2CRBA

Solution structure of mit domain from mouse nrbf-2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
GSSGSSGMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nuclear receptor binding factor 2
publication title Solution structure of MIT domain from mouse NRBF-2
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2crbA00
1WFDA 2WWVA 1WCRA 4WZXA 2LRLA 3K1SA 5CJ5A 3ZSSA 2MPKA 4U7YA 2JQ9A 3ZSTA 2W2UA 4IT4A 4P1NA 2V6YA 5LB7B 2V6YB 2LRKA 2DL1A 2CRBA 2V6XA 4U3CA 1YXRA 4U31A 3ZT7A 5FVKA 3EABA 1WR0A 4CN4A 2XZEA 3ZT6A 2CPTA 4U2ZA 2WY2A 4CN1A 2JQKA 2RPAA 4A5XA 5FVLA 2JQHA 4ZEYA 4CN6A 4U7IA 3ZT5A 4U2YA 4U33A 5CGMA 2K3WA 4NIQA 2A9UA
chains in the Genus database with same CATH superfamily
2PG8A 2CE7A 3CX7B 3H37A 2XQ7A 3AA7B 4OYJA 4DNDA 5AQHB 2E9XC 4EEDA 3VR9A 2BS4A 2CLYB 2XM2A 2NWBA 3P8CD 4TV9E 2CPTA 5AQTB 3L09A 3AE2A 4H9SE 1U5PA 3T1HT 2VK9A 3TLSA 4HFIA 3I1AA 2N2NA 2MPKA 3UUMA 3ZEFB 4KP3C 3JAFA 5ABFA 3T1YT 3ZKRA 4DV6T 3N9OA 2KXPB 3AE1A 3CX8B 2YDSA 5KXJA 4IL9A 4FI5A 4QKNA 4BJNA 3SFEA 4O8SA 3KVBA 4AIUA 1N32T 3N9MA 4HTEA 4UR9A 2EHOA 2ES0A 2BZBA 3FHNA 4PJLA 1XDPA 4JV5T 4JEHB 1FEWA 5F8PA 5CB4E 1X79A 3ZMTB 3Q5DA 3VKGA 4N78D 5A1LA 3H3AA 2CWYA 4O4LE 3F2EA 1W0AA 4HFBA 5M4YA 4QWNB 4ZZCA 4TWFA 4B6XA 2UXDT 5KX5E 1XDOA 4BA9A 5JTGA 2BS3A 4EZ4A 4JUYA 3T8OA 4X65T 4H9NC 1U4QA 2X9HA 2ZM6T 2X9YA 2W00A 4Z91A 3RKGA 1FMWA 4G63A 5FY0A 4PJMA 2XAGB 2XTLA 4B3MT 3FXEB 4HFEA 5KDMC 5FYMA 1ZOYA 3C4WA 3RX6A 4UF0B 4E7ZA 2A72A 1V9DA 5HXSA 2W66A 3C50A 2IMLA 2K5BB 3IEEA 1R8IA 5LGTB 5HEGA 2D5UA 3ZC0A 3TKLB 2XQ4A 1Z0PA 3O1IA 4O2AE 4YTNA 2LSIA 2ZLYA 3J7Yq 3LBXB 1M7KA 1D1AA 5LHHB 1OXZA 3AA6B 5JREA 3OBVE 3RQWA 2WZIA 4A98A 3AEGA 2OV9A 4HFVA 2XSBA 1G8XA 2LE8A 5L3DB 4JBWF 4X20E 4TWHA 1SE7A 3PUSA 5AQPB 2I0MA 3JCFA 3K3QC 1SA0E 5JH7E 4QH4A 3ABVA 2VURA 4U2YA 2E2AA 2WZHA 2W0GA 1KF6A 2N1GA 3I9WA 3V5SA 4AKRB 3UUXB 1ZEEA 2CRBA 3EABA 1L0VA 3ZMVB 1J1JA 4QHOA 2JMKA 4CXXA 3OJAA 1W0BA 4ASKA 2FBWA 2V7KA 3HL6A 4WNKA 2XPKA 2YINA 3U78A 2LSGA 4JI4T 5DJQC 1QUUA 5HEOA 3RIUC 3EDUA 4LFAT 1KEYA 4CZZB 3N9LA 3HKCE 2YDRA 2XY8B 2UXCT 2JPFA 2UXBT 2DI4A 1WYBA 2J47A 5FXZA 5JR9C 2BKPA 3EUHA 5L2LA 2K48A 3ZSTA 4ZI2D 2Q9QD 3AE9A 4X64T 4O2BE 2WU5A 4JYAT 5FVLA 4ZZBA 4TX5A 2CM0A 3V5UA 3E08A 3EHZA 3B5MA 2HN1A 2K24A 1VCSA 2YOEA 3ZJ1A 2BVLA 2E9XB 4LF4T 4AQGA 3Q9DA 4A56A 2WB5A 4PJJA 1EZ3A 4YT0A 1QLBA 3MK7C 3UUNA 2D0TA 5FY1A 2WDRA 2LSKA 5LGNB 3LFMA 3SFDA 4NXMT 4KMCA 4X62T 3M65A 3EDVA 1H7CA 4QXBB 4LF8T 3RRWA 3AEBA 4G2AA 1D0XA 2FJAA 2IHR1 4F6RC 5LG3A 3RI5A 4UVAB 4LF6T 1ZV4X 5FXVA 5FVKA 3O1HA 4EOZB 4LMJA 1ZP0A 4A97A 2LJLA 5AQUB 5FL0A 3HA4A 1UX5A 2AE9A 2B76A 2XM1A 5HYAA 3AVRA 1WCRA 5L3GB 4ILUA 5AQIB 3CK6A 5AQKB 5L3BB 4DR3T 3KBTA 3UU8A 2PFVA 4HEAA 3EI0A 2KT9A 5ADXL 2CMRA 5CJ5A 4X66T 1X9BA 3AEAA 1UX4A 3RQUA 5C8YE 2ZM8A 4WYVA 5BR8T 5LP6E 2C5KT 3AEDA 4COFA 3AE4A 2NTXA 