2CRBA

Solution structure of mit domain from mouse nrbf-2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
b'GSSGSSGMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nuclear receptor binding factor 2
publication title Solution structure of MIT domain from mouse NRBF-2
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2crbA00
4IT4A 2V6YB 4U2ZA 3ZSTA 5FVKA 2A9UA 4NIQA 2CPTA 4CN6A 4CN1A 5CJ5A 4U7YA 2WY2A 5FVLA 1WCRA 2V6XA 4U7IA 4CN4A 2DL1A 2K3WA 4U2YA 1YXRA 3ZT7A 2RPAA 2WWVA 4P1NA 4A5XA 2LRLA 2V6YA 2MPKA 3EABA 4WZXA 1WFDA 2JQHA 4U31A 2CRBA 4U3CA 2XZEA 3K1SA 3ZT5A 3ZSSA 2JQKA 3ZT6A 5CGMA 4U33A 2LRKA 5LB7B 2JQ9A 4ZEYA 2W2UA 1WR0A
chains in the Genus database with same CATH superfamily
4TZ4C 1T8BA 4AKLA 5LHHB 3NRXA 5L47A 1YQ3A 4EXTA 1UGOA 4ZXLA 4JI6T 3LJCA 4UVBB 4IDZA 2JJ9A 1W09A 1NEKA 4XZCA 4AQYT 3FZFB 3RIFA 1QSDA 5HEJA 4B3TT 2WDQA 3NRYA 2DWGA 3OYXA 3NVOA 1OEDA 3HR0A 5L3CB 3UFEA 4H9QC 3AECA 1WRDA 2H88A 3RRWA 4DBQA 4DR6T 4O2AE 3ZT7A 3RYHE 4UIGA 5BR8T 4P0AA 2MPKA 2XQAA 4LFBT 3CKDA 3M3ZB 2CWOA 2VKHA 3LK2B 2W67A 3SOLA 5C8YE 3KV4A 2VKOA 2XUEA 2BDEA 3J9X1 4PJMA 3ETUA 2NR4A 3RPUA 1XMQT 2H7OA 2LEHA 3ZEFB 4EB6E 3PUAA 1IAPA 2NP9A 3PU3A 5IYZE 2WZIA 2A9UA 4ISSA 4DV0T 2J4GA 3ETVA 5AQHB 1KNRA 5IHYA 1D0XA 1LRZA 4H9RC 3UU6A 3MZKB 2XQYA 5FL1A 1NENA 2QA7A 5HWXA 2WB5A 4CQIA 4JV5T 1N36T 2RA1A 2HH7A 3TLSA 3KVBA 3AA0B 4GK5E 2QVAA 4IIJE 5AQLB 3AEDA 3AB3B 2DI4A 2Q9QB 4G2AA 4QX8B 3A7MA 5JR9B 1KK7A 2V7KA 4X5TA 5HWYA 2FBWA 2XQ9A 5IWAT 3CQXC 3H37A 4U33A 2NTXA 2HHHT 4LMJA 3C4WA 1IBLT 2XAJB 4OFZA 2BVLA 5CFBA 4U7YA 4DBRA 5AQIB 2OLTA 3AAAB 1U5PA 1ZOYA 3I0QA 5AQUB 3EABA 1ZHCA 2DWKA 3O1JA 4GK0E 2X9WA 2M67A 3AE8A 5L3FB 1BR1A 3LG7A 2B76A 3QK6A 1KEYA 2N2NA 4X20E 1YW0A 4U74A 2LLYA 4QXCB 4DR3T 3PUWF 3KV9A 2WSSV 1W0BA 2K48A 3L39A 4LFAT 4EGWA 1W9RA 3EDUA 5EK4A 3MACA 4U72A 3KFWX 1WYCA 4EOZB 4MFRA 2UXDT 2PBIA 3AA7B 1UUSA 3EAMA 2WWVA 4WZXA 5L3GB 2C5JA 3ZMSB 4KBMB 4PJNA 1W0AA 2W62A 3ONXA 3IBPA 5JTGA 5JVDE 4DV6T 5ADXL 4GIWA 2KSRA 1UX5A 5LP6E 1AJ3A 1HF8A 3P50A 4O2BE 1SHZC 2UXCT 2A72A 1LVKA 4KMCA 1I94T 4HGAA 1ZKEA 4KX6A 1H7CA 3RF1A 4H63V 2CA5A 3AE9A 2HN1A 4QH1A 1Y64B 1T72A 5LYJE 4I4TE 3AE3A 1IJ5A 5LJMA 5CGMA 1OEDB 4UVCB 2KT9A 1GQEA 2WU2A 1D0YA 1YD8G 1ZP0A 2V1DB 2XQ4A 3AA1B 2H89A 4U31A 3SFDA 3UUMA 4X64T 2X9XA 3N2OA 4CN6A 5FL0A 5HYAA 2RP4A 1L0VA 4DO0A 4L0RA 4UF0A 4A98A 2CLYC 5HEOA 4KUMB 1MNEA 2WU5A 2V7LA 4B3MT 3ZCJA 4EYUA 2EHOD 3MK7C 3UT5E 2VASA 4O4HE 2LSIA 3OYZA 4UVAB 4ZHQE 4LF4T 5FYMA 1FIOA 3EUHA 2WQYA 5FKYA 1BR0A 3CIRA 4JI0T 2XTLA 2LOSA 3H3MA 2XAQB 3VRBA 5LGUB 5L2LA 4TWDA 2QRXA 2W0GA 1QUUA 4UR9A 1WCRA 2KINB 1EZ3A 2YKSA 3JC6D 5CA1E 4H9OC 5LXTE 5DQWA 4TV9E 2JQKA 1OWAA 1YKEB 2XAFB 4Z8XA 3JCFA 3PUSA 2W4XA 3PUXF 4PK4A 5FVLA 5GONE 3V5UA 1QLBA 4HFDA 3P4PA 5F5WA 3DJBA 2IDOB 3PUYF 5ABGA 4IHJE 4ISTA 4AXPA 3EHZA 4MLKA 2XQ7A 3E22E 