2WWUA

Crystal structure of the catalytic domain of phd finger protein 8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
363
structure length
363
Chain Sequence
VKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PHD FINGER PROTEIN 8
publication title Crystal structure of the PHF8 Jumonji domain, an Nepsilon-methyl lysine demethylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 363
sequence length 363
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wwuA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2wwuA01
3N9MA 2GP3A 5F2WA 5ISLA 5FXXA 2Q8EA 3KV4A 3KV9A 5A7OA 4QXBA 5F3EA 2YU2A 5FZDA 4EYUA 5IVBA 5LW9A 2OS2A 3NJYA 4CUGA 3AL5A 5FV3A 4EZHA 4GJYA 5FY0A 4GD4A 4UF0A 3DXTA 2WWUA 5FZAA 2YBKA 3K2OA 5FY7A 4E4HA 5A1LA 5FZGA 5FZBA 1VRBA 4HOOA 3OPTA 2W2IA 5A1FA 5FWEA 5FZ6A 2OQ7A 5FYTA 5FP8A 5FWJA 3KV5A 4QXCA 5FYCA 5FUPA 3U4SA 5FZ7A 5FZ0A 4NUBA 5F5IA 2PXJA 5A7SA 5A7NA 2WWJA 3U78A 5FZMA 2GP5A 5FYYA 5FP9A 5FP3A 5FZIA 5FXWA 3OPWA 3PUQA 5FXVA 5FZ8A 5IWFA 5FYBA 5F39A 5A3WA 3ZLIA 5KR7A 2OT7A 4V2VA 5F3IA 5FBJA 4QU1A 2VD7A 4Y33A 5FZLA 5IVCA 5IVEA 5F32A 5FPBA 4QXHA 5F5AA 5FYZA 5FXZA 5FPVA 3KVBA 5FZOB 4XDPA 4D6SA 2XDVA 3AL6A 4QX7A 5A7WB 4BISA 5A3PA 4IGOA 5FZKA 5A3TA 5K4LA 4C8DA 5FZ3A 4D6RA 4CCNA 3PUSA 3AVSA 3N9LA 5A7QA 5ANQA 5FZHA 5FPLA 5FZFA 2XXZA 5FY8A 5FZCA 4URAA 4Y4RA 5IW0A 5F2SA 5FZ1A 4BU2A 5FZ9A 5CEHA 3DXUA 5A7WA 4CCOA 4LITA 5LY2A 3K3NA 4XDOA 5IVFA 5IVJA 4CCLA 2YBPA 3PU8A 4LIVA 5F37A 4AAPA 4QX8A 4QWNA 2YU1A 4CCKA 3LDBA 4ASKA 4TN7A 5FY5A 4D6QA 5FPAA 5E6HA 5FPUA 3KVAA 4Y3OA 5LWBA 5FZ4A 3RVHA 3PTRB 5FYHA 5FY4A 5FYUA 5FYSA 5A80A 4CCMA 4EZ4A 4HONA 5LY1A 4LIUA 5FYMA 5A7PA 5F3CA 4V2WA 4IGPA 4CCJA 2XUEA 4IGQA 3N9PA 5IVVA 5F5CA 3N9QA 2XMLA 3UYJA 3PUAA 5FUNA 5FY9A 5FZOA 5FJKA 2OX0A 5FP4A 2Q8CA 3N9NA 3PURA 5IVYA 3AVRA 5FJHA 2OQ6A 5FZEA 4BXFA 3PU3A 5FP7A 5FYVA 5A3NA 4DO0A 4LXLA 3ZPOA 4UF0B 4CSWA 2P5BA 4AI9A 3PDQA 2YPDA 5F3GA 4DIQA 4GJZA 2YBSA 2Q8DA 5FY1A 3N9OA 5FYIA 3KV6A 3K3OA 4GAZA 3LD8A
chains in the Genus database with same CATH superfamily
2XSAA 3RH3A 4UI9L 4EYUA 4COZA 4D3WA 5LW9A 3VZJA 4HFVA 3NJVA 2DCKA 1H2NA 5FZBA 4HOOA 1R1ZA 4BCUA 4NXMT 3U4SA 3VRBA 3QCWA 2QQOA 1FPN1 3TN93 3ZFEB 4MXWB 3T09A 2VXJA 3T4VA 3WP4A 1VBE3 3WW3A 1W6QB 2RS12 3PUVF 4NIDA 5LEJA 4BJNA 4N53A 4GMP0 5JMOA 1OFNA 2EXKA 1QSDA 1DYPA 3RIUC 1PX3A 3SHRA 4FP2A 3N2GE 5LEKA 5F37A 1ZNPA 2C1FA 4BK5A 1Q8OA 1T8BA 1RUG1 2MAWA 1OF3A 3OF1A 3RZJA 4A6SA 4RQPB 2O8QA 3M65A 4I4TE 2LKHA 2FJBA 2LSJA 3UFGA 1W8FA 1WMXA 1MVEA 4O9GA 2YEVC 2WZPP 2W66A 4KI5M 3C7GA 4JVAA 3WW2A 5EPAA 2VCCA 4OQ8A 1IS3A 2W92A 2RE9A 4QD2A 5F3EA 1RJ7A 3FXEB 2BBJA 1Y9MA 1HRV3 5A1LA 2W1QA 1J1TA 2NQYA 3OPTA 2N2NA 1T2XA 3LA7A 2FDFA 1H8TB 4P9JA 1A8MA 1IAPA 1CJPA 4P08A 5CYYA 1LVFA 2MHFA 2W68A 1I94T 1YLLA 1YQCA 4QDSA 1QJU3 1B09A 1GZTA 4TWDA 4CDUB 3FZKB 3IN9A 1JH5A 1MS9A 3SLIA 1J59A 2YU1A 2BW8A 1V6KA 3GZTB 4JGZA 4YSXA 4XBFB 4XE9A 4YW3A 1TMF1 1N33T 2PAMA 3RI9A 4OHVA 2FMYA 1GP6A 1RL3A 2D40A 1ZX5A 4JHZA 2V6YB 4WZFA 4NR1A 1L7LA 4F8HA 1QJY2 2UUBT 3VBUC 1Z0PA 4Q25A 1NA1A 4AFAA 2DVGA 3EO6A 1BQPA 5C9AC 2IVIB 5L36A 1F31A 1RXFA 2J1TA 2HPJA 4AGGA 1FOD3 2ARAA 5EIYB 3S0MA 2ZHNA 5IFTA 2NR4A 2QTWB 4P9LA 3RZGA 5FL1A 1KF6A 3O1IA 2P9BA 4PJJA 1DYOA 2X51A 3N35A 4PK6A 4CI2B 2Z5WA 4SLIA 1FMD2 2BGPA 2W91A 4Y5SA 3VU7H 2WQZC 3KGLA 1OLMA 3KT7A 3MW4A 5KDMC 5FQ0B 1V9U3 2XAJB 2L3LA 3E6DA 1TQ5A 3K3NA 1ODNA 4XFGA 4BJMA 5L47A 4QQLA 1KGYA 3FL7A 1LGBA 5DAVA 3UQ4A 4MHCA 3JZVA 2YDSA 4CTEA 1RUH1 1I1EA 2QVAA 4HBNA 5I8TA 4JCKA 1IPKA 3IAPA 1JYNA 4DB5A 4XUTA 1FT9A 3JXSA 3THCA 1GYKA 4EN9B 5FP7A 3W9AA 4PJLA 2SLIA 2RDRA 2YBSA 1IS6A 4RGAA 5L2LA 3ZYPA 2D5UA 1XXNA 2ADEA 2XLAA 2PYTA 4Y4YA 3WNOA 2ARBA 2D6MA 1SUMB 5JOXA 2RA1A 2VZVA 3ZN6B 3WQ0A 3BIEA 4L9IA 4R9AA 2W63A 4M3CA 1UY0A 1UIJA 2J7MA 1UW8A 3HL6A 5C8CC 1WLTA 4LUMA 1V6IA 2J42A 4NHYA 4QB2A 3VB9A 1WLXA 1W6MB 2UXXB 4GB31 2K9AA 4HKAA 4YW1A 4IEXA 3P4RA 2JJ6A 5A33A 1OVSA 5GZDA 3VBUB 4U3CA 3EI0A 4IGUA 4TXWA 1YRZA 4DBRA 5C9AB 3TNPB 2VAUA 5H9SA 5KBFA 2K0GA 4JHTA 3ZYJB 1R081 4ZONA 3RJRA 3B57A 4LIUA 2YB7A 1K5JA 3EUHA 3T2PA 3N9PA 3PJAA 1HG5A 1NZCA 3PMSA 3ZEFB 3NKZA 1S94A 3R4UA 1C1FA 5I8SA 3AP9A 3P8CD 3N2OA 5K0UC 3ZMUB 2W2UA 4LFCT 3HOBA 3K51A 2W9XA 3PMEA 4CRQA 4WBNE 4LK6A 4OI0A 1VBA3 3VBRC 3D0SA 2WZR1 4XYXA 2XJPA 2UU8A 4PK5A 2W1WA 1E2AA 2VECA 2B9VA 1GSLA 1DQ6A 3FZ3A 1EPWA 1VIWB 4RN5A 1EY2A 2XAQB 4FFGA 1WZXA 1UU4A 1JU3A 1FPN2 5KXEA 2VZRA 3SFDA 3L39A 1BR0A 5JSPA 2J4GA 4KWLA 2ZGPA 2V72A 1XNBA 4GALA 3FHIB 3E5QA 4FTEA 3Q5EA 1UX5A 4HEAA 4CXWA 4HG6B 1PVC1 1LODA 5EK3A 1WCDJ 5BYNA 4UW5A 1XNCA 1E57A 3KD4A 5BNOA 3LFIA 2O1QA 5GLVA 5AQVB 1PO23 3AP6A 1BR1A 2CXDA 3MEPA 1H2KA 3AVRA 2ACXA 3HJRA 1OXCA 3ACHA 3J7Yq 1JBCA 4CXXA 4RHV3 3Q8FA 3POBA 1RUE3 5C8CB 4ITCA 5HXEA 3QACA 2QJVA 5KX5E 1AR82 4KX6A 1HXS3 4K20A 4FPCA 2VK9A 2FDKA 4AHZA 1K45A 4MGSA 4XIOA 3ZR5A 4GWMA 1CX4A 4M01A 2CM0A 1W8NA 4A2UA 5C4WA 5FP3A 1STMA 4HMZA 1DZTA 1Z8UA 2LSGA 1MMGA 5JSRA 4P9YA 5C8YE 2BV4A 5KHIA 3O1TA 1HX1B 5CB4E 1O3XA 3MK7C 5ANQA 3I2IA 5K0UB 4AVCA 4YVSA 4QWNA 2D97A 3HIFA 