3RIUA

Crystal structure of drosophila hexameric c3po formed by truncated translin and trax
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
206
Chain Sequence
DIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLDGLRKRFDALKYDVKKIEEVVYDVSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Translin
publication title Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 70
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3riuA01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3riuA02
1KEYA 3RIUC 1J1JA 3AXJB 3AXJA 2QVAA 2QRXA 3QB5K 3QB5A 4WYVA 3PJAJ 3RIUA 3PJAA
chains in the Genus database with same CATH superfamily
1S94A 4U2ZA 4C90A 3V5SA 5GONE 1O3XA 2J1DG 2YKSA 3ETVA 4Z90A 2B1EA 2PTFA 2WU5A 4NXNT 3LDQB 3C50A 3AE6A 2CHOA 3OBVE 4PFOA 5JRCA 3UUMA 4QWNB 3KBUA 2N9DA 4OX9T 2YOEA 4GYSA 1MMNA 4DNDA 4JI3T 4LF5T 2Q9QB 3EHZA 3VR9A 3AE2A 3ONJA 1UGOA 1KNZA 4F8HA 2BG9C 2IW5B 4BA9A 4B3ST 4JEHB 2CWYA 2WWUA 3DP7A 2SPCA 4WNKA 1E2AA 3ZJ1A 2JQQA 2W67A 4Z91A 4DR1T 3OYXA 4CZZB 3ONLC 1IAPA 3LJCA 1N36T 2FBWA 2WSSV 3C51A 4IDOA 1T98A 4JI4T 3Q5WA 3ABVA 2ODUA 2VKJA 2PG8A 5HXSA 3P4SA 3R6NA 4GYRA 3HR0A 3VU7H 2Y6XA 3UFGA 2H88A 1J5WA 3PUQA 3RPUA 5JR9A 2E8IA 4EEDA 3Q5EA 2IUBA 3C98B 4OHFA 2GK9A 5JH7E 4UV8B 2KNDA 5HEJA 3FBLA 2LKGA 4IDNA 3PV0F 2BS4A 5AQSB 4JI5T 4B6XA 2E5VA 4IDQA 1OWAA 1NWMX 5FNVE 4MLKA 3F57A 3CPZA 2BKNA 5AQIB 3AE3A 3D0TA 4TWHA 4GKKT 3RQUA 3IF8B 1QSDA 4P09A 3AE1A 3B57A 3OVUA 5HAXA 3ZSTA 2MTQA 5L3EB 3VRBA 1FMWA 5ABFA 2V6YB 1J1JA 3GA8A 1IJ5A 3WI3A 4V1Av 4IE7A 3RYIE 4KP3C 3ZT5A 4TNWA 1VRBA 2HN2A 4DVDA 3ZMVB 2Z6EA 1XNRT 5HXHA 3PUGA 1XDOA 4YFSA 5L2LA 3UU5A 2IIUA 3BQLA 4ASKA 3UULA 3N9OA 5AQQB 5JR9C 2W4XA 3AXJA 2HHHT 2F4VT 4ILUA 4DIDB 1US7B 3FZMB 4JI8T 3P7IA 4DBRA 2VQET 4X1KE 2W2UA 2EHOC 2V5CA 1JNZA 2WM9A 3P4PA 2NW8A 1IBKT 3PUXF 3O1JA 3AE5A 3LSVA 5JDFA 2H89A 4DUYT 5CA1E 3UU6A 2WMNA 3K3NA 4HWIB 4KI0F 4K0UA 4EGWA 4ZI2D 5HCJA 4EV6A 2LLYA 3P50A 2J4GA 5AQNB 2H7OA 1E1HB 4CN6A 2LT3A 1OXZA 4JBWF 3KFWX 4YLHA 3KDSE 5LHHB 1D0YA 2X68A 2J47A 5AQMB 2L3LA 1NAFA 2WMOA 3IBPA 3MZKB 2JMKA 3Q2MA 2XAQB 2W0GA 3PUVF 2WCAA 3TLUA 3HKBE 4YY3T 2D0TA 5KMGP 2ACZA 3ZT7A 3KV9A 3SFEA 3Q9DA 3IHRA 4HTEA 3P4QA 4TV9E 1HX8A 2V7MA 4E7SA 4HWHA 3CQXC 4O8SA 4X66T 4IIJE 4E7ZA 4H63V 2C0SA 2AE9A 2CXLA 5FY7A 4JI2T 2CWOA 1BR1A 2Q9QA 2XUEA 2XZEA 4YTMA 1WR0A 2DLRA 4IL9A 3AECA 2JQKA 3J9X1 5HCMA 3N2OA 1FMVA 2JQHA 4OFZA 3E08A 1ZEEA 2XQ7A 3KV6A 5LBMA 5AQOB 3RKGA 4P0AA 2XQ5A 5LXTE 5JDMA 5AQKB 3AEAA 2V1DB 3NZPA 3CKDA 3JC6D 3ZYKA 4UVCB 4NXMT 3K3OA 1MMAA 2J62A 4YTNA 3MJXA 1ZP0A 2VL8A 1GQEA 2H7VC 2V7IA 4O4LE 3UUBA 5F8PA 2CXDA 3RX6A 2I6HA 5J2TE 4MFRA 4H63H 5F5WA 3VRAA 4DUZT 2WP9A 3CQCB 3GWHA 3PJAJ 4LF9T 3CX8B 3OKQA 5HEOA 4UVBB 