3RIUA

Crystal structure of drosophila hexameric c3po formed by truncated translin and trax
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
206
Chain Sequence
DIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLDGLRKRFDALKYDVKKIEEVVYDVSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translin
publication title Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 70
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3riuA01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3riuA02
3QB5K 3RIUC 1J1JA 3PJAA 4WYVA 1KEYA 3QB5A 3AXJB 3RIUA 2QVAA 2QRXA 3PJAJ 3AXJA
chains in the Genus database with same CATH superfamily
4ZZCA 3PUXF 4DV1T 5HWYA 2YU2A 4PJJA 4H9QC 4LF8T 2E2AA 4TN7B 3ZMZB 3L09A 4GYSA 4IREA 5ABHA 3TLVA 5JDLA 3VKGA 3N9LA 4FI5A 4ZI7E 5EK4A 2XQ4A 4NPPA 1MNDA 4CI1B 4IE6A 2HHHT 1BR2A 3FXDB 3KBTA 2C5JA 3M65A 4QH5A 4HWFA 3LBXA 4HFVA 4ZI3C 4HFBA 3H37A 4I50E 4GK0E 3E22E 2Q9QC 4NUVA 2FJEA 3RQWA 2VQFT 2K9AA 2YDRA 3FZKB 2CWYA 3FB2A 1E7PA 3QOFA 3FZMB 4ILBA 4NXMT 2YU1A 3JC6C 1KNPA 4JI6T 2K48A 1KK7A 3UQ7A 2IHR1 4XBFB 1W0BA 3AE4A 3KINB 5AQUB 4O2AE 4TUYE 4E7SA 5C8YE 2EHOA 2DLRA 3UU3A 5ADXL 1ZV4X 3PUVF 4ILUA 4GIWA 3B5MA 1BR4A 5LOVE 3J9X1 1E1HB 3RYCE 5L3GB 3EAMA 2VQET 5FXZA 2WY2A 1NENA 2WZIA 2I6HA 2BKNA 4YSXA 4A97A 3P4SA 4PJMA 3O1IA 4DMWA 5JQGE 3KBUA 2DHRA 3JADA 4ILCA 4I55E 1N32T 3AAEB 1HS7A 4DV7T 2PFVA 5LJNA 2CRBA 3AA1B 4EB6E 3CQCB 4NUUA 4I0UA 2LHRA 3MA9A 4V1Av 2BKPA 2V5CA 3K8PC 3VHLA 3Q5DA 3N2KE 2CXDA 1R8IA 3ZN0B 3CX6B 1I94T 3PUYF 2CBJA 5JVDE 2CM0A 2WM9A 4U74A 2WWUA 5CFBA 3ZLIA 1GQEA 4U2ZA 2WSSV 3PUAA 5F3JA 2UU9T 5DABA 2PTFA 5L4HA 2CMRA 3DTOA 2E9XB 3FZHB 3GN5B 3PURA 5AQKB 3C64A 2W63A 2ES0A 3EDUA 4HWDA 4UIGA 4ZHQE 2XQAA 4DV0T 4CQIA 1QLBA 5FMNA 1XNQT 4IDNA 4UV9B 4GYRA 2JQHA 3VR8A 5HYAA 4U7YA 3FZLB 3QK6A 2HPJA 2X9YA 3KV9A 2UUCT 1WRDA 2PBIA 4KHPT 5AQGB 3RC3A 4EXTA 3N9PA 5AQRB 3N9MA 2IC9A 2NR4A 3AECA 4CI3B 4LF9T 4IL9A 5LG3A 2N9DA 2LM9A 3ZC1A 4HWHA 5FXWA 3T8OA 3VRBA 5J1GA 4ISTA 5A1LA 3DP7A 2WMNA 1XZYA 2XAQB 2X0LB 4PNIA 5LGNB 2XAFB 3N2GE 1XMQT 4EOZB 2CLYB 5L2LA 1WR0A 2ODUA 4DV5T 2CHOA 4PK6A 3RPUA 2XM2A 4AQGA 3TLTA 4EYYR 4QX8B 2X9HA 1J1JA 2N2NA 4AIUA 4QH1A 3RX6A 2V6XA 4OYJA 4KMCA 4JI1T 3ZJ1A 1XDPA 4UR9A 4NIQA 1FEWA 3AA7B 1J5ET 2YKSA 2BZBA 2XQYA 5JR9A 5L3CB 2BBJA 1OEDC 4YY3T 3UULA 2LT3A 3HA4A 4ILAA 5JDGA 1HNXT 1IZNB 2FJAA 1YKEB 1HNZT 3N9NA 4TV8E 1AJ3A 3P50A 3ZMUB 3TLSA 1FIOA 4ANJA 2LM2A 4LMKA 1MIWA 4HFDA 3BK9A 2NW9A 1FJGT 2WDRA 2E8IA 2WAUA 2XSAA 2OV9A 3TKLB 2VKHA 3H3AA 4BJNA 3X1DA 3FZFB 4PW8A 4X62T 3WAKA 5CJ5A 3UU4A 3O1HA 3ZJ2A 2HH7A 4BJMA 2HN1A 2G0UA 4P09A 5HEJA 2B1EA 2JMHA 3C4ZA 3O9XA 4JI7T 3LSVA 1MIVA 2QGSA 1M7KA 2JJ9A 1D0XA 2EHOD 4AXPA 3E08A 3ZN1B 3PUGA 2IC6A 