2CRBA

Solution structure of mit domain from mouse nrbf-2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
GSSGSSGMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nuclear receptor binding factor 2
publication title Solution structure of MIT domain from mouse NRBF-2
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2crbA00
4A5XA 5CJ5A 5FVLA 2CRBA 4ZEYA 4P1NA 5LB7B 3ZT6A 2W2UA 2JQHA 2V6YB 2DL1A 4U7IA 3K1SA 2V6YA 1YXRA 5CGMA 4WZXA 1WCRA 5FVKA 4U3CA 4NIQA 2WWVA 2WY2A 3ZSTA 2K3WA 1WR0A 4CN6A 2CPTA 2MPKA 2A9UA 2JQKA 2LRKA 3ZT5A 1WFDA 4CN4A 2V6XA 4U33A 3ZSSA 3ZT7A 3EABA 4U7YA 2XZEA 4U2YA 4U31A 2JQ9A 2LRLA 2RPAA 4IT4A 4U2ZA 4CN1A
chains in the Genus database with same CATH superfamily
4F6RC 1QUUA 2NP9A 4HWFA 2CHOA 2CWOA 1M62A 3U78A 1J5WA 4NUVA 4HFHA 2YU1A 4DR4T 1NAFA 4JI5T 2KSRA 4J2CA 3LDQB 4CN4A 3ZYKA 2MAWA 4HFVA 4JUYA 4DUZT 2BS2A 3A7MA 5ABFA 3IHRA 5FVLA 2LHRA 4AQFC 1Y01A 3LBXB 1ZV4X 3ESLA 4BAYB 4JYAT 3HI2A 2C0SA 3A5XA 2BG9A 5F5WA 3QUJA 2UUBT 4JI2T 4U74A 2CBJA 2VQFT 1AJ3A 2DHRA 2H3RA 5J1GA 2LM9A 2JRKA 2LKHA 4QWNB 2HPJA 3KV9A 2XSBA 2I59A 4FI5A 4ZS2A 2HPLA 2W63A 1HFAA 2ZLYA 4IREA 3PURA 3UU6A 2EHOB 2CBIA 3OYZA 4LMKA 5ABGA 3RGLA 5AQPB 4A56A 3K3OA 1UK5A 2LT3A 4AKIA 2E9XC 3ZLIA 2XQ5A 3HKDE 2BKNA 4COFA 5ABHA 4B3MT 1E1HB 4PK5A 3RIAA 3GA8A 4L0RA 3C64A 2LLYA 2BDEA 1V9DA 2V1DB 4KX6A 4LF9T 4WW0A 3MK7C 4X1IE 2M6BA 4HWHA 4JI6T 3TLTA 1US7B 4EZ4A 3MJXA 1W9RA 1I94T 5HXEA 1UX5A 4ZXLA 2W62A 3N9PA 5JR9C 4KI0F 5CA1E 4IDNA 4ZI7E 3K3NA 4GK0E 3K3QC 1OEDB 3FZFB 3I0OA 4P09A 3FXDB 3K1SA 3C4WA 4CZZB 2V7IA 3QK6A 3N9NA 3SS1A 2H88A 4HWCA 2D9DA 4GIWA 4EZHA 5HWXA 3ANWA 4ANJA 1YQ3A 3AEBA 4WBOA 4GYRA 4DBQA 1L0VA 5AQKB 5HXHA 3AXJA 3EDUA 3IA3A 1ZHCA 2V7LA 3NVOA 2C5IT 1MIVA 4ISTA 3OVUA 3MZKB 3HL6A 4ZZBA 5L47A 3T8OA 1OWAA 4O4HE 1T72A 2IDOB 3ETVA 4ASKA 2FJDA 5ABFB 4H9OC 4DV4T 5FKYA 4ZS3A 2BBJA 4G2AA 3TKLB 1N33T 4TUYE 3T1HT 5L4HA 2CXLA 4IDOA 5KMGP 2LRLA 2J62A 2CM0A 4DO0A 3BQKA 3MA9A 3I9YA 1ZP0A 2W4XA 4EAHA 3PDYA 3OYXA 2WM9A 3HR0A 4PAGA 1NEKA 1VRBA 4YHHT 4MLKA 2OV9A 4X20E 3AA6B 4X66T 2IUBA 2ZM8A 2F4VT 5AQTB 3PUVF 3LFMA 3RKGA 3O4XE 2L9QA 4ISSA 2V6YA 5BR8T 3UU5A 2HH7A 5FVKA 3ZMTB 2DCFA 3RYFE 1YKEB 2CWYA 2JPFA 2WDVA 3UU8A 4LMJA 3RHWA 1J5ET 5JDMA 2V7MA 2KLQA 5E0OA 1E2AA 3OTOT 1SE7A 3FXEB 4WNKA 2N2NA 2BBHA 2V7KA 2EHOC 2QVAA 2AXDS 4KUMB 3RIUA 4H9SE 4ZZCA 4DV5T 3AE5A 4DUYT 4U2ZA 1I6ZA 4DNDA 4IE4A 4ERRA 5FXZA 1VCSA 1FEWA 4IL9A 5L3CB 2B1EA 1HG5A 5LG4A 3PUAA 1YD8G 4GYSA 4H63H 3AEEA 2V7JA 2YN6A 3DJBA 1BR4A 4XZCA 4YFSA 2H7VC 3ZYMA 3S4UA 3N9LA 1R8IA 4QH5A 2YKSA 4KHPT 5FMNA 2XQ9A 2FJBA 5LHGB 1OEDC 4YJ2E 3SWHA 4GOUA 5LGUB 2W61A 3Q5WA 3ZMZB 3TLVA 2ZM6T 4MALA 1D0YA 4CXWA 1NWMX 1BR2A 2KNDA 3N9OA 4TWFA 2P9BA 2LEHA 4YT0A 4CQIA 1ZKEA 2LM2A 3V5UA 4H63V 3ZJ2A 5CJ5A 2FUPA 2IIUA 3NWIA 4LFBT 1LVKA 4MFRA 3AE1A 4G63A 2Y48B 4DR5T 5DQVA 5J0ZA 