3E08A 4C90A 5JDGA 2UXNB 4BAYB 2HPJA 4IE6A 2RPAA 3OBVE 3VKHA 3ZN0B 2PTFA 3K1SA 1SE7A 4YTMA 3NKZA 4O4IE 3UUNA 3PJAA 2DHRA 3BK9A 3QB5A 3UU4A 4LF6T 1N32T 3RKGA 2ZM6T 5J2UE 4NPPA 4IDQA 5L3BB 4H9NC 1HG2A 5FXXA 4YT0A 4AQGA 4H9PC 2WS3A 2V26A 2IMLA 2IC9A 4X1IE 3OVUA 3A8YC 4F8HA 4HFEA 5LGTB 1Z0PA 4IE7A 4U2ZA 3C98B 2CXFA 2B1EA 4AI6A 4JYAT 2E9XD 2V5CA 4MBQA 2YK0A 4N78D 2BG9A 3CQCB 3UQ7A 4MALA 1FMVA 3TLUA 1HCIA 1G8XA 3ZMVB 1X79A 2KLQA 4ILAA 3N9OA 2E5VA 3LBXA 5FY0A 4PJLA 4DR1T 4H9SE 3U3IA 2LKHA 2CPTA 2M6BA 4JI2T 5FXWA 4UEMA 2D2SA 4OYKA 4LF9T 4L5GA 1VCSA 2MOZA 5FY1A 4QWNB 2XAGB 2VL8A 3WAKA 5FVKA 4E7ZA 3P4WA 2BVMA 2D5UA 3AVRA 3IA3A 4YLHA 2VQET 1R8IA 2W61A 5LNKA 5KX5E 2N1GA 3ZN1B 2VK9A 3N9QA 4EAHA 4IGUA 2DNXA 4KHZF 5TAOA 3RIAA 3LSVA 3AVSA 3F57A 3ZJ1A 3ZYLA 3RHWA 2Y6XA 3ZSSA 4UF0B 4PAGA 2KNDA 1MMAA 3F31A 3P4SA 4DR7T 4DVDA 5F3JA 2VURA 4CI1B 3WI3A 4DV7T 4H63H 3V5SA 3AE5A 3PU8A 3CQGB 2EHOC 3NZQA 1VRBA 4COFA 2L8KA 4PK5A 1KF6A 1E7PA 5KXJA 4XAXB 4X1YE 4X66T 5AQGB 2EHOA 3I0OA 4YSZA 3L8RA 2MAWA 3UFGA 4I43B 1HX8A 2X51A 5FY7A 1B7TA 4QX7B 1KNPA 4GYSA 4WW0A 3RX6A 3VRAA 1UK5A 4HKAA 4PFOA 3B57A 3JC6C 5LA6E 3UU5A 2V7IA 2DCFA 1MMGA 4DUYT 1HNZT 4ZEYA 2DLRA 2V5DA 1UCUA 1N34T 2WDRA 4LF7T 3R84B 3AEBA 2X9HA 3N2GE 2WCAA 5A1LA 3T1YT 3AA6B 4K0KT 2YEVC 5LG3A 2J1DG 1X9BA 2YU1A 4OYJA 4UXNB 2VL0A 2QYWA 3RIUC 3VHLA 4DUZT 3TLTA 3ZC0A 3P4RA 1UX4A 5AQQB 1HS7A 2IUBA 4HN9A 2YINA 4QXHB 2CM0A 3K3NA 3IHRA 2LSKA 1MMNA 4IE4A 2XSBA 2UUAT 4PK6A 3Q5EA 4MHCA 5L3EB 1ZEEA 2BZBA 4JEUB 4IL4A 2BKOA 2IIUA 2LT3A 5HEGA 4UV9B 1E2AA 4HFCA 1SUMB 3FZHB 1CUNA 5LCYA 2YDQA 5HXHA 4TV8E 3JADA 2X0YA 2CBIA 5L4HA 2VWAA 1VOMA 5H6RB 2PFVA 3U78A 3VR8A 3W15B 3QC9A 5LMNT 1ZV4X 4KP3C 3AAIA 2BG9B 3PUQA 3OKQA 4ASKA 2E9XC 4B3RT 4DMVA 3T8OA 2ZM0A 3CPZA 4I55E 4EZ4A 3LBXB 4AQFC 3AXJB 1HX1B 4YTNA 2CBJA 2LSGA 3SFEA 4O8SA 3KVAA 3ZYMA 2L3LA 2YN6A 3FBLA 5JQGE 1IBMT 2BS3A 4DV1T 2E9XA 3TKLB 5HCMA 3PV0F 1MNDA 4BA9A 2VKJA 5JH7E 5L3DB 3GWHA 2ES0A 3GMIA 4AKGA 2JPFA 3FXDB 1WFDA 2JQHA 3VU7H 4NUVA 3RRCA 2LE8A 3K3QC 3FBZA 1SA0E 4JUYA 4JI1T 2KZ7B 1J5ET 2J47A 3PUGA 4O4JE 4CXYA 4I50E 1XNRT 4WYVA 3KV6A 4AKIA 4CI3B 5HXSA 5LB7B 1XZYA 5AQOB 2CMRA 1LVFA 3UUXB 3RYFE 5CJ5A 3ZMUB 4AISA 2C5IT 4I0UA 4X62T 2PG8A 2YU2A 2AE9A 2MYSA 3AE7A 4OK0A 4WBOA 5DQVA 5LBMA 4ERRA 2SPCA 3GA8A 4BJNA 5L4EA 3AAEB 2ZLYA 3KBUA 5AQPB 3LK42 3GN5A 3LDQB 4EEDA 4LMLA 5HEUA 2PJQA 3CWZB 2KXPB 3PUZF 3N9PA 2BS2A 4X65T 2EHOB 3R6NA 2XHEB 2W00A 3FZMB 2XQ3A 2LKGA 4TNWA 4YJ3E 2WBLA 4WBNE 3RC3A 2X67A 3HKCE 3RLFF 3HA4A 5IUXA 3VR9A 2FJEA 5AQSB 2ZMAA 1E1HB 2W66A 2VKDA 2X66A 5CA0E 5JDHA 2LM9A 4JI7T 5HXEA 3P7IA 5ABHA 2LOPA 2KMFA 2H3RA 2XZEA 2CWYA 1MIVA 4HWFA 1KNZA 5JR9C 4YY3T 2X9YA 3Q9DA 4ZI3D 2XJ7A 5KMGP 1S94A 2JMHA 4HFBA 4PW8A 4XBFB 2XQ8A 1MMDA 4F6RC 1OEDE 3Q2MA 4ZI7E 2W63A 3MJXA 5JDFA 5AQMB 2V6YB 2WDVA 4OHFA 4O4LE 3K8PC 2R6GF 4BJMA 