2CRBA

Solution structure of mit domain from mouse nrbf-2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
GSSGSSGMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords nuclear receptor binding factor 2
publication title Solution structure of MIT domain from mouse NRBF-2
rcsb
source organism Mus musculus
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2crbA00
2V6YA 4CN1A 3EABA 2LRKA 3K1SA 2V6YB 2XZEA 1YXRA 4IT4A 4U2ZA 2CPTA 4U7IA 5FVLA 2RPAA 4U31A 3ZSSA 2V6XA 4U33A 4A5XA 4CN4A 2JQKA 3ZT5A 5CJ5A 1WCRA 4NIQA 5FVKA 2LRLA 4U2YA 3ZT6A 2DL1A 2JQ9A 4U3CA 4CN6A 2CRBA 4U7YA 2W2UA 2WY2A 4WZXA 5CGMA 2MPKA 3ZSTA 1WR0A 3ZT7A 5LB7B 2JQHA 2K3WA 4P1NA 1WFDA 4ZEYA 2WWVA 2A9UA
chains in the Genus database with same CATH superfamily
2OV9A 3MZKB 2XJ7A 4GIWA 1XDOA 3ZSSA 3KDSE 3OVUA 4TUYE 4H9PC 2K9AA 4GK5E 1JNRA 5IHYA 4CZZB 5FXXA 4DVDA 4L0RA 1T8BA 4P09A 2ODUA 1HFAA 5ABEA 2YK0A 5LNKA 3J7Yq 2X68A 2NR4A 4DMVA 5L3GB 5GONE 1UX5A 2X9WA 3HA4A 2FJDA 2JPFA 3SOLA 4HWFA 4A98A 2V5CA 2OA5A 3QK6A 2KLQA 4U74A 2NW7A 3LG7A 3OPCA 4GOUA 3BQLA 2WU2A 4H9QC 2KWIB 1U4QA 3IBPA 2Y8DA 3AE3A 2UUBT 5HEJA 3ONLC 2NWBA 3O1HA 3EVYA 1HG5A 5C2TA 2HN2A 1SE7A 2WBLA 3AA0B 3PUXF 4U2YA 3HL6A 2WY2A 5AQTB 2V7JA 2F4VT 3PUGA 2J4GA 1MIWA 3L3PA 3M65A 3U78A 1HNZT 4E7SA 1ZV4X 5AQQB 4DR4T 2NW9A 3I9YA 3KV9A 1XZYA 4P0AA 3HKDE 1E2AA 4AI6A 3GA8A 3T1YT 2V7LA 4B6XA 3Q5DA 2EHOA 5ABGA 3ANWB 1HG2A 5LHGB 2CEAA 4CXWA 2LHRA 4TV9E 1SUMB 4TWHA 4H9SE 4HGAA 1CUNA 3RC8A 4EB6E 2A9UA 2CHOA 5L4EA 3SWHA 5EK2A 5HCJA 4YLHA 2DLRA 3ZJ1A 4QH1A 4IHJE 5L3EB 1CHUA 4AQFA 4A56A 3I0OA 1DU2A 2WCAA 4O4JE 2K3WA 5JR9A 4PNIA 4IE4A 2L9QA 4KHPT 2N9DA 4B3TT 1IJ6A 2FJAA 4V1Av 5AQPB 2BDEA 2BG9B 1FEWA 3PURA 5IWAT 3AVSA 1WCRA 3MJXA 5FY0A 5JH7E 3ZMSB 4QHOA 2CBIA 1N33T 2ES0A 2V6YA 3RYHE 2CA5A 2B76A 3C51A 4EEBA 2BZBA 4UVAB 4DV5T 3CQGB 2JJ9A 2BBJA 2D2SA 4DR6T 4DV3T 2ZM0A 3N9QA 3C4ZA 2LSGA 5HWYA 2V8SV 4TNVA 5FY1A 2IIUA 4JI8T 3O1IA 1UK5A 2XQ3A 4OX9T 2C5JA 4A5XA 2XAQB 2YN6A 4IE0A 4BAYB 3JAEA 3C4WA 3H3MA 5C8YE 3S4UA 4E7ZA 1US7B 3L09A 1XMOT 3RIAA 2PG8A 4UIGA 2VL8A 2VURA 4HWHA 2LSYA 3E0ZA 3GWHA 3W15B 4PFPA 2AE9A 3NBXX 1T7SA 4O8SA 1UGOA 2X9XA 4KP3C 3G06A 3PE0A 3FZLB 4ZXLA 3AE1A 1BR0A 2W62A 5AQOB 1Z8UA 3CWZB 4ZI3C 4WZXA 1BR4A 3RRWA 4ZS2A 2VVNA 4IDOA 2CMRA 1S94A 4CN1A 1KK7A 4QKNA 5H6QB 2X66A 2CWYA 2CXLA 2W61A 4NXMT 5LHIB 1W9RA 2ZM6T 3WAJA 1ZOYA 2CBJA 2IUBA 3EDVA 2UXBT 2PJQA 1X9BA 2H89A 4DMWA 2WAUA 4MLKA 1XNQT 3LK42 2EHOC 3FZKB 3AAAB 2CRBA 5AQKB 4XBFB 3K3QC 2MTQA 3F57A 2LE8A 5LG3A 3N2KE 1FMVA 2B1EA 4GKJT 4X66T 2VKOA 2CM0A 3AA1B 4HFBA 5FP3A 2LHNA 3EUHA 4ERRA 3NKZA 5CGMA 4ZI2C 2WMOA 2IDOB 2XQ9A 3UU4A 2NOXA 4AQFC 5JR9C 5L4HA 2CLYC 2V6YB 1YXRA 2Q9QD 2UUCT 5LHHB 3O1JA 3HKCE 3A7MA 2MYSA 4FJOA 4X20E 1OEDB 2DI4A 2IAKA 2CCQA 2BG9E 3PDYA 1KNZA 4ZZCA 1KFYA 5ABHA 3UT5E 1D0YA 4F8HA 4NXNT 5JDQA 2I0MA 5AQGB 