2WWUA

Crystal structure of the catalytic domain of phd finger protein 8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
363
structure length
363
Chain Sequence
VKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD FINGER PROTEIN 8
publication title Crystal structure of the PHF8 Jumonji domain, an Nepsilon-methyl lysine demethylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 107
structure length 363
sequence length 363
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wwuA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2wwuA01
5FXWA 4GJZA 2VD7A 5F37A 4CSWA 5A7SA 3UYJA 5KR7A 4GD4A 4IGPA 3PUAA 4Y3OA 5FUNA 3DXTA 3K3OA 3PTRB 4QXCA 5A3WA 3PUQA 4QU1A 4Y4RA 5FZBA 5FYMA 2YBKA 2YPDA 3DXUA 4EYUA 5LY1A 5FZKA 5IVCA 5FZ8A 5FP7A 5LWBA 4GAZA 4XDPA 5FP3A 5E6HA 5FUPA 5FWEA 4LXLA 5F5CA 5IVFA 2WWJA 3PDQA 5FY9A 5K4LA 5FPLA 5FZDA 4CCJA 5LW9A 4QX7A 5FZ3A 4C8DA 4UF0A 5FPVA 3AL6A 4QWNA 5FY1A 4ASKA 5ISLA 4CCKA 3K2OA 5F3IA 4CCMA 5FWJA 3OPWA 4QXHA 2Q8DA 5A7WB 5FZIA 4IGQA 5IW0A 4AAPA 5FYUA 5FXXA 5FY0A 3K3NA 5IWFA 2YBPA 5FXZA 4D6RA 3KV4A 5IVEA 5FPUA 5FYIA 5FP9A 2PXJA 4V2VA 4TN7A 5F2SA 5IVVA 4LIUA 3KV5A 2OS2A 2XDVA 5FZ4A 5A7PA 4EZ4A 5FJHA 5FPBA 4CCOA 4URAA 3PUSA 4CCLA 3AVRA 3LDBA 2Q8CA 5FJKA 5IVYA 4QX8A 4GJYA 5FYTA 2XMLA 2GP3A 5F2WA 2OT7A 5A7WA 5FZ7A 2XXZA 5A3NA 5FZOB 3RVHA 4XDOA 3AL5A 2OQ7A 5FYYA 5FP4A 5FYHA 5FYSA 3U4SA 5A3TA 5FP8A 4AI9A 3LD8A 5FZLA 5FY8A 5FYBA 3PU8A 5FYVA 5FZGA 3PU3A 2YU2A 5FBJA 5FZ6A 4EZHA 5FY4A 3N9PA 5FZMA 4CCNA 4HONA 2OX0A 5A1FA 5A7QA 3OPTA 5F3GA 2XUEA 4E4HA 4QXBA 4V2WA 5FZCA 5F39A 5FZAA 2P5BA 5F5AA 5A7NA 4CUGA 5FZOA 2WWUA 2YU1A 3KVBA 5FV3A 5FY7A 2Q8EA 3U78A 4BXFA 3KV6A 3N9NA 3N9OA 5F32A 5ANQA 5FZ9A 3N9QA 4LITA 5A80A 2GP5A 5CEHA 5F5IA 4BISA 5FZFA 5FYZA 5FXVA 4BU2A 1VRBA 5FZ1A 3ZPOA 3NJYA 4NUBA 4D6QA 5FPAA 5F3EA 4LIVA 5IVJA 4Y33A 3ZLIA 2W2IA 4HOOA 2OQ6A 5A1LA 5IVBA 5A3PA 3N9LA 3PURA 2YBSA 4DIQA 5F3CA 5FZ0A 3KV9A 3KVAA 4IGOA 5FYCA 5LY2A 3N9MA 5FZEA 4D6SA 5FZHA 5FY5A 4DO0A 4UF0B 5A7OA 3AVSA
chains in the Genus database with same CATH superfamily
2VM9A 4IE4A 4YW2A 2OUJA 2CA5A 5AQVB 1F4AA 4FP2A 3RMYA 4ATFA 5DMYA 4YG3A 3ZC1A 4XIKA 5F5CA 3SCFA 1IBKT 3PIJA 4M4PA 3R6NA 1D1AA 4FBFA 1SHWB 1HTJF 2QQMA 4FI9A 2O14A 4ANJA 4FPJA 4DUXA 5HWXA 1HX6A 2OS2A 2K9ZA 5BNOA 3BQIA 3SHRA 2WSSV 3O14A 3PMSA 2ZKNA 1IS4A 4UI9L 3DTOA 2XVGA 2WZHA 3AP6A 1J58A 5A7QA 3KLSA 2E33A 3MV11 1FATA 3CWZB 4MGTA 4B4PA 2BG9A 5C8CA 4BCUA 2VMFA 1X79A 4RR3B 1AXKA 4Y1UA 2Z2SB 2DCJA 1GQHA 2WNVC 2ADDA 1HB4A 3BQKA 1W06A 4CDUC 2X5IB 5IUQA 3GZEA 4K0UA 3NV1A 3GJBA 1ASJ1 5K7PA 5LNKA 4EOZB 3P3PA 5L2LA 2LRKA 3ZOIA 4QXHA 5DZFA 4BK5A 2YZ4A 1NY72 5G05L 1T6GC 4LO6B 5FP9A 5ERLA 1F15A 3OJAA 1CAWA 5JR2A 2WWSA 3AA0B 2E53A 3KGZA 2XXZA 3WT3A 4GH4B 3KINB 1D2QA 4LUMA 4AEDA 3ZR5A 2DCZA 3ZYBA 3LD8A 5FYVA 5JUVA 1YFUA 2WLPA 4CP9A 2VK9A 4V2WA 1OQEA 4WV8A 4JGYC 5FY7A 3JU9A 2WU2A 4CQIA 2JWPA 2G9ZA 2I2SA 5C8YE 3DYMA 5JWPA 5FQ0B 3DKQA 1C8M3 4GWMA 2JMHA 1W9SA 1ND2C 1VPHA 1BHGA 4IGOA 1ND3A 4DXZA 5JI7A 4OUMA 1YIPA 1IHMA 4AG4A 4LTAA 3BOWA 2C9AA 4AQ2A 1WA4A 3C7FA 1IGOA 4COWA 4KNCA 4OHWA 1MS4A 2KR2A 1S0EA 4YTPA 2HPJA 4CI3B 2WZ8A 2VAUA 2Q4SA 3POIA 5EJZB 4QX8B 2D0UA 2RP4A 4LFAT 3CNAA 2XB6C 3OY8B 2D43A 2V7KA 3VD9A 4DRRA 3OBZA 1PM7A 2FDJA 3BOPA 4KH9A 4J6GA 1UURA 4GJYA 2XZEA 1ZA7A 1QJU1 5FYSA 2UUBT 1OOPC 3FUQA 4BXSV 2VL0A 4I4TE 2VULA 4I30A 3LOBA 3WOGA 2ACZA 4JI0T 4HONA 3MIBA 1XJAA 1SEFA 2VW0A 4A3XA 1NLSA 2WWVA 3RPUA 2VZ3A 3VU7H 5C3SA 4H9PC 5JRCB 2J1EA 3NJYA 3VR8A 1MQTC 4BQYA 1ACCA 3ZM8A 2XQ5A 1U5XA 2NLRA 2WFF3 4WYVA 2VD7A 4D69A 4GD4A 2UWAA 4RN5A 3PTRB 2OA5A 1NEKA 1MZ6A 4PHZA 1PVC3 3AEBA 4E4SA 4A4AA 4H9RC 4R52A 1NCQB 5FO9B 1K5MA 3POFA 1D4VB 1XE7A 2VQUA 1RUF3 4DV4T 1SPPA 3T08A 1W8ZA 3I9YA 3AVRA 1DYKA 4QXBB 5GLUA 4C1XA 5GZFA 2VVSA 5HPOA 3RG0A 4JRAA 1DBNA 1AJ3A 3AE3A 5FYBA 3VBRA 1OMIA 4NAOA 1LGCA 2K9AA 4COUA 4YYOA 3KWVA 3USUA 2WWUA 4XJ8A 2ILMA 3KFWX 4IEYA 2QYWA 4K9SA 5C70A 3NKTA 3MIGA 5E8AA 2OXBA 3JD73 2ZEWA 3Q8FA 2WFPA 2W2IA 2D6PA 4MBQA 1XRUA 1DQ5A 1D0YA 4K7JA 5EYYA 5A6QA 4CEYB 5LBQB 2XWJB 1QIQA 3OEBA 3KT7A 2YGMA 3ZYMA 3ACHA 4P00B 3DXUA 1XNAA 4KWLA 1NLQA 3GCXA 3KMHA 1LKXA 2HH9A 4I3GA 3ZMZB 4GKJT 2VQAA 2ZAAA 3WAJA 1S2KA 3V56A 3GZTB 3EMRA 1QJY2 4O65A 4LMFA 1OA2A 1LAJA 4QX3A 4IV1A 4Q4X2 1FYUA 5DG1A 4IIJE 2VNRA 4HK9A 3TB0A 4D7SA 2KLQA 3OUJA 5LA9A 1C8M1 3E5XA 3OUIA 4NIAA 2G0UA 2H6CA 4LHLA 5A1AA 4BQ5A 4ZS3A 2XAGB 1I3HA 3FHQA 1AXYA 3JC6C 1OH4A 4LHKA 3FL7A 2DTYA 4AF9A 3NZQA 1XYNA 2OPWA 4WM7A 3O5SA 3PE0A 4G63A 2XLGA 4CCEA 2DVFA 4CU6A 3IM0A 1W9RA 2QQOA 5L4HA 1ZRCA 1CQ9A 2EIGA 5A70A 2QJVA 1IZ3A 3THDA 1WCKA 4K0KT 3IPVA 2JE7A 1HDKA 2ODVA 4N9IA 4QPGB 5GLVA 5CKNA 2BNMA 1ENRA 1NA1B 5HWYA 1FPN2 4AGVA 5FZKA 3MIFA 3O1PA 4Y20A 3BCWA 1CJDA 1AR82 5DUXA 3MLLA 5AFUL 3VKLA 1HIXA 3ITQA 3AYEA 4S2FA 3ILRA 3O0VA 3POYA 1GOGA 4G9SB 2BZDA 1HF8A 5K9YA 3C8XA 3OCPA 5F2WA 3AEFA 4H9SE 4ZU5A 4CU7A 4DV5T 2W1UA 4HEAA 4IERA 2A70A 5F6LB 1HQLA 1D0XA 1H0BA 4RQPA 2OLTA 3VL8A 2QZ2A 2WFF1 3L2YA 4E7SA 2CXLA 1REFA 4NWVA 3VKNA 2V26A 3I4IA 1G6NA 2YDSA 1APNA 3ZPOA 