1VOMA 2H89A 3P4RA 1OEDE 2MTQA 2LSIA 2N1GA 2L3LA 3NRYA 2V6YB 4NXNT 2XQYA 2JMHA 2ODUA 4H9NC 3AAEB 1D0ZA 3I1AA 4BJMA 5HXCA 1UX4A 4QH4A 4U2YA 4DR6T 3CX6B 4UEMA 1B7TA 4UV9B 3HKCE 3SFEA 3LG7A 3AE4A 4JEHB 4HFEA 4NPPA 2LOSA 5KX5E 1IBKT 4JI7T 5LGTB 3PUSA 3ZJ1A 5L3BB 2CRBA 4HFCA 2W2UA 4X1YE 4GKJT 1X9BA 3JC6C 3H3AA 2BG9E 3WAKA 2A9UA 4IIJE 1WFDA 5FP3A 5L3FB 4U31A 3CQXC 4NXMT 2X9WA 4A5XA 4LF4T 2RP4A 2YOEA 3AAIA 5FNVE 2NW9A 2BKOA 5JDHA 2CHNA 4IE0A 2N9DA 3F2EA 4YTPA 2UUCT 4P0BA 3AECA 3UUMA 4O8SA 3SOLA 3RYIE 4DV1T 4H9RC 4DR7T 2QGSA 2IMLA 3EI0A 2WCAA 5LGNB 3PV0F 3LK42 5DABA 5LJNA 3N2GE 1HNZT 5FY7A 5KXJA 5FY1A 2VKOA 3H37A 5DJQC 2CXDA 2CA5A 4L5GA 2WWVA 5FY0A 3FBLA 1T7SA 1WRDA 1LRZA 2XHEB 4XBFB 2XAQB 5C2TA 2YDSA 3PUQA 5ABEA 2LOPA 2WZIA 3P8CD 3P4QA 4HEAA 5L2LA 2VVSA 2DNXA 1N36T 1G73A 2XASB 2CPTA 4LF6T 4CI1B 5LYJE 3R6NA 2CLYB 2ES0A 4UIGA 2WMNA 1MMGA 4UXNB 4ZEYA 1ZOYA 1YXRA 2W00A 4Z8XA 2K3WA 1XDOA 5AQSB 4HN9A 3NZQA 5LJMA 3PU8A 3GN5A 3AA1B 2HHHT 4DIDB 2X51A 3BK9A 2PJQA 4CI3B 3D0TA 1GQEA 3AE3A 4YY3T 1MMAA 2C5JA 4CN6A 5JRCB 3ONLC 2HN2A 3CQGB 5IHYA 1CUNA 2Q9QD 2XQ8A 3ONXA 4NIQA 1MIWA 2YDRA 3RIUC 4YJ3E 1W0BA 3ZEFB 2ODVA 3L8RA 4EXTA 4QXCB 3RQWA 2W67A 2K9AA 4PJNA 1HR0T 2KMFA 2ZM0A 1M7KA 2UXNB 4EYYR 4JV5T 4UVCB 2JJ9A 1HF8A 1LVFA 3NRXA 5EK4A 3SFDA 4N78D 1LKXA 4HKAA 4BJNA 1O3XA 3P4WA 4CXXA 4U3CA 1DU2A 3AEGA 3UUNA 5L3EB 3B13A 3F57A 1J1JA 1IJ5A 2XSAA 3EDVA 3ETUA 5F3JA 3CVRA 5HEJA 4AKHA 4NUUA 2HN1A 5JH7E 4KBMB 4JEUB 4TN7B 1QLBA 3ZMVB 3QB5A 5C3JA 2VL0A 2DL1A 1WYCA 4AQFA 1EZ3A 4C90A 3N2OA 2ACZA 2Y8DA 2BG9B 5LBQB 2VKJA 3RI5A 5AQFB 5AQGB 3Q5EA 3W15B 2VK9A 2M6IA 4TX5A 4UF0A 1IBMT 2J4GA 4F8HA 4IE7A 5AQNB 3ZC1A 2WY2A 4AKRB 2IW5B 4DR2T 2XM2A 4JI0T 3N5LA 3OKQA 4I0UA 1T8BA 4JI4T 3RLFF 3O1HA 3B5MA 2XY8B 4EOZB 2J1DG 3N9QA 3UFEA 5FXVA 3U3IA 3GN5B 2CLYC 4BA9A 2KT9A 5ETWA 1IAPA 4X1KE 5EZYE 2MBGA 1MIYA 2YINA 3NBXX 2VVNA 4IE6A 2X0HA 4IDQA 3UT5E 4EEDA 2E9XA 3PU3A 5CGMA 2DLRA 4ILUA 4JBWF 3VU7H 1IJ6A 4HTEA 2E2AA 5IUXA 4DVDA 4LF8T 3ZCJA 3ZT7A 4E7SA 3PUZF 4UVBB 4AKGA 4PW8A 1MNEA 1HNXT 2LSKA 3CX8B 2ACXA 3Q5DA 2Q9QA 3CIRA 4KMCA 1X79A 3AE2A 3ZT5A 5JR9A 4PK6A 5LBMA 3MACA 5F8PA 5HCMA 4PNIA 3HKBE 1FMVA 3PTRB 3EVYA 5AQHB 4K0KT 4HGAA 1FMWA 2LE8A 3AE6A 4MBQA 5BMVE 4GKKT 1FIOA 4O2AE 2BKPA 3AEAA 5HEGA 3ANWB 5ADXL 3VKGA 4LF5T 3AXJB 4CI2B 5FL1A 1YKHB 1KFYA 3C4XA 2WQYA 5J2UE 5FXXA 4GK5E 2LKGA 4X62T 4ZI2D 2WWUA 4QXHB 3RPUA 2K5BB 5LA6E 4U33A 5L3DB 3QNUA 2DWKA 5H6RB 5HYAA 4YTNA 2E5VA 2IAKA 3J9X1 2IC6A 4PK4A 4ILAA 2A2FX 2K24A 3RQUA 4YLHA 2XM1A 3P50A 1WR0A 5HEUA 2WSSV 1D1CA 3B57A 5JDLA 1XNRT 3VRAA 4OX9T 4FJOA 1XNQT 3P4PA 1T98A 1HCIA 2JQHA 3RC3A 4QX7B 5HCJA 1XDPA 4MHCA 4O4JE 3PUYF 5JDNA 2BG9C 3ZKRA 4EYUA 5JDGA 3P4SA 3KDSE 2VQET 2X9HA 4ZI3D 2J47A 3FZLB 2CCQA 1HG2A 2WB5A 4E7ZA 1JNRA 2CEAA 1HTJF 3O9XA 2V5DA 4TZ4C 5IWAT 1IBLT 2NTXA 3JAFA 3AEDA 5JDQA 2X9XA 