5JDHA 2BKOA 2YEVC 3TKLB 3FB2A 2D0UA 4EGWA 1ZKEA 3CQCB 3AE6A 3ZSTA 2K48A 2PBIA 1W09A 4PJNA 1LVFA 2WP9A 4JYAT 4TX5A 4NPPA 4ZHQE 4IT4A 4WBOA 3MXZA 2XSAA 2RP4A 2XQ8A 3CPZA 2ACZA 2X0HA 1NENA 2FBWA 3K8PC 4ZI3D 1VRBA 4U72A 3H3AA 4MFRA 4GYRA 1N36T 4KI0F 3PUZF 4LMLA 3RYFE 2ZM8A 5KXJA 4X1KE 3VRBA 1WR0A 4LMJA 2IC6A 3IA3A 5F5WA 2UU9T 3VR9A 1GQEA 3CKDA 5AQMB 3OBVE 2DNXA 2FJBA 3ZT5A 1X79A 3RF1A 3AAIA 2EHOD 2V5DA 2XQAA 3UU5A 3LSVA 3DJBA 3FZFB 4JI2T 1YKHB 5EK4A 1KNRA 3UUBA 2ACXA 3ETVA 2H7OA 2LSJA 2XM2A 3UU8A 3UUXB 1JNZA 2XQ5A 5JTGA 5DQVA 1ZEEA 3HKBE 4UEMA 2E9XC 4EOZB 4JI0T 1D0XA 2IHR1 5KDMC 5J0ZA 4HFEA 4BA9A 3TLSA 1UUSA 2X0LB 3RRCA 3B13A 3RIUA 4I4TE 2VKDA 2Y6XA 4IL4A 5JRCB 3KV6A 5HEOA 3K3OA 5CA0E 1IZNB 4FI5A 3U3IA 3N2OA 4HKAA 1OWAA 2JMHA 2P9BA 2PTFA 4PK4A 3KVBA 2WMNA 1EZ3A 4TV8E 4HWDA 2LOPA 3WI3A 4UXNB 5FVLA 4YJ2E 4KMCA 2XAGB 4MBQA 1Z0PA 5LMNT 1KEYA 4LF5T 3E08A 1KF6A 3NZQA 4EAHA 5C3JA 5AQVB 1LVKA 2V7KA 3AEAA 5AQLB 1VCTA 4KHZF 3PUVF 1O3XA 3AEDA 3K1SA 3NVOA 3C98B 3RPUA 4JI3T 3ZYLA 2KNDA 2XM1A 2DWGA 2VK9A 4YSXA 4BJMA 4L9IA 3UTKA 3AE5A 2OLTA 3L39A 5L3BB 2QGSA 2BVMA 2CWOA 3PU8A 3AXJA 4AKIA 1L0VA 5HXRA 5AFUL 3QNUA 2WS3A 4JEUB 2V26A 3UUNA 4IDZA 1I94T 4LFCT 4QXHB 2UUAT 4B3RT 1VCSA 5J2TE 5HXSA 2XAJB 3ZKRA 3LJCA 3SFDA 1UX4A 2RPAA 1NAFA 1HNWT 4C91A 2M6IA 2G0UA 2W00A 4TNWA 5LOVE 3X1DA 3RYIE 2HH7A 4J2CA 3UUMA 4O4LE 2WU5A 2YDQA 1J1JA 2E9XD 3N5LA 5HCMA 2KMFA 5LJMA 4DR3T 2XAFB 4JBWF 3RC3A 2A72A 3MKDA 2WZIA 5LBMA 3SFEA 3KFWX 3M3ZB 3FXDB 4TWDA 3MK7C 2MPKA 3NZPA 4YTMA 4JV5T 2YDSA 3AEBA 3RYCE 4DV2T 3EABA 2BS3A 4YY3T 2BG9C 2SPCA 1WR6A 1OEDA 2VL0A 3UFGA 5ETWA 3N9PA 5L3DB 1S35A 3VKHA 4ADZA 2LKHA 4K0UA 3O9XA 2XQ4A 4ZEYA 4JI4T 2Q9QC 4GKKT 2VWAA 3C4XA 3E22E 3RIUC 4G2AA 3MACA 1E7PA 4EZHA 2BS2A 3T8OA 3JAFA 3AE2A 4AIUA 3D0TA 2YINA 4NUUA 4HFVA 1IAPA 5L47A 1HCIA 4PAGA 4JEHB 3RKGA 1QLBA 3ESLA 2V1DB 4C90A 1HF8A 4Q25A 2D9DA 1G8XA 2L3LA 1WLXA 3IF8B 3V5UA 5IUXA 5AQFB 5HAXA 4Z90A 4MHCA 3AXJB 2YU2A 5CB4E 2DL1A 2XY8B 4LFAT 4ILCA 1IBMT 4GK0E 1ZP0A 2XQ7A 3R84B 4HFDA 5LP6E 3B5MA 3A8YC 2WDRA 2CXFA 3OYXA 3N2GE 4KX6A 2IMLA 4G63A 2V7MA 5LCYA 1HR0T 4LF9T 5HYAA 2Z6EA 2X9HA 1MIVA 4A97A 1FIOA 4AKGA 2YU1A 4DV4T 3MA9A 4H9NC 2YKSA 3OYZA 3UFEA 5FY7A 4QWNB 5M4YA 4QH5A 5AQSB 4DV1T 3EI0A 3UU3A 1UCUA 4H9RC 4M1PA 4WNKA 3ZMZB 1NWMX 4YXDA 2HPLA 2LKGA 2ZLYA 3JC6C 1MMDA 3RH3A 5HXHA 4UF0B 1XNRT 2ZMAA 1QUUA 5FXVA 1WFDA 2LT3A 2CLYB 5JRCA 2DHRA 2AXDS 4YJ3E 5IYZE 4TN7B 3FHNA 2NTXA 2YDRA 2E8IA 1LRZA 3LDQB 2L8KA 4IE5A 4IDQA 2JQ9A 3IHRA 2H3RA 5HXEA 3CX6B 3PTRB 4I43B 5BR8T 5KMGP 1T98A 3PV0F 2X9YA 2Y48B 3J9X1 2D0TA 1Y64B 3QC9A 4CN4A 4OK0A 2LRLA 3P4QA 4YSYA 2H7VC 4KBMB 3T1HT 2DWKA 2KXPB 5L3FB 4DV7T 2A3DA 1FJGT 5AQJB 1HX8A 3FZMB 3JCFA 4AQYT 3OJAA 1AJ3A 4TWFA 3RIFA 2YOEA 2DCFA 2LM2A 1M62A 3RX6A 4CXXA 1IJ5A 2H88A 5HEGA 3KBUA 4WYVA 1MNEA 4K0KT 4ZI7E 2BVLA 3I0QA 3KINB 4WBNE 