2AXDS

Solution structure of the theta subunit of escherichia coli dna polymerase iii in complex with the epsilon subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
b'MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III, theta subunit
publication title Structure of the theta subunit of Escherichia coli DNA polymerase III in complex with the epsilon subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 22
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2axdS00
2IDOB 2AXDS 1DU2A 2AE9A 1SE7A 2XY8B
chains in the Genus database with same CATH superfamily
1MMGA 4HGAA 4U72A 3UUNA 3CMLA 2X9WA 4IREA 3HKCE 2LKGA 5A1LA 5AQJB 4DR5T 2RP4A 1VRBA 4UVAB 4HEAA 1XDPA 4Z8XA 3C64A 4WBNE 1R8IA 3SS1A 2BKOA 2MBGA 4TNWA 1VOMA 3MXZA 1N34T 5FL0A 3ZJ2A 3I0QA 5FVKA 4A5XA 5JH7E 2MAWA 5CFBA 3L39A 4CXYA 2K48A 5AQIB 2PFVA 2VK9A 2WQYA 3LG7A 4JI1T 4PNIA 3N9LA 3AE2A 5FXXA 1QSDA 4KP3C 2C5KT 3AAEB 3UU6A 2PTFA 2X0HA 3K3OA 2V5DA 4HN9A 2H88A 4X5TA 1HX1B 4DR2T 2F4VT 2I6HA 1V9DA 2XAFB 3AVSA 3ZCIA 4CQIA 4UIGA 3I1AA 4QKNA 3U78A 4K0KT 4GYSA 4B3ST 4NXMT 4PJMA 2ZM6T 3EAMA 4I4TE 2Q9QB 1MNDA 1B7TA 3RIAA 3LK2B 3QUJA 2KSRA 3CK6A 3E08A 3AE8A 3PUAA 5FXZA 2CE7A 5JTGA 4LFAT 4GIWA 1Y01A 2WWUA 4ZI2D 4NUUA 1YW0A 3HR0A 3ETVA 3PURA 1Z0PA 3ONXA 3NKZA 4LF8T 4PFPA 3ZC0A 2X0YA 5H6RB 4P1NA 1W9RA 3J7Yq 3QNUA 4UVBB 1H7CA 3C4WA 4N78D 4LF7T 1WLXA 4DV3T 2D0UA 2VVSA 5KX5E 4HWCA 3RC3A 5L3FB 3JC6C 5L47A 2JIWA 2W67A 2RA1A 3Q5WA 4QXCB 4WBOA 3ZEFB 4ZS3A 1OXZA 3GWHA 1KF6A 2YU1A 4UV9B 2KINB 2A9UA 2XAJB 3UU5A 4YSZA 3RC8A 3KV6A 3CIRA 3F2EA 4YHHT 1O3XA 2PG8A 1E7PA 4TWDA 4TWHA 1X79A 5H6QB 4QX7B 1ZP0A 2WBLA 3AE4A 5LGNB 5GONE 2NW7A 1N36T 4X1YE 4EB6E 2C5JA 4KX6A 3AEAA 3K8PC 3AEBA 5HXRA 1U5PA 2IUBA 2KLQA 4ASKA 4PK6A 4PFOA 2D2SA 4OYKA 4DR7T 2E9XA 5LJMA 1CHUA 4DV4T 5L3DB 3B5MA 3Q5XA 1UX4A 4F6RC 3UULA 4O4JE 5HEJA 3ANWA 2BVMA 3VR9A 3ABVA 5EK4A 2JMHA 3PV0F 3LJCA 4H9PC 5JDNA 3ZN1B 1W0BA 5IYZE 5JVDE 1XNQT 5HXCA 2ZM0A 2B76A 4EIWA 3N9PA 2V6YA 3ZT6A 2KZ7B 4I43B 5L3EB 4DR3T 5BR8T 5AQKB 1WR6A 3PUSA 1W0AA 4AI6A 3NRYA 2CWYA 4PJNA 3Q5EA 2FJAA 4DR6T 3PE0A 5F5WA 3ESLA 2IHR1 4ILCA 2WP9A 3HA4A 3RRCA 4U2ZA 2YK0A 4EYYR 3TKLB 3AE1A 2UUBT 4P0AA 4DV1T 3C4ZA 4V1Av 1EZ3A 3OKQA 4YFSA 5J0ZA 1BR1A 1SA0E 3NZQA 2D9DA 2JQKA 2XAGB 3RI5A 4DO0A 4YSXA 4G2AA 4IDQA 5AQGB 4ILBA 4IDZA 4G63A 4I0UA 3W15B 1US7B 2L9QA 4DBRA 4DBQA 2BS2A 1S35A 4KBMB 5JRCA 1Y64B 2C0SA 2I59A 5CB4E 2IW5B 2ZLYA 5DQWA 3T1YT 4IL9A 5JDQA 4JI8T 5M4YA 2VB6A 4DV5T 4LMLA 1T7SA 4I50E 4B6XA 3RYIE 5HEOA 1XNRT 5FXVA 1N33T 5L3CB 3ETUA 1KNRA 4ZI2C 1YXRA 2IIUA 2NWBA 4U74A 2BBJA 1XMOT 2IC6A 4IDOA 4O2BE 3H37A 1OWAA 2WU5A 4BJNA 5HEHA 2BG9B 4AKHA 4H63H 3LK42 1ZOYA 3OYZA 5KDMC 