2JQHA 1PVC1 1RUH2 4Q26A 4AFCA 3E22E 1AHSA 1WLDA 1UGOA 2XTLA 4LA3A 1JOPA 1I6ZA 4XW3A 2K5BB 2W47A 2OZJA 4CDQA 2KD7A 3SKVA 4O9GA 2BVBA 1RUF1 3BTAA 3USSA 1ZA4A 4MHUA 4P02B 2WA4A 3Q5XA 1SFYA 1O3XA 4DV7T 5A7WB 3FWEA 3OF1A 1QF3A 2XM2A 2RS33 4YVSB 5FAXA 1WYBA 1IBLT 4XIOA 5EK2A 3POSA 2ZACA 1ULCA 5BUVA 4P9IA 4XILA 1MZEA 3OJBA 2UU9T 3JD71 4UFHA 4I09A 2PFWA 3DPRC 2PHUA 2IUWA 2ZXQA 5FZMA 3OGVA 1BMV1 4X1KE 3OPCA 3ZT5A 2ZGPA 4EN9B 5KHGA 4LBKA 4AKHA 1K42A 5C2TA 3LFMA 4BOWA 3K1SA 4R4ZA 4AKGA 4XBQA 4GXLA 4MGSA 1QHDA 1ZZ6A 1LHVA 4JKKA 2EHOB 2J1UA 3N7MA 3T2QA 1HXS3 2GAUA 4Q0PA 1Y4WA 3ZXGA 4QX2A 1SLIA 2JDUA 5J48A 3H8OA 5BNNB 3A23A 4KGQA 5HCAA 3POBA 4L97A 1DYPA 2VGDA 4H9QC 1UZYA 4OYUA 3EJKA 3S7EA 5GM0A 2TNFA 5C9AB 2JG8A 2ZBJA 4QM9A 5BNQA 4HG6B 2BS3A 2MBGA 2K24A 1J1TA 3MIHA 2VQ0A 1AR62 4AWDA 3HWJA 4QQLA 3HBZA 1AX1A 2FDIA 3KF3A 3MK7C 4U7YA 3RPQA 1S2EA 3WHTA 3AE1A 3R6SA 4JCKA 1WLCA 4LEJA 5H6RB 1O7FA 1Q8PA 2Y60A 2X29A 3VBUB 4R9BA 4EWDA 3PTYA 1V6NA 4CYDA 1HNWT 3SRZA 4P9WA 4Q8LA 2EXHA 2VMGA 4UV9B 5FZ9A 3ZKRA 4RHV1 3LBXA 1H4HA 3TN93 1JXNA 5KXEA 3ELNA 4YJ3E 5B4NA 3N36A 5FBZA 4JC1A 2HWD3 4XUQA 3PDYA 4HETA 2ZMKA 4LHNA 2CXDA 4D6SA 2QQVA 3H3LA 1AR72 1DIWA 3PUVF 2J4GA 5J36A 2YGLA 1W2AX 2VVFA 3EHKA 4XFGA 5A3UA 2P9BA 5IFPA 4ILUA 2VC9A 3NAPA 1V6LA 5FYUA 5FY0A 2D40A 3PUXF 3MI8A 1ZM1A 2D44A 1OF4A 1MIYA 3MXZA 1HG2A 1AX2A 3R4DB 3VZJA 2IC9A 3D0TA 4Q4W3 4JHTA 1UQXA 3J8F3 2W63A 4AI0A 4QDRA 1FMWA 3AMMA 1OLME 3ZSSA 5CG8A 1ZOYA 5A3TA 3K3QC 2WT1A 3P1IA 3Q9DA 5E1RA 1YXWA 3LJCA 4O4HE 4NPMA 2HPLA 4X1YE 1H2LA 3SITA 5A33B 2Y0IA 3VDDC 1R1ZA 4CXWA 2H7VC 1R093 3VBSB 2GP5A 4D7YA 5FO8B 3FXDB 1JH5A 1WBLA 1G9DA 3GN5A 1YJKA 2OQ6A 4RFRB 4YM0A 5A3PA 2WNUB 2WM9A 4DMVA 4L11A 5EK4A 1V6MA 2RS31 5ETWA 4IDOA 4UF0B 4NXNT 5F37A 4AQTA 4JX0A 3T1YT 1MS9A 4TV8E 1BBT2 3EDUA 1RUNA 2QNKA 4JKLA 4FQZA 3AYDA 4TV9E 1BVP1 1PK6A 2H88A 3ZXJA 1UPSA 5IW0A 4YPJA 4YT0A 5L3CB 4YTMA 2LROA 4YLZA 4J1WA 2X9HA 4EZ4A 2M6BA 3OBRA 3LA2A 2GDFA 1RHI3 3CIRA 5ABJA 1NUKA 3EO6A 2IWGB 3POJA 1GBGA 4ZZ5A 2EAAA 4LQRA 2QUOA 5DDJ2 1OT5A 1HXS1 1FOD2 2EIEA 4K20A 4ZI7E 3PLQA 5FZAA 3T2PA 2R1DA 2O0OA 3ANWB 2ERFA 3MLKA 5IT6A 1SFPA 2PBIA 2G9GA 2IXLA 1IPSA 2QQIA 4DUWA 1DZQA 4UOJA 1NE6A 1VE0A 1Z7S3 5T5PA 3ZMNA 4U3CA 1QNYA 3ZXKA 3IIAA 2A71A 1WCQA 3NV4A 2QVAA 4O4LE 4ZEYA 5L47A 4YHJA 1C4RA 1JHNA 3I3DA 3CZJA 3TBDA 2DCFA 1LHNA 1ZNPA 3ZFEC 5GLWA 3PMEA 2I6HA 1SZBA 3V0AB 1EUUA 3V65A 1T7SA 3AZZA 4CDXC 2BRTA 4X6QB 2KMFA 4AQFA 3TN91 2LOPA 2AUYA 4IV3C 4ISRA 4DBRA 1MEC3 5D1IA 2HWD1 2VZ1A 4LA2A 4X6RB 2BS4A 2ZGKA 5LBFA 5JI9A 4YG0A 3RSJA 3S57A 2WO3A 1NZIA 5HEUA 2E32A 1AR92 2HYXA 4MV2A 2F4LA 4MHRA 1XWMA 2OV9A 2I45A 4Q4W1 3J8F1 4PF1A 2D6OX 1OXZA 4IT4A 1NXD1 4KP3C 3WDWA 3FBLA 1JUHA 2FMYA 1LVFA 5K8SA 2R6QA 1C5IA 1DLCA 1RVF3 1KS4A 2RMU2 5C6CA 5E0OA 3BKZA 2WO7A 1SBFA 3ETQA 3RYFE 1NOVA 2HWF3 4XFHA 3INAA 5CFDB 2N7GA 2B1EA 4PDWB 3O1VA 1KD7A 3OYWB 3ILNA 2YEVC 1R091 5JZGB 1RUJ2 2MYSA 1PIV2 4HFDA 3MO4A 3L3PA 3T0DA 2RS12 2HLEA 1XQNA 5FZGA 1DGRA 4A45A 1WW6A 3M3CA 2PYTA 3OD0A 3J7MA 1XDOA 1H8TC 3H0OA 2R32A 1H30A 2VNVA 2YU1A 4HFSA 3C4ZA 3AMNA 4AHXA 4LLOA 1UF2C 2ZM6T 2YKSA 3VKHA 5FR3A 5E88A 2A7AA 3RYIE 1B35C 3FC0A 4AQYT 1VCTA 3TNQA 2R073 3PUQA 5FYMA 1W8OA 3CU7A 2HKXA 4NIDA 1RHI1 2EIBA 1IBMT 2Y26A 3DN7A 5F8PA 1OEDA 2PAEA 3NWKA 1WMFA 2AZ5A 2QQUA 3O1UA 4RS5A 3QK6A 5FPBA 2VXJA 1UOBA 1ZBE2 4YRDA 1F9KA 3VKOA 3AL5A 3JQWA 1PGW2 3IEEA 5I0UA 5GZDA 4XJUA 3CX6B 1E7PA 2HWC2 2XPKA 5FZ6A 3ONLC 1GUIA 3TYJA 3AKTA 1X33A 4YFZA 2JDMA 1EZ3A 1Z7S1 3I3BA 1O3QA 1U5IA 1ZKEA 1V9DA 4RSUA 3W21A 4BXFA 2WDBA 3CBNA 3ZFFB 1MS8A 1MS0A 3WX5A 4NIQA 2ES3A 1UX4A 3VBFC 1N3OA 4JI1T 4YWAA 2V4AA 1BZWA 4DV2T 1COV2 3ALQA 1GZCA 4OX9T 5CFBA 2D2SA 1FMD2 3AMQA 5FVLA 4Q4Y2 2HWE3 3CQXC 4P9LA 2XONA 2XKPA 4IEPA 3ONXA 1CHUA 2VZOA 3JUUA 4JAAA 3AECA 3FHNA 2R062 2WQ8A 4BM8A 4TWTA 3QB5A 4M00A 1MEC1 1SBEA 3PVEA 3B9CA 2W1SA 1RMU3 5ABEA 4MSVA 1LENA 4IE7A 4K1ZA 5J98B 4BHPA 2SLIA 1BQPA 2P6CA 3MZKB 4B3ST 4KBBA 3E0ZA 5A7PA 3FZHB 4TWHA 1ZYBA 2WQZC 3LSDA 2NP0A 3C7EA 1BJQA 4NHYA 4UFIA 1LULA 4Q0QA 3AEAA 1H7CA 2WNVA 2PA7A 3UKTA 3MACA 5AQQB 3QNUA 1VBC3 5KXCA 1AVBA 1NLRA 3MDPA 1VRBA 4LBLA 3S7IA 1WMEA 3WF1A 2W67A 1RVF1 4PJLA 5LBMA 2GH8A 1E2AA 2RG4A 1UXXX 3K77A 4DY5A 4OI2A 4FVVA 5CADA 2HWF1 4TWFA 1PGSA 4DXRA 1VB2A 4N43B 2DCKA 2JE9A 5L4EA 4TN7B 2J1VA 3ZO0B 3ZN6B 2R16A 4GB32 3ZYLA 5FREA 3P50A 2M6IA 2JICA 2DWRA 1CAXA 2Y38A 4DR3T 3UETA 3WQ0A 3RX6A 3K4AA 3RYRA 3ETPA 1M7KA 4H14A 2P2KA 3O1JA 1LOAA 5BNOC 2VUCA 5FJKA 3SOLA 2YYOA 1GSLA 4JV5T 1D4M3 4QGNA 2BTVC 3POWA 5BYNA 2VWAA 3A7MA 2BNOA 1ND2A 4L2NA 1WR0A 3H42B 3JB8A 3ZFGB 4RL7A 1VBB3 3RRDA 2ZEZA 4BQ2A 2R071 4IW3A 1LRHA 3TOJA 5AC93 1XNQT 1QQP2 4K21A 5KDMC 4PW8A 2C1FA 4YM1A 4ET7A 3THPA 1BR4A 3VKFC 2RV9A 4DB5A 2PHTA 2XJQA 4ILAA 4OZXA 3LWCA 2O8QA 2BG9C 3U37A 2JG9A 4EGWA 4L0PA 4OYKA 4NN0A 5FZEA 2FDGA 4DV3T 2OPKA 1J3RA 1ZEEA 1LCLA 3ZSJA 5HCMA 5C8WA 2QQLA 3O7OA 5FUPA 1LOGA 2HBTA 2J42A 1ZBA3 5HBAA 4PIZA 1OOPA 3O1SA 3H3UA 2WZEA 1UMIA 3ZDVA 4X20E 4PF5A 2VZTA 2XKOA 4XZUG 4NPLA 2LJLA 2ZLYA 2JX9A 1VCSA 2CWSA 3H7YA 4W6WA 