3RIUA

Crystal structure of drosophila hexameric c3po formed by truncated translin and trax
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
206
Chain Sequence
b'DIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLDGLRKRFDALKYDVKKIEEVVYDVSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translin
publication title Multimeric assembly and biochemical characterization of the Trax-translin endonuclease complex.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 70
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3riuA01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3riuA02
3RIUA 3RIUC 1J1JA 3QB5A 3AXJA 3QB5K 3PJAJ 3AXJB 3PJAA 4WYVA 2QVAA 2QRXA 1KEYA
chains in the Genus database with same CATH superfamily
1IJ6A 1ZEEA 2MBGA 3ZMUB 3MJXA 3K3QC 1CUNA 2OA5A 5HXEA 2XASB 4X65T 3AECA 3C51A 3Q5EA 3WAKA 3A7MA 2ODUA 3SS1A 3QC9A 1VRBA 4OX9T 4JI4T 4DR3T 4ZHQE 4HWHA 5J2UE 3G06A 3NZQA 1N34T 5FKYA 5LHGB 3ZPOA 1UX4A 4OYJA 4TWHA 3VR9A 5LGNB 4P09A 4YTMA 1HS7A 1FEWA 3Q9DA 4JI1T 4PK4A 2XJ7A 2CM0A 3OYZA 1OXZA 3MACA 3AA1B 3ETUA 3H3AA 3AE4A 2IHR1 1HTJF 4LF6T 1HR0T 5JRCA 2XQ9A 4DV4T 5FL0A 3MXZA 3RF1A 2C5KT 3ZYKA 5LG3A 3ZMTB 1KNRA 3I1AA 3FBLA 2LRLA 3AEBA 3BQKA 5CFBA 3NVOA 5JR9A 5AQFB 4DV1T 4MBQA 3ZJ1A 2KNDA 4K0KT 2V7JA 4YFSA 3HKBE 3AB3B 1YKHB 3CQGB 2CRBA 3AEGA 2LJLA 4HFEA 2YDSA 4X64T 4PAGA 4TWFA 3OYXA 4F8HA 3JCFA 3I9YA 4IIJE 2VL0A 2XPKA 2J4GA 3VRAA 1L0VA 1KFYA 5L3FB 2R6GF 1HG5A 2RA1A 1J1JA 3CIRA 2Q9QB 3ZT7A 4B3TT 2CBIA 2A9UA 2H7OA 3RQWA 4AQGA 2IMLA 1Y01A 2CEAA 1WYBA 2H3RA 5AQTB 4DBQA 1QSDA 1M7KA 2ZM0A 3B57A 4NUVA 4ZS2A 1W0AA 4CN1A 4QXCB 5LOVE 4I55E 1IJ5A 4EGWA 3EHZA 2M6IA 2NW7A 2WWUA 3RYHE 2KZ7B 4IL4A 4ZZCA 2WAUA 2E9XB 3U78A 3L3PA 4LFCT 1MMAA 2JQ9A 2RPAA 1ZOYA 4ERRA 2K24A 1QLBA 3P4PA 2KT9A 5HEGA 4IT4A 3CPZA 3WI3A 3KVBA 4AKGA 5ADXL 3UUNA 2XTLA 4UV9B 3VRBA 4GKKT 3FZMB 3IEEA 3ABVA 4E7ZA 5AQSB 2L9QA 3AVSA 2J1DG 3AA7B 3ONLC 3I9WA 4GKJT 3PJAA 4JI6T 4O8SA 2CLYB 5AQMB 5DQVA 2VQFT 4JV5T 4EEBA 3T8OA 3J7Yq 3AE1A 1OEDE 4Z90A 1W9RA 1HNZT 1W09A 1WR6A 4AQFA 4MALA 2V8SV 2VURA 3BQIA 4DV3T 3LK3B 5AQJB 1OWAA 4LF7T 5TAOA 3AAEB 4B6XA 2BDEA 3O1HA 4HGAA 2LM2A 4NPPA 3O4XE 3ONJA 3ESLA 1US7B 4YTNA 4CI2B 2XM2A 4JI5T 2E5VA 2JQHA 4IE5A 2IC9A 3ETVA 2N1GA 4U7IA 1OEDB 3SFDA 2EHOA 4B3ST 4J2CA 4AXPA 1Z0PA 2XAJB 2XHEB 4TV9E 4IDOA 4TNWA 3PUGA 3JC6C 3AA0B 3PUSA 3UU6A 5DJQC 4QX8B 2ODVA 4IE0A 4U3CA 4I4TE 4B3MT 1T8BA 2B76A 4KMCA 5FXVA 3ZJ2A 2Q9QC 3AEAA 4O2BE 2V1DB 4XAXB 2YN6A 4GK0E 3PUYF 5AQHB 4PJMA 4ZXLA 2YK0A 4U2YA 5FYMA 2XQ8A 4H9RC 2HN2A 3RIAA 1FMVA 4IREA 4AKIA 3PUVF 1YKEB 4K0UA 1R8IA 3ANWA 5HYAA 2DI4A 2YINA 3VKGA 2A72A 2Y6XA 2AXDS 2V5CA 1T7SA 1UK5A 2DNXA 2LHNA 2VASA 4G63A 4MHCA 2E9XC 4P0AA 4CXWA 2C5IT 4Z8XA 