3O1JA 1HNWT 3AE8A 4U7IA 3UU4A 1SHZC 2SPCA 4KHZF 3BQLA 4YHJA 1W09A 1IZNB 3CMLA 1N32T 2IHR1 2LSGA 4AXPA 2NW8A 4LFCT 4PJJA 5GONE 2WS3A 1BR0A 3RRWA 4HFDA 3ZMSB 2Q9QB 5LOVE 3N9MA 2D0UA 2G0UA 4M1PA 3RF1A 5LXTE 2UUAT 5JDFA 3L3PA 4IDZA 2E5LT 3QOFA 3FZKB 2KZ7B 5LP6E 5LB7B 4ILCA 2X67A 3JAEA 4A98A 5FL0A 4JLEA 5AQLB 2MPKA 4DMVA 2JQKA 2QRXA 2DWGA 5LMUT 4P0AA 4O4LE 3DP7A 5EK2A 3RC8A 3WAJA 2PFVA 4IE5A 1HS7A 5HEOA 2I6HA 4EEBA 2X66A 4DV0T 1KNZA 1KF6A 2L8KA 1SUMB 4LFAT 2BS4A 3ABVA 3QC9A 1XZYA 2V26A 1KEYA 4I50E 3FB2A 2PG8A 4DR1T 4O2BE 3VKHA 3DTOA 3RH3A 3ZCIA 4IGUA 4WBNE 2KWIB 3AAAB 4V1Av 3ZC0A 4ADZA 5AQJB 3CX7B 1S35A 2KXPB 2CXFA 1G8XA 2RPAA 2WBLA 4TV8E 2VL8A 2E8IA 4UELA 2UU9T 3N2KE 4PFPA 5HWYA 3LSVA 1VCTA 2OLTA 1WLXA 3P7IA 2X0YA 2JQ9A 3AA7B 2UXCT 1S94A 3ZT6A 5JQGE 2XQAA 4EV6A 3PE0A 5J2TE 3AE9A 4AISA 3C98B 4OK0A 4HFIA 3GMIA 5LG3A 2E9XD 3ZN1B 3MXZA 2NW7A 5AQQB 2X0LB 4Z90A 2BVMA 5FYMA 2UXDT 3O1IA 5AFUL 1MMDA 3NZPA 5AQVB 5TAOA 3ZYLA 1CHUA 4X5TA 2NR4A 4U72A 2WU2A 5AQIB 4TNWA 3MKDA 2FBWA 4CXYA 4LMLA 4TWDA 3UQ7A 4DV3T 1D0XA 2WDQA 3ZSSA 3EABA 4PJMA 2XZEA 4WYVA 3L39A 2R6GF 2GK9A 1KNPA 4X65T 2WAUA 3E0ZA 2NTYA 5LNKA 2JMKA 3Q2MA 2Q9QC 4DBRA 2OA5A 1XMOT 4WZXA 2D5UA 2A3DA 4JI3T 5CFBA 1UURA 1WYBA 3RIFA 2WDRA 2Z6EA 2AE9A 4A97A 1MNDA 2K48A 3OPCA 3F31A 3K8PC 3PUWF 3X1DA 1HX8A 3T1YT 2XQ7A 3SRZA 3IBPA 2XAFB 1QSDA 1YQ4A 4HWDA 4AIUA 4B3TT 4QX8B 2YEVC 2UXBT 3V5SA 4YSYA 4UV8B 3LK3B 3L09A 2H7OA 4YSZA 4AI6A 3PUXF 3UTKA 5LMNT 2LHNA 4PJLA 5LHIB 3OBVE 4C91A 3C4ZA 3VR9A 5FXWA 2D0TA 4YSXA 1U4QA 3HKEE 2D2SA 4HFBA 2XAHB 2RA1A 3EAMA 3J7Yq 3GWHA 4CN1A 3Q9DA 3RRCA 3ONJA 4AQGA 3ZSTA 3LJCA 3PUGA 3EUHA 5JTGA 3UFGA 3JCFA 2WZHA 4EB6E 2A72A 4KP3C 5CA0E 4JI8T 4ZHQE 3PJAA 1UUSA 2XPKA 4H9PC 1HX1B 2LJLA 3CK6A 5HAXA 4LF7T 2EHOD 2VASA 3UU3A 4QXBB 4OFZA 2XAJB 3C51A 4QHOA 2V8SV 5AQRB 3A8YC 5LCYA 4YTMA 3E08A 3QB5K 4I4TE 4DR3T 4QH1A 2BS3A 2ZM2A 3UUBA 2PTFA 1WR6A 1NENA 2YU2A 3KV4A 4O4IE 1E7PA 1UCUA 4B6XA 4UR9A 5JREA 2KWHA 2BZBA 1YW0A 5H6QB 2FJEA 3TLSA 2BVLA 4EGWA 2WP9A 2VB6A 2XUEA 2XQ4A 4U7YA 2JIWA 2MOZA 4Q25A 3RX6A 1KNRA 2XQ6A 3C50A 3VR8A 4P1NA 2XTLA 3EHZA 2W0GA 1BR1A 1Z8UA 3FBZA 2YK0A 3IF8B 5JVDE 4AQYT 3H3MA 4HE8A 4YXDA 4IL4A 4DMWA 4UVAB 3KINB 4I55E 2VKDA 4ILBA 3UUXB 3KFWX 3KVAA 3VRBA 2XQ3A 4EIWA 2YDQA 2LSJA 5AQMB 3E22E 2Y6XA 3JADA 3UQ4A 4HWIB 5A1LA 4X64T 4DV6T 2MYSA 3NKZA 3FZHB 4K0UA 2LRKA 3I0QA 4ZI2C 3IEEA 3LK2B 2XJ7A 1SA0E 4UF0B 2WMOA 3Q5XA 4AKLA 5HXRA 4TV9E 3CKDA 2LSYA 1W0AA 3VHLA 4B3RT 4DV7T 3AA0B 3LBXA 4ZOLE 3FHNA 2VKHA 5L4EA 3I9WA 2CMRA 3RKOA 2V6XA 2W66A 3ZPOA 4H9QC 4I43B 2DI4A 3OJAA 3AVRA 4XAXB 4JI1T 4B3ST 3HA4A 3KBTA 1N34T 1KK7A 1MMNA 1Z0PA 2CE7A 4Z91A 2UXXB 3FZMB 4TWHA 5C8YE 2PBIA 5AQUB 4TNVA 3CWZB 4ZI3C 3AE7A 3M3ZB 2E9XB 1U5PA 3R84B 1OXZA 1WCRA 3ZN0B 5L3GB 5HXSA 4QKNA 2KINB 3RYHE 4L9IA 2EHOA 1UGOA 3PJAJ 3CPZA 2X9YA 1D1AA 4OYKA 3KVBA 5HEHA 4IDPA 3JC6D 3KBUA 3KV5A 2XAGB 5M4YA 5JRCA 2M67A 2QA7A 2QYWA 3UULA 1ZEEA 5JR9B 3G06A 2B76A 4OHFA 4PFOA 3RYCE 5CB4E 2VURA 4OYJA 2ZMAA 2C5KT 1Y64B 3CQCB 5EK3A 5AQOB 2FJAA 5IYZE 2WU5A 2VWAA 3ZMUB 2NOXA 1XMQT 3TLWA 4IT4A 2X68A 3KV6A 1OEDA 2I0MA 1JNZA 3AB3B 3WI3A 5DQWA 2NWBA 2JQQA 2V5CA 1XWMA 5KDMC 2IC9A 5LHHB 3BQIA 4IHJE 1H7CA 3AEFA 4DV2T 3M65A 3TLUA 1FJGT 3AVSA 1D1BA