4AEDC 1QXRA 2D98A 1OFSA 2EA7A 3EAMA 5LJMA 4JI6T 1FMVA 4EZHA 5JDGA 4NHXA 1RUG3 2HWE1 5JIAA 4BA6A 2Z79A 3NKGA 2QA7A 3LK2B 3KVBA 3J26N 4CDUB 3UUMA 4ZOLE 4GKXA 4XF4A 1ALYA 3D4KA 3RQWA 3WF3A 3WG3A 3MBWA 2Z5WA 3VBOC 4Z8BA 4FFGA 4GKKT 4A44A 2BNNA 4CI1B 1RMU1 3POGA 5C3QA 3KHBA 4NUUA 3ZYPA 4UVCB 3IDAA 4BH9A 2B45X 1NT0A 1V9U2 1JYTA 2ZCWA 1YLLA 2X9XA 3RIFA 1UL9A 5FZ8A 5IVCA 3I0QA 4YSZA 1L7RA 1S4CA 3H8XA 5LW9A 1PMIA 2AACA 4QQHA 2LM9A 1W99A 5CKQA 4DR2T 5IWAT 2QQNA 2HJIA 1O8SA 3KQ4B 4Z07A 2VW2A 3M65A 1OA4A 1HN1A 2CWMA 4YM2A 4META 3HNMA 1VBC1 4JGYB 2R043 3UTKA 1PO13 3B5LB 1S55A 5FZOB 4KWJA 3I49A 4QM8A 4P09A 1N1YA 2HWB2 2CHNA 2V6YB 3V0BA 5FPZA 3C2UA 3OGGA 4NRPA 2XAHB 3QD6A 4CEWA 1W6QB 2Y0OA 1P8JA 4DMIA 4MXWB 2BKOA 4W6XA 1W6MB 2WYFA 4KX6A 3AXDA 4DMWA 4PK4A 2V6XA 1FIOA 3DUIA 5FCCA 2NW8A 3VZKA 5A1LA 5I8YA 3KVAA 4H63V 1UD1A 2QFEA 1WD3A 2XJSA 4NMIA 4GOUA 3I2DA 3S30A 4U2ZA 1OHFA 4P9GA 4JQRA 1XSRA 2FUPA 3ES4A 1JZ7A 4LE4A 3WNXA 1AF9A 2VQTA 1N33T 1D4M1 1IKPA 4XFBA 4QWNA 1CN1A 4XF3A 2VB6A 3ETUA 2XUMA 2RDSA 4XVHA 4IE6A 1HRV3 1K5MC 1JTZX 2LSIA 1VBB1 1VBE2 5AC91 1X9TA 1T72A 3TWIA 3TLTA 1UY4A 2GC1A 4Q5OA 3VHRA 1RXGA 1PVXA 4F8HA 2MOZA 3E1F1 4JTNA 4DUZT 4ORFA 4AGRA 5I93A 3ZYGA 5AQGB 1YI7A 1O3SA 4CPBA 2FDFA 3E5UA 1MQTB 1GV9A 3WNPA 3VBRC 5J2TE 4WVWA 2RS52 2R30A 2M67A 2ZM8A 4X8PA 3M3ZB 4MG2A 1W09A 1OURA 5C5UA 2VQFT 2E6VA 4AQSA 2ZMAA 2IXKA 1ZBA1 4QU2A 4UV8B 4L8QA 1YW0A 3F57A 1C3HA 4KQ7A 2VL4A 1DQ1A 3T2OA 2X68A 1Y01A 3JAEA 3TLSA 2E26A 1VBD3 5LY1A 3ZMSB 5BNPA 1JZ8A 1EUTA 3JXSA 3T1LA 1UMZA 2A6YA 4ASKA 4FJOA 2CLYC 4XXAA 1S0FA 2YOEA 1XBFA 3K4ZA 5FXXA 3H37A 3NRUA 1MVQA 1RUG1 3WF2A 1R082 4EEBA 1W0PA 3LIGA 3T09A 1H9WA 4P9XA 3JBG3 4PLOA 4IV1C 1A3KA 3T0BA 2OZ6A 1REEA 4MOAA 1RUE3 1NKGA 1C57A 3U4SA 1TEIA 2JKBA 5FZLA 2VR4A 4AFDA 2ACXA 5CG9A 3BB6A 5C3JA 4BQ1A 4XUPA 4I0AA 4Q4V3 2XOMA 1TNFA 2NN8A 2P1BA 1NQDA 3N7LA 5CIRA 3WSOA 3GHNA 5FYZA 1QXJA 2YINA 4AI6A 3AFGA 3H8UA 5BXXA 2WQYA 1N1TA 2ZGLA 4XPVA 3V0AA 1BKZA 3B93A 4YNIA 5KMGP 4RYDA 3I2IA 4MGZE 4YVWA 4AVVA 1PVC2 5AVAA 5JSPA 4OHFA 2ZGTA 3ZYJB 5DAQA 2R041 1UY2A 3W59A 1PO11 2XQ3A 2ZHNA 2JDHA 5LHHB 1RUF2 3UK9A 3BN6A 4DINB 4FPGA 3OPWA 1U5ZA 4S2HA 4U7IA 2OKXA 3ZN1B 2YDQA 3TLWA 3UU3A 4PBOA 4EAHA 2W61A 5HXVA 1W8NA 4A7YA 4BWOA 3WI3A 4PJMA 1D0ZA 2RM22 3NBXX 3AK0A 1T8BA 1POQA 3T4VA 3CQOA 5FP8A 2JJ9A 4LF4T 3UKNA 2DCTA 1NYWA 3PU3A 2KXPB 4AGGA 4RQPC 2BG9E 2DHRA 2XAQB 3I2GA 1YHFA 3O1TA 5A32A 2XJRA 5GZCA 3R84B 5C3PA 3ZCIA 2E7TA 1BMV2 4OLLA 2XBO2 3AA7B 4QQOA 2VZVA 5CFCA 2FDKA 1VBA3 3CJIA 3AC0A 5JXIA 3KM5A 3LFIA 2RPAA 1VRH3 3AB3B 1OXCA 4PLMA 1RUC2 4CDQC 1HRV1 1OLQA 4Y22A 2P3KA 4E2SA 4F8AA 3BIEA 3AXJA 1YKHB 4EN6B 2P3JA 4UT5A 4QB1A 5FKYA 3VBHC 2DUOA 3IBPA 1OPMA 5DQWA 4DR4T 4B6XA 2K48A 3AZXA 1UYZA 4N90A 4I0UA 4IDPA 4XCAA 3I3QA 1U5YA 2X67A 5K0UB 2BYVE 1JOJA 1Z8UA 2Q5TA 5T3NA 3CQCB 4LBQB 4UFKA 2VW1A 2WZR3 2MEV2 3SKJE 2JMKA 2FCVA 4DEVA 5FY4A 4DR6T 1GZ9A 3P4PA 1VBD1 4KU7A 1UZ0A 5EK3A 4ZZ8A 3HT1A 3UUXB 2YC2A 2NW7A 3KHCA 2WT2A 2CWOA 1UOGA 3PURA 1WMDA 1R1A2 4TWDA 5I8TA 4HFVA 4BIFA 1QJX3 2FDHA 1I1EA 1WBFA 4XQWA 3JBG1 4LFBT 3NL1A 5T5OA 4XBLA 1IS6A 3ZC0A 2WUHA 3N4MA 4GIWA 3VHOA 2P4EA 4AI2A 3U1XA 1GWMA 1RUE1 3IBMA 2JG8C 3MFAA 1D2SA 3MEPA 3DL3A 3DPRB 1DHKB 4J1XA 5FYIA 5IHRA 4Q4V1 4EQVA 5F2SA 1ULDA 2WO2A 3UGHA 3AAIA 3VDDA 1CONA 3LE0A 5J3UA 1M62A 2R6GF 2V7JA 2UXBT 3W5MA 3FXEB 5IJRA 2EICA 4HVOA 1IQDC 4QPIC 5CA0E 3KF5A 3I2JA 5L7OC 3CL1A 1H1IA 2XJUA 3DEMA 4ASMB 3NRXA 3W9AA 5AQRB 3KCXA 3IDEA 2UY8A 2A3XA 5JR9C 1W6OA 4TYSA 4ARXA 3D0SA 2FCUA 1UZWA 1AYM2 1URXA 1NCRC 1YI9A 3W5NA 5IHYA 5D8AC 4TNVA 4IL9A 3KQRA 2V5YA 4D94A 4Y5TA 2YPDA 3VN4A 1LESA 3CLPA 4QKFA 3MUY1 3H1YA 1Z0HA 1ENSA 3B5MA 3NAPC 4PT6A 1JYNA 2EAKA 5F5WA 4KG0A 3AP4A 1TVGA 3MF9A 4XUTA 4QH4A 1ULOA 4EYYR 2YXSA 2Q9QA 1KGYA 1DGLA 2BGPA 3D6EA 1N1VA 1QH6A 2PN5A 3UJOA 3ACLA 1H2MA 2YY1A 1ZZ9A 1A8MA 1VBA1 3ZEFB 1Y43B 1JZ5A 2ETEA 2JB4A 2W46A 3NV2A 4HPKB 1VRH1 4BJNA 1RUI2 3NJVA 5JPNB 4YTNA 1CIWA 1DQ4A 3C64A 1D0GA 2CY6A 1S0DA 3AFKA 4P5HA 2IC1A 2WRAA 3P4SA 1HB2A 3MUZ1 3GBFA 4DV0T 5LGTB 1RGSA 3HD8B 4XHBA 4Y26A 2J7MA 4CCDA 5AQUB 2H7OA 2W0GA 2CDOA 4U74A 1LOBA 1ULFA 2XHEB 3ZFEA 2A3DA 2BZBA 2DV9A 3WINE 2VCCA 5E6HA 4CDXA 1LU2A 4HXCA 2SPCA 2C24A 4YW1A 4YHHT 3RYPA 1KNZA 4NUVA 2WZR1 2FD8A 4AOCA 5DAXA 3PL0A 1G8XA 3J7NA 2NTXA 1N1SA 1XMOT 5DQVA 1EV13 4LMJA 1KITA 4RR3C 2A6XA 2Y6LA 1UOFA 3FB2A 1GANA 4HVQA 1UIKA 3OBAA 4AW7A 3NWIA 2IMLA 5ABFA 1QJX1 2WC2A 1JBCA 2LRLA 2E5VA 4YZ1A 4B7KA 3HQUA 4ES9A 5L73A 3UESA 3QUJA 1YNAA 3SH4A 4YG6A 4H7LA 3SH3A 5C7GA 5JAXA 4N53B 2Y6GA 5FY5A 1N36T 2JRKA 4UAPA 4XMAA 4GYRA 4AVTA 4GMP3 4GH4C 4DIDB 4OQ8A 2VMDA 1YQ5A 1W6NB 4UFJA 4B1LA 2ODUA 2F4PA 1MZFA 4FTEA 1A6CA 4A2UA 3BK9A 3GF6A 2PXJA 5EQUA 1H8TA 1X9PA 2ID4A 4OMCA 5JXJA 2F17A 4HSLA 3ZT6A 4FTSA 3QBQA 3BVCA 4E4ZA 3LGRA 4AQFC 1UYYA 1W0BA 4XHXA 1UN1A 5AQMB 5EJ1B 2KA3A 2D3PA 2PTMA 1W03A 5FZCA 1B35A 5FMOS 2VOWA 1YXRA 2LHRA 4UIGA 3QB5K 5EIYB 5DZGA 5F5IA 4BISA 3UT5E 2RR12 3WNNA 5LCYA 5LJNA 2OUHA 4CCCA 4COZA 1GZWA 1B7TA 4HN0A 1AX0A 4JDNA 5LY2A 2X09A 2CXFA 2BKPA 1CAVB 1ULEA 