1CHUA 1U4QA 3RKOA 5J2TE 1HNXT 3DJBA 2PJQA 4ZS3A 3SWHA 2QGSA 2N9DA 2WMNA 3B13A 4LF5T 5IUXA 2LE8A 4EOZB 3RKGA 4AKLA 2X9YA 5AQRB 3IHRA 4U2ZA 1SHZC 2WS3A 3F2EA 2H7VC 3ZLIA 4LMJA 5JTGA 2UUCT 2JRKA 1UGOA 4U72A 3SOLA 2CLYC 2XQ6A 2WMOA 1H7CA 4ADZA 4CN6A 5FNVE 5EK4A 1XMQT 3RYFE 4UVBB 2OV9A 2D2SA 1LKXA 2Q9QD 3AAAB 4YXDA 1WYCA 4COFA 4KHZF 4WZXA 5JDMA 4HTEA 1WRDA 5L3DB 3VU7H 3ZKRA 5ABFB 2HPLA 2BBJA 3AEEA 3GWHA 4YT0A 2MYSA 4CXXA 2WU5A 2YU1A 1ZP0A 2VB6A 2JJ9A 4OHFA 2KLQA 2X67A 3ZSTA 1D0XA 1KF6A 2ZMAA 5KXJA 3N9OA 3RI5A 2X9XA 2BS3A 2W00A 3C64A 3RQUA 1S35A 2BKPA 2QVAA 4O4IE 4QXBB 3ZYMA 1OEDC 1XDPA 5LXTE 4UVCB 3UQ4A 3CVRA 2FJBA 3PUQA 4ZZBA 5L4HA 3RRWA 4X1YE 5FVKA 4MLKA 4AKHA 3P4WA 3PUAA 5DABA 1T98A 3Q5DA 2V6YB 3TLTA 4XZCA 4JUYA 3CWZB 3IA3A 4JI7T 3AE5A 3M65A 2KWHA 3N9MA 4CI3B 3UTKA 3Q5XA 4IHJE 1YW0A 4IE6A 5LNKA 4AKRB 2Y8DA 2UXXB 2W2UA 3BK9A 2WB5A 2EHOD 3RGLA 4QHOA 4UV8B 3LSVA 2VQET 2UUBT 1NEKA 4ILCA 2CMRA 1XWMA 2P9BA 3C50A 3OKQA 1HNWT 5FY1A 2XSBA 2E2AA 3O1JA 2D5UA 2A2FX 4AI6A 5KDMC 3AE9A 4DBRA 3RC3A 5HCMA 4JI2T 3CK6A 4JYAT 2BZBA 2ACZA 4AISA 2W63A 3E22E 4GIWA 5FMNA 3RRCA 2DLRA 2CXFA 4A97A 2PFVA 1BR0A 4LF9T 3JAEA 4LFBT 3Q2MA 4Z91A 3TLVA 3RC8A 4IDZA 2OLTA 5KMGP 3MA9A 3RX6A 4E7SA 5IWAT 5FXZA 4TUYE 3UFGA 4CXYA 5CA1E 5AQGB 3N5LA 4EZ4A 4A56A 3I0OA 2JQQA 5AQIB 4M1PA 4QWNB 1W0BA 3R84B 4UVAB 1WLXA 2J47A 1XZYA 2H88A 4ZEYA 3N9QA 4JI8T 4C91A 4HFVA 4PJNA 3UU3A 2QYWA 1BR4A 5J0ZA 2V26A 5ABGA 1Z8UA 4U7YA 2X0YA 2W61A 2WP9A 2WDRA 1HG2A 5CGMA 4DUZT 3ZSSA 1GQEA 3CQXC 4MFRA 2FUPA 3EI0A 1N36T 2JIWA 4QXHB 5EZYE 2CXDA 2WQYA 4DR2T 4JEUB 1B7TA 2WDVA 2PTFA 5AQQB 5JQGE 5HWXA 4YSYA 3OTOT 2BG9E 4YJ2E 1MNDA 5F8PA 4HFBA 4X1IE 4O4JE 3O9XA 5A1LA 3PJAJ 3QB5A 5CJ5A 1T72A 4BJNA 5LMUT 5FVLA 3UU8A 1HF8A 1E7PA 1S94A 3PUWF 2Q9QA 2QA7A 3OVUA 4L0RA 3ZC0A 4DNDA 3WAJA 1WCRA 3CQCB 4DVDA 1U5PA 1Y64B 5LP6E 2NW9A 3KV4A 2WY2A 2V7MA 2HPJA 5LBQB 3BQLA 3PTRB 2JMHA 4WYVA 3MKDA 5IYZE 5L3CB 3VHLA 2BG9B 3LBXA 3GN5B 1LVFA 3EABA 5C2TA 4ZI7E 4FI5A 1ZKEA 5FP3A 3R6NA 1E1HB 5LHIB 3O1IA 1WFDA 3K8PC 3ZCIA 2E9XA 4BJMA 1XNQT 3AEFA 2W62A 2ACXA 5LBMA 2IC6A 1YQ3A 2N2NA 1X9BA 4HKAA 3EVYA 2BBHA 2J62A 2WDQA 2ES0A 4Q25A 3UU4A 3EAMA 1N33T 3QK6A 1UX5A 3JADA 3UT5E 3VR8A 4EIWA 4QX7B 3KV6A 4HEAA 4UELA 4EZHA 4HWCA 3N2OA 3N2GE 4I0UA 3PU8A 3NZPA 5LYJE 3LFMA 4A98A 1X79A 1D1CA 4H9QC 4ISTA 3P4RA 4O4HE 3KDSE 4EV6A 3SRZA 2UXCT 2WBLA 4ILBA 4X1KE 2LSJA 4OFZA 5AQVB 3UULA 3E0ZA 5LJNA 3LK2B 3NKZA 2KINB 4LMKA 2E5LT 1MMNA 3FBZA 3HKCE 3FZFB 2L8KA 5LGUB 2V7LA 4HFIA 2CA5A 2NWBA 2M6BA 4OK0A 3FZKB 4UF0B 4H63V 3V5UA 2CWYA 2CXLA 4DR4T 2DL1A 4UIGA 2D0TA 3OPCA 1FJGT 1JNZA 3H3MA 2W67A 2NR4A 5HAXA 3KINB 5AQPB 3RIUC 4TZ4C 1HX1B 4TNVA 1OEDA 5L3BB 3NRYA 2K3WA 5KX5E 2VKDA 4OYKA 2I59A 3JAFA 1MMGA 