2WWUA

Crystal structure of the catalytic domain of phd finger protein 8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
363
structure length
363
Chain Sequence
VKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD FINGER PROTEIN 8
publication title Crystal structure of the PHF8 Jumonji domain, an Nepsilon-methyl lysine demethylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 107
structure length 363
sequence length 363
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wwuA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2wwuA01
5F39A 3PDQA 4D6QA 5FXXA 4NUBA 5FYUA 3K3OA 3PU3A 3U4SA 2VD7A 2XUEA 5FY9A 4QX7A 3DXTA 4V2WA 5FP9A 5FZEA 4CCMA 2P5BA 5FZBA 5F2WA 4GJZA 5CEHA 4GJYA 5IVFA 3KV4A 4URAA 4BISA 2W2IA 5FZIA 5FY1A 5FYHA 5FYMA 5FJHA 3N9QA 5F37A 2YPDA 3AL6A 4XDOA 4QXBA 5A7OA 5A7WB 3RVHA 4IGOA 3KV6A 5A7WA 3N9MA 4QX8A 5F2SA 3PURA 5FZHA 5A7QA 2GP3A 5IVBA 2PXJA 5FZ0A 3DXUA 5ANQA 3K2OA 4LIVA 4LITA 4Y4RA 4CCKA 4AAPA 3LDBA 3LD8A 4LXLA 5A3WA 4CCLA 2WWUA 3AL5A 4E4HA 5A1LA 4ASKA 3N9LA 4HONA 5FZFA 5IW0A 5FP8A 5IVCA 5FBJA 5A80A 1VRBA 2Q8DA 3N9NA 5A7PA 5FYCA 2OT7A 2WWJA 2YBSA 5FUNA 5FY7A 5FP4A 5FZLA 4QU1A 4CCJA 5IVEA 3U78A 5K4LA 5FPBA 4CUGA 4UF0B 5FZKA 5LWBA 5IVJA 3ZLIA 5A1FA 5F5CA 5F3CA 5FY8A 5FY0A 4D6RA 5LY2A 4DO0A 5F3EA 5A3PA 4D6SA 5F32A 2XDVA 5FZ7A 5LW9A 4CCOA 4QXCA 5FXWA 5F3GA 2YU2A 2OQ6A 3N9OA 4LIUA 5FYBA 3NJYA 5FZMA 5F5IA 3UYJA 3PUAA 5FY5A 3K3NA 3AVSA 2Q8EA 5A7SA 5FJKA 3KVBA 5FPVA 5FXVA 5KR7A 3OPWA 5FP7A 5FPLA 5FZGA 3ZPOA 5FXZA 5FZ1A 5FWJA 4EZ4A 4EZHA 5A3NA 5FZDA 2YBPA 3N9PA 3PUSA 2OS2A 4QXHA 5F5AA 4EYUA 4QWNA 5FP3A 5FYSA 4IGQA 2GP5A 4TN7A 5E6HA 5FPUA 4UF0A 5FZOB 2OX0A 4IGPA 5FYVA 3AVRA 5FZ3A 5LY1A 4V2VA 5FZOA 4CSWA 5FUPA 2YU1A 3PTRB 5A7NA 5FYZA 2XMLA 4BXFA 5FZCA 5FYTA 5IWFA 5A3TA 5FWEA 4BU2A 4GAZA 5FY4A 5FZ9A 2Q8CA 4XDPA 4Y3OA 5ISLA 4GD4A 4AI9A 4C8DA 5IVYA 3PUQA 4DIQA 5FZ8A 2OQ7A 3KV5A 4HOOA 3PU8A 4Y33A 5F3IA 2XXZA 5FZ4A 5FZAA 4CCNA 5FZ6A 3KVAA 5FYIA 5FV3A 2YBKA 5IVVA 3OPTA 5FPAA 3KV9A 5FYYA
chains in the Genus database with same CATH superfamily