4ZS2A 1T8BA 2AE9A 1YW0A 2AXDS 3UTKA 4UXNB 2Z6EA 3ZMVB 3U3IA 1XDOA 2K5BB 5KX5E 3NRXA 2LKGA 3OJAA 3AVRA 3RIFA 5AQVB 1N34T 2KINB 1HX8A 2XUEA 2BVMA 2UXCT 4YJ3E 5H6RB 3S4UA 2LSIA 2M67A 2A72A 3IEEA 2W4XA 4CN6A 1V9DA 4K0UA 1IBMT 1LRZA 4U72A 2VKOA 4HWCA 3OPCA 4I4TE 3HKDE 2VKDA 2QRXA 2V7JA 4DR6T 3KV6A 2XM1A 1MMNA 4HFHA 4TNVA 3SFEA 4OHFA 5CGMA 3AE3A 2W00A 2LSGA 2GK9A 2E9XA 1S94A 5FL1A 1IJ6A 3AE2A 2X68A 2QYWA 2UXDT 3KVBA 4KUMB 3AEEA 4X65T 4EAHA 5ABFA 4LMJA 2YN6A 4O2BE 2CXFA 2UXBT 3UFEA 5FP3A 3UFGA 2NTYA 3HKEE 4L5GA 5HEUA 3CIRA 3RKGA 4Z91A 2C5KT 4LFCT 4DBQA 2QA7A 4DV3T 3J7Yq 3I1AA 5IYZE 4CXWA 4DV6T 2ACZA 3PUZF 5LBQB 3NZQA 2DWGA 4CI2B 2VURA 5L3EB 4UV8B 4YLHA 1KEYA 4X64T 1DU2A 2IDOB 3EVYA 4HKAA 2KWIB 2FJDA 5LA6E 4H9RC 5HXCA 3RYFE 1FMVA 3N9OA 5JR9B 3Q2MA 5LB7B 3R6NA 2XAHB 2JQ9A 2Q9QA 3RRWA 1SA0E 3UT5E 3KFWX 4ZI2D 2A9UA 1ZP0A 2LHNA 4Z90A 5HXSA 1QUUA 2WZHA 2K3WA 3HR0A 5FXVA 4C91A 1KNRA 4A98A 5ABGA 3LFMA 4TWFA 4GKKT 2D2SA 3AAIA 2V6YB 1HTJF 1VRBA 1OXZA 1MIYA 2YEVC 3UUNA 4PK4A 4J2CA 3I9WA 3ZCIA 3Q5EA 1MMGA 4GOUA 3ZSTA 4X20E 4LMLA 2J47A 3K3QC 4MLKA 4UVCB 4B6XA 3L8RA 4X1YE 5F8PA 5KMGP 5FL0A 5LYJE 5C3JA 1IJ5A 2LSJA 2K24A 5H6QB 1S35A 2XQ5A 3R84B 5HWXA 3PUQA 2VKJA 3HKCE 2ZM6T 3IF8B 3EUHA 2XQ9A 1Y01A 5JRCB 1B7TA 2VVNA 2D0TA 3OYXA 2X66A 4JYAT 2VWAA 3AEAA 3CX8B 4JI0T 4YT0A 1WLXA 3HI2A 4DUZT 4X1IE 1MNEA 4GKJT 2H88A 2ZMAA 3A5XA 5HEHA 4CXYA 5HEGA 1W0AA 2WU2A 2X9XA 2OA5A 2RP4A 2XQ6A 3F31A 2BDEA 4P0BA 1HG5A 4YHHT 3H3MA 1UCUA 4PFOA 4XAXB 4EGWA 3GA8A 4CN4A 3NBXX 3C4WA 4ISSA 3ZKRA 3L39A 3HKBE 2Y48B 4AQFC 3SRZA 2MTQA 3LG7A 4YSZA 4PJNA 4DVDA 3ZEFB 4KI0F 2JIWA 5AQIB 5LMUT 3MKDA 3ZT6A 1IAPA 4BAYB 5FVLA 2UXXB 2W67A 2A2FX 2W0GA 4ZXLA 3EI0A 4EEDA 2W66A 4IE5A 4H9NC 4HE8A 4H9PC 4IDZA 4ZS3A 1WCRA 2NW8A 3UU6A 3PV0F 5ABFB 2XQ3A 1D1AA 4H63H 3AAAB 2BG9C 5KXJA 3PUWF 2VASA 2J62A 5CA1E 3NVOA 1X9BA 4P1NA 4JV5T 4M1PA 1QSDA 3WI3A 2XQ7A 3P4QA 1ZOYA 4DR5T 4MFRA 2IUBA 3Q5XA 4LF6T 2KZ7B 4OFZA 4MHCA 2MBGA 2JRKA 2NP9A 3B57A 4AKLA 4B3MT 1BR0A 2KLQA 2F4VT 2L8KA 4LFBT 4GK5E 5LNKA 4QXCB 2WB5A 3MK7C 4ADZA 3RQUA 2H89A 4MALA 4UELA 3NWIA 3KV4A 3F57A 4DBRA 1SHZC 4H9OC 2SPCA 2E5VA 2LJLA 2E9XD 1D0ZA 4IGUA 5E0OA 5HXRA 2Q9QB 3AEDA 2J1DG 1W9RA 2WWVA 4TWHA 4YFSA 2KT9A 2WBLA 3LK2B 3RIAA 1U4QA 1G73A 3O1JA 4QKNA 4YHJA 3O4XE 2CCQA 4YTNA 3C51A 5LJMA 4LF4T 2LSYA 1XMOT 3OTOT 1YXRA 1YD8G 3UUMA 1ZEEA 5AQTB 3ZPOA 5FVKA 3F2EA 2BS2A 2KXPB 3MXZA 4CXXA 2P9BA 2XAGB 4K0KT 4I43B 2LEHA 4EZHA 2H7VC 2X0HA 3P4PA 4F8HA 5HCMA 2XHEB 4IIJE 4KHZF 4ASKA 4ZI3D 5L3DB 3FBLA 4BA9A 2V6YA 2I0MA 4KBMB 4IT4A 2IMLA 2ZM0A 3V5SA 3PTRB 2D0UA 5JDMA 2VL8A 1CHUA 5L47A 5CA0E 1X79A 4IL4A 4YSYA 1MMDA 3OKQA 3JC6D 1VCSA 2X0YA 2VB6A 2A3DA 4X5TA 4L0RA 4HN9A 2M6IA 4CZZB 5EK3A 2CHNA 