3AE3A 1ZV4X 4ZI2C 5HXHA 3N9PA 3P4QA 2WWVA 3LG7A 5HEOA 2KMFA 3C98B 3FXDB 2FJEA 4PJJA 3QB5K 4IE4A 4IGUA 2GK9A 4BA9A 5HEJA 2LHRA 3MZKB 5ABHA 1I94T 3C4XA 4L9IA 2CE7A 2FBWA 4X66T 5JDHA 2K48A 3C4WA 3RYCE 3TLWA 2BG9C 4DO0A 2DWKA 1IAPA 3AXJB 2PBIA 3N9NA 5FXXA 3UUMA 5HCJA 1G73A 1WR0A 4I50E 2W66A 2WCAA 3KFWX 1FIOA 3JC6D 2LT3A 2XQ3A 1O3XA 1YQ4A 4EAHA 2NOXA 3AE6A 4DR7T 1YD8G 2LM9A 2LOPA 5L3GB 1D1AA 5AQOB 3ZC1A 2V5DA 4YJ3E 2LKGA 3N9LA 3QOFA 1V9DA 2CHNA 5HXRA 1MNEA 4TN7B 4WW0A 2FJDA 1XNRT 4YLHA 3RLFF 4HFDA 4V1Av 4H9PC 2CWOA 1SA0E 4DV6T 3MK7C 2V6XA 1MIVA 2FJAA 4LFAT 3ZCJA 5JVDE 5L3EB 2X0LB 3UQ7A 2E9XD 4CN4A 2I6HA 3FZHB 2BS4A 2NTXA 5LMNT 1XDOA 2NW8A 3P50A 2DHRA 3H37A 5ETWA 3T1HT 3CX8B 5ABFA 4PFOA 3KBTA 3GA8A 3F57A 4IL9A 4H9NC 2KXPB 4WBOA 3V5SA 2F4VT 4ZI3C 3P4SA 5AQUB 2LSGA 4PNIA 3PE0A 5LB7B 4EXTA 4DV7T 3GMIA 5J1GA 2W0GA 2A3DA 2C0SA 5AQLB 3CX7B 4CZZB 3CX6B 2CCQA 2IUBA 1KNPA 3TLSA 2UUAT 2CHOA 1D1BA 2WM9A 4QKNA 3L09A 2XZEA 1IBMT 3TKLB 4LMLA 4KHPT 5JRCB 1UUSA 4IDNA 4WNKA 5JREA 5L47A 4GYRA 2V6YA 2CPTA 2IDOB 2AE9A 3K3NA 2LKHA 3F31A 3K3OA 2SPCA 4KX6A 5JR9B 2XAQB 1D0YA 5AQKB 4HFHA 2LSKA 4IDPA 3LJCA 3AE7A 5ABEA 3QNUA 4LF4T 3ZMVB 1VCSA 3ZMSB 2HN1A 2ZM6T 2HHHT 1LVKA 1IBLT 5H6RB 1BR2A 3OJAA 4XBFB 4X5TA 4ZI3D 4WBNE 1QUUA 2M67A 3I0QA 4O4LE 5CB4E 4NUUA 4DR6T 3UU5A 2K5BB 3UFEA 2X66A 5FL1A 4KBMB 2DWGA 3RIFA 2KWIB 2WU2A 3VKHA 5EK2A 3ZEFB 2UXBT 2HH7A 2UU9T 5AQNB 4ANJA 3FZLB 3U3IA 2XQYA 4PJLA 4F6RC 2XUEA 4JI0T 3J9X1 2XQAA 5GONE 4GYSA 2C5JA 3AE2A 4G2AA 4KI0F 2YU2A 2LLYA 3L39A 3L8RA 2NTYA 1KEYA 2V7KA 5IHYA 2X9WA 4EYUA 2B1EA 2VVNA 3RYIE 4NXMT 3M3ZB 5JH7E 1HX8A 3EDUA 4P1NA 4AQYT 2KSRA 2IAKA 3AA6B 3KBUA 5M4YA 3ZYLA 1J5ET 5C3JA 2UXDT 4HN9A 3HA4A 4QH1A 5FY7A 3FHNA 4B3RT 4X20E 5H6QB 2BVMA 3LBXB 1I6ZA 1M62A 3PDYA 4U31A 4DR5T 3A5XA 4AIUA 3X1DA 2XY8B 3RIUA 4UEMA 5LJMA 3IF8B 3RHWA 4YSZA 3HI2A 1FMWA 5LGTB 1SE7A 3E08A 1XMOT 3PUXF 3D0TA 1NENA 4YSXA 3KVAA 2JMKA 3A8YC 4CI1B 5FY0A 2QRXA 1UCUA 2IW5B 4TWDA 3FXEB 2UXNB 2WZIA 3EUHA 3T1YT 4PK5A 1VCTA 3LDQB 1ZHCA 3S4UA 4TX5A 2V7IA 4UXNB 5JR9C 5L2LA 3CMLA 2DCFA 4PFPA 1MIWA 3UUBA 2BG9A 2H89A 4H9OC 3QUJA 3GN5A 4U33A 4PW8A 3P8CD 4ZOLE 4P0BA 3PURA 2EHOB 4HWDA 3ZN1B 1UURA 4JBWF 3EDVA 1HCIA 2XQ5A 3ONXA 4YHHT 4HFCA 4HWFA 1BR1A 3RPUA 2K9AA 5BMVE 1LRZA 2MAWA 4YTPA 2XAFB 4HWIB 3ZN0B 5L4EA 1SUMB 2BKOA 4YY3T 2MPKA 2XSAA 2ZM8A 2XAGB 1YXRA 2WSSV 5FXWA 5JDQA 4X62T 2X51A 1EZ3A 3HL6A 4LF8T 3UUXB 3PV0F 2X68A 4JLEA 3ANWB 2YKSA 4C90A 2VVSA 3W15B 3B5MA 2MTQA 3K1SA 5LHHB 2Y48B 4DIDB 5HXCA 2VK9A 5F3JA 1KK7A 3AEDA 4U74A 5F5WA 3KV9A 3NRXA 4FJOA 4L5GA 2VL8A 2XAHB 4A5XA 4H63H 2NP9A 4UF0A 5LA6E 3HR0A 3CKDA 5C8YE 2IIUA 4IDQA 4H9SE 4EEDA 4CQIA 2YDQA 4NXNT 4KP3C 3N2KE 4KUMB 4DUYT 2LSIA 1KNZA 3DP7A 2D9DA 4QH5A 