4UXNB 2XUEA 3CQGB 3CQCB 4XZCA 4TUYE 5JR9B 3JCFA 2IDOB 3C50A 4AKLA 4ANJA 4LF6T 4EXTA 4NPPA 5FMNA 4IE0A 3GA8A 2XAHB 1D0XA 3VRAA 1HR0T 2YU2A 3AXJA 2HN1A 1MIYA 1FMVA 4EGWA 1UX5A 2Q9QA 3KDSE 4YJ2E 1KNPA 2BS4A 4DV7T 2Z6EA 2K9AA 4AISA 2BKNA 3KV5A 3UFGA 1WFDA 2XAQB 2NTYA 1M7KA 3GN5B 3P8CD 2E2AA 4JLEA 3ZSSA 1T8BA 4DNDA 1S94A 3AEFA 2M6BA 2N1GA 2A72A 4HFHA 4ILUA 3ZYKA 5CA0E 2X9HA 4FI5A 5AFUL 3SFEA 2OA5A 3UU3A 4CN6A 4GKKT 3P50A 4X65T 2XM2A 5FXWA 5ABFB 4IDNA 4EYUA 4HFDA 3PUGA 5LGTB 3U3IA 5LHIB 2W61A 3OVUA 3RKGA 4H9RC 3UQ7A 4PW8A 2HPJA 3EHZA 4HWIB 1ZEEA 2BKPA 3F57A 3PJAA 5HEUA 4L5GA 4DV6T 2FUPA 4KHZF 4WZXA 3K1SA 2LSYA 5FYMA 1HNZT 3R84B 1OEDB 4AQFA 4ISSA 2ZMAA 2LSGA 2LSIA 3QOFA 1IAPA 4MALA 5TAOA 4JUYA 2L3LA 1KEYA 3CWZB 2CMRA 3KVAA 2A3DA 4JI0T 1MMDA 3L8RA 4ISTA 4O8SA 4YTPA 4YTMA 2NOXA 3R6NA 2XY8B 4ZZBA 2YEVC 5AQQB 2LHRA 3MZKB 4H9SE 4EZ4A 4CXWA 1AJ3A 2E9XD 4B3MT 3AEGA 3TLUA 1D1AA 5EK2A 4JI5T 2D5UA 2XQ3A 2UXXB 1YD8G 5J2UE 3S4UA 2X9XA 3VU7H 4O4IE 4QH5A 4UEMA 4O2AE 3HI2A 3EI0A 5FNVE 4KHPT 1N32T 2MPKA 4TX5A 3BK9A 3CVRA 3PU8A 3ZMSB 4QH4A 5CJ5A 3KFWX 1UGOA 2AXDS 1LVKA 2XJ7A 1I94T 3FXDB 4ZHQE 2BVLA 4X20E 4KMCA 3MJXA 3AA7B 3CPZA 1FJGT 1MMNA 5AQHB 5LMNT 1WCRA 2KT9A 2P9BA 3M3ZB 5IWAT 4TWFA 1WYCA 2X0LB 2N2NA 3P4WA 4E7SA 3AAAB 1IJ6A 4OHFA 5ABHA 2WDQA 3Q2MA 4NXNT 2KMFA 3K3QC 4UELA 3TLSA 3FHNA 2ES0A 3CQXC 3FZHB 4Z91A 4P0BA 3ZCJA 4DIDB 4YTNA 2K5BB 1UUSA 3T8OA 3EABA 3AE6A 2XASB 5HAXA 2A2FX 5J1GA 2NTXA 1T98A 2E8IA 3P4RA 3NVOA 1M62A 4EOZB 4ZI7E 2BG9A 5AQTB 4DUZT 3RKOA 4TV8E 5DABA 3QB5A 4MBQA 4NIQA 4UF0B 2UXBT 2EHOB 5KXJA 5FY7A 2XQYA 4HE8A 5KMGP 2OLTA 3PDYA 3N9OA 2X67A 5AQVB 5LBMA 3N9MA 3RF1A 2Y8DA 2J62A 2LRLA 4CN4A 2XM1A 4H9QC 2ODVA 3ZC1A 4B3RT 1HCIA 3ZLIA 3UTKA 2JMKA 4BJMA 2ACXA 4UVCB 3PUZF 4F8HA 4EEBA 2Y6XA 4ERRA 2PBIA 2WDRA 2CRBA 4IE6A 3L09A 3LBXB 3CX8B 2KXPB 3F31A 2I0MA 3PUVF 3KV9A 4IL4A 2X9YA 1XMQT 3MACA 1NAFA 3FZLB 3GN5A 3PUWF 5C8YE 4CI2B 3RIUA 1LVFA 3P4PA 1QUUA 3RYFE 2V8SV 1FEWA 4DR4T 1ZV4X 2XQ6A 2DL1A 3RQUA 4U7YA 2WZHA 3DP7A 4DUYT 2CWOA 1JNRA 5FY0A 4TNVA 2CXLA 2UXNB 2CEAA 3WAKA 2CHNA 4QH1A 2YINA 3QB5K 2NW9A 2SPCA 5AQPB 3SOLA 2Q9QD 4TZ4C 5FY1A 2N9DA 3OYXA 4XBFB 3IA3A 2LSJA 2LOSA 5ABFA 4LF9T 1J5WA 2XSAA 4ZI3D 4YXDA 4WNKA 2JQ9A 3P4SA 2LJLA 4JBWF 4HTEA 4JI6T 2C5IT 2H7VC 2M6IA 5AQNB 5HEGA 2XQ8A 3LK3B 2WSSV 2WAUA 4MHCA 5DJQC 2E9XC 1GQEA 4IHJE 3O1HA 3O4XE 3ZMUB 1G8XA 3O1IA 4DMVA 4EAHA 1UK5A 1OEDA 4H9OC 4ADZA 2D0TA 5AQOB 5FP3A 2V7KA 4YY3T 2YKSA 2E5VA 2Y48B 1MIVA 4HFBA 2VQFT 1QLBA 4WW0A 5HCJA 3J9X1 4P09A 3N9QA 5LG3A 4U2YA 4LFCT 5HXEA 1E2AA 2YDSA 4IT4A 5HXHA 2XQ7A 2GK9A 2W4XA 3PJAJ 3X1DA 4LF5T 2HHHT 4HKAA 3EDVA 5AQSB 2KWIB 2ZM8A 5LNKA 2X66A 2XQ4A 5IHYA 4LMKA 2VASA 5CA1E 