2FJEA 1XDPA 1SDWA 3K77A 4IT4A 2RM23 4LF5T 1TNRA 1ULCA 4C1XA 3RRDA 4A3XA 1QXJA 3VBRB 1XNKA 3VKOA 2VCBA 2OW4A 2VASA 1DCSA 3Q2MA 4AI9A 3CX7B 5FAXA 4NROA 4IDPA 1H1IA 2JG8C 3MO4A 4WM7A 1DLLA 5A7OA 2J62A 2WQ8A 2DCFA 3WAKA 2NN8A 1CZVA 4DR4T 3PV0F 3SKVA 1HS7A 2ZGNA 4XC9A 3KLSA 2YFZA 2WDVA 2ID4A 4K3UA 5FZMA 2I74A 1ZYBA 2ZGLA 1US3A 4O4JE 2SPCA 2AH2A 3LPFA 1N3OA 4CN1A 3M4FA 4UV9B 1NCQC 2LE8A 3OYWA 4IGOA 5FZKA 5JMCA 1WMFA 3ME2A 3IB3A 1QJEA 3CZJA 3OOXA 1VOMA 3MUZ1 1AR72 4TUYE 2ZM0A 1C4RA 3FZFB 4UELA 2X9XA 2C9KA 1KFYA 1SQ4A 2A6VA 5LWBA 2GC2A 1BJQA 3AC0A 4H2AA 2QQIA 3WNKA 5LA0A 1FEWA 5HXCA 1W8ZA 4KU8A 4RSUA 1J83A 4CN4A 5IFPA 5GLUA 2PTFA 5I0DA 4JI2T 1RUH2 3CZUA 3UL2A 1MR5A 5EZYE 3M70A 3FHQA 3VL9A 3D8CA 5T54A 2WBKA 1EAH3 4SBVA 4NMIA 5FZ7A 2PELA 1A3KA 3D5OA 1WW7A 2CNAA 2N9DA 3AP5A 4HKOA 1DZQA 2QKDA 2B45X 5L9RA 3FLRA 4UF0A 4YW4A 4U33A 1OT5A 3H1WA 2R6QA 1MQTC 3BTXA 1AVBA 2WS92 2GDFA 1O3RA 2MPFA 4H7MA 5IHYA 2VURA 1SBDA 1JTZX 1W39A 5LRSA 1ND3C 3PUHA 4M00A 3KBUA 5HCJA 3DKWA 3ZCIA 2VTXA 1AX0A 3I9YA 3NRUA 3BPSA 2XQ6A 5HXMA 2VZOA 4LBLA 2ZMAA 3UU3A 5A6YA 2GNMA 1B35B 4DR1T 4GB32 3ZKRA 4JTOA 2E9XC 4PAGA 2JG8B 4Y3OA 3IBMA 1RUNA 3J8F2 2XJVA 2NP9A 3FHAA 1AL0G 2QNKA 4XMAA 5JDQA 3ZSEA 3I0QA 3S7IA 4Q4V3 1G9AA 3RQWA 4C90A 1AYM3 3P50A 4AG4A 3P7IA 4EN0A 1XE0A 2I07B 4ARYA 2HPLA 4TV8E 1OQDA 2ENRA 4D69A 3LKJA 3O1OA 2G9FA 3OUIA 1UZWA 3IM0A 2CWSA 1RUI3 4AEDC 4DR5T 3VD3A 1YCIA 4P9WA 1DYKA 1PMIA 2WZR2 5IVEA 2AE9A 1NLSA 2ZKNA 5J98B 1T98A 3LDRA 3I49A 2VCAA 5FZ3A 2ZMKA 4D6RA 4JAAA 4E4SA 3H3MA 3KFWX 2XXZA 4LPLA 1VAMA 4FPOB 4B3MT 3ACFA 1M62A 1PGW1 3NNLA 3VGIA 4JBWF 4YTPA 3H3AA 2W1UA 5FRAA 5FPAA 2JX9A 4A42A 2RS13 2W4XA 5JRCA 5FYSA 3HT1A 2DUPA 1PVC2 4HT1T 3IA3A 4KBZA 2HWF3 2C0ZA 3CJIC 4N8MA 3VKFC 3NNGA 4GZ9A 2Q8CA 5BNNC 1MQTB 3TYJA 4NN0A 4UYBA 2DYCA 1GQEA 2Z42A 4UBHA 5LNKA 3PIGA 3ZC1A 3W58A 4LT5A 4BMBA 1QLBA 1D7PM 4Y5Z0 4O4HE 1ND3B 3FHNA 4PIXA 2IDOB 2IXLA 3TEZA 2Z6EA 2V7IA 5L3DB 4WZCA 2WZHA 5J48A 3POYA 5JDGA 2DDUA 1ZRDA 3F95A 1UOBA 1KDKA 2GC1A 4KWKA 3HT2A 3WG4A 1JI6A 4R8HA 3IDEA 2E9XB 1VMFA 3DPRC 5AVPA 2QFEA 4QKNA 3ZFFC 1CIYA 1PGL1 5HV0A 5FIXA 4XUPA 2LTNA 1J84A 3CQXC 2F4VT 3JC6D 1MIWA 4DUWA 2DCZA 3H9AA 3WDTA 5A7PA 1YKEB 1ZRRA 4V2WA 3KBTA 3AEAA 2YC0A 1X8MA 2ZGOA 2DF7A 1AL21 1AX2A 4XHXA 3ENRA 4QDQA 3CIHA 3DYMA 1W99A 4AEDB 5F9TA 2NMNA 5ABFB 2YC4A 4ILBA 2DCTA 5LYJE 1CAXB 3CEWA 3C3VA 5LJNA 1F15A 3JBG1 1CAWA 1FV3A 1OHFA 4F7ZA 3HNYM 5CKMA 4E7SA 1K5MC 1QJY3 5ABJC 5FZ6A 3IDCB 4A5XA 2PXJA 2PHLA 4JQTA 3P4QA 3ZYBA 4L97A 3RQ0A 1HF8A 3OPWA 5DAQA 3PL0A 4YSFA 5A32B 5IVCA 2V4VA 4DY5A 5GONE 4BISA 1TG7A 4W65A 1DGLA 2XLGA 3FMGA 3CJIB 3SCFA 5SV5A 4AVTA 4LNVA 3PUIA 3N9LA 5CB7A 4K8RB 5BNNB 1WRDA 1C5IA 1PIV2 1BKZA 1OURA 1O59A 2IC1A 3RIFA 4PK4A 1L0VA 3WCSA 3KT1A 4D6QA 4CYDA 2HWE3 4GK5E 3NRYA 1FMD3 2Q9QD 2BKPA 5FR3A 3DUIA 4S2GA 3BIWE 4DUYT 1OWAA 3HA4A 3O1SA 3L8RA 4XFBA 2OZJA 4U36A 4YG3A 4CI3B 1XMOT 4LXLA 1SDDB 1VBB2 5DUUA 4NRPA 3G6JB 5FY1A 3BALA 2JMKA 1VBC2 2EVXA 4L0PA 3DPRB 3TLTA 4C91A 3JCFA 5JOWA 3NNMA 1LENA 3DEMA 1DFQA 2D0TA 4E2SA 1VRBA 3JD72 3ZFFB 3GN5B 1RVF2 1JOJA 3THTA 2GP5A 3CDZB 4PW8A 3OB8A 2ZCWA 3S30A 1RHI1 2DCYA 5F32A 2CGOA 2LM2A 2EF6A 4YHHT 4XZCA 4WVMA 3JCIA 2A6ZA 4OZXA 3N4MA 1GZWB 1JYIA 3RX6A 4DS0A 1Y64B 3M8LA 5A7WA 4YARA 1GNHA 4C0BA 3VKNA 4CCKA 4ZS2A 5HXVA 2C6SA 1MMNA 3QOFA 2WWVA 5CFDA 1HLCA 2GSYA 3BOPA 2XJUA 4CP2A 4MGTA 4PDWA 5GZCA 1LHWA 1VRH2 5I0TA 3OBAA 4CEYA 1K5MB 4LOSA 1IOAA 3E22E 4QH5A 4HVRA 1J3RA 2NMOA 4QQHA 3ZPOA 4RR3A 3FBYA 4LLFA 1VBD2 4A7YA 2YPDA 4Q29A 2Q8DA 4HPKB 4FQ4A 3ZMOA 3KQ4B 2HLEA 2V7MA 3ILFA 1QJX1 2D6PA 3MDPA 3AMMA 3U07A 1OI6A 1X9TA 3ZDSA 4FFHA 3VHRA 2XQ7A 5LBMA 2VVFA 3ZN1B 3A21A 1IZ3A 5A7NA 2C9AA 1GQGA 1XYPA 2NM1A 1R091 2EIGA 1BCXA 1URXA 1UD1A 3DYOA 4EN7B 3MKDA 3V64A 3AKPA 4LO7A 3QBQA 2O14A 2NW7A 3I0OA 3PUSA 1DQ1A 1DQ0A 2VO5A 4IV1C 4CE8A 4LF9T 3ZT7A 1UMIA 3C7OA 5F2SA 5FZ1A 3H1YA 5JR2A 1M7KA 5DZGA 4JI3T 3OKQA 4GKKT 1NY72 4R9CA 1FAYA 4ILCA 4BLJA 1UY3A 2VMGA 4EWEA 1FPN3 1UPIA 1MIVA 3R84B 1PGW2 2W52A 5A6QA 5LASA 1VE0A 1DF0A 1G9FA 5KWRA 1AZDA 2JKBA 1NT0A 1YO8A 2ZAAA 4QX0A 4OFGA 3AE5A 4AWDA 4XXAA 2CHHA 1WCSA 2D6LX 1ULPA 4DRRA 3P3NA 1QOTA 2LEHA 3K4ZA 4XDQA 1RGSA 1BYHA 2W39A 1RUG3 4FFIA 4XETA 3RI5A 1AYN2 1HX8A 2VW1A 2JQKA 3POJA 1LRHA 2Q1FA 2UURA 1D4VB 1JW6A 1UCXA 3NZQA 4XXPA 4D8MA 1YD8G 1AR83 2VXRA 4I0UA 5DAXA 4O65A 2AXDS 2WFPA 3LF7A 1FYUA 1HB3A 1A6CA 4ORFA 5I93A 2VOWA 3P4WA 2F4LA 4Q1RA 1NX9A 4IE7A 4XF3A 3AXJA 5FZFA 3ES1A 2V5CA 1OMIA 1GOHA 2BG9B 1PGL2 2A75A 3O0WA 3POIA 2B9UA 2FHRA 4A56A 3VBFC 3EB7A 3ZMTB 3OYZA 2WA3A 1MIYA 2BVVA 4DBQA 1N47A 2EXHA 4ES8A 1BR4A 1RUJ1 2OUJA 1AL22 1MVQA 1GQPA 4QKDA 5F3JA 2VL0A 3A8YC 3V56A 4IE6A 1WFDA 4WW0A 2J1RA 3SH3A 5BPXA 3A22A 3RIAA 1W28A 4P09A 4NIAA 3WHTA 2BVBA 2PG8A 1DQ4A 4ES9A 3NW4A 4IV1B 3KF5A 1BVVA 4ERRA 3LEMA 1ZEEA 3JU9A 3SKJE 2DWKA 3JBG2 1A34A 4QX7B 4LBQB 4UFLA 5L73A 4AQYT 3PUQA 2UXCT 4KMCA 4I09A 4M3CF 5L9BA 4B3ST 4DEVA 2A6WA 1LAJA 4EYYR 1V0AA 2EHOD 2RMU1 4Q0SA 3WDYA 2V73A 2TEPA 4YW2A 2XHNA 2AGSA 3I8TA 3I3MA 4XJZA 5L7OC 1US2A 2QUOA 2VZ3A 5JDBA 