5BR8T 2CBJA 2VWAA 4O2AE 3HKDE 4ASKA 4I43B 1N32T 5HXSA 2D0UA 1JNRA 2X0HA 4ISSA 2MOZA 4EB6E 4NIQA 2LSYA 2X9HA 3TLUA 4IE7A 2ZLYA 1AJ3A 1NWMX 3SFEA 5JDNA 1G8XA 2W4XA 2ZM2A 2WZHA 4AQFC 3HKEE 2YDRA 2I0MA 3OBVE 3RH3A 3C4ZA 5JDFA 4PK6A 5JDLA 4JI3T 1D0ZA 2E8IA 5JDGA 4GK5E 4N78D 2YOEA 1MIYA 3LK42 2LOSA 4JEHB 1E2AA 5AFUL 2XQ7A 1HFAA 4DV0T 3AXJA 5LCYA 4DV2T 3AAIA 3Q5WA 5CA0E 2VKHA 5LG4A 4QH4A 5HWYA 2G0UA 3PU3A 1MMDA 4DR1T 1IZNB 2EHOC 4ZI2D 4YHJA 4GOUA 5HEHA 4ILAA 4BAYB 3IBPA 1IBKT 2XQ4A 3PUZF 4HE8A 2JPFA 2L3LA 4DMVA 2RP4A 2XM1A 3ZMZB 4DMWA 3ZT6A 4DV5T 2PG8A 4UR9A 2YEVC 3AE8A 2BS2A 3NBXX 3ZT5A 3P7IA 1J5WA 4EYYR 2JQKA 2Z6EA 5HEUA 5DQWA 5E0OA 3AVRA 4TV8E 3FB2A 1DU2A 4ILUA 3DTOA 1NAFA 2LRKA 2LEHA 1VOMA 2BVLA 5EK3A 3KV5A 2VKOA 3NWIA 2BKNA 2VKJA
chains in the Genus database with same CATH topology
3RIUA 3RIUC 1J1JA 3QB5A 3AXJA 3QB5K 3PJAJ 3AXJB 3PJAA 4WYVA 2QVAA 2QRXA 1KEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIU A;  3RIU C;  1J1J A;  3QB5 A;  3AXJ A;  3QB5 K;  3PJA J;  3AXJ B;  3PJA A;  4WYV A;  2QVA A;  2QRX A;  1KEY A; 
#chains in the Genus database with same CATH topology
 1IJ6 A;  1ZEE A;  2MBG A;  3ZMU B;  3MJX A;  3K3Q C;  1CUN A;  2OA5 A;  5HXE A;  2XAS B;  4X65 T;  3AEC A;  3C51 A;  3Q5E A;  3WAK A;  3A7M A;  2ODU A;  3SS1 A;  3QC9 A;  1VRB A;  4OX9 T;  4JI4 T;  4DR3 T;  4ZHQ E;  4HWH A;  5J2U E;  3G06 A;  3NZQ A;  1N34 T;  5FKY A;  5LHG B;  3ZPO A;  1UX4 A;  4OYJ A;  4TWH A;  3VR9 A;  5LGN B;  4P09 A;  4YTM A;  1HS7 A;  1FEW A;  3Q9D A;  4JI1 T;  4PK4 A;  2XJ7 A;  2CM0 A;  3OYZ A;  1OXZ A;  3MAC A;  3AA1 B;  3ETU A;  3H3A A;  3AE4 A;  2IHR 1;  1HTJ F;  4LF6 T;  1HR0 T;  5JRC A;  2XQ9 A;  4DV4 T;  5FL0 A;  3MXZ A;  3RF1 A;  2C5K T;  3ZYK A;  5LG3 A;  3ZMT B;  1KNR A;  3I1A A;  3FBL A;  2LRL A;  3AEB A;  3BQK A;  5CFB A;  3NVO A;  5JR9 A;  5AQF B;  4DV1 T;  4MBQ A;  3ZJ1 A;  2KND A;  4K0K T;  2V7J A;  4YFS A;  3HKB E;  3AB3 B;  1YKH B;  3CQG B;  2CRB A;  3AEG A;  2LJL A;  4HFE A;  2YDS A;  4X64 T;  4PAG A;  4TWF A;  3OYX A;  4F8H A;  3JCF A;  3I9Y A;  4IIJ E;  2VL0 A;  2XPK A;  2J4G A;  3VRA A;  1L0V A;  1KFY A;  5L3F B;  2R6G F;  1HG5 A;  2RA1 A;  1J1J A;  3CIR A;  2Q9Q B;  3ZT7 A;  4B3T T;  2CBI A;  2A9U A;  2H7O A;  3RQW A;  4AQG A;  2IML A;  1Y01 A;  2CEA A;  1WYB A;  2H3R A;  5AQT B;  4DBQ A;  1QSD A;  1M7K A;  2ZM0 A;  3B57 A;  4NUV A;  4ZS2 A;  1W0A A;  4CN1 A;  4QXC B;  5LOV E;  4I55 E;  1IJ5 A;  4EGW A;  3EHZ A;  2M6I A;  2NW7 A;  2WWU A;  3RYH E;  2KZ7 B;  4IL4 A;  4ZZC A;  2WAU A;  2E9X B;  3U78 A;  3L3P A;  4LFC T;  1MMA A;  2JQ9 A;  2RPA A;  1ZOY A;  4ERR A;  2K24 A;  1QLB A;  3P4P A;  2KT9 A;  5HEG A;  4IT4 A;  3CPZ A;  3WI3 A;  3KVB A;  4AKG A;  5ADX L;  