3HKDE 2QA7A 3N9NA 2DHRA 2X68A 1IBKT 2VQET 1HNWT 2V26A 2XZEA 1NEKA 2G0UA 2YDQA 3ZPOA 3T1HT 1I6ZA 3ZMVB 2V7JA 3MA9A 2V7MA 4X62T 4U31A 2B1EA 2CM0A 1YKEB 5F8PA 3RRWA 2CA5A 2CLYC 2L8KA 4WYVA 3OPCA 4DV0T 3IBPA 3IHRA 1DU2A 2VWAA 1KFYA 3AA6B 2XQAA 5F3JA 3C98B 5J2TE 2IC9A 3BQKA 4OYJA 1W09A 1HG5A 3IF8B 4E7ZA 4QHOA 2JJ9A 2JQHA 5LA6E 3KVBA 4DV2T 3IEEA 3UQ4A 2WDVA 3NBXX 3MK7C 2OV9A 4CI3B 2DCFA 5DQVA 2XTLA 2XHEB 4JV5T 5ABGA 3CKDA 2J47A 3NWIA 1D0YA 3AECA 3C4XA 3ZKRA 2BDEA 3UUMA 1XWMA 2YOEA 3ZT5A 1T72A 4HFEA 4HWDA 3AA0B 1YKHB 3SRZA 2IMLA 2LM2A 2CCQA 2FJEA 2ACZA 3Q5DA 4UF0A 4QWNB 2EHOA 3C51A 3UUXB 2LT3A 2CBJA 3AA1B 5FKYA 2WY2A 2CPTA 2CXFA 3I0OA 2LHNA 2AE9A 3KV4A 4AKIA 5HYAA 4HFVA 4IE7A 4C90A 2J4GA 4H9NC 5HCMA 2Q9QC 4LFBT 2LE8A 3ONLC 2PJQA 3DTOA 3I9WA 3RPUA 2W63A 3TLWA 4PJLA 2YDRA 4ZI3C 3SWHA 5LG4A 3I9YA 3PU3A 4ZOLE 1YQ3A 3AE9A 2UXCT 3ZMZB 3LBXA 2DI4A 2FBWA 4YT0A 1HFAA 2NR4A 2E5LT 3RX6A 4CXXA 4I55E 5LJNA 1FIOA 4COFA 5JDMA 3ONJA 4AXPA 2CBIA 1XDOA 1BR0A 4MFRA 4X64T 1D1BA 3AEDA 2VKJA 2NP9A 2HN2A 4NUVA 1NENA 3LSVA 3TLTA 3ZN0B 2QYWA 3OTOT 1HX8A 1IZNB 4TN7B 5BMVE 2H7OA 3PUQA 3JAFA 4DMWA 2DWGA 2ODUA 4K0UA 1G73A 5FVLA 3P7IA 4GYRA 5LGUB 4B3TT 2EHOC 3N5LA 4YJ3E 4C91A 2NW8A 3AVRA 3FBZA 3AXJB 1LRZA 4YLHA 1WR0A 2JQQA 1MMAA 5HWYA 2QGSA 3E0ZA 4H63V 3FZFB 5AQFB 4CI1B 2YN6A 3A8YC 4AQFC 2WB5A 2V5CA 1FMWA 3UU4A 4HWHA 5E0OA 1ZKEA 5JQGE 1MNEA 3RIFA 4A98A 3V5UA 3N2OA 2FJDA 3M65A 1VCTA 2BBHA 1HNXT 2WCAA 4IE4A 2HPLA 3EVYA 3VHLA 4A56A 1SE7A 3WI3A 5JDLA 2UUCT 1J5ET 2QRXA 4OK0A 2V7LA 2JRKA 5C3JA 3NRXA 3FZMB 2W2UA 2DWKA 4PK4A 3LFMA 2H89A 3A7MA 4YHJA 5L3GB 2K3WA 2BZBA 1LKXA 3N2GE 5JR9A 3FZKB 5L3BB 2VL0A 4FJOA 1J1JA 3O1JA 1YQ4A 3JADA 2WMNA 3OBVE 4U33A 3D0TA 3RYCE 4PAGA 1BR4A 4GOUA 4HWFA 3O9XA 2IAKA 2QVAA 4ZS2A 4Q25A 1XZYA 4GKJT 4M1PA 3BQIA 1CUNA 5JDFA 4JEHB 3AE3A 2V1DB 5LCYA 3VRBA 2XQ5A 4JEUB 2LOPA 3FBLA 2VKDA 4A97A 4AIUA 1SHZC 3RHWA 3G06A 2LLYA 4GK0E 3UUBA 3CX6B 5LXTE 2HH7A 1SUMB 1HTJF 2VURA 3UFEA 4CN1A 2FJBA 2W62A 4L0RA 3N2KE 1ZHCA 3KBUA 2WZIA 5C2TA 3MKDA 2BG9E 4AQYT 2W66A 3B57A 2W00A 5ABEA 4Z90A 4JI4T 1UCUA 3V5SA 2MYSA 2MTQA 4AKGA 4U3CA 5L4HA 4X1IE 2BG9C 1MIWA 1BR2A 3H3AA 4MLKA 2UU9T 5JR9C 4GK5E 3BQLA 5L4EA 1WYBA 5EZYE 2LEHA 1D1CA 2VKOA 5L2LA 2WWVA 2LRKA 2ZM2A 5IUXA 2XPKA 5ADXL 3RH3A 3LDQB 4QX8B 4ZXLA 4HFIA 4OFZA 1HS7A 2H3RA 4PK5A 4PJJA 4IGUA 2DLRA 4JI3T 5JREA 2V7IA 2MOZA 5AQMB 3HKEE 3RQWA 2WMOA 4U7IA 2VVNA 4X1KE 3TLVA 4JYAT 4LF4T 2JPFA 5LBQB 5HXSA 4DVDA 3RIUC 3QC9A 4HFCA 4ZEYA 2J1DG 1IBMT 3PTRB 4KUMB 3SFDA 2EHOD 2VKHA 4ZZCA 2UXDT 3PUXF 1X9BA 2V6XA 4UR9A 5CGMA 5JDGA 4O4LE 4YSYA 5LP6E 3KBTA 5FL1A 3AAIA 3VKHA 3ZYMA 4L9IA 3ZSTA 3ZJ1A 3OJAA 3HL6A 5AQLB 2XQ9A 3VR8A 2KNDA 1NWMX 