chains in the Genus database with same CATH topology
4A5XA 5CJ5A 5FVLA 2CRBA 4ZEYA 4P1NA 5LB7B 3ZT6A 2W2UA 2JQHA 2V6YB 2DL1A 4U7IA 3K1SA 2V6YA 1YXRA 5CGMA 4WZXA 1WCRA 5FVKA 4U3CA 4NIQA 2WWVA 2WY2A 3ZSTA 2K3WA 1WR0A 4CN6A 2CPTA 2MPKA 2A9UA 2JQKA 2LRKA 3ZT5A 1WFDA 4CN4A 2V6XA 4U33A 3ZSSA 3ZT7A 3EABA 4U7YA 2XZEA 4U2YA 4U31A 2JQ9A 2LRLA 2RPAA 4IT4A 4U2ZA 4CN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5X A;  5CJ5 A;  5FVL A;  2CRB A;  4ZEY A;  4P1N A;  5LB7 B;  3ZT6 A;  2W2U A;  2JQH A;  2V6Y B;  2DL1 A;  4U7I A;  3K1S A;  2V6Y A;  1YXR A;  5CGM A;  4WZX A;  1WCR A;  5FVK A;  4U3C A;  4NIQ A;  2WWV A;  2WY2 A;  3ZST A;  2K3W A;  1WR0 A;  4CN6 A;  2CPT A;  2MPK A;  2A9U A;  2JQK A;  2LRK A;  3ZT5 A;  1WFD A;  4CN4 A;  2V6X A;  4U33 A;  3ZSS A;  3ZT7 A;  3EAB A;  4U7Y A;  2XZE A;  4U2Y A;  4U31 A;  2JQ9 A;  2LRL A;  2RPA A;  4IT4 A;  4U2Z A;  4CN1 A; 
#chains in the Genus database with same CATH topology
 4F6R C;  1QUU A;  2NP9 A;  4HWF A;  2CHO A;  2CWO A;  1M62 A;  3U78 A;  1J5W A;  4NUV A;  4HFH A;  2YU1 A;  4DR4 T;  1NAF A;  4JI5 T;  2KSR A;  4J2C A;  3LDQ B;  4CN4 A;  3ZYK A;  2MAW A;  4HFV A;  4JUY A;  4DUZ T;  2BS2 A;  3A7M A;  5ABF A;  3IHR A;  5FVL A;  2LHR A;  4AQF C;  1Y01 A;  3LBX B;  1ZV4 X;  3ESL A;  4BAY B;  4JYA T;  3HI2 A;  2C0S A;  3A5X A;  2BG9 A;  5F5W A;  3QUJ A;  2UUB T;  4JI2 T;  4U74 A;  2CBJ A;  2VQF T;  1AJ3 A;  2DHR A;  2H3R A;  5J1G A;  2LM9 A;  2JRK A;  2LKH A;  4QWN B;  2HPJ A;  3KV9 A;  2XSB A;  2I59 A;  4FI5 A;  4ZS2 A;  2HPL A;  2W63 A;  1HFA A;  2ZLY A;  4IRE A;  3PUR A;  3UU6 A;  2EHO B;  2CBI A;  3OYZ A;  4LMK A;  5ABG A;  3RGL A;  5AQP B;  4A56 A;  3K3O A;  1UK5 A;  2LT3 A;  4AKI A;  2E9X C;  3ZLI A;  2XQ5 A;  3HKD E;  2BKN A;  4COF A;  5ABH A;  4B3M T;  1E1H B;  4PK5 A;  3RIA A;  3GA8 A;  4L0R A;  3C64 A;  2LLY A;  2BDE A;  1V9D A;  2V1D B;  4KX6 A;  4LF9 T;  4WW0 A;  3MK7 C;  4X1I E;  2M6B A;  4HWH A;  4JI6 T;  3TLT A;  1US7 B;  4EZ4 A;  3MJX A;  1W9R A;  1I94 T;  5HXE A;  1UX5 A;  4ZXL A;  2W62 A;  3N9P A;  5JR9 C;  4KI0 F;  5CA1 E;  4IDN A;  4ZI7 E;  3K3N A;  4GK0 E;  3K3Q C;  1OED B;  3FZF B;  3I0O A;  4P09 A;  3FXD B;  3K1S A;  3C4W A;  4CZZ B;  2V7I A;  3QK6 A;  3N9N A;  3SS1 A;  2H88 A;  4HWC A;  2D9D A;  4GIW A;  4EZH A;  5HWX A;  3ANW A;  4ANJ A;  1YQ3 A;  3AEB A;  4WBO A;  4GYR A;  4DBQ A;  1L0V A;  5AQK B;  5HXH A;  3AXJ A;  3EDU A;  3IA3 A;  1ZHC A;  2V7L A;  3NVO