3UUN A;  2XTL A;  4UV9 B;  3VRB A;  4GKK T;  3FZM B;  3IEE A;  3ABV A;  4E7Z A;  5AQS B;  2L9Q A;  3AVS A;  2J1D G;  3AA7 B;  3ONL C;  3I9W A;  4GKJ T;  3PJA A;  4JI6 T;  4O8S A;  2CLY B;  5AQM B;  5DQV A;  2VQF T;  4JV5 T;  4EEB A;  3T8O A;  3J7Y q;  3AE1 A;  1OED E;  4Z90 A;  1W9R A;  1HNZ T;  1W09 A;  1WR6 A;  4AQF A;  4MAL A;  2V8S V;  2VUR A;  3BQI A;  4DV3 T;  3LK3 B;  5AQJ B;  1OWA A;  4LF7 T;  5TAO A;  3AAE B;  4B6X A;  2BDE A;  3O1H A;  4HGA A;  2LM2 A;  4NPP A;  3O4X E;  3ONJ A;  3ESL A;  1US7 B;  4YTN A;  4CI2 B;  2XM2 A;  4JI5 T;  2E5V A;  2JQH A;  4IE5 A;  2IC9 A;  3ETV A;  2N1G A;  4U7I A;  1OED B;  3SFD A;  2EHO A;  4B3S T;  4J2C A;  4AXP A;  1Z0P A;  2XAJ B;  2XHE B;  4TV9 E;  4IDO A;  4TNW A;  3PUG A;  3JC6 C;  3AA0 B;  3PUS A;  3UU6 A;  5DJQ C;  4QX8 B;  2ODV A;  4IE0 A;  4U3C A;  4I4T E;  4B3M T;  1T8B A;  2B76 A;  4KMC A;  5FXV A;  3ZJ2 A;  2Q9Q C;  3AEA A;  4O2B E;  2V1D B;  4XAX B;  2YN6 A;  4GK0 E;  3PUY F;  5AQH B;  4PJM A;  4ZXL A;  2YK0 A;  4U2Y A;  5FYM A;  2XQ8 A;  4H9R C;  2HN2 A;  3RIA A;  1FMV A;  4IRE A;  4AKI A;  3PUV F;  1YKE B;  4K0U A;  1R8I A;  3ANW A;  5HYA A;  2DI4 A;  2YIN A;  3VKG A;  2A72 A;  2Y6X A;  2AXD S;  2V5C A;  1T7S A;  1UK5 A;  2DNX A;  2LHN A;  2VAS A;  4G63 A;  4MHC A;  2E9X C;  4P0A A;  4CXW A;  2C5I T;  4Z8X A;  1CHU A;  1U4Q A;  3RKO A;  5J2T E;  1HNX T;  3DJB A;  2PJQ A;  4ZS3 A;  3SWH A;  2QGS A;  2N9D A;  2WMN A;  3B13 A;  4LF5 T;  5IUX A;  2LE8 A;  4EOZ B;  3RKG A;  4AKL A;  2X9Y A;  5AQR B;  3IHR A;  4U2Z A;  1SHZ C;  2WS3 A;  3F2E A;  2H7V C;  3ZLI A;  4LMJ A;  5JTG A;  2UUC T;  2JRK A;  1UGO A;  4U72 A;  3SOL A;  2CLY C;  2XQ6 A;  2WMO A;  1H7C A;  4ADZ A;  4CN6 A;  5FNV E;  5EK4 A;  1XMQ T;  3RYF E;  4UVB B;  2OV9 A;  2D2S A;  1LKX A;  2Q9Q D;  3AAA B;  4YXD A;  1WYC A;  4COF A;  4KHZ F;  4WZX A;  5JDM A;  4HTE A;  1WRD A;  5L3D B;  3VU7 H;  3ZKR A;  5ABF B;  2HPL A;  2BBJ A;  3AEE A;  3GWH A;  4YT0 A;  2MYS A;  4CXX A;  2WU5 A;  2YU1 A;  1ZP0 A;  2VB6 A;  2JJ9 A;  4OHF A;  2KLQ A;  2X67 A;  3ZST A;  1D0X A;  1KF6 A;  2ZMA A;  5KXJ A;  3N9O A;  3RI5 A;  2X9X A;  2BS3 A;  2W00 A;  3C64 A;  3RQU A;  1S35 A;  2BKP A;  2QVA A;  4O4I E;  4QXB B;  3ZYM A;  1OED C;  1XDP A;  5LXT E;  4UVC B;  3UQ4 A;  3CVR A;  2FJB A;  3PUQ A;  4ZZB A;  5L4H A;  3RRW A;  4X1Y E;  5FVK A;  4MLK A;  4AKH A;  3P4W A;  3PUA A;  5DAB A;  1T98 A;  3Q5D A;  2V6Y B;  3TLT A;  4XZC A;  4JUY A;  3CWZ B;  3IA3 A;  4JI7 T;  3AE5 A;  3M65 A;  2KWH A;  3N9M A;  4CI3 B;  3UTK A;  3Q5X A;  4IHJ E;  1YW0 A;  4IE6 A;  5LNK A;  4AKR B;  2Y8D A;  2UXX B;  2W2U A;  3BK9 A;  2WB5 A;  2EHO D;  3RGL A;  4QHO A;  4UV8 B;  3LSV A;  2VQE T;  2UUB T;  1NEK