2AXDS

Solution structure of the theta subunit of escherichia coli dna polymerase iii in complex with the epsilon subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase III, theta subunit
publication title Structure of the theta subunit of Escherichia coli DNA polymerase III in complex with the epsilon subunit
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2axdS00
2AXDS 2AE9A 1SE7A 2IDOB 1DU2A 2XY8B
chains in the Genus database with same CATH superfamily
3KINB 3ZLIA 4DR4T 4U33A 4YY3T 1W0BA 3RLFF 4OHFA 2JPFA 4DVDA 4H9NC 4DR3T 3ZMVB 2D0UA 3O1HA 4EIWA 4CXWA 2Y6XA 2BDEA 2XZEA 2V6YB 3ETUA 4HKAA 1D0XA 3V5SA 2CE7A 2C5JA 4X1YE 3O1JA 3HKBE 5F5WA 1G8XA 3TKLB 1OXZA 1IBKT 4HFBA 3CKDA 5LJNA 4QHOA 5LA6E 3P4SA 2JMHA 4DV5T 4TX5A 2IDOB 3M3ZB 4UXNB 3ZT6A 2JQ9A 3K3OA 2AXDS 4HEAA 4A97A 4QXBB 3TLTA 3I9WA 5ABHA 2H3RA 1MNEA 3RX6A 3A7MA 2JQHA 2W63A 1E7PA 3IBPA 4ILAA 3C50A 3AEBA 3C98B 3RIUA 1D0YA 4F8HA 2DI4A 3O1IA 4IHJE 1W0AA 3ZC1A 4X1IE 2VVSA 5AQRB 1BR4A 4JYAT 1IAPA 3K3QC 5FNVE 2YKSA 2UU9T 5FMNA 2V7MA 2X0LB 3UUXB 5FKYA 3W15B 3JC6D 4PK5A 3RIFA 2V7IA 5AQSB 4K0UA 4GIWA 3FXEB 5HXSA 2MYSA 2H7OA 3GN5A 2WM9A 2HN2A 5FY1A 2PG8A 4DR5T 2JMKA 2VKJA 4PJNA 1J5WA 4YSXA 3AXJA 4DV7T 4M1PA 2CM0A 2XTLA 1B7TA 3NWIA 4P0BA 3AE6A 1D1BA 4IDZA 1UUSA 4ERRA 1WR0A 4ZI2C 4K0KT 5C3JA 5EK2A 1FEWA 3UTKA 4JI2T 4E7ZA 3AA0B 3LBXB 4Z8XA 3ESLA 1N32T 4BA9A 3ZMSB 4HWHA 3PUGA 1HNWT 3P4WA 2CA5A 1DU2A 3QB5A 1Z8UA 3ZYKA 5LGTB 2YK0A 3AE5A 3ZT7A 4GKJT 2EHOC 3AVSA 3RYFE 5IWAT 2CRBA 3AE7A 3B13A 1LRZA 1M62A 4YHJA 1NAFA 3I0OA 3RC3A 3B5MA 3SRZA 2E9XD 5AQFB 2BG9E 2BKOA 3ZN0B 3SFDA 3Q5DA 4YJ3E 2CHNA 2XQAA 2E5VA 2UXBT 4L9IA 2LHNA 2CXFA 2ZM6T 1YKEB 3BK9A 2LSYA 4IGUA 3RYIE 2V8SV 5JDMA 4JI6T 2KINB 2SPCA 2J1DG 2HH7A 1IBLT 5M4YA 4U74A 4EZ4A 1D1CA 5H6RB 1VOMA 3HR0A 3T1YT 1Z0PA 3AE8A 1MIYA 2BG9A 1S35A 1SE7A 2W4XA 3JAFA 3CIRA 4V1Av 2DL1A 1XDPA 4L5GA 5IHYA 4UV9B 4LMJA 3GMIA 5LOVE 4I0UA 3N9OA 5ETWA 3ANWB 4H9OC 2YOEA 4B3RT 1SHZC 4TNVA 2ZM0A 4YXDA 2ACXA 2BS3A 4A98A 4TV9E 4U7YA 2LM9A 2V6YA 4AKGA 4PFOA 3J9X1 5CGMA 3WI3A 2DWGA 4P1NA 5HAXA 1HS7A 4F6RC 2ZMAA 1VCTA 3SFEA 3VHLA 4NXMT 2X68A 2W2UA 3EI0A 3RKGA 3MK7C 5LP6E 3O4XE 4O2AE 4U2YA 1MMDA 5JDHA 4LF8T 4LFCT 1AJ3A 5FY0A 2H7VC 5KX5E 2NW8A 1QSDA 5FP3A 2IC6A 4AKLA 5L4EA 3RC8A 4DBQA 3CMLA 1WCRA 2NTXA 4JI1T 3SOLA 1ZV4X 3CQXC 3TLWA 3C64A 4CZZB 2EHOB 4PFPA 4LF6T 3PUWF 4CN4A 1BR0A 1XNRT 2LKHA 5AQGB 3UFEA 2FJEA 2IC9A 5LNKA 3AE4A 4IIJE 3RPUA 2I59A 3KVAA 4QH1A 2Z6EA 2QVAA 2N1GA 4BJMA 2OV9A 4GK0E 4HWFA 4IE0A 3RF1A 2KXPB 5AQUB 2W66A 3IEEA 2XM2A 1IJ5A 3A8YC 4NXNT 1ZEEA 2XQ8A 5EK4A 1R8IA 5JDLA 3FZFB 1N33T 4O8SA 2JQKA 3ZT5A 2BBHA 3K1SA 2PFVA 5JTGA 3DP7A 3RH3A 5FXVA 