2D0TA 4KI0F 2C5KT 3BQIA 3MXZA 3NWIA 3ZYKA 4U3CA 1VCTA 3B5MA 5EK2A 1IZNB 4IDNA 3RC8A 3PDYA 2WWUA 2YDRA 3KV5A 4HEAA 2YDSA 4DV4T 2LSYA 4PJJA 4YSXA 3KDSE 2I0MA 4E7SA 3AE2A 2F4VT 1XNQT 2JIWA 4TWHA 1BR4A 4HWIB 3C4XA 5J0ZA 2D9DA 3E0ZA 3D0TA 3CMLA 4DV5T 3C50A 3EVYA 3ZJ2A 3B13A 2JMKA 4JBWF 5AQNB 3I9YA 5H6QB 3AXJA 4DV2T 2G0UA 4CXWA 4ZI2D 4Q25A 2FJBA 2MBGA 3AE6A 2E9XB 4CXXA 2K9AA 2CXLA 3DP7A 5LG4A 4ADZA 4GKKT 4QHOA 4B3ST 2IHR1 1Z8UA 1WR0A 3KBTA 1IBKT 4DR4T 2FUPA 2H7VC 1HTJF 1D1CA 1JNRA 3EI0A 4QH4A 4TUYE 3ZMTB 3PTRB 1OEDC 3FZKB 3O1HA 2LRLA 1IJ6A 4NXMT 1T98A 3ABVA 4HFIA 4TX5A 2E2AA 4LMKA 4CI2B 4EYYR 4HWCA 5JRCA 2NW7A 5BMVE 3HL6A 1UURA 2WP9A 4A5XA 4P1NA 4IREA 4JEHB 2V7MA 3K3OA 4GYRA 3ZC1A 2ODVA 3AE4A 3MA9A 5ABEA 1LKXA 4LFCT 2WY2A 2KWHA 2IC6A 2OA5A 1T7SA 4ZOLE 2XAHB 4AKHA 3RGLA 1I6ZA 3C64A 2K24A 4NUUA 2CLYB 4IDPA 3AEEA 3X1DA 3GN5B 5AQJB 1DU2A 3UQ4A 5M4YA 2OV9A 4U2YA 3ESLA 5JDMA 1YXRA 2FJAA 2MTQA 5CB4E 2XM2A 3RH3A 2A3DA 4JI4T 2CHNA 3CX8B 5C3JA 3LFMA 3SRZA 3ZMZB 4A56A 4ILUA 4ILCA 3UU8A 3RYIE 2K5BB 2UUCT 2UXXB 4TWFA 4YSYA 2K3WA 2XASB 3HKBE 5J1GA 2NWBA 1FMWA 4L9IA 2NOXA 3ANWA 4PNIA 2L9QA 2KWIB 4X1KE 3PURA 1J1JA 2Q9QD 5EZYE 5FXVA 1Y01A 3F2EA 3M65A 4K0UA 3JAEA 3G06A 4ZZBA 4TN7B 2YOEA 4UV8B 2A2FX 4DR5T 1XWMA 2BBJA 4ZI3C 3O4XE 2CEAA 5HXCA 2Y8DA 4CN1A 4Z90A 4Z91A 3MKDA 3ZCIA 1FJGT 4LF5T 2V6YA 1D1AA 3RIUA 3FHNA 4HTEA 2XSAA 3PUVF 5F8PA 1O3XA 2CCQA 3Q5WA 5AQVB 2Z6EA 5ABFA 4GOUA 2Y48B 2WAUA 3AEGA 3FZLB 2VVSA 3I1AA 3Q5DA 1YQ4A 3EDVA 4AKRB 5ETWA 1V9DA 1M62A 4ZS3A 5FMNA 4OX9T 3N2KE 1WYBA 3QB5K 5C2TA 5DJQC 3PE0A 4JLEA 2GK9A 5JDQA 3QUJA 2ZM2A 4P0BA 3TLWA 3ONJA 4LF8T 2CXDA 1BR2A 5LOVE 3AEFA 4QXBB 1KFYA 1MIWA 4CN4A 4FJOA 2XY8B 3TLVA 2LHNA 1XMOT 2IW5B 5LHGB 4DV3T 2CHOA 2VB6A 1MIYA 4TNVA 4B6XA 2JQQA 1JNZA 4ZI2C 1J5WA 5HXRA 5FXZA 2UU9T 4DR2T 1US7B 3C51A 3AE1A 3LK3B 2E5LT 4NIQA 4AQFA 3C4ZA 3P8CD 3HKEE 2E8IA 4JI3T 2LHRA 3BQKA 5LBQB 4WNKA 5AFUL 1NWMX 2CRBA 2WMOA 4CZZB 3VKGA 4J2CA 4EV6A 2VQFT 3O1IA 4JI5T 4UELA 2NW9A 1XDPA 1N33T 4HFVA 4V1Av 5JRCB 5JDLA 5HAXA 1XDOA 2LSJA 2WMNA 3N5LA 3S4UA 4YFSA 4YHHT 3L3PA 3ZPOA 2JRKA 2W2UA 5JDNA 3OTOT 3BQLA 1YKHB 2N9DA 3J7Yq 5JREA 2ODUA 4ZZCA 3ZT5A 1D1BA 2BKPA 2ACXA 1OXZA 2LRKA 2X0HA 4HFHA 4YXDA 4GKJT 3P4QA 3H3AA 3CX7B 2V7JA 2X0LB 2FJDA 5LJNA 3ONLC 3ZSTA 4YHJA 4HE8A 5DABA 3CX6B 4YJ2E 5KDMC 2V6XA 2DL1A 4DNDA 2CE7A 1M7KA 1U4QA 2BG9E 1WLXA 4DIDB 5HEHA 3UULA 3T1HT 1CHUA 2HN2A 5J2TE 1HR0T 3JAFA 4ZS2A 2LJLA 2HPLA 3UTKA 3ANWB 4AIUA 4U7IA 3SS1A 4QKNA 2XQ5A 3FXEB 1FEWA 4DMWA 3N9MA 2AXDS 2P9BA 2ACZA 3FB2A 2Q9QC 3IEEA 5LHIB 2JQ9A 5LMUT 2X68A 3DTOA 3N9LA 4A97A 1WR6A 2VVNA 4IE0A 4YTPA 3OPCA 4P09A 2C0SA 4FI5A 1D0ZA 3NBXX 4HWHA 2Q9QA 2BS4A 2ZM8A 3UUBA 5LGNB 2NW8A 3RKOA 4JI8T 4EEBA 5JR9A 2D0UA 3RI5A 2WZHA 3CK6A 1NAFA 5HCJA 1HNXT 3RQWA 1G73A 4EZHA 2NTYA 5ABFB 4IDOA 4IE5A 3HKDE 4PFPA 2WM9A 3HI2A 3QNUA 4ILBA 2XPKA 3UU3A 2UXBT 4QH5A 3A5XA 2I6HA 3N9NA 3AEAA 5AQFB 3RYCE 3CVRA 4IT4A 1HNWT 3OJAA 3QOFA 5EK3A 4IL9A 3KINB 5E0OA 2IAKA 3NZPA 3Q5XA 5AQTB 4ANJA 2XM1A 3ZT6A 3SWHA 4G63A 5FNVE 2BG9C 2QGSA 2BBHA 3I9WA 5FP3A 4HWDA 3IF8B 2UUBT 3PJAJ 1HG5A 2J62A 1S35A 3ZLIA 2V8SV 3WAJA 2M6IA 4EIWA 3O9XA 3RQUA 4M1PA 4NXNT 2BKNA 2I59A 3ZKRA 5AQKB 2LM2A 5AQRB 1HFAA 2XQ6A 3L09A 4KHPT 4C91A