A;  4ILC A;  2CMR A;  1XWM A;  2P9B A;  3C50 A;  3OKQ A;  1HNW T;  5FY1 A;  2XSB A;  2E2A A;  3O1J A;  2D5U A;  2A2F X;  4AI6 A;  5KDM C;  3AE9 A;  4DBR A;  3RC3 A;  5HCM A;  4JI2 T;  3CK6 A;  4JYA T;  2BZB A;  2ACZ A;  4AIS A;  2W63 A;  3E22 E;  4GIW A;  5FMN A;  3RRC A;  2DLR A;  2CXF A;  4A97 A;  2PFV A;  1BR0 A;  4LF9 T;  3JAE A;  4LFB T;  3Q2M A;  4Z91 A;  3TLV A;  3RC8 A;  4IDZ A;  2OLT A;  5KMG P;  3MA9 A;  3RX6 A;  4E7S A;  5IWA T;  5FXZ A;  4TUY E;  3UFG A;  4CXY A;  5CA1 E;  5AQG B;  3N5L A;  4EZ4 A;  4A56 A;  3I0O A;  2JQQ A;  5AQI B;  4M1P A;  4QWN B;  1W0B A;  3R84 B;  4UVA B;  1WLX A;  2J47 A;  1XZY A;  2H88 A;  4ZEY A;  3N9Q A;  4JI8 T;  4C91 A;  4HFV A;  4PJN A;  3UU3 A;  2QYW A;  1BR4 A;  5J0Z A;  2V26 A;  5ABG A;  1Z8U A;  4U7Y A;  2X0Y A;  2W61 A;  2WP9 A;  2WDR A;  1HG2 A;  5CGM A;  4DUZ T;  3ZSS A;  1GQE A;  3CQX C;  4MFR A;  2FUP A;  3EI0 A;  1N36 T;  2JIW A;  4QXH B;  5EZY E;  2CXD A;  2WQY A;  4DR2 T;  4JEU B;  1B7T A;  2WDV A;  2PTF A;  5AQQ B;  5JQG E;  5HWX A;  4YSY A;  3OTO T;  2BG9 E;  4YJ2 E;  1MND A;  5F8P A;  4HFB A;  4X1I E;  4O4J E;  3O9X A;  5A1L A;  3PJA J;  3QB5 A;  5CJ5 A;  1T72 A;  4BJN A;  5LMU T;  5FVL A;  3UU8 A;  1HF8 A;  1E7P A;  1S94 A;  3PUW F;  2Q9Q A;  2QA7 A;  3OVU A;  4L0R A;  3ZC0 A;  4DND A;  3WAJ A;  1WCR A;  3CQC B;  4DVD A;  1U5P A;  1Y64 B;  5LP6 E;  2NW9 A;  3KV4 A;  2WY2 A;  2V7M A;  2HPJ A;  5LBQ B;  3BQL A;  3PTR B;  2JMH A;  4WYV A;  3MKD A;  5IYZ E;  5L3C B;  3VHL A;  2BG9 B;  3LBX A;  3GN5 B;  1LVF A;  3EAB A;  5C2T A;  4ZI7 E;  4FI5 A;  1ZKE A;  5FP3 A;  3R6N A;  1E1H B;  5LHI B;  3O1I A;  1WFD A;  3K8P C;  3ZCI A;  2E9X A;  4BJM A;  1XNQ T;  3AEF A;  2W62 A;  2ACX A;  5LBM A;  2IC6 A;  1YQ3 A;  2N2N A;  1X9B A;  4HKA A;  3EVY A;  2BBH A;  2J62 A;  2WDQ A;  2ES0 A;  4Q25 A;  3UU4 A;  3EAM A;  1N33 T;  3QK6 A;  1UX5 A;  3JAD A;  3UT5 E;  3VR8 A;  4EIW A;  4QX7 B;  3KV6 A;  4HEA A;  4UEL A;  4EZH A;  4HWC A;  3N2O A;  3N2G E;  4I0U A;  3PU8 A;  3NZP A;  5LYJ E;  3LFM A;  4A98 A;  1X79 A;  1D1C A;  4H9Q C;  4IST A;  3P4R A;  4O4H E;  3KDS E;  4EV6 A;  3SRZ A;  2UXC T;  2WBL A;  4ILB A;  4X1K E;  2LSJ A;  4OFZ A;  5AQV B;  3UUL A;  3E0Z A;  5LJN A;  3LK2 B;  3NKZ A;  2KIN B;  4LMK A;  2E5L T;  1MMN A;  3FBZ A;  3HKC E;  3FZF B;  2L8K A;  5LGU B;  2V7L A;  4HFI A;  2CA5 A;  2NWB A;  2M6B A;  4OK0 A;  3FZK B;  4UF0 B;  4H63 V;  3V5U A;  2CWY A;  2CXL A;  4DR4 T;  2DL1 A;  4UIG A;  2D0T A;  3OPC A;  1FJG T;  1JNZ A;  3H3M A;  2W67 A;  2NR4 A;  5HAX A;  3KIN B;  5AQP B;  3RIU C;  4TZ4 C;  1HX1 B;  4TNV A;  1OED A;  5L3B B;  3NRY A;  2K3W A;  5KX5 E;  2VKD A;  4OYK A;  2I59 A;  3JAF A;  1MMG A;  3AE3 A;  1ZV4 X;  4ZI2 