1QUUA 3F57A 4EYYR 5JDGA 5L3CB 1XDOA 2X0HA 3UT5E 4CN6A 4AQFA 2VKOA 5J2UE 3LBXA 3UQ4A 3L8RA 3NKZA 2LE8A 3PUAA 3CQGB 3ZN1B 4HFCA 2XQ9A 2XAHB 3AAAB 3PUZF 2MBGA 2JJ9A 4J2CA 4FJOA 2XY8B 4XAXB 2CBIA 4ZS2A 3E22E 2KNDA 2J47A 4U72A 3QB5K 1MIWA 4AXPA 4AI6A 3JAEA 4IDPA 2WWUA 3RRWA 3FZMB 3RQWA 3BQKA 2XPKA 4HFVA 3EUHA 2FBWA 4GK5E 2XHEB 4EOZB 5CB4E 4PNIA 2LSKA 4DO0A 4DUZT 4CQIA 2LSIA 1XMQT 2UUBT 5JDFA 3UU4A 3PE0A 1QLBA 2J4GA 5HWYA 3EHZA 5LG4A 3F2EA 3QUJA 4COFA 2YEVC 2HN1A 1I6ZA 5E0OA 1KK7A 2NP9A 5A1LA 1J1JA 2DHRA 4HN9A 2FJAA 4HWCA 4C90A 3IA3A 1E2AA 1U4QA 4UEMA 2NR4A 2KT9A 2WZIA 5ABEA 2I0MA 3NVOA 1KFYA 2WY2A 2K9AA 1JNRA 2XJ7A 2V5DA 3Q5EA 2L3LA 3ZCIA 5L3BB 5L47A 4DV2T 2VL0A 2LJLA 2X9HA 2VB6A 1HX8A 3ANWA 3UU3A 1HX1B 4QXCB 5L3GB 4TNWA 2WBLA 5J0ZA 2N2NA 5F8PA 5JQGE 5IUXA 2A72A 2XSAA 3K8PC 4YTMA 4ZI3D 4JI0T 5FY7A 3Q5XA 2QYWA 2XQ6A 3EVYA 4YHHT 3C4WA 2W0GA 1D1AA 5AQOB 4ZS3A 5CFBA 3P8CD 4IL9A 2Q9QB 3LK2B 2C5KT 2VASA 2IHR1 2IAKA 1OEDE 2BVMA 5LMNT 4LFAT 4ILUA 1WYBA 3LJCA 5LHHB 3KV5A 2NTYA 5AQMB 4IE7A 4QXHB 2EHOA 4HWDA 1SUMB 1NEKA 2QA7A 1WYCA 4CI1B 3PUQA 3MZKB 3VR9A 3VKHA 4CXYA 1YQ3A 3LG7A 3OKQA 3AEAA 1US7B 4CI3B 4UVBB 4E7SA 3AE9A 5KXJA 2W67A 1HFAA 2YU2A 2VQFT 4BJNA 3KV6A 4X64T 4JI3T 3DJBA 3FXDB 5IYZE 1UURA 2NW9A 1XWMA 3M65A 4LMLA 4HWIB 4QX8B 4EEBA 2BZBA 4X1KE 2CLYC 3AEEA 2AE9A 1WLXA 4UIGA 3N5LA 2I6HA 3P4PA 2X9YA 4BAYB 5FYMA 2R6GF 3ZYLA 4IE4A 3LK3B 4ZXLA 3RGLA 4JLEA 5KDMC 1W9RA 1HG2A 1U5PA 3FBLA 3ONLC 4O4HE 3P7IA 4PJJA 4GOUA 3Q5WA 2XAFB 2P9BA 3CVRA 1ZP0A 5LHIB 4ZZCA 4WNKA 2NWBA 4JEHB 4PJLA 3PU8A 4ZHQE 3CX6B 4JUYA 4U3CA 4EEDA 3ZPOA 5LBMA 5FL1A 3CX7B 4OK0A 4YSZA 4UVCB 1T72A 4U2ZA 3PV0F 4ZOLE 2M6BA 4O4LE 3MJXA 1OEDC 1IZNB 4H9SE 3ZSSA 4QX7B 3C4ZA 2L8KA 5H6QB 5JDNA 3AE3A 3AECA 2RA1A 2LOSA 2BBJA 3B57A 2WDRA 4DUYT 1G73A 2UXXB 1GQEA 4HFHA 2F4VT 4A5XA 4DV0T 3AAEB 3P50A 2A2FX 2K24A 3JC6C 1MNDA 2WU5A 4DV6T 2CXLA 1HF8A 3E0ZA 3VR8A 2BKNA 4G2AA 2E2AA 4GKKT 4ASKA 2H89A 3ZJ1A 5CA1E 3KBTA 2VKHA 4EV6A 5L3FB 3UU6A 1YXRA 4U7IA 3CK6A 2XAGB 4H9RC 3PURA 3PUYF 4A56A 2BVLA 3UU8A 2X9WA 4AQYT 4X62T 3KFWX 1JNZA 2LLYA 2YDSA 4ILCA 3ZMZB 2V7LA 3NZQA 5JR9C 3LDQB 1J5ET 3FHNA 5JREA 4DR2T 2WZHA 2BKPA 2X67A 2VWAA 3OYZA 4DR7T 2W00A 3JADA 4TV8E 1HTJF 3OJAA 4DV4T 3L09A 2WP9A 2CLYB 1HNXT 4DV3T 4JEUB 4X66T 3FZHB 4FI5A 4OYKA 3N9PA 2IW5B 3O9XA 5AQHB 2V6XA 2K5BB 4MHCA 3ZCJA 1T98A 2LOPA 2Q9QA 3L3PA 5HEOA 4UF0B 3ZEFB 2E9XC 5DQWA 2DLRA 3VRBA 3N2KE 2X51A 3FZLB 4IT4A 1MMAA 1ZKEA 4ZI7E 2IUBA 3AB3B 3AE1A 4AQGA 5CA0E 2YN6A 1LKXA 1HR0T 5BMVE 4JV5T 5FXZA 4I43B 4IDNA 3ZJ2A 4HFDA 2FJBA 4ANJA 5L3EB 2LM2A 3KBUA 4XZCA 5FXWA 2VK9A 1OEDB 2LT3A 2V1DB 4UELA 3LK42 5AQVB 3PJAA 1V9DA 1S94A 4UR9A 4KI0F 4AKHA 