JAEA 4IIJE 3JADA 1LKXA 5DJQC 2W61A 3UUBA 4AISA 4X64T 4EYUA 4OX9T 4Z8XA 4WBOA 4DV3T 5BMVE 3K3OA 4H63H 5L3CB 4U72A 4PK5A 2N1GA 1KNPA 4ILCA 3C50A 4CXWA 3AE8A 3OVUA 5JDHA 5J0ZA 4MALA 2NTYA 1WR0A 4MHCA 2YDQA 4ERRA 2IIUA 3NVOA 3QOFA 3AAIA 4K0UA 3IA3A 3NWIA 5LP6E 5DABA 2JMHA 3RX6A 4NIQA 2WDRA 5JVDE 3RKGA 3TLUA 3B5MA 4YSYA 4DR2T 4X1IE 4LFCT 4YJ2E 1HFAA 3OBVE 3UU5A 1MNDA 4JI4T 2F4VT 2WMOA 3UQ7A 3FXDB 1CHUA 4CN1A 5FXWA 4TNWA 1N32T 3ONLC 3T1YT 4YXDA 4F8HA 3QNUA 4AI6A 3H3AA 3FXEB 2NTXA 4ASKA 1Z0PA 1W0AA 4GK0E 2H89A 3AEDA 2L3LA 2LM9A 2JMKA 1XNQT 4QX8B 2K5BB 4H9PC 4E7ZA 2X66A 4GKJT 2E5LT 3AE4A 2W66A 2X51A 4YTNA 3HKDE 2DNXA 4CXXA 4GIWA 4Q25A 2XJ7A 4QKNA 5HEUA 2K9AA 4KUMB 2LT3A 3KV6A 2CBIA 1XMOT 4DV6T 3K8PC 5TAOA 2HHHT 3CQGB 4MFRA 2UXXB 3DJBA 2X0HA 3LK3B 2V7LA 1B7TA 2X0YA 3EDUA 4ZS2A 2X68A 3FBLA 2BG9B 5HCMA 5EZYE 3ZYKA 2B1EA 5AQIB 2YN6A 4HN9A 2Y6XA 4DBQA 4CZZB 4GK5E 2KZ7B 1HNWT 3HKCE 2V7JA 5C3JA 4BA9A 2WM9A 4GOUA 1YKEB 4ZOLE 1XZYA 1D1AA 3P4WA 4HWDA 4HWHA 1FEWA 3EHZA 3OYZA 3NBXX 4MBQA 5IHYA 1H7CA 5HXHA 1LRZA 1VCSA 5AQFB 1UCUA 3TLSA 5ETWA 1EZ3A 5LGNB 4BAYB 2CHNA 2DCFA 1HNZT 1MIWA 3Q9DA 4COFA 3UU6A 3ZCIA 3P4PA 4YSZA 2QA7A 1HNXT 1X79A 1BR2A 4CI3B 4DV0T 4PNIA 5JDFA 4IE0A 4HWCA 2VB6A 1FMWA 3FZKB 2XPKA 3AEGA 3DTOA 2BKPA 4M1PA 1UGOA 5CFBA 5FMNA 2C5JA 1L0VA 4IE4A 2UXNB 1T7SA 2V1DB 4DO0A 5BR8T 2WDQA 4NUVA 2E9XD 5A1LA 4LMJA 3PDYA 3O4XE 1XDPA 3G06A 1IZNB 3V5UA 3VRBA 4QX7B 1AJ3A 4EGWA 4CN4A 1IAPA 4NXMT 3PUXF 5JQGE 1HS7A 2JQ9A 1OEDC 3RHWA 4DIDB 2XAHB 2Q9QC 1HR0T 2NR4A 2WQYA 4ZI3D 4O4JE 3R6NA 5FXZA 4EOZB 3QC9A 3KVAA 2CRBA 3RIUC 3RC8A 2XHEB 3UFGA 3WAKA 2J47A 5L3BB 5GONE 4PFOA 2XASB 2M67A 1XDOA 1NAFA 3UU4A 1D1CA 3SFDA 1T8BA 1D0XA 4DR3T 1Y64B 4XZCA 4CXYA 1YXRA 4LF4T 4EZHA 1ZV4X 3VKGA 2MPKA 4GYSA 3UULA 4CQIA 5FKYA 2XSBA 4JI3T 1VCTA 2KWIB 2X9YA 5AQNB 4H9QC 4U2YA 2X9WA 3I0OA 2HN2A 2E9XA 3PU8A 3HA4A 3I0QA 5EK2A 1G8XA 2HPLA 2IDOB 4HEAA 1I6ZA 1MMAA 5FYMA 2UU9T 3ZEFB 4IL9A 4O4IE 4DV5T 2VKOA 1KEYA 1JNZA 3ZMTB 2WSSV 5M4YA 2R6GF 3KV5A 1XWMA 2K48A 4QHOA 4ZZCA 4ANJA 4DNDA 4EV6A 4KMCA 5HXRA 3VKHA 2LM2A 2J4GA 2FJAA 5F8PA 2BBJA 4UF0B 3P4QA 3LJCA 3ZMSB 2XAJB 3MZKB 3PU3A 4UXNB 1UK5A 4X5TA 2XQ6A 4YFSA 4JEUB 4O4HE 3LG7A 2DHRA 2CE7A 4X1KE 5JH7E 2A9UA 4P09A 2IC6A 3AXJA 2CCQA 2MYSA 2W00A 1NENA 2ZM8A 3CPZA 4PJNA 3C64A 3QUJA 4TWDA 2D0TA 2YINA 4PAGA 2KT9A 5IYZE 1IBMT 4JI0T 4HE8A 4BJMA 1HG2A 2C5KT 4NXNT 1IJ6A 2BG9C 5KXJA 4JEHB 4B3ST 3TLWA 2NW7A 4UV8B 1WFDA 