1UOFA 5LATA 3OTOT 2BBVA 1AR73 2Q5TA 4LOTA 2XBO2 2WFF2 2K9ZA 1V6MA 1QWRA 1HKDA 3ZIWA 3CO2A 4FT8A 3AEFA 1MMDA 4W6WA 3OEAA 3CU7A 4YFZA 1KEXA 4QGNA 4X66T 3B93A 4UFMA 3UFEA 1RUH3 4PHZA 3KV5A 4JRAA 1KNPA 3GDBA 4YFWA 5FP9A 5F1RA 2B42B 5FZ8A 5IAXA 3H8UA 3SFEA 5ANNA 4TV9E 3MGUA 5C3QA 2VZQA 3VBFB 1HRV1 2VM9A 1W6NA 4CP9B 4ASLA 1AXZA 3GZEA 3UU5A 4H7LA 2VUCA 1RHI2 3TLUA 4OHWA 2D43A 2VTFA 2PAEA 4PT6A 5CGMA 1ULEA 5KMGP 2XVGA 4DXTA 3P3PA 2LSIA 1YQ5A 1CJDA 4EGWA 1CAVB 1AR61 4NPMA 1QJU1 5LMNT 1V70A 2YY1A 3BI3A 4NAMA 4G3YC 4IERA 5BNPC 3UK9A 3P5BA 2VZSA 3GNEA 2I59A 3JC6C 3AZZA 3LB9A 1YHFA 4JKLA 4GB33 4L0RA 3S5QA 2YPJA 1XZYA 3SS1A 4GJZA 3J8F3 3LDKA 2HWD2 4Q4W1 1C8M1 4BDVB 2DBIA 1AJKA 4R4XA 5FY0A 3VBSA 3N36A 2WY2A 2C24A 1R083 3ZSKA 1N1TA 4CU8A 3RYRA 5E0OA 2EXJA 4N43A 2WJSA 4X20E 1UKGA 1D0ZA 1QJX2 3FE5A 1E5HA 1MS0A 5AQQB 4PLMA 2QA7A 3O1HA 4AI1A 4FOWA 3SNMA 3H3UA 1KRIA 1AHSA 4QXHA 4XAEA 2E5LT 2H7OA 1FOD1 2KM2A 2GMPA 2JD9A 4A45A 2QDNA 2ARCA 1OQEA 3TWIA 4AL9A 5JXIA 4UFKA 3WLUA 2N7GA 4XQWA 2VUJA 5IVJA 4J2CA 3R0RA 2WZR3 4QXBB 3ZYKA 2ES3A 4IEVA 3PTRB 2AACA 5ETWA 2QQUA 1QY4A 1FIOA 2VKDA 5KHKA 4IDZA 4UVAB 1V9U1 4HLTA 4YZ3A 3VL8A 4YM3A 3U3IA 2C5DA 2BGOA 2Y8KA 2MTQA 2Q9QC 5DXDA 4MSVA 1CONA 2WZEA 3C7FA 2YZ4A 3MACA 2BVMA 4AI6A 1HIXA 1PVC3 3MICA 2W87A 4EZHA 4OI1A 3ZKUA 1JNRA 4KI0F 3GA8A 1FV2A 4CDWB 4RL7A 2P1BA 5HWYA 2X53S 2PFVA 1CAUA 1S0DA 1JOBA 3OVUA 3QH7A 1JZ2A 1RMU1 2K48A 3QK6A 5I8YA 3AL6A 2OVUA 5CBLA 3ZSJA 1I9RA 4HWCA 5BNPB 4HWIB 5HAXA 1V6OA 2B7YA 4PFPA 4CZZB 2WNUA 4PLOA 4FPFA 1IQDC 2JXAA 2IFWA 1KQRA 4Y20B 3C98B 2IFRA 1UF2C 1EP0A 2PHDA 1HX6A 1EUTA 5A3OA 3RMXA 1ULDA 4JGZC 4NIHA 4JC1A 2OKXA 2H0BA 2ARXA 1FI2A 2J1UA 3O7OA 1OSGA 2ES0A 1UZZA 3FN9A 4HN1A 1JXNA 1Q8VA 3LD8A 2XG3A 1HR0T 3ZT5A 3IAQA 4N9IA 3VZOA 1PHMA 3QD6A 2RPAA 2GC0A 3B5MA 2JICA 4OHZA 4B6XA 4C0HA 2JRKA 1REDA 1OXZA 4XFIA 1VP6A 1J3PA 1LOEA 3A0KA 2ZGRA 2DTWA 4LA3A 3UJOA 4CN6A 2DUQA 2UXBT 5LHHB 1F2NA 3VBOC 1EUUA 1M4WA 1VBA1 5J7MA 2CDOA 1YQ2A 5I0RA 5IT6A 4NWVA 4AFDA 3MIBA 4PJNA 2Y48B 4PLNA 3TLVA 3O14A 3DXUA 5HEUA 2RMU2 3T2QA 2DBNA 1ENSA 2HEVF 2V6XA 1JYCA 2WUHA 3QH6A 2H6BA 1P8JA 1G9CA 2PLV1 1UMZA 3C51A 2WT1A 5D1IA 4NWWA 4GXLA 3APBA 3ZYHA 2ZA9A 3AA7B 2ZM6T 5JR9C 5JREA 2PTMA 1ZA7A 4L8QA 2VB6A 4KG8A 1I6ZA 2VCMA 3L2YA 2WNVA 4S2DA 5F5WA 2Y6GA 1YW0A 4YM0A 1J1LA 1HRI2 2CBIA 4TLGA 5FWJA 2WB5A 5KHJA 2VQAA 1BZWA 2BWAA 5L9VA 3LEGA 4RHV1 3HEIA 2ETEA 5I0SA 3OGRA 2BDEA 1RUE1 1YC61 1VBC3 1OUSA 3VR9A 4O2AE 2CMRA 2V5DA 2VVEA 1AXKA 2CXFA 2XB6C 2Q30A 4GMP3 2BRTA 3H7JA 2I45A 3JD73 4PIZA 2QQLA 4ZZ5A 5EP9A 4YJ3E 2OUHA 4JGZB 1RVF3 2VZUA 1LU2A 5EYXA 5CEHA 3OBVE 1GOFA 3CF6E 3AB0A 2WR9A 4JRLA 3O1MA 5A1AA 3ZFEA 4MXWA 3C7HA 2ZMLA 1NA1B 4DV1T 4ZEYA 1G7YA 2CA5A 4QHBA 1AUYA 4YM2A 2JDKA 1AR62 2OQ6A 3ETQA 2UXDT 4RA0A 1OQ1A 3OJAA 3EVYA 3B9IA 3RC3A 4B4RA 3CKHA 5G04L 2IVJA 2RM21 4LKFA 2QZ3A 3RS6A 3CX8B 1DGWA 1VRH3 4YLZA 2WWUA 2XUMA 1AJ3A 5AQLB 3BVCA 1C8M2 3GM8A 1JZ7A 3MFAA 4NVPA 3ZIXA 5AQGB 4GIQA 1JUHA 4BWOA 1AF9A 4XJAA 3NWIA 3IZOA 1VR3A 5FZOB 2D7FA 3RF1A 5A3TA 2KT9A 3ES4A 1AJOA 3S4UA 4I3GA 3AAEB 1ZA4A 5FMNA 2W47A 3J9X1 4URAA 5JR9B 1F5JA 2XVKA 1ZZ6A 5CG9A 4JKMA 2XSBA 4HSLA 3UKVA 3RVHA 3AYEA 2VBPA 4BAYB 4YPJA 5D8AC 3HBZA 1YXWA 2WNOA 5FOBB 3QC9A 5AQMB 1SEFA 4QQOA 4UVBB 4IE0A 1S4CA 2UWAA 2WT0A 2XAHB 4QM8A 4QU2A 5KXJA 1JS9A 4IW3A 3OY8B 4JQRA 4BH9A 2C5KT 2NW8A 3RHWA 1GLHA 1W2OA 3RYHE 4KHPT 1POV0 3ACIA 2V6YA 1F8VA 1EAH1 2R49A 1LEDA 4HFHA 1N32T 5A33B 1FATA 1S2KA 4XUQA 4E2QA 1AYN3 4XIKA 4MYEA 3OSDA 4Y1VA 4TTGA 2KSRA 1RMU2 2LOSA 2MOZA 2A70A 1H2LA 2WAOA 3RIUA 1QHDA 1MNDA 2CE7A 2VBDA 3CQCB 3VHLA 3T4HB 1V00A 3DKQA 1D1CA 1NWMX 4YVSC 3ZSLA 4QH1A 2YROA 3FUOA 3LDQB 2Y6LA 3E08A 3H1MA 3SISA 2A3WA 1LB2A 2WDBA 5FQ0A 2R7EB 4QH4A 3OBTA 2V5YA 2Y60A 5ABEA 4ATFA 1LJ7A 4CCDA 3BQIA 2EAAA 1VPHA 4O4LE 5FZAA 1ZOYA 2LM9A 1UAIA 2DTYA 4AHWA 2BS3A 3OD4A 3OTFA 4WM7C 2X68A 1AL23 2KWIB 4Z82A 4HVOA 1YFYA 4EAHA 5J1XA 3RZMA 1XNQT 4QU1A 2QQVA 1Z78A 3FBMA 3WSOA 3VDBA 2XVLA 5D8AB 3RYPA 4WV8A 4Q8KA 5GZEA 2VNOA 4GYSA 5A3MA 4Z8BA 2FBEA 3JBG3 4Y4RA 3ALQA 4B3TT 4PJMA 5LY2A 3WOGA 3ZN6A 2JE8A 3RWNA 4XJUA 3FZHB 2XQ5A 2YINA 1SLAA 4A7KA 4K6BA 1S0IA 3E5UA 4QB6A 3G7DA 2BS4A 4IL9A 1AXYA 4J1WA 3PURA 1W6MA 3GHNA 3NKTA 5ACA2 4LFAT 2PLV2 2ZS6B 4FCAA 4XCBA 4HGAA 4CDQA 2RS11 2XJ7A 4FVVA 2AEYA 2LALA 1YI7A 5C9AA 4IV3C 1ZZBA 2QDRA 3W5NA 1U12A 5FPXA 3WG3A 3UETA 2JB8A 1Y3TA 5GKAC 2XQYA 2B8MA 3AMPA 4XUNA 4B29A 2XBO3 3MIHA 2WFF3 2LJLA 1UKRA 3UUNA 2X10A 3AE4A 5SV8A 5E88A 2WWSA 1Q43A 3GJBA 3FXDB 1IBLT 5L4EA 4XMIA 4YVSB 1IPJA 2HH9A 3U11A 2R1DA 3TLSA 2YDEA 3H3LA 4DXSA 5IK5A 1RJ8A 4ZS3A 5M0TA 4HETA 2D5FA 1ENRA 1CPNA 3MFCA 4Y1UA 2UU9T 5I0UA 1NZIA 2BOJA 2BOIA 1RHI3 4ILUA 1JHJA 3MLJA 4WM7B 4RGKA 4AOCA 4IEUA 4KMQA 2IC6A 2GP3A 2QQWA 4LO4B 4LR4A 4TZDA 3RYCE 2XASB 4W6XA 2JJ9A 4EIWA 4XAXB 4GOUA 4H3WA 3NVCA 4AXOA 3NJZA 1X36A 5LGUB 4UV8B 4AF9A 5FYCA 2XQ4A 4IREA 4FI5A 1PX4A 3AFKA 3OYWB 2M6BA 4HN0A 2HWD3 3U0ZA 3KF3A 2A72A 1PGSA 3BKZA 3UUBA 5C8CA 4NE9A 3WNPA 3RYFE 1O4ZA 3VD9A 1QJY1 3EJKA 3J4UH 4CUAA 4HWHA 3I9WA 2G9ZA 1QJX3 2K46A 4H63H 