4GWNA 4MBQA 1HV1A 5LGUB 1YXWA 5H6RB 1ZM1A 4FJOA 3E6BA 2VY0A 4QQ2A 2X5IA 3UJQA 3WF4A 4WW0A 3D0SA 4BMEA 5A32A 4OZXA 2BV4A 5KHIA 1O7FA 3P4QA 4LFCT 4WBBA 4LHLA 4RGGA 4JDNA 1W8TA 2J1RA 4Q27A 3CEWA 4CN1A 4IV3B 3MLKA 3JAFA 4FO9A 4Y1YA 1DU2A 4XHBA 1Q8OA 3BTAA 3MIEA 3LA2A 2D6KA 4GOUA 4COZA 2WSVA 3AMNA 5JMOA 2K9ZA 2Z69A 1RJ7A 5EJZB 4BB3A 4AGVA 2LEHA 1CVNA 3NWIA 3POGA 2PHLA 3VD9A 1UU6A 1ZNPA 4EV0A 3X29B 2BKNA 3H3MA 2WAAA 4RS5B 2Z2SB 1U5XA 4XW3A 2J1VA 2BBVA 2CEAA 1LRZA 5FY4A 4YJ2E 4NRMA 2UY9A 2CWMA 5CNAA 1IJ6A 1V9U3 2YDRA 3PU8A 2LTNA 3R0RA 4XAAA 3UV9A 4U2ZA 3PVBB 1N3QA 2AYHA 3N5LA 1YC61 2X0YA 3AXDA 3GJBA 3LSEA 4RS5A 2DFCA 2W9XA 3K77A 4XUQA 5JOWA 4EIWA 4BJNA 1PM7A 3RKGA 4YSFA 1NWMX 3N9QA 3RWKX 1MACA 2PTFA 2BPA2 4AL9A 4LOSA 1JZ2A 3AKSA 1EV12 2RP4A 2HWE1 2EHOA 5BNQA 2YFUA 3O1VA 3ELNA 2BS4A 4CCCA 4B3RT 2KLQA 1TE1B 4Q4V2 5FMOS 3VR8A 2KD7A 3PNAA 4LKSA 4UIGA 1OKQA 3IBMA 5D2AA 3KLSA 1KEXA 4CUAA 3E6DA 1E1HB 4BQYA 3DYOA 5M0TA 1ZRDA 4AOCA 4NO4A 3TOJA 1O3TA 2R30A 3FBYA 2GC2A 2IFRA 4HANA 4HWHA 2PHRA 4C0HA 5AQQB 1LGBA 3UETA 4CDWC 1AL22 2E9QA 3POBA 4CN4A 2VCCA 1HNXT 5J3UA 5FZAA 2Q9QD 1WLTA 4IE5A 2KT9A 1R082 3H3UA 2DBIA 3NAPC 1WMFA 3LG7A 2NTYA 4NIGA 1XJAA 3T08A 3J8F2 4HETA 3OJBA 4TSVA 3I3BA 3GNEA 1NLQA 4OQ8A 2JXAA 5LATA 4UXAA 2WAOA 1ND2C 3N9LA 3OOXA 1W8ZA 4AEMA 4FOQA 1UY4A 2VQTA 1UZWA 1WYCA 2QQLA 4TZ4C 1CZTA 1HX1B 3SKJE 3VKNA 2VOVA 4CXYA 5AFBA 2MAWA 1QOTA 2W2UA 1MS3A 4NHLA 2PMWB 1ENXA 4ET7A 4HXCA 4UWDA 2XQ6A 3WDXA 5J0ZA 4EYUA 4W6YA 1VRH1 3F95A 4V2VA 3NKZA 5J2UE 3TEZA 4BE3A 1RHI2 2XMLA 5D21A 2W1UA 1WYBA 3CO2A 4A6OA 5A6XA 4LO8A 5AQOB 1A8DA 1GBGA 3ZYHA 2HKXA 1IHMA 4KMCA 3FXDB 3HAGA 1ZBA1 1BR0A 3T4HB 3VGIA 1AR63 4AEKA 1S0IA 1NA1C 2VKHA 2K0GA 2JD9A 2ZOEB 2GNTA 1KRIA 1VBB2 2JDNA 4CCMA 4QGMA 4N53B 4XURA 2ZMNA 4PIZA 4FXGB 1K5MC 2XSBA 2VUCA 2GMEA 4QXBB 1HLCA 5F7UA 2EALA 1NXD1 5JRCB 1EYBA 4CI3B 4DZGA 5C8YE 4MOAA 5JDGA 3VD5A 1Q5OA 4CDXC 1KQRA 1S0DA 3OYXA 2FDHA 5F3JA 1JOBA 3B13A 3ZLIA 1W0NA 2P2KA 4PDWC 3AJYA 1AYM2 1FMWA 1D4M1 4PAGA 5DDJ2 1AXYA 1NAEA 3IBPA 1OHFA 3KB5A 4LORA 2XQAA 1YO8A 2Q8EA 2WDBA 4XJUA 3MLLA 5GZCA 1XB9A 2BS2A 4FT8A 4MALA 3VKLA 4CU6A 1XYNA 3O5SA 2BNOA 2N7GA 3CU7A 3QCWA 3ANWB 1HRI1 5GZFA 2X9WA 5FOBB 2IUWA 2LUWA 1PGL2 5LK5A 5C2TA 1ULFA 4XFFA 4OHZA 4CI1B 1BMV1 2ERFA 3WEZA 1MEC2 3NAPB 5H9QA 4Y5TA 4E9KA 2ARAA 2G4IA 1CAUB 1QXJA 2CGNA 1QDOA 4U7IA 2DVAA 3Q8CA 1CJPA 4CDWA 1OFNA 1RTVA 2QKDA 5FKCA 3U78A 3FBMA 2K9AA 4GK5E 1UCUA 4TTGA 2LSIA 2GAUA 