2DWGA 1G73A 1WRDA 2LSIA 2CA5A 4ZXLA 4ILBA 2WZHA 2X9HA 1NWMX 5LBMA 3UQ4A 3AE2A 3BK9A 4A56A 5AQOB 3P7IA 5HCJA 4HTEA 2QGSA 3AECA 3FZFB 1BR4A 3ESLA 4LF8T 4I55E 4AKGA 1DU2A 5LG4A 1LVKA 3GWHA 4LFAT 5J2TE 3GMIA 2UXBT 2XAFB 3A7MA 2I0MA 3RI5A 3CKDA 3AEFA 3EAMA 4HFIA 2VVSA 3AAAB 5LGUB 2XQ4A 4IE5A 1R8IA 2XQ8A 2VKHA 3AE3A 3I9WA 4OK0A 4FJOA 4X20E 5LB7B 4KHPT 4DR6T 3PURA 5FY0A 3ZT7A 3JCFA 2OA5A 3ZMVB 5FXXA 2VKJA 4ZEYA 4XAXB 3ZC0A 3RRWA 2LOSA 3RYHE 4WYVA 1ZP0A 3ZMUB 1W0BA 2WMNA 4LF7T 5AQGB 4DMWA 3RIFA 3UU3A 2L8KA 2CBJA 3UUMA 1MNEA 3VU7H 4I4TE 4LFBT 1YD8G 3FHNA 3VHLA 2LRLA 4U2ZA 4TNVA 3ZKRA 5ADXL 4IDNA 5HEGA 4QXCB 2WP9A 4HGAA 3J9X1 2IAKA 3OPCA 4QH5A 5F3JA 2KINB 2YK0A 4I0UA 4HKAA 4OYKA 2C5IT 1WYCA 1IJ5A 2UUCT 4AKRB 2G0UA 4AXPA 2E9XB 2ZMAA 3KINB 4KHZF 4YTPA 3OKQA 3CK6A 4ZI2C 4DR1T 3MJXA 5CB4E 3UUNA 1T98A 2BS4A 3FB2A 4HFBA 3DP7A 3I1AA 2WWVA 5L3DB 5L4HA 2WAUA 4F6RC 5AQVB 2BBHA 2LSYA 3RGLA 3LFMA 4DVDA 3ZN1B 1J5WA 3FZHB 3BQKA 5HXSA 2LSJA 2H88A 3E08A 2XQ5A 4C91A 3JC6C 3N9OA 1JNRA 2ACXA 2YDRA 3JAFA 5AQPB 3AXJB 3SRZA 5LBQB 3C4XA 4JI1T 2VVNA 4EXTA 2KSRA 4YHHT 4UF0A 4WZXA 3RRCA 1M7KA 4PJLA 4MLKA 4TWHA 3KBTA 4HWFA 3PUGA 5HEJA 2WY2A 5ABGA 4QXHB 2JQKA 2LKGA 2CXDA 3CX8B 2XUEA 3UUXB 4G2AA 1UUSA 4TN7B 4LF6T 2LE8A 3IEEA 2V6XA 3ZSSA 4IDPA 5FP3A 3IBPA 3A8YC 2Q9QD 3AE6A 5AQMB 5LHGB 1SUMB 1FIOA 4EYYR 5AQSB 5JR9A 3ETUA 4Z90A 3FZMB 3VR9A 2EHOD 2ODUA 5AQJB 3P8CD 4I50E 2ZM2A 4ISTA 2PTFA 4JI2T 2JQQA 1J5ET 4DV2T 2GK9A 3QB5A 3MKDA 3ZJ2A 3CVRA 3RPUA 2DWKA 2AE9A 2CXLA 3ZJ1A 4I43B 2MTQA 1KK7A 3HL6A 2N9DA 5AQKB 2W0GA 2XZEA 4YHJA 2XTLA 4P0AA 4AQGA 1W9RA 3EDVA 3AEAA 1ZOYA 2X9XA 2WB5A 3MXZA 4JV5T 3MK7C 4YJ3E 4YY3T 3OTOT 1E1HB 3B57A 3RQWA 5JDNA 2X67A 3SS1A 1OXZA 3L8RA 5KMGP 2WBLA 1XMQT 4KBMB 2YOEA 2Y48B 1MIYA 5L2LA 2NW9A 3N9QA 1HX8A 2IC9A 5C8YE 4K0KT 3H3MA 2NOXA 4DUYT 2BVLA 3VR8A 5J2UE 2ODVA 4L0RA 3ZPOA 3N9NA 4DR5T 4PK4A 2EHOA 4UVAB 3WI3A 1WLXA 2HH7A 4YTMA 5IUXA 3N5LA 4AKHA 1YKHB 3TLTA 1OEDE 4KI0F 2LSKA 3PUQA 3U3IA 2A3DA 3AA1B 5HEOA 3RQUA 2QRXA 2N2NA 4OYJA 3M65A 2FJEA 2XQAA 2FJDA 2XY8B 1ZKEA 5HEHA 4PJMA 2LRKA 5L4EA 3RIAA 2LLYA 2V7KA 2CWYA 1I94T 1YQ3A 2CXFA 3QK6A 3LK42 1HG5A 3N2GE 4KP3C 4DMVA 5AFUL 2ZM6T 4C90A 3F57A 2KXPB 3NRXA 3TLVA 2BZBA 3LBXB 3BQIA 4TUYE 5F5WA 2V5CA 1SHZC 3RF1A 4JI6T 5IWAT 4JBWF 3PUVF 5FL0A 3K1SA 2E9XC 1CUNA 1UX5A 5DQWA 4B6XA 2FJBA 4IGUA 4V1Av 4IDQA 1U4QA 3ABVA 3LDQB 4JYAT 1W09A 3IF8B 5AQRB 2BDEA 5AQTB 4UVBB 2W4XA 3EUHA 1VOMA 1MMDA 