1HG2A 4TNWA 1LVKA 5EK2A 3IBPA 3QNUA 4F6RC 4DR1T 3AE6A 2CE7A 5JRCA 2UXNB 4B3TT 4JI5T 1H7CA 3UQ4A 4HFIA 3AA6B 4H63V 4HEAA 2NOXA 4WBOA 5LHHB 3EABA 1HF8A 2NWBA 2CWOA 1N33T 4YTPA 2UUAT 3RH3A 4ERRA 1LKXA 3FXEB 3QUJA 2XY8B 1HX1B 3QB5K 2PJQA 3RIUA 4O4IE 4WNKA 4DR7T 4YJ2E 3OVUA 3G06A 4ZOLE 2MYSA 4U2YA 5AQNB 3I9YA 3HL6A 1O3XA 5HCJA 3PU8A 4LF5T 1T72A 3NKZA 4IE0A 4UF0B 5HEOA 3ONXA 2H7OA 5L3FB 4QWNB 2NTXA 3CMLA 4L9IA 4JI2T 4AKHA 3C50A 2X67A 2FUPA 2NW7A 2M6BA 2BS4A 3AXJA 4DR3T 5IUXA 1JNRA 3NRYA 2WQYA 3V5UA 1EZ3A 1MMAA 1US7B 2V8SV 5GONE 3ZYMA 5AFUL 3GMIA 3CPZA 2VK9A 1NEKA 2LE8A 4WZXA 5C2TA 4O4JE 2XZEA 1UURA 1YQ4A 5LG4A 1HNWT 2DI4A 4QHOA 1UGOA 4JBWF 4EEBA 2XTLA 1FMWA 4AKRB 3RGLA 3GWHA 1U5PA 5L4EA 2FBWA 1KNZA 5HXEA 1ZHCA 2IIUA 5IWAT 3BQLA 2QVAA 2V1DB 1SUMB 4AQYT 2YDSA 2LRKA 2YK0A 2Y6XA 3JAEA 3AE9A 4COFA 4TV9E 4JUYA 3K1SA 1G8XA 1OEDB 3A8YC 2X9WA 5AQSB 2BKOA 3BQIA 3ANWB 4U7IA 1D1CA 2Y8DA 2L3LA 1M62A 4B3ST 1OWAA 1XNRT 1Z8UA 1D1BA 5BMVE 3TLWA 2X51A 5M4YA 5LP6E 2C5IT 1HCIA 5LCYA 2E5LT 4UEMA 5LGUB 2LOSA 3CVRA 4DUYT 3SOLA 3T1YT 4EZ4A 1IBLT 2C0SA 2DWKA 2IAKA 4DV2T 4JI8T 2WDVA 2XSBA 5AQJB 2W62A 3KDSE 4QXHB 3WAJA 3AEFA 4O8SA 4UVAB 4WW0A 4AKGA 5F5WA 2CLYC 4CN1A 2ZLYA 4XZCA 2VVSA 3LJCA 1ZKEA 4TWDA 5JDNA 5ABEA 3SWHA 5JDHA 1JNZA 4UVBB 4YTMA 4QXBB 5LGTB 5LBMA 3T1HT 2RA1A 4LF7T 2J4GA 2CXLA 5IHYA 4MBQA 5AQQB 3P4RA 3IA3A 2I59A 2XAJB 5LHIB 3RHWA 3SFDA 4JI3T 4ZEYA 2EHOC 1HR0T 3ONJA 2UUBT 3CK6A 2WDQA 3BQKA 2JPFA 2JQKA 5KDMC 2FJBA 5JH7E 3FHNA 4KP3C 3RYHE 3RKOA 2D5UA 4LFAT 4AQFA 4DO0A 3EDVA 2W2UA 4A5XA 3MZKB 1T98A 2MOZA 3N5LA 4G63A 2RPAA 3I0QA 3PU3A 3P8CD 2LSKA 3PJAJ 3AA0B 3OBVE 4DR2T 2V7LA 4PK5A 5CB4E 3N2OA 3AXJB 2HN2A 5DQVA 3C98B 2KNDA 4DNDA 4ZZBA 3AE5A 4U33A 2BG9A 1IBKT 5BR8T 3JAFA 3AE1A 3RLFF 1YKHB 2XQ8A 4UF0A 3OYZA 4WBNE 3CQXC 5FY1A 3RYIE 5FXXA 3RRCA 2ZM2A 3ZMSB 4DR4T 4HFEA 3E0ZA 3CKDA 5L3BB 2MAWA 5EZYE 3I0OA 2V5DA 2LLYA 2WU5A 3RI5A 4DIDB 2ACXA 3AE8A 4X1KE 5AQHB 2JMKA 3UU8A 2CBIA 1YQ3A 3M3ZB 4X66T 2BG9E 2V7IA 1L0VA 4G2AA 2BS3A 3CQGB 3PUSA 5AQMB 5JDFA 4P0AA 2BBHA 1Z0PA 2D9DA 1J5WA 2CEAA 2WP9A 5AQPB 4N78D 3PE0A 1XWMA 3DJBA 5FNVE 4OX9T 4H9SE 3AEGA 4OK0A 3C4XA 4AISA 1UUSA 3CX7B 4EIWA 2YOEA 2XASB 2ODVA 4TZ4C 4ZI2C 2V7KA 4IE4A 2DL1A 4PAGA 3ZSSA 3ZT5A 3ZT7A 1OEDA 2LKHA 1Y64B 4HFCA 5DJQC 3LBXB 1E2AA 3ANWA 5LHGB 3W15B 5HXHA 5AQLB 4C90A 3AB3B 4Q25A 3AVSA 5LMNT 5HAXA 2WMOA 2DNXA 5ETWA 2MPKA 4TX5A 3CWZB 3PDYA 1W09A 2B76A 4AKIA 5DQWA 2KSRA 2W61A 3K3NA 4IDOA 3D0TA 3JCFA 1UK5A 2EHOB 3UUXB 1OEDE 2Q9QD 2N1GA 4PFPA 2V7MA 1CUNA 2CPTA 5JR9C 3P4WA 4B3RT 3Q9DA 4IE7A 4HGAA 5FY0A 4IHJE 4O4LE 4Z8XA 4WYVA 4FJOA 2KWHA 3KVAA 1N36T 2R6GF 1VOMA 2OLTA 3ETUA 4U3CA 5JTGA 3IHRA 3L3PA 1UX4A 2BVLA 1WFDA 5AQFB 2KMFA 3VKHA 1KF6A 