A;  2C5I T;  1MIV A;  4IST A;  3OVU A;  3MZK B;  3HL6 A;  4ZZB A;  5L47 A;  3T8O A;  1OWA A;  4O4H E;  1T72 A;  2IDO B;  3ETV A;  4ASK A;  2FJD A;  5ABF B;  4H9O C;  4DV4 T;  5FKY A;  4ZS3 A;  2BBJ A;  4G2A A;  3TKL B;  1N33 T;  4TUY E;  3T1H T;  5L4H A;  2CXL A;  4IDO A;  5KMG P;  2LRL A;  2J62 A;  2CM0 A;  4DO0 A;  3BQK A;  3MA9 A;  3I9Y A;  1ZP0 A;  2W4X A;  4EAH A;  3PDY A;  3OYX A;  2WM9 A;  3HR0 A;  4PAG A;  1NEK A;  1VRB A;  4YHH T;  4MLK A;  2OV9 A;  4X20 E;  3AA6 B;  4X66 T;  2IUB A;  2ZM8 A;  2F4V T;  5AQT B;  3PUV F;  3LFM A;  3RKG A;  3O4X E;  2L9Q A;  4ISS A;  2V6Y A;  5BR8 T;  3UU5 A;  2HH7 A;  5FVK A;  3ZMT B;  2DCF A;  3RYF E;  1YKE B;  2CWY A;  2JPF A;  2WDV A;  3UU8 A;  4LMJ A;  3RHW A;  1J5E T;  5JDM A;  2V7M A;  2KLQ A;  5E0O A;  1E2A A;  3OTO T;  1SE7 A;  3FXE B;  4WNK A;  2N2N A;  2BBH A;  2V7K A;  2EHO C;  2QVA A;  2AXD S;  4KUM B;  3RIU A;  4H9S E;  4ZZC A;  4DV5 T;  3AE5 A;  4DUY T;  4U2Z A;  1I6Z A;  4DND A;  4IE4 A;  4ERR A;  5FXZ A;  1VCS A;  1FEW A;  4IL9 A;  5L3C B;  2B1E A;  1HG5 A;  5LG4 A;  3PUA A;  1YD8 G;  4GYS A;  4H63 H;  3AEE A;  2V7J A;  2YN6 A;  3DJB A;  1BR4 A;  4XZC A;  4YFS A;  2H7V C;  3ZYM A;  3S4U A;  3N9L A;  1R8I A;  4QH5 A;  2YKS A;  4KHP T;  5FMN A;  2XQ9 A;  2FJB A;  5LHG B;  1OED C;  4YJ2 E;  3SWH A;  4GOU A;  5LGU B;  2W61 A;  3Q5W A;  3ZMZ B;  3TLV A;  2ZM6 T;  4MAL A;  1D0Y A;  4CXW A;  1NWM X;  1BR2 A;  2KND A;  3N9O A;  4TWF A;  2P9B A;  2LEH A;  4YT0 A;  4CQI A;  1ZKE A;  2LM2 A;  3V5U A;  4H63 V;  3ZJ2 A;  5CJ5 A;  2FUP A;  2IIU A;  3NWI A;  4LFB T;  1LVK A;  4MFR A;  3AE1 A;  4G63 A;  2Y48 B;  4DR5 T;  5DQV A;  5J0Z A;  1VOM A;  2H89 A;  3P4R A;  1OED E;  2MTQ A;  2LSI A;  2N1G A;  2L3L A;  3NRY A;  2V6Y B;  4NXN T;  2XQY A;  2JMH A;  2ODU A;  4H9N C;  3AAE B;  1D0Z A;  3I1A A;  4BJM A;  5HXC A;  1UX4 A;  4QH4 A;  4U2Y A;  4DR6 T;  3CX6 B;  4UEM A;  1B7T A;  4UV9 B;  3HKC E;  3SFE A;  3LG7 A;  3AE4 A;  4JEH B;  4HFE A;  4NPP A;  2LOS A;  5KX5 E;  1IBK T;  4JI7 T;  5LGT B;  3PUS A;  3ZJ1 A;  5L3B B;  2CRB A;  4HFC A;  2W2U A;  4X1Y E;  4GKJ T;  1X9B A;  3JC6 C;  3H3A A;  2BG9 E;  3WAK A;  2A9U A;  4IIJ E;  1WFD A;  5FP3 A;  5L3F B;  4U31 A;  3CQX C;  4NXM T;  2X9W A;  4A5X A;  4LF4 T;  2RP4 A;  2YOE A;  3AAI A;  5FNV E;  2NW9 A;  2BKO A;  5JDH A;  2CHN A;  4IE0 A;  2N9D A;  3F2E A;  4YTP A;  2UUC T;  4P0B A;  3AEC A;  3UUM A;  4O8S A;  3SOL A;  3RYI E;  4DV1 T;  4H9R C;  4DR7 T;  2QGS A;  2IML A;  3EI0 A;  2WCA A;  5LGN B;  3PV0 F;  3LK4 2;  5DAB A;  5LJN A;  3N2G E;  1HNZ T;  5FY7 A;  5KXJ A;  5FY1 A;  2VKO A;  3H37 A;  5DJQ C;  2CXD A;  2CA5 A;  4L5G A;  2WWV A;  5FY0 A;  3FBL A;  1T7S A;  1WRD A;  1LRZ A;  2XHE B;  4XBF B;  2XAQ B;  5C2T A;  2YDS A;  3PUQ A;  5ABE A;  2LOP A;  2WZI A;  3P8C D;  3P4Q A;  4HEA A;  