3R6NA 2JQHA 2A2FX 4I4TE 2YEVC 4HFHA 4CI1B 2BG9C 1O3XA 4BAYB 1FJGT 5AQGB 3UQ7A 2CA5A 4IL4A 3RLFF 5HEJA 3N5LA 2BKNA 3OVUA 5JDMA 4CI3B 4IDNA 2W67A 4DMVA 2UUAT 2V5CA 3QOFA 5LG4A 4ZHQE 4F8HA 1E7PA 3AAEB 2Q9QA 1FIOA 3U3IA 3JC6D 3ONJA 5CGMA 3CQCB 2VKHA 3K8PC 2WMOA 3QB5A 1N36T 3ZCJA 3P4QA 4MHCA 4DR2T 5J1GA 1YKEB 2V6XA 1OEDB 2FJEA 1HTJF 4DR4T 2SPCA 2L9QA 2YU2A 2WM9A 4EYUA 3ZT5A 4AQYT 2WDVA 3RIAA 3IBPA 1BR4A 3MACA 2HPJA 4U7YA 4QX8B 1XWMA 4TWDA 2ACZA 4JLEA 3ZMSB 2WY2A 3H3MA 2UXXB 4PK5A 1YKHB 2DLRA 1WR6A 2NOXA 3ZMZB 3N2OA 4KUMB 4GK0E 4YSYA 4GYRA 4DIDB 5LXTE 2NR4A 3N2GE 4LFBT 3B13A 4IIJE 4ILBA 3ANWB 2Z6EA 4TV8E 4HFDA 5LYJE 5JR9B 5LA6E 3J9X1 4AQFA 2QYWA 4ADZA 3RC8A 2FJBA 5LOVE 1E1HB 2XAFB 2XJ7A 1JNRA 5HXRA 2XUEA 4Q25A 3RYIE 3BK9A 4KHPT 4DUYT 3P7IA 4JI0T 5L3EB 2XAJB 3A7MA 5LHGB 2VL0A 4JI8T 3KVAA 3AEEA 3UU3A 1YD8G 2L8KA 3RIFA 5LMNT 1IBKT 3ZYMA 3AB3B 5IYZE 2DNXA 4OHFA 3SRZA 4PNIA 5HCMA 1J5WA 4YSXA 5LBQB 1IJ6A 5JDNA 2VL8A 5LJMA 3PJAA 4DBRA 3UUBA 2RP4A 3GWHA 4YSZA 2KWIB 4K0KT 2WWVA 2X9XA 1YQ4A 3UT5E 4EEBA 3HR0A 3AAAB 1MIWA 5LCYA 5H6QB 3W15B 4UELA 2FJDA 2VKOA 4XAXB 2V5DA 2VQFT 1HX8A 3AE8A 2QGSA 4O4HE 3HKEE 4IE6A 5L4HA 1OEDA 5GONE 4DV7T 4AI6A 4UVBB 4P0AA 4CN4A 2W61A 5LBMA 2WWUA 2VWAA 5AQFB 2W63A 5L3FB 1HNXT 4HWCA 1BR0A 2R6GF 3KV9A 5FMNA 2VQET 4WBOA 2E8IA 2H88A 3OKQA 3Q2MA 4I0UA 4HWHA 2H3RA 4L9IA 4IE0A 1SUMB 1AJ3A 3BQIA 3FZFB 4KHZF 4NIQA 2HN2A 4YHJA 3ONLC 3VHLA 3AVSA 2CHOA 2BG9B 3ETVA 1HNWT 3RC3A 1D1CA 2BVMA 4TUYE 1XMOT 3FB2A 3GN5B 4UV8B 2V6YB 4LF5T 1MIYA 2EHOC 3ANWA 3C4ZA 4X1KE 4PK6A 2V26A 5LJNA 4AISA 2JRKA 2IC6A 3BQLA 4EB6E 1NENA 4GKKT 4ZI3D 4U2ZA 3F57A 3EVYA 3UU6A 2OA5A 2WSSV 4PAGA 3GMIA 2V7IA 2BS2A 1YW0A 2KSRA 2XHEB 3G06A 4H9QC 2ZM0A 2H89A 5AQQB 4CN1A 1DU2A 2UUCT 3P4SA 2N9DA 3LK42 1Z8UA 3Q5XA 4AKIA 1UUSA 5HXCA 2C5IT 3RH3A 1UK5A 3IF8B 3N9PA 1LVFA 1MIVA 4OYKA 2OLTA 4Z90A 2LHNA 3OTOT 4Z8XA 1BR1A 3HKBE 4NUVA 3ZT6A 4CXYA 4H9PC 3AXJB 4I50E 2B1EA 2WS3A 3I9YA 4WW0A 4WZXA 2ZM2A 3JAEA 3LK2B 4ILAA 3QB5K 2MOZA 2D2SA 4NPPA 3PUZF 2LRKA 2DL1A 4CI2B 5JDQA 2VVNA 2WQYA 5JDFA 3UU4A 2KMFA 3C51A 1JNZA 2WP9A 4IDOA 4EZHA 3CQXC 5F5WA 4DV3T 3PUWF 3LK3B 5IUXA 1HG5A 1HNZT 2A3DA 2CXDA 2E9XD 1GQEA 2UXNB 2CLYC 3CVRA 2V7JA 2I6HA 5HEHA 3RHWA 3RF1A 3PUYF 3AE7A 1KK7A 2LOPA 5EZYE 4PK4A 3NKZA 2VB6A 4PW8A 4ZXLA 5L4EA 1Y01A 4UF0A 1XNRT 4ISTA 2MBGA 1NAFA 2M6IA 2VVSA 2YKSA 2UU9T 2YK0A 2XQ8A 4E7SA 2X67A 3TLVA 3PURA 3K3NA 4GYSA 4YHHT 3BQKA 5AQRB 4IGUA 1B7TA 2NW7A 3AEFA 1WRDA 1E2AA 3NZQA 4YFSA 3LBXA 2KWHA 3KV4A 2HH7A 4YTMA 3RYFE 5LMUT 3AA0B 1IZNB 4GOUA 4H9OC 1HFAA 3F31A 4I55E 4LF7T 5JVDE 4ZI7E 4C90A 1D0YA 2RA1A 2LT3A 3UFGA 4QXHB 4IE5A 1HR0T 3FZMB 5FY7A 3NZPA 4A5XA 3UFEA 3VRBA 2IUBA 2WAUA 4QH1A 2E5LT 5AQJB 4O4IE 3WI3A 4IT4A 3L39A 2XASB 4HE8A 3O4XE 1HF8A 4DV4T 4EYYR 2H7OA 3IA3A 3ZLIA 2QRXA 2MAWA 2V8SV 4PJNA 4JI5T 3NWIA 5ABFB 2XQ5A 4UV9B 