3N9MA 4OX9T 3MA9A 2PTFA 5AQKB 3L39A 4EAHA 4B3MT 5HEJA 1X9BA 1FMWA 1LVFA 3EDVA 2KZ7B 3CWZB 3RRCA 3UFGA 2WAUA 3WAKA 2UUCT 1T7SA 4LMKA 3OBVE 3NRXA 5HCJA 1WR6A 4P0AA 3Q9DA 5L2LA 2XM1A 4QH4A 3D0TA 1MMGA 2NW7A 1OWAA 5CJ5A 4AKIA 2BS2A 4DIDB 2WU2A 5AFUL 4EB6E 5AQQB 5LGNB 1N34T 2N9DA 3DTOA 1FIOA 4H9PC 3U78A 2DWKA 3T8OA 2X66A 3ABVA 4IE6A 1M7KA 4OYJA 5AQJB 3EAMA 3N9LA 4KP3C 2WDVA 5JR9B 2JRKA 2LHRA 2FJDA 4HGAA 5ABFB 4MBQA 5LJMA 1ZHCA 3P4RA 5HXRA 3ONJA 4TN7B 5HYAA 4LFBT 3NZPA 2HPJA 1HG5A 4JI8T 3N9NA 4XBFB 5DQVA 2D0TA 2Y8DA 2WCAA 2KSRA 1Y01A 2D2SA 3H3MA 3UU5A 5F3JA 3G06A 2WMOA 1EZ3A 2CHOA 2YDRA 3FBZA 3UUBA 2E9XB 2CXDA 4DMVA 2WMNA 4TWFA 1BR2A 4KX6A 4GYRA 2E8IA 2MPKA 2KMFA 4KBMB 2H88A 4PJMA 1LVKA 3S4UA 4ZEYA 3AA6B 3QOFA 4EGWA 1E1HB 3LFMA 3QK6A 3AEFA 2BS4A 2KWIB 4ZI2D 4B3ST 1KF6A 1KNZA 1XNQT 1IJ6A 4KUMB 5FVLA 3PTRB 2XQ7A 3EDUA 2YU1A 3U3IA 2CPTA 5KMGP 2OA5A 1XZYA 1FMVA 1WFDA 2EHOD 4PW8A 3JCFA 5LGUB 5JH7E 4YLHA 3ZYMA 4H63H 2J62A 5LB7B 2ODUA 3CQCB 3PJAJ 4O2BE 2DCFA 5FL0A 1W09A 2JQQA 1WRDA 1L0VA 1UX4A 4QH5A 4TUYE 3VRAA 4WYVA 2YDQA 2ZLYA 5C8YE 4HTEA 4Q25A 4CN1A 5JDQA 4I55E 3A5XA 3HKCE 4UF0A 2QGSA 3SS1A 5JRCB 3AEDA 2C0SA 4LF4T 3ZC0A 4YJ2E 5GONE 4ZZBA 1YQ4A 5LHGB 4HE8A 4GYSA 3AVRA 3AA7B 3NRYA 4DR6T 4O4IE 1UX5A 1OEDA 1HNZT 3H37A 3E08A 3TLUA 1XMOT 3V5UA 3N9QA 2K48A 2L9QA 3RYCE 3X1DA 3UUMA 2X0YA 3MXZA 4YFSA 5AQNB 4PK6A 1ZOYA 2ACZA 1HCIA 3PDYA 1IBMT 3I1AA 2KWHA 2PBIA 4Z90A 3MKDA 5LYJE 3RIUC 3BQLA 3BQIA 4LF7T 2XQ3A 2V5CA 3C4XA 2IIUA 4Z91A 4YT0A 4UVAB 5HXHA 5LMUT 1SA0E 1NWMX 2E5LT 3CPZA 2XAQB 2PJQA 4U31A 2CCQA 3OPCA 2A3DA 4ZI3C 5HCMA 3KV9A 1YD8G 1UCUA 2QRXA 4YTNA 3K3NA 3LSVA 3I0QA 5BR8T 3RHWA 3GA8A 2VURA 2WQYA 2MAWA 4I50E 2IMLA 4EYUA 5JR9A 4C91A 2VKDA 4HFEA 1FJGT 3MACA 2WSSV 4DBRA 5ABFA 3T1HT 4TWDA 4IDQA 5LCYA 2UXDT 2M67A 5DABA 3ZMUB 2DNXA 1UGOA 3UULA 3I9YA 4DV1T 3KVBA 4JI5T 4ADZA 3HI2A 2HHHT 2X9XA 5DJQC 2LEHA 4H9QC 4CXXA 2E9XA 2HPLA 5ADXL 4WBNE 4KMCA 4IDOA 5L3DB 2W61A 3PUSA 2CEAA 2XQYA 2XSBA 4JBWF 4JI4T 1YW0A 2A9UA 3Q2MA 3R84B 4AIUA 3P4QA 1MMNA 2YINA 3F31A 1KEYA 2WDQA 5HEGA 3KDSE 4NUVA 1VRBA 2LRLA 1KNRA 2MTQA 4MALA 4EXTA 1D0ZA 1NENA 3N2GE 4MLKA 2Q9QD 2M6IA 2KLQA 2JIWA 3HKDE 4O4JE 5FXXA 4EZHA 3AE2A 4KHZF 2WB5A 4N78D 1KNPA 4L0RA 4IE5A 4CI2B 5EZYE 3FB2A 2UXCT 4I4TE 5EK3A 2WWVA 2V7JA 5J2TE 3PU3A 4NIQA 4KHPT 3C51A 3OYXA 4ISSA 4DMWA 2UXNB 2ES0A 3R6NA 3VU7H 5LG3A 4G63A 3TLVA 4X5TA 2ZM2A 2W62A 4PK4A 1MIVA 3ZSTA 2XASB 2BG9C 3IHRA 3AEGA 2CWOA 3RQUA 5JRCA 5HEHA 5HXEA 1O3XA 2CMRA 4HFIA 4AISA 3WAJA 1N36T 2G0UA 4B3TT 4OFZA 2C5IT 2RPAA 3RIAA 2V26A 1T8BA 3QC9A 3PUVF 4DNDA 5JVDE 5AQIB 3GN5B 3UUNA 5C2TA 1X79A 3VKGA 3AA1B 5ABGA 2D9DA 3AXJB 1VCSA 5HWXA 4QKNA 3GWHA 