5L2L A;  2VVS A;  2DNX A;  1N36 T;  1G73 A;  2XAS B;  2CPT A;  4LF6 T;  4CI1 B;  5LYJ E;  3R6N A;  2CLY B;  2ES0 A;  4UIG A;  2WMN A;  1MMG A;  4UXN B;  4ZEY A;  1ZOY A;  1YXR A;  2W00 A;  4Z8X A;  2K3W A;  1XDO A;  5AQS B;  4HN9 A;  3NZQ A;  5LJM A;  3PU8 A;  3GN5 A;  3AA1 B;  2HHH T;  4DID B;  2X51 A;  3BK9 A;  2PJQ A;  4CI3 B;  3D0T A;  1GQE A;  3AE3 A;  4YY3 T;  1MMA A;  2C5J A;  4CN6 A;  5JRC B;  3ONL C;  2HN2 A;  3CQG B;  5IHY A;  1CUN A;  2Q9Q D;  2XQ8 A;  3ONX A;  4NIQ A;  1MIW A;  2YDR A;  3RIU C;  4YJ3 E;  1W0B A;  3ZEF B;  2ODV A;  3L8R A;  4EXT A;  4QXC B;  3RQW A;  2W67 A;  2K9A A;  4PJN A;  1HR0 T;  2KMF A;  2ZM0 A;  1M7K A;  2UXN B;  4EYY R;  4JV5 T;  4UVC B;  2JJ9 A;  1HF8 A;  1LVF A;  3NRX A;  5EK4 A;  3SFD A;  4N78 D;  1LKX A;  4HKA A;  4BJN A;  1O3X A;  3P4W A;  4CXX A;  4U3C A;  1DU2 A;  3AEG A;  3UUN A;  5L3E B;  3B13 A;  3F57 A;  1J1J A;  1IJ5 A;  2XSA A;  3EDV A;  3ETU A;  5F3J A;  3CVR A;  5HEJ A;  4AKH A;  4NUU A;  2HN1 A;  5JH7 E;  4KBM B;  4JEU B;  4TN7 B;  1QLB A;  3ZMV B;  3QB5 A;  5C3J A;  2VL0 A;  2DL1 A;  1WYC A;  4AQF A;  1EZ3 A;  4C90 A;  3N2O A;  2ACZ A;  2Y8D A;  2BG9 B;  5LBQ B;  2VKJ A;  3RI5 A;  5AQF B;  5AQG B;  3Q5E A;  3W15 B;  2VK9 A;  2M6I A;  4TX5 A;  4UF0 A;  1IBM T;  2J4G A;  4F8H A;  4IE7 A;  5AQN B;  3ZC1 A;  2WY2 A;  4AKR B;  2IW5 B;  4DR2 T;  2XM2 A;  4JI0 T;  3N5L A;  3OKQ A;  4I0U A;  1T8B A;  4JI4 T;  3RLF F;  3O1H A;  3B5M A;  2XY8 B;  4EOZ B;  2J1D G;  3N9Q A;  3UFE A;  5FXV A;  3U3I A;  3GN5 B;  2CLY C;  4BA9 A;  2KT9 A;  5ETW A;  1IAP A;  4X1K E;  5EZY E;  2MBG A;  1MIY A;  2YIN A;  3NBX X;  2VVN A;  4IE6 A;  2X0H A;  4IDQ A;  3UT5 E;  4EED A;  2E9X A;  3PU3 A;  5CGM A;  2DLR A;  4ILU A;  4JBW F;  3VU7 H;  1IJ6 A;  4HTE A;  2E2A A;  5IUX A;  4DVD A;  4LF8 T;  3ZCJ A;  3ZT7 A;  4E7S A;  3PUZ F;  4UVB B;  4AKG A;  4PW8 A;  1MNE A;  1HNX T;  2LSK A;  3CX8 B;  2ACX A;  3Q5D A;  2Q9Q A;  3CIR A;  4KMC A;  1X79 A;  3AE2 A;  3ZT5 A;  5JR9 A;  4PK6 A;  5LBM A;  3MAC A;  5F8P A;  5HCM A;  4PNI A;  3HKB E;  1FMV A;  3PTR B;  3EVY A;  5AQH B;  4K0K T;  4HGA A;  1FMW A;  2LE8 A;  3AE6 A;  4MBQ A;  5BMV E;  4GKK T;  1FIO A;  4O2A E;  2BKP A;  3AEA A;  5HEG A;  3ANW B;  5ADX L;  3VKG A;  4LF5 T;  3AXJ B;  4CI2 B;  5FL1 A;  1YKH B;  1KFY A;  3C4X A;  2WQY A;  5J2U E;  5FXX A;  4GK5 E;  2LKG A;  4X62 T;  4ZI2 D;  2WWU A;  4QXH B;  3RPU A;  2K5B B;  5LA6 E;  4U33 A;  5L3D B;  3QNU A;  2DWK A;  5H6R B;  5HYA A;  4YTN A;  2E5V A;  2IAK A;  3J9X 1;  2IC6 A;  4PK4 A;  4ILA A;  2A2F X;  2K24 A;  3RQU A;  4YLH A;  2XM1 A;  3P50 A;  1WR0 A;  5HEU A;  2WSS V;  1D1C A;  3B57 A;  5JDL A;  1XNR T;  3VRA A;  4OX9 T;  4FJO A;  1XNQ T;  3P4P A;  1T98 A;  1HCI A;  2JQH A;  3RC3 A;  4QX7 B;  5HCJ A;  1XDP A;  4MHC A;  4O4J E;  3PUY F;  5JDN A;  2BG9 C;  