C;  5HXH A;  3N9P A;  3P4Q A;  2WWV A;  3LG7 A;  5HEO A;  2KMF A;  3C98 B;  3FXD B;  2FJE A;  4PJJ A;  3QB5 K;  4IE4 A;  4IGU A;  2GK9 A;  4BA9 A;  5HEJ A;  2LHR A;  3MZK B;  5ABH A;  1I94 T;  3C4X A;  4L9I A;  2CE7 A;  2FBW A;  4X66 T;  5JDH A;  2K48 A;  3C4W A;  3RYC E;  3TLW A;  2BG9 C;  4DO0 A;  2DWK A;  1IAP A;  3AXJ B;  2PBI A;  3N9N A;  5FXX A;  3UUM A;  5HCJ A;  1G73 A;  1WR0 A;  4I50 E;  2W66 A;  2WCA A;  3KFW X;  1FIO A;  3JC6 D;  2LT3 A;  2XQ3 A;  1O3X A;  1YQ4 A;  4EAH A;  2NOX A;  3AE6 A;  4DR7 T;  1YD8 G;  2LM9 A;  2LOP A;  5L3G B;  1D1A A;  5AQO B;  3ZC1 A;  2V5D A;  4YJ3 E;  2LKG A;  3N9L A;  3QOF A;  1V9D A;  2CHN A;  5HXR A;  1MNE A;  4TN7 B;  4WW0 A;  2FJD A;  1XNR T;  4YLH A;  3RLF F;  4HFD A;  4V1A v;  4H9P C;  2CWO A;  1SA0 E;  4DV6 T;  3MK7 C;  2V6X A;  1MIV A;  2FJA A;  4LFA T;  3ZCJ A;  5JVD E;  5L3E B;  2X0L B;  3UQ7 A;  2E9X D;  4CN4 A;  2I6H A;  3FZH B;  2BS4 A;  2NTX A;  5LMN T;  1XDO A;  2NW8 A;  3P50 A;  2DHR A;  3H37 A;  5ETW A;  3T1H T;  3CX8 B;  5ABF A;  4PFO A;  3KBT A;  3GA8 A;  3F57 A;  4IL9 A;  4H9N C;  2KXP B;  4WBO A;  3V5S A;  2F4V T;  4ZI3 C;  3P4S A;  5AQU B;  2LSG A;  4PNI A;  3PE0 A;  5LB7 B;  4EXT A;  4DV7 T;  3GMI A;  5J1G A;  2W0G A;  2A3D A;  2C0S A;  5AQL B;  3CX7 B;  4CZZ B;  3CX6 B;  2CCQ A;  2IUB A;  1KNP A;  3TLS A;  2UUA T;  2CHO A;  1D1B A;  2WM9 A;  4QKN A;  3L09 A;  2XZE A;  1IBM T;  3TKL B;  4LML A;  4KHP T;  5JRC B;  1UUS A;  4IDN A;  4WNK A;  5JRE A;  5L47 A;  4GYR A;  2V6Y A;  2CPT A;  2IDO B;  2AE9 A;  3K3N A;  2LKH A;  3F31 A;  3K3O A;  2SPC A;  4KX6 A;  5JR9 B;  2XAQ B;  1D0Y A;  5AQK B;  4HFH A;  2LSK A;  4IDP A;  3LJC A;  3AE7 A;  5ABE A;  3QNU A;  4LF4 T;  3ZMV B;  1VCS A;  3ZMS B;  2HN1 A;  2ZM6 T;  2HHH T;  1LVK A;  1IBL T;  5H6R B;  1BR2 A;  3OJA A;  4XBF B;  4X5T A;  4ZI3 D;  4WBN E;  1QUU A;  2M67 A;  3I0Q A;  4O4L E;  5CB4 E;  4NUU A;  4DR6 T;  3UU5 A;  2K5B B;  3UFE A;  2X66 A;  5FL1 A;  4KBM B;  2DWG A;  3RIF A;  2KWI B;  2WU2 A;  3VKH A;  5EK2 A;  3ZEF B;  2UXB T;  2HH7 A;  2UU9 T;  5AQN B;  4ANJ A;  3FZL B;  3U3I A;  2XQY A;  4PJL A;  4F6R C;  2XUE A;  4JI0 T;  3J9X 1;  2XQA A;  5GON E;  4GYS A;  2C5J A;  3AE2 A;  4G2A A;  4KI0 F;  2YU2 A;  2LLY A;  3L39 A;  3L8R A;  2NTY A;  1KEY A;  2V7K A;  5IHY A;  2X9W A;  4EYU A;  2B1E A;  2VVN A;  3RYI E;  4NXM T;  3M3Z B;  5JH7 E;  1HX8 A;  3EDU A;  4P1N A;  4AQY T;  2KSR A;  2IAK A;  3AA6 B;  3KBU A;  5M4Y A;  3ZYL A;  1J5E T;  5C3J A;  2UXD T;  4HN9 A;  3HA4 A;  4QH1 A;  5FY7 A;  3FHN A;  4B3R T;  4X20 E;  5H6Q B;  2BVM A;  3LBX B;  1I6Z A;  1M62 A;  3PDY A;  4U31 A;  4DR5 T;  3A5X A;  4AIU A;  3X1D A;  2XY8 B;  3RIU A;  4UEM A;  5LJM A;  3IF8 B;  