3PUZF 3TKLB 1QUUA 3AA6B 4B3TT 2DI4A 2IHR1 3RC3A 3KVBA 2K3WA 3RKOA 3RLFF 4IREA 1HTJF 4U74A 3ZSTA 2JPFA 3M3ZB 5JDMA 2E8IA 2XQ9A 4H9OC 2XM2A 5EK4A 5LJNA 4H9RC 4DV1T 2H7OA 2K24A 3E0ZA 4B3MT 4ISSA 3HKBE 2V6YB 3AE5A 3IHRA 2CM0A 5JR9B 4P0BA 4ZS3A 3F2EA 2ZM0A 4A98A 3P50A 5L3GB 5L3EB 4JI5T 4DV4T 3E22E 1WR6A 1OWAA 4JUYA 2D2SA 3GN5A 3C51A 4EEBA 3ZYLA 4KX6A 2RA1A 5ABHA 4HFDA 5DQVA 4IE6A 3Q5EA 2I6HA 4PW8A 4HWIB 1KF6A 5LJMA 4ADZA 2D9DA 4YSXA 1Z8UA 4QH4A 2CPTA 2PBIA 3MA9A 3SOLA 2LHNA 2VWAA 4ZI2D 3GA8A 4H63V 2WDVA 4LF9T 1QSDA 2FBWA 2LHRA 5LG3A 3R84B 4X66T 4HFEA 4OFZA 1N34T 3U78A 2NW8A 4WBNE 4U31A 1VRBA 2IW5B 2V26A 2V7IA 1OEDB 1M62A 2Q9QB 4ILAA 3QB5K 1FJGT 3NRYA 4AIUA 1SE7A 4YLHA 2BKOA 2IUBA 4UELA 3OYXA 2EHOB 3OJAA 3NKZA 3RYIE 3JC6D 3L39A 3Q5DA 2BS2A 1Y01A 3B13A 4E7SA 1N36T 2XM1A 3H37A 5L47A 2Z6EA 1YW0A 2P9BA 2UUAT 4FI5A 2MAWA 3PUAA 5ABEA 1LVFA 4UVCB 4WNKA 1T72A 4LMLA 3AE9A 1SA0E 3ANWA 4P1NA 1J1JA 2VL0A 4HFVA 3N9LA 4O8SA 5CJ5A 2NP9A 2Y8DA 3W15B 2HN1A 2UXDT 2W67A 1O3XA 3CX6B 4UV9B 4G63A 4ZHQE 4OHFA 2CWOA 4PJJA 2YKSA 1WYBA 3PE0A 5EK3A 3AEEA 2QVAA 2VL8A 2ZLYA 3RYFE 5ABFA 2LKHA 3LBXA 2MBGA 3CMLA 2LSGA 3HR0A 4H9SE 2E2AA 4IDOA 2ES0A 2WZIA 3C4ZA 5JRCB 3KV9A 1HF8A 2KWHA 5JDLA 4QH1A 4O4LE 4AQYT 2UXCT 3N9PA 4N78D 3X1DA 3KBUA 4TV9E 3KDSE 5HXCA 4ZZBA 5J1GA 3T1HT 3L09A 1MMNA 4EZ4A 3A5XA 5FNVE 3V5SA 2SPCA 3N2OA 3EVYA 4EAHA 5HWXA 4GKKT 3PV0F 3N9MA 4JLEA 5CGMA 5AQHB 3P4SA 3L3PA 5LMUT 1UURA 1HCIA 2WWUA 2AXDS 2JQHA 3CQCB 2VK9A 5HYAA 1D1BA 3RH3A 3GN5B 3KV4A 3F31A 3D0TA 5FL1A 4YT0A 4O2AE 2H3RA 2V6YA 2WU5A 2YU1A 3PUYF 1GQEA 2V7MA 2DL1A 2RPAA 4UIGA 1QLBA 1N33T 3VRAA 2RP4A 3NZQA 3AE1A 2PG8A 3C98B 5JDQA 2BVMA 5H6RB 3AA0B 5JR9C 4DR7T 3ZCJA 2CHOA 3ZN0B 4X65T 2JJ9A 3ZLIA 3CX7B 1KFYA 2LJLA 5LMNT 4AKIA 4DV7T 1E2AA 2CLYB 2D0UA 5LGTB 4QWNB 3PTRB 4IHJE 3EABA 4U33A 5LOVE 4B3RT 2X0LB 1XNRT 4LF5T 4ILUA 3HI2A 2YU2A 4XBFB 5LHHB 4EIWA 3AAEB 4AKLA 3AA7B 5HWYA 4HFCA 1E7PA 4GYRA 2NWBA 2WU2A
chains in the Genus database with same CATH topology
2AXDS 2AE9A 1SE7A 2IDOB 1DU2A 2XY8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXD S;  2AE9 A;  1SE7 A;  2IDO B;  1DU2 A;  2XY8 B; 
#chains in the Genus database with same CATH topology