2K24A 3ZT7A 1IJ5A 3WAJA 1OEDE 3B13A 3AB3B 4IDPA 4ILAA 1U4QA 1KNZA 3HKBE 1HF8A 3FB2A 2XSBA 4LMJA 2VL8A 2E9XB 5LHHB 2CXDA 1UURA 2DNXA 2LKHA 3JC6D 3UU8A 5HWXA 2RPAA 3ANWB 3RYHE 3Q9DA 1VCSA 3L3PA 1OEDC 2LSKA 4TV9E 2WU2A 3P4QA 3RGLA 2BS3A 4CZZB 2W0GA 1WRDA 4O4HE 3EUHA 3FXEB 3DJBA 2V6YB 3JAEA 3RLFF 5LOVE 4JI2T 1JNZA 4UV8B 3AEEA 4AKRB 3KINB 2WS3A 1IBLT 3EDUA 1E1HB 5AQUB 5AQRB 4EV6A 3NZPA 4IIJE 4EZHA 3AE7A 3ZMTB 3A5XA 5EK3A 1D0ZA 1KK7A 3K3NA 4IE5A 4BA9A 5LHGB 3GMIA 4J2CA 4XAXB 4QXBB 1L0VA 3UT5E 4OX9T 2M67A 5LMUT 2X51A 3H3MA 4BAYB 3VKGA 2KWHA 3ZYLA 2R6GF 3AE5A 3QK6A 2UUAT 1Z8UA 5LYJE 4EEDA 2CLYB 4KI0F 4X66T 3CX7B 5ETWA 2WM9A 2LM9A 3E22E 1HG2A 2CHOA 3PUYF 4DR1T 5LB7B 5JRCB 5JDHA 4QXHB 4AQGA 4JI7T
chains in the Genus database with same CATH topology
2IDOB 2AXDS 1DU2A 2AE9A 1SE7A 2XY8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDO B;  2AXD S;  1DU2 A;  2AE9 A;  1SE7 A;  2XY8 B; 
#chains in the Genus database with same CATH topology
 1MMG A;  4HGA A;  4U72 A;  3UUN A;  3CML A;  2X9W A;  4IRE A;  3HKC E;  2LKG A;  5A1L A;  5AQJ B;  4DR5 T;  2RP4 A;  1VRB A;  4UVA B;  4HEA A;  1XDP A;  4Z8X A;  3C64 A;  4WBN E;  1R8I A;  3SS1 A;  2BKO A;  2MBG A;  4TNW A;  1VOM A;  3MXZ A;  1N34 T;  5FL0 A;  3ZJ2 A;  3I0Q A;  5FVK A;  4A5X A;  5JH7 E;  2MAW A;  5CFB A;  3L39 A;  4CXY A;  2K48 A;  5AQI B;  2PFV A;  2VK9 A;  2WQY A;  3LG7 A;  4JI1 T;  4PNI A;  3N9L A;  3AE2 A;  5FXX A;  1QSD A;  4KP3 C;  2C5K T;  3AAE B;  3UU6 A;  2PTF A;  2X0H A;  3K3O A;  2V5D A;  4HN9 A;  2H88 A;  4X5T A;  1HX1 B;  4DR2 T;  2F4V T;  2I6H A;  1V9D A;  2XAF B;  3AVS A;  3ZCI A;  4CQI A;  4UIG A;  3I1A A;  4QKN A;  3U78 A;  4K0K T;  4GYS A;  4B3S T;  4NXM T;  4PJM A;  2ZM6 T;  3EAM A;  4I4T E;  2Q9Q B;  1MND A;  1B7T A;  3RIA A;  3LK2 B;  3QUJ A;  2KSR A;  3CK6 A;  3E08 A;  3AE8 A;  3PUA A;  5FXZ A;  2CE7 A;  5JTG A;  4LFA T;  4GIW A;  1Y01 A;  2WWU A;  4ZI2 D;  4NUU A;  1YW0 A;  3HR0 A;  3ETV A;  3PUR A;  1Z0P A;  3ONX A;  3NKZ A;  4LF8 T;  4PFP A;  3ZC0 A;  2X0Y A;  5H6R B;  4P1N A;  1W9R A;  3J7Y q;  3QNU A;  4UVB B;  1H7C A;  3C4W A;  4N78 D;  4LF7 T;  1WLX A;  4DV3 T;  2D0U A;  2VVS A;  5KX5 E;  4HWC A;  3RC3 A;  5L3F B;  3JC6 C;  5L47 A;  2JIW A;  2W67 A;  2RA1 A;  3Q5W A;  4QXC B;  4WBO A;  3ZEF B;  4ZS3 A;  1OXZ A;  3GWH A;  1KF6 A;  2YU1 A;  4UV9 B;  2KIN B;  2A9U A;  2XAJ B;  3UU5 A;  4YSZ A;  3RC8 A;  3KV6 A;  3CIR A;  3F2E A;  4YHH T;  1O3X A;  2PG8 A;  1E7P A;  4TWD A;  4TWH A;  1X79 A;  5H6Q B;  4QX7 B;  1ZP0 A;  2WBL A;  3AE4 A;  5LGN B;  5GON E;  2NW7 A;  1N36 T;  4X1Y E;  4EB6 E;  2C5J A;  4KX6 A;  3AEA A;  3K8P C;  3AEB A;  5HXR A;  1U5P A;  2IUB A;  