3K1SA 3N9MA 2UUBT 4AKHA 3PUWF 4CXWA 3PURA 3T8OA 5JDQA 5CGMA 3P8CD 4G2AA 1BR0A 1IZNB 4FI5A 4DV5T 4TN7B 4YXDA 4AI6A 4DO0A 4GOUA 4AISA 2BVMA 2WAUA 3E0ZA 4K0KT 5KXJA 2W00A 4TV8E 4GKJT 2A9UA 2V5DA 2PBIA 4H9PC 5ETWA 3E22E 2FJAA 3J7Yq 3P4WA 1AJ3A 1ZKEA 2RP4A 1HR0T 2UXBT 4NUVA 2V7KA 3HKCE 3MA9A 2ES0A 2XQ4A 4CQIA 4QHOA 4KX6A 3O9XA 2QYWA 3U3IA 3EVYA 1V9DA 3I9YA 1MNDA 2V6YA 3ZLIA 2CLYB 1W0BA 4H9NC 4AQGA 3NRXA 4I50E 2BKPA 3JAFA 4ZEYA 1LRZA 3C64A 4DR6T 1T72A 4N78D 4HWFA 1HG2A 4P0BA 3N2GE 2DCFA 2WU2A 2V26A 4UR9A 2MAWA 2H3RA 2OLTA 2JRKA 3SRZA 4AKLA 3VKGA 3JCFA 3IEEA 5AQJB 2Y48B 2K48A 5ABHA 4COFA 3M3ZB 1HCIA 2WDVA 4AIUA 4ZOLE 4ISTA 4JI0T 4DV7T 3ZN0B 3RIUA 2W62A 1MIWA 3NBXX 5LB7B 1MNEA 1UURA 3UQ4A 4CXYA 4B3RT 1KK7A 2LSKA 4EEBA 2VASA 3SOLA 2R6GF 1EZ3A 4CI2B 2OV9A 3AA6B 2CEAA 3QB5K 3DJBA 2E2AA 1KF6A 3HA4A 4O2BE 2CBJA 2Q9QD 2IMLA 3L3PA 4IE6A 4ZI3D 4HFVA 3VHLA 2W61A 1SUMB 2MYSA 5LMUT 3N5LA 2YN6A 3I9WA 2ZM0A 2CRBA 2M6IA 1Y01A 2ODVA 2RA1A 3EAMA 4IE5A 1N34T 2LOSA 3O4XE 5L3FB 1VCTA 3HL6A 5CFBA 3VR8A 3BK9A 4UXNB 3LFMA 3N9PA 1KEYA 3RKOA 3AEFA 3OPCA 5FMNA 2E9XB 2CM0A 5AFUL 2QA7A 5ABEA 4XZCA 5ADXL 5C3JA 4AQYT 2WZHA 2BS2A 5FL0A 1WYCA 2K5BB 2KZ7B 4LMKA 3RI5A 2LHRA 4IGUA 3RF1A 2KMFA 3AA1B 4DV3T 4DV0T 3AEDA 4NUUA 5HEGA 2ZM6T 5HXRA 2B76A 2MBGA 3EI0A 3L8RA 4KUMB 4YHJA 1BR2A 1D1CA 4JLEA 4TUYE 5HYAA 5AQTB 4DR2T 4NPPA 5HEUA 2XSAA 5LNKA 2X66A 3LK2B 2V6XA 4HFHA 2BG9B 4KMCA 3FZFB 3RYHE 3C4XA 3AB3B 3IA3A 2VVSA 1BR4A 4EOZB 2UXCT 2D5UA 4TNVA 2VKOA 2XQAA 2BS3A 5AQLB 3EDVA 4PJMA 2E5LT 3HKEE 4GK5E 4YSXA 4O4IE 4X5TA 3FHNA 2CA5A 3RLFF 2LHNA 4LF4T 5JTGA 4UF0B 1G73A 2CHNA 1HG5A 4HWCA 3RGLA 3OTOT 2KINB 4LMLA 2W66A 5LA6E 3PTRB 3QC9A 5AQHB 1WCRA 3AEBA 4IDZA 1I6ZA 4ZZBA 2X9HA 4QXCB 2NR4A 4B3TT 4AQFA 2KT9A 3UTKA 4U33A 4H9QC 3LBXB 3RIFA 2YU2A 4HEAA 3T1YT 1UCUA 2N1GA 5FY1A 3JC6C 1YW0A 2CXFA 2UUAT 3N9LA 4NIQA 4IT4A 3I1AA 4L0RA 2MOZA 5EK4A 1YQ3A 3SS1A 4PJNA 4JEUB 3RYFE 3N9QA 4JI6T 3AAIA 3AEEA 5LGNB 3C4WA 4A98A 2JQ9A 3ZMSB 4LFAT 3FBZA 1FJGT 4IREA 3ZYMA 2CE7A 2VURA 2XAGB 1W9RA 3HKDE 1UX4A 5EK3A 3WAKA 1XWMA 1MMDA 1U4QA 4H9SE 4KHZF 2X67A 1XZYA 4IL4A 4HFIA 2LEHA 5AQGB 4A5XA 4CN4A 4CI1B 4G63A 3X1DA 4CN1A 2UUCT 3RHWA 2XQYA 1WR6A 3PUYF 3CX6B 5H6QB 2V8SV 4CI3B 5FVKA 2BKOA 2X51A 5JREA 5LGTB 2FUPA 4A56A 2YEVC 3UU8A 4QKNA 3AE7A 4WBNE 4UV9B 5L47A 5LJNA 3W15B 1Y64B 4ZHQE 4HFCA 2G0UA 3CX7B 5IHYA 3RRCA 2FJBA 2XSBA 2MPKA 3VKHA 2K9AA 2M6BA 3KVAA 5KX5E 4PAGA 1HFAA 4B3MT 4I43B 4X1IE 3MK7C 3B5MA 4IDPA 2L9QA 1SE7A 4EZ4A 1NENA 4HN9A 1X79A 3FB2A 4P1NA 2CCQA 4KHPT 4UIGA 5FYMA 2EHOB 2XAJB 1FIOA 1QLBA 3S4UA 3AVRA 2JIWA 3CVRA 5A1LA 3NKZA 3QNUA 2C5IT 1N32T 3ZT6A 2DI4A 3C4ZA 3H3AA 1U5PA 4ZZCA 1LKXA 3UU4A 2XQ6A 1UUSA 1CHUA 2WDQA 5DQVA 5JVDE 4BJMA 