3RHW A;  4YSZ A;  3HI2 A;  1FMW A;  5LGT B;  1SE7 A;  3E08 A;  1XMO T;  3PUX F;  3D0T A;  1NEN A;  4YSX A;  3KVA A;  2JMK A;  3A8Y C;  4CI1 B;  5FY0 A;  2QRX A;  1UCU A;  2IW5 B;  4TWD A;  3FXE B;  2UXN B;  2WZI A;  3EUH A;  3T1Y T;  4PK5 A;  1VCT A;  3LDQ B;  1ZHC A;  3S4U A;  4TX5 A;  2V7I A;  4UXN B;  5JR9 C;  5L2L A;  3CML A;  2DCF A;  4PFP A;  1MIW A;  3UUB A;  2BG9 A;  2H89 A;  4H9O C;  3QUJ A;  3GN5 A;  4U33 A;  4PW8 A;  3P8C D;  4ZOL E;  4P0B A;  3PUR A;  2EHO B;  4HWD A;  3ZN1 B;  1UUR A;  4JBW F;  3EDV A;  1HCI A;  2XQ5 A;  3ONX A;  4YHH T;  4HFC A;  4HWF A;  1BR1 A;  3RPU A;  2K9A A;  5BMV E;  1LRZ A;  2MAW A;  4YTP A;  2XAF B;  4HWI B;  3ZN0 B;  5L4E A;  1SUM B;  2BKO A;  4YY3 T;  2MPK A;  2XSA A;  2ZM8 A;  2XAG B;  1YXR A;  2WSS V;  5FXW A;  5JDQ A;  4X62 T;  2X51 A;  1EZ3 A;  3HL6 A;  4LF8 T;  3UUX B;  3PV0 F;  2X68 A;  4JLE A;  3ANW B;  2YKS A;  4C90 A;  2VVS A;  3W15 B;  3B5M A;  2MTQ A;  3K1S A;  5LHH B;  2Y48 B;  4DID B;  5HXC A;  2VK9 A;  5F3J A;  1KK7 A;  3AED A;  4U74 A;  5F5W A;  3KV9 A;  3NRX A;  4FJO A;  4L5G A;  2VL8 A;  2XAH B;  4A5X A;  4H63 H;  2NP9 A;  4UF0 A;  5LA6 E;  3HR0 A;  3CKD A;  5C8Y E;  2IIU A;  4IDQ A;  4H9S E;  4EED A;  4CQI A;  2YDQ A;  4NXN T;  4KP3 C;  3N2K E;  4KUM B;  4DUY T;  2LSI A;  1KNZ A;  3DP7 A;  2D9D A;  4QH5 A;  5BR8 T;  2CBJ A;  2VWA A;  4O2A E;  3HKD E;  4ASK A;  4I43 B;  1N32 T;  5HXS A;  2D0U A;  1JNR A;  2X0H A;  4ISS A;  2MOZ A;  4EB6 E;  4NIQ A;  2LSY A;  2X9H A;  3TLU A;  4IE7 A;  2ZLY A;  1AJ3 A;  1NWM X;  3SFE A;  5JDN A;  1G8X A;  2W4X A;  2ZM2 A;  2WZH A;  4AQF C;  3HKE E;  2YDR A;  2I0M A;  3OBV E;  3RH3 A;  3C4Z A;  5JDF A;  4PK6 A;  5JDL A;  4JI3 T;  1D0Z A;  2E8I A;  5JDG A;  4GK5 E;  4N78 D;  2YOE A;  1MIY A;  3LK4 2;  2LOS A;  4JEH B;  1E2A A;  5AFU L;  2XQ7 A;  1HFA A;  4DV0 T;  3AXJ A;  5LCY A;  4DV2 T;  3AAI A;  3Q5W A;  5CA0 E;  2VKH A;  5LG4 A;  4QH4 A;  5HWY A;  2G0U A;  3PU3 A;  1MMD A;  4DR1 T;  1IZN B;  2EHO C;  4ZI2 D;  4YHJ A;  4GOU A;  5HEH A;  4ILA A;  4BAY B;  3IBP A;  1IBK T;  2XQ4 A;  3PUZ F;  4HE8 A;  2JPF A;  2L3L A;  4DMV A;  2RP4 A;  2XM1 A;  3ZMZ B;  4DMW A;  3ZT6 A;  4DV5 T;  2PG8 A;  4UR9 A;  2YEV C;  3AE8 A;  2BS2 A;  3NBX X;  3ZT5 A;  3P7I A;  1J5W A;  4EYY R;  2JQK A;  2Z6E A;  5HEU A;  5DQW A;  5E0O A;  3AVR A;  4TV8 E;  3FB2 A;  1DU2 A;  4ILU A;  3DTO A;  1NAF A;  2LRK A;  2LEH A;  1VOM A;  2BVL A;  5EK3 A;  3KV5 A;  2VKO A;  3NWI A;  2BKN A;  2VKJ A; 
#chains in the Genus database with same CATH homology
 3RIU A;  3RIU C;  1J1J A;  3QB5 A;  3AXJ A;  3QB5 K;  3PJA J;  3AXJ B;  3PJA A;  4WYV A;  2QVA A;  2QRX A;  1KEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...