3ZKR A;  4EYU A;  5JDG A;  3P4S A;  3KDS E;  2VQE T;  2X9H A;  4ZI3 D;  2J47 A;  3FZL B;  2CCQ A;  1HG2 A;  2WB5 A;  4E7Z A;  1JNR A;  2CEA A;  1HTJ F;  3O9X A;  2V5D A;  4TZ4 C;  5IWA T;  1IBL T;  2NTX A;  3JAF A;  3AED A;  5JDQ A;  2X9X A;  3O1J A;  1HNW T;  3AE8 A;  4U7I A;  3UU4 A;  1SHZ C;  2SPC A;  4KHZ F;  3BQL A;  4YHJ A;  1W09 A;  1IZN B;  3CML A;  1N32 T;  2IHR 1;  2LSG A;  4AXP A;  2NW8 A;  4LFC T;  4PJJ A;  5GON E;  2WS3 A;  1BR0 A;  3RRW A;  4HFD A;  3ZMS B;  2Q9Q B;  5LOV E;  3N9M A;  2D0U A;  2G0U A;  4M1P A;  3RF1 A;  5LXT E;  2UUA T;  5JDF A;  3L3P A;  4IDZ A;  2E5L T;  3QOF A;  3FZK B;  2KZ7 B;  5LP6 E;  5LB7 B;  4ILC A;  2X67 A;  3JAE A;  4A98 A;  5FL0 A;  4JLE A;  5AQL B;  2MPK A;  4DMV A;  2JQK A;  2QRX A;  2DWG A;  5LMU T;  4P0A A;  4O4L E;  3DP7 A;  5EK2 A;  3RC8 A;  3WAJ A;  2PFV A;  4IE5 A;  1HS7 A;  5HEO A;  2I6H A;  4EEB A;  2X66 A;  4DV0 T;  1KNZ A;  1KF6 A;  2L8K A;  1SUM B;  4LFA T;  2BS4 A;  3ABV A;  3QC9 A;  1XZY A;  2V26 A;  1KEY A;  4I50 E;  3FB2 A;  2PG8 A;  4DR1 T;  4O2B E;  3VKH A;  3DTO A;  3RH3 A;  3ZCI A;  4IGU A;  4WBN E;  2KWI B;  3AAA B;  4V1A v;  3ZC0 A;  4ADZ A;  5AQJ B;  3CX7 B;  1S35 A;  2KXP B;  2CXF A;  1G8X A;  2RPA A;  2WBL A;  4TV8 E;  2VL8 A;  2E8I A;  4UEL A;  2UU9 T;  3N2K E;  4PFP A;  5HWY A;  3LSV A;  1VCT A;  2OLT A;  1WLX A;  3P7I A;  2X0Y A;  2JQ9 A;  3AA7 B;  2UXC T;  1S94 A;  3ZT6 A;  5JQG E;  2XQA A;  4EV6 A;  3PE0 A;  5J2T E;  3AE9 A;  4AIS A;  3C98 B;  4OK0 A;  4HFI A;  3GMI A;  5LG3 A;  2E9X D;  3ZN1 B;  3MXZ A;  2NW7 A;  5AQQ B;  2X0L B;  4Z90 A;  2BVM A;  5FYM A;  2UXD T;  3O1I A;  5AFU L;  1MMD A;  3NZP A;  5AQV B;  5TAO A;  3ZYL A;  1CHU A;  4X5T A;  2NR4 A;  4U72 A;  2WU2 A;  5AQI B;  4TNW A;  3MKD A;  2FBW A;  4CXY A;  4LML A;  4TWD A;  3UQ7 A;  4DV3 T;  1D0X A;  2WDQ A;  3ZSS A;  3EAB A;  4PJM A;  2XZE A;  4WYV A;  3L39 A;  2R6G F;  2GK9 A;  1KNP A;  4X65 T;  2WAU A;  3E0Z A;  2NTY A;  5LNK A;  2JMK A;  3Q2M A;  2Q9Q C;  4DBR A;  2OA5 A;  1XMO T;  4WZX A;  2D5U A;  2A3D A;  4JI3 T;  5CFB A;  1UUR A;  1WYB A;  3RIF A;  2WDR A;  2Z6E A;  2AE9 A;  4A97 A;  1MND A;  2K48 A;  3OPC A;  3F31 A;  3K8P C;  3PUW F;  3X1D A;  1HX8 A;  3T1Y T;  2XQ7 A;  3SRZ A;  3IBP A;  2XAF B;  1QSD A;  1YQ4 A;  4HWD A;  4AIU A;  4B3T T;  4QX8 B;  2YEV C;  2UXB T;  3V5S A;  4YSY A;  4UV8 B;  3LK3 B;  3L09 A;  2H7O A;  4YSZ A;  4AI6 A;  3PUX F;  3UTK A;  5LMN T;  2LHN A;  4PJL A;  5LHI B;  3OBV E;  4C91 A;  3C4Z A;  3VR9 A;  5FXW A;  2D0T A;  4YSX A;  1U4Q A;  3HKE E;  2D2S A;  4HFB A;  2XAH B;  2RA1 A;  3EAM A;  3J7Y q;  3GWH A;  4CN1 A;  3Q9D A;  3RRC A;  3ONJ A;  4AQG A;  3ZST A;  3LJC A;  3PUG A;  3EUH A;  5JTG A;  3UFG A;  3JCF A;  2WZH A;  4EB6 E;  2A72 A;  4KP3 C;  5CA0 E;  4JI8 T;  4ZHQ E;  3PJA A;  1UUS A;  2XPK A;  4H9P C;  