 2LOP A;  4HFH A;  4DBR A;  5LA6 E;  3Q2M A;  5JRE A;  1X9B A;  3ZMZ B;  3AE7 A;  2XQ7 A;  3K3N A;  3RYC E;  2W63 A;  1UX4 A;  1OED A;  1U5P A;  4J2C A;  2Q9Q A;  2MOZ A;  2A2F X;  5LXT E;  3AB3 B;  4CI2 B;  2BS3 A;  4NUU A;  4X62 T;  3J7Y q;  4TWF A;  5LHI B;  4CN6 A;  3EI0 A;  2BKN A;  3O1H A;  5FVL A;  5FY7 A;  2IML A;  3ANW B;  2WS3 A;  2C0S A;  3I9Y A;  3RIU A;  3ETV A;  4EED A;  2KLQ A;  3ZT5 A;  5JDG A;  3AEB A;  2EHO C;  3MAC A;  1IBK T;  4IE7 A;  2J62 A;  5LCY A;  2I59 A;  4AQF A;  3NZP A;  5L3F B;  4A5X A;  3ONJ A;  4ZI7 E;  4L5G A;  2YEV C;  4UR9 A;  4IDZ A;  2CMR A;  5AQU B;  1KNZ A;  5KX5 E;  1HX1 B;  1YQ4 A;  3FZL B;  4JI7 T;  3ZYM A;  3P4R A;  4AQF C;  3K3Q C;  3LSV A;  3CIR A;  3UFE A;  5ABF B;  4A97 A;  5AQL B;  2PJQ A;  2LEH A;  1S35 A;  3C4W A;  3ZT6 A;  2VAS A;  2KND A;  2FUP A;  2VQE T;  4TX5 A;  2VKD A;  1D0Y A;  3O1I A;  1V9D A;  4BJN A;  2W2U A;  1BR0 A;  4CI1 B;  3ZC1 A;  4TV8 E;  2L9Q A;  4U3C A;  5JTG A;  4U7Y A;  4X1Y E;  5HXE A;  5FY1 A;  2XQY A;  3SWH A;  2E5V A;  2OLT A;  2M6B A;  1IBL T;  4PK6 A;  4U7I A;  5JRC A;  3N2K E;  5HAX A;  4IT4 A;  1ZHC A;  5H6Q B;  5CA0 E;  4ZI3 C;  2VQF T;  2HPJ A;  3O1J A;  1ZEE A;  1WCR A;  4DR4 T;  3AVR A;  3O9X A;  2V5D A;  2DLR A;  1S94 A;  3PUS A;  2M6I A;  3ONX A;  2YDS A;  1BR1 A;  3PJA J;  2H7V C;  2W62 A;  5LYJ E;  5FVK A;  2OV9 A;  2B76 A;  2BG9 A;  4Z91 A;  2VUR A;  4IL4 A;  1MMG A;  3PUW F;  3LK2 B;  4WW0 A;  2XAQ B;  4UEM A;  2WCA A;  2UUB T;  3T8O A;  5E0O A;  3AVS A;  1US7 B;  3S4U A;  3Q5W A;  4O2B E;  3UU8 A;  3SFE A;  5KDM C;  3Q5X A;  3UTK A;  2KMF A;  2V8S V;  5FXV A;  2JIW A;  5LNK A;  3HKE E;  2XSA A;  2BG9 E;  4H9N C;  3UT5 E;  1FMV A;  3KFW X;  5AQQ B;  4QXB B;  5CA1 E;  4NPP A;  1KNR A;  4PFP A;  2ACZ A;  2J1D G;  1D0Z A;  1NEK A;  4EB6 E;  4DUZ T;  2A72 A;  4LMK A;  3BQL A;  4JI8 T;  3WAJ A;  2XAG B;  4L9I A;  2XQ3 A;  2CEA A;  3FBZ A;  3PJA A;  2JRK A;  4TZ4 C;  2D5U A;  2QYW A;  2PFV A;  2CLY C;  3CWZ B;  1MIV A;  5C2T A;  3CQX C;  3JAE A;  4IIJ E;  3JAD A;  1LKX A;  5DJQ C;  2W61 A;  3UUB A;  4AIS A;  4X64 T;  4EYU A;  4OX9 T;  4Z8X A;  4WBO A;  4DV3 T;  5BMV E;  3K3O A;  4H63 H;  5L3C B;  4U72 A;  4PK5 A;  2N1G A;  1KNP A;  4ILC A;  3C50 A;  4CXW A;  3AE8 A;  3OVU A;  5JDH A;  5J0Z A;  4MAL A;  2NTY A;  1WR0 A;  4MHC A;  2YDQ A;  4ERR A;  2IIU A;  3NVO A;  3QOF A;  3AAI A;  4K0U A;  3IA3 A;  3NWI A;  5LP6 E;  5DAB A;  2JMH A;  3RX6 A;  4NIQ A;  2WDR A;  5JVD E;  3RKG A;  3TLU A;  3B5M A;  4YSY A;  4DR2 T;  4X1I E;  4LFC T;  4YJ2 E;  1HFA A;  3OBV E;  3UU5 A;  1MND A;  4JI4 T;  2F4V T;  2WMO A;  3UQ7 A;  3FXD B;  1CHU A;  4CN1 A;  5FXW