3K3OA 5J0ZA 4HWIB 3RF1A 2HPLA 1I6ZA 1UX5A 2PG8A 4A56A 3MJXA 3ABVA 3EHZA 1NWMX 3RC8A 4JEHB 1WYBA 3LDQB 2DCFA 2VL0A 2XPKA 4DV4T 2YINA 3B13A 3P7IA 2V26A 3TLUA 3A7MA 1WR6A 3ZYLA 5FKYA 2BG9B 3ONLC 1D0YA 3NZPA 5AQOB 4JI4T 3QB5A 3ZCJA 2L9QA 3MACA 4EV6A 2YDQA 3LK3B 2LRLA 3VU7H 2XJ7A 1LVFA 3ZC0A 2WCAA 3FBZA 2JQQA 3VR9A 1SE7A 4PJLA 2LOPA 4EYUA 4E7ZA 3RIUC 5JREA 3KV5A 4IDPA 2CA5A 4YXDA 4HTEA 2ZM8A 3U78A 2IW5B 5LXTE 2H3RA 3UUBA 3ESLA 4QH4A 3UU5A 3AE7A 5TAOA 3VRAA 4IDQA 5JDQA 4AI6A 1HFAA 3GN5A 4NXNT 5FYMA 3SS1A 5J2TE 4DMVA 3ZMTB 3Q5WA 3LK42 1KFYA 3ZYKA 4O4HE 2E9XC 1WYCA 1T7SA 3QC9A 4OYKA 3ETVA 4KX6A 5J2UE 1VCTA 3PJAA 4JLEA 2WS3A 4QX7B 3N9QA 4JEUB 5FY7A 1NAFA 1BR1A 3AEBA 4U31A
chains in the Genus database with same CATH topology
3QB5K 3RIUC 1J1JA 3PJAA 4WYVA 1KEYA 3QB5A 3AXJB 3RIUA 2QVAA 2QRXA 3PJAJ 3AXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QB5 K;  3RIU C;  1J1J A;  3PJA A;  4WYV A;  1KEY A;  3QB5 A;  3AXJ B;  3RIU A;  2QVA A;  2QRX A;  3PJA J;  3AXJ A; 
#chains in the Genus database with same CATH topology
 4ZZC A;  3PUX F;  4DV1 T;  5HWY A;  2YU2 A;  4PJJ A;  4H9Q C;  4LF8 T;  2E2A A;  4TN7 B;  3ZMZ B;  3L09 A;  4GYS A;  4IRE A;  5ABH A;  3TLV A;  5JDL A;  3VKG A;  3N9L A;  4FI5 A;  4ZI7 E;  5EK4 A;  2XQ4 A;  4NPP A;  1MND A;  4CI1 B;  4IE6 A;  2HHH T;  1BR2 A;  3FXD B;  3KBT A;  2C5J A;  3M65 A;  4QH5 A;  4HWF A;  3LBX A;  4HFV A;  4ZI3 C;  4HFB A;  3H37 A;  4I50 E;  4GK0 E;  3E22 E;  2Q9Q C;  4NUV A;  2FJE A;  3RQW A;  2VQF T;  2K9A A;  2YDR A;  3FZK B;  2CWY A;  3FB2 A;  1E7P A;  3QOF A;  3FZM B;  4ILB A;  4NXM T;  2YU1 A;  3JC6 C;  1KNP A;  4JI6 T;  2K48 A;  1KK7 A;  3UQ7 A;  2IHR 1;  4XBF B;  1W0B A;  3AE4 A;  3KIN B;  5AQU B;  4O2A E;  4TUY E;  4E7S A;  5C8Y E;  2EHO A;  2DLR A;  3UU3 A;  5ADX L;  1ZV4 X;  3PUV F;  4ILU A;  4GIW A;  3B5M A;  1BR4 A;  5LOV E;  3J9X 1;  1E1H B;  3RYC E;  5L3G B;  3EAM A;  2VQE T;  5FXZ A;  2WY2 A;  1NEN A;  2WZI A;  2I6H A;  2BKN A;  4YSX A;  4A97 A;  3P4S A;  4PJM A;  3O1I A;  4DMW A;  5JQG E;  3KBU A;  2DHR A;  3JAD A;  4ILC A;  4I55 E;  1N32 T;  3AAE B;  1HS7 A;  4DV7 T;  2PFV A;  5LJN A;  2CRB A;  3AA1 B;  4EB6 E;  3CQC B;  4NUU A;  4I0U A;  2LHR A;  3MA9 A;  4V1A v;  2BKP A;  2V5C A;  3K8P C;  3VHL A;  3Q5D A;  3N2K E;  2CXD A;  1R8I A;  3ZN0 B;  3CX6 B;  1I94 T;  3PUY F;  2CBJ A;  5JVD E;  2CM0 A;  2WM9 A;  4U74 A;  2WWU A;  5CFB A;  3ZLI A;  1GQE A;  4U2Z A;  2WSS V;  3PUA A;  5F3J A;  2UU9 T;  5DAB A;  2PTF A;  5L4H A;  2CMR A;  3DTO A;  2E9X B;  3FZH B;  3GN5 B;  3PUR A;  5AQK B;  3C64 A;  2W63 A;  2ES0 A;  3EDU A;  4HWD A;  4UIG A;  4ZHQ E;  2XQA A;  4DV0 T;  4CQI A;  1QLB A;  5FMN A;  1XNQ T;  4IDN A;  4UV9 