4YSZA 5JDMA 3AEGA 3P4SA 3PU3A 4U7IA 2C0SA 2XQ6A 1YKEB 2KZ7B 2X51A 1M7KA 1OXZA 2W63A 5DJQC 3AE7A 2CE7A 3ONJA 4PJJA 3AA6B 5FXWA 3JADA 2KINB 2N2NA 3CQXC 3C64A 2MBGA 5L3CB 2J47A 3AB3B 4ASKA 4DR7T 4OYKA 4DR2T 4HWIB 4B3ST 4EZ4A 3R6NA 2HHHT 5AQUB 3AAEB 5HWXA 4HN9A 4OFZA 4DV0T 5JDFA 1LKXA 3JC6D 3BQIA 4UVBB 2HPJA 4AKHA 2MOZA 5FL1A 2WZHA 3Q2MA 5EK3A 3ZC1A 1J5ET 3AECA 4LF6T 5LBQB 2NW8A 4ISSA 4NUVA 3QOFA 3ZPOA 1WYBA 1MIYA 2VVSA 2LJLA 2JQHA 3RQWA 3PJAA 2UXNB 2IC9A 3Q5XA 3ZN0B 3Q5WA 5AQNB 4U33A 4YTPA 4OHFA 2WWUA 1HX1B 4CI1B 3AE9A 3PUWF 1NEKA 3TLVA 3HI2A 4XZCA 1N34T 2KT9A 3F31A 1YQ4A 4JI5T 3GMIA 2UXCT 2X67A 5ABFA 4EIWA 3GN5B 4JI1T 3UQ7A 4LFBT 1SA0E 3B57A 2W67A 3QUJA 2X0YA 4LF8T 4I50E 2ZM2A 4OYJA 4DUYT 1FMWA 1UURA 3RQUA 5LGNB 4EV6A 4O2BE 4CI3B 3ZYKA 3KBTA 3QB5K 5LGUB 1OEDE 1I6ZA 1D0ZA 4UV8B 2QVAA 4BJNA 4X1IE 4H63H 5CJ5A 4HFIA 3LFMA 4WW0A 3ZYMA 5L2LA 3P7IA 1ZHCA 4X1YE 4Z91A 5AQIB 4EXTA 4LMKA 2QRXA 1E1HB 3V5SA 3UULA 3N9OA 4UVCB 3ETUA 1N32T 5H6RB 4CI2B 5J1GA 4X5TA 3OTOT 2E5LT 4IREA 4PFOA 3ZJ2A 4CQIA 3KV4A 3EAMA 2JIWA 1IBLT 2QYWA 2UXXB 2XASB 3PUSA 5FYMA 3DP7A 2XQYA 4QX8B 5LMUT 2M67A 5EZYE 3FBLA 1HTJF 4YFSA 2LOSA 2JRKA 4IIJE 4JLEA 3F2EA 3RKOA 4DUZT 4JI7T 4EYUA 3UU6A 3NRXA 2KWHA 2E2AA 2CXDA 4JUYA 1R8IA 2WB5A 3ZT6A 4XAXB 3K3NA 4YT0A 4P1NA 4ZZBA 1H7CA 1MMAA 2VQET 4UR9A 5LYJE 2JQKA 2VB6A 3AEFA 3ZMUB 4AQGA 3LBXA 1XMQT 1MMGA 4UF0A 2HN1A 3VU7H 5LB7B 4P0BA 4H9OC 3SRZA 5CA1E 3AEEA 3PJAJ 2LSIA 2WSSV 1T72A 3ONXA 4L5GA 4ILBA 3AE8A 2XAHB 4DBQA 4PK6A 4O4IE 3VHLA 3DTOA 4KUMB 2Q9QB 5A1LA 4HTEA 3ZMVB 1D1BA 2W66A 2M6BA 2C5IT 4HFCA 4AISA 4B3MT 5ABFB 2VKHA 5HEUA 4QXCB 3WAKA 4ZOLE 2BKPA 2C5KT 4GYSA 2A2FX 2W4XA 2WWVA 2UXDT 3BK9A 3ZCJA 4IDPA 3RLFF 3TLUA 4LF4T 2XTLA 2CPTA 5FL0A 1HS7A 2MAWA 2I6HA 4PJLA 4YTNA 4HE8A 4YHJA 4COFA 3AA7B 3PUAA 4IGUA 5DQWA 3TLTA 2N1GA 3L8RA 2BS4A 3FZHB 4Z8XA 2BBHA 2WDQA 2W0GA 3N9LA 4U31A 4ZS3A 5CFBA 2LSKA 4IE7A 3Q5EA 2K5BB 2J62A 4I0UA 5HXCA 1Y01A 5BMVE 2CHNA 2VKJA 1U5PA 3CMLA 5LG4A 5LJNA 2XZEA 3IEEA 2PFVA 2VQFT 1VOMA 5JVDE 3SS1A 4H63V 1SHZC 3LK2B 4DV6T 3N9MA 4ANJA 3P50A 4LF7T 3ZEFB 3HR0A 5FNVE 5JQGE 2V6XA 2EHOB 3ZC0A 4F6RC 4IE6A 3NRYA 3VR8A 5LGTB 3ZLIA 4O4HE 1WRDA 3CX7B 1D1AA 3NWIA 3FXEB 3P4WA 2E9XA 2FUPA 2LEHA 1MNDA 1B7TA 3CX8B 2E5VA 3LBXB 3BQKA 4PW8A 1YD8G 5AQRB 1YQ3A 1J5WA 5JR9B 3N9NA 5DABA 2XHEB 5F8PA 4O2AE 3PUYF 3RHWA 2NTYA 2VASA 4NIQA 4U3CA 3AE4A 3I9WA 2ODVA 4JI6T 4ILUA 5TAOA 5JREA 4YHHT 4DR1T 5JDGA 3GN5A 5KX5E 5ADXL 4DIDB 5FVKA 5FMNA 1OEDC 1HNXT 1BR2A 3LK3B 4DO0A 4PJMA 5JDNA 2JMKA 4DBRA 3CK6A 3EDUA 4ILAA 4QXBB 3H37A 4DNDA 3HKEE 4UELA 3P8CD 4HFHA 2D5UA 2QA7A 1D1CA 4UV9B 2K24A 2FJEA 5FXZA 2I59A 3VKGA 3O4XE 5HEHA 3EHZA 3TLWA 5FKYA 2IW5B 2KSRA 5AQHB 5JDLA 1WYCA 3ZCIA 4U7YA 2JQQA 4CXYA 3CVRA 3PUQA 3QB5A 1G73A 1MMNA 3A5XA 3FBZA 2WQYA 4DR5T 4CN6A 3P4RA 4AXPA 1YW0A 3KVAA 3ZT7A 2XUEA 3CIRA 3I1AA 2WDVA 3ZMTB 4MALA 3RI5A 3OKQA 3Q9DA 2LRKA 3VRAA 4ISTA 2LM9A 5LA6E 2WM9A 3ANWA 3ZN1B 1W0BA 2XPKA 3C50A 2R6GF 4I55E 3RGLA 4EYYR 1QSDA 5E0OA 2LLYA 4IL9A 5F3JA 1V9DA 4QH4A 4IDNA 1BR1A 3P4PA 4X62T 2E9XB 1IBKT 4X64T 4PK5A 5J2UE 1XDPA 2GK9A 2RA1A 2NP9A 2W2UA 4EEDA 3KV5A 4ZI2D 2J1DG 4AKRB 2BG9A 2BKNA 1W0AA 3ABVA 4TZ4C 4U2ZA 4QX7B 4X65T 2V7IA 2XSBA 1XWMA 3AVRA 1KNPA 4HEAA 3UQ4A 4HWCA 2Q9QA 4N78D 4AKLA 5LXTE