2RP4A 4ILBA 3OVUA 5AQTB 2D5UA 4P09A 5LXTE 3RI5A 3FZKB 5TAOA 4MFRA 2XQ5A 3OTOT 5HXCA 4WZXA 2CBJA 3IF8B 2B76A 2VL8A 4QWNB 3PUXF 4PAGA 2ZM8A 5LBQB 5HEUA 3HKEE 1CHUA 3NBXX 1BR1A 4X20E 2LSJA 3KV4A 2Q9QC 2OLTA 2CWYA 3J7Yq 4LF9T 2LSGA 1H7CA 5L4HA 3ZKRA 4YTPA 4NUUA 4DR1T 4JI7T 4YSYA 2Y48B 4AKRB 4TZ4C 2GK9A 3QNUA 1YKHB 4LF5T 3CX8B 4WBOA 2VQET 5AQLB 1UK5A 4H63V 2V7KA 1CUNA 2MOZA 3HL6A 4TWHA 4X65T 4UV8B 3ZMTB 4IREA 4IL4A 2XUEA 3AAIA 4ISTA 2LRKA 3RKOA 2NOXA 3ETVA 2ODVA 4WW0A 4B6XA 3SWHA 1Y64B 3HA4A 3H3AA 2FUPA 3UQ7A 5FVKA 4NPPA 3EABA 3TLSA 2LKGA 2B1EA 5J1GA 4AQFC 3RYHE 5AQPB 2BG9B 3ONXA 2K3WA 1I94T 3N2OA 2XAJB 2WS3A 2VVNA 2XQ4A 2UUAT
chains in the Genus database with same CATH topology
2AXDS 2AE9A 1SE7A 2IDOB 1DU2A 2XY8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXD S;  2AE9 A;  1SE7 A;  2IDO B;  1DU2 A;  2XY8 B; 
#chains in the Genus database with same CATH topology
 3KIN B;  3ZLI A;  4DR4 T;  4U33 A;  4YY3 T;  1W0B A;  3RLF F;  4OHF A;  2JPF A;  4DVD A;  4H9N C;  4DR3 T;  3ZMV B;  2D0U A;  3O1H A;  4EIW A;  4CXW A;  2Y6X A;  2BDE A;  2XZE A;  2V6Y B;  3ETU A;  4HKA A;  1D0X A;  3V5S A;  2CE7 A;  2C5J A;  4X1Y E;  3O1J A;  3HKB E;  5F5W A;  1G8X A;  3TKL B;  1OXZ A;  1IBK T;  4HFB A;  3CKD A;  5LJN A;  4QHO A;  5LA6 E;  3P4S A;  2JMH A;  4DV5 T;  4TX5 A;  2IDO B;  3M3Z B;  4UXN B;  3ZT6 A;  2JQ9 A;  3K3O A;  2AXD S;  4HEA A;  4A97 A;  4QXB B;  3TLT A;  3I9W A;  5ABH A;  2H3R A;  1MNE A;  3RX6 A;  3A7M A;  2JQH A;  2W63 A;  1E7P A;  3IBP A;  4ILA A;  3C50 A;  3AEB A;  3C98 B;  3RIU A;  1D0Y A;  4F8H A;  2DI4 A;  3O1I A;  4IHJ E;  1W0A A;  3ZC1 A;  4X1I E;  2VVS A;  5AQR B;  1BR4 A;  4JYA T;  1IAP A;  3K3Q C;  5FNV E;  2YKS A;  2UU9 T;  5FMN A;  2V7M A;  2X0L B;  3UUX B;  5FKY A;  3W15 B;  3JC6 D;  4PK5 A;  3RIF A;  2V7I A;  5AQS B;  4K0U A;  4GIW A;  3FXE B;  5HXS A;  2MYS A;  2H7O A;  3GN5 A;  2WM9 A;  2HN2 A;  5FY1 A;  2PG8 A;  4DR5 T;  2JMK A;  2VKJ A;  4PJN A;  1J5W A;  4YSX A;  3AXJ A;  4DV7 T;  4M1P A;  2CM0 A;  2XTL A;  1B7T A;  3NWI A;  4P0B A;  3AE6 A;  1D1B A;  4IDZ A;  1UUS A;  4ERR A;  1WR0 A;  4ZI2 C;  4K0K T;  5C3J A;  5EK2 A;  1FEW A;  3UTK A;  4JI2 T;  4E7Z A;  3AA0 B;  3LBX B;  4Z8X A;  3ESL A;  1N32 T;  4BA9 A;  3ZMS B;  4HWH A;  3PUG A;  1HNW T;  3P4W A;  2CA5 A;  1DU2 A;  3QB5 A;  1Z8U A;  3ZYK A;  5LGT B;  2YK0 A;  3AE5 A;  3ZT7 A;  4GKJ T;  2EHO C;  3AVS A;  3RYF E;  5IWA T;  2CRB A;  3AE7 A;  3B13 A;  1LRZ A;  1M62 A;  4YHJ A;  1NAF A;  3I0O A;  3RC3 A;  3B5M A;  3SRZ A;  2E9X D;  5AQF B;  2BG9 E;  2BKO A;  3ZN0 B;  3SFD A;  3Q5D A;  4YJ3 E;  2CHN A;  2XQA A;  2E5V A;  2UXB T;  4L9I A;  2LHN A;  