B;  4GYR A;  2JQH A;  3VR8 A;  5HYA A;  4U7Y A;  3FZL B;  3QK6 A;  2HPJ A;  2X9Y A;  3KV9 A;  2UUC T;  1WRD A;  2PBI A;  4KHP T;  5AQG B;  3RC3 A;  4EXT A;  3N9P A;  5AQR B;  3N9M A;  2IC9 A;  2NR4 A;  3AEC A;  4CI3 B;  4LF9 T;  4IL9 A;  5LG3 A;  2N9D A;  2LM9 A;  3ZC1 A;  4HWH A;  5FXW A;  3T8O A;  3VRB A;  5J1G A;  4IST A;  5A1L A;  3DP7 A;  2WMN A;  1XZY A;  2XAQ B;  2X0L B;  4PNI A;  5LGN B;  2XAF B;  3N2G E;  1XMQ T;  4EOZ B;  2CLY B;  5L2L A;  1WR0 A;  2ODU A;  4DV5 T;  2CHO A;  4PK6 A;  3RPU A;  2XM2 A;  4AQG A;  3TLT A;  4EYY R;  4QX8 B;  2X9H A;  1J1J A;  2N2N A;  4AIU A;  4QH1 A;  3RX6 A;  2V6X A;  4OYJ A;  4KMC A;  4JI1 T;  3ZJ1 A;  1XDP A;  4UR9 A;  4NIQ A;  1FEW A;  3AA7 B;  1J5E T;  2YKS A;  2BZB A;  2XQY A;  5JR9 A;  5L3C B;  2BBJ A;  1OED C;  4YY3 T;  3UUL A;  2LT3 A;  3HA4 A;  4ILA A;  5JDG A;  1HNX T;  1IZN B;  2FJA A;  1YKE B;  1HNZ T;  3N9N A;  4TV8 E;  1AJ3 A;  3P50 A;  3ZMU B;  3TLS A;  1FIO A;  4ANJ A;  2LM2 A;  4LMK A;  1MIW A;  4HFD A;  3BK9 A;  2NW9 A;  1FJG T;  2WDR A;  2E8I A;  2WAU A;  2XSA A;  2OV9 A;  3TKL B;  2VKH A;  3H3A A;  4BJN A;  3X1D A;  3FZF B;  4PW8 A;  4X62 T;  3WAK A;  5CJ5 A;  3UU4 A;  3O1H A;  3ZJ2 A;  2HH7 A;  4BJM A;  2HN1 A;  2G0U A;  4P09 A;  5HEJ A;  2B1E A;  2JMH A;  3C4Z A;  3O9X A;  4JI7 T;  3LSV A;  1MIV A;  2QGS A;  1M7K A;  2JJ9 A;  1D0X A;  2EHO D;  4AXP A;  3E08 A;  3ZN1 B;  3PUG A;  2IC6 A;  4ZS2 A;  1T8B A;  2AE9 A;  1YW0 A;  2AXD S;  3UTK A;  4UXN B;  2Z6E A;  3ZMV B;  3U3I A;  1XDO A;  2K5B B;  5KX5 E;  3NRX A;  2LKG A;  3OJA A;  3AVR A;  3RIF A;  5AQV B;  1N34 T;  2KIN B;  1HX8 A;  2XUE A;  2BVM A;  2UXC T;  4YJ3 E;  5H6R B;  3S4U A;  2LSI A;  2M67 A;  2A72 A;  3IEE A;  2W4X A;  4CN6 A;  1V9D A;  4K0U A;  1IBM T;  1LRZ A;  4U72 A;  2VKO A;  4HWC A;  3OPC A;  4I4T E;  3HKD E;  2VKD A;  2QRX A;  2V7J A;  4DR6 T;  3KV6 A;  2XM1 A;  1MMN A;  4HFH A;  4TNV A;  3SFE A;  4OHF A;  5CGM A;  3AE3 A;  2W00 A;  2LSG A;  2GK9 A;  2E9X A;  1S94 A;  5FL1 A;  1IJ6 A;  3AE2 A;  2X68 A;  2QYW A;  2UXD T;  3KVB A;  4KUM B;  3AEE A;  4X65 T;  4EAH A;  5ABF A;  4LMJ A;  2YN6 A;  4O2B E;  2CXF A;  2UXB T;  3UFE A;  5FP3 A;  3UFG A;  2NTY A;  3HKE E;  4L5G A;  5HEU A;  3CIR A;  3RKG A;  4Z91 A;  2C5K T;  4LFC T;  4DBQ A;  2QA7 A;  4DV3 T;  3J7Y q;  3I1A A;  5IYZ E;  4CXW A;  4DV6 T;  2ACZ A;  3PUZ F;  5LBQ B;  3NZQ A;  2DWG A;  4CI2 B;  2VUR A;  5L3E B;  4UV8 B;  4YLH A;  1KEY A;  4X64 T;  1DU2 A;  2IDO B;  3EVY A;  4HKA A;  2KWI B;  2FJD A;  5LA6 E;  4H9R C;  5HXC A;  3RYF E;  1FMV A;  3N9O A;  5JR9 B;  3Q2M A;  5LB7 B;  3R6N A;  2XAH B;  2JQ9 A;  2Q9Q A;  3RRW A;  1SA0 E;  3UT5 E;  3KFW X;  4ZI2 D;  2A9U A;  1ZP0 