chains in the Genus database with same CATH topology
4IT4A 2V6YB 4U2ZA 3ZSTA 5FVKA 2A9UA 4NIQA 2CPTA 4CN6A 4CN1A 5CJ5A 4U7YA 2WY2A 5FVLA 1WCRA 2V6XA 4U7IA 4CN4A 2DL1A 2K3WA 4U2YA 1YXRA 3ZT7A 2RPAA 2WWVA 4P1NA 4A5XA 2LRLA 2V6YA 2MPKA 3EABA 4WZXA 1WFDA 2JQHA 4U31A 2CRBA 4U3CA 2XZEA 3K1SA 3ZT5A 3ZSSA 2JQKA 3ZT6A 5CGMA 4U33A 2LRKA 5LB7B 2JQ9A 4ZEYA 2W2UA 1WR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT4 A;  2V6Y B;  4U2Z A;  3ZST A;  5FVK A;  2A9U A;  4NIQ A;  2CPT A;  4CN6 A;  4CN1 A;  5CJ5 A;  4U7Y A;  2WY2 A;  5FVL A;  1WCR A;  2V6X A;  4U7I A;  4CN4 A;  2DL1 A;  2K3W A;  4U2Y A;  1YXR A;  3ZT7 A;  2RPA A;  2WWV A;  4P1N A;  4A5X A;  2LRL A;  2V6Y A;  2MPK A;  3EAB A;  4WZX A;  1WFD A;  2JQH A;  4U31 A;  2CRB A;  4U3C A;  2XZE A;  3K1S A;  3ZT5 A;  3ZSS A;  2JQK A;  3ZT6 A;  5CGM A;  4U33 A;  2LRK A;  5LB7 B;  2JQ9 A;  4ZEY A;  2W2U A;  1WR0 A; 
#chains in the Genus database with same CATH topology
 4TZ4 C;  1T8B A;  4AKL A;  5LHH B;  3NRX A;  5L47 A;  1YQ3 A;  4EXT A;  1UGO A;  4ZXL A;  4JI6 T;  3LJC A;  4UVB B;  4IDZ A;  2JJ9 A;  1W09 A;  1NEK A;  4XZC A;  4AQY T;  3FZF B;  3RIF A;  1QSD A;  5HEJ A;  4B3T T;  2WDQ A;  3NRY A;  2DWG A;  3OYX A;  3NVO A;  1OED A;  3HR0 A;  5L3C B;  3UFE A;  4H9Q C;  3AEC A;  1WRD A;  2H88 A;  3RRW A;  4DBQ A;  4DR6 T;  4O2A E;  3ZT7 A;  3RYH E;  4UIG A;  5BR8 T;  4P0A A;  2MPK A;  2XQA A;  4LFB T;  3CKD A;  3M3Z B;  2CWO A;  2VKH A;  3LK2 B;  2W67 A;  3SOL A;  5C8Y E;  3KV4 A;  2VKO A;  2XUE A;  2BDE A;  3J9X 1;  4PJM A;  3ETU A;  2NR4 A;  3RPU A;  1XMQ T;  2H7O A;  2LEH A;  3ZEF B;  4EB6 E;  3PUA A;  1IAP A;  2NP9 A;  3PU3 A;  5IYZ E;  2WZI A;  2A9U A;  4ISS A;  4DV0 T;  2J4G A;  3ETV A;  5AQH B;  1KNR A;  5IHY A;  1D0X A;  1LRZ A;  4H9R C;  3UU6 A;  3MZK B;  2XQY A;  5FL1 A;  1NEN A;  2QA7 A;  5HWX A;  2WB5 A;  4CQI A;  4JV5 T;  1N36 T;  2RA1 A;  2HH7 A;  3TLS A;  3KVB A;  3AA0 B;  4GK5 E;  2QVA A;  4IIJ E;  5AQL B;  3AED A;  3AB3 B;  2DI4 A;  2Q9Q B;  4G2A A;  4QX8 B;  3A7M A;  5JR9 B;  1KK7 A;  2V7K A;  4X5T A;  5HWY A;  2FBW A;  2XQ9 A;  5IWA T;  3CQX C;  3H37 A;  4U33 A;  2NTX A;  2HHH T;  4LMJ A;  3C4W A;  1IBL T;  2XAJ B;  4OFZ A;  2BVL A;  5CFB A;  4U7Y A;  4DBR A;  5AQI B;  2OLT A;  3AAA B;  1U5P A;  1ZOY A;  3I0Q A;  5AQU B;  3EAB A;  1ZHC A;  2DWK A;  3O1J A;  4GK0 E;  2X9W A;  2M67 A;  3AE8 A;  5L3F B;  1BR1 A;  3LG7 A;  2B76 A;  3QK6 A;  1KEY A;  2N2N A;  