2WDQA 3PJAJ 4XZCA 2G0UA 3UU5A 5FP3A 3CKDA 4YJ3E 1IBLT 2MYSA 5L47A 3PU3A 3ZSSA 4DUZT 5HEUA 2XQAA 4YJ2E 2JJ9A 2YN6A 2C0SA 4QH5A 4JI7T 3AAIA 3AE3A 2LM9A 2X51A 4MFRA 4K0UA 2GK9A 3FZLB 3ZCIA 1KNZA 1OEDE 3HI2A 4ILCA 2E9XA 4HWDA 3PUXF 1IBMT 4H9RC 4EAHA 4TZ4C 1HS7A 3RGLA 1WLXA 2V7LA 3GA8A 3ZN0B 2LKHA 4ERRA 3KBUA 4MLKA 2JQ9A 2X0LB 1MNEA 1KFYA 1MMGA 2HHHT 2DWKA 3ZMUB 1XMQT 4LF9T 3FBLA 3PU8A 1UCUA 3KDSE 4QX7B 4IDPA 3PUVF 5FL1A 4J2CA 4EGWA 4KBMB 4NXNT 1W09A 1T7SA 1XNQT 5LHIB 2CCQA 3NBXX 3VR8A 3CX6B 4H63V 5AQNB 1ZHCA 4LFCT 3SWHA 3O9XA 4ZEYA 2AXDS 2CXLA 3FZHB 2YU1A 2LEHA 4HGAA 5EK2A 3LSVA 4JI1T 2KINB 4U31A 1N34T 3HKDE 4AKHA 4ZI2C 2JQKA 2Q9QC 3JADA 2PTFA 4U33A 5HWXA 2PBIA 5HWYA 4CQIA 1D0ZA 4HWIB 3VU7H 4BJMA 2J62A 5HXHA 3Q5EA 4HKAA 5EK4A 2D9DA 4XBFB 3ZC1A 4U7IA 3WAJA 2XQ9A 3P4RA 2LRLA 2LSJA 2LM2A 2QA7A 2LSYA 5L3CB 2LHRA 5IHYA 4HWFA 3FBZA 2BBHA 4KI0F 2WCAA 1IAPA 3AE5A 3MA9A 3AE6A 2M67A 3OYZA 3UULA 3RYCE 5C2TA 3CMLA 4QXCB 4TNVA 2JMHA 4DVDA 1I94T 2Y48B 1WYCA 4HN9A 1VCTA 3TLUA 3PV0F 5DQVA 2CXFA 2JIWA 4IHJE 4O4JE 1VOMA 4EV6A 4DV2T 5ABEA 2KZ7B 1LRZA 4AQFC 1OWAA 3SS1A 2CBJA 4UXNB 3PUAA 3ZT7A 4LMKA 4AKLA 5HCJA 2IIUA 3MXZA 5E0OA 1CUNA 3SOLA 2KNDA 4DV0T 2XQ3A 4TNWA 4IE4A 4B3ST 2XQYA 1BR2A 4UIGA 1HG2A 5AQSB 4YY3T 4UEMA 2BG9E 2NP9A 2DCFA 5HXEA 3D0TA 4MALA 2DHRA 4YTPA 3ZYKA 3ZN1B 4PFPA 4TN7B 5ABGA 3K3OA 5JDHA 3RIUA 3QK6A 1W9RA 1MNDA 5ABHA 1HX1B 2WBLA 3DTOA 3ONXA 5JR9A 3K1SA 3I0QA 2X66A 2W2UA 5AQOB 5FKYA 4DR5T 4C91A 5JQGE 2DWGA 4GKJT 2V1DB 1KNRA 3P4PA 5ETWA 5JDLA 5LNKA 3EAMA 2A9UA 3JC6C 3UTKA 5AFUL 2VASA 2YDQA 3ETUA 4AXPA 3QNUA 2XAHB 2QVAA 4HFCA 5FNVE 4IREA 1OEDC 4LMLA 1UGOA 3PE0A 3QC9A 1S35A 3MJXA 5CA1E 3DP7A 4L5GA 3CQGB 4ZS3A 3ESLA 2WU2A 3E22E 2NW9A 1Y64B 4DR6T 5LB7B 3PUGA 1WR0A 2ACXA 2IW5B 4JEUB 4X5TA 4OK0A 3Q5WA 3QUJA 3ZJ2A 2XQ6A 3LJCA 3P50A 4H63H 2NW8A 1YXRA 1LVKA 3O1JA 1MMAA 5J2UE 3AECA 2IAKA 4UVCB 3DJBA 2ODVA 3PDYA 5AQMB 2LKGA 2X0YA 5KMGP 3FXDB 3N9QA 4U74A 3ZYLA 2XZEA 4OFZA 2Q9QB 5DQWA 2X9WA 4M1PA 1ZKEA 1T8BA 2M6BA 3KV5A 2BDEA 1NWMX 4V1Av 3KINB 4B3RT 4IDQA 3I0OA 3CPZA 4DV1T 5JDGA 2FUPA 2J4GA 1M62A 5AQVB 3L8RA 1CHUA 2BG9A 1SHZC 2KLQA 1S94A 3GN5A 3S4UA 1FMVA 1KNPA 1J5ET 2V6YA 3R84B 3OPCA 5JRCB 2X0HA 3C98B 3VKHA 2V7MA 2Y8DA 1I6ZA 2XSAA 3C64A 3NRXA 2X68A 2J1DG 4ISSA 3WAKA 3TLWA 2NTYA 2W4XA 4ZOLE 3KFWX 3CIRA 3PTRB 4EXTA 4FJOA 5H6RB 1D1BA 1YQ3A 2CWOA 1T72A 3LG7A 2P9BA 4P09A 4GK5E 3A8YC 3A5XA 2JQQA 5EK3A 4X1YE 4WBNE 3RYHE 4PFOA 5IWAT 2CBIA 4AKGA 1LKXA 2BKOA 2L3LA 5LGUB 5BMVE 3P4WA 3OYXA 3UQ4A 4DR7T 1MMNA 1MMDA 3X1DA 1UURA 1NEKA 4B3TT 3M3ZB 2VKDA 3B57A 3AXJA 4DR1T 3E0ZA 5J0ZA 2PJQA 2LLYA 2HPLA 4ANJA 4I43B 4P1NA 5CFBA 2VKJA 2UUBT 2ZMAA 4JI2T 5DABA 5C3JA 2EHOD 3KV6A 3VRAA 1VRBA 1XZYA 4DO0A 3RKOA 2EHOB 4MBQA 4NUUA 1IJ5A 3NVOA 4DBQA 2ODUA 1WFDA 4YLHA 4DV5T 1N33T 4YXDA 5HAXA 4ZS2A 1QSDA 2I59A 4JI3T 3AA1B 3IHRA 3TLTA 5FXWA 2W62A 4GIWA 4IDZA 3MKDA 5AQLB 2C5JA 4ZI3C 4DMWA 2MTQA 2K3WA 5J2TE 3RRCA 2Y6XA 2K9AA 3FZKB 4P0BA 2H7VC 2CHNA 2F4VT 1G73A 4X1IE 2RPAA 3L3PA 5FXXA 4CN6A 3PUQA 2IC9A 4JI6T 3C4XA 4OX9T 5CA0E 5TAOA 2BBJA 5JRCA 3NRYA 1T98A 3LDQB 4U3CA 1US7B 2WMNA 4EIWA 3N2KE 2E5VA 3ZPOA 2CEAA 2XAQB 3N9NA 2LOSA 4CXWA 4U72A 3RPUA 3CWZB 5F3JA 1HCIA 2IDOB 4KX6A 3MZKB 4IE7A 2D0UA 4L0RA