4BQ4A 3T8OA 5FK8A 2FQPA 1QH6A 4ZI3C 1OEDE 4BA6A 3C2UA 5FZ4A 4GQ7A 3RPUA 3BPZA 1ZVFA 4JI1T 4YY3T 4IV3B 4ISTA 4COWA 4WM8A 1CESA 5IUQA 5AQNB 2XAGB 1XWMA 1WLCA 4OFZA 1LTEA 4WBBA 2ZTNA 2BNOA 2DVDA 4XFAA 1N1YA 2PJQA 4UF0B 2WN3A 4F83A 5C3RA 4U7YA 2E53A 2D3RA 4LBKA 5LBFA 1X8EA 2GN3A 1HG2A 3ILRA 2FUPA 3AP7A 1IHMA 2D6KA 4YZ2A 3SCHA 1ZZCA 2F6BA 3VBRA 4RFT0 4CDXA 2CRBA 3UKTA 5C71A 1ZZ7A 4XFFA 1HTJF 2JD4A 1WCUA 5DAWA 2CAVA 2J1DG 4XJ9A 1PVXA 3K1SA 3I2GA 3W59A 1XJAA 4IEYA 5C6CA 4DUZT 3C64A 3WQBA 4XPVA 5IYZE 5IW0A 4OMCA 2HYKA 2B5HA 3VZLA 2ZBJA 2Q1MA 2LM3A 3I54A 1YFUA 1KFXL 3RRWA 1XU2A 2FZ2A 2WLPA 4DV5T 5BXXA 1XU1A 2GU9A 3PJYA 1UO9A 1NUKA 5M4YA 1H8VA 2VMHA 3PU3A 3IDBB 5C3SA 2R071 3PVNA 2I2SA 3J9SA 2R1BA 1W6PA 4FPYA 1HV1A 5A6ZA 4CUGA 4BQ5A 3ZSSA 3GBGA 3ZYIB 5F6LB 4QB1A 1W8TA 3HQUA 3O4XE 3IF8B 5FZ0A 4IIJE 3K4DA 3KSCA 1H8TC 3NWKA 3PJQA 2RP4A 2ZEXA 1R1A2 2RS51 1CGPA 5L19A 3KCYA 2PHFA 1ND2C 3AB3B 1HV0A 5DDJ2 5CA0E 3KZ4C 5FZ9A 4PFOA 1WGPA 1EV12 1JYTA 4JX0A 4AAXA 5GLWA 1GZCA 4X6RB 3BQLA 3P6BA 1UOGA 1Q56A 2HKXA 1ASJ2 1E5IA 3VLBB 4ZU4A 3B7MA 2GMMA 2HBTA 1ENXA 4XTPA 4D94A 3AEGA 1X9PA 2C4XA 2RMU3 3PDQA 2VKHA 3PNAA 1CVNA 4IDOA 1JUIA 1O7FA 2PHTA 5L3FB 3ONXA 1JZ3A 2XY8B 3WQ7A 4KWJA 2J1VA 2JG8A 1ZBE1 3C8XA 3I2KA 1C28A 3KDSE 2GMEA 5FFOC 3ZT6A 1HNXT 4CA9A 2Y26A 2R0FA 5FZIA 2C5JA 4IL7A 2RS31 4FTSA 2ZGUA 5LBEA 1KD7A 4OVEA 4JGYC 4FI9A 5KHHA 5JCTA 2NPIA 1HRI3 2LHRA 3WDVA 4IETA 1NCQA 4D7YA 2L9LA 4E27A 1AR81 1WCQA 1H0BA 2XQXA 3A7MA 5FY5A 2DFCA 3CJXA 1X79A 4IXLA 4NIGA 2ZOEB 2H6CA 3PUWF 4NHMA 4X1IE 5F5CA 3U14A 1W2UA 1Y9QA 3ZSMA 4BIOA 1W6OA 2FCVA 5K7PA 3L9JT 4NJ4A 1MPXA 2P3JA 5LCYA 1CAWB 3URFA 2R16A 5FYIA 2BWCA 1RINA 2BNNA 3MUY1 4CEYC 4EJRA 3ZN0B 1SLBA 3FX3A 3NJXA 2DLRA 4YFSA 2AYHA 4KWUA 5LRRA 4W8JA 4GD4A 4AGRA 4RR3C 4DR7T 1ND2B 2YBKA 1AR63 2BFUL 2E9XD 1S2EA 5IK7A 3WX5A 4Q4Y2 2XR4A 4Y22B 1T6GC 2WWJA 3RWKX 3WW4A 4NPRA 2GH8A 5J09A 5JWPA 3ETPA 1OEDA 1O4YA 5ABHA 1HB4A 4NIIA 1ND3A 3AE2A 4Q4W3 1C8M3 3ZFGC 2WDQA 4R9DA 3A5XA 2NW9A 2QCSB 2MEV2 2LKGA 2ZX4A 1XBFA 2VR4A 1RUOA 2LROA 1W03A 4H9RC 5APAA 3BK9A 3NV1A 3RFRA 3ON7A 1WA6X 3ZYRA 4OQ9A 2JDYA 3J7LA 1H6YA 2WNEA 5I91A 3T1HT 3NQHA 3V5SA 4FPKA 4FQZA 2Q4SA 3N9OA 1OA4A 1C5HA 1HB1A 4JGYB 4CEWC 1KDMA 1HJGA 4MV2A 4AQTA 2G0UA 3H3ZA 2WSVA 1AR71 4AZZA 1YYNA 2BS2A 2XGXA 4S2HA 1GZ9A 2X66A 2E31A 4TX5A 2JDMA 3TN92 4COFA 1BMV2 1SPPB 4ZU7A 4WVMB 2CU5A 1WCKA 4AEDA 4EROA 2OZ6A 1EZ3A 5ABFA 1ZV4X 4LEJA 5A7WB 5LZ6A 1CAXA 4NOTA 3E0ZA 1W9WA 4Y1ZA 4U2YA 3Q8BA 4N9HA 1CWPA 2YHJA 1DIWA 5L3CB 3TB0A 3ZXJA 4JI5T 5FZCA 5CFDB 3WW1A 4I43B 2QQNA 3ZM8A 4MVTA 4CEYB 2Q0AA 3UUMA 4HFSA 3PVEA 1OD5A 3H37A 4JDMA 4BB3A 1D0HA 1NE6A 2RG4A 1UX4A 4RR3B 5A32A 3FZLB 2WS91 1FJGT 1RMU3 3CJIA 2D6NA 1BHGA 3F31A 1XB9A 5BNNA 5IWAT 3MLKA 3K8PC 4MGYE 3GWHA 2P6CA 3HPNA 3I59B 5FMOL 2R072 3ZFGB 3MJXA 1CPMA 1C8NA 2J1SA 1LHUA 4EN6B 1O91A 1Y01A 2M67A 3LA3A 3J8F1 5IHRA 4AVSA 4BLIA 1ZREA 4BZ4A 2PBIA 2ZX3A 3ZPYA 4OK0A 4MX3A 4WVWA 2P3YA 4Q27A 4EOZB 4D6SA 1WYCA 2J1EA 4RS5A 2WQYA 4K9SA 3LQCA 1PM4A 2X5IA 3VDDC 2RS52 4INDA 1NCRC 5AFUL 4HTEA 2JB4A 3ZFFA 4O61A 2V7LA 1OOPA 2YBPA 2XQRA 1W90A 3EHKA 3H8RA 4CEWB 2NLRA 1IKPA 1QGLA 3WP6A 3GYDA 5FJKA 2CWYA 1RUD1 4P5HA 2ZACA 3RMYA 4H14A 3B69A 1S0GA 3VD7A 5B2GB 1LOAA 3LJCA 4CP0A 5FKYA 2VMIA 5LHIB 4GAZA 1UZ0A 3HBKA 5ISLA 4ILAA 4AQFA 3ZXDA 3MV11 3R6SA 1O3SA 2UYBA 2P3IA 3O12A 2WO2A 4P02B 4QGLA 1KNRA 1KNZA 5ACA3 2H89A 2PLV3 5FUPA 1K5MA 5ABJA 1ZBE2 3ZN5A 2PMWB 1GWMA 3RRCA 3AXJB 1OA2A 4ARXA 5F7UA 4C8DA 1WMEA 2RS32 2RDSA 2W3JA 4Q26A 2EIDA 5EXOA 3AMNA 2D5HA 2D0UA 1RXGA 4E8DA 3THPA 4TN7A 4PBPA 4QX2A 2KXLA 4QPIA 1DQ2A 4OI4A 1GUIA 2YK0A 4J6GA 4EQVA 4XQ4A 1JYWA 2GN7A 2FCTA 4IESA 1YEWA 2BU9A 5CADA 2PFWA 5A3UA 5JPNB 2VMCA 2Y38A 1GP5A 5K9YA 3WF4A 1F9KA 4NRMA 2BKOA 3KT4A 4M0NA 4YW7A 3M3QA 4IEPA 2NZ9A 1NENA 3VDDB 1YI9A 1NCRB 4XCAA 4J1XA 3P4SA 1ZBA2 4JDNA 1E5RA 3I3QA 4PBOA 1MMAA 4TWFA 4J25A 4MGQA 1XYOA 5IATA 4DV3T 3IDAA 3SMHA 1V6JA 4W4ZA 4N43C 3LZZA 3Q5XA 1N36T 2KA3A 1S0JA 2P34A 3HR9A 2B1EA 3IWZA 3WUDA 2X9WA 2W95A 3KMHA 1TME2 4G2AA 4XW3A 2PAKA 2OPWA 2ZMNA 3NO8A 4AKLA 4ASKA 5LBBA 1B35C 5KXCA 5JDNA 4N90A 5FY4A 1VALA 1WW6A 2OV9A 4EEDA 5CA1E 1YFXA 4BE3A 5HXHA 2KLQA 3NZPA 4AHYA 4U2ZA 1PM7A 3JQWA 3HWJA 4Z90A 2GK9A 5JOZA 5A3NA 4HZFA 4COVA 5CAZA 4KL1A 4IUGA 2PHXA 2I0MA 4OYKA 4K1YA 2YDRA 4H9NC 1IBMT 4YVWC 1PIV1 3UESA 1GKBA 4LBQD 5E89A 4O7XA 4AEJA 4Z07A 5AQIB 2W1SA 3RSJA 4O2BE 5FVLA 2V7KA 1AR91 2TUNA 2X0YA 2FDHA 2HEYF 2WABA 1NLRA 4Q0QA 1YXRA 1W09A 3MLLA 2ORXA 1UYXA 5F5AA 1L7QA 5FBZA 1H1MA 1D4M1 2DHRA 4P9IA 1KS4A 1O4TA 4EB6E 5K4LA 2DL1A 3UT5E 3AVSA 3M3CA 3IT8A 4DMWA 1VBB1 2H3RA 2LT3A 1VBC1 3AECA 3WP5A 2DWRA 4QX8A 4DV6T 4GMP1 3NAPC 1WLWA 2ZM8A 4TZ4C 2VQFT 3JD71 3GGLA 2ATFA 5F3CA 4QXCB 1ULGA 2VULA 1RVF1 5LK7B 4MADA 2CHOA 2ZGTA 3H50A 2VUAA 4DOUA 2PQSA 2C26A 2E26A 3U1XA 1LHNA 3POFA 5JZGA 3VZNA 4DV7T 3VD5A 3E6CC 1HXS2 4CPBD 1B7TA 2BPA2 4JI6T 4N43B 4F6RC 4CUBA 4G4FA 3ZVXA 4YW6A 2CAUA 3UTKA 4QXHB 1UY1A 1D0YA 4PI2A 1ALYA 4G63A 4AFCA 1O6UA 4KUMB 1VRH1 1NAFA 1H7CA 2DFBA 5C3JA 3T2TA 1VAVA 1UPSA 2H0VA 