3SMHA 3P8CD 3LAGA 2RA1A 1KK7A 4YGCA 4QPWA 1IAPA 2PHDA 2PHRA 3FZMB 1POV3 3HIFA 4OHZA 4C0HA 4UVBB 3BIWE 5ABHA 4NR1A 2VZSA 5LATA 4PFOA 4AKLA 1AYN2 2Q8DA 3RZJA 4IV3B 3NZPA 3J7HA 4FT8A 3O1OA 2Z42A 1DZRA 4YSFA 2C5KT 4ZI2D 3MICA 1NY71 2VZRA 4YW3A 4MGKE 2ZHKA 4COYA 1LU1A 3WNLA 2Z69A 4OI1A 1KEYA 4A98A 4EV0A 5H9RA 3AYAA 5EHDA 2ZGUA 3RZMA 4IGUA 2JDPA 3NQHA 1QMJA 1AJKA 1DG6A 1QJY3 2E9XA 5GLZA 3EI0A 2X51A 4A6SA 4Q4X3 1U4QA 1XU1A 4ILCA 3ILFA 4LIVA 5GONE 2CHHA 1LOEA 2C5JA 4PFPA 3S0MA 2E7QA 1GICA 5FZ0A 1S0IA 5CU1A 1WMXA 2E2AA 2FCTA 2F4VT 4M1PA 4EJRA 1LTEA 2L3LA 2NWBA 1EV11 1UAIA 5LA1A 1CAUA 1OQ1A 5FZBA 4NIIA 1O59A 2VJXA 1UNBA 1Y9MA 2UXCT 4ADZA 2V5DA 4QX7A 3CJXA 4EE2A 5J37A 3JCIA 5FTTC 2Q9QD 1BR1A 3LDQB 5FZIA 3QH7A 4PQQA 2B5HA 1F5JA 5EYXA 4AFBA 2SBAA 1OBNA 3RKOA 4AI1A 4U72A 2VPVA 5JH7E 4B1MA 1FPN3 1QOTA 4CEYC 3HNBM 5FLIA 3HI2A 3QLQA 2A2FX 2GK9A 2XQRA 3B57A 1AR83 1XNDA 2V73A 4GMP1 2R0FA 1YWKA 3P7IA 4DV6T 2Y48B 3C50A 3TEZA 3LEGA 3LB9A 5I0SA 3N9OA 1Q8SA 1LKNA 3I59B 4C1WA 2UURA 2W92A 1H2KA 2HEVF 1WD4A 3H1MA 3U3IA 3LKJA 3OB8A 3OKQA 5GKAC 3CF6E 3LEKA 1CD3G 3RYCE 2C26A 2BWAA 3Q8CA 3ZMUB 1TQ5A 3K51A 3TEWA 2Q1ZB 2K0GA 4Z2WA 4K6BA 1LOCA 1L7LA 2R1BA 4AZZA 4I3PA 3TLVA 4C8DA 3HN1A 5DUVA 1YQ2A 2LSJA 2XJPA 3T4HB 3MW3A 2VECA 3I1AA 1DU3D 1RUH3 5LG3A 5F6KA 4Q0UA 5IVVA 4JLEA 4LIUA 1SMVA 4E8DA 1C1FA 1UZZA 4IEVA 4C90A 3E08A 3ZIWA 1PNGA 2X53S 2GNDA 3T0AA 3VR9A 3VBFB 4OI0A 3FHAA 1NA1C 3MHZA 3J4UH 4YZ5A 1YIFA 2XJ7A 2BW8A 4YW4A 5IK8A 2DBIA 3RLFF 2J22A 1O8PA 5LBEA 5LZ6A 4JGZB 4BU2A 1QLBA 1DQ6A 1POV1 1Y9QA 1T98A 2JKXA 1SA0E 2R072 1US7B 4R4XA 1SCRA 3I8TA 4M0NA 1FV2A 3ZVXA 3AVSA 1W6PB 4GJZA 2GMPA 1FV3A 3IB3A 2LM2A 4XE9A 4UW3A 1RINA 4XJ9A 3WXPA 3NNGA 3PDQA 1LJ7A 4MX3A 1N47A 1W28A 2B4KA 3ZT7A 1UO9A 2IZWA 4EB6E 3I3MA 2V7LA 4HE8A 3U4XA 3EYPA 2XQ7A 1QJY1 2A3YA 4AVAA 3IF8B 4XZPA 2UYBA 4Q4X1 3AXEA 4AHWA 4LO7A 1W9TA 4XXPA 4CDWB 1VR3A 3HN3A 3VBOA 4NRQA 4DEQA 2I74A 3FBYA 2N1GA 3OGRA 5A1FA 1VIWB 4MYEA 2ZEXA 2XUEA 2IHR1 3I0OA 2P3IA 2CDPA 2PAMA 5GALA 1S0GA 5CYYA 5L3DB 3JCFA 1JW6A 3MFCA 3BU7A 4S2GA 4O9EA 4A3ZA 4IEXA 1ENQA 2JG9C 2PQQA 5HXRA 1WR6A 3OTOT 1HX8A 2L9LA 2FZ1A 1WRDA 3AZYA 3D5OA 3HVDA 2YMZA 4YW7A 4AI3A 5LWBA 4GKYA 1G7YA 5LHGB 2AH2A 5BNOB 2GMEA 4ZZBA 1FPN1 3VZNA 2RJLA 5LGUB 4BMBA 4CCKA 3RZGA 3AB0A 3NW4A 4QB6A 4UW6A 1AR81 5J1XA 4UVAB 1NWMX 4XZCA 1JHJA 4JDOA 1HKDA 3PUSA 3AE5A 3BTXA 4QH1A 1CESA 2VBBA 3RQUA 1AR73 5BNNC 3RJRA 4JI7T 1PZ9A 4AK3A 5C4WA 2DI4A 4XJZA 1KJLA 2E9XD 4HTEA 1VBC2 3WUDA 1S35A 2BG9B 2OX0A 4P9YA 5C8CB 4ZPIA 5J09A 2WO1A 4CRQA 1RJ7A 5HXSA 3AE8A 1MMGA 2VMHA 1KDKA 2UXDT 1BEV2 3T30A 1MZ5A 1EAH3 3MW2A 2ZHMA 3UQ4A 1JU3A 3PUGA 3BPSA 5IYYA 3RZLA 2JD4A 4XBNA 3IIIA 4DR5T 2HN2A 1RUH1 2VBPA 2ZJCA 4ZXEA 4Y1XA 4I55E 4KHZF 2AXDS 3LCPA 4A97A 5FLHA 1O3RA 4QXCA 1IQAA 5G04L 1V6KA 2XJTA 1MMNA 4LMKA 3RYKA 2E9QA 5FPLA 3ZKYA 4PI2A 1CAWB 3A7QA 4AXOA 4IUGA 1EP0A 1AUYA 1HNZT 4EROA 1JZ2A 5GJ6A 4AEDB 2LTNA 3AJYA 3A5XA 3WDUA 4UBGA 1YQ4A 5FJHA 3H8RA 4HLTA 4CP9B 2WU5A 5L19A 1GWKA 2Z6EA 5FZ7A 1QDOA 4FXKB 1HN0A 4DBQA 1BBT3 2YC0A 4NAMA 3GHMA 3M3QA 5JDNA 4SLIA 5LEJA 5KWRA 2A73B 2NMOA 4QT6A 4FTBA 1W8HA 3VZOA 5F3GA 1AL22 1IG3A 2ZTNA 3C51A 3RRCA 3HA4A 1ND3B 4GQ7A 4CEWC 2DU0A 5IK5A 5ACA2 3VUOA 1PMHX 2WZIA 5L9RA 4X64T 4BK4A 1FNYA 3ZLIA 3VD4A 2CNAA 4FPEA 2LSGA 2YN6A 4JHZA 4PJNA 5AFBA 1SLLA 4TZDA 1F2NA 5DDJ3 4HKAA 2BFUS 2PTFA 1FOD3 2B39A 5LRRA 2YFUA 2D5HA 3X29B 1LNSA 1OEDE 5AVPA 5JIUA 1UX7A 4QXKA 1SFNA 4UW4A 5EZYE 4CCJA 4KBZA 5FZ3A 3N5LA 3DCQA 1LB2A 2DVAA 2MPKA 2WAOA 1OH3A 3IDBB 5KX5E 4AHYA 5JVVA 4EN0A 4IE0A 3CVRA 1HNXT 3I54A 3I97A 3RYHE 1KF6A 1RITA 3WDTA 4YY3T 2BGOA 5JDHA 2C0ZA 3WP4A 2D0TA 2WDQA 5IK7A 2B76A 5T50A 1H2NA 2LOSA 4LUKA 4XETA 4PJJA 4RHV3 2XAJB 2YBSA 2CAUA 1BLZA 4WVMA 1MNEA 5JDFA 4RA0A 2ADEA 4WM8A 4CUAA 2XPJA 2MNGA 4HBNA 1O5LA 4MFRA 1E5SA 3Q8AA 5JXHA 1ZV4X 5CBLA 3L2HA 2IXHA 1K5MB 1W39A 2HEYF 3H50A 3Q5WA 1LODA 1GR3A 1W8TA 1AR71 1SPPB 2HBUA 5BNPC 3IWZA 2NM1A 3I2FA 1N34T 4NXMT 3AL6A 1UXZA 2VCMA 5LXTE 2CTVA 2R042 4IL4A 3KV4A 1PNFA 1H8VA 1AR93 4TLGA 5FMDA 2UYAA 3Q2MA 3J7LA 3VBRB 3BALA 3HOBA 1F5FA 2W08A 1OQDA 1HRI2 1LOFA 2PG8A 4N9HA 4R9DA 5DUWA 1MS3A 5H9SA 1EAH1 3USUB 5A3NA 4NOTA 2JENA 1WGPA 5B2GB 1C1LA 3AP7A 5ABGA 1HS7A 2XL9A 3RIUA 4XOGA 2RMU3 4FO9A 1WYCA 5I0TA 3VD7A 4Y24A 3LA3A 2RVAA 4LBNA 5KBFA 4LK6A 4I0BA 1XC6A 2KWIB 4OQ9A 1BCXA 1RUJ3 3WW1A 5FPXA 1PIV3 5JSRA 3PJYA 1K45A 3VBHA 3P4WA 4JZRA 2Y6HA 5A7OA 2RS13 3WW3A 1IJ5A 4YVWC 3PUYF 3F2ZA 1KDMA 4MGIE 5AQFB 1PHMA 5FVKA 2BJSA 4MALA 2ZZQA 2YBKA 2AYHA 2BP6A 4IV1B 5AQLB 4F7ZA 3SFDA 1W90A 3RKGA 1U12A 2XH6A 1BBT1 1HV0A 2B8MA 5FY1A 4XQ4A 1VAVA 3WNMA 3HKDE 4WW0A 2VKDA 1UKRA 5EJ3A 2CL2A 3KCYA 1C28A 3CMGA 1L7QA 4TUYE 3LDRA 2LT3A 5HCFA 4AEKA 1LEDA 5L9VA 4LO4B 2GNTA 3CPZA 4BQWA 4JTOA 4PIYA 4WM7B 3NNJA 3KB5A 4AYUA 2EVXA 2MPFA 1SLCA 2BBAA 3W58A 2TBVA 1K3IA 3O12A 1JI6A 1JYIA 3OPZA 5DG2A 1JNRA 5DDJ1 3EXUA 2JPFA 1FOD1 2KINB 3IPVB 1QOSA 5KXBA 2J1AA 1CX4A 3JQXA 4URTA 1VMJA 2JDNA 1CIYA 4DNDA 3S6PA 3RS6A 1H9PA 4U36A 5CFCC 2QZ3A 1KS5A 4PDWC 3CJIC 3TRSB 2DBNA 4Q8KA 5JZGC 3UUNA 4HFHA 