chains in the Genus database with same CATH topology
1WFDA 2WWVA 1WCRA 4WZXA 2LRLA 3K1SA 5CJ5A 3ZSSA 2MPKA 4U7YA 2JQ9A 3ZSTA 2W2UA 4IT4A 4P1NA 2V6YA 5LB7B 2V6YB 2LRKA 2DL1A 2CRBA 2V6XA 4U3CA 1YXRA 4U31A 3ZT7A 5FVKA 3EABA 1WR0A 4CN4A 2XZEA 3ZT6A 2CPTA 4U2ZA 2WY2A 4CN1A 2JQKA 2RPAA 4A5XA 5FVLA 2JQHA 4ZEYA 4CN6A 4U7IA 3ZT5A 4U2YA 4U33A 5CGMA 2K3WA 4NIQA 2A9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFD A;  2WWV A;  1WCR A;  4WZX A;  2LRL A;  3K1S A;  5CJ5 A;  3ZSS A;  2MPK A;  4U7Y A;  2JQ9 A;  3ZST A;  2W2U A;  4IT4 A;  4P1N A;  2V6Y A;  5LB7 B;  2V6Y B;  2LRK A;  2DL1 A;  2CRB A;  2V6X A;  4U3C A;  1YXR A;  4U31 A;  3ZT7 A;  5FVK A;  3EAB A;  1WR0 A;  4CN4 A;  2XZE A;  3ZT6 A;  2CPT A;  4U2Z A;  2WY2 A;  4CN1 A;  2JQK A;  2RPA A;  4A5X A;  5FVL A;  2JQH A;  4ZEY A;  4CN6 A;  4U7I A;  3ZT5 A;  4U2Y A;  4U33 A;  5CGM A;  2K3W A;  4NIQ A;  2A9U A; 
#chains in the Genus database with same CATH topology
 2PG8 A;  2CE7 A;  3CX7 B;  3H37 A;  2XQ7 A;  3AA7 B;  4OYJ A;  4DND A;  5AQH B;  2E9X C;  4EED A;  3VR9 A;  2BS4 A;  2CLY B;  2XM2 A;  2NWB A;  3P8C D;  4TV9 E;  2CPT A;  5AQT B;  3L09 A;  3AE2 A;  4H9S E;  1U5P A;  3T1H T;  2VK9 A;  3TLS A;  4HFI A;  3I1A A;  2N2N A;  2MPK A;  3UUM A;  3ZEF B;  4KP3 C;  3JAF A;  5ABF A;  3T1Y T;  3ZKR A;  4DV6 T;  3N9O A;  2KXP B;  3AE1 A;  3CX8 B;  2YDS A;  5KXJ A;  4IL9 A;  4FI5 A;  4QKN A;  4BJN A;  3SFE A;  4O8S A;  3KVB A;  4AIU A;  1N32 T;  3N9M A;  4HTE A;  4UR9 A;  2EHO A;  2ES0 A;  2BZB A;  3FHN A;  4PJL A;  1XDP A;  4JV5 T;  4JEH B;  1FEW A;  5F8P A;  5CB4 E;  1X79 A;  3ZMT B;  3Q5D A;  3VKG A;  4N78 D;  5A1L A;  3H3A A;  2CWY A;  4O4L E;  3F2E A;  1W0A A;  4HFB A;  5M4Y A;  4QWN B;  4ZZC A;  4TWF A;  4B6X A;  2UXD T;  5KX5 E;  1XDO A;  4BA9 A;  5JTG A;  2BS3 A;  4EZ4 A;  4JUY A;  3T8O A;  4X65 T;  4H9N C;  1U4Q A;  2X9H A;  2ZM6 T;  2X9Y A;  2W00 A;  4Z91 A;  3RKG A;  1FMW A;  4G63 A;  5FY0 A;  4PJM A;  2XAG B;  2XTL A;  4B3M T;  3FXE B;  4HFE A;  5KDM C;  5FYM A;  1ZOY A;  3C4W A;  3RX6 A;  4UF0 B;  4E7Z A;  2A72 A;  1V9D A;  5HXS A;  2W66 A;  3C50 A;  2IML A;  2K5B B;  3IEE A;  1R8I A;  5LGT B;  5HEG A;  2D5U A;  3ZC0 A;  3TKL B;  2XQ4 A;  1Z0P A;  3O1I A;  4O2A E;  4YTN A;  2LSI A;  2ZLY A;  3J7Y q;  3LBX B;  1M7K A;  1D1A A;  5LHH B;  1OXZ A;  3AA6 B;  5JRE A;  3OBV E;  3RQW A;  2WZI A;  4A98 A;  3AEG A;  2OV9 A;  4HFV A;  2XSB A;  1G8X A;  2LE8 A;  5L3D B;  4JBW