5FLJA 1MEC2 3AE8A 5E8AA 1VBD1 2AEZA 4CPBA 4XBLA 3PUGA 5L3BB 4Q2FA 2WINB 1R1A3 3LDBA 5EK4A 3LGRA 1SLCA 2XKPA 2YDQA 5DDJ3 4YVWB 3USUA 3ZOIA 1LOBA 3PUAA 5JI7A 3VBFA 1PZ8A 3BGAA 5FP4A 4K0UA 3LSEA 2XWBB 4OUSA 5FYVA 1FMVA 2E6VA 1W2TA 2LS6A 4ISRA 2VVNA 3K3OA 1RUD2 3SEPA 4MXVA 5FZDA 3M3OA 4MZUA 1YQ3A 3ABZA 1RUC1 4FXKB 4JV5T 3WNLA 1CAUB 4AI2A 4JEHB 2DVAA 4JTNA 1IS4A 3L2HA 1NY71 1VMHA 3TBDA 4KBBA 3K4AA 2WAUA 4MGIE 2D9DA 2JE9A 5J96B 4L99A 2BZBA 2W62A 3IKWA 2GNDA 4YHJA 1WD4A 3NAPB 3DCQA 2WO3A 2CXLA 1SFYA 5A3PA 1YJLA 4XQDA 3V0BB 1SG3A 1WWYA 2YMZA 5JDLA 2ZGSA 4AE2A 4UIGA 4QX1A 3NBXX 3WDWA 1MZFA 3O0XA 2Q8OA 1ZRFA 2WDRA 4FXGB 1XE8A 4DMVA 3N7LA 5LJMA 3KHBA 5JUVA 3VZMA 3NNJA 1AYN1 4A41A 5L7OA 4K40A 4OCTA 2Y6HA 2V8SV 1RC6A 3ITQA 3E5XA 4ZXLA 2JDHA 2VOXA 2KD7A 3BB6A 3CNAA 1XQNA 4XBQA 3INAA 1W9SA 4K8FA 4O8SA 3FUQA 4QXBA 5GZGA 4IE4A 4LHSA 1SCRA 2TBVA 2DU0A 4OHXA 1ZKEA 4Y24A 2BQPA 1JOPA 4L2NA 3PDYA 3CKDA 3TKLB 1XNRT 2Z2SB 2ZHKA 5H9RA 3I1AA 2RJKA 5L4HA 3GCXA 1ODMA 4QX3A 4AEMA 1REEA 3KM5A 5F3IA 5FZLA 4YSZA 5CFBA 3RZLA 2XPKA 5HEOA 5T5OA 2VW0A 4CCNA 3UU4A 4Q4Y3 1X82A 1NLQA 3GBFA 5CNAA 3PU8A 1UX6A 3U10A 4KP3C 1KITA 2ZX2A 4COUA 1EYBA 1QF3A 2WCAA 3ZCJA 4DR3T 3MIEA 3WVJA 4N7UA 4Q4V2 3SWHA 2EA7A 2MEV3 3DYPA 3WT3A 3M3EA 4QDRA 4MGKE 4DEQA 2RJLA 5BNPA 3I2HA 3N3HA 1XNDA 2VVDA 1COV1 5D21A 1G86A 2JENA 5AFEA 3V0AA 2XQ9A 4L92A 4OYUA 1QEXA 4Y20A 2VQTA 3EAMA 3F2EA 5TAOA 4AI0A 4Q4X2 2M6IA 1RUI2 3T0DA 5FCCA 3IIAA 3BU0A 4OYJA 2KXPB 2W5FA 4XBNA 4P9XA 4P0AA 2D6OX 2DURA 1AR92 2C5IT 5CISA 5AQJB 1J1JA 2ZEWA 4MLOA 4A97A 3CIRA 1VLNA 1VCTA 2XBO1 1O8PA 5AQOB 2WFF1 3CX6B 4XF0A 3VV1A 5LOVE 4BXSV 1D4M2 2FDIA 4M0HA 4U74A 3MF6A 4BQ3A 4QQ2A 2VZPA 4BMEA 1VJ2A 3ETUA 1QOOA 2XAFB 2HWF2 4JI7T 2W67A 3BN6A 2WU2A 4FPEA 5BMVE 1LECA 1CR7A 2X0HA 1BEV2 1ZHCA 2Q9QA 1PZ7A 3T08A 1X50A 3POGA 5JH7E 3MIDA 4LF7T 3IPVB 4JI0T 1HQLA 5FO9B 4FPLA 2DWGA 2YYOA 3FWEA 1HQNA 4UWDA 3U78A 1WBLA 4ZI7E 3WG1A 1QDOA 3LPGA 3B02A 4W6YA 1O5LA 3MIFA 2R073 2FZ1A 2UYAA 4AQ6A 4OUMA 4EV6A 2BKNA 2FMDA 1PK6C 3TRSB 1C1LA 2HWC1 2HWD1 3GZUC 3LA2A 1LGNA 4LO8A 2ZPXA 4B1MA 5AQKB 3RG0A 3JAEA 3T1YT 4ZXEA 2BG9C 2Y8DA 1O8SA 3CPZA 3VHNA 3ONLC 4GH4C 1N1VA 5H6RB 2RS53 1GMMA 4WVVA 1CN1A 5JTGA 4LKDA 5HPOA 3Q8AA 2R061 3AMHA 2WZIA 3TEWA 4XF4A 4LBNA 4YW5A 2WC2A 3QB5K 2A5ZA 3I2DA 3P4PA 2PHWA 3BTZA 3DXTA 2JQQA 2BZDA 3K2OA 4YZ1A 4YTNA 2OA2A 4CDQC 2QQMA 2OQ7A 4OHFA 1QQP2 1RUC2 3NSTA 4GWJA 1QMJA 1H30A 4KG0A 1GNZA 5ADXL 5FBJA 4L11A 3WF1A 5FO7B 3EDUA 5HEHA 5FPBA 3D4KA 3EXUA 2VL8A 1SE7A 3VBOA 4EWAA 1CZTA 2UUCT 4QHZA 1J5ET 2X09A 1U5PA 1ZBE3 3ZX7A 2ET7A 1ZZ8A 1ULFA 2HWE2 4ONUA 1U5XA 1H1AA 5K8SA 5FYUA 4Z92B 1UWWA 4HK8A 2RS33 1SLIA 4LMLA 3AE9A 5FZOA 1Z7S1 1X7NA 1RUF2 5FKCA 4YZ5A 3U4XA 3BU7A 3MZKB 4AKRB 1KXGA 5JR9A 4ZOLE 4UT5A 1NYWA 2PN5A 2CY6A 1LOFA 2YU2A 1POV3 2AZ5A 1NAEA 2A9UA 5FUIA 1PK6B 5B4NA 3RJ2X 3D6EA 2KWHA 3AXDA 4AIUA 5A7SA 1CUNA 2ZJCA 5JXHA 4L5GA 3DL3A 1GOGA 3D82A 1I6XA 1UK5A 1T72A 1GICA 1W9YA 4Q8LA 2IXHA 4GH4B 1IZNB 4YGEA 3O1RA 3OY8A 1UZVA 4KNCA 3WNXA 1GR3A 2XPJA 2YKSA 1JYXA 5FPLA 1ZBA3 1NEKA 4AKHA 2A3YA 5HYAA 3DTOA 4TLFA 4ZI2D 4OLLA 5HI0A 2H7VC 4CCMA 5J1GA 2IZWA 1R64A 1BK0A 1D1BA 4IDNA 4CDQB 4FBFA 5JQGE 3JUUA 3MHZA 1RTVA 1TME3 2W94A 1UZYA 1MZ6A 3Q9DA 3GJAA 3HAGA 2QGSA 3VKMA 4AISA 4CSWA 3FFZA 4WM8C 1MS1A 5DUVA 4O4IE 4BPZA 3T2OA 3WR0A 4XZUG 5FXXA 2Q1ZB 1NOVA 3SQOA 1JU4A 4Y5TA 2X9HA 1COV2 5HCFA 3HKBE 5GZFA 1JHNA 3K75B 4R9BA 4Z2WA 2D93A 2X67A 3HKDE 2ACZA 3ZXEA 5HEJA 3R4SA 4UXNB 3LK42 4FPJA 5FYZA 3OJBA 2XQAA 4CDXC 1Y4WA 2W08A 1XNAA 1U5YA 3V65A 4WNKA 2V1DB 3NKGA 2RR11 2FD8A 3POSA 4JKKA 4ZPIA 3X29B 4GWNA 4CCOA 3AA0B 4LIVA 3AYDA 2WT2A 3SEEA 2E33A 1RB8G 1KS5A 3UNPA 1BBT1 2IXJA 5FYHA 3MA9A 3K46A 1HRI1 2EHOA 1S2BA 2UWCA 2XUEA 3E97A 5L3GB 1PO11 3UYJA 2XJTA 1OH3A 5D8AA 2N1GA 3T0BA 3ZR6A 5KC5A 2E2AA 2EALA 4E4DX 4YWAA 2VQUA 3FBLA 2Y64A 1UQXA 5JPMB 4IDQA 3ROUA 2VQET 3AEBA 5T3NA 3TEYA 1BR2A 2Y34A 3RGBA 2GNBA 2HJIA 4GJYA 2BBHA 4A6OA 1RUG2 2VJXA 2ERFA 4YM1A 2UY8A 3UULA 4ZHQE 4CDWC 3O1PA 2WS93 4KU7A 4ZXKA 4NUVA 4NPPA 4LO5B 4QPGC 3Q8EA 1JZ4A 1FX5A 3AKQA 2WP9A 2KINB 1DU2A 4MO3M 3DV8A 5DQ0A 3AE7A 5DZEA 2HWB1 3VBHC 4YTMA 1W2AX 3N7MA 4WVZA 4A98A 3PE0A 4CCLA 4B4QA 4WM8B 4BYYA 2LHNA 1VB4A 2HWC2 3WHUA 1MEC3 5T5JA 3PVOA 1XSQA 1A78A 3ZYFA 3RZHA 4UFIA 5FY9A 3WQ1A 2WYSA 3B00A 4DPNA 2JQHA 1XE7A 5FK7A 3W21A 2BYVE 5LK5A 2X29A 1UU5A 5A3LA 3LOIA 3VDAA 3ZXAC 2ODVA 3B94A 4U31A 2LSYA 4DV2T 3RKOA 2QQPA 3ANWA 2BJSA 2VNGA 2R062 3W5MA 3AL5A 4CDXB 5CFCA 4UEMA 2HYXA 1C57A 1TMF2 3NV2A 4X5TA 1UNBA 2IUWA 3B9CA 1W0PA 2W46A 4UR9A 1ONAA 3ECQA 1OH4A 2G19A 3PTYA 5FYYA 5CKNA 1RUD3 1XRUA 4MOAA 3LEIA 1H6XA 1CHUA 5IAVA 4META 4N53C 4AR2A 4Y1YA 2ZGMA 2WO1A 4UW4A 2IUBA 3OBZA 1GFF2 1EPZA 2ZHMA 1UU6A 1UGOA 3WDUA 4DV0T 4BM8A 3MI8A 5LHGB 2E32A 2A7AA 3I2FA 5L3EB 4BK4A 1J3QA 2IAKA 3J26N 1CD3G 2QRXA 2WSSV 2EXIA 3AM2A 2QE3A 3V5UA 1WMDA 1LHVA 1WR6A 3HI2A 1W6PB 2V09A 3WD5A 2BTVC 2R32A 1IQAA 2J22A 4QPGB 1UCUA 1Z7S2 4LHLA 3AA6B 1UY2A 4XTMA 2OS2A 4ATEA 1LGCA 3WV6A 4JDOA 3NRXA 4XAAA 2C0SA 4LJHA 4IV3A 3VBHB 5C70A 3P1IA 4HN9A 