chains in the Genus database with same CATH topology
2V6YA 4CN1A 3EABA 2LRKA 3K1SA 2V6YB 2XZEA 1YXRA 4IT4A 4U2ZA 2CPTA 4U7IA 5FVLA 2RPAA 4U31A 3ZSSA 2V6XA 4U33A 4A5XA 4CN4A 2JQKA 3ZT5A 5CJ5A 1WCRA 4NIQA 5FVKA 2LRLA 4U2YA 3ZT6A 2DL1A 2JQ9A 4U3CA 4CN6A 2CRBA 4U7YA 2W2UA 2WY2A 4WZXA 5CGMA 2MPKA 3ZSTA 1WR0A 3ZT7A 5LB7B 2JQHA 2K3WA 4P1NA 1WFDA 4ZEYA 2WWVA 2A9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6Y A;  4CN1 A;  3EAB A;  2LRK A;  3K1S A;  2V6Y B;  2XZE A;  1YXR A;  4IT4 A;  4U2Z A;  2CPT A;  4U7I A;  5FVL A;  2RPA A;  4U31 A;  3ZSS A;  2V6X A;  4U33 A;  4A5X A;  4CN4 A;  2JQK A;  3ZT5 A;  5CJ5 A;  1WCR A;  4NIQ A;  5FVK A;  2LRL A;  4U2Y A;  3ZT6 A;  2DL1 A;  2JQ9 A;  4U3C A;  4CN6 A;  2CRB A;  4U7Y A;  2W2U A;  2WY2 A;  4WZX A;  5CGM A;  2MPK A;  3ZST A;  1WR0 A;  3ZT7 A;  5LB7 B;  2JQH A;  2K3W A;  4P1N A;  1WFD A;  4ZEY A;  2WWV A;  2A9U A; 
#chains in the Genus database with same CATH topology
 2OV9 A;  3MZK B;  2XJ7 A;  4GIW A;  1XDO A;  3ZSS A;  3KDS E;  3OVU A;  4TUY E;  4H9P C;  2K9A A;  4GK5 E;  1JNR A;  5IHY A;  4CZZ B;  5FXX A;  4DVD A;  4L0R A;  1T8B A;  4P09 A;  2ODU A;  1HFA A;  5ABE A;  2YK0 A;  5LNK A;  3J7Y q;  2X68 A;  2NR4 A;  4DMV A;  5L3G B;  5GON E;  1UX5 A;  2X9W A;  3HA4 A;  2FJD A;  2JPF A;  3SOL A;  4HWF A;  4A98 A;  2V5C A;  2OA5 A;  3QK6 A;  2KLQ A;  4U74 A;  2NW7 A;  3LG7 A;  3OPC A;  4GOU A;  3BQL A;  2WU2 A;  4H9Q C;  2KWI B;  1U4Q A;  3IBP A;  2Y8D A;  3AE3 A;  2UUB T;  5HEJ A;  3ONL C;  2NWB A;  3O1H A;  3EVY A;  1HG5 A;  5C2T A;  2HN2 A;  1SE7 A;  2WBL A;  3AA0 B;  3PUX F;  4U2Y A;  3HL6 A;  2WY2 A;  5AQT B;  2V7J A;  2F4V T;  3PUG A;  2J4G A;  1MIW A;  3L3P A;  3M65 A;  3U78 A;  1HNZ T;  4E7S A;  1ZV4 X;  5AQQ B;  4DR4 T;  2NW9 A;  3I9Y A;  3KV9 A;  1XZY A;  4P0A A;  3HKD E;  1E2A A;  4AI6 A;  3GA8 A;  3T1Y T;  2V7L A;  4B6X A;  3Q5D A;  2EHO A;  5ABG A;  3ANW B;  1HG2 A;  5LHG B;  2CEA A;  4CXW A;  2LHR A;  4TV9 E;  1SUM B;  4TWH A;  4H9S E;  4HGA A;  1CUN A;  3RC8 A;  4EB6 E;  2A9U A;  2CHO A;  5L4E A;  3SWH A;  5EK2 A;  5HCJ A;  4YLH A;  2DLR A;  3ZJ1 A;  4QH1 A;  4IHJ E;  5L3E B;  1CHU A;  4AQF A;  4A56 A;  3I0O A;  1DU2 A;  2WCA A;  4O4J E;  2K3W A;  5JR9 A;  4PNI A;  4IE4 A;  2L9Q A;  4KHP T;  2N9D A;  4B3T T;  1IJ6 A;  2FJA A;  4V1A v;  5AQP B;  2BDE A;  2BG9 B;  1FEW A;  3PUR A;  5IWA T;  3AVS A;  1WCR A;  3MJX A;  5FY0 A;  5JH7 E;  3ZMS B;  