3I9WA 2HWC3 4BIOA 1RTVA 3PUAA 4R9AA 4Y4RA 3WR0A 3O9XA 5AQJB 3MLJA 4XFCA 4QDSA 2EALA 4BQ3A 5EXOA 2JQ9A 3HEIA 4QAWA 3B13A 5AQOB 1COV3 2VUJA 1GNYA 4DY3A 2G1MA 4RQPB 5FZ4A 4QPIA 1FMD3 1PGL2 4FOYA 5L7OA 4U31A 3T1MA 5JSOA 3CKHA 4W8JA 3ECQA 4WVZA 3AE7A 2XJVA 3R4UA 5JR9A 4Z90A 2IXCA 4AXPA 4IL7A 2D6LX 2R063 1D1BA 4FPHA 3IA3A 3AAEB 2J1SA 1KEXA 1NCRA 1QWRA 4XQDA 2CM0A 1GWLA 2WS93 3ZXAC 4UELA 5D8AA 4CDQB 1DU2A 2FJBA 1TMF2 2W3JA 4ZU4A 3E6DA 1B09A 4JKMA 3U10A 2X05A 3AKPA 3AE4A 4M3CA 4B4RA 3SWHA 4XTMA 2PLV2 1S94A 4A6OA 1AR91 5FXWA 5LMUT 3TEXA 5F3JA 5CISA 2N2NA 3RZKA 3HKCE 2E8IA 4CZSA 1RC6A 1XMQT 2LSYA 1PO22 3A0NA 5FWJA 4XCBA 4HSJA 3ZFFC 2IVIB 3I59A 4BQXA 1EY2A 2BUKA 3BTZA 1SQ4A 2RMU1 3IZOA 4KUMB 1JYXA 4OHVA 3P6BA 2Q8CA 4L9BA 2D97A 4BLIA 4OUEA 2OQ7A 1MS1A 4DRVA 3DJBA 4MH0E 5A6YA 3ZMVB 1J84A 1RUJ1 4ZI2C 4XAXB 1PIV1 2BU9A 4DV1T 4GB33 1O6UA 3RC3A 4J25A 2RS11 3N2OA 2P6HA 1X9BA 3ACGA 3E6CC 4E8CA 2W0XA 3MPPG 2G4IA 1GZTA 4LITA 1BYHA 1VRH2 1C8NA 1YYNA 3UULA 3QACA 3SLIA 5IVJA 1N3PA 2QQKA 4I0WB 3WQBA 4OK0A 4KU8A 3VLBB 2JG8B 3O1RA 2VUAA 4F6RC 3GBGA 2XSAA 3ABZA 2JDKA 3WUCA 5CVRA 2A6ZA 2XSBA 3HQRA 4MLOA 3UNPA 1J3QA 2A72A 2J47A 3GBWA 1MIWA 4RR3A 3ESLA 2BGCA 5LK5A 2CGPA 1VP6A 1HJGA 1QQP3 3ROUA 2WT0A 2IIUA 3JADA 2X5IA 2W94A 4DOUA 3ZXDA 3P4RA 2CPTA 4LF7T 1WW4A 2XASB 2Q9QC 1CJPA 1Y7BA 2Q1MA 3N3HA 2P3YA 1X8MA 3H9AA 1HJFA 3OSDA 3LBXB 1W9WA 1DP0A 4GWNA 1PGW1 4N43C 2HWC1 3V5UA 3PUWF 5AQPB 4CA9A 1N32T 2CGNA 4GH4A 2VU9A 1ULGA 1A8DA 2JQQA 2Z4FA 5FXVA 2ZMNA 3AKRA 1O91A 4HFEA 1RYYA 1XYPA 5B4XA 1COV1 3C4WA 3NMBA 3NAPB 2DVDA 4INDA 5L36A 1RUD2 5FQ0A 1FMD1 1GKBA 4QU1A 1DQ2A 4X65T 3OEAA 2FBEA 5H9PA 4FI5A 1ZZBA 2GNBA 4R8HA 1SLAA 3ZFGC 5C5TA 2GC3A 2R061 1YD8G 2W4XA 2R49A 5GZGA 2NOXA 4H9NC 4CTEA 2WJSA 2WS91 4QQPA 1F8VA 3GDBA 4CCLA 5AQKB 1LHOA 4QX8A 1Q8QA 2NPIA 4EV6A 5DAVA 4GWJA 3HNYM 1V9U3 1UMHA 3OY8A 2PQSA 3FE5A 2QDRA 4B7EA 2VBDA 2JIGA 3TAYA 4JI5T 4YGBA 4PAGA 1DZTA 4BDVB 4E2GA 4ZY9A 1XB9A 4DFSA 4H55A 1WFDA 1CGPA 1JUIA 4LHSA 1UX6A 3GN5B 3OPTA 5JTGA 2D7FA 4CUGA 4XTPA 4JVAA 3OGJA 1UIJA 2YHJA 4OZOA 1LGBA 3FHIB 3J9SA 3KS7A 3HKEE 2X8KA 5FO7B 1OUXA 2C0SA 1K12A 5IK4A 4GALA 1LR5A 1PK6B 2HWB3 5JRCA 3DXTA 3SEPA 1UU6A 4KGGA 4M0HA 2PELA 3RF1A 5E16A 4PBPA 3LDKA 3RWNA 2VTXJ 2UY9A 1JZ6A 5FP3A 1V00A 1OD3A 2C6SA 4AFAA 3QH6A 2P34A 4OYJA 5LA0A 3N2KE 2Y8DA 4YFWA 4GB31 2QQPA 3ZYRA 5ABJB 4LF9T 4V2VA 2KSRA 3KBTA 3WDYA 4H2AA 3RZHA 4BMEA 3WP6A 1WA6X 2CEAA 4DS0A 5LB6A 2LUWA 1NCQA 3VGIA 3GYDA 2NYYA 4JI4T 4EIWA 3CK6A 4FOVA 2W1WA 2P37A 4DVDA 4QXBA 2IXIA 4NVPA 1XNRT 3LA7A 3ZMTB 5BPXA 1TME2 2W1QA 3F95A 1VBE3 1KQRA 3OOXA 1QQP1 3UU5A 5L3FB 2JECA 4CXYA 2BOJA 2GN3A 2K46A 2VVDA 5DXDA 4QHBA 1AJOA 4DO0A 3VKMA 5KXJA 3Q9OA 2WNOA 4XMIA 5KHKA 5A3LA 4XF0A 1ST8A 2CE7A 2RS53 3THTA 2BWCA 4YSXA 5FWEA 3ORJA 2BBJA 4LXLA 4WZXA 5HXEA 2AE9A 1PX3A 4LO5B 1EV12 4FXGB 4CEYA 3PVNA 1UYXA 1E5HA 4I2OA 3ZSEA 4OMDA 4HKWA 2XQ8A 2JIJA 1S0JA 3NRYA 2XGXA 3GMIA 2HHHT 1MMAA 5HCJA 4BAYB 2LRPA 1G9AA 1SLTA 4XURA 5KC5A 2PHWA 2BVVA 3THCA 3T8OA 5A3OA 3RHWA 4AI9A 4QDQA 3UU8A 2FJEA 3UL2A 3ZJ1A 4JEUB 4NE9A 3Q8EA 2ENRA 3LPFA 3KSCA 4K8FA 1VAMA 4YJ2E 4CU9A 1W0OA 1IPKA 3AEDA 3C4XA 1R083 5F32A 2VMIA 2E9XC 4AE2A 2KT9A 3LG7A 4A56A 3M3IA 3LEIA 4CVUA 2ZGNA 2LM3A 2LLYA 1ZZCA 3ACIA 2QQJA 3WEZA 5M4YA 1YQ3A 2DVGA 4M01A 3N2GE 1OC1A 2VKHA 1MPXA 1QDCA 1V9U1 4QX5A 2ZGSA 2BDRA 4LNVA 2BBHA 5TSWA 4QPGA 1NQJA 2D93A 1NA1A 4G2AA 2VTXA 4O8SA 4A5XA 5FPUA 2E63A 3LEMA 3MZHA 4LO8A 4TLFA 4ATEA 4EN7B 3UT0A 3O0XA 3F2EA 3FZLB 2K2SA 4HWIB 3HL6A 2QTWB 4NHKA 1W2TA 4X8NA 3JB4C 2HWB1 2Y6XA 4C0BA 5LA6E 2NQYA 1DGWA 3I3EA 5A80A 4HN1A 5C3OA 4Y5SA 2ZOEB 1GOHA 3LSEA 1HB1A 2RM23 2A6WA 1W0NA 1L3JA 1RL3A 2DTWA 5FZHA 1IJ6A 5EP9A 1YRZA 1XXNA 1ASJ2 2WYSA 2BVMA 4WBNE 1UK5A 4HL0A 5LBBA 1OEDB 2GN7A 5JQGE 3ZYIB 3ZJ2A 4O2AE 2JDAA 4XF1A 4IEZA 4RS5B 5LGNB 2WP9A 1KNPA 4B8EA 5DN2A 2XBO3 3NSTA 2AC1A 3L39A 2Y6KA 1HX1B 1WWYA 3EBRA 3N7JA 4ASLA 3KBUA 1WCDJ 2A6VA 4QQ2A 5LRSA 2DFBA 4Q0SA 1RUC3 5J1GA 4EWEA 5A7WA 1VBE1 1LRZA 1QUUA 2XL7A 4YVSA 3LF7A 3D0JA 5CB7A 2BBVA 4FFIA 4AEMA 2OW4A 3PUHA 1CZVA 3W20A 1OKQA 2DYCA 1JYVA 5HXMA 3ZXFA 3HQXA 3KV6A 3B9IA 2RS51 5FZFA 2JDZA 3FZ3A 2GC0A 1YUDA 1WW5A 2CMRA 1W2UA 4HWCA 4NIGA 2WSVA 1Z0PA 1YC61 2JQKA 1KFUL 1O5UA 4QMAA 1NXMA 5C71A 2MEV3 2MAWA 1QSDA 5LEKA 5A3WA 2IUBA 4L0RA 5KHIA 5L9BA 2EHOA 4XDPA 2DVBA 2CRBA 2BQPA 1ZX5A 2V7MA 1JN2P 4FFFA 1DGRN 5BNNA 2ARXA 2ZA9A 4CCMA 1ZZ8A 1SACA 4BQ4A 2XQ9A 4N7UA 4D6RA 1ZRIA 3R4SA 2GH2A 2RDQA 1R1A3 5FMNA 1QH7A 4Q1RA 5C9AA 1QJU2 1R081 1X82A 3C3VA 2FZ2A 4MLKA 2WNVB 5LP6E 4O7XA 5JDMA 2GMMA 4MVTA 1RIRA 2UUAT 2ES0A 3M3EA 2ZX3A 4ERRA 5C3RA 4E2QA 3VKGA 5L3BB 3W15B 4GZ9A 2VASA 1OA3A 3U07A 5A7NA 3VDBA 1M4WA 4HN9A 3AMHA 1NG0A 3VBUA 4P08A 1J1JA 4BA9A 5F3EA 1SHZC 1UW8A 4ZHQE 1W2OA 4WBOA 3NVOA 3I7DA 4WBBA 5FYCA 4P0BA 2VMCA 1G73A 5K0UC 3CO2A 1CAXB 2QQWA 5F5QA 2JJ6A 5JLVA 2W95A 4YFSA 1Q8VA 2C5DA 3AA6B 3CHXA 4OFZA 1ZRDA 2WMOA 1PMJX 5FLJA 2FHRA 3OUHA 1WUVA 1EPWA 3RH3A 4Q0VA 5FXZA 1R8IA 2KXLA 5I8SA 3AZWA 1M06G 4UFMA 4KMQA 1AYM3 4YZ4A 1ND2B 5APAA 3AKQA 4MXVA 3ZSLA 2I0MA 