4X20 E;  1YW0 A;  4U74 A;  2LLY A;  4QXC B;  4DR3 T;  3PUW F;  3KV9 A;  2WSS V;  1W0B A;  2K48 A;  3L39 A;  4LFA T;  4EGW A;  1W9R A;  3EDU A;  5EK4 A;  3MAC A;  4U72 A;  3KFW X;  1WYC A;  4EOZ B;  4MFR A;  2UXD T;  2PBI A;  3AA7 B;  1UUS A;  3EAM A;  2WWV A;  4WZX A;  5L3G B;  2C5J A;  3ZMS B;  4KBM B;  4PJN A;  1W0A A;  2W62 A;  3ONX A;  3IBP A;  5JTG A;  5JVD E;  4DV6 T;  5ADX L;  4GIW A;  2KSR A;  1UX5 A;  5LP6 E;  1AJ3 A;  1HF8 A;  3P50 A;  4O2B E;  1SHZ C;  2UXC T;  2A72 A;  1LVK A;  4KMC A;  1I94 T;  4HGA A;  1ZKE A;  4KX6 A;  1H7C A;  3RF1 A;  4H63 V;  2CA5 A;  3AE9 A;  2HN1 A;  4QH1 A;  1Y64 B;  1T72 A;  5LYJ E;  4I4T E;  3AE3 A;  1IJ5 A;  5LJM A;  5CGM A;  1OED B;  4UVC B;  2KT9 A;  1GQE A;  2WU2 A;  1D0Y A;  1YD8 G;  1ZP0 A;  2V1D B;  2XQ4 A;  3AA1 B;  2H89 A;  4U31 A;  3SFD A;  3UUM A;  4X64 T;  2X9X A;  3N2O A;  4CN6 A;  5FL0 A;  5HYA A;  2RP4 A;  1L0V A;  4DO0 A;  4L0R A;  4UF0 A;  4A98 A;  2CLY C;  5HEO A;  4KUM B;  1MNE A;  2WU5 A;  2V7L A;  4B3M T;  3ZCJ A;  4EYU A;  2EHO D;  3MK7 C;  3UT5 E;  2VAS A;  4O4H E;  2LSI A;  3OYZ A;  4UVA B;  4ZHQ E;  4LF4 T;  5FYM A;  1FIO A;  3EUH A;  2WQY A;  5FKY A;  1BR0 A;  3CIR A;  4JI0 T;  2XTL A;  2LOS A;  3H3M A;  2XAQ B;  3VRB A;  5LGU B;  5L2L A;  4TWD A;  2QRX A;  2W0G A;  1QUU A;  4UR9 A;  1WCR A;  2KIN B;  1EZ3 A;  2YKS A;  3JC6 D;  5CA1 E;  4H9O C;  5LXT E;  5DQW A;  4TV9 E;  2JQK A;  1OWA A;  1YKE B;  2XAF B;  4Z8X A;  3JCF A;  3PUS A;  2W4X A;  3PUX F;  4PK4 A;  5FVL A;  5GON E;  3V5U A;  1QLB A;  4HFD A;  3P4P A;  5F5W A;  3DJB A;  2IDO B;  3PUY F;  5ABG A;  4IHJ E;  4IST A;  4AXP A;  3EHZ A;  4MLK A;  2XQ7 A;  3E22 E;  3E08 A;  4C90 A;  5JDG A;  2UXN B;  4BAY B;  2HPJ A;  4IE6 A;  2RPA A;  3OBV E;  3VKH A;  3ZN0 B;  2PTF A;  3K1S A;  1SE7 A;  4YTM A;  3NKZ A;  4O4I E;  3UUN A;  3PJA A;  2DHR A;  3BK9 A;  3QB5 A;  3UU4 A;  4LF6 T;  1N32 T;  3RKG A;  2ZM6 T;  5J2U E;  4NPP A;  4IDQ A;  5L3B B;  4H9N C;  1HG2 A;  5FXX A;  4YT0 A;  4AQG A;  4H9P C;  2WS3 A;  2V26 A;  2IML A;  2IC9 A;  4X1I E;  3OVU A;  3A8Y C;  4F8H A;  4HFE A;  5LGT B;  1Z0P A;  4IE7 A;  4U2Z A;  3C98 B;  2CXF A;  2B1E A;  4AI6 A;  4JYA T;  2E9X D;  2V5C A;  4MBQ A;  2YK0 A;  4N78 D;  2BG9 A;  3CQC B;  3UQ7 A;  4MAL A;  1FMV A;  3TLU A;  1HCI A;  1G8X A;  3ZMV B;  1X79 A;  2KLQ A;  4ILA A;  3N9O A;  2E5V A;  3LBX A;  5FY0 A;  4PJL A;  4DR1 T;  4H9S E;  3U3I A;  2LKH A;  2CPT A;  2M6B A;  4JI2 T;  5FXW A;  4UEM A;  2D2S A;  4OYK A;  4LF9 T;  4L5G A;  1VCS A;  2MOZ A;  5FY1 A;  4QWN B;  2XAG B;  2VL8 A;  3WAK A;  5FVK A;  4E7Z A;  3P4W A;  2BVM A;  2D5U A;  3AVR A;  3IA3 A;  4YLH A;  2VQE T;  1R8I A;  2W61 A;  5LNK A;  5KX5 E;  2N1G A;  3ZN1 B;  2VK9 A;  3N9Q A;  4EAH A;  4IGU A;  2DNX A;  4KHZ F;  5TAO A;  3RIA A;  3LSV A;  3AVS A;  3F57 A;  3ZJ1 A;  3ZYL A;  3RHW A;  2Y6X A;  3ZSS A;  4UF0 B;  4PAG A;  2KND A;  1MMA A;  3F31 A;  3P4S A;  4DR7 T;  4DVD A;  5F3J A;  2VUR A;  4CI1 B;  3WI3 A;  4DV7 T;  4H63 H;  3V5S A;  3AE5 A;  3PU8 A;  3CQG B;  2EHO C;  3NZQ A;  1VRB A;  4COF A;  2L8K A;  4PK5 A;  1KF6 A;  1E7P A;  5KXJ A;  4XAX B;  4X1Y E;  4X66 T;  5AQG B;  2EHO A;  3I0O A;  4YSZ A;  3L8R A;  2MAW A;  3UFG A;  4I43 B;  1HX8 A;  2X51 A;  5FY7 A;  1B7T A;  4QX7 B;  1KNP A;  4GYS A;  4WW0 A;  3RX6 A;  3VRA A;  1UK5 A;  4HKA A;  4PFO A;  3B57 A;  3JC6 C;  5LA6 E;  3UU5 A;  2V7I A;  2DCF A;  1MMG A;  4DUY T;  1HNZ T;  4ZEY A;  2DLR A;  2V5D A;  1UCU A;  1N34 T;  2WDR A;  4LF7 T;  3R84 B;  3AEB A;  2X9H A;  3N2G E;  2WCA A;  5A1L A;  3T1Y T;  3AA6 B;  4K0K T;  2YEV C;  5LG3 A;  2J1D G;  1X9B A;  2YU1 A;  4OYJ A;  4UXN B;  2VL0 A;  2QYW A;  3RIU C;  3VHL A;  4DUZ T;  3TLT A;  3ZC0 A;  3P4R A;  1UX4 A;  5AQQ B;  1HS7 A;  2IUB A;  4HN9 A;  2YIN A;  4QXH B;  2CM0 A;  3K3N A;  3IHR A;  2LSK A;  1MMN A;  4IE4 A;  2XSB A;  2UUA T;  4PK6 A;  3Q5E A;  4MHC A;  5L3E B;  1ZEE A;  2BZB A;  4JEU B;  4IL4 A;  2BKO A;  2IIU A;  2LT3 A;  5HEG A;  4UV9 B;  1E2A A;  4HFC A;  1SUM B;  3FZH B;  1CUN A;  5LCY A;  2YDQ A;  5HXH A;  4TV8 E;  3JAD A;  2X0Y A;  2CBI A;  5L4H A;  2VWA A;  1VOM A;  5H6R B;  2PFV A;  3U78 A;  3VR8 A;  3W15 B;  3QC9 A;  5LMN T;  1ZV4 X;  4KP3 C;  3AAI A;  2BG9 B;  3PUQ A;  3OKQ A;  4ASK A;  2E9X C;  4B3R T;  4DMV A;  3T8O A;  2ZM0 A;  3CPZ A;  4I55 E;  4EZ4 A;  3LBX B;  4AQF C;  3AXJ B;  1HX1 B;  4YTN A;  2CBJ A;  2LSG A;  3SFE A;  4O8S A;  3KVA A;  3ZYM A;  2L3L A;  2YN6 A;  3FBL A;  5JQG E;  1IBM T;  2BS3 A;  4DV1 T;  2E9X A;  3TKL B;  5HCM A;  3PV0 F;  1MND A;  4BA9 A;  2VKJ A;  5JH7 E;  5L3D B;  3GWH A;  2ES0 A;  3GMI A;  4AKG A;  2JPF A;  3FXD B;  1WFD A;  2JQH A;  3VU7 H;  4NUV A;  3RRC A;  2LE8 A;  3K3Q C;  3FBZ A;  1SA0 E;  4JUY A;  4JI1 T;  2KZ7 B;  1J5E T;  2J47 A;  3PUG A;  4O4J E;  4CXY A;  4I50 E;  1XNR T;  4WYV A;  3KV6 A;  4AKI A;  4CI3 B;  5HXS A;  5LB7 B;  1XZY A;  5AQO B;  2CMR A;  1LVF A;  3UUX B;  3RYF E;  5CJ5 A;  3ZMU B;  4AIS A;  2C5I T;  4I0U A;  4X62 T;  2PG8 A;  2YU2 A;  2AE9 A;  2MYS A;  3AE7 A;  4OK0 A;  4WBO A;  5DQV A;  5LBM A;  4ERR A;  2SPC A;  3GA8 A;  4BJN A;  5L4E A;  3AAE B;  2ZLY A;  3KBU A;  5AQP B;  3LK4 2;  3GN5 A;  3LDQ B;  4EED A;  4LML A;  5HEU A;  2PJQ A;  3CWZ B;  2KXP B;  3PUZ F;  3N9P A;  2BS2 A;  4X65 T;  2EHO B;  3R6N A;  2XHE B;  2W00 A;  3FZM B;  2XQ3 A;  2LKG A;  4TNW A;  4YJ3 E;  2WBL A;  4WBN E;  3RC3 A;  2X67 A;  3HKC E;  3RLF F;  3HA4 A;  5IUX A;  3VR9 A;  2FJE A;  5AQS B;  2ZMA A;  1E1H B;  2W66 A;  2VKD A;  2X66 A;  5CA0 E;  5JDH A;  2LM9 A;  4JI7 T;  5HXE A;  3P7I A;  5ABH A;  2LOP A;  2KMF A;  2H3R A;  2XZE A;  2CWY A;  1MIV A;  4HWF A;  1KNZ A;  5JR9 C;  4YY3 T;  