F;  4X20 E;  4TWH A;  1SE7 A;  3PUS A;  5AQP B;  2I0M A;  3JCF A;  3K3Q C;  1SA0 E;  5JH7 E;  4QH4 A;  3ABV A;  2VUR A;  4U2Y A;  2E2A A;  2WZH A;  2W0G A;  1KF6 A;  2N1G A;  3I9W A;  3V5S A;  4AKR B;  3UUX B;  1ZEE A;  2CRB A;  3EAB A;  1L0V A;  3ZMV B;  1J1J A;  4QHO A;  2JMK A;  4CXX A;  3OJA A;  1W0B A;  4ASK A;  2FBW A;  2V7K A;  3HL6 A;  4WNK A;  2XPK A;  2YIN A;  3U78 A;  2LSG A;  4JI4 T;  5DJQ C;  1QUU A;  5HEO A;  3RIU C;  3EDU A;  4LFA T;  1KEY A;  4CZZ B;  3N9L A;  3HKC E;  2YDR A;  2XY8 B;  2UXC T;  2JPF A;  2UXB T;  2DI4 A;  1WYB A;  2J47 A;  5FXZ A;  5JR9 C;  2BKP A;  3EUH A;  5L2L A;  2K48 A;  3ZST A;  4ZI2 D;  2Q9Q D;  3AE9 A;  4X64 T;  4O2B E;  2WU5 A;  4JYA T;  5FVL A;  4ZZB A;  4TX5 A;  2CM0 A;  3V5U A;  3E08 A;  3EHZ A;  3B5M A;  2HN1 A;  2K24 A;  1VCS A;  2YOE A;  3ZJ1 A;  2BVL A;  2E9X B;  4LF4 T;  4AQG A;  3Q9D A;  4A56 A;  2WB5 A;  4PJJ A;  1EZ3 A;  4YT0 A;  1QLB A;  3MK7 C;  3UUN A;  2D0T A;  5FY1 A;  2WDR A;  2LSK A;  5LGN B;  3LFM A;  3SFD A;  4NXM T;  4KMC A;  4X62 T;  3M65 A;  3EDV A;  1H7C A;  4QXB B;  4LF8 T;  3RRW A;  3AEB A;  4G2A A;  1D0X A;  2FJA A;  2IHR 1;  4F6R C;  5LG3 A;  3RI5 A;  4UVA B;  4LF6 T;  1ZV4 X;  5FXV A;  5FVK A;  3O1H A;  4EOZ B;  4LMJ A;  1ZP0 A;  4A97 A;  2LJL A;  5AQU B;  5FL0 A;  3HA4 A;  1UX5 A;  2AE9 A;  2B76 A;  2XM1 A;  5HYA A;  3AVR A;  1WCR A;  5L3G B;  4ILU A;  5AQI B;  3CK6 A;  5AQK B;  5L3B B;  4DR3 T;  3KBT A;  3UU8 A;  2PFV A;  4HEA A;  3EI0 A;  2KT9 A;  5ADX L;  2CMR A;  5CJ5 A;  4X66 T;  1X9B A;  3AEA A;  1UX4 A;  3RQU A;  5C8Y E;  2ZM8 A;  4WYV A;  5BR8 T;  5LP6 E;  2C5K T;  3AED A;  4COF A;  3AE4 A;  2NTX A;  3R6N A;  2JQH A;  2A2F X;  4I4T E;  2YEV C;  4HFH A;  4CI1 B;  2BG9 C;  1O3X A;  4BAY B;  1FJG T;  5AQG B;  3UQ7 A;  2CA5 A;  4IL4 A;  3RLF F;  5HEJ A;  3N5L A;  2BKN A;  3OVU A;  5JDM A;  4CI3 B;  4IDN A;  2W67 A;  4DMV A;  2UUA T;  2V5C A;  3QOF A;  5LG4 A;  4ZHQ E;  4F8H A;  1E7P A;  3AAE B;  2Q9Q A;  1FIO A;  3U3I A;  3JC6 D;  3ONJ A;  5CGM A;  3CQC B;  2VKH A;  3K8P C;  2WMO A;  3QB5 A;  1N36 T;  3ZCJ A;  3P4Q A;  4MHC A;  4DR2 T;  5J1G A;  1YKE B;  2V6X A;  1OED B;  2FJE A;  1HTJ F;  4DR4 T;  2SPC A;  2L9Q A;  2YU2 A;  2WM9 A;  4EYU A;  3ZT5 A;  4AQY T;  2WDV A;  3RIA A;  3IBP A;  1BR4 A;  3MAC A;  2HPJ A;  4U7Y A;  4QX8 B;  1XWM A;  4TWD A;  2ACZ A;  4JLE A;  3ZMS B;  2WY2 A;  3H3M A;  2UXX B;  4PK5 A;  1YKH B;  2DLR A;  1WR6 A;  2NOX A;  3ZMZ B;  3N2O A;  4KUM B;  4GK0 E;  4YSY A;  4GYR A;  4DID B;  5LXT E;  2NR4 A;  3N2G E;  4LFB T;  3B13 A;  4IIJ E;  4ILB A;  3ANW B;  2Z6E A;  4TV8 E;  4HFD A;  5LYJ E;  5JR9 B;  5LA6 E;  3J9X 1;  4AQF A;  2QYW A;  4ADZ A;  3RC8 A;  2FJB A;  5LOV E;  1E1H B;  2XAF B;  2XJ7 A;  1JNR A;  5HXR A;  2XUE A;  4Q25 A;  3RYI E;  3BK9 A;  4KHP T;  4DUY T;  3P7I A;  