2CXF A;  2ZM6 T;  1YKE B;  3BK9 A;  2LSY A;  4IGU A;  3RYI E;  2V8S V;  5JDM A;  4JI6 T;  2KIN B;  2SPC A;  2J1D G;  2HH7 A;  1IBL T;  5M4Y A;  4U74 A;  4EZ4 A;  1D1C A;  5H6R B;  1VOM A;  3HR0 A;  3T1Y T;  1Z0P A;  3AE8 A;  1MIY A;  2BG9 A;  1S35 A;  1SE7 A;  2W4X A;  3JAF A;  3CIR A;  4V1A v;  2DL1 A;  1XDP A;  4L5G A;  5IHY A;  4UV9 B;  4LMJ A;  3GMI A;  5LOV E;  4I0U A;  3N9O A;  5ETW A;  3ANW B;  4H9O C;  2YOE A;  4B3R T;  1SHZ C;  4TNV A;  2ZM0 A;  4YXD A;  2ACX A;  2BS3 A;  4A98 A;  4TV9 E;  4U7Y A;  2LM9 A;  2V6Y A;  4AKG A;  4PFO A;  3J9X 1;  5CGM A;  3WI3 A;  2DWG A;  4P1N A;  5HAX A;  1HS7 A;  4F6R C;  2ZMA A;  1VCT A;  3SFE A;  3VHL A;  4NXM T;  2X68 A;  2W2U A;  3EI0 A;  3RKG A;  3MK7 C;  5LP6 E;  3O4X E;  4O2A E;  4U2Y A;  1MMD A;  5JDH A;  4LF8 T;  4LFC T;  1AJ3 A;  5FY0 A;  2H7V C;  5KX5 E;  2NW8 A;  1QSD A;  5FP3 A;  2IC6 A;  4AKL A;  5L4E A;  3RC8 A;  4DBQ A;  3CML A;  1WCR A;  2NTX A;  4JI1 T;  3SOL A;  1ZV4 X;  3CQX C;  3TLW A;  3C64 A;  4CZZ B;  2EHO B;  4PFP A;  4LF6 T;  3PUW F;  4CN4 A;  1BR0 A;  1XNR T;  2LKH A;  5AQG B;  3UFE A;  2FJE A;  2IC9 A;  5LNK A;  3AE4 A;  4IIJ E;  3RPU A;  2I59 A;  3KVA A;  4QH1 A;  2Z6E A;  2QVA A;  2N1G A;  4BJM A;  2OV9 A;  4GK0 E;  4HWF A;  4IE0 A;  3RF1 A;  2KXP B;  5AQU B;  2W66 A;  3IEE A;  2XM2 A;  1IJ5 A;  3A8Y C;  4NXN T;  1ZEE A;  2XQ8 A;  5EK4 A;  1R8I A;  5JDL A;  3FZF B;  1N33 T;  4O8S A;  2JQK A;  3ZT5 A;  2BBH A;  3K1S A;  2PFV A;  5JTG A;  3DP7 A;  3RH3 A;  5FXV A;  1QUU A;  3F57 A;  4EYY R;  5JDG A;  5L3C B;  1XDO A;  2X0H A;  3UT5 E;  4CN6 A;  4AQF A;  2VKO A;  5J2U E;  3LBX A;  3UQ4 A;  3L8R A;  3NKZ A;  2LE8 A;  3PUA A;  3CQG B;  3ZN1 B;  4HFC A;  2XQ9 A;  2XAH B;  3AAA B;  3PUZ F;  2MBG A;  2JJ9 A;  4J2C A;  4FJO A;  2XY8 B;  4XAX B;  2CBI A;  4ZS2 A;  3E22 E;  2KND A;  2J47 A;  4U72 A;  3QB5 K;  1MIW A;  4AXP A;  4AI6 A;  3JAE A;  4IDP A;  2WWU A;  3RRW A;  3FZM B;  3RQW A;  3BQK A;  2XPK A;  4HFV A;  3EUH A;  2FBW A;  4GK5 E;  2XHE B;  4EOZ B;  5CB4 E;  4PNI A;  2LSK A;  4DO0 A;  4DUZ T;  4CQI A;  2LSI A;  1XMQ T;  2UUB T;  5JDF A;  3UU4 A;  3PE0 A;  1QLB A;  2J4G A;  5HWY A;  3EHZ A;  5LG4 A;  3F2E A;  3QUJ A;  4COF A;  2YEV C;  2HN1 A;  1I6Z A;  5E0O A;  1KK7 A;  2NP9 A;  5A1L A;  1J1J A;  2DHR A;  4HN9 A;  2FJA A;  4HWC A;  4C90 A;  3IA3 A;  1E2A A;  1U4Q A;  4UEM A;  2NR4 A;  2KT9 A;  2WZI A;  5ABE A;  2I0M A;  3NVO A;  1KFY A;  2WY2 A;  2K9A A;  1JNR A;  2XJ7 A;  2V5D A;  3Q5E A;  2L3L A;  3ZCI A;  5L3B B;  5L47 A;  4DV2 T;  2VL0 A;  2LJL A;  2X9H A;  2VB6 A;  1HX8 A;  3ANW A;  3UU3 A;  1HX1 B;  4QXC B;  5L3G B;  4TNW A;  2WBL A;  5J0Z