1J58A 3AE3A 2IXCA 3Q5DA 5FXVA 1E5SA 1FNYA 5DQWA 4R4ZA 5FMCA 4YNIA 5EJZB 5JIUA 2VWAA 1PMHX 1D0GA 4M1PA 5HCMA 1OC1A 1W8UA 2DI4A 2WN2A 5IJRA 2PA7A 1OEDC 2JE7A 3D0JA 3CQGB 2RV9A 3C4ZA 3AFGA 1GWLA 1CZSA 4EN8B 5JXGA 4P14A 1WKYA 1M06G 4HXCA 3HKCE 4HL0A 4AK3A 1YIPA 3WDXA 3EQEA 3Q5WA 5FNVE 1S1AA 3AK0A 3O5SA 4V1PA 1NA1C 2ZGKA 1QNWA 4UFJA 3RYKA 2JG9A 1PNGA 5G05L 4AI8A 5F3GA 5JDHA 4MALA 5HV4A 4FPHA 2B4KA 4X8PA 3C4XA 3NJYA 3ACLA 4N53B 4BQ2A 3IBPA 2DNXA 1GNYA 3Q9OA 1R082 4QPWA 3ZN4A 2HBUA 5FP8A 4ZI3D 4NRQA 1ZZ9A 5DABA 5T5PA 1W8WA 2YUEA 2WU5A 3RZKA 3G06A 2R041 4LF8T 1L7RA 1NCQB 3LBXA 3TEXA 4TSVA 3DECA 4FAHA 5ACA1 2W00A 4I0BA 3PUXF 4O9EA 4Q4X3 1LEMA 2IIUA 1GQHA 3UGFA 3ZYMA 1PIV3 4LULA 4AVAA 3R05A 3ZMNA 2QYWA 3LIHA 2RR12 2ZZJA 2JMHA 2DVFA 3OPZA 1W6OB 3HN1A 1AR93 3MPPG 1JODA 1DHKB 4B7EA 3D0TA 3RKGA 1SLTA 5FUNA 1D2QA 5HBAA 3N2KE 1BBT2 1OUXA 4A3ZA 1D4M3 1IS5A 2WYFA 2AUYA 3OBRA 4AI3A 4BQYA 1PO12 3WF2A 1VBB3 4Q0UA 1RITA 4LBJA 4XABA 4E9KA 4X8NA 1MS4A 3A4UA 3WNMA 3LWCA 3EBRA 2X05A 4NIQA 5FWEA 1HNZT 1JZ6A 4HFEA 3H8OA 1OEDB 1VB2A 2AREA 4U2AA 1IBKT 1BEV3 3ESLA 5H9PA 3VKLA 1UUSA 4V2VA 5GM0A 2WA4A 3CL1A 3ZO0B 4HWFA 4YJ2E 4GKYA 2VKOA 2JQ9A 2ZEZA 4XF9A 3WI3A 4BJ0A 2JIJA 3AZWA 1W6QA 4Q5OA 3FLTA 5DJQC 4XDOA 1LU1A 4RS5C 3OUHA 5FMBA 2HWB2 2X5IC 4CQIA 4ZZ8A 2CV6A 1OFSA 1RIRA 1OOPC 4I0WB 5IVVA 3VRAA 2VOKA 1ENQA 1F35A 1F4AA 4ZY9A 4ZI2C 2XTLA 4PF5A 4RQPA 4HFIA 1HW5A 4X65T 1O5UA 1VBD3 2CWOA 2P37A 4E7ZA 4XHBA 5AC91 1I5PA 4UFHA 1UYZA 4PF1A 4P5YA 4MGZE 3WF0A 1Q3EA 2JIWA 5FY7A 2MNGA 4PI0A 2KMFA 4GKXA 2A71A 4UAPA 2NTYA 1JZ8A 4AQSA 1W8OA 2JEMA 4AQFC 2J47A 3LEKA 5T5LA 3QLQA 2MYSA 3ZYLA 2WL1A 1H8TA 5FXZA 2VBBA 4K7JA 3GHMA 3KQRA 2ET1A 1D1AA 1ND2A 1QQP3 1RUC3 3LCPA 4H55A 1DP0A 4IQPA 3GBWA 2JDAA 1F4HA 3NV3A 5BNOC 5E1RA 4DIDB 3LSDA 4Y22A 3VHPA 4LMJA 2D44A 1RYYA 5A80A 4CDUA 4YXDA 4HONA 3WNNA 4IGQA 3ORJA 5DG2A 4LBOA 5IK4A 4M3CB 3S6PA 4YGCA 2Z4FA 3UQ7A 3AKRA 4QPIC 3MW2A 4FOYA 3MV01 4LHNA 2E8IA 5H6QB 4PNIA 3ZMZB 1W9TA 2ODUA 1LRZA 1T7SA 4C1WA 4JZRA 4MG2A 1WCRA 2E5VA 1RUF3 3AMQA 5C4WC 1V6NA 2OLTA 1UYYA 1S0CA 4UOJA 1KJRA 5DZFA 3WF3A 5F8PA 2VH9A 4RS5B 2DVBA 4OMDA 1POQA 1SLLA 5CKQA 1HDKA 2XHKA 5C3PA 2X5IB 3RDIA 2GH2A 4Z8XA 1LOCA 4D7SA 4Z1VA 1OOPB 2NYYA 4JGYA 2WIIB 5C5TA 3I2OA 2LW8A 2R0HA 4OUEA 3CLPA 1O3QA 1SCSA 1LR5A 2QQKA 4H9SE 4DV4T 2JDZA 5JOYA 2EIBA 1SPPA 2ZHLA 5FKBA 3HNMA 5FYMA 1MS8A 2Y6KA 1MZ5A 3T1LA 3AP4A 1SBEA 2JDUA 2WO7A 4PIYA 1WBFA 5FZEA 1R1A1 2QBXA 1GBGA 1DBNA 4K1ZA 3VUOA 3ABVA 4AQGA 1SZBA 3E6BA 2VG9A 4I50E 5DDJ1 4QM9A 5ABJB 2VU9A 2XH6A 4LKSA 3HMYA 1GANA 4NPLA 4DUXA 4HVQA 4M4PA 1EV11 2YFUA 5AQFB 3UGGA 2YV8A 1BVP1 5BNOB 1V6LA 5JR7B 1SMVA 2G1MA 1QKQA 4CCEA 2PQQA 3ZYGA 5EJ1B 3U37A 1ASJ1 4Q0VA 2R042 1COV3 4UW3A 1SHWB 1YQ6A 2BUKA 1W3VA 3JADA 4TN7B 3I59A 3AZYA 4QPIB 2VMFA 1SA0E 3ZFGA 3I7DA 2O8OA 3O1JA 2Y6JA 2WLQA 3WINE 3KVAA 3AAAB 2Y6XA 4LE4A 5DPNA 4CCCA 3WG2A 3VDCA 5CIRA 3VBUA 2CCQA 5HCHA 1Q5OA 5CJ5A 1DDLA 5C4WB 2F17A 5IYYA 1W0AA 1LCLA 1OLRA 1GU3A 4XUOA 2MPKA 2BGCA 1W0OA 1W0NA 2X8KA 2YXSA 4BA9A 3X1DA 1IG0A 2XJRA 3THDA 2GAUA 3AEDA 5JDFA 2IW5B 2I6HA 2GNTA 4CEWA 5JZGC 5DAPA 2FDJA 3PLQA 2CWMA 1ZP0A 4LK7A 4QWNB 1Q8QA 3AXEA 1QU0A 2R6GF 2B39A 4LHKA 4YG6A 4ISSA 4AFMA 2XKOA 2XL9A 4AGVA 3F2ZA 2VVSA 5HEGA 2VD7A 1WR0A 3VKHA 2X0LB 3UKNA 5FPVA 4P00B 2XDVA 2J1AA 4EWDA 3HKEE 1NG0A 4W50A 5LBCA 4E8CA 3OEBA 4H9OC 3N7KA 4KH9A 5FY8A 1W05A 5FREA 4EV0A 4QKFA 3AE6A 3SOLA 1TVGA 2IWGB 2HHHT 1F5FA 1E1HB 5EK2A 2ZZQA 5E6HA 5FPUA 1K42A 4M4RA 5EJ3A 2LOPA 4QX5A 2OA5A 4A4AA 1UIKA 2SBAA 3FBZA 2V26A 4Q4Y1 1WYBA 3WXPA 4NHXA 4YGDA 2P4EA 2VOVA 5LBQB 5HCBA 4X64T 4RGGA 2VY0A 3WP3A 3PJAJ 3MW3A 4FP3A 1XNTA 2HWC3 3O1VA 3T0AA 5F6KA 2BP6A 3LFMA 1K12A 5DQVA 1JN2P 2CBJA 3CMLA 2XQ8A 1HN0A 1G6NA 3OUJA 1MS3A 2MEV1 3UV9A 4X1YE 1TE1B 3LAGA 5AC92 3H0OA 5FVKA 2VPVA 2BEOA 3UT0A 5LA6E 2WMNA 1QH7A 4TNWA 3SITA 5AQUB 3RZZA 3VD4A 3IHRA 1HJFA 2R063 4ANJA 2P17A 5AQPB 1TMF3 4E2GA 5F5QA 4QX8B 2A6XA 4BQWA 2ZLYA 3CMGA 3AKTA 3VDDA 3WEZA 3ZC0A 5CVRA 1NCRA 3IMNA 1QJFA 3AX4A 1K3IA 4WYVA 5AFBA 3GMIA 3BQKA 4A44A 4FO9A 4JI8T 2VGDA 1HCIA 2O0OA 5K0UA 3UGHA 4IGPA 4N7IA 4DXZA 3UU8A 2D3PA 5JZGB 3TN91 1BMV1 3C7EA 4GULA 3OPCA 4F3JA 3N9NA 5FTTC 1WA4A 1KJLA 2ZM2A 1SACA 1VBE1 4DMIA 3HN3A 2OPKA 1LNSA 1GWKA 2TNFA 1I5ZA 5EYYA 5JVDE 2AC1A 1DQ5A 5FOJB 1SHZC 5AQSB 4XZPA 1W3XA 3UU6A 3MPBA 4KHZF 4AKGA 3CHXA 1Z7S3 1W06A 4CI1B 5FYBA 4ZZCA 2OT7A 4QPYA 4CVUA 3FB2A 3HVDA 1S0EA 1QOSA 4YZ4A 2CEAA 1LESA 3AE1A 2CDPA 1JMUB 5A7QA 2E7TA 2UUAT 2P2KA 2JWPA 4CU6A 1ST8A 1YFWA 5LA9A 5LG3A 3USUB 2AR6A 3ZDVA 4PCRA 5LCWL 5HXSA 1E7PA 3CK6A 3R4DB 3HR0A 4AFBA 2WM9A 3POWA 1KEYA 4DRVA 4BXFA 2VQ0A 3FZMB 1QXPA 3HQRA 2B76A 5A6XA 4G9SB 2PHRA 2XONA 2ZEYA 4A7ZA 4I3PA 1NQDA 5C5UA 1G73A 3I3EA 1XC6A 3TOJA 5EQUA 4QXCA 1H9WA 4JI4T 4YT0A 5JXJA 3H7YA 4COYA 2NP0A 4CU7A 2NOXA 5JRCB 5LGTB 1QJZA 1MS5A 1W2NA 3ZKYA 3GCWA 1IKQA 3KHCA 3S57A 4MLKA 3MIGA 3KINB 1W9FA 3CQOA 1WLDA 3OD0A 4URTA 5J2UE 1WW4A 1H4GA 2XJQA 1FNZA 4LITA 2B46X 3DJBA 4DQAA 5L7OB 2RDNA 3RNSA 3FJSA 1YNAA 3AJYA 1FMWA 1B35A 4XJWA 5LA2A 1UMHA 5LB6A 2BERA 