5LMNT 4PJJA 4I0UA 3ZMZB 4J2CA 2E9XA 5FXWA 4X1YE 2BDEA 2KXPB 3ZN1B 1WRDA 1HNZT 2X0HA 3CWZB 3FZHB 2IC6A 1HTJF 2WS3A 3RIAA 5DQWA 4I55E 2LSYA 3ZPOA 2ZMAA 5FXXA 4ADZA 5L4HA 5FXVA 3PE0A 1NEKA 4QH1A 4U31A 3HI2A 1YQ4A 2XAFB 4DV2T 2VKDA 1CUNA 2YINA 1KNRA 1J5ET 4O4JE 2HPLA 2KSRA 2Q9QC 5CA0E 3K8PC 4ZI3C 2WQYA 3TLTA 4BJNA 2DHRA 5LHIB 3MKDA 2NTXA 5BR8T 2XHEB 2LRKA 3UFEA 2BG9A 3ZCJA 3U78A 4EB6E 4IE0A 4UELA 3H37A 4DR5T 2UU9T 4GK0E 2HN1A 4KBMB 1HF8A 4U2YA 2D0UA 5CB4E 3RH3A 4LF7T 4M1PA 4UF0A 2QRXA 3DTOA 4AXPA 2YU1A 3NWIA 3PJAA 5L3CB 1QUUA 3AE9A 3QK6A 5ABGA 1MMGA 2KWHA 2IAKA 3A5XA 4ZXLA 5DJQC 5L3DB 5FVLA 4MHCA 3AEGA 3AA7B 5LCYA 2A72A 3QUJA 3TLSA 1OEDB 4U74A 5HWYA 4MBQA 1Z0PA 4PJLA 1SHZC 3LBXA 4ZI7E 3QB5A 5L3GB 5LBQB 2KWIB 5EK2A 3CQGB 4EYYR 1E7PA 1HNXT 4QXHB 2X0YA 1W0AA 4X20E 1XMQT 4ANJA 2LE8A 4CXXA 2V7LA 4WW0A 1MIVA 4OYJA 2YK0A 5LHGB 3AAEB 4A97A 3EUHA 2XPKA 4Q25A 3KINB 3KV5A 3TLVA 4PW8A 4X64T 2L8KA 3ONXA 3AA0B 2X9XA 2LOPA 1R8IA 4IE4A 3I0OA 1DU2A 1KNPA 4FJOA 4HE8A 2VVNA 3AE4A 3UT5E 4PNIA 3ANWB 2HH7A 4QH5A 2LSGA 2ACXA 5FKYA 5KDMC 1KFYA 2WY2A 3Q5DA 3FZLB 4HKAA 4HGAA 4ZS2A 4ILCA 2CBIA 4MALA 1YKEB 5AQPB 3UUXB 3R84B 4DV6T 2DL1A 5AQRB 1UK5A 3F31A 3SWHA 4DMVA 3LG7A 5C2TA 3RC8A 1VOMA 4TZ4C 3ZC1A 4YSZA 4WYVA 4QX8B 2FJDA 2UXNB 4JV5T 4DV4T 5L4EA 4JUYA 2BVLA 1I94T 3TKLB 3QOFA 3RC3A 3T1HT 2D9DA 1G8XA 5L3BB 2DWKA 2C5JA 3KV4A 4LFCT 4YJ3E 3N2KE 4UVAB 4H9RC 4ZI2C 2XQ3A 2YDSA 1JNRA 3JAEA 4OK0A 2NTYA 4JI1T 4L5GA 3AE8A 5HXCA 3RIUC 2E9XD 3B13A 5F3JA 4F6RC 1XNQT 3FXEB 2EHOA 4LMJA 3PU8A 2WB5A 2VK9A 3UUNA 4JYAT 5IUXA 1HS7A 2AXDS 1W09A 2VKHA 3WAJA 2K24A 1D0ZA 2RPAA 3L09A 4AKRB 1SA0E 4YTPA 3PUAA 3RQWA 2LRLA 5IWAT 3GN5B 3OJAA 1IBLT 2M67A 3SFDA 2IC9A 5AQUB 2A2FX 1OEDE 4DMWA 5FP3A 2JJ9A 2XQ8A 4GIWA 5J0ZA 2LM9A 4X65T 1XMOT 4AKGA 1VCSA 1HX1B 4EXTA 3NRYA 4QH4A 3NZQA 3ETUA 3ZSSA 4EZHA 3I0QA 5DABA 3P4RA 1HNWT 4QX7B 2VQFT 2XAHB 2WDRA 2I0MA 3OYZA 4DBQA 2XTLA 4ERRA 4YJ2E 3FZKB 4PK6A 2ZM2A 3ZMTB 2XY8B 1H7CA 1IBMT 2W63A 3M65A 2LM2A 3MACA 2DNXA 2UXDT 3RRWA 2WZIA 2JPFA 3CMLA 4U7YA 3CIRA 4ILAA 4XAXB 3ZYLA 2LKHA 1T7SA 4C91A 3PU3A 4XBFB 5HEHA 5EZYE 1YKHB 2Y8DA 4IHJE 5JRCB 2NP9A 5LP6E 1B7TA 4DR4T 2D2SA 1IJ6A 1D1AA 2K3WA 1N33T 2V7JA 1WLXA 3G06A 5LG3A 3EDUA 4UEMA 1OEDA 5J2UE 3KBTA 3LK42 5E0OA 4TX5A 5H6RB 5AQFB 2YDRA 4QXBB 1LVFA 5JDHA 2XQ9A 5JQGE 3PDYA 3ESLA 1X9BA 2LJLA 4WZXA 2XASB 2ZM8A 2VL0A 2WBLA 2IDOB 2XM2A 5FXZA 2BBHA 5FL1A 4HFEA 1UX5A 3O1IA 1ZOYA 3ZC0A 4AQFC 3ZMUB 4HWDA 2DWGA 3AVSA 2OA5A 3KVBA 2QVAA 3H3MA 2UXXB 2KLQA 1D1BA 3FXDB 1L0VA 3F2EA 3ZJ2A 3UQ7A 3ANWA 1T8BA 2VWAA 4ZS3A 4I4TE 2X9YA 5JR9B 3K3QC 5M4YA 2BG9E 4H9OC 2CMRA 4DV1T 3ZEFB 4AKIA 2QGSA 2N2NA 3A8YC 4YHHT 2NW7A 2CLYC 1WYBA 4TWFA 1WFDA 2PJQA 2P9BA 3RYCE 3ZCIA 