A;  2N2N A;  5F8P A;  5JQG E;  5IUX A;  2A72 A;  2XSA A;  3K8P C;  4YTM A;  4ZI3 D;  4JI0 T;  5FY7 A;  3Q5X A;  2QYW A;  2XQ6 A;  3EVY A;  4YHH T;  3C4W A;  2W0G A;  1D1A A;  5AQO B;  4ZS3 A;  5CFB A;  3P8C D;  4IL9 A;  2Q9Q B;  3LK2 B;  2C5K T;  2VAS A;  2IHR 1;  2IAK A;  1OED E;  2BVM A;  5LMN T;  4LFA T;  4ILU A;  1WYB A;  3LJC A;  5LHH B;  3KV5 A;  2NTY A;  5AQM B;  4IE7 A;  4QXH B;  2EHO A;  4HWD A;  1SUM B;  1NEK A;  2QA7 A;  1WYC A;  4CI1 B;  3PUQ A;  3MZK B;  3VR9 A;  3VKH A;  4CXY A;  1YQ3 A;  3LG7 A;  3OKQ A;  3AEA A;  1US7 B;  4CI3 B;  4UVB B;  4E7S A;  3AE9 A;  5KXJ A;  2W67 A;  1HFA A;  2YU2 A;  2VQF T;  4BJN A;  3KV6 A;  4X64 T;  4JI3 T;  3DJB A;  3FXD B;  5IYZ E;  1UUR A;  2NW9 A;  1XWM A;  3M65 A;  4LML A;  4HWI B;  4QX8 B;  4EEB A;  2BZB A;  4X1K E;  2CLY C;  3AEE A;  2AE9 A;  1WLX A;  4UIG A;  3N5L A;  2I6H A;  3P4P A;  2X9Y A;  4BAY B;  5FYM A;  2R6G F;  3ZYL A;  4IE4 A;  3LK3 B;  4ZXL A;  3RGL A;  4JLE A;  5KDM C;  1W9R A;  1HG2 A;  1U5P A;  3FBL A;  3ONL C;  4O4H E;  3P7I A;  4PJJ A;  4GOU A;  3Q5W A;  2XAF B;  2P9B A;  3CVR A;  1ZP0 A;  5LHI B;  4ZZC A;  4WNK A;  2NWB A;  4JEH B;  4PJL A;  3PU8 A;  4ZHQ E;  3CX6 B;  4JUY A;  4U3C A;  4EED A;  3ZPO A;  5LBM A;  5FL1 A;  3CX7 B;  4OK0 A;  4YSZ A;  4UVC B;  1T72 A;  4U2Z A;  3PV0 F;  4ZOL E;  2M6B A;  4O4L E;  3MJX A;  1OED C;  1IZN B;  4H9S E;  3ZSS A;  4QX7 B;  3C4Z A;  2L8K A;  5H6Q B;  5JDN A;  3AE3 A;  3AEC A;  2RA1 A;  2LOS A;  2BBJ A;  3B57 A;  2WDR A;  4DUY T;  1G73 A;  2UXX B;  1GQE A;  4HFH A;  2F4V T;  4A5X A;  4DV0 T;  3AAE B;  3P50 A;  2A2F X;  2K24 A;  3JC6 C;  1MND A;  2WU5 A;  4DV6 T;  2CXL A;  1HF8 A;  3E0Z A;  3VR8 A;  2BKN A;  4G2A A;  2E2A A;  4GKK T;  4ASK A;  2H89 A;  3ZJ1 A;  5CA1 E;  3KBT A;  2VKH A;  4EV6 A;  5L3F B;  3UU6 A;  1YXR A;  4U7I A;  3CK6 A;  2XAG B;  4H9R C;  3PUR A;  3PUY F;  4A56 A;  2BVL A;  3UU8 A;  2X9W A;  4AQY T;  4X62 T;  3KFW X;  1JNZ A;  2LLY A;  2YDS A;  4ILC A;  3ZMZ B;  2V7L A;  3NZQ A;  5JR9 C;  3LDQ B;  1J5E T;  3FHN A;  5JRE A;  4DR2 T;  2WZH A;  2BKP A;  2X67 A;  2VWA A;  3OYZ A;  4DR7 T;  2W00 A;  3JAD A;  4TV8 E;  1HTJ F;  3OJA A;  4DV4 T;  3L09 A;  2WP9 A;  2CLY B;  1HNX T;  4DV3 T;  4JEU B;  4X66 T;  3FZH B;  4FI5 A;  4OYK A;  3N9P A;  2IW5 B;  3O9X A;  5AQH B;  2V6X A;  2K5B B;  4MHC A;  3ZCJ A;  1T98 A;  2LOP A;  2Q9Q A;  3L3P A;  5HEO A;  4UF0 B;  3ZEF B;  2E9X C;  5DQW A;  2DLR A;  3VRB A;  3N2K E;  2X51 A;  3FZL B;  4IT4 A;  1MMA A;  1ZKE A;  4ZI7 E;  2IUB A;  3AB3 B;  3AE1 A;  4AQG A;  5CA0 E;  2YN6 A;  1LKX A;  1HR0 T;  5BMV E;  4JV5 T;  5FXZ A;  4I43 B;  4IDN A;  3ZJ2 A;  4HFD A;  2FJB