2JDPA 1R092 3VR8A 2VNRA 5FJHA 1NKGA 2RR13 4QQPA 3B5LB 1T6BX 5HXRA 1D0XA 4NUUA 2IXIA 4XFHA 1LOGA 2XLFA 4XVHA 1S0FA 4GA9A 4DINB 4LQRA 1BBT3 5FPZA 4YVWA 4UW6A 4I0AA 5LMUT 1TNFA 3K48A 5E16A 1PO13 1G8XA 3OGJA 1OKOA 4YLHA 3ZJ2A 2X9YA 5EWSA 3H8XA 1POV1 2A3XA 5C33A 4YSYA 4E4ZA 2VZ1A 3T1MA 4Q0PA 2L9QA 2CPTA 2OYZA 2DU1A 2NTXA 3FFQA 1C3HA 1KK7A 4UXAA 1S35A 3BODA 4U7IA 2VTXJ 1U4QA 5CFDC 5T52A 3UUXB 1OD3A 4PDWC 4P9GA 4BOWA 1UN1A 2K24A 5LY1A 3SXWA 2D2SA 5CG8A 2K3WA 3NAPA 2Z79A 2AENA 1ZBA1 1G8WA 3M1HA 4FTBA 3V0BA 3AKSA 3V0AB 4QHOA 3NV4A 1UX7A 5T50A 4HFBA 1BK1A 3UJQA 2HWB3 4FSJA 2RHPA 2D3SA 1VCSA 1MQTA 3EMRA 1U5ZA 4LF4T 5DUWA 2A2FX 1MZEA 1NXD1 1TME1 4YGBA 3T3YA 1WW5A 3O9XA 1XDOA 3KS7A 3AAIA 4AKIA 5FXWA 2VNVA 2LLYA 3K3QC 5A3WA 4AW7A 4JV4A 4LFBT 2QZ2A 3QNUA 1DZRA 1RUJ2 3PUYF 5HCAA 4XDPA 4R52A 3IMMA 2XL7A 3KCXA 2E9XA 2LRKA 2CL2A 2G4IA 5JSOA 4HFCA 4LF6T 4ZZBA 3J7HA 5IVFA 3A0NA 3GALA 2W0GA 1CQ9A 2BVLA 3ONJA 2CGNA 2ZXQA 3ZJ1A 1FXZA 3S7EA 5J2TE 1GP4A 4XOGA 2YGMA 3JQXA 4HSJA 4X6QB 2Y0IA 2XHEB 3HQXA 4K21A 2Z69A 3SC7X 3WZ1A 2JDNA 2VUDA 4JUYA 2G9GA 2Q9QB 2LRPA 4IEZA 2P5BA 2FDGA 3QUJA 3RQUA 5DMYA 1S0BA 1UL9A 2JPFA 3KV9A 2VL4A 4QXKA 2BG9E 1VBE2 1O3TA 1QDCA 3EYPA 4GK0E 3NNFA 5DUXA 4KQ7A 2YC2A 3U75A 1LKXA 1LOFC 3KCCA 4HKLA 3JB4C 5JDMA 3M7AA 2DUOA 1XSRA 1PO21 4XACA 5LB7B 2FJAA 3ZSTA 1QIQA 1H2MA 4PDWB 2V4AA 5T55A 3ACGA 4IEWA 3KVBA 4NO4A 1XPWA 4MH0E 4QGMA 1A8DA 2P6HA 5FZHA 3H42B 2LSKA 5BY5A 3IEEA 3WY6A 1HXS1 5BNQA 4X1KE 2JKXA 5FO8B 2ZKLA 3LSVA 2HH7A 1OA3A 4XF1A 2UY9A 4MUVA 2DV9A 4HWDA 3JAFA 3N9QA 1HRV2 1S55A 2L8KA 4RD7A 4AVVA 4LORA 2UWBA 1JZ5A 4FJOA 2KNDA 2MBGA 4N78D 2HEWF 3MF9A 1QNYA 1MEC1 5KXBA 3BTYA 5FMDA 3PHMA 1OF4A 5AQTB 2EICA 5FZGA 5LP6E 1QJU2 2A73B 4CZSA 3DPRA 3W20A 3OCPA 1N3PA 1Y9GA 4AQ2A 2CSGA 4XILA 3VBOB 5IWFA 4PJYA 1AX1A 3ZLIA 3LE0A 3GN5A 4P1NA 2ADDA 4HANA 4DFSA 2WSUA 4Q4W2 4OHYA 1CX1A 3CVRA 4OI2A 3IPVA 3OGGA 3Q8CA 5AVAA 4BU2A 2A6YA 4B8EA 2VC9A 1DGRN 1W0BA 4B1LA 4ISQA 3L09A 4KBMB 1D2SA 1GZWA 5GALA 5J0ZA 4AHXA 2R043 5H9QA 5JI9A 4I02A 4LO6B 5EV7A 3GF6A 4TNVA 4GIWA 3ATGA 3O0VA 2VE1A 2Y33A 1FOD2 3N7JA 2XQ3A 5KXDA 4QMAA 1Q8SA 4MFRA 3NVOA 2CTVA 4QT6A 2EHOC 3I3DA 4FAGA 2RJ2A 4TWHA 3I4IA 3DF0A 1APNA 3GXUA 1OVPA 2BDRA 1ULOA 2XM2A 4ASMB 3JB8A 5FLIA 3VN4A 1IJ6A 2E7AA 4HPKA 5A1FA 5FYTA 1NXMA 2ZAHA 5FDBA 4DNDA 1HQWA 3ZXKA 1V9U2 3PIJA 2ZABA 1Q8PA 2W61A 1ZRIA 1DGWX 5GLTA 2WS3A 4AEKA 2WAAA 3M3IA 3ZMSB 3FLPA 5EHDA 4DNYA 3AEEA 5JAXA 3R6NA 4I55E 3NL1A 1TZOA 1W8HA 5DN2A 5AQHB 4RYDA 5EZWA 4NHKA 1SFPA 3I3BA 4B3RT 1US7B 1HNWT 5ABGA 4Y1XA 4CUCA 3J7NA 2CHNA 4OZOA 4D0QA 2YGLA 2E7QA 4ET7A 3ZXFA 5J3UA 3B3QE 1QXRA 3KWVA 4GWIA 4HFDA 1Y7BA 4CP1A 4UBGA 4LLOA 3OGSA 4TYSA 4PQ9A 2XM1A 3SCGA 1CIWA 1L3JA 2VKJA 1YQ4A 3WCRA 4YRDA 4V1Av 3VBSC 1UOJA 3KB5A 1R8IA 4LMFA 5F2WA 2Q8EA 3KV4A 2IXKA 4LTAA 3SRZA 1BLZA 2IHR1 4CU9A 1REFA 4ZKTB 4B7KA 3M2MA 3BCWA 1VAKA 3LOBA 3E1F1 2WRAA 2WQ4A 2RVAA 5CFCC 3CWZB 1JYVA 3N5LA 4P0BA 5FL0A 5B4XA 2E51A 3D3AA 4Q4V1 1W9RA 2ZX1A 5LA1A 3LIGA 2ILMA 1AYM1 1JNZA 4XURA 5AC93 3VKGA 3SH4A 3ILNA 2IC9A 2WBLA 3IIIA 2EHOB 1PK6A 2BBAA 4AAPA 3BTAA 4KGQA 3CBNA 1X33A 4AYUA 3TAYA 3LK2B 1NQJA 2YN6A 3M3ZB 2WKKA 5IK8A 4DZGA 2F4PA 3BYWA 1XOYA 2W0XA 4Q4X1 2BG9A 1RUI1 5BR8T 1VBA2 3MZHA 4H63V 3PVBB 2CLYC 4GH4A 2OX0A 1OKQA 3I97A 4XFCA 3TLWA 2OXBA 4JLEA 4K0KT 3RPQA 2GALA 3N9MA 1W6NB 3SH5A 5FV3A 4IL4A 1G9DA 4MBQA 4GKJT 3L3PA 1ACCA 3WAJA 2QVSB 3QB5A 5KR7A 4IV1A 2LUWA 4UVCB 4EE2A 2HWF1 3NMBA 4Y33A 3ZMVB 2NWBA 2FJDA 2ZGQA 4LBQA 4QX7A 1PO22 2A3DA 4FOQA 3DGTA 5IUXA 2WZ8A 1LKNA 2WNUC 4WBOA 5C7GA 3TNQA 3AZXA 3WUCA 5A70A 5D2AA 1DU3D 1SFNA 1BEV1 2BFUS 3J7MA 3DN7A 3AYCA 3C50A 4U72A 4RHV2 3VBSB 1RUE2 1OPMA 5CU1A 2EIEA 5J36A 5J37A 4AXPA 3USSA 1LVKA 1WUVA 4AVBA 3C4WA 4CCJA 4HKWA 4X62T 4XJ8A 2KR2A 4LBMA 1U0AA 1IG3A 3ETVA 3I2JA 3ANWB 1N34T 4QAWA 5CFCB 5KC6A 4H9PC 3MXZA 3EHZA 3ZXLA 3KV6A 2GZWA 4HE8A 1VMJA 3QOPA 1TEIA 1W04A 2BNMA 3FC0A 2VMDA 4IEQA 4OULA 4DUVA 2JG9C 1OBNA 3S5AA 2YOEA 4HK9A 1UURA 4OX9T 5C2TA 1KFUL 1PMJX 2IMLA 2LRLA 2FCUA 1BXHA 4BIFA 4YG0A 2H88A 2EAKA 4NUBA 5F5IA 2ZX0A 1J5WA 3BOWA 4D7TA 1OPOA 1PNFA 2K2SA 5F39A 1SBFA 2FBWA 1N1SA 1V9DA 3RC8A 2DCJA 4NXNT 2JECA 1NE4A 2RM22 4GYRA 3VHOA 3RYIE 4LA2A 2V7JA 3EABA 2CLYB 4F8AA 4DR6T 5KHGA 2YG0A 1U5IA 4CP9A 2JIGA 4DXRA 1EV13 4BQ1A 2Y0OA 4KGGA 3MYXA 4FOVA 5LGNB 3ASIA 1PZ9A 3OYXA 5HWXA 5LG4A 1YJKA 2VZTA 4Z2AA 3KGZA 2HN1A 1ASJ3 1QQP1 3A7QA 1MNEA 4B4PA 1CAVA 3OGVA 5EFUA 2RDQA 4DO0A 1LULA 3AA1B 4LE3A 2WNVC 2HN2A 4MHRA 3F57A 1DLCA 3LG7A 5BV6A 2QQJA 5IVBA 1MACA 2E9QA 4FPGA 4S2FA 1I3HA 1R093 1Y43B 2VMEA 4IE5A 5LXTE 4JYAT 4NHLA 2WNUB 1N3QA 1Z0HA 3AYAA 1XYNA 2HWE1 1GV9A 1FMD1 4EXTA 1ZM1A 2XWJB 3A23A 3VZKA 4MHUA 3PUZF 2E63A 1IJ5A 1YUDA 2Y6FA 4LKEA 1RUF1 4NAOA 4BQXA 3RGLA 5FMOS 1WD3A 2UXNB 3T30A 1HFAA 2A1XA 4IEOA 5GLZA 3RI8A 2VW2A 5BUVA 4I30A 3ZFEC 2CYFA 4LMKA 1EAH2 2WMOA 4EZ4A 1DG6A 1OLME 2JG9B 2KZ7B 4EEBA 1YIFA 1HN1A 3OG2A 2XMLA 4H9QC 4DY3A 3AJZA 1X9BA 3HD8B 5IVYA 1UXXX 1LHOA 4PQQA 2XJSA 2D98A 3LK3B 4Z91A 2GC3A 3B13A 4RQPC 1UXZA 5JLVA 4E4HA 1ZRCA 2W2IA 4I2OA 3ZXGA 3LBXB 4ZHNA 3RLFF 1OLQA 4DVDA 1H4HA 5TSWA 5JIAA 2VOTA 4LUKA 3ST7A 3HNBM 5C3OA 2PHUA 4CDWA 5GJ6A 1XMQT 3GZAA 5CA6A 4WZXA 2K5BB 2R30A 3DP7A 1UYPA 4QPGA 5DG1A 3BUCA 3W15B 3O1UA 1UY4A 4ADZA 4IHJE 4YYOA 4B3NA 3EDVA 2ORZA 4M3CE 4TWTA 5CZKA 4DR2T 4I01A 4RFRB 4Q1PA 1AYM2 3B01A 3VBHA 4CXYA 2WNVB 3MBWA 4Y26A 1RUJ3 2XZEA 1YKHB 3POEA 1H9PA 4L9BA 1G9BA 1YQ8A 1DGRA 2CGPA 2XOMA 1QUUA 5C8WA 5JVVA 2OIIA 4QKBA 5ERLA 2P3KA 4FFFA 4JEUB 4CDUC 4ZU5A 3ELNA 4XEZA 4BHPA 1IGOA 1YWKA 1IPSA 5AQRB 3AZVA 4DIQA 5FLHA 1HB2A