A;  2LHN A;  4Z90 A;  5HXS A;  1QUU A;  2WZH A;  2K3W A;  3HR0 A;  5FXV A;  4C91 A;  1KNR A;  4A98 A;  5ABG A;  3LFM A;  4TWF A;  4GKK T;  2D2S A;  3AAI A;  2V6Y B;  1HTJ F;  1VRB A;  1OXZ A;  1MIY A;  2YEV C;  3UUN A;  4PK4 A;  4J2C A;  3I9W A;  3ZCI A;  3Q5E A;  1MMG A;  4GOU A;  3ZST A;  4X20 E;  4LML A;  2J47 A;  3K3Q C;  4MLK A;  4UVC B;  4B6X A;  3L8R A;  4X1Y E;  5F8P A;  5KMG P;  5FL0 A;  5LYJ E;  5C3J A;  1IJ5 A;  2LSJ A;  2K24 A;  5H6Q B;  1S35 A;  2XQ5 A;  3R84 B;  5HWX A;  3PUQ A;  2VKJ A;  3HKC E;  2ZM6 T;  3IF8 B;  3EUH A;  2XQ9 A;  1Y01 A;  5JRC B;  1B7T A;  2VVN A;  2D0T A;  3OYX A;  2X66 A;  4JYA T;  2VWA A;  3AEA A;  3CX8 B;  4JI0 T;  4YT0 A;  1WLX A;  3HI2 A;  4DUZ T;  4X1I E;  1MNE A;  4GKJ T;  2H88 A;  2ZMA A;  3A5X A;  5HEH A;  4CXY A;  5HEG A;  1W0A A;  2WU2 A;  2X9X A;  2OA5 A;  2RP4 A;  2XQ6 A;  3F31 A;  2BDE A;  4P0B A;  1HG5 A;  4YHH T;  3H3M A;  1UCU A;  4PFO A;  4XAX B;  4EGW A;  3GA8 A;  4CN4 A;  3NBX X;  3C4W A;  4ISS A;  3ZKR A;  3L39 A;  3HKB E;  2Y48 B;  4AQF C;  3SRZ A;  2MTQ A;  3LG7 A;  4YSZ A;  4PJN A;  4DVD A;  3ZEF B;  4KI0 F;  2JIW A;  5AQI B;  5LMU T;  3MKD A;  3ZT6 A;  1IAP A;  4BAY B;  5FVL A;  2UXX B;  2W67 A;  2A2F X;  2W0G A;  4ZXL A;  3EI0 A;  4EED A;  2W66 A;  4IE5 A;  4H9N C;  4HE8 A;  4H9P C;  4IDZ A;  4ZS3 A;  1WCR A;  2NW8 A;  3UU6 A;  3PV0 F;  5ABF B;  2XQ3 A;  1D1A A;  4H63 H;  3AAA B;  2BG9 C;  5KXJ A;  3PUW F;  2VAS A;  2J62 A;  5CA1 E;  3NVO A;  1X9B A;  4P1N A;  4JV5 T;  4M1P A;  1QSD A;  3WI3 A;  2XQ7 A;  3P4Q A;  1ZOY A;  4DR5 T;  4MFR A;  2IUB A;  3Q5X A;  4LF6 T;  2KZ7 B;  4OFZ A;  4MHC A;  2MBG A;  2JRK A;  2NP9 A;  3B57 A;  4AKL A;  4B3M T;  1BR0 A;  2KLQ A;  2F4V T;  2L8K A;  4LFB T;  4GK5 E;  5LNK A;  4QXC B;  2WB5 A;  3MK7 C;  4ADZ A;  3RQU A;  2H89 A;  4MAL A;  4UEL A;  3NWI A;  3KV4 A;  3F57 A;  4DBR A;  1SHZ C;  4H9O C;  2SPC A;  2E5V A;  2LJL A;  2E9X D;  1D0Z A;  4IGU A;  5E0O A;  5HXR A;  2Q9Q B;  3AED A;  2J1D G;  1W9R A;  2WWV A;  4TWH A;  4YFS A;  2KT9 A;  2WBL A;  3LK2 B;  3RIA A;  1U4Q A;  1G73 A;  3O1J A;  4QKN A;  4YHJ A;  3O4X E;  2CCQ A;  4YTN A;  3C51 A;  5LJM A;  4LF4 T;  2LSY A;  1XMO T;  3OTO T;  1YXR A;  1YD8 G;  3UUM A;  1ZEE A;  5AQT B;  3ZPO A;  5FVK A;  3F2E A;  2BS2 A;  2KXP B;  3MXZ A;  4CXX A;  2P9B A;  2XAG B;  4K0K T;  4I43 B;  2LEH A;  4EZH A;  2H7V C;  2X0H A;  3P4P A;  4F8H A;  5HCM A;  2XHE B;  4IIJ E;  4KHZ F;  4ASK A;  4ZI3 D;  5L3D B;  3FBL A;  4BA9 A;  2V6Y A;  2I0M A;  4KBM B;  4IT4 A;  2IML A;  2ZM0 A;  3V5S A;  3PTR B;  2D0U A;  5JDM A;  2VL8 A;  1CHU A;  5L47 A;  5CA0 E;  1X79 A;  4IL4 A;  4YSY A;  1MMD A;  3OKQ A;  3JC6 D;  1VCS A;  2X0Y A;  2VB6 A;  