5IAXA 3B94A 4Z91A 5IYZE 2HN1A 2BEOA 4X66T 2RM21 3O1HA 3CX7B 4H63H 4ZS2A 1F31A 4FOQA 4LFCT 5C4WC 1SE7A 3UFEA 3FX3A 5F1RA 2HEWF 3EB7A 3TEYA 4G4FA 2JG9B 1CX1A 2P5BA 1YFXA 3VHLA 5EPAA 2NZ9A 3KCCA 5FRAA 2JIWA 1HQNA 1R64A 4YGDA 5A33A 3RNSA 2K3WA 2XBO1 3MIDA 4HKLA 3N9MA 2DL1A 4YZ3A 1XNBA 4QGMA 1OOPB 2WQ4A 3VBSA 3GXUA 1GQGA 5M0TA 1ZHCA 3O1IA 1RUI3 2J1RA 1RUC1 5FP7A 2GC2A 4HVRA 2WNUA 4Y4YA 2D5FA 4AHZA 4PJYA 3APBA 2DLRA 4UF0A 5ISLA 3SFEA 4ZZCA 2EXKA 1ODMA 4E27A 1JNZA 5A3MA 3GA8A 3FZFB 1C8M2 1BK1A 3J9X1 4XEZA 1EYBA 1VOMA 5FDBA 2X66A 5DPNA 4X5TA 3QCWA 2CYFA 2RDNA 4K1YA 4JEHB 3RGLA 4N7IA 3ZKUA 1KNRA 2PHLA 3ZSMA 4RFT0 4QHZA 3EVYA 1XYOA 2MEV1 4BJ0A 2ZGQA 5ADXL 3VHPA 3G7DA 1SDWA 3WP5A 1WCSA 2WN3A 2JE8A 3B02A 3BODA 4LF5T 1XZYA 1OD5A 3AX4A 4L9IA 4PLNA 3ANWA 2OA2A 1J5WA 1R1A1 1BR2A 3GGLA 4DXSA 4P0AA 1GNHA 4MGQA 4KWUA 3OYZA 5IATA 2W66A 1G8WA 2MTQA 2IDOB 3POEA 3ZYKA 5GLTA 3UFGA 3K3NA 4YLHA 2D6KA 4QPYA 3BGAA 3V0BB 1WCRA 1WLWA 2WDRA 5LK7B 4B3RT 3BI3A 1FJGT 4CEWB 5SV5A 5IUXA 2BERA 5FP4A 2OIIA 2WFF2 2B7YA 4PNIA 2YU2A 1EAH2 4CP1A 3DP7A 3E5QA 5HCBA 4XDQA 1NENA 2WB5A 4CUBA 1YKEB 4CU8A 5ANQA 3N9QA 2CWYA 3AZVA 2XLAA 5FMOL 1OSGA 3DV8A 3NNFA 3ONJA 3CIHA 3A0KA 5CGMA 3RI5A 5HEHA 2EHOD 3WF4A 5DAWA 4QWNB 3WY6A 1HFAA 3SEEA 5A7SA 1AYM1 1OLRA 4WM8C 3GCWA 4Z92B 1I5PA 2VZQA 5JMCA 2FJDA 2V5CA 3SC7X 3H3MA 2X0LB 5LCWL 2XAFB 1UY0A 3PVOA 2ZPXA 4AAPA 2RR13 3U0ZA 5DUUA 3A22A 3VL9A 2WLQA 2CGOA 5HXCA 4E4DX 5FK8A 3JD72 1ZRFA 4LJHA 2QVSB 3ZYHA 4N53C 3RDIA 1LOFC 1S0CA 3B00A 3OGSA 5FL1A 2Y64A 4B4QA 3WQ7A 5F9TA 2WBLA 3CKDA 1XNTA 1JU4A 5CFDA 3IAQA 4PDWA 4QGLA 3OYWA 5JZGA 3JAFA 5JDQA 2QE3A 3FLPA 3BPZA 1AYN3 1E1HB 4W4ZA 5JXGA 3RIUC 1RUI1 1VB4A 2XR4A 4LR4A 4NHMA 4AVSA 5LBCA 3ZXEA 2VKOA 1JS9A 4WZCA 5A6XA 1GP4A 1GOFA 3VRAA 4E7ZA 2W5FA 3KT1A 5BNPB 1A78A 4I43B 1US3A 2YC4A 1WW7A 3M7AA 2ZX4A 4LK7A 3RI8A 4EXTA 3UYJA 2WMNA 5HXHA 4G3YC 2DU1A 3V64A 3PJQA 3WCSA 1JZ4A 4NROA 3SCGA 3PUZF 4UEMA 1YEWA 2H6BA 4LMLA 2V7IA 1YJLA 4Z82A 4XFAA 1AZDA 3G6JB 3I2OA 5JCTA 2TEPA 4U2AA 3U75A 3KV5A 1QY4A 5KHHA 2W39A 2VZPA 4URAA 4IDQA 3OTFA 5D21A 1REDA 2Y6JA 4MADA 4IQPA 4LULA 2A75A 4ZHNA 3AKSA 3DKWA 3CEWA 4PQ9A 4ILBA 1QNWA 2BOIA 5LB7B 2ZM0A 2ZZJA 4RHV2 2YDRA 1UYPA 2TUNA 5IAVA 2Q8EA 2VURA 4YVWB 1S0BA 4CP2A 2JXAA 4D6QA 5BY5A 2LKHA 2VUDA 1CPMA 4ISTA 3ZFFA 4D8MA 1G9FA 3AA1B 3SISA 3N7KA 1U0AA 4F3JA 1UY1A 2VQET 4MGYE 3WHUA 4FSJA 3AAAB 2ZEYA 1KJRA 4X62T 1CZSA 3A21A 3Q8BA 3SH5A 4A42A 2ARCA 2JDYA 2VZUA 4Y5Z0 5JOWA 2XQXA 1W0AA 4XJAA 4XF9A 1W3XA 4D3WA 2VVNA 3S5AA 4JQTA 3D8CA 3H7JA 1FT9A 2VNOA 1GP5A 3GJAA 1MIVA 2WY2A 4TX5A 3O4XE 5J96B 5CA6A 1BXHA 4DUVA 5A32B 2OYZA 4IESA 4HT1T 3A8YC 2CHOA 1IOAA 1O4ZA 2EF6A 2UWBA 5CFCB 4W50A 1RUOA 3CJIB 2PAKA 5EV7A 1SDDB 2VOVA 1WLXA 4PCRA 3B7MA 4HFIA 2VG9A 2XQ6A 2KM2A 2RS32 4RD7A 4Y22B 3FN9A 3AXJB 1PZ7A 2RR11 2BV4A 3WZ1A 1IKQA 4TXWA 5H9QA 2VY0A 3IN9A 2VO5A 3PNAA 3MKDA 4O4JE 2BDEA 2D6MA 1OVPA 2YFZA 4OCTA 5JOXA 4ZXLA 3M3OA 2FMDA 5FUIA 3ZMOA 4B3MT 4IGQA 5LA2A 4YW6A 4JUYA 4B29A 3H1WA 4PI0A 4IE5A 1PZ8A 4N43A 3LOIA 1AYN1 4LLFA 4TN7A 5JOZA 2XHKA 3ZN6A 1O4YA 4QX1A 4IXLA 3EHZA 5C33A 1GYKA 3URFA 1O3TA 2XMLA 5CJ5A 1HXS2 4Y1VA 1C5HA 3RQ0A 4JRLA 2WABA 3TNPB 2JD9A 3NKZA 1CWPA 4XABA 5HYAA 2Y33A 1UY3A 1MMDA 1YFYA 5F39A 3ZR6A 1H1MA 2E5LT 2UUCT 5H6QB 2Y8KA 2X9YA 4HWFA 3PJAJ 4L92A 1UCUA 1XSQA 5LOVE 2AREA 2ZKLA 3ZFGA 4LOSA 2VCAA 5SV8A 3D82A 3S5QA 5LYJE 1SLBA 1W05A 4EEDA 2A5ZA 4B3NA 4ZI3D 5FOBB 2J1DG 2B42B 4FPCA 3RWKX 3HKBE 3LPGA 3B3QE 3VZMA 4ISSA 1YCIA 1TZOA 1ODNA 2I07B 3VDDB 1XNKA 3V5SA 3R05A 4AQ6A 2PJQA 2X5IC 4DXTA 5IWFA 1I94T 3WG2A 4D0QA 3DYPA 4JGZC 1Y9GA 1QOOA 3TN92 4OFGA 4ISQA 3B01A 2EIDA 2ZX1A 3F31A 1XU2A 2HWD2 1DDLA 3FFZA 5FYYA 2D3SA 4P1NA 2WS92 4AAXA 3WW4A 2W52A 4DR7T 4LBJA 2A3WA 5KC6A 3NV3A 1W6OB 5LMNT 3UQ7A 3HR0A 5AQSB 5FV3A 3AEEA 4OUSA 2LS6A 2RJ2A 1VAKA 1MS5A 4YARA 2XM1A 2Y6FA 3P5BA 3WG1A 4AVBA 4Q4W2 3J8F2 3FLTA 4Z1VA 4CDUA 1CUNA 4CDWC 4Y3OA 1STMA 3WW2A 3K8PC 2LW8A 4BPZA 4QHOA 2H0VA 4GAZA 4ITCA 4Q25A 1BEV3 2WWJA 2Q9QB 2PFVA 2HH7A 1UU4A 5FPVA 3M4FA 3S4UA 1DQ0A 1BR0A 5FMCA 4FPFA 2UXXB 1R092 4GA9A 4CXXA 4L99A 2E31A 1ZREA 4ONUA 1MACA 2GP3A 4YW5A 4A7ZA 3RVHA 1OF3A 3OBVE 2PHFA 1W3VA 1S1AA 3ZPYA 1V6IA 4L5GA 5J0ZA 2XQYA 4UW5A 2LE8A 4EN8B 4JGYA 5FKBA 2L8KA 5FZOA 3U78A 3VRBA 2H3RA 2ZGMA 4LE3A 3FUOA 2ZMLA 4I50E 5CEHA 3N35A 1OVSA 2LSKA 1SG3A 4NO4A 3ZFEB 3PUIA 2V6YA 5FPAA 1GP6A 1AL0G 2DDUA 3BUCA 1LHUA 2CSGA 4AKRB 1RXFA 4CDXB 1QGLA 1W6QA 1T2XA 3BU0A 3U11A 3PJAA 1GQEA 4MXWA 2XWBB 1W6MA 1VMFA 1T6BX 3K3OA 1LEMA 5DJQC 3ASIA 1RHI2 3AMPA 1AL23 1ENXA 4PK5A 3M8LA 5FFOC 5A6ZA 2BFUL 2QKDA 1QXPA 1S2BA 5FKCA 5C8CC 4V1Av 5ACA3 4UXNB 3VB9A 1Y3TA 4YGEA 4YXDA 1FEWA 5EZWA 4AIUA 3SCHA 4EWAA 1TE1B 3CDZB 5ABFB 3QOFA 2WR9A 4O61A 2AEZA 3UU6A 4BYYA 3C7OA 3IMNA 4PIXA 4FAGA 1NCQC 4TSVA 1E57A 1Z7S2 5FY8A 5FNVE 3N9PA 4LKFA 1ONAA 2ZS6B 3N9NA 2E51A 4JDMA 3RFRA 5HAXA 5L3EB 3UGGA 2IFWA 1MQTA 4FPKA 4YSYA 3IAPA 4MUVA 2ORZA 5FOJB 4CP0A 5AQTB 3KV9A 4TNWA 1SCSA 5JDBA 2VNGA 3AEGA 3OBTA 4NPRA 4KMCA 3NO8A 2HYKA 2Q1FA 2NP9A 4EYUA 1MEC2 3HPNA 1H8TB 2GZWA 3FLRA 3GNEA 