A;  4ANJ A;  5L3E B;  2LM2 A;  3KBU A;  4XZC A;  5FXW A;  2VK9 A;  1OED B;  2LT3 A;  2V1D B;  4UEL A;  3LK4 2;  5AQV B;  3PJA A;  1V9D A;  1S94 A;  4UR9 A;  4KI0 F;  4AKH A;  3N9M A;  4OX9 T;  3MA9 A;  2PTF A;  5AQK B;  3L39 A;  4EAH A;  4B3M T;  5HEJ A;  1X9B A;  1FMW A;  1LVF A;  3EDV A;  2KZ7 B;  3CWZ B;  3RRC A;  3UFG A;  2WAU A;  3WAK A;  2UUC T;  1T7S A;  4LMK A;  3OBV E;  3NRX A;  5HCJ A;  1WR6 A;  4P0A A;  3Q9D A;  5L2L A;  2XM1 A;  4QH4 A;  3D0T A;  1MMG A;  2NW7 A;  1OWA A;  5CJ5 A;  4AKI A;  2BS2 A;  4DID B;  2WU2 A;  5AFU L;  4EB6 E;  5AQQ B;  5LGN B;  1N34 T;  2N9D A;  3DTO A;  1FIO A;  4H9P C;  3U78 A;  2DWK A;  3T8O A;  2X66 A;  3ABV A;  4IE6 A;  1M7K A;  4OYJ A;  5AQJ B;  3EAM A;  3N9L A;  4KP3 C;  2WDV A;  5JR9 B;  2JRK A;  2LHR A;  2FJD A;  4HGA A;  5ABF B;  4MBQ A;  5LJM A;  1ZHC A;  3P4R A;  5HXR A;  3ONJ A;  4TN7 B;  5HYA A;  4LFB T;  3NZP A;  2HPJ A;  1HG5 A;  4JI8 T;  3N9N A;  4XBF B;  5DQV A;  2D0T A;  2Y8D A;  2WCA A;  2KSR A;  1Y01 A;  2D2S A;  3H3M A;  3UU5 A;  5F3J A;  3G06 A;  2WMO A;  1EZ3 A;  2CHO A;  2YDR A;  3FBZ A;  3UUB A;  2E9X B;  2CXD A;  4DMV A;  2WMN A;  4TWF A;  1BR2 A;  4KX6 A;  4GYR A;  2E8I A;  2MPK A;  2KMF A;  4KBM B;  2H88 A;  4PJM A;  1LVK A;  3S4U A;  4ZEY A;  3AA6 B;  3QOF A;  4EGW A;  1E1H B;  3LFM A;  3QK6 A;  3AEF A;  2BS4 A;  2KWI B;  4ZI2 D;  4B3S T;  1KF6 A;  1KNZ A;  1XNQ T;  1IJ6 A;  4KUM B;  5FVL A;  3PTR B;  2XQ7 A;  3EDU A;  2YU1 A;  3U3I A;  2CPT A;  5KMG P;  2OA5 A;  1XZY A;  1FMV A;  1WFD A;  2EHO D;  4PW8 A;  3JCF A;  5LGU B;  5JH7 E;  4YLH A;  3ZYM A;  4H63 H;  2J62 A;  5LB7 B;  2ODU A;  3CQC B;  3PJA J;  4O2B E;  2DCF A;  5FL0 A;  1W09 A;  2JQQ A;  1WRD A;  1L0V A;  1UX4 A;  4QH5 A;  4TUY E;  3VRA A;  4WYV A;  2YDQ A;  2ZLY A;  5C8Y E;  4HTE A;  4Q25 A;  4CN1 A;  5JDQ A;  4I55 E;  3A5X A;  3HKC E;  4UF0 A;  2QGS A;  3SS1 A;  5JRC B;  3AED A;  2C0S A;  4LF4 T;  3ZC0 A;  4YJ2 E;  5GON E;  4ZZB A;  1YQ4 A;  5LHG B;  4HE8 A;  4GYS A;  3AVR A;  3AA7 B;  3NRY A;  4DR6 T;  4O4I E;  1UX5 A;  1OED A;  1HNZ T;  3H37 A;  3E08 A;  3TLU A;  1XMO T;  3V5U A;  3N9Q A;  2K48 A;  2L9Q A;  3RYC E;  3X1D A;  3UUM A;  2X0Y A;  3MXZ A;  4YFS A;  5AQN B;  4PK6 A;  1ZOY A;  2ACZ A;  1HCI A;  3PDY A;  1IBM T;  3I1A A;  2KWH A;  2PBI A;  4Z90 A;  3MKD A;  5LYJ E;  3RIU C;  3BQL A;  3BQI A;  4LF7 T;  2XQ3 A;  2V5C A;  3C4X A;  2IIU A;  4Z91 A;  4YT0 A;  4UVA B;  5HXH A;  5LMU T;  1SA0 E;  1NWM X;  2E5L T;  3CPZ A;  2XAQ B;  2PJQ A;  4U31 A;  2CCQ A;  3OPC A;  2A3D A;  4ZI3 C;  5HCM A;  3KV9 A;  1YD8 G;  1UCU A;  2QRX A;  4YTN A;  3K3N A;  3LSV A;  3I0Q A;  5BR8 T;  3RHW A;  