2A3D A;  4X5T A;  4L0R A;  4HN9 A;  2M6I A;  4CZZ B;  5EK3 A;  2CHN A;  1HG2 A;  4TNW A;  1LVK A;  5EK2 A;  3IBP A;  3QNU A;  4F6R C;  4DR1 T;  3AE6 A;  2CE7 A;  5JRC A;  2UXN B;  4B3T T;  4JI5 T;  1H7C A;  3UQ4 A;  4HFI A;  3AA6 B;  4H63 V;  4HEA A;  2NOX A;  4WBO A;  5LHH B;  3EAB A;  1HF8 A;  2NWB A;  2CWO A;  1N33 T;  4YTP A;  2UUA T;  3RH3 A;  4ERR A;  1LKX A;  3FXE B;  3QUJ A;  2XY8 B;  1HX1 B;  3QB5 K;  2PJQ A;  3RIU A;  4O4I E;  4WNK A;  4DR7 T;  4YJ2 E;  3OVU A;  3G06 A;  4ZOL E;  2MYS A;  4U2Y A;  5AQN B;  3I9Y A;  3HL6 A;  1O3X A;  5HCJ A;  3PU8 A;  4LF5 T;  1T72 A;  3NKZ A;  4IE0 A;  4UF0 B;  5HEO A;  3ONX A;  2H7O A;  5L3F B;  4QWN B;  2NTX A;  3CML A;  4L9I A;  4JI2 T;  4AKH A;  3C50 A;  2X67 A;  2FUP A;  2NW7 A;  2M6B A;  2BS4 A;  3AXJ A;  4DR3 T;  5IUX A;  1JNR A;  3NRY A;  2WQY A;  3V5U A;  1EZ3 A;  1MMA A;  1US7 B;  2V8S V;  5GON E;  3ZYM A;  5AFU L;  3GMI A;  3CPZ A;  2VK9 A;  1NEK A;  2LE8 A;  4WZX A;  5C2T A;  4O4J E;  2XZE A;  1UUR A;  1YQ4 A;  5LG4 A;  1HNW T;  2DI4 A;  4QHO A;  1UGO A;  4JBW F;  4EEB A;  2XTL A;  1FMW A;  4AKR B;  3RGL A;  3GWH A;  1U5P A;  5L4E A;  2FBW A;  1KNZ A;  5HXE A;  1ZHC A;  2IIU A;  5IWA T;  3BQL A;  2QVA A;  2V1D B;  1SUM B;  4AQY T;  2YDS A;  2LRK A;  2YK0 A;  2Y6X A;  3JAE A;  3AE9 A;  4COF A;  4TV9 E;  4JUY A;  3K1S A;  1G8X A;  1OED B;  3A8Y C;  2X9W A;  5AQS B;  2BKO A;  3BQI A;  3ANW B;  4U7I A;  1D1C A;  2Y8D A;  2L3L A;  1M62 A;  4B3S T;  1OWA A;  1XNR T;  1Z8U A;  1D1B A;  5BMV E;  3TLW A;  2X51 A;  5M4Y A;  5LP6 E;  2C5I T;  1HCI A;  5LCY A;  2E5L T;  4UEM A;  5LGU B;  2LOS A;  3CVR A;  4DUY T;  3SOL A;  3T1Y T;  4EZ4 A;  1IBL T;  2C0S A;  2DWK A;  2IAK A;  4DV2 T;  4JI8 T;  2WDV A;  2XSB A;  5AQJ B;  2W62 A;  3KDS E;  4QXH B;  3WAJ A;  3AEF A;  4O8S A;  4UVA B;  4WW0 A;  4AKG A;  5F5W A;  2CLY C;  4CN1 A;  2ZLY A;  4XZC A;  2VVS A;  3LJC A;  1ZKE A;  4TWD A;  5JDN A;  5ABE A;  3SWH A;  5JDH A;  1JNZ A;  4UVB B;  4YTM A;  4QXB B;  5LGT B;  5LBM A;  3T1H T;  2RA1 A;  4LF7 T;  2J4G A;  2CXL A;  5IHY A;  4MBQ A;  5AQQ B;  3P4R A;  3IA3 A;  2I59 A;  2XAJ B;  5LHI B;  3RHW A;  3SFD A;  4JI3 T;  4ZEY A;  2EHO C;  1HR0 T;  3ONJ A;  2UUB T;  3CK6 A;  2WDQ A;  3BQK A;  2JPF A;  2JQK A;  5KDM C;  2FJB A;  5JH7 E;  3FHN A;  4KP3 C;  3RYH E;  3RKO A;  2D5U A;  4LFA T;  4AQF A;  4DO0 A;  3EDV A;  2W2U A;  4A5X A;  3MZK B;  1T98 A;  2MOZ A;  3N5L A;  4G63 A;  2RPA A;  3I0Q A;  3PU3 A;  3P8C D;  2LSK A;  3PJA J;  3AA0 B;  3OBV E;  4DR2 T;  2V7L A;  4PK5 A;  5CB4 E;  3N2O A;  3AXJ B;  2HN2 A;  5DQV A;  3C98 B;  2KND A;  4DND A;  4ZZB A;  3AE5 A;  4U33 A;  2BG9 A;  1IBK T;  5BR8 T;  3JAF A;  3AE1 A;  3RLF F;  1YKH