4JI0 T;  5L3E B;  2XAJ B;  3A7M A;  5LHG B;  2VL0 A;  4JI8 T;  3KVA A;  3AEE A;  3UU3 A;  1YD8 G;  2L8K A;  3RIF A;  5LMN T;  1IBK T;  3ZYM A;  3AB3 B;  5IYZ E;  2DNX A;  4OHF A;  3SRZ A;  4PNI A;  5HCM A;  1J5W A;  4YSX A;  5LBQ B;  1IJ6 A;  5JDN A;  2VL8 A;  5LJM A;  3PJA A;  4DBR A;  3UUB A;  2RP4 A;  3GWH A;  4YSZ A;  2KWI B;  4K0K T;  2WWV A;  2X9X A;  1YQ4 A;  3UT5 E;  4EEB A;  3HR0 A;  3AAA B;  1MIW A;  5LCY A;  5H6Q B;  3W15 B;  4UEL A;  2FJD A;  2VKO A;  4XAX B;  2V5D A;  2VQF T;  1HX8 A;  3AE8 A;  2QGS A;  4O4H E;  3HKE E;  4IE6 A;  5L4H A;  1OED A;  5GON E;  4DV7 T;  4AI6 A;  4UVB B;  4P0A A;  4CN4 A;  2W61 A;  5LBM A;  2WWU A;  2VWA A;  5AQF B;  2W63 A;  5L3F B;  1HNX T;  4HWC A;  1BR0 A;  2R6G F;  3KV9 A;  5FMN A;  2VQE T;  4WBO A;  2E8I A;  2H88 A;  3OKQ A;  3Q2M A;  4I0U A;  4HWH A;  2H3R A;  4L9I A;  4IE0 A;  1SUM B;  1AJ3 A;  3BQI A;  3FZF B;  4KHZ F;  4NIQ A;  2HN2 A;  4YHJ A;  3ONL C;  3VHL A;  3AVS A;  2CHO A;  2BG9 B;  3ETV A;  1HNW T;  3RC3 A;  1D1C A;  2BVM A;  4TUY E;  1XMO T;  3FB2 A;  3GN5 B;  4UV8 B;  2V6Y B;  4LF5 T;  1MIY A;  2EHO C;  3ANW A;  3C4Z A;  4X1K E;  4PK6 A;  2V26 A;  5LJN A;  4AIS A;  2JRK A;  2IC6 A;  3BQL A;  4EB6 E;  1NEN A;  4GKK T;  4ZI3 D;  4U2Z A;  3F57 A;  3EVY A;  3UU6 A;  2OA5 A;  2WSS V;  4PAG A;  3GMI A;  2V7I A;  2BS2 A;  1YW0 A;  2KSR A;  2XHE B;  3G06 A;  4H9Q C;  2ZM0 A;  2H89 A;  5AQQ B;  4CN1 A;  1DU2 A;  2UUC T;  3P4S A;  2N9D A;  3LK4 2;  1Z8U A;  3Q5X A;  4AKI A;  1UUS A;  5HXC A;  2C5I T;  3RH3 A;  1UK5 A;  3IF8 B;  3N9P A;  1LVF A;  1MIV A;  4OYK A;  2OLT A;  4Z90 A;  2LHN A;  3OTO T;  4Z8X A;  1BR1 A;  3HKB E;  4NUV A;  3ZT6 A;  4CXY A;  4H9P C;  3AXJ B;  4I50 E;  2B1E A;  2WS3 A;  3I9Y A;  4WW0 A;  4WZX A;  2ZM2 A;  3JAE A;  3LK2 B;  4ILA A;  3QB5 K;  2MOZ A;  2D2S A;  4NPP A;  3PUZ F;  2LRK A;  2DL1 A;  4CI2 B;  5JDQ A;  2VVN A;  2WQY A;  5JDF A;  3UU4 A;  2KMF A;  3C51 A;  1JNZ A;  2WP9 A;  4IDO A;  4EZH A;  3CQX C;  5F5W A;  4DV3 T;  3PUW F;  3LK3 B;  5IUX A;  1HG5 A;  1HNZ T;  2A3D A;  2CXD A;  2E9X D;  1GQE A;  2UXN B;  2CLY C;  3CVR A;  2V7J A;  2I6H A;  5HEH A;  3RHW A;  3RF1 A;  3PUY F;  3AE7 A;  1KK7 A;  2LOP A;  5EZY E;  4PK4 A;  3NKZ A;  2VB6 A;  4PW8 A;  4ZXL A;  5L4E A;  1Y01 A;  4UF0 A;  1XNR T;  4IST A;  2MBG A;  1NAF A;  2M6I A;  2VVS A;  2YKS A;  2UU9 T;  2YK0 A;  2XQ8 A;  4E7S A;  2X67 A;  3TLV A;  3PUR A;  3K3N A;  4GYS A;  4YHH T;  3BQK A;  5AQR B;  4IGU A;  1B7T A;  2NW7 A;  3AEF A;  1WRD A;  1E2A A;  3NZQ A;  4YFS A;  3LBX A;  2KWH A;  3KV4 A;  2HH7 A;  4YTM A;  3RYF E;  5LMU T;  3AA0 B;  1IZN B;  4GOU A;  4H9O C;  1HFA A;  3F31 A;  4I55 E;  4LF7 T;  5JVD E;  4ZI7 E;  4C90 A;  1D0Y A;  2RA1 A;  2LT3 A;  3UFG A;  4QXH B;  4IE5 A;  1HR0 T;  3FZM B;  5FY7 A;  3NZP A;  4A5X A;  3UFE A;  3VRB A;  