4EAHA 5JDLA 2I59A 5IYZE 2EHOD 5C8YE 1YD8G 1OEDC 3MXZA 3UU3A 4U72A 3GMIA 4EYUA 4HFDA 4BAYB 4X62T 2CPTA 2IHR1 3V5UA 4PK4A 4HFBA 5LYJE 2C5KT 2BZBA 3O1HA 2LSIA 3NVOA 4Z8XA 1MIYA 2NWBA 3JADA 2LSJA 5LOVE 1Z8UA 3CK6A 1YXRA 1M7KA 1ZV4X 5ABFB 4JI7T 5JDGA 2NOXA 2JMHA 5FY0A 3BQKA 3TLWA 2HPJA 3PUZF 3LK3B 4YSYA 4DR3T 2XM1A 2ZLYA 4U7IA 2XJ7A 4PK5A 5AQVB 4O2AE 4LFBT 4TWDA 4U3CA 5LJMA 2FJEA 3N9NA 4DR7T 2X9WA 3GN5A 3L39A 5JDNA 5TAOA 5HXEA 4LF6T 2YDQA 3A7MA 5LGUB 1FEWA 1D0XA 4WBOA 1XDPA 4L9IA 3AXJB 5HWXA 1S35A 3PUSA 4EIWA 2PFVA 4O4HE 3AAAB 5J1GA 4YT0A 4ILBA 4LF8T 1ZHCA 1LVKA 4ISSA 4OYKA 2WWVA 3ZKRA 2NW9A 2BBJA 5CJ5A 3EABA 3BQIA 5BMVE 5LG4A 2X0LB 4PFPA 2A3DA 2VB6A 3Q5XA 2E9XC 1M62A
chains in the Genus database with same CATH topology
1KEYA 3RIUC 1J1JA 3AXJB 3AXJA 2QVAA 2QRXA 3QB5K 3QB5A 4WYVA 3PJAJ 3RIUA 3PJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KEY A;  3RIU C;  1J1J A;  3AXJ B;  3AXJ A;  2QVA A;  2QRX A;  3QB5 K;  3QB5 A;  4WYV A;  3PJA J;  3RIU A;  3PJA A; 
#chains in the Genus database with same CATH topology
 1S94 A;  4U2Z A;  4C90 A;  3V5S A;  5GON E;  1O3X A;  2J1D G;  2YKS A;  3ETV A;  4Z90 A;  2B1E A;  2PTF A;  2WU5 A;  4NXN T;  3LDQ B;  3C50 A;  3AE6 A;  2CHO A;  3OBV E;  4PFO A;  5JRC A;  3UUM A;  4QWN B;  3KBU A;  2N9D A;  4OX9 T;  2YOE A;  4GYS A;  1MMN A;  4DND A;  4JI3 T;  4LF5 T;  2Q9Q B;  3EHZ A;  3VR9 A;  3AE2 A;  3ONJ A;  1UGO A;  1KNZ A;  4F8H A;  2BG9 C;  2IW5 B;  4BA9 A;  4B3S T;  4JEH B;  2CWY A;  2WWU A;  3DP7 A;  2SPC A;  4WNK A;  1E2A A;  3ZJ1 A;  2JQQ A;  2W67 A;  4Z91 A;  4DR1 T;  3OYX A;  4CZZ B;  3ONL C;  1IAP A;  3LJC A;  1N36 T;  2FBW A;  2WSS V;  3C51 A;  4IDO A;  1T98 A;  4JI4 T;  3Q5W A;  3ABV A;  2ODU A;  2VKJ A;  2PG8 A;  5HXS A;  3P4S A;  3R6N A;  4GYR A;  3HR0 A;  3VU7 H;  2Y6X A;  3UFG A;  2H88 A;  1J5W A;  3PUQ A;  3RPU A;  5JR9 A;  2E8I A;  4EED A;  3Q5E A;  2IUB A;  3C98 B;  4OHF A;  2GK9 A;  5JH7 E;  4UV8 B;  2KND A;  5HEJ A;  3FBL A;  2LKG A;  4IDN A;  3PV0 F;  2BS4 A;  5AQS B;  4JI5 T;  4B6X A;  2E5V A;  4IDQ A;  1OWA A;  1NWM X;  5FNV E;  4MLK A;  3F57 A;  3CPZ A;  2BKN A;  5AQI B;  3AE3 A;  3D0T A;  4TWH A;  4GKK T;  3RQU A;  3IF8 B;  1QSD A;  4P09 A;  3AE1 A;  3B57 A;  3OVU A;  5HAX A;  3ZST A;  2MTQ A;  5L3E B;  3VRB A;  1FMW A;  5ABF A;  2V6Y B;  1J1J A;  3GA8 A;  1IJ5 A;  3WI3 A;  4V1A v;  4IE7 A;  3RYI E;  4KP3 C;  3ZT5 A;  4TNW A;  1VRB A;  2HN2 A;  4DVD A;  3ZMV B;  2Z6E A;  1XNR T;  5HXH A;  3PUG A;  1XDO A;  4YFS A;  5L2L A;  3UU5 A;  2IIU A;  3BQL A;  4ASK A;  3UUL A;  3N9O A;  5AQQ B;  5JR9 C;  2W4X A;  3AXJ A;  2HHH T;  2F4V T;  4ILU A;  4DID B;  1US7 B;  3FZM B;  4JI8 T;  3P7I A;  4DBR A;  2VQE T;  4X1K