1HX1 B;  2LJL A;  3CK6 A;  5HAX A;  4LF7 T;  2EHO D;  2VAS A;  3UU3 A;  4QXB B;  4OFZ A;  2XAJ B;  3C51 A;  4QHO A;  2V8S V;  5AQR B;  3A8Y C;  5LCY A;  4YTM A;  3E08 A;  3QB5 K;  4I4T E;  4DR3 T;  4QH1 A;  2BS3 A;  2ZM2 A;  3UUB A;  2PTF A;  1WR6 A;  1NEN A;  2YU2 A;  3KV4 A;  4O4I E;  1E7P A;  1UCU A;  4B6X A;  4UR9 A;  5JRE A;  2KWH A;  2BZB A;  1YW0 A;  5H6Q B;  2FJE A;  3TLS A;  2BVL A;  4EGW A;  2WP9 A;  2VB6 A;  2XUE A;  2XQ4 A;  4U7Y A;  2JIW A;  2MOZ A;  4Q25 A;  3RX6 A;  1KNR A;  2XQ6 A;  3C50 A;  3VR8 A;  4P1N A;  2XTL A;  3EHZ A;  2W0G A;  1BR1 A;  1Z8U A;  3FBZ A;  2YK0 A;  3IF8 B;  5JVD E;  4AQY T;  3H3M A;  4HE8 A;  4YXD A;  4IL4 A;  4DMW A;  4UVA B;  3KIN B;  4I55 E;  2VKD A;  4ILB A;  3UUX B;  3KFW X;  3KVA A;  3VRB A;  2XQ3 A;  4EIW A;  2YDQ A;  2LSJ A;  5AQM B;  3E22 E;  2Y6X A;  3JAD A;  3UQ4 A;  4HWI B;  5A1L A;  4X64 T;  4DV6 T;  2MYS A;  3NKZ A;  3FZH B;  4K0U A;  2LRK A;  3I0Q A;  4ZI2 C;  3IEE A;  3LK2 B;  2XJ7 A;  1SA0 E;  4UF0 B;  2WMO A;  3Q5X A;  4AKL A;  5HXR A;  4TV9 E;  3CKD A;  2LSY A;  1W0A A;  3VHL A;  4B3R T;  4DV7 T;  3AA0 B;  3LBX A;  4ZOL E;  3FHN A;  2VKH A;  5L4E A;  3I9W A;  2CMR A;  3RKO A;  2V6X A;  2W66 A;  3ZPO A;  4H9Q C;  4I43 B;  2DI4 A;  3OJA A;  3AVR A;  4XAX B;  4JI1 T;  4B3S T;  3HA4 A;  3KBT A;  1N34 T;  1KK7 A;  1MMN A;  1Z0P A;  2CE7 A;  4Z91 A;  2UXX B;  3FZM B;  4TWH A;  5C8Y E;  2PBI A;  5AQU B;  4TNV A;  3CWZ B;  4ZI3 C;  3AE7 A;  3M3Z B;  2E9X B;  1U5P A;  3R84 B;  1OXZ A;  1WCR A;  3ZN0 B;  5L3G B;  5HXS A;  4QKN A;  2KIN B;  3RYH E;  4L9I A;  2EHO A;  1UGO A;  3PJA J;  3CPZ A;  2X9Y A;  1D1A A;  4OYK A;  3KVB A;  5HEH A;  4IDP A;  3JC6 D;  3KBU A;  3KV5 A;  2XAG B;  5M4Y A;  5JRC A;  2M67 A;  2QA7 A;  2QYW A;  3UUL A;  1ZEE A;  5JR9 B;  3G06 A;  2B76 A;  4OHF A;  4PFO A;  3RYC E;  5CB4 E;  2VUR A;  4OYJ A;  2ZMA A;  2C5K T;  1Y64 B;  3CQC B;  5EK3 A;  5AQO B;  2FJA A;  5IYZ E;  2WU5 A;  2VWA A;  3ZMU B;  2NOX A;  1XMQ T;  3TLW A;  4IT4 A;  2X68 A;  3KV6 A;  1OED A;  2I0M A;  1JNZ A;  3AB3 B;  3WI3 A;  5DQW A;  2NWB A;  2JQQ A;  2V5C A;  1XWM A;  5KDM C;  2IC9 A;  5LHH B;  3BQI A;  4IHJ E;  1H7C A;  3AEF A;  4DV2 T;  3M65 A;  3TLU A;  1FJG T;  3AVS A;  1D1B A; 
#chains in the Genus database with same CATH homology
 4A5X A;  5CJ5 A;  5FVL A;  2CRB A;  4ZEY A;  4P1N A;  5LB7 B;  3ZT6 A;  2W2U A;  2JQH A;  2V6Y B;  2DL1 A;  4U7I A;  3K1S A;  2V6Y A;  1YXR A;  5CGM A;  4WZX A;  1WCR A;  5FVK A;  4U3C A;  4NIQ A;  2WWV A;  2WY2 A;  3ZST A;  2K3W A;  1WR0 A;  4CN6 A;  2CPT A;  2MPK A;  2A9U A;  2JQK A;  2LRK A;  3ZT5 A;  1WFD A;  4CN4 A;  2V6X A;  4U33 A;  3ZSS A;  3ZT7 A;  3EAB A;  4U7Y A;  2XZE A;  4U2Y A;  4U31 A;  2JQ9 A;  2LRL A;  2RPA A;  4IT4 A;  4U2Z A;  4CN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...