A;  4TNW A;  1N32 T;  3ONL C;  3T1Y T;  4YXD A;  4F8H A;  3QNU A;  4AI6 A;  3H3A A;  3FXE B;  2NTX A;  4ASK A;  1Z0P A;  1W0A A;  4GK0 E;  2H89 A;  3AED A;  2L3L A;  2LM9 A;  2JMK A;  1XNQ T;  4QX8 B;  2K5B B;  4H9P C;  4E7Z A;  2X66 A;  4GKJ T;  2E5L T;  3AE4 A;  2W66 A;  2X51 A;  4YTN A;  3HKD E;  2DNX A;  4CXX A;  4GIW A;  4Q25 A;  2XJ7 A;  4QKN A;  5HEU A;  2K9A A;  4KUM B;  2LT3 A;  3KV6 A;  2CBI A;  1XMO T;  4DV6 T;  3K8P C;  5TAO A;  2HHH T;  3CQG B;  4MFR A;  2UXX B;  3DJB A;  2X0H A;  3LK3 B;  2V7L A;  1B7T A;  2X0Y A;  3EDU A;  4ZS2 A;  2X68 A;  3FBL A;  2BG9 B;  5HCM A;  5EZY E;  3ZYK A;  2B1E A;  5AQI B;  2YN6 A;  4HN9 A;  2Y6X A;  4DBQ A;  4CZZ B;  4GK5 E;  2KZ7 B;  1HNW T;  3HKC E;  2V7J A;  5C3J A;  4BA9 A;  2WM9 A;  4GOU A;  1YKE B;  4ZOL E;  1XZY A;  1D1A A;  3P4W A;  4HWD A;  4HWH A;  1FEW A;  3EHZ A;  3OYZ A;  3NBX X;  4MBQ A;  5IHY A;  1H7C A;  5HXH A;  1LRZ A;  1VCS A;  5AQF B;  1UCU A;  3TLS A;  5ETW A;  1EZ3 A;  5LGN B;  4BAY B;  2CHN A;  2DCF A;  1HNZ T;  1MIW A;  3Q9D A;  4COF A;  3UU6 A;  3ZCI A;  3P4P A;  4YSZ A;  2QA7 A;  1HNX T;  1X79 A;  1BR2 A;  4CI3 B;  4DV0 T;  4PNI A;  5JDF A;  4IE0 A;  4HWC A;  2VB6 A;  1FMW A;  3FZK B;  2XPK A;  3AEG A;  3DTO A;  2BKP A;  4M1P A;  1UGO A;  5CFB A;  5FMN A;  2C5J A;  1L0V A;  4IE4 A;  2UXN B;  1T7S A;  2V1D B;  4DO0 A;  5BR8 T;  2WDQ A;  4NUV A;  2E9X D;  5A1L A;  4LMJ A;  3PDY A;  3O4X E;  1XDP A;  3G06 A;  1IZN B;  3V5U A;  3VRB A;  4QX7 B;  1AJ3 A;  4EGW A;  4CN4 A;  1IAP A;  4NXM T;  3PUX F;  5JQG E;  1HS7 A;  2JQ9 A;  1OED C;  3RHW A;  4DID B;  2XAH B;  2Q9Q C;  1HR0 T;  2NR4 A;  2WQY A;  4ZI3 D;  4O4J E;  3R6N A;  5FXZ A;  4EOZ B;  3QC9 A;  3KVA A;  2CRB A;  3RIU C;  3RC8 A;  2XHE B;  3UFG A;  3WAK A;  2J47 A;  5L3B B;  5GON E;  4PFO A;  2XAS B;  2M67 A;  1XDO A;  1NAF A;  3UU4 A;  1D1C A;  3SFD A;  1T8B A;  1D0X A;  4DR3 T;  1Y64 B;  4XZC A;  4CXY A;  1YXR A;  4LF4 T;  4EZH A;  1ZV4 X;  3VKG A;  2MPK A;  4GYS A;  3UUL A;  4CQI A;  5FKY A;  2XSB A;  4JI3 T;  1VCT A;  2KWI B;  2X9Y A;  5AQN B;  4H9Q C;  4U2Y A;  2X9W A;  3I0O A;  2HN2 A;  2E9X A;  3PU8 A;  3HA4 A;  3I0Q A;  5EK2 A;  1G8X A;  2HPL A;  2IDO B;  4HEA A;  1I6Z A;  1MMA A;  5FYM A;  2UU9 T;  3ZEF B;  4IL9 A;  4O4I E;  4DV5 T;  2VKO A;  1KEY A;  1JNZ A;  3ZMT B;  2WSS V;  5M4Y A;  2R6G F;  3KV5 A;  1XWM A;  2K48 A;  4QHO A;  4ZZC A;  4ANJ A;  4DND A;  4EV6 A;  4KMC