2IUB A;  2WAU A;  4QH1 A;  2E5L T;  5AQJ B;  4O4I E;  3WI3 A;  4IT4 A;  3L39 A;  2XAS B;  4HE8 A;  3O4X E;  1HF8 A;  4DV4 T;  4EYY R;  2H7O A;  3IA3 A;  3ZLI A;  2QRX A;  2MAW A;  2V8S V;  4PJN A;  4JI5 T;  3NWI A;  5ABF B;  2XQ5 A;  4UV9 B;  2WDQ A;  3PJA J;  4XZC A;  2G0U A;  3UU5 A;  5FP3 A;  3CKD A;  4YJ3 E;  1IBL T;  2MYS A;  5L47 A;  3PU3 A;  3ZSS A;  4DUZ T;  5HEU A;  2XQA A;  4YJ2 E;  2JJ9 A;  2YN6 A;  2C0S A;  4QH5 A;  4JI7 T;  3AAI A;  3AE3 A;  2LM9 A;  2X51 A;  4MFR A;  4K0U A;  2GK9 A;  3FZL B;  3ZCI A;  1KNZ A;  1OED E;  3HI2 A;  4ILC A;  2E9X A;  4HWD A;  3PUX F;  1IBM T;  4H9R C;  4EAH A;  4TZ4 C;  1HS7 A;  3RGL A;  1WLX A;  2V7L A;  3GA8 A;  3ZN0 B;  2LKH A;  4ERR A;  3KBU A;  4MLK A;  2JQ9 A;  2X0L B;  1MNE A;  1KFY A;  1MMG A;  2HHH T;  2DWK A;  3ZMU B;  1XMQ T;  4LF9 T;  3FBL A;  3PU8 A;  1UCU A;  3KDS E;  4QX7 B;  4IDP A;  3PUV F;  5FL1 A;  4J2C A;  4EGW A;  4KBM B;  4NXN T;  1W09 A;  1T7S A;  1XNQ T;  5LHI B;  2CCQ A;  3NBX X;  3VR8 A;  3CX6 B;  4H63 V;  5AQN B;  1ZHC A;  4LFC T;  3SWH A;  3O9X A;  4ZEY A;  2AXD S;  2CXL A;  3FZH B;  2YU1 A;  2LEH A;  4HGA A;  5EK2 A;  3LSV A;  4JI1 T;  2KIN B;  4U31 A;  1N34 T;  3HKD E;  4AKH A;  4ZI2 C;  2JQK A;  2Q9Q C;  3JAD A;  2PTF A;  4U33 A;  5HWX A;  2PBI A;  5HWY A;  4CQI A;  1D0Z A;  4HWI B;  3VU7 H;  4BJM A;  2J62 A;  5HXH A;  3Q5E A;  4HKA A;  5EK4 A;  2D9D A;  4XBF B;  3ZC1 A;  4U7I A;  3WAJ A;  2XQ9 A;  3P4R A;  2LRL A;  2LSJ A;  2LM2 A;  2QA7 A;  2LSY A;  5L3C B;  2LHR A;  5IHY A;  4HWF A;  3FBZ A;  2BBH A;  4KI0 F;  2WCA A;  1IAP A;  3AE5 A;  3MA9 A;  3AE6 A;  2M67 A;  3OYZ A;  3UUL A;  3RYC E;  5C2T A;  3CML A;  4QXC B;  4TNV A;  2JMH A;  4DVD A;  1I94 T;  2Y48 B;  1WYC A;  4HN9 A;  1VCT A;  3TLU A;  3PV0 F;  5DQV A;  2CXF A;  2JIW A;  4IHJ E;  4O4J E;  1VOM A;  4EV6 A;  4DV2 T;  5ABE A;  2KZ7 B;  1LRZ A;  4AQF C;  1OWA A;  3SS1 A;  2CBJ A;  4UXN B;  3PUA A;  3ZT7 A;  4LMK A;  4AKL A;  5HCJ A;  2IIU A;  3MXZ A;  5E0O A;  1CUN A;  3SOL A;  2KND A;  4DV0 T;  2XQ3 A;  4TNW A;  4IE4 A;  4B3S T;  2XQY A;  1BR2 A;  4UIG A;  1HG2 A;  5AQS B;  4YY3 T;  4UEM A;  2BG9 E;  2NP9 A;  2DCF A;  5HXE A;  3D0T A;  4MAL A;  2DHR A;  4YTP A;  3ZYK A;  3ZN1 B;  4PFP A;  4TN7 B;  5ABG A;  3K3O A;  5JDH A;  3RIU A;  3QK6 A;  1W9R A;  1MND A;  5ABH A;  1HX1 B;  2WBL A;  3DTO A;  3ONX A;  5JR9 A;  3K1S A;  3I0Q A;  2X66 A;  2W2U A;  5AQO B;  5FKY A;  4DR5 T;  4C91 A;  5JQG E;  2DWG A;  4GKJ T;  2V1D B;  1KNR A;  3P4P A;  5ETW A;  5JDL A;  5LNK A;  3EAM A;  2A9U A;  3JC6 C;  3UTK A;  5AFU L;  2VAS A;  2YDQ A;  3ETU A;  4AXP A;  3QNU A;  2XAH B;  2QVA A;  4HFC A;  5FNV E;  4IRE A;  1OED C;  4LML A;  1UGO A;  3PE0 A;  3QC9 A;  1S35 A;  3MJX A;  5CA1 E;  3DP7 A;  4L5G A;  3CQG B;  4ZS3 A;  3ESL A;  2WU2 A;  3E22 E;  2NW9 A;  1Y64 B;  