E;  2W2U A;  2EHO C;  2V5C A;  1JNZ A;  2WM9 A;  3P4P A;  2NW8 A;  1IBK T;  3PUX F;  3O1J A;  3AE5 A;  3LSV A;  5JDF A;  2H89 A;  4DUY T;  5CA1 E;  3UU6 A;  2WMN A;  3K3N A;  4HWI B;  4KI0 F;  4K0U A;  4EGW A;  4ZI2 D;  5HCJ A;  4EV6 A;  2LLY A;  3P50 A;  2J4G A;  5AQN B;  2H7O A;  1E1H B;  4CN6 A;  2LT3 A;  1OXZ A;  4JBW F;  3KFW X;  4YLH A;  3KDS E;  5LHH B;  1D0Y A;  2X68 A;  2J47 A;  5AQM B;  2L3L A;  1NAF A;  2WMO A;  3IBP A;  3MZK B;  2JMK A;  3Q2M A;  2XAQ B;  2W0G A;  3PUV F;  2WCA A;  3TLU A;  3HKB E;  4YY3 T;  2D0T A;  5KMG P;  2ACZ A;  3ZT7 A;  3KV9 A;  3SFE A;  3Q9D A;  3IHR A;  4HTE A;  3P4Q A;  4TV9 E;  1HX8 A;  2V7M A;  4E7S A;  4HWH A;  3CQX C;  4O8S A;  4X66 T;  4IIJ E;  4E7Z A;  4H63 V;  2C0S A;  2AE9 A;  2CXL A;  5FY7 A;  4JI2 T;  2CWO A;  1BR1 A;  2Q9Q A;  2XUE A;  2XZE A;  4YTM A;  1WR0 A;  2DLR A;  4IL9 A;  3AEC A;  2JQK A;  3J9X 1;  5HCM A;  3N2O A;  1FMV A;  2JQH A;  4OFZ A;  3E08 A;  1ZEE A;  2XQ7 A;  3KV6 A;  5LBM A;  5AQO B;  3RKG A;  4P0A A;  2XQ5 A;  5LXT E;  5JDM A;  5AQK B;  3AEA A;  2V1D B;  3NZP A;  3CKD A;  3JC6 D;  3ZYK A;  4UVC B;  4NXM T;  3K3O A;  1MMA A;  2J62 A;  4YTN A;  3MJX A;  1ZP0 A;  2VL8 A;  1GQE A;  2H7V C;  2V7I A;  4O4L E;  3UUB A;  5F8P A;  2CXD A;  3RX6 A;  2I6H A;  5J2T E;  4MFR A;  4H63 H;  5F5W A;  3VRA A;  4DUZ T;  2WP9 A;  3CQC B;  3GWH A;  3PJA J;  4LF9 T;  3CX8 B;  3OKQ A;  5HEO A;  4UVB B;  3K1S A;  3N9M A;  2UUB T;  4AKH A;  3PUW F;  4CXW A;  3PUR A;  3T8O A;  5JDQ A;  5CGM A;  3P8C D;  4G2A A;  1BR0 A;  1IZN B;  4FI5 A;  4DV5 T;  4TN7 B;  4YXD A;  4AI6 A;  4DO0 A;  4GOU A;  4AIS A;  2BVM A;  2WAU A;  3E0Z A;  4K0K T;  5KXJ A;  2W00 A;  4TV8 E;  4GKJ T;  2A9U A;  2V5D A;  2PBI A;  4H9P C;  5ETW A;  3E22 E;  2FJA A;  3J7Y q;  3P4W A;  1AJ3 A;  1ZKE A;  2RP4 A;  1HR0 T;  2UXB T;  4NUV A;  2V7K A;  3HKC E;  3MA9 A;  2ES0 A;  2XQ4 A;  4CQI A;  4QHO A;  4KX6 A;  3O9X A;  2QYW A;  3U3I A;  3EVY A;  1V9D A;  3I9Y A;  1MND A;  2V6Y A;  3ZLI A;  2CLY B;  1W0B A;  4H9N C;  4AQG A;  3NRX A;  4I50 E;  2BKP A;  3JAF A;  4ZEY A;  1LRZ A;  3C64 A;  4DR6 T;  1T72 A;  4N78 D;  4HWF A;  1HG2 A;  4P0B A;  3N2G E;  2DCF A;  2WU2 A;  2V26 A;  4UR9 A;  2MAW A;  2H3R A;  2OLT A;  2JRK A;  3SRZ A;  4AKL A;  3VKG A;  3JCF A;  3IEE A;  5AQJ B;  2Y48 B;  2K48 A;  5ABH A;  4COF A;  3M3Z B;  1HCI A;  2WDV A;  4AIU A;  4ZOL E;  4IST A;  4JI0 T;  4DV7 T;  3ZN0 B;  3RIU A;  2W62 A;  1MIW A;  3NBX X;  5LB7 B;  1MNE A;  1UUR A;  3UQ4 A;  4CXY A;  4B3R T;  1KK7 A;  2LSK A;  4EEB A;  2VAS A;  3SOL A;  2R6G F;  1EZ3 A;  4CI2 B;  2OV9 A;  3AA6 B;  2CEA A;  3QB5 K;  3DJB A;  2E2A A;  1KF6 A;  3HA4 A;  4O2B E;  2CBJ A;  2Q9Q D;  2IML