A;  5HXR A;  3VKH A;  2LM2 A;  2J4G A;  2FJA A;  5F8P A;  2BBJ A;  4UF0 B;  3P4Q A;  3LJC A;  3ZMS B;  2XAJ B;  3MZK B;  3PU3 A;  4UXN B;  1UK5 A;  4X5T A;  2XQ6 A;  4YFS A;  4JEU B;  4O4H E;  3LG7 A;  2DHR A;  2CE7 A;  4X1K E;  5JH7 E;  2A9U A;  4P09 A;  2IC6 A;  3AXJ A;  2CCQ A;  2MYS A;  2W00 A;  1NEN A;  2ZM8 A;  3CPZ A;  4PJN A;  3C64 A;  3QUJ A;  4TWD A;  2D0T A;  2YIN A;  4PAG A;  2KT9 A;  5IYZ E;  1IBM T;  4JI0 T;  4HE8 A;  4BJM A;  1HG2 A;  2C5K T;  4NXN T;  1IJ6 A;  2BG9 C;  5KXJ A;  4JEH B;  4B3S T;  3TLW A;  2NW7 A;  4UV8 B;  1WFD A;  2DWG A;  1G73 A;  1WRD A;  2LSI A;  2CA5 A;  4ZXL A;  4ILB A;  2WZH A;  2X9H A;  1NWM X;  5LBM A;  3UQ4 A;  3AE2 A;  3BK9 A;  4A56 A;  5AQO B;  3P7I A;  5HCJ A;  4HTE A;  2QGS A;  3AEC A;  3FZF B;  1BR4 A;  3ESL A;  4LF8 T;  4I55 E;  4AKG A;  1DU2 A;  5LG4 A;  1LVK A;  3GWH A;  4LFA T;  5J2T E;  3GMI A;  2UXB T;  2XAF B;  3A7M A;  2I0M A;  3RI5 A;  3CKD A;  3AEF A;  3EAM A;  4HFI A;  2VVS A;  3AAA B;  5LGU B;  2XQ4 A;  4IE5 A;  1R8I A;  2XQ8 A;  2VKH A;  3AE3 A;  3I9W A;  4OK0 A;  4FJO A;  4X20 E;  5LB7 B;  4KHP T;  4DR6 T;  3PUR A;  5FY0 A;  3ZT7 A;  3JCF A;  2OA5 A;  3ZMV B;  5FXX A;  2VKJ A;  4ZEY A;  4XAX B;  3ZC0 A;  3RRW A;  2LOS A;  3RYH E;  4WYV A;  1ZP0 A;  3ZMU B;  1W0B A;  2WMN A;  4LF7 T;  5AQG B;  4DMW A;  3RIF A;  3UU3 A;  2L8K A;  2CBJ A;  3UUM A;  1MNE A;  3VU7 H;  4I4T E;  4LFB T;  1YD8 G;  3FHN A;  3VHL A;  2LRL A;  4U2Z A;  4TNV A;  3ZKR A;  5ADX L;  4IDN A;  5HEG A;  4QXC B;  2WP9 A;  4HGA A;  3J9X 1;  2IAK A;  3OPC A;  4QH5 A;  5F3J A;  2KIN B;  2YK0 A;  4I0U A;  4HKA A;  4OYK A;  2C5I T;  1WYC A;  1IJ5 A;  2UUC T;  4AKR B;  2G0U A;  4AXP A;  2E9X B;  2ZMA A;  3KIN B;  4KHZ F;  4YTP A;  3OKQ A;  3CK6 A;  4ZI2 C;  4DR1 T;  3MJX A;  5CB4 E;  3UUN A;  1T98 A;  2BS4 A;  3FB2 A;  4HFB A;  3DP7 A;  3I1A A;  2WWV A;  5L3D B;  5L4H A;  2WAU A;  4F6R C;  5AQV B;  2BBH A;  2LSY A;  3RGL A;  3LFM A;  4DVD A;  3ZN1 B;  1J5W A;  3FZH B;  3BQK A;  5HXS A;  2LSJ A;  2H88 A;  3E08 A;  2XQ5 A;  4C91 A;  3JC6 C;  3N9O A;  1JNR A;  2ACX A;  2YDR A;  3JAF A;  5AQP B;  3AXJ B;  3SRZ A;  5LBQ B;  3C4X A;  4JI1 T;  2VVN A;  4EXT A;  2KSR A;  4YHH T;  4UF0 A;  4WZX A;  3RRC A;  1M7K A;  4PJL A;  4MLK A;  4TWH A;  3KBT A;  4HWF A;  3PUG A;  5HEJ A;  2WY2 A;  5ABG A;  4QXH B;  2JQK A;  2LKG A;  2CXD A;  3CX8 B;  2XUE A;  3UUX B;  4G2A A;  1UUS A;  4TN7 B;  4LF6 