4QHO A;  2CBI A;  1N33 T;  2ES0 A;  2V6Y A;  3RYH E;  2CA5 A;  2B76 A;  3C51 A;  4EEB A;  2BZB A;  4UVA B;  4DV5 T;  3CQG B;  2JJ9 A;  2BBJ A;  2D2S A;  4DR6 T;  4DV3 T;  2ZM0 A;  3N9Q A;  3C4Z A;  2LSG A;  5HWY A;  2V8S V;  4TNV A;  5FY1 A;  2IIU A;  4JI8 T;  3O1I A;  1UK5 A;  2XQ3 A;  4OX9 T;  2C5J A;  4A5X A;  2XAQ B;  2YN6 A;  4IE0 A;  4BAY B;  3JAE A;  3C4W A;  3H3M A;  5C8Y E;  3S4U A;  4E7Z A;  1US7 B;  3L09 A;  1XMO T;  3RIA A;  2PG8 A;  4UIG A;  2VL8 A;  2VUR A;  4HWH A;  2LSY A;  3E0Z A;  3GWH A;  3W15 B;  4PFP A;  2AE9 A;  3NBX X;  1T7S A;  4O8S A;  1UGO A;  2X9X A;  4KP3 C;  3G06 A;  3PE0 A;  3FZL B;  4ZXL A;  3AE1 A;  1BR0 A;  2W62 A;  5AQO B;  1Z8U A;  3CWZ B;  4ZI3 C;  4WZX A;  1BR4 A;  3RRW A;  4ZS2 A;  2VVN A;  4IDO A;  2CMR A;  1S94 A;  4CN1 A;  1KK7 A;  4QKN A;  5H6Q B;  2X66 A;  2CWY A;  2CXL A;  2W61 A;  4NXM T;  5LHI B;  1W9R A;  2ZM6 T;  3WAJ A;  1ZOY A;  2CBJ A;  2IUB A;  3EDV A;  2UXB T;  2PJQ A;  1X9B A;  2H89 A;  4DMW A;  2WAU A;  4MLK A;  1XNQ T;  3LK4 2;  2EHO C;  3FZK B;  3AAA B;  2CRB A;  5AQK B;  4XBF B;  3K3Q C;  2MTQ A;  3F57 A;  2LE8 A;  5LG3 A;  3N2K E;  1FMV A;  2B1E A;  4GKJ T;  4X66 T;  2VKO A;  2CM0 A;  3AA1 B;  4HFB A;  5FP3 A;  2LHN A;  3EUH A;  4ERR A;  3NKZ A;  5CGM A;  4ZI2 C;  2WMO A;  2IDO B;  2XQ9 A;  3UU4 A;  2NOX A;  4AQF C;  5JR9 C;  5L4H A;  2CLY C;  2V6Y B;  1YXR A;  2Q9Q D;  2UUC T;  5LHH B;  3O1J A;  3HKC E;  3A7M A;  2MYS A;  4FJO A;  4X20 E;  1OED B;  2DI4 A;  2IAK A;  2CCQ A;  2BG9 E;  3PDY A;  1KNZ A;  4ZZC A;  1KFY A;  5ABH A;  3UT5 E;  1D0Y A;  4F8H A;  4NXN T;  5JDQ A;  2I0M A;  5AQG B;  5JDH A;  2BKO A;  2YEV C;  3TKL B;  3FB2 A;  2D0U A;  4EGW A;  1ZKE A;  3CQC B;  3AE6 A;  3ZST A;  2K48 A;  2PBI A;  1W09 A;  4PJN A;  1LVF A;  2WP9 A;  4JYA T;  4TX5 A;  4NPP A;  4ZHQ E;  4IT4 A;  4WBO A;  3MXZ A;  2XSA A;  2RP4 A;  2XQ8 A;  3CPZ A;  2ACZ A;  2X0H A;  1NEN A;  2FBW A;  3K8P C;  4ZI3 D;  1VRB A;  4U72 A;  3H3A A;  4MFR A;  4GYR A;  1N36 T;  4KI0 F;  3PUZ F;  4LML A;  3RYF E;  2ZM8 A;  5KXJ A;  4X1K E;  3VRB A;  1WR0 A;  4LMJ A;  2IC6 A;  3IA3 A;  5F5W A;  2UU9 T;  3VR9 A;  1GQE A;  3CKD A;  5AQM B;  3OBV E;  2DNX A;  2FJB A;  3ZT5 A;  1X79 A;  3RF1 A;  3AAI A;  2EHO D;  2V5D A;  2XQA A;  3UU5 A;  3LSV A;  3DJB A;  3FZF B;  4JI2 T;  1YKH B;  5EK4 A;  1KNR A;  3UUB A;  2ACX A;  3ETV A;  2H7O A;  2LSJ A;  2XM2 A;  3UU8 A;  3UUX B;  1JNZ A;  2XQ5 A;  5JTG A;  5DQV A;  1ZEE A;  3HKB E;  4UEM A;  2E9X C;  4EOZ B;  4JI0 T;  1D0X A;  2IHR 1;  5KDM C;  5J0Z A;  4HFE A;  4BA9 A;  3TLS A;  1UUS A;  2X0L B;  3RRC A;  3B13 A;  3RIU A;  4I4T E;  2VKD A;  2Y6X A;  4IL4 A;  5JRC B;  3KV6 A;  5HEO A;  3K3O A;  5CA0 E;  1IZN B;  4FI5 A;  3U3I A;  3N2O A;  4HKA A;  1OWA A;  2JMH A;  2P9B A;  2PTF A;  4PK4 A;  3KVB A;  2WMN A;  1EZ3 A;  4TV8 