A;  3L3P A;  4IE6 A;  4ZI3 D;  4HFV A;  3VHL A;  2W61 A;  1SUM B;  2MYS A;  5LMU T;  3N5L A;  2YN6 A;  3I9W A;  2ZM0 A;  2CRB A;  2M6I A;  1Y01 A;  2ODV A;  2RA1 A;  3EAM A;  4IE5 A;  1N34 T;  2LOS A;  3O4X E;  5L3F B;  1VCT A;  3HL6 A;  5CFB A;  3VR8 A;  3BK9 A;  4UXN B;  3LFM A;  3N9P A;  1KEY A;  3RKO A;  3AEF A;  3OPC A;  5FMN A;  2E9X B;  2CM0 A;  5AFU L;  2QA7 A;  5ABE A;  4XZC A;  5ADX L;  5C3J A;  4AQY T;  2WZH A;  2BS2 A;  5FL0 A;  1WYC A;  2K5B B;  2KZ7 B;  4LMK A;  3RI5 A;  2LHR A;  4IGU A;  3RF1 A;  2KMF A;  3AA1 B;  4DV3 T;  4DV0 T;  3AED A;  4NUU A;  5HEG A;  2ZM6 T;  5HXR A;  2B76 A;  2MBG A;  3EI0 A;  3L8R A;  4KUM B;  4YHJ A;  1BR2 A;  1D1C A;  4JLE A;  4TUY E;  5HYA A;  5AQT B;  4DR2 T;  4NPP A;  5HEU A;  2XSA A;  5LNK A;  2X66 A;  3LK2 B;  2V6X A;  4HFH A;  2BG9 B;  4KMC A;  3FZF B;  3RYH E;  3C4X A;  3AB3 B;  3IA3 A;  2VVS A;  1BR4 A;  4EOZ B;  2UXC T;  2D5U A;  4TNV A;  2VKO A;  2XQA A;  2BS3 A;  5AQL B;  3EDV A;  4PJM A;  2E5L T;  3HKE E;  4GK5 E;  4YSX A;  4O4I E;  4X5T A;  3FHN A;  2CA5 A;  3RLF F;  2LHN A;  4LF4 T;  5JTG A;  4UF0 B;  1G73 A;  2CHN A;  1HG5 A;  4HWC A;  3RGL A;  3OTO T;  2KIN B;  4LML A;  2W66 A;  5LA6 E;  3PTR B;  3QC9 A;  5AQH B;  1WCR A;  3AEB A;  4IDZ A;  1I6Z A;  4ZZB A;  2X9H A;  4QXC B;  2NR4 A;  4B3T T;  4AQF A;  2KT9 A;  3UTK A;  4U33 A;  4H9Q C;  3LBX B;  3RIF A;  2YU2 A;  4HEA A;  3T1Y T;  1UCU A;  2N1G A;  5FY1 A;  3JC6 C;  1YW0 A;  2CXF A;  2UUA T;  3N9L A;  4NIQ A;  4IT4 A;  3I1A A;  4L0R A;  2MOZ A;  5EK4 A;  1YQ3 A;  3SS1 A;  4PJN A;  4JEU B;  3RYF E;  3N9Q A;  4JI6 T;  3AAI A;  3AEE A;  5LGN B;  3C4W A;  4A98 A;  2JQ9 A;  3ZMS B;  4LFA T;  3FBZ A;  1FJG T;  4IRE A;  3ZYM A;  2CE7 A;  2VUR A;  2XAG B;  1W9R A;  3HKD E;  1UX4 A;  5EK3 A;  3WAK A;  1XWM A;  1MMD A;  1U4Q A;  4H9S E;  4KHZ F;  2X67 A;  1XZY A;  4IL4 A;  4HFI A;  2LEH A;  5AQG B;  4A5X A;  4CN4 A;  4CI1 B;  4G63 A;  3X1D A;  4CN1 A;  2UUC T;  3RHW A;  2XQY A;  1WR6 A;  3PUY F;  3CX6 B;  5H6Q B;  2V8S V;  4CI3 B;  5FVK A;  2BKO A;  2X51 A;  5JRE A;  5LGT B;  2FUP A;  4A56 A;  2YEV C;  3UU8 A;  4QKN A;  3AE7 A;  4WBN E;  4UV9 B;  5L47 A;  5LJN A;  3W15 B;  1Y64 B;  4ZHQ E;  4HFC A;  2G0U A;  3CX7 B;  5IHY A;  3RRC A;  2FJB A;  2XSB A;  2MPK A;  3VKH A;  2K9A A;  2M6B A;  3KVA A;  5KX5 E;  4PAG A;  1HFA A;  4B3M T;  4I43 B;  4X1I E;  3MK7 C;  3B5M A;  4IDP A;  2L9Q A;  1SE7 A;  4EZ4 A;  1NEN A;  4HN9 A;  1X79 A;  3FB2 A;  4P1N A;  2CCQ A;  4KHP T;  4UIG A;  5FYM A;  2EHO B;  2XAJ B;  1FIO A;  1QLB A;  3S4U A;  3AVR A;  2JIW A;  3CVR A;  5A1L A;  3NKZ A;  3QNU A;  2C5I T;  1N32 T;  3ZT6 A;  2DI4 A;  3C4Z A;  3H3A A;  1U5P A;  4ZZC A;  1LKX A;  