5FY9A 4Q2FA 3SQOA 1HG5A 3MW4A 2ET7A 1D7PM 1KFXL 2QBXA 4NHLA 1ND3C 4R9CA 2BVLA 1JMUB 5KHJA 1ULPA 1OFNA 1DGWX 3RMXA 4OI4A 1B35B 4OVEA 3IKWA 1SUMB 3MA9A 1G9BA 5DAPA 4J2CA 3PHMA 2WAAA 1W9FA 1X36A 4Z8XA 1OLMA 1GZWB 3GALA 2WIIB 3ZN4A 4BLJA 5HCHA 1V70A 1UWWA 4M3CE 5FL0A 4CZZB 2AEYA 1J3PA 4OULA 4LF8T 3CX8B 2UU8A 1RVF2 1QJFA 4D7TA 5BV6A 1YQCA 3MV01 4QB2A 4UXAA 2NMNA 3L9JT 1BEV1 3OD4A 1HRI3 4Y33A 1YQ8A 5BMVE 2HWF2 2W2UA 4GWIA 4XUNA 2KWHA 5HV0A 3AM2A 3WCRA 1XNCA 2B9VA 2WSUA 1UCXA 5JMOA 2O8OA 3EQEA 4GK0E 4JBWF 1UKGA 2IAKA 1Y64B 3B69A 3ACFA 2H0BA 4GULA 4NRMA 2EXIA 3WDXA 4FFHA 2YB7A 3J7Yq 3T2TA 3RC8A 1E5RA 4COVA 4QPGC 5FMBA 3T1HT 4HWDA 2ARAA 2NTYA 4AKIA 2XDVA 3R0RA 3SS1A 2BKNA 4IETA 3EDVA 2IVJA 1X50A 3I2HA 2E9XB 4HMZA 2XVKA 3QOPA 3Q5DA 2V72A 1JOBA 5IFTA 3PU8A 1HV1A 5JPMB 1KFYA 2LHNA 4A7KA 4CCNA 2W00A 3O0WA 2QCSB 4IEUA 4I01A 4W6YA 4XBFB 5CKMA 2LEHA 4U33A 4TTGA 2CAVA 1AL21 1CAUB 5ACA1 4X1IE 3IT8A 3ZYFA 4ES8A 2A1XA 2Q0AA 2DURA 4QD2A 2KZ7B 4CN6A 4B3TT 4XAEA 3WQ1A 4QX7B 3LK3B 2I59A 3MIEA 2G19A 4IGPA 5BR8T 1UU5A 5JDLA 4DPNA 1LECA 2OVUA 1HW5A 2ZGRA 3GM8A 4LKSA 4YZ2A 2VL8A 4KL1A 2NR4A 4AISA 1GU3A 3K2OA 4CN1A 5E89A 2YBPA 3G06A 2KNDA 5IVEA 2MHFA 5T55A 3CQGB 1OPOA 4HGAA 1XPWA 2W62A 1DCSA 1AR63 2QRXA 2VKJA 3MGUA 2WNEA 4DQAA 3FZKB 4QH5A 2HWE2 4YVSC 4Y1YA 3C7HA 1HB3A 4FPOB 1UUSA 5CZKA 2WL1A 2V09A 5K0UA 3PV0F 1D1CA 3JZVA 4LBQA 4Y1ZA 2Q30A 5L3GB 3RZZA 4MHCA 1MNDA 4XUOA 1IS5A 2DWKA 1RMU2 4H7MA 2GNMA 2Q8OA 3VDAA 2CBJA 5GZEA 4FPYA 4PK6A 1VMHA 1FX5A 4MZUA 1F35A 2F6BA 5EFUA 4WM7C 2WA3A 4KI5M 3O1MA 3ZXLA 5HEOA 5FUNA 5T5JA 3ZCJA 2VCBA 3RI9A 1FNZA 2EHOC 2RE9A 4HKOA 4A41A 3WD5A 1D0HA 3BYWA 3VDCA 1TMF3 4Q29A 5T52A 4TZ4C 2FQPA 2VH9A 4ZU7A 1XDPA 1V6OA 2RJKA 4NPPA 2PLV3 3IHRA 2DWGA 3VZLA 5C9AC 2LKGA 3AYCA 3WVJA 4LOTA 3NNMA 3DPRA 1HRI1 1WLTA 4AL9A 5I0RA 2BS2A 2CU5A 2YK0A 4KI0F 1PO23 1QKQA 4GYSA 4IREA 4WNKA 4N78D 4ZONA 4HK8A 4WVVA 1CVNA 1DFQA 1QJZA 5HI0A 4QXHB 4F83A 3HT2A 3VBUC 1K5JA 2W9XA 3PIGA 3WF0A 1A34A 1MR5A 4K40A 4WZFA 1I6XA 2IXJA 1VLNA 1CR7A 5LG4A 2VVEA 4NWWA 4AEJA 2NW9A 1D4M2 2ZM2A 3CZUA 1TG7A 5AQNB 2VTFA 1GFF2 1W8WA 1I5ZA 4XJWA 3C7GA 4FQ4A 3MJXA 2UXNB 5ANNA 1G9CA 2ATFA 1VBB2 4XFFA 5AC92 1XE8A 3VBOB 3DYOA 1JODA 4E9KA 4P9JA 1FAYA 3NNLA 4CCOA 5DABA 4UBHA 3RJ2X 3FBMA 1NAEA 4XDOA 5HV4A 4DZGA 3ST7A 3LK42 3D3AA 4IEOA 1UOJA 1V0AA 1LVKA 3VD5A 1OI6A 4UFLA 3BTYA 1W9YA 3KT4A 3K46A 3WDVA 1IPJA 1JYCA 1ZBA2 2B9UA 4HPKA 2W68A 2C4XA 4IHJE 4LF6T 4Q1PA 2QGSA 3KZ4C 2R7EB 1HLCA 2X0HA 4XACA 3RGBA 4P14A 3OVUA 2YDEA 4ZXKA 5KR7A 3P4QA 2WINB 3VBSC 2DUPA 2XQ4A 4OHXA 4QKDA 1TNRA 1H6YA 1DF0A 1AR61 2XHNA 2WNUC 3ABVA 1LHWA 1RUG2 2AENA 1GQPA 3IDCB 3KD4A 1BVVA 4AVCA 3P3NA 2LALA 1U5PA 1OUSA 1PM4A 1NZCA 5C4WB 1F4HA 3PVBB 3UJQA 3I2KA 3ON7A 4GIQA 4P5YA 3JC6D 4Q27A 2DUQA 3L8RA 3OYXA 3LDBA 1QJEA 1LGNA 4GMP0 4IDNA 1RUD3 1PGL1 3WNOA 4O4IE 1NAFA 1XOYA 1DLLA 5CAZA 2GSYA 4CPBD 3H3AA 2CV6A 3KDSE 3M70A 4XC9A 2N9DA 3HJRA 4KWKA 4OHYA 1J83A 4QXCB 3C98B 3MYXA 5HEJA 2ZABA 1TMF1 4S2DA 2WBKA 4RGAA 2ZHLA 3NJXA 3DECA 1PO12 4NIHA 4RGGA 3AE2A 2PLV1 2L9QA 5CA1E 5FK7A 4N53A 2X0YA 2JB8A 3HR9A 5FZDA 1O4TA 4FAHA 3AP5A 4LBMA 1J59A 1VALA 3OG2A 1PO21 1KRIA 3SNMA 1H4GA 5T54A 2R0HA 4Z2AA 2XG3A 1PX4A 2G9FA 1MVEA 1W6NA 3VHNA 2XY8B 3IMMA 1QU0A 2V4VA 5IVYA 3NVCA 5FYTA 2OT7A 4H3WA 2GALA 3ETVA 1G86A 2WZPP 5CNAA 4BZ4A 4LKEA 3TLUA 1JZ3A 5JVDE 1FXZA 4LBQD 4HFBA 2B46X 1POV0 2Y34A 3WG4A 1GMMA 2CLYB 2YROA 3WP3A 2D6NA 3WNKA 5FZ1A 3A4UA 4O2BE 4K8RB 4HFCA 1H1AA 4KG8A 5IVBA 4DIQA 1HRV2 2PMWB 5AFEA 1WZXA 3HMYA 1XE0A 3RRWA 2VMEA 4V1PA 3E97A 3UUBA 4BJMA 4QKBA 3UGFA 2WAUA 1CAVA 1TME3 4ZI3C 3T3YA 3LIHA 2D3RA 2UWCA 4HWHA 4C91A 4DR1T 1EPZA 1Q43A 3GZUC 4FOWA 5D2AA 1ZZ7A 3GZAA 4UWDA 3LQCA 1L0VA 2ET1A 4IV3A 2X10A 5J2UE 2DFCA 4FPLA 1FI2A 1PK6C 3UU4A 2WS3A 2GU9A 4DNYA 1ZBE3 3K4DA 5CFDC 1OKOA 4CE8A 1VBD2 4Y20B 3ATGA 4COFA 4IEQA 4WVMB 2D9DA 3WV6A 3MPBA 4WM8B 2VXRA 1YO8A 1ZP0A 5ABJC 4M3CF 4JV4A 1I9RA 2W91A 2PHXA 2ZX0A 4HANA 2EXJA 1WCUA 1HR0T 3JBG2 1IS3A 2ARBA 2O1QA 4KBMB 1J1LA 1RB8G 2H89A 5AQHB 4UR9A 1ZVFA 3M1HA 4JI2T 3U14A 4ZKTB 5J7MA 1ZRRA 1RUE2 3ZN5A 1IZNB 3LSVA 2AR6A 2A9UA 5CB4E 1RUD1 4Q4Y3 3ZN0B 4FCAA 3ES1A 3ME2A 4HZFA 3KGLA 3EABA 4Q4V2 2YUEA 2IC6A 2J62A 5TAOA 2QDNA 4IDZA 2XVLA 5LASA 3DGTA 4LORA 4IEWA 1NX9A 1W8UA 1E5IA 1VJ2A 2C9KA 3M2MA 4ARYA 2DNXA 4XFIA 4AI8A 3ENRA 4LPLA 3E6BA 3HAGA 3VBHB 2E7AA 4DUYT 3HBKA 1SBDA 3UV9A 3BQLA 2AGSA 3ZSTA 5JOYA 2IFRA 4N8MA 3L09A 5T5LA 1H6XA 3K48A 1J5ET 4CSWA 3MF6A 2DCYA 4LT5A 2V1DB 1W8FA 2D5UA 1IG0A 2WN2A 3RIAA 3AJZA 2VOXA 3NJZA 4BB3A 1YQ6A 4JI3T 2ZX2A 5KXDA 2XLFA 5K4LA 2CCQA 4NJ4A 2XQAA 2CBIA 4LBOA 1BK0A 2FJAA 2W87A 5JR7B 1X8EA 4U2YA 3X1DA 2P17A 4CN4A 1Z78A 1NE4A 4I02A 3AE9A 1OWAA 3ZIXA 2VOTA 3FFQA 1VBA2 1ASJ3 2WKKA 3GWHA 1Q3EA 5FYHA 3ZSKA 4AQGA 3VV1A 3EUHA 5I0DA 1N3QA 5HEGA 3ZDSA 3SXWA 5FBJA 2DF7A 5I91A 2YPJA 4AFMA 2WDVA 4JYAT 4E4HA 5JREA 2VOKA 2RDRA 3VBFA 2V8SV 1X7NA 1V6JA 1DYOA 2FBWA 3FBZA 3DF0A 1UZVA 3CMLA 1AXZA 3K75B 4UYBA 3QC9A 1TME1 4HOOA 4AR2A 3N9LA 5F3CA 5AQIB 3WLUA 4H9OC 2ORXA 4QX0A 1US2A 4LKDA 4JGZA 1UPIA 5DZEA 4M4RA 2J1TA 1Q5OA 2WZR2 4KHPT 4QPIB 5IVFA 4SBVA 5EWSA 5L7OB 5DQ0A 3Q5EA 2RHPA 4JI8T 4YM3A 1W6PA 2IW5B 5F3IA 1HQWA 4RGKA 3FJSA 1ZBE1 1Q8OA 2ZGOA 1GNZA 3UKVA 1W04A 5JR9B 3FMGA 2JEMA 5F7UA 1QEXA 2ZAHA 1NCRB 1CPNA 1UX5A 2VE1A 2WCAA 5LHIB 5D8AB 1JYWA 3AE6A 2BPA2 1QJX2 4GK5E 4XAAA 3LZZA 1GLHA 3VD3A 1OEDC 3WAKA 4BE3A 4CUCA 1HCIA 4RS5C 1Q56A 4M3CB 4MO3M 5F5AA 4CI2B 4CDWA 2YV8A 4QKNA 4W65A 3H3ZA 4XYXA 2C5IT 1CZTA 2X9WA 1WKYA 4Q4Y1 4NUBA 4K3UA 1QJU3 5FIXA 1KXGA 1YFWA 1RJ8A 2YG0A 4FP3A 3AP9A 3ZX7A 1W2NA 3TKLB