2X9Y A;  3Q9D A;  4ZI3 D;  2XJ7 A;  5KMG P;  1S94 A;  2JMH A;  4HFB A;  4PW8 A;  4XBF B;  2XQ8 A;  1MMD A;  4F6R C;  1OED E;  3Q2M A;  4ZI7 E;  2W63 A;  3MJX A;  5JDF A;  5AQM B;  2V6Y B;  2WDV A;  4OHF A;  4O4L E;  3K8P C;  2R6G F;  4BJM A;  2D0T A;  4KI0 F;  2C5K T;  3BQI A;  3MXZ A;  3NWI A;  3ZYK A;  4U3C A;  1VCT A;  3B5M A;  5EK2 A;  1IZN B;  4IDN A;  3RC8 A;  3PDY A;  2WWU A;  2YDR A;  3KV5 A;  4HEA A;  2YDS A;  4DV4 T;  2LSY A;  4PJJ A;  4YSX A;  3KDS E;  2I0M A;  4E7S A;  3AE2 A;  2F4V T;  1XNQ T;  2JIW A;  4TWH A;  1BR4 A;  4HWI B;  3C4X A;  5J0Z A;  2D9D A;  3E0Z A;  3D0T A;  3CML A;  4DV5 T;  3C50 A;  3EVY A;  3ZJ2 A;  3B13 A;  2JMK A;  4JBW F;  5AQN B;  3I9Y A;  5H6Q B;  3AXJ A;  4DV2 T;  2G0U A;  4CXW A;  4ZI2 D;  4Q25 A;  2FJB A;  2MBG A;  3AE6 A;  2E9X B;  4CXX A;  2K9A A;  2CXL A;  3DP7 A;  5LG4 A;  4ADZ A;  4GKK T;  4QHO A;  4B3S T;  2IHR 1;  1Z8U A;  1WR0 A;  3KBT A;  1IBK T;  4DR4 T;  2FUP A;  2H7V C;  1HTJ F;  1D1C A;  1JNR A;  3EI0 A;  4QH4 A;  4TUY E;  3ZMT B;  3PTR B;  1OED C;  3FZK B;  3O1H A;  2LRL A;  1IJ6 A;  4NXM T;  1T98 A;  3ABV A;  4HFI A;  4TX5 A;  2E2A A;  4LMK A;  4CI2 B;  4EYY R;  4HWC A;  5JRC A;  2NW7 A;  5BMV E;  3HL6 A;  1UUR A;  2WP9 A;  4A5X A;  4P1N A;  4IRE A;  4JEH B;  2V7M A;  3K3O A;  4GYR A;  3ZC1 A;  2ODV A;  3AE4 A;  3MA9 A;  5ABE A;  1LKX A;  4LFC T;  2WY2 A;  2KWH A;  2IC6 A;  2OA5 A;  1T7S A;  4ZOL E;  2XAH B;  4AKH A;  3RGL A;  1I6Z A;  3C64 A;  2K24 A;  4NUU A;  2CLY B;  4IDP A;  3AEE A;  3X1D A;  3GN5 B;  5AQJ B;  1DU2 A;  3UQ4 A;  5M4Y A;  2OV9 A;  4U2Y A;  3ESL A;  5JDM A;  1YXR A;  2FJA A;  2MTQ A;  5CB4 E;  2XM2 A;  3RH3 A;  2A3D A;  4JI4 T;  2CHN A;  3CX8 B;  5C3J A;  3LFM A;  3SRZ A;  3ZMZ B;  4A56 A;  4ILU A;  4ILC A;  3UU8 A;  3RYI E;  2K5B B;  2UUC T;  2UXX B;  4TWF A;  4YSY A;  2K3W A;  2XAS B;  3HKB E;  5J1G A;  2NWB A;  1FMW A;  4L9I A;  2NOX A;  3ANW A;  4PNI A;  2L9Q A;  2KWI B;  4X1K E;  3PUR A;  1J1J A;  2Q9Q D;  5EZY E;  5FXV A;  1Y01 A;  3F2E A;  3M65 A;  4K0U A;  3JAE A;  3G06 A;  4ZZB A;  4TN7 B;  2YOE A;  4UV8 B;  2A2F X;  4DR5 T;  1XWM A;  2BBJ A;  4ZI3 C;  3O4X E;  2CEA A;  5HXC A;  2Y8D A;  4CN1 A;  4Z90 A;  4Z91 A;  3MKD A;  3ZCI A;  1FJG T;  4LF5 T;  2V6Y A;  1D1A A;  3RIU A;  3FHN A;  4HTE A;  2XSA A;  3PUV F;  5F8P A;  1O3X A;  2CCQ A;  3Q5W A;  5AQV B;  2Z6E A;  5ABF A;  4GOU A;  2Y48 B;  2WAU A;  3AEG A;  3FZL B;  2VVS A;  3I1A A;  3Q5D A;  1YQ4 A;  3EDV A;  4AKR B;  5ETW A;  1V9D A;  1M62 A;  4ZS3 A;  5FMN A;  4OX9 T;  3N2K E;  1WYB A;  3QB5 K;  5C2T A;  5DJQ C;  3PE0 A;  4JLE A;  2GK9 A;  5JDQ A;  3QUJ A;  2ZM2 A;  4P0B A;  3TLW A;  3ONJ A;  4LF8 T;  2CXD A;  1BR2 A;  5LOV E;  3AEF A;  4QXB B;  1KFY A;  1MIW A;  4CN4 A;  4FJO A;  2XY8 B;  3TLV A;  2LHN A;  1XMO T;  2IW5 B;  5LHG B;  4DV3 T;  