2KLQ A;  4ASK A;  4PK6 A;  4PFO A;  2D2S A;  4OYK A;  4DR7 T;  2E9X A;  5LJM A;  1CHU A;  4DV4 T;  5L3D B;  3B5M A;  3Q5X A;  1UX4 A;  4F6R C;  3UUL A;  4O4J E;  5HEJ A;  3ANW A;  2BVM A;  3VR9 A;  3ABV A;  5EK4 A;  2JMH A;  3PV0 F;  3LJC A;  4H9P C;  5JDN A;  3ZN1 B;  1W0B A;  5IYZ E;  5JVD E;  1XNQ T;  5HXC A;  2ZM0 A;  2B76 A;  4EIW A;  3N9P A;  2V6Y A;  3ZT6 A;  2KZ7 B;  4I43 B;  5L3E B;  4DR3 T;  5BR8 T;  5AQK B;  1WR6 A;  3PUS A;  1W0A A;  4AI6 A;  3NRY A;  2CWY A;  4PJN A;  3Q5E A;  2FJA A;  4DR6 T;  3PE0 A;  5F5W A;  3ESL A;  2IHR 1;  4ILC A;  2WP9 A;  3HA4 A;  3RRC A;  4U2Z A;  2YK0 A;  4EYY R;  3TKL B;  3AE1 A;  2UUB T;  4P0A A;  4DV1 T;  3C4Z A;  4V1A v;  1EZ3 A;  3OKQ A;  4YFS A;  5J0Z A;  1BR1 A;  1SA0 E;  3NZQ A;  2D9D A;  2JQK A;  2XAG B;  3RI5 A;  4DO0 A;  4YSX A;  4G2A A;  4IDQ A;  5AQG B;  4ILB A;  4IDZ A;  4G63 A;  4I0U A;  3W15 B;  1US7 B;  2L9Q A;  4DBR A;  4DBQ A;  2BS2 A;  1S35 A;  4KBM B;  5JRC A;  1Y64 B;  2C0S A;  2I59 A;  5CB4 E;  2IW5 B;  2ZLY A;  5DQW A;  3T1Y T;  4IL9 A;  5JDQ A;  4JI8 T;  5M4Y A;  2VB6 A;  4DV5 T;  4LML A;  1T7S A;  4I50 E;  4B6X A;  3RYI E;  5HEO A;  1XNR T;  5FXV A;  1N33 T;  5L3C B;  3ETU A;  1KNR A;  4ZI2 C;  1YXR A;  2IIU A;  2NWB A;  4U74 A;  2BBJ A;  1XMO T;  2IC6 A;  4IDO A;  4O2B E;  3H37 A;  1OWA A;  2WU5 A;  4BJN A;  5HEH A;  2BG9 B;  4AKH A;  4H63 H;  3LK4 2;  1ZOY A;  3OYZ A;  5KDM C;  4UXN B;  2XUE A;  3CQG B;  3CQC B;  4XZC A;  4TUY E;  5JR9 B;  3JCF A;  2IDO B;  3C50 A;  4AKL A;  4ANJ A;  4LF6 T;  4EXT A;  4NPP A;  5FMN A;  4IE0 A;  3GA8 A;  2XAH B;  1D0X A;  3VRA A;  1HR0 T;  2YU2 A;  3AXJ A;  2HN1 A;  1MIY A;  1FMV A;  4EGW A;  1UX5 A;  2Q9Q A;  3KDS E;  4YJ2 E;  1KNP A;  2BS4 A;  4DV7 T;  2Z6E A;  2K9A A;  4AIS A;  2BKN A;  3KV5 A;  3UFG A;  1WFD A;  2XAQ B;  2NTY A;  1M7K A;  3GN5 B;  3P8C D;  2E2A A;  4JLE A;  3ZSS A;  1T8B A;  4DND A;  1S94 A;  3AEF A;  2M6B A;  2N1G A;  2A72 A;  4HFH A;  4ILU A;  3ZYK A;  5CA0 E;  2X9H A;  4FI5 A;  5AFU L;  3SFE A;  2OA5 A;  3UU3 A;  4CN6 A;  4GKK T;  3P50 A;  4X65 T;  2XM2 A;  5FXW A;  5ABF B;  4IDN A;  4EYU A;  4HFD A;  3PUG A;  5LGT B;  3U3I A;  5LHI B;  2W61 A;  3OVU A;  3RKG A;  4H9R C;  3UQ7 A;  4PW8 A;  2HPJ A;  3EHZ A;  4HWI B;  1ZEE A;  2BKP A;  3F57 A;  3PJA A;  5HEU A;  4L5G A;  4DV6 T;  2FUP A;  4KHZ F;  4WZX A;  3K1S A;  2LSY A;  5FYM A;  1HNZ T;  3R84 B;  1OED B;  4AQF A;  4ISS A;  2ZMA A;  2LSG A;  2LSI A;  3QOF A;  1IAP A;  4MAL A;  5TAO A;  4JUY A;  2L3L A;  1KEY A;  3CWZ B;  2CMR A;  3KVA A;  2A3D A;  4JI0 T;  1MMD A;  3L8R A;  4IST A;  4O8S A;  4YTP A;  4YTM A;  2NOX A;  3R6N A;  2XY8 B;  4ZZB A;  2YEV C;  5AQQ B;  2LHR A;  3MZK B;  4H9S E;  4EZ4 A;  4CXW A;  1AJ3 A;  2E9X D;  4B3M T;  3AEG A;  3TLU A;  1D1A A;  5EK2 A;  4JI5 T;  2D5U A;  2XQ3 A;  2UXX B;  1YD8 G;  5J2U E;  3S4U A;  2X9X A;  3VU7 H;  4O4I E;  4QH5 A;  4UEM A;  4O2A E;  3HI2 A;  3EI0 A;  5FNV E;  4KHP T;  1N32 T;  2MPK A;  4TX5 A;  3BK9 A;  3CVR A;  3PU8 A;  3ZMS B;  4QH4 A;  5CJ5 A;  3KFW X;  1UGO A;  2AXD S;  1LVK A;  2XJ7 A;  1I94 T;  3FXD B;  4ZHQ E;  2BVL A;  4X20 E;  4KMC A;  3MJX A;  3AA7 B;  3CPZ A;  1FJG T;  1MMN A;  5AQH B;  5LMN T;  1WCR A;  2KT9 A;  2P9B A;  3M3Z B;  5IWA T;  4TWF A;  1WYC A;  2X0L B;  2N2N A;  3P4W A;  4E7S A;  3AAA B;  1IJ6 A;  4OHF A;  5ABH A;  2WDQ A;  3Q2M A;  4NXN T;  2KMF A;  3K3Q C;  4UEL A;  3TLS A;  3FHN A;  2ES0 A;  3CQX C;  3FZH B;  4Z91 A;  4P0B A;  3ZCJ A;  4DID B;  4YTN A;  2K5B B;  1UUS A;  3T8O A;  3EAB A;  3AE6 A;  2XAS B;  5HAX A;  2A2F X;  5J1G A;  2NTX A;  1T98 A;  2E8I A;  3P4R A;  3NVO A;  1M62 A;  4EOZ B;  4ZI7 E;  2BG9 A;  5AQT B;  4DUZ T;  3RKO A;  4TV8 E;  5DAB A;  3QB5 A;  4MBQ A;  4NIQ A;  4UF0 B;  2UXB T;  2EHO B;  5KXJ A;  5FY7 A;  2XQY A;  4HE8 A;  5KMG P;  2OLT A;  3PDY A;  3N9O A;  2X67 A;  5AQV B;  5LBM A;  3N9M A;  3RF1 A;  2Y8D A;  2J62 A;  2LRL A;  4CN4 A;  2XM1 A;  4H9Q C;  2ODV A;  3ZC1 A;  4B3R T;  1HCI A;  3ZLI A;  3UTK A;  2JMK A;  4BJM A;  2ACX A;  4UVC B;  3PUZ F;  4F8H A;  4EEB A;  2Y6X A;  4ERR A;  2PBI A;  2WDR A;  2CRB A;  4IE6 A;  3L09 A;  3LBX B;  3CX8 B;  2KXP B;  3F31 A;  2I0M A;  3PUV F;  3KV9 A;  4IL4 A;  2X9Y A;  1XMQ T;  3MAC A;  1NAF A;  3FZL B;  3GN5 A;  3PUW F;  5C8Y E;  4CI2 B;  3RIU A;  1LVF A;  3P4P A;  1QUU A;  3RYF E;  2V8S V;  1FEW A;  4DR4 T;  1ZV4 X;  2XQ6 A;  2DL1 A;  3RQU A;  4U7Y A;  2WZH A;  3DP7 A;  4DUY T;  2CWO A;  1JNR A;  5FY0 A;  4TNV A;  2CXL A;  2UXN B;  2CEA A;  3WAK A;  2CHN A;  4QH1 A;  2YIN A;  3QB5 K;  2NW9 A;  2SPC A;  5AQP B;  3SOL A;  2Q9Q D;  4TZ4 C;  5FY1 A;  2N9D A;  3OYX A;  4XBF B;  3IA3 A;  2LSJ A;  2LOS A;  5ABF A;  4LF9 T;  1J5W A;  2XSA A;  4ZI3 D;  4YXD A;  4WNK A;  2JQ9 A;  3P4S A;  2LJL A;  4JBW F;  4HTE A;  4JI6 T;  2C5I T;  2H7V C;  2M6I A;  5AQN B;  5HEG A;  2XQ8 A;  3LK3 B;  2WSS V;  2WAU A;  4MHC A;  5DJQ C;  2E9X C;  1GQE A;  4IHJ E;  3O1H A;  3O4X E;  3ZMU B;  1G8X A;  3O1I A;  4DMV A;  4EAH A;  1UK5 A;  1OED A;  4H9O C;  4ADZ A;  2D0T A;  5AQO B;  5FP3 A;  2V7K A;  4YY3 T;  2YKS A;  2E5V A;  2Y48 B;  1MIV A;  4HFB A;  2VQF T;  1QLB A;  4WW0 A;  5HCJ A;  3J9X 1;  4P09 A;  3N9Q A;  5LG3 A;  4U2Y A;  4LFC T;  5HXE A;  1E2A A;  2YDS A;  4IT4 A;  5HXH A;  2XQ7 A;  2GK9 A;  2W4X A;  3PJA J;  3X1D A;  4LF5 T;  2HHH T;  4HKA A;  3EDV A;  5AQS