T;  2LE8 A;  3IEE A;  2V6X A;  3ZSS A;  4IDP A;  5FP3 A;  3IBP A;  3A8Y C;  2Q9Q D;  3AE6 A;  5AQM B;  5LHG B;  1SUM B;  1FIO A;  4EYY R;  5AQS B;  5JR9 A;  3ETU A;  4Z90 A;  3FZM B;  3VR9 A;  2EHO D;  2ODU A;  5AQJ B;  3P8C D;  4I50 E;  2ZM2 A;  4IST A;  2PTF A;  4JI2 T;  2JQQ A;  1J5E T;  4DV2 T;  2GK9 A;  3QB5 A;  3MKD A;  3ZJ2 A;  3CVR A;  3RPU A;  2DWK A;  2AE9 A;  2CXL A;  3ZJ1 A;  4I43 B;  2MTQ A;  1KK7 A;  3HL6 A;  2N9D A;  5AQK B;  2W0G A;  2XZE A;  4YHJ A;  2XTL A;  4P0A A;  4AQG A;  1W9R A;  3EDV A;  3AEA A;  1ZOY A;  2X9X A;  2WB5 A;  3MXZ A;  4JV5 T;  3MK7 C;  4YJ3 E;  4YY3 T;  3OTO T;  1E1H B;  3B57 A;  3RQW A;  5JDN A;  2X67 A;  3SS1 A;  1OXZ A;  3L8R A;  5KMG P;  2WBL A;  1XMQ T;  4KBM B;  2YOE A;  2Y48 B;  1MIY A;  5L2L A;  2NW9 A;  3N9Q A;  1HX8 A;  2IC9 A;  5C8Y E;  4K0K T;  3H3M A;  2NOX A;  4DUY T;  2BVL A;  3VR8 A;  5J2U E;  2ODV A;  4L0R A;  3ZPO A;  3N9N A;  4DR5 T;  4PK4 A;  2EHO A;  4UVA B;  3WI3 A;  1WLX A;  2HH7 A;  4YTM A;  5IUX A;  3N5L A;  4AKH A;  1YKH B;  3TLT A;  1OED E;  4KI0 F;  2LSK A;  3PUQ A;  3U3I A;  2A3D A;  3AA1 B;  5HEO A;  3RQU A;  2QRX A;  2N2N A;  4OYJ A;  3M65 A;  2FJE A;  2XQA A;  2FJD A;  2XY8 B;  1ZKE A;  5HEH A;  4PJM A;  2LRK A;  5L4E A;  3RIA A;  2LLY A;  2V7K A;  2CWY A;  1I94 T;  1YQ3 A;  2CXF A;  3QK6 A;  3LK4 2;  1HG5 A;  3N2G E;  4KP3 C;  4DMV A;  5AFU L;  2ZM6 T;  4C90 A;  3F57 A;  2KXP B;  3NRX A;  3TLV A;  2BZB A;  3LBX B;  3BQI A;  4TUY E;  5F5W A;  2V5C A;  1SHZ C;  3RF1 A;  4JI6 T;  5IWA T;  4JBW F;  3PUV F;  5FL0 A;  3K1S A;  2E9X C;  1CUN A;  1UX5 A;  5DQW A;  4B6X A;  2FJB A;  4IGU A;  4V1A v;  4IDQ A;  1U4Q A;  3ABV A;  3LDQ B;  4JYA T;  1W09 A;  3IF8 B;  5AQR B;  2BDE A;  5AQT B;  4UVB B;  2W4X A;  3EUH A;  1VOM A;  1MMD A;  3PUZ F;  3TKL B;  1QUU A;  3AA6 B;  4B3T T;  2DI4 A;  2IHR 1;  3RC3 A;  3KVB A;  2K3W A;  3RKO A;  3RLF F;  4IRE A;  1HTJ F;  4U74 A;  3ZST A;  2JPF A;  3M3Z B;  5JDM A;  2E8I A;  2XQ9 A;  4H9O C;  2XM2 A;  5EK4 A;  5LJN A;  4H9R C;  4DV1 T;  2H7O A;  2K24 A;  3E0Z A;  4B3M T;  4ISS A;  3HKB E;  2V6Y B;  3AE5 A;  3IHR A;  2CM0 A;  5JR9 B;  4P0B A;  4ZS3 A;  3F2E A;  2ZM0 A;  4A98 A;  3P50 A;  5L3G B;  5L3E B;  4JI5 T;  4DV4 T;  3E22 E;  1WR6 A;  1OWA A;  4JUY A;  2D2S A;  3GN5 A;  3C51 A;  4EEB A;  3ZYL A;  4KX6 A;  2RA1 A;  5ABH A;  4HFD A;  5DQV A;  4IE6 A;  3Q5E A;  2I6H A;  4PW8 A;  4HWI B;  1KF6 A;  5LJM