E;  4HWD A;  2LOP A;  3WI3 A;  4UXN B;  5FVL A;  4YJ2 E;  4KMC A;  2XAG B;  4MBQ A;  1Z0P A;  5LMN T;  1KEY A;  4LF5 T;  3E08 A;  1KF6 A;  3NZQ A;  4EAH A;  5C3J A;  5AQV B;  1LVK A;  2V7K A;  3AEA A;  5AQL B;  1VCT A;  4KHZ F;  3PUV F;  1O3X A;  3AED A;  3K1S A;  3NVO A;  3C98 B;  3RPU A;  4JI3 T;  3ZYL A;  2KND A;  2XM1 A;  2DWG A;  2VK9 A;  4YSX A;  4BJM A;  4L9I A;  3UTK A;  3AE5 A;  2OLT A;  3L39 A;  5L3B B;  2QGS A;  2BVM A;  2CWO A;  3PU8 A;  3AXJ A;  4AKI A;  1L0V A;  5HXR A;  5AFU L;  3QNU A;  2WS3 A;  4JEU B;  2V26 A;  3UUN A;  4IDZ A;  1I94 T;  4LFC T;  4QXH B;  2UUA T;  4B3R T;  1VCS A;  5J2T E;  5HXS A;  2XAJ B;  3ZKR A;  3LJC A;  3SFD A;  1UX4 A;  2RPA A;  1NAF A;  1HNW T;  4C91 A;  2M6I A;  2G0U A;  2W00 A;  4TNW A;  5LOV E;  3X1D A;  3RYI E;  2HH7 A;  4J2C A;  3UUM A;  4O4L E;  2WU5 A;  2YDQ A;  1J1J A;  2E9X D;  3N5L A;  5HCM A;  2KMF A;  5LJM A;  4DR3 T;  2XAF B;  4JBW F;  3RC3 A;  2A72 A;  3MKD A;  2WZI A;  5LBM A;  3SFE A;  3KFW X;  3M3Z B;  3FXD B;  4TWD A;  3MK7 C;  2MPK A;  3NZP A;  4YTM A;  4JV5 T;  2YDS A;  3AEB A;  3RYC E;  4DV2 T;  3EAB A;  2BS3 A;  4YY3 T;  2BG9 C;  2SPC A;  1WR6 A;  1OED A;  2VL0 A;  3UFG A;  5ETW A;  3N9P A;  5L3D B;  1S35 A;  3VKH A;  4ADZ A;  2LKH A;  4K0U A;  3O9X A;  2XQ4 A;  4ZEY A;  4JI4 T;  2Q9Q C;  4GKK T;  2VWA A;  3C4X A;  3E22 E;  3RIU C;  4G2A A;  3MAC A;  1E7P A;  4EZH A;  2BS2 A;  3T8O A;  3JAF A;  3AE2 A;  4AIU A;  3D0T A;  2YIN A;  4NUU A;  4HFV A;  1IAP A;  5L47 A;  1HCI A;  4PAG A;  4JEH B;  3RKG A;  1QLB A;  3ESL A;  2V1D B;  4C90 A;  1HF8 A;  4Q25 A;  2D9D A;  1G8X A;  2L3L A;  1WLX A;  3IF8 B;  3V5U A;  5IUX A;  5AQF B;  5HAX A;  4Z90 A;  4MHC A;  3AXJ B;  2YU2 A;  5CB4 E;  2DL1 A;  2XY8 B;  4LFA T;  4ILC A;  1IBM T;  4GK0 E;  1ZP0 A;  2XQ7 A;  3R84 B;  4HFD A;  5LP6 E;  3B5M A;  3A8Y C;  2WDR A;  2CXF A;  3OYX A;  3N2G E;  4KX6 A;  2IML A;  4G63 A;  2V7M A;  5LCY A;  1HR0 T;  4LF9 T;  5HYA A;  2Z6E A;  2X9H A;  1MIV A;  4A97 A;  1FIO A;  4AKG A;  2YU1 A;  4DV4 T;  3MA9 A;  4H9N C;  2YKS A;  3OYZ A;  3UFE A;  5FY7 A;  4QWN B;  5M4Y A;  4QH5 A;  5AQS B;  4DV1 T;  3EI0 A;  3UU3 A;  1UCU A;  4H9R C;  4M1P A;  4WNK A;  3ZMZ B;  1NWM X;  4YXD A;  2HPL A;  2LKG A;  2ZLY A;  3JC6 C;  1MMD A;  3RH3 A;  5HXH A;  4UF0 B;  1XNR T;  2ZMA A;  1QUU A;  5FXV A;  1WFD A;  2LT3 A;  2CLY B;  5JRC A;  2DHR A;  2AXD S;  4YJ3 E;  5IYZ E;  4TN7 B;  3FHN A;  2NTX A;  2YDR A;  2E8I A;  1LRZ A;  3LDQ B;  2L8K A;  4IE5 A;  4IDQ A;  2JQ9 A;  3IHR A;  2H3R A;  5HXE A;  3CX6 B;  3PTR B;  4I43 B;  5BR8 T;  5KMG P;  1T98 A;  3PV0 F;  2X9Y A;  2Y48 B;  3J9X 1;  2D0T A;  1Y64 B;  3QC9 A;  4CN4 A;  4OK0 A;  2LRL A;  3P4Q A;  4YSY A;  2H7V C;  4KBM B;  3T1H T;  2DWK A;  2KXP B;  5L3F B;  4DV7 T;  2A3D A;  1FJG T;  5AQJ B;  1HX8 A;  3FZM B;  3JCF A;  