B;  2KWI B;  2ZM8 A;  5LNK A;  2X66 A;  2XQ4 A;  5IHY A;  4LMK A;  2VAS A;  5CA1 E;  3HKD E;  2QA7 A;  3N9N A;  2DHR A;  2X68 A;  1IBK T;  2VQE T;  1HNW T;  2V26 A;  2XZE A;  1NEK A;  2G0U A;  2YDQ A;  3ZPO A;  3T1H T;  1I6Z A;  3ZMV B;  2V7J A;  3MA9 A;  2V7M A;  4X62 T;  4U31 A;  2B1E A;  2CM0 A;  1YKE B;  5F8P A;  3RRW A;  2CA5 A;  2CLY C;  2L8K A;  4WYV A;  3OPC A;  4DV0 T;  3IBP A;  3IHR A;  1DU2 A;  2VWA A;  1KFY A;  3AA6 B;  2XQA A;  5F3J A;  3C98 B;  5J2T E;  2IC9 A;  3BQK A;  4OYJ A;  1W09 A;  1HG5 A;  3IF8 B;  4E7Z A;  4QHO A;  2JJ9 A;  2JQH A;  5LA6 E;  3KVB A;  4DV2 T;  3IEE A;  3UQ4 A;  2WDV A;  3NBX X;  3MK7 C;  2OV9 A;  4CI3 B;  2DCF A;  5DQV A;  2XTL A;  2XHE B;  4JV5 T;  5ABG A;  3CKD A;  2J47 A;  3NWI A;  1D0Y A;  3AEC A;  3C4X A;  3ZKR A;  2BDE A;  3UUM A;  1XWM A;  2YOE A;  3ZT5 A;  1T72 A;  4HFE A;  4HWD A;  3AA0 B;  1YKH B;  3SRZ A;  2IML A;  2LM2 A;  2CCQ A;  2FJE A;  2ACZ A;  3Q5D A;  4UF0 A;  4QWN B;  2EHO A;  3C51 A;  3UUX B;  2LT3 A;  2CBJ A;  3AA1 B;  5FKY A;  2WY2 A;  2CPT A;  2CXF A;  3I0O A;  2LHN A;  2AE9 A;  3KV4 A;  4AKI A;  5HYA A;  4HFV A;  4IE7 A;  4C90 A;  2J4G A;  4H9N C;  5HCM A;  2Q9Q C;  4LFB T;  2LE8 A;  3ONL C;  2PJQ A;  3DTO A;  3I9W A;  3RPU A;  2W63 A;  3TLW A;  4PJL A;  2YDR A;  4ZI3 C;  3SWH A;  5LG4 A;  3I9Y A;  3PU3 A;  4ZOL E;  1YQ3 A;  3AE9 A;  2UXC T;  3ZMZ B;  3LBX A;  2DI4 A;  2FBW A;  4YT0 A;  1HFA A;  2NR4 A;  2E5L T;  3RX6 A;  4CXX A;  4I55 E;  5LJN A;  1FIO A;  4COF A;  5JDM A;  3ONJ A;  4AXP A;  2CBI A;  1XDO A;  1BR0 A;  4MFR A;  4X64 T;  1D1B A;  3AED A;  2VKJ A;  2NP9 A;  2HN2 A;  4NUV A;  1NEN A;  3LSV A;  3TLT A;  3ZN0 B;  2QYW A;  3OTO T;  1HX8 A;  1IZN B;  4TN7 B;  5BMV E;  2H7O A;  3PUQ A;  3JAF A;  4DMW A;  2DWG A;  2ODU A;  4K0U A;  1G73 A;  5FVL A;  3P7I A;  4GYR A;  5LGU B;  4B3T T;  2EHO C;  3N5L A;  4YJ3 E;  4C91 A;  2NW8 A;  3AVR A;  3FBZ A;  3AXJ B;  1LRZ A;  4YLH A;  1WR0 A;  2JQQ A;  1MMA A;  5HWY A;  2QGS A;  3E0Z A;  4H63 V;  3FZF B;  5AQF B;  4CI1 B;  2YN6 A;  3A8Y C;  4AQF C;  2WB5 A;  2V5C A;  1FMW A;  3UU4 A;  4HWH A;  5E0O A;  1ZKE A;  5JQG E;  1MNE A;  3RIF A;  4A98 A;  3V5U A;  3N2O A;  2FJD A;  3M65 A;  1VCT A;  2BBH A;  1HNX T;  2WCA A;  4IE4 A;  2HPL A;  3EVY A;  3VHL A;  4A56 A;  1SE7 A;  3WI3 A;  5JDL A;  2UUC T;  1J5E T;  2QRX A;  4OK0 A;  2V7L A;  2JRK A;  5C3J A;  3NRX A;  3FZM B;  2W2U A;  2DWK A;  4PK4 A;  3LFM A;  2H89 A;  3A7M A;  4YHJ A;  5L3G B;  2K3W A;  2BZB A;  1LKX A;  3N2G E;  5JR9 A;  3FZK B;  5L3B B;  2VL0 A;  4FJO A;  1J1J A;  3O1J A;  1YQ4 A;  3JAD A;  2WMN A;  3OBV E;  4U33 A;  3D0T A;  3RYC E;  4PAG A;  1BR4 A;  4GOU