A;  4ADZ A;  2D9D A;  4YSX A;  1Z8U A;  4QH4 A;  2CPT A;  2PBI A;  3MA9 A;  3SOL A;  2LHN A;  2VWA A;  4ZI2 D;  3GA8 A;  4H63 V;  2WDV A;  4LF9 T;  1QSD A;  2FBW A;  2LHR A;  5LG3 A;  3R84 B;  4X66 T;  4HFE A;  4OFZ A;  1N34 T;  3U78 A;  2NW8 A;  4WBN E;  4U31 A;  1VRB A;  2IW5 B;  2V26 A;  2V7I A;  1OED B;  1M62 A;  2Q9Q B;  4ILA A;  3QB5 K;  1FJG T;  3NRY A;  4AIU A;  1SE7 A;  4YLH A;  2BKO A;  2IUB A;  4UEL A;  3OYX A;  2EHO B;  3OJA A;  3NKZ A;  3RYI E;  3JC6 D;  3L39 A;  3Q5D A;  2BS2 A;  1Y01 A;  3B13 A;  4E7S A;  1N36 T;  2XM1 A;  3H37 A;  5L47 A;  2Z6E A;  1YW0 A;  2P9B A;  2UUA T;  4FI5 A;  2MAW A;  3PUA A;  5ABE A;  1LVF A;  4UVC B;  4WNK A;  1T72 A;  4LML A;  3AE9 A;  1SA0 E;  3ANW A;  4P1N A;  1J1J A;  2VL0 A;  4HFV A;  3N9L A;  4O8S A;  5CJ5 A;  2NP9 A;  2Y8D A;  3W15 B;  2HN1 A;  2UXD T;  2W67 A;  1O3X A;  3CX6 B;  4UV9 B;  4G63 A;  4ZHQ E;  4OHF A;  2CWO A;  4PJJ A;  2YKS A;  1WYB A;  3PE0 A;  5EK3 A;  3AEE A;  2QVA A;  2VL8 A;  2ZLY A;  3RYF E;  5ABF A;  2LKH A;  3LBX A;  2MBG A;  3CML A;  2LSG A;  3HR0 A;  4H9S E;  2E2A A;  4IDO A;  2ES0 A;  2WZI A;  3C4Z A;  5JRC B;  3KV9 A;  1HF8 A;  2KWH A;  5JDL A;  4QH1 A;  4O4L E;  4AQY T;  2UXC T;  3N9P A;  4N78 D;  3X1D A;  3KBU A;  4TV9 E;  3KDS E;  5HXC A;  4ZZB A;  5J1G A;  3T1H T;  3L09 A;  1MMN A;  4EZ4 A;  3A5X A;  5FNV E;  3V5S A;  2SPC A;  3N2O A;  3EVY A;  4EAH A;  5HWX A;  4GKK T;  3PV0 F;  3N9M A;  4JLE A;  5CGM A;  5AQH B;  3P4S A;  3L3P A;  5LMU T;  1UUR A;  1HCI A;  2WWU A;  2AXD S;  2JQH A;  3CQC B;  2VK9 A;  5HYA A;  1D1B A;  3RH3 A;  3GN5 B;  3KV4 A;  3F31 A;  3D0T A;  5FL1 A;  4YT0 A;  4O2A E;  2H3R A;  2V6Y A;  2WU5 A;  2YU1 A;  3PUY F;  1GQE A;  2V7M A;  2DL1 A;  2RPA A;  4UIG A;  1QLB A;  1N33 T;  3VRA A;  2RP4 A;  3NZQ A;  3AE1 A;  2PG8 A;  3C98 B;  5JDQ A;  2BVM A;  5H6R B;  3AA0 B;  5JR9 C;  4DR7 T;  3ZCJ A;  2CHO A;  3ZN0 B;  4X65 T;  2JJ9 A;  3ZLI A;  3CX7 B;  1KFY A;  2LJL A;  5LMN T;  4AKI A;  4DV7 T;  1E2A A;  2CLY B;  2D0U A;  5LGT B;  4QWN B;  3PTR B;  4IHJ E;  3EAB A;  4U33 A;  5LOV E;  4B3R T;  2X0L B;  1XNR T;  4LF5 T;  4ILU A;  3HI2 A;  2YU2 A;  4XBF B;  5LHH B;  4EIW A;  3AAE B;  4AKL A;  3AA7 B;  5HWY A;  4HFC A;  1E7P A;  4GYR A;  2NWB A;  2WU2 A; 
#chains in the Genus database with same CATH homology
 2AXD S;  2AE9 A;  1SE7 A;  2IDO B;  1DU2 A;  2XY8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...