chains in the Genus database with same CATH topology
4GJZA 3AA1B 4F6RC 5LBQB 4IE4A 5FUNA 2CA5A 3RRWA 3K3OA 5DJQC 5M4YA 4MFRA 3ZYMA 3PUQA 1ZHCA 2X9XA 1ZV4X 3O1IA 5FYMA 3AAAB 3ZCJA 3N2GE 3DXUA 2A72A 2VKHA 4PK5A 5FZ8A 5IVCA 5FP7A 3Q5WA 1MIWA 1YKHB 3ESLA 4BJMA 2EHOC 3I0QA 3ZC1A 2P9BA 5F5CA 1LKXA 3PDQA 4V1Av 5LW9A 2DLRA 2WAUA 4UF0A 3R6NA 3AL6A 4ILUA 1D1AA 4ZI3C 4UXNB 3ZMZB 2ODUA 5ISLA 2LM9A 3WAJA 1HTJF 5LXTE 3IBPA 3BK9A 5DQWA 4B6XA 5FYUA 5F8PA 5FY0A 1FEWA 2K48A 2V7LA 4G2AA 4EB6E 4ANJA 4C91A 3KV4A 4HE8A 4TZ4C 4O8SA 1MIYA 3MXZA 5FPUA 1HG2A 2PXJA 5HWXA 3M65A 3Q2MA 3GA8A 2IC9A 3D0TA 3QK6A 2OS2A 2W63A 3BQIA 4IIJE 3IHRA 1FMWA 1MIVA 2DWGA 5FPBA 2XASB 3IF8B 4TX5A 2PG8A 3J9X1 2KLQA 2Q9QC 2WSSV 1VOMA 2X67A 3UTKA 3O4XE 5A3NA 5FZOB 3DTOA 2G0UA 3F2EA 4AQFC 5J2UE 3AL5A 2X66A 5A3TA 3IEEA 4ZS3A 3K3QC 3CQCB 2XAGB 4P09A 3CX6B 2YK0A 3LBXB 3Q9DA 5FY8A 4JEHB 3HL6A 5FNVE 5FZ6A 2JMKA 3JC6C 3LJCA 4O4HE 5FY4A 3N9PA 4GYSA 2HPLA 2N1GA 3NZQA 4X1YE 5A1FA 5A7QA 4WNKA 3V5UA 1HS7A 4N78D 1EZ3A 2XUEA 3EVYA 2XAHB 5FZCA 1WLXA 1WYCA 1ZKEA 1V9DA 2Y6XA 4BXFA 3I0OA 3PE0A 3CWZB 2LHRA 3N9NA 4G63A 4UIGA 5LA6E 4QXHB 4CXWA 2H7VC 5HAXA 5L3EB 1UX4A 5ADXL 5A80A 2GP5A 5F5IA 2JQQA 4BISA 5FXVA 3UT5E 5EK3A 4DMWA 5LCYA 5L3DB 3FXDB 5LJNA 3UUXB 4PK4A 2KWIB 1FIOA 2NW7A 3GN5A 2NW8A 1X79A 5A1LA 2OQ6A 2CWOA 5A3PA 3PURA 1B7TA 2D2SA 3KV9A 3KVAA 4H63V 5LY2A 2WM9A 4L9IA 4KBMB 5HXRA 4DMVA 3ANWA 2CXFA 5FZHA 4HFVA 5EK4A 5ETWA 4UF0B 5A7OA 3BQKA 1IJ6A 3CQXC 2ODVA 3C4WA 1WR6A 1IJ5A 5F37A 4KMCA 2BVMA 3P8CD 1BR2A 4GOUA 4WBNE 5LG4A 2RA1A 1HX8A 4P0AA 4QU1A 1WRDA 3ONXA 2NP9A 5HWYA 3MKDA 1KK7A 4MALA 1IZNB 4K0UA 2NW9A 2ZM2A 4TV8E 2YBKA 4EYUA 4GIWA 1IAPA 5JQGE 3EDUA 4O4JE 4O2AE 3ZJ2A 5FZKA 2BDEA 5LWBA 5CB4E 5LNKA 3OYZA 5LHGB 4EOZB 4FI5A 3ZN0B 5LGNB 3FHNA 4UVBB 5FY9A 1HG5A 5L2LA 2MTQA 4TV9E 3MJXA 2UXNB 4PFOA 5FY1A 5LGUB 4QWNA 4CCKA 3HKDE 4WW0A 5AFUL 2VKDA 4QXHA 4AKLA 2Q8DA 2VB6A 3ZYKA 4IGQA 5IW0A 3NZPA 1YD8G 2IC6A 4JUYA 3ETUA 3K3NA 4IE7A 4IE5A 4UVAB 5TAOA 4YLHA 2BVLA 4TUYE 5L3CB 5FYIA 2NOXA 5FP9A 4H9NC 4IE6A 4IDZA 2LT3A 1NWMX 2C5KT 3MZKB 4XZCA 4ZI2D 4TN7A 5F2SA 2LSIA 3E0ZA 5A7PA 2X9HA 4EZ4A 3KBUA 4CCOA 1HF8A 3PUSA 5DABA 3OJAA 4CCLA 3AA0B 3AAIA 3CPZA 4QX8A 5J1GA 2XMLA 5F2WA 4H9SE 5A7WA 2MOZA 2XXZA 1LRZA 1QUUA 4XDOA 3KINB 3MA9A 4HEAA 5FP4A 3LK42 4J2CA 3LD8A 2DI4A 4IGUA 4PAGA 2DNXA 2V7JA 2E9XD 4HTEA 5FYVA 1D0XA 4PNIA 2YU2A 3FXEB 1S35A 1H7CA 4ZI7E 5HYAA 4Z8XA 3GN5B 2OX0A 5J2TE 1LVKA 3OPTA 1MMDA 2VK9A 4E7SA 4V2WA 5F39A 5FZAA 2JPFA 5HXSA 5CA0E 4CUGA 1MMGA 5FY7A 3MACA 4CZZB 3DP7A 3KV6A 3ANWB 2CXLA 2E9XA 4CQIA 2KINB 3CX8B 5H6QB 2M67A 2ZM8A 1YKEB 2V26A 2X51A 2X9YA 3BQLA 3N9QA 5ANQA 2PBIA 3NRXA 1U4QA 2CWYA 5C8YE 5FZFA 1VRBA 3ZPOA 3HKEE 2JMHA 1UCUA 2ZMAA 4LIVA 2CMRA 5GONE 4Y33A 5JR9C 3E22E 4UV8B 5LOVE 4DNDA 3PUGA 4PJLA 5LBMA 2C5JA 5BMVE 4PFPA 2C0SA 1YW0A 3F57A 4IHJE 2XTLA 1Z0PA 5LYJE 5FZ0A 2QGSA 4IGOA 2KWHA 2K5BB 3L09A 3UUNA 2EHOD 4QWNB 3I9WA 1HFAA 4I55E 4M1PA 4CSWA 2X68A 5A7SA 4ZI3D 3ZC0A 5IHYA 5JRCA 5KR7A 3PUAA 2L3LA 2NWBA 3DXTA 2J1DG 1QSDA 4QXCA 2V1DB 5A3WA 4GK0E 3HKBE 4Y4RA 5FZBA 2IAKA 1Y64B 2D5UA 2YPDA 5LY1A 3Q5XA 4ISSA 4L0RA 3ZMSB 2EHOA 3O9XA 1MMNA 4TN7B 4XDPA 2X0LB 5FP3A 5K4LA 4ADZA 2HPJA 3ZYLA 2V7MA 4CI3B 5FPLA 2CCQA 4OYJA 4QX7A 1O3XA 2XAFB 3N2KE 2Y8DA 4ASKA 4FJOA 2CLYC 4QX8B 3J7Yq 2D0UA 4O4LE 2RP4A 4CCMA 3V5SA 2Q9QD 1U5PA 1BR1A 3RC8A 5FZIA 5A7WB 4AAPA 2PJQA 4YHJA 2V7KA 5FXXA 3H37A 5IWFA 3B13A 4D6RA 2DCFA 3RX6A 3A5XA 1WYBA 2NTYA 5HXCA 4V2VA 3KBTA 5EK2A 4AKIA 4EYYR 2XDVA 5FZ4A 5FMNA 1OWAA 3SS1A 5FJHA 2Q9QA 3JC6D 3O1JA 3RKOA 2CEAA 3OYXA 3LDBA 5FJKA 3F31A 3SOLA 4MLKA 4U72A 4GJYA 2KMFA 4AQFA 5LP6E 5FZ7A 2Z6EA 3GWHA 2LOPA 3EDVA 5JDMA 5JH7E 5FYYA 5FYHA 5FYSA 2E9XB 3U4SA 4AQGA 4DBQA 3EUHA 4DBRA 2ES0A 2WBLA 4I4TE 4O4IE 2VWAA 5JR9A 5FZLA 3ZEFB 1NAFA 3CKDA 5JDNA 3PU8A 3HI2A 2ACXA 4AXPA 2A2FX 4ERRA 5FBJA 2LHNA 1D1BA 2GK9A 3B57A 3VKGA 5FZMA 4EIWA 5L3BB 4CCNA 2W00A 4BJNA 4HONA 3AAEB 3H3AA 3W15B 4X1KE 4DVDA 5JDQA 5F3GA 2VASA 4QXBA 4E4HA 3C64A 5JREA 3KDSE 3HR0A 3P7IA 1E1HB 3C51A 2CM0A 3RRCA 5A7NA 2Y48B 3C50A 5FV3A 3HA4A 4AKHA 3RPUA 4UELA 4XBFB 2LEHA 4HN9A 2N9DA 3N9OA 3LFMA 5KDMC 3VU7H 4PW8A 3ZMTB 1BR4A 4H9PC 5JRCB 3FBZA 5FYZA 5LGTB 4AKGA 3NJYA 2YINA 2VKOA 3CMLA 4AI6A 4QXCB 4BA9A 5F3EA 3C98B 1SHZC 3U3IA 5L3FB 4X1IE 3ZLIA 3QC9A 4ZHQE 3OKQA 4CXYA 4HOOA 4E7ZA 2EHOB 3N9LA 5F3CA 2LSGA 4WBOA 4H9OC 2H7OA 5KMGP 4PJNA 2KZ7B 4OYKA 5FYCA 3SWHA 2W0GA 4P0BA 4I43B 5FZEA 4QX7B 1CUNA 4U74A 1S94A 3LK3B 3RYCE 4DO0A 1G73A 2I59A 3ZMUB 5FXWA 2VD7A 2XHEB 4HKAA