3UU4 A;  2XQ6 A;  1UUS A;  1CHU A;  2WDQ A;  5DQV A;  5JVD E;  4BJM A;  5LMN T;  4PJJ A;  4I0U A;  3ZMZ B;  4J2C A;  2E9X A;  5FXW A;  4X1Y E;  2BDE A;  2KXP B;  3ZN1 B;  1WRD A;  1HNZ T;  2X0H A;  3CWZ B;  3FZH B;  2IC6 A;  1HTJ F;  2WS3 A;  3RIA A;  5DQW A;  4I55 E;  2LSY A;  3ZPO A;  2ZMA A;  5FXX A;  4ADZ A;  5L4H A;  5FXV A;  3PE0 A;  1NEK A;  4QH1 A;  4U31 A;  3HI2 A;  1YQ4 A;  2XAF B;  4DV2 T;  2VKD A;  1CUN A;  2YIN A;  1KNR A;  1J5E T;  4O4J E;  2HPL A;  2KSR A;  2Q9Q C;  5CA0 E;  3K8P C;  4ZI3 C;  2WQY A;  3TLT A;  4BJN A;  2DHR A;  5LHI B;  3MKD A;  2NTX A;  5BR8 T;  2XHE B;  2LRK A;  3UFE A;  2BG9 A;  3ZCJ A;  3U78 A;  4EB6 E;  4IE0 A;  4UEL A;  3H37 A;  4DR5 T;  2UU9 T;  4GK0 E;  2HN1 A;  4KBM B;  1HF8 A;  4U2Y A;  2D0U A;  5CB4 E;  3RH3 A;  4LF7 T;  4M1P A;  4UF0 A;  2QRX A;  3DTO A;  4AXP A;  2YU1 A;  3NWI A;  3PJA A;  5L3C B;  1QUU A;  3AE9 A;  3QK6 A;  5ABG A;  1MMG A;  2KWH A;  2IAK A;  3A5X A;  4ZXL A;  5DJQ C;  5L3D B;  5FVL A;  4MHC A;  3AEG A;  3AA7 B;  5LCY A;  2A72 A;  3QUJ A;  3TLS A;  1OED B;  4U74 A;  5HWY A;  4MBQ A;  1Z0P A;  4PJL A;  1SHZ C;  3LBX A;  4ZI7 E;  3QB5 A;  5L3G B;  5LBQ B;  2KWI B;  5EK2 A;  3CQG B;  4EYY R;  1E7P A;  1HNX T;  4QXH B;  2X0Y A;  1W0A A;  4X20 E;  1XMQ T;  4ANJ A;  2LE8 A;  4CXX A;  2V7L A;  4WW0 A;  1MIV A;  4OYJ A;  2YK0 A;  5LHG B;  3AAE B;  4A97 A;  3EUH A;  2XPK A;  4Q25 A;  3KIN B;  3KV5 A;  3TLV A;  4PW8 A;  4X64 T;  2L8K A;  3ONX A;  3AA0 B;  2X9X A;  2LOP A;  1R8I A;  4IE4 A;  3I0O A;  1DU2 A;  1KNP A;  4FJO A;  4HE8 A;  2VVN A;  3AE4 A;  3UT5 E;  4PNI A;  3ANW B;  2HH7 A;  4QH5 A;  2LSG A;  2ACX A;  5FKY A;  5KDM C;  1KFY A;  2WY2 A;  3Q5D A;  3FZL B;  4HKA A;  4HGA A;  4ZS2 A;  4ILC A;  2CBI A;  4MAL A;  1YKE B;  5AQP B;  3UUX B;  3R84 B;  4DV6 T;  2DL1 A;  5AQR B;  1UK5 A;  3F31 A;  3SWH A;  4DMV A;  3LG7 A;  5C2T A;  3RC8 A;  1VOM A;  4TZ4 C;  3ZC1 A;  4YSZ A;  4WYV A;  4QX8 B;  2FJD A;  2UXN B;  4JV5 T;  4DV4 T;  5L4E A;  4JUY A;  2BVL A;  1I94 T;  3TKL B;  3QOF A;  3RC3 A;  3T1H T;  2D9D A;  1G8X A;  5L3B B;  2DWK A;  2C5J A;  3KV4 A;  4LFC T;  4YJ3 E;  3N2K E;  4UVA B;  4H9R C;  4ZI2 C;  2XQ3 A;  2YDS A;  1JNR A;  3JAE A;  4OK0 A;  2NTY A;  4JI1 T;  4L5G A;  3AE8 A;  5HXC A;  3RIU C;  2E9X D;  3B13 A;  5F3J A;  4F6R C;  1XNQ T;  3FXE B;  2EHO A;  4LMJ A;  3PU8 A;  2WB5 A;  2VK9 A;  3UUN A;  4JYA T;  5IUX A;  1HS7 A;  2AXD S;  1W09 A;  2VKH A;  3WAJ A;  2K24 A;  1D0Z A;  2RPA A;  3L09 A;  4AKR B;  1SA0 E;  4YTP A;  3PUA A;  3RQW A;  2LRL A;  5IWA T;  3GN5 B;  3OJA A;  1IBL T;  2M67 A;  3SFD A;  2IC9 A;  5AQU B;  2A2F X;  1OED E;  4DMW A;  5FP3 A;  2JJ9 A;  2XQ8 A;  4GIW A;  5J0Z A;  2LM9 