4AQY T;  3OJA A;  1AJ3 A;  4TWF A;  3RIF A;  2YOE A;  2DCF A;  2LM2 A;  1M62 A;  3RX6 A;  4CXX A;  1IJ5 A;  2H88 A;  5HEG A;  3KBU A;  4WYV A;  1MNE A;  4K0K T;  4ZI7 E;  2BVL A;  3I0Q A;  3KIN B;  4WBN E;  4YSZ A;  5JDM A;  3AEG A;  3P4S A;  3PU3 A;  4U7I A;  2C0S A;  2XQ6 A;  1YKE B;  2KZ7 B;  2X51 A;  1M7K A;  1OXZ A;  2W63 A;  5DJQ C;  3AE7 A;  2CE7 A;  3ONJ A;  4PJJ A;  3AA6 B;  5FXW A;  3JAD A;  2KIN B;  2N2N A;  3CQX C;  3C64 A;  2MBG A;  5L3C B;  2J47 A;  3AB3 B;  4ASK A;  4DR7 T;  4OYK A;  4DR2 T;  4HWI B;  4B3S T;  4EZ4 A;  3R6N A;  2HHH T;  5AQU B;  3AAE B;  5HWX A;  4HN9 A;  4OFZ A;  4DV0 T;  5JDF A;  1LKX A;  3JC6 D;  3BQI A;  4UVB B;  2HPJ A;  4AKH A;  2MOZ A;  5FL1 A;  2WZH A;  3Q2M A;  5EK3 A;  3ZC1 A;  1J5E T;  3AEC A;  4LF6 T;  5LBQ B;  2NW8 A;  4ISS A;  4NUV A;  3QOF A;  3ZPO A;  1WYB A;  1MIY A;  2VVS A;  2LJL A;  2JQH A;  3RQW A;  3PJA A;  2UXN B;  2IC9 A;  3Q5X A;  3ZN0 B;  3Q5W A;  5AQN B;  4U33 A;  4YTP A;  4OHF A;  2WWU A;  1HX1 B;  4CI1 B;  3AE9 A;  3PUW F;  1NEK A;  3TLV A;  3HI2 A;  4XZC A;  1N34 T;  2KT9 A;  3F31 A;  1YQ4 A;  4JI5 T;  3GMI A;  2UXC T;  2X67 A;  5ABF A;  4EIW A;  3GN5 B;  4JI1 T;  3UQ7 A;  4LFB T;  1SA0 E;  3B57 A;  2W67 A;  3QUJ A;  2X0Y A;  4LF8 T;  4I50 E;  2ZM2 A;  4OYJ A;  4DUY T;  1FMW A;  1UUR A;  3RQU A;  5LGN B;  4EV6 A;  4O2B E;  4CI3 B;  3ZYK A;  3KBT A;  3QB5 K;  5LGU B;  1OED E;  1I6Z A;  1D0Z A;  4UV8 B;  2QVA A;  4BJN A;  4X1I E;  4H63 H;  5CJ5 A;  4HFI A;  3LFM A;  4WW0 A;  3ZYM A;  5L2L A;  3P7I A;  1ZHC A;  4X1Y E;  4Z91 A;  5AQI B;  4EXT A;  4LMK A;  2QRX A;  1E1H B;  3V5S A;  3UUL A;  3N9O A;  4UVC B;  3ETU A;  1N32 T;  5H6R B;  4CI2 B;  5J1G A;  4X5T A;  3OTO T;  2E5L T;  4IRE A;  4PFO A;  3ZJ2 A;  4CQI A;  3KV4 A;  3EAM A;  2JIW A;  1IBL T;  2QYW A;  2UXX B;  2XAS B;  3PUS A;  5FYM A;  3DP7 A;  2XQY A;  4QX8 B;  5LMU T;  2M67 A;  5EZY E;  3FBL A;  1HTJ F;  4YFS A;  2LOS A;  2JRK A;  4IIJ E;  4JLE A;  3F2E A;  3RKO A;  4DUZ T;  4JI7 T;  4EYU A;  3UU6 A;  3NRX A;  2KWH A;  2E2A A;  2CXD A;  4JUY A;  1R8I A;  2WB5 A;  3ZT6 A;  4XAX B;  3K3N A;  4YT0 A;  4P1N A;  4ZZB A;  1H7C A;  1MMA A;  2VQE T;  4UR9 A;  5LYJ E;  2JQK A;  2VB6 A;  3AEF A;  3ZMU B;  4AQG A;  3LBX A;  1XMQ T;  1MMG A;  4UF0 A;  2HN1 A;  3VU7 H;  5LB7 B;  4P0B A;  4H9O C;  3SRZ A;  5CA1 E;  3AEE A;  3PJA J;  2LSI A;  2WSS V;  1T72 A;  3ONX A;  4L5G A;  4ILB A;  3AE8 A;  2XAH B;  4DBQ A;  4PK6 A;  4O4I E;  3VHL A;  3DTO A;  4KUM B;  2Q9Q B;  5A1L A;  4HTE A;  3ZMV B;  1D1B A;  2W66 A;  2M6B A;  2C5I T;  4HFC A;  4AIS A;  4B3M T;  5ABF B;  2VKH A;  5HEU A;  4QXC B;  3WAK A;  4ZOL E;  2BKP A;  2C5K T;  4GYS A;  2A2F X;  2W4X A;  2WWV A;  2UXD T;  3BK9 A;  3ZCJ A;  4IDP A;  3RLF F;  3TLU A;  4LF4 T;  2XTL A;  2CPT A;  5FL0 A;  1HS7 A;  2MAW A;  2I6H A;  4PJL