A;  4HWF A;  3O9X A;  2IAK A;  2QVA A;  4ZS2 A;  4Q25 A;  1XZY A;  4GKJ T;  4M1P A;  3BQI A;  1CUN A;  5JDF A;  4JEH B;  3AE3 A;  2V1D B;  5LCY A;  3VRB A;  2XQ5 A;  4JEU B;  2LOP A;  3FBL A;  2VKD A;  4A97 A;  4AIU A;  1SHZ C;  3RHW A;  3G06 A;  2LLY A;  4GK0 E;  3UUB A;  3CX6 B;  5LXT E;  2HH7 A;  1SUM B;  1HTJ F;  2VUR A;  3UFE A;  4CN1 A;  2FJB A;  2W62 A;  4L0R A;  3N2K E;  1ZHC A;  3KBU A;  2WZI A;  5C2T A;  3MKD A;  2BG9 E;  4AQY T;  2W66 A;  3B57 A;  2W00 A;  5ABE A;  4Z90 A;  4JI4 T;  1UCU A;  3V5S A;  2MYS A;  2MTQ A;  4AKG A;  4U3C A;  5L4H A;  4X1I E;  2BG9 C;  1MIW A;  1BR2 A;  3H3A A;  4MLK A;  2UU9 T;  5JR9 C;  4GK5 E;  3BQL A;  5L4E A;  1WYB A;  5EZY E;  2LEH A;  1D1C A;  2VKO A;  5L2L A;  2WWV A;  2LRK A;  2ZM2 A;  5IUX A;  2XPK A;  5ADX L;  3RH3 A;  3LDQ B;  4QX8 B;  4ZXL A;  4HFI A;  4OFZ A;  1HS7 A;  2H3R A;  4PK5 A;  4PJJ A;  4IGU A;  2DLR A;  4JI3 T;  5JRE A;  2V7I A;  2MOZ A;  5AQM B;  3HKE E;  3RQW A;  2WMO A;  4U7I A;  2VVN A;  4X1K E;  3TLV A;  4JYA T;  4LF4 T;  2JPF A;  5LBQ B;  5HXS A;  4DVD A;  3RIU C;  3QC9 A;  4HFC A;  4ZEY A;  2J1D G;  1IBM T;  3PTR B;  4KUM B;  3SFD A;  2EHO D;  2VKH A;  4ZZC A;  2UXD T;  3PUX F;  1X9B A;  2V6X A;  4UR9 A;  5CGM A;  5JDG A;  4O4L E;  4YSY A;  5LP6 E;  3KBT A;  5FL1 A;  3AAI A;  3VKH A;  3ZYM A;  4L9I A;  3ZST A;  3ZJ1 A;  3OJA A;  3HL6 A;  5AQL B;  2XQ9 A;  3VR8 A;  2KND A;  1NWM X;  2K24 A;  3ZT7 A;  1IJ5 A;  3WAJ A;  1OED E;  3B13 A;  3AB3 B;  4IDP A;  4ILA A;  1U4Q A;  1KNZ A;  3HKB E;  1HF8 A;  3FB2 A;  2XSB A;  4LMJ A;  2VL8 A;  2E9X B;  5LHH B;  2CXD A;  1UUR A;  2DNX A;  2LKH A;  3JC6 D;  3UU8 A;  5HWX A;  2RPA A;  3ANW B;  3RYH E;  3Q9D A;  1VCS A;  3L3P A;  1OED C;  2LSK A;  4TV9 E;  2WU2 A;  3P4Q A;  3RGL A;  2BS3 A;  4CZZ B;  2W0G A;  1WRD A;  4O4H E;  3EUH A;  3FXE B;  3DJB A;  2V6Y B;  3JAE A;  3RLF F;  5LOV E;  4JI2 T;  1JNZ A;  4UV8 B;  3AEE A;  4AKR B;  3KIN B;  2WS3 A;  1IBL T;  3EDU A;  1E1H B;  5AQU B;  5AQR B;  4EV6 A;  3NZP A;  4IIJ E;  4EZH A;  3AE7 A;  3ZMT B;  3A5X A;  5EK3 A;  1D0Z A;  1KK7 A;  3K3N A;  4IE5 A;  4BA9 A;  5LHG B;  3GMI A;  4J2C A;  4XAX B;  4QXB B;  1L0V A;  3UT5 E;  4OX9 T;  2M67 A;  5LMU T;  2X51 A;  3H3M A;  4BAY B;  3VKG A;  2KWH A;  3ZYL A;  2R6G F;  3AE5 A;  3QK6 A;  2UUA T;  1Z8U A;  5LYJ E;  4EED A;  2CLY B;  4KI0 F;  4X66 T;  3CX7 B;  5ETW A;  2WM9 A;  2LM9 A;  3E22 E;  1HG2 A;  2CHO A;  3PUY F;  4DR1 T;  5LB7 B;  5JRC B;  5JDH A;  4QXH B;  4AQG A;  4JI7 T; 
#chains in the Genus database with same CATH homology
 2IDO B;  2AXD S;  1DU2 A;  2AE9 A;  1SE7 A;  2XY8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...