A;  4X65 T;  1XMO T;  4AKG A;  1VCS A;  1HX1 B;  4EXT A;  3NRY A;  4QH4 A;  3NZQ A;  3ETU A;  3ZSS A;  4EZH A;  3I0Q A;  5DAB A;  3P4R A;  1HNW T;  4QX7 B;  2VQF T;  2XAH B;  2WDR A;  2I0M A;  3OYZ A;  4DBQ A;  2XTL A;  4ERR A;  4YJ2 E;  3FZK B;  4PK6 A;  2ZM2 A;  3ZMT B;  2XY8 B;  1H7C A;  1IBM T;  2W63 A;  3M65 A;  2LM2 A;  3MAC A;  2DNX A;  2UXD T;  3RRW A;  2WZI A;  2JPF A;  3CML A;  4U7Y A;  3CIR A;  4ILA A;  4XAX B;  3ZYL A;  2LKH A;  1T7S A;  4C91 A;  3PU3 A;  4XBF B;  5HEH A;  5EZY E;  1YKH B;  2Y8D A;  4IHJ E;  5JRC B;  2NP9 A;  5LP6 E;  1B7T A;  4DR4 T;  2D2S A;  1IJ6 A;  1D1A A;  2K3W A;  1N33 T;  2V7J A;  1WLX A;  3G06 A;  5LG3 A;  3EDU A;  4UEM A;  1OED A;  5J2U E;  3KBT A;  3LK4 2;  5E0O A;  4TX5 A;  5H6R B;  5AQF B;  2YDR A;  4QXB B;  1LVF A;  5JDH A;  2XQ9 A;  5JQG E;  3PDY A;  3ESL A;  1X9B A;  2LJL A;  4WZX A;  2XAS B;  2ZM8 A;  2VL0 A;  2WBL A;  2IDO B;  2XM2 A;  5FXZ A;  2BBH A;  5FL1 A;  4HFE A;  1UX5 A;  3O1I A;  1ZOY A;  3ZC0 A;  4AQF C;  3ZMU B;  4HWD A;  2DWG A;  3AVS A;  2OA5 A;  3KVB A;  2QVA A;  3H3M A;  2UXX B;  2KLQ A;  1D1B A;  3FXD B;  1L0V A;  3F2E A;  3ZJ2 A;  3UQ7 A;  3ANW A;  1T8B A;  2VWA A;  4ZS3 A;  4I4T E;  2X9Y A;  5JR9 B;  3K3Q C;  5M4Y A;  2BG9 E;  4H9O C;  2CMR A;  4DV1 T;  3ZEF B;  4AKI A;  2QGS A;  2N2N A;  3A8Y C;  4YHH T;  2NW7 A;  2CLY C;  1WYB A;  4TWF A;  1WFD A;  2PJQ A;  2P9B A;  3RYC E;  3ZCI A;  4EAH A;  5JDL A;  2I59 A;  5IYZ E;  2EHO D;  5C8Y E;  1YD8 G;  1OED C;  3MXZ A;  3UU3 A;  4U72 A;  3GMI A;  4EYU A;  4HFD A;  4BAY B;  4X62 T;  2CPT A;  2IHR 1;  3V5U A;  4PK4 A;  4HFB A;  5LYJ E;  2C5K T;  2BZB A;  3O1H A;  2LSI A;  3NVO A;  4Z8X A;  1MIY A;  2NWB A;  3JAD A;  2LSJ A;  5LOV E;  1Z8U A;  3CK6 A;  1YXR A;  1M7K A;  1ZV4 X;  5ABF B;  4JI7 T;  5JDG A;  2NOX A;  2JMH A;  5FY0 A;  3BQK A;  3TLW A;  2HPJ A;  3PUZ F;  3LK3 B;  4YSY A;  4DR3 T;  2XM1 A;  2ZLY A;  4U7I A;  2XJ7 A;  4PK5 A;  5AQV B;  4O2A E;  4LFB T;  4TWD A;  4U3C A;  5LJM A;  2FJE A;  3N9N A;  4DR7 T;  2X9W A;  3GN5 A;  3L39 A;  5JDN A;  5TAO A;  5HXE A;  4LF6 T;  2YDQ A;  3A7M A;  5LGU B;  1FEW A;  1D0X A;  4WBO A;  1XDP A;  4L9I A;  3AXJ B;  5HWX A;  1S35 A;  3PUS A;  4EIW A;  2PFV A;  4O4H E;  3AAA B;  5J1G A;  4YT0 A;  4ILB A;  4LF8 T;  1ZHC A;  1LVK A;  4ISS A;  4OYK A;  2WWV A;  3ZKR A;  2NW9 A;  2BBJ A;  5CJ5 A;  3EAB A;  3BQI A;  5BMV E;  5LG4 A;  2X0L B;  4PFP A;  2A3D A;  2VB6 A;  3Q5X A;  2E9X C;  1M62 A; 
#chains in the Genus database with same CATH homology
 1KEY A;  3RIU C;  1J1J A;  3AXJ B;  3AXJ A;  2QVA A;  2QRX A;  3QB5 K;  3QB5 A;  4WYV A;  3PJA J;  3RIU A;  3PJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...