A;  4YTN A;  4HE8 A;  4YHJ A;  4COF A;  3AA7 B;  3PUA A;  4IGU A;  5DQW A;  3TLT A;  2N1G A;  3L8R A;  2BS4 A;  3FZH B;  4Z8X A;  2BBH A;  2WDQ A;  2W0G A;  3N9L A;  4U31 A;  4ZS3 A;  5CFB A;  2LSK A;  4IE7 A;  3Q5E A;  2K5B B;  2J62 A;  4I0U A;  5HXC A;  1Y01 A;  5BMV E;  2CHN A;  2VKJ A;  1U5P A;  3CML A;  5LG4 A;  5LJN A;  2XZE A;  3IEE A;  2PFV A;  2VQF T;  1VOM A;  5JVD E;  3SS1 A;  4H63 V;  1SHZ C;  3LK2 B;  4DV6 T;  3N9M A;  4ANJ A;  3P50 A;  4LF7 T;  3ZEF B;  3HR0 A;  5FNV E;  5JQG E;  2V6X A;  2EHO B;  3ZC0 A;  4F6R C;  4IE6 A;  3NRY A;  3VR8 A;  5LGT B;  3ZLI A;  4O4H E;  1WRD A;  3CX7 B;  1D1A A;  3NWI A;  3FXE B;  3P4W A;  2E9X A;  2FUP A;  2LEH A;  1MND A;  1B7T A;  3CX8 B;  2E5V A;  3LBX B;  3BQK A;  4PW8 A;  1YD8 G;  5AQR B;  1YQ3 A;  1J5W A;  5JR9 B;  3N9N A;  5DAB A;  2XHE B;  5F8P A;  4O2A E;  3PUY F;  3RHW A;  2NTY A;  2VAS A;  4NIQ A;  4U3C A;  3AE4 A;  3I9W A;  2ODV A;  4JI6 T;  4ILU A;  5TAO A;  5JRE A;  4YHH T;  4DR1 T;  5JDG A;  3GN5 A;  5KX5 E;  5ADX L;  4DID B;  5FVK A;  5FMN A;  1OED C;  1HNX T;  1BR2 A;  3LK3 B;  4DO0 A;  4PJM A;  5JDN A;  2JMK A;  4DBR A;  3CK6 A;  3EDU A;  4ILA A;  4QXB B;  3H37 A;  4DND A;  3HKE E;  4UEL A;  3P8C D;  4HFH A;  2D5U A;  2QA7 A;  1D1C A;  4UV9 B;  2K24 A;  2FJE A;  5FXZ A;  2I59 A;  3VKG A;  3O4X E;  5HEH A;  3EHZ A;  3TLW A;  5FKY A;  2IW5 B;  2KSR A;  5AQH B;  5JDL A;  1WYC A;  3ZCI A;  4U7Y A;  2JQQ A;  4CXY A;  3CVR A;  3PUQ A;  3QB5 A;  1G73 A;  1MMN A;  3A5X A;  3FBZ A;  2WQY A;  4DR5 T;  4CN6 A;  3P4R A;  4AXP A;  1YW0 A;  3KVA A;  3ZT7 A;  2XUE A;  3CIR A;  3I1A A;  2WDV A;  3ZMT B;  4MAL A;  3RI5 A;  3OKQ A;  3Q9D A;  2LRK A;  3VRA A;  4IST A;  2LM9 A;  5LA6 E;  2WM9 A;  3ANW A;  3ZN1 B;  1W0B A;  2XPK A;  3C50 A;  2R6G F;  4I55 E;  3RGL A;  4EYY R;  1QSD A;  5E0O A;  2LLY A;  4IL9 A;  5F3J A;  1V9D A;  4QH4 A;  4IDN A;  1BR1 A;  3P4P A;  4X62 T;  2E9X B;  1IBK T;  4X64 T;  4PK5 A;  5J2U E;  1XDP A;  2GK9 A;  2RA1 A;  2NP9 A;  2W2U A;  4EED A;  3KV5 A;  4ZI2 D;  2J1D G;  4AKR B;  2BG9 A;  2BKN A;  1W0A A;  3ABV A;  4TZ4 C;  4U2Z A;  4QX7 B;  4X65 T;  2V7I A;  2XSB A;  1XWM A;  3AVR A;  1KNP A;  4HEA A;  3UQ4 A;  4HWC A;  2Q9Q A;  4N78 D;  4AKL A;  5LXT E; 
#chains in the Genus database with same CATH homology
 2V6Y A;  4CN1 A;  3EAB A;  2LRK A;  3K1S A;  2V6Y B;  2XZE A;  1YXR A;  4IT4 A;  4U2Z A;  2CPT A;  4U7I A;  5FVL A;  2RPA A;  4U31 A;  3ZSS A;  2V6X A;  4U33 A;  4A5X A;  4CN4 A;  2JQK A;  3ZT5 A;  5CJ5 A;  1WCR A;  4NIQ A;  5FVK A;  2LRL A;  4U2Y A;  3ZT6 A;  2DL1 A;  2JQ9 A;  4U3C A;  4CN6 A;  2CRB A;  4U7Y A;  2W2U A;  2WY2 A;  4WZX A;  5CGM A;  2MPK A;  3ZST A;  1WR0 A;  3ZT7 A;  5LB7 B;  2JQH A;  2K3W A;  4P1N A;  1WFD A;  4ZEY A;  2WWV A;  2A9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...