B;  2XQ8 A;  4UF0 A;  3OYZ A;  4WBN E;  3CQX C;  5FY1 A;  3RYI E;  5FXX A;  3RRC A;  2ZM2 A;  3ZMS B;  4DR4 T;  4HFE A;  3E0Z A;  3CKD A;  5L3B B;  2MAW A;  5EZY E;  3I0O A;  2V5D A;  2LLY A;  2WU5 A;  3RI5 A;  4DID B;  2ACX A;  3AE8 A;  4X1K E;  5AQH B;  2JMK A;  3UU8 A;  2CBI A;  1YQ3 A;  3M3Z B;  4X66 T;  2BG9 E;  2V7I A;  1L0V A;  4G2A A;  2BS3 A;  3CQG B;  3PUS A;  5AQM B;  5JDF A;  4P0A A;  2BBH A;  1Z0P A;  2D9D A;  1J5W A;  2CEA A;  2WP9 A;  5AQP B;  4N78 D;  3PE0 A;  1XWM A;  3DJB A;  5FNV E;  4OX9 T;  4H9S E;  3AEG A;  4OK0 A;  3C4X A;  4AIS A;  1UUS A;  3CX7 B;  4EIW A;  2YOE A;  2XAS B;  2ODV A;  4TZ4 C;  4ZI2 C;  2V7K A;  4IE4 A;  2DL1 A;  4PAG A;  3ZSS A;  3ZT5 A;  3ZT7 A;  1OED A;  2LKH A;  1Y64 B;  4HFC A;  5DJQ C;  3LBX B;  1E2A A;  3ANW A;  5LHG B;  3W15 B;  5HXH A;  5AQL B;  4C90 A;  3AB3 B;  4Q25 A;  3AVS A;  5LMN T;  5HAX A;  2WMO A;  2DNX A;  5ETW A;  2MPK A;  4TX5 A;  3CWZ B;  3PDY A;  1W09 A;  2B76 A;  4AKI A;  5DQW A;  2KSR A;  2W61 A;  3K3N A;  4IDO A;  3D0T A;  3JCF A;  1UK5 A;  2EHO B;  3UUX B;  1OED E;  2Q9Q D;  2N1G A;  4PFP A;  2V7M A;  1CUN A;  2CPT A;  5JR9 C;  3P4W A;  4B3R T;  3Q9D A;  4IE7 A;  4HGA A;  5FY0 A;  4IHJ E;  4O4L E;  4Z8X A;  4WYV A;  4FJO A;  2KWH A;  3KVA A;  1N36 T;  2R6G F;  1VOM A;  2OLT A;  3ETU A;  4U3C A;  5JTG A;  3IHR A;  3L3P A;  1UX4 A;  2BVL A;  1WFD A;  5AQF B;  2KMF A;  3VKH A;  1KF6 A;  3K3O A;  5J0Z A;  4HWI B;  3RF1 A;  2HPL A;  1I6Z A;  1UX5 A;  2PG8 A;  4A56 A;  3MJX A;  3ABV A;  3EHZ A;  1NWM X;  3RC8 A;  4JEH B;  1WYB A;  3LDQ B;  2DCF A;  2VL0 A;  2XPK A;  4DV4 T;  2YIN A;  3B13 A;  3P7I A;  2V26 A;  3TLU A;  3A7M A;  1WR6 A;  3ZYL A;  5FKY A;  2BG9 B;  3ONL C;  1D0Y A;  3NZP A;  5AQO B;  4JI4 T;  3QB5 A;  3ZCJ A;  2L9Q A;  3MAC A;  4EV6 A;  2YDQ A;  3LK3 B;  2LRL A;  3VU7 H;  2XJ7 A;  1LVF A;  3ZC0 A;  2WCA A;  3FBZ A;  2JQQ A;  3VR9 A;  1SE7 A;  4PJL A;  2LOP A;  4EYU A;  4E7Z A;  3RIU C;  5JRE A;  3KV5 A;  4IDP A;  2CA5 A;  4YXD A;  4HTE A;  2ZM8 A;  3U78 A;  2IW5 B;  5LXT E;  2H3R A;  3UUB A;  3ESL A;  4QH4 A;  3UU5 A;  3AE7 A;  5TAO A;  3VRA A;  4IDQ A;  5JDQ A;  4AI6 A;  1HFA A;  3GN5 A;  4NXN T;  5FYM A;  3SS1 A;  5J2T E;  4DMV A;  3ZMT B;  3Q5W A;  3LK4 2;  1KFY A;  3ZYK A;  4O4H E;  2E9X C;  1WYC A;  1T7S A;  3QC9 A;  4OYK A;  3ETV A;  4KX6 A;  5J2U E;  1VCT A;  3PJA A;  4JLE A;  2WS3 A;  4QX7 B;  3N9Q A;  4JEU B;  5FY7 A;  1NAF A;  1BR1 A;  3AEB A;  4U31 A; 
#chains in the Genus database with same CATH homology
 3QB5 K;  3RIU C;  1J1J A;  3PJA A;  4WYV A;  1KEY A;  3QB5 A;  3AXJ B;  3RIU A;  2QVA A;  2QRX A;  3PJA J;  3AXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...