chains in the Genus database with same CATH topology
3N9MA 2ODUA 4ZOLE 2GP3A 3RH3A 2JPFA 3AA6B 3ZN0B 3RYCE 2HPLA 3KV9A 2XASB 2DLRA 4O8SA 2YU2A 4YFSA 2JJ9A 4IE4A 5JVDE 4QXBA 2OS2A 5LW9A 4TV8E 4EIWA 3CX8B 5FV3A 4HFVA 1LRZA 2V7MA 5FY0A 4GD4A 4WBNE 4XAXB 1ZKEA 2WWUA 4GOUA 2YBKA 3NRXA 4MBQA 4GK0E 2C0SA 1SHZC 3L3PA 3PDYA 5FZBA 1AJ3A 4HOOA 5LGUB 5E0OA 3CKDA 3TKLB 4UV8B 2E9XD 5FYCA 4PK5A 3U4SA 1LKXA 3WAJA 4X20E 4HN9A 5LBMA 2KWHA 4FI5A 3ZN1B 4AKGA 5A7SA 1D0ZA 5A7NA 1CUNA 2WWJA 3I1AA 5F8PA 5JDMA 1MMAA 2QA7A 5FXVA 3O1HA 5DQWA 4L5GA 4CI1B 5FYBA 5KR7A 2A72A 2OT7A 4UVCB 5F3IA 3FB2A 2XAQB 4Z8XA 4Y33A 5FZLA 3ZMVB 5IVEA 2NWBA 4QXHA 1T98A 3KVBA 2H7OA 5FZOB 2CEAA 3Q5XA 4QX7A 3MKDA 1IZNB 3RYFE 5A3TA 2KT9A 1BR0A 2A3DA 4BJNA 2VWAA 5FZ3A 3S4UA 4WBOA 4M1PA 4D6RA 3AAEB 4CCNA 2NW7A 3I0OA 3I9WA 3PUSA 2DI4A 5FMNA 5A7QA 2B1EA 5FZHA 2X9WA 3A5XA 5FPLA 2LSKA 1QSDA 3J9X1 3KFWX 2NW9A 2XXZA 3IEEA 4URAA 5JR9B 4AKHA 5F2SA 5FZ1A 4H63H 1UX5A 4G2AA 3N2GE 5IVJA 3CQGB 4H9SE 4HEAA 4J2CA 4CXWA 3OKQA 5HYAA 3PU8A 3T8OA 5EK3A 5F37A 4QXBB 3ZYKA 3C4ZA 3H3AA 4KP3C 4X1KE 4H9RC 4ZI3C 4AKLA 3C50A 4ASKA 3BK9A 5JDNA 3DTOA 4U72A 5FPAA 4ZI2D 3ZCJA 5FZ4A 2HH7A 3PTRB 3RVHA 3RPUA 5JRCA 1MIVA 2H7VC 5FY4A 3R84B 5ETWA 4AXPA 5FYSA 4CCMA 1LVKA 1FIOA 3HKCE 4BAYB 5FYMA 3C4WA 2VKDA 5J1GA 4CCJA 4ISTA 1BR1A 5CA1E 5HXSA 3M65A 5HXHA 4I4TE 2KLQA 3N9QA 1D1BA 4IDZA 3NZPA 4UVAB 2LSJA 3SWHA 3Q5WA 5FNVE 2CXDA 2XAGB 3V5SA 5JQGE 2L8KA 3ETVA 3HR0A 3QC9A 4OFZA 2WM9A 3ANWB 2Q8CA 3U3IA 3AVRA 2GK9A 3Q9DA 2MTQA 2Q9QC 2YEVC 5FZEA 4BXFA 4UVBB 2ACXA 2QGSA 5A3NA 4IE0A 5LNKA 2PJQA 3J7Yq 4UF0B 4CSWA 4FJOA 2KNDA 2MBGA 4CXXA 4N78D 5F3GA 2XAHB 4H9PC 3MXZA 5JDHA 3N9OA 4MALA 3ZC1A 3KV6A 3MACA 4O4IE 5HXEA 4HE8A 5KX5E 4O4HE 2BVMA 4AQGA 4AI6A 1HG2A 3FHNA 5FXXA 3C4XA 5F3EA 2Z6EA 3FXEB 2V7IA 3NJYA 2LEHA 4OYKA 4I50E 5L3DB 2VK9A 4EZHA 2C5KT 3IBPA 4H9NC 2NW8A 2DNXA 2X9HA 2G0UA 3F2EA 1G73A 5A1LA 5FZGA 3GA8A 5LP6E 3OPTA 2N2NA 5JDGA 1HX8A 3HKBE 5TAOA 4ZI3D 5FP8A 4QXCA 3RYHE 5DABA 5HWYA 2X66A 4O2BE 4TX5A 2CM0A 4NUBA 5F5IA 2V7KA 1IAPA 4OYJA 2KXPB 3NZQA 2PFVA 1HTJF 5FP3A 1LVFA 2NOXA 5JRCB 1YD8G 5LGTB 5IWFA 5F39A 2E9XB 2X67A 3HKDE 3ZLIA 2LSGA 3LBXA 3GN5A 4P0AA 2J1DG 1MMGA 4UXNB 3LK42 1EZ3A 5C8YE 5F5AA 4MLKA 5FYZA 2K48A 1V9DA 3RC8A 1ZV4X 3QK6A 2C5IT 3AL6A 5A7WB 2DHRA 3E0ZA 3C64A 4QKNA 4EB6E 4GYRA 3CVRA 5K4LA 4WNKA 2V1DB 2W00A 3KINB 3RYIE 5HAXA 5CB4E 4TN7B 2V7JA 3UT5E 4IE7A 5IYZE 3AVSA 1O3XA 3MK7C 2CLYB 4PFPA 4CZZB 5ANQA 5L3CB 4DMWA 5FZFA 5FZCA 3CX6B 5J2UE 5IW0A 1SA0E 2LOSA 4BU2A 2H3RA 2LT3A 3ZYMA 5LOVE 4I43B 4CCOA 2MOZA 4LITA 3O1JA 3AA0B 3DJBA 3CQXC 4LIVA 4U74A 4QX8A 4QWNA 2JMHA 2YU1A 3L09A 4KBMB 1MNDA 2CE7A 3JC6D 3UUMA 3KVAA 3AAAB 4XBFB 2Y6XA 3H37A 1MIWA 3CQCB 3VHLA 3C98B 3RRWA 5LGNB 5FYHA 4A56A 3MA9A 2ZM8A 4TZ4C 3OYXA 5HWXA 5LG4A 1FMWA 3ETUA 3ZMTB 5A7PA 1YKEB 2XAFB 1D1CA 2EHOA 1UX4A 3KBTA 4GIWA 1NWMX 4QXCB 2CCQA 2XUEA 4V2WA 5F3CA 3OYZA 5L3GB 1MIYA 3D0TA 3UYJA 5FUNA 4DBQA 3N2KE 2VASA 1MNEA 4MFRA 2N1GA 3E08A 5FJHA 5M4YA 1BR4A 3PU3A 3Q2MA 5BMVE 4DO0A 3F31A 1Z0PA 3FBLA 2EHOC 4AI9A 2ES0A 3CX7B 3AA1B 1ZHCA 2Q9QA 3F57A 5F3JA 4BA9A 5LYJE 5HXRA 3LD8A 1B7TA 1D0XA 3LG7A 4IE6A 3K8PC 4WW0A 5JH7E 1BR2A 4NUUA 5A7OA 5LJNA 5IVBA 3BQIA 4CUGA 5JDFA 4F6RC 2IW5B 3GWHA 2HPJA 4GJYA 2DCFA 4O4LE 4P09A 3WAKA 5FZAA 1IJ6A 2LM9A 4IE5A 5LXTE 3MJXA 4B6XA 2JRKA 4E7SA 5A1FA 2PG8A 5FWEA 5FZ6A 4EYUA 2DWGA 5FYTA 1HS7A 3O4XE 3IF8B 4ERRA 1OXZA 3UULA 1ZEEA 4QWNB 3UTKA 4DNDA 4ZHQE 5FZ0A 4QXHB 4IIJE 1D0YA 2DWKA 2M67A 2X68A 2PXJA 4QX7B 1G8XA 3U78A 3O1IA 2W61A 4NUVA 4ISSA 4EXTA 5FZMA 2KWIB 2P9BA 3ESLA 4PJJA 4ZI7E 1HF8A 2X51A 3PUQA 4G63A 4EAHA 3OPWA 4KMCA 4O4JE 2SPCA 4PK6A 4CI2B 5LHHB 4YLHA 2RP4A 2PBIA 3ZJ2A 2X9YA 4KUMB 4V2VA 2KINB 3ZMSB 4OK0A 2VD7A 4QU1A 1NAFA 5IVCA 1H7CA 3VKHA 2X0LB 4UV9B 5GONE 5FPVA 4YJ2E 4EOZB 4D6SA 2VKOA 1IJ5A 3R6NA 2XDVA 4I55E 4BISA 2LE8A 1WYCA 3HKEE 4EYYR 4IGOA 5FZKA 3VU7H 3AB3B 2EHOD 2L9QA 3WI3A 5KDMC 2UXNB 4H9OC 3N9LA 2NTXA 4GYSA 5CA0E 1VOMA 1WRDA 5FY8A 1US7B 2XAJB 4Y4RA 1KK7A 4PJNA 2L3LA 2Y48B 5AFUL 4HTEA 1HFAA 5FZ9A 1S35A 3DXUA 5DJQC 4PJMA 5LY2A 3K3NA 4XDOA 1U4QA 2V7LA 3PE0A 3PUGA 3SOLA 4TUYE 2YBPA 4PFOA 4PK4A 4CCLA 2ZM0A 4BJMA 5L3BB 4UELA 1E1HB 2X9XA 3UUXB 2LHNA 5EK2A 3LDBA 4D6QA 5E6HA 5FPUA 4CQIA 4GK5E 3NRYA 5EK4A 5LWBA 4MHCA 2LOPA 2Q9QD 2YINA 2WMOA 2Y8DA 2OA5A 4EZ4A 2K24A 3CPZA 2KZ7B 5LY1A 3BQLA 1FEWA 2D2SA 3FBZA 5HXCA 3C51A 2V26A 5H6RB 5IVVA 2XMLA 3PUAA 1WYBA 5FY9A 1OWAA 4H9QC 5FJKA 3HA4A 2CWYA 3AA7B 5FP4A 5LBQB 3PURA 4K0UA 4QHOA 2XTLA 4ZI2C 5IVYA 5JR9C 5JREA <