4DR6 T;  5LB7 B;  3PUG A;  1WR0 A;  2ACX A;  2IW5 B;  4JEU B;  4X5T A;  4OK0 A;  3Q5W A;  3QUJ A;  3ZJ2 A;  2XQ6 A;  3LJC A;  3P50 A;  4H63 H;  2NW8 A;  1YXR A;  1LVK A;  3O1J A;  1MMA A;  5J2U E;  3AEC A;  2IAK A;  4UVC B;  3DJB A;  2ODV A;  3PDY A;  5AQM B;  2LKG A;  2X0Y A;  5KMG P;  3FXD B;  3N9Q A;  4U74 A;  3ZYL A;  2XZE A;  4OFZ A;  2Q9Q B;  5DQW A;  2X9W A;  4M1P A;  1ZKE A;  1T8B A;  2M6B A;  3KV5 A;  2BDE A;  1NWM X;  4V1A v;  3KIN B;  4B3R T;  4IDQ A;  3I0O A;  3CPZ A;  4DV1 T;  5JDG A;  2FUP A;  2J4G A;  1M62 A;  5AQV B;  3L8R A;  1CHU A;  2BG9 A;  1SHZ C;  2KLQ A;  1S94 A;  3GN5 A;  3S4U A;  1FMV A;  1KNP A;  1J5E T;  2V6Y A;  3R84 B;  3OPC A;  5JRC B;  2X0H A;  3C98 B;  3VKH A;  2V7M A;  2Y8D A;  1I6Z A;  2XSA A;  3C64 A;  3NRX A;  2X68 A;  2J1D G;  4ISS A;  3WAK A;  3TLW A;  2NTY A;  2W4X A;  4ZOL E;  3KFW X;  3CIR A;  3PTR B;  4EXT A;  4FJO A;  5H6R B;  1D1B A;  1YQ3 A;  2CWO A;  1T72 A;  3LG7 A;  2P9B A;  4P09 A;  4GK5 E;  3A8Y C;  3A5X A;  2JQQ A;  5EK3 A;  4X1Y E;  4WBN E;  3RYH E;  4PFO A;  5IWA T;  2CBI A;  4AKG A;  1LKX A;  2BKO A;  2L3L A;  5LGU B;  5BMV E;  3P4W A;  3OYX A;  3UQ4 A;  4DR7 T;  1MMN A;  1MMD A;  3X1D A;  1UUR A;  1NEK A;  4B3T T;  3M3Z B;  2VKD A;  3B57 A;  3AXJ A;  4DR1 T;  3E0Z A;  5J0Z A;  2PJQ A;  2LLY A;  2HPL A;  4ANJ A;  4I43 B;  4P1N A;  5CFB A;  2VKJ A;  2UUB T;  2ZMA A;  4JI2 T;  5DAB A;  5C3J A;  2EHO D;  3KV6 A;  3VRA A;  1VRB A;  1XZY A;  4DO0 A;  3RKO A;  2EHO B;  4MBQ A;  4NUU A;  1IJ5 A;  3NVO A;  4DBQ A;  2ODU A;  1WFD A;  4YLH A;  4DV5 T;  1N33 T;  4YXD A;  5HAX A;  4ZS2 A;  1QSD A;  2I59 A;  4JI3 T;  3AA1 B;  3IHR A;  3TLT A;  5FXW A;  2W62 A;  4GIW A;  4IDZ A;  3MKD A;  5AQL B;  2C5J A;  4ZI3 C;  4DMW A;  2MTQ A;  2K3W A;  5J2T E;  3RRC A;  2Y6X A;  2K9A A;  3FZK B;  4P0B A;  2H7V C;  2CHN A;  2F4V T;  1G73 A;  4X1I E;  2RPA A;  3L3P A;  5FXX A;  4CN6 A;  3PUQ A;  2IC9 A;  4JI6 T;  3C4X A;  4OX9 T;  5CA0 E;  5TAO A;  2BBJ A;  5JRC A;  3NRY A;  1T98 A;  3LDQ B;  4U3C A;  1US7 B;  2WMN A;  4EIW A;  3N2K E;  2E5V A;  3ZPO A;  2CEA A;  2XAQ B;  3N9N A;  2LOS A;  4CXW A;  4U72 A;  3RPU A;  3CWZ B;  5F3J A;  1HCI A;  2IDO B;  4KX6 A;  3MZK B;  4IE7 A;  2D0U A;  4L0R A; 
#chains in the Genus database with same CATH homology
 1WFD A;  2WWV A;  1WCR A;  4WZX A;  2LRL A;  3K1S A;  5CJ5 A;  3ZSS A;  2MPK A;  4U7Y A;  2JQ9 A;  3ZST A;  2W2U A;  4IT4 A;  4P1N A;  2V6Y A;  5LB7 B;  2V6Y B;  2LRK A;  2DL1 A;  2CRB A;  2V6X A;  4U3C A;  1YXR A;  4U31 A;  3ZT7 A;  5FVK A;  3EAB A;  1WR0 A;  4CN4 A;  2XZE A;  3ZT6 A;  2CPT A;  4U2Z A;  2WY2 A;  4CN1 A;  2JQK A;  2RPA A;  4A5X A;  5FVL A;  2JQH A;  4ZEY A;  4CN6 A;  4U7I A;  3ZT5 A;  4U2Y A;  4U33 A;  5CGM A;  2K3W A;  4NIQ A;  2A9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...