2CHO A;  2VB6 A;  1MIY A;  4TNV A;  4B6X A;  2JQQ A;  1JNZ A;  4ZI2 C;  1J5W A;  5HXR A;  5FXZ A;  2UU9 T;  4DR2 T;  1US7 B;  3C51 A;  3AE1 A;  3LK3 B;  2E5L T;  4NIQ A;  4AQF A;  3C4Z A;  3P8C D;  3HKE E;  2E8I A;  4JI3 T;  2LHR A;  3BQK A;  5LBQ B;  4WNK A;  5AFU L;  1NWM X;  2CRB A;  2WMO A;  4CZZ B;  3VKG A;  4J2C A;  4EV6 A;  2VQF T;  3O1I A;  4JI5 T;  4UEL A;  2NW9 A;  1XDP A;  1N33 T;  4HFV A;  4V1A v;  5JRC B;  5JDL A;  5HAX A;  1XDO A;  2LSJ A;  2WMN A;  3N5L A;  3S4U A;  4YFS A;  4YHH T;  3L3P A;  3ZPO A;  2JRK A;  2W2U A;  5JDN A;  3OTO T;  3BQL A;  1YKH B;  2N9D A;  3J7Y q;  5JRE A;  2ODU A;  4ZZC A;  3ZT5 A;  1D1B A;  2BKP A;  2ACX A;  1OXZ A;  2LRK A;  2X0H A;  4HFH A;  4YXD A;  4GKJ T;  3P4Q A;  3H3A A;  3CX7 B;  2V7J A;  2X0L B;  2FJD A;  5LJN A;  3ONL C;  3ZST A;  4YHJ A;  4HE8 A;  5DAB A;  3CX6 B;  4YJ2 E;  5KDM C;  2V6X A;  2DL1 A;  4DND A;  2CE7 A;  1M7K A;  1U4Q A;  2BG9 E;  1WLX A;  4DID B;  5HEH A;  3UUL A;  3T1H T;  1CHU A;  2HN2 A;  5J2T E;  1HR0 T;  3JAF A;  4ZS2 A;  2LJL A;  2HPL A;  3UTK A;  3ANW B;  4AIU A;  4U7I A;  3SS1 A;  4QKN A;  2XQ5 A;  3FXE B;  1FEW A;  4DMW A;  3N9M A;  2AXD S;  2P9B A;  2ACZ A;  3FB2 A;  2Q9Q C;  3IEE A;  5LHI B;  2JQ9 A;  5LMU T;  2X68 A;  3DTO A;  3N9L A;  4A97 A;  1WR6 A;  2VVN A;  4IE0 A;  4YTP A;  3OPC A;  4P09 A;  2C0S A;  4FI5 A;  1D0Z A;  3NBX X;  4HWH A;  2Q9Q A;  2BS4 A;  2ZM8 A;  3UUB A;  5LGN B;  2NW8 A;  3RKO A;  4JI8 T;  4EEB A;  5JR9 A;  2D0U A;  3RI5 A;  2WZH A;  3CK6 A;  1NAF A;  5HCJ A;  1HNX T;  3RQW A;  1G73 A;  4EZH A;  2NTY A;  5ABF B;  4IDO A;  4IE5 A;  3HKD E;  4PFP A;  2WM9 A;  3HI2 A;  3QNU A;  4ILB A;  2XPK A;  3UU3 A;  2UXB T;  4QH5 A;  3A5X A;  2I6H A;  3N9N A;  3AEA A;  5AQF B;  3RYC E;  3CVR A;  4IT4 A;  1HNW T;  3OJA A;  3QOF A;  5EK3 A;  4IL9 A;  3KIN B;  5E0O A;  2IAK A;  3NZP A;  3Q5X A;  5AQT B;  4ANJ A;  2XM1 A;  3ZT6 A;  3SWH A;  4G63 A;  5FNV E;  2BG9 C;  2QGS A;  2BBH A;  3I9W A;  5FP3 A;  4HWD A;  3IF8 B;  2UUB T;  3PJA J;  1HG5 A;  2J62 A;  1S35 A;  3ZLI A;  2V8S V;  3WAJ A;  2M6I A;  4EIW A;  3O9X A;  3RQU A;  4M1P A;  4NXN T;  2BKN A;  2I59 A;  3ZKR A;  5AQK B;  2LM2 A;  5AQR B;  1HFA A;  2XQ6 A;  3L09 A;  4KHP T;  4C91 A; 
#chains in the Genus database with same CATH homology
 4IT4 A;  2V6Y B;  4U2Z A;  3ZST A;  5FVK A;  2A9U A;  4NIQ A;  2CPT A;  4CN6 A;  4CN1 A;  5CJ5 A;  4U7Y A;  2WY2 A;  5FVL A;  1WCR A;  2V6X A;  4U7I A;  4CN4 A;  2DL1 A;  2K3W A;  4U2Y A;  1YXR A;  3ZT7 A;  2RPA A;  2WWV A;  4P1N A;  4A5X A;  2LRL A;  2V6Y A;  2MPK A;  3EAB A;  4WZX A;  1WFD A;  2JQH A;  4U31 A;  2CRB A;  4U3C A;  2XZE A;  3K1S A;  3ZT5 A;  3ZSS A;  2JQK A;  3ZT6 A;  5CGM A;  4U33 A;  2LRK A;  5LB7 B;  2JQ9 A;  4ZEY A;  2W2U A;  1WR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...