3GA8 A;  2VUR A;  2WQY A;  2MAW A;  4I50 E;  2IML A;  4EYU A;  5JR9 A;  4C91 A;  2VKD A;  4HFE A;  1FJG T;  3MAC A;  2WSS V;  4DBR A;  5ABF A;  3T1H T;  4TWD A;  4IDQ A;  5LCY A;  2UXD T;  2M67 A;  5DAB A;  3ZMU B;  2DNX A;  1UGO A;  3UUL A;  3I9Y A;  4DV1 T;  3KVB A;  4JI5 T;  4ADZ A;  3HI2 A;  2HHH T;  2X9X A;  5DJQ C;  2LEH A;  4H9Q C;  4CXX A;  2E9X A;  2HPL A;  5ADX L;  4WBN E;  4KMC A;  4IDO A;  5L3D B;  2W61 A;  3PUS A;  2CEA A;  2XQY A;  2XSB A;  4JBW F;  4JI4 T;  1YW0 A;  2A9U A;  3Q2M A;  3R84 B;  4AIU A;  3P4Q A;  1MMN A;  2YIN A;  3F31 A;  1KEY A;  2WDQ A;  5HEG A;  3KDS E;  4NUV A;  1VRB A;  2LRL A;  1KNR A;  2MTQ A;  4MAL A;  4EXT A;  1D0Z A;  1NEN A;  3N2G E;  4MLK A;  2Q9Q D;  2M6I A;  2KLQ A;  2JIW A;  3HKD E;  4O4J E;  5FXX A;  4EZH A;  3AE2 A;  4KHZ F;  2WB5 A;  4N78 D;  1KNP A;  4L0R A;  4IE5 A;  4CI2 B;  5EZY E;  3FB2 A;  2UXC T;  4I4T E;  5EK3 A;  2WWV A;  2V7J A;  5J2T E;  3PU3 A;  4NIQ A;  4KHP T;  3C51 A;  3OYX A;  4ISS A;  4DMW A;  2UXN B;  2ES0 A;  3R6N A;  3VU7 H;  5LG3 A;  4G63 A;  3TLV A;  4X5T A;  2ZM2 A;  2W62 A;  4PK4 A;  1MIV A;  3ZST A;  2XAS B;  2BG9 C;  3IHR A;  3AEG A;  2CWO A;  3RQU A;  5JRC A;  5HEH A;  5HXE A;  1O3X A;  2CMR A;  4HFI A;  4AIS A;  3WAJ A;  1N36 T;  2G0U A;  4B3T T;  4OFZ A;  2C5I T;  2RPA A;  3RIA A;  2V26 A;  1T8B A;  3QC9 A;  3PUV F;  4DND A;  5JVD E;  5AQI B;  3GN5 B;  3UUN A;  5C2T A;  1X79 A;  3VKG A;  3AA1 B;  5ABG A;  2D9D A;  3AXJ B;  1VCS A;  5HWX A;  4QKN A;  3GWH A;  2RP4 A;  4ILB A;  3OVU A;  5AQT B;  2D5U A;  4P09 A;  5LXT E;  3RI5 A;  3FZK B;  5TAO A;  4MFR A;  2XQ5 A;  3OTO T;  5HXC A;  4WZX A;  2CBJ A;  3IF8 B;  2B76 A;  2VL8 A;  4QWN B;  3PUX F;  4PAG A;  2ZM8 A;  5LBQ B;  5HEU A;  3HKE E;  1CHU A;  3NBX X;  1BR1 A;  4X20 E;  2LSJ A;  3KV4 A;  2Q9Q C;  2OLT A;  2CWY A;  3J7Y q;  4LF9 T;  2LSG A;  1H7C A;  5L4H A;  3ZKR A;  4YTP A;  4NUU A;  4DR1 T;  4JI7 T;  4YSY A;  2Y48 B;  4AKR B;  4TZ4 C;  2GK9 A;  3QNU A;  1YKH B;  4LF5 T;  3CX8 B;  4WBO A;  2VQE T;  5AQL B;  1UK5 A;  4H63 V;  2V7K A;  1CUN A;  2MOZ A;  3HL6 A;  4TWH A;  4X65 T;  4UV8 B;  3ZMT B;  4IRE A;  4IL4 A;  2XUE A;  3AAI A;  4IST A;  2LRK A;  3RKO A;  2NOX A;  3ETV A;  2ODV A;  4WW0 A;  4B6X A;  3SWH A;  1Y64 B;  3HA4 A;  3H3A A;  2FUP A;  3UQ7 A;  5FVK A;  4NPP A;  3EAB A;  3TLS A;  2LKG A;  2B1E A;  5J1G A;  4AQF C;  3RYH E;  5AQP B;  2BG9 B;  3ONX A;  2K3W A;  1I94 T;  3N2O A;  2XAJ B;  2WS3 A;  2VVN A;  2XQ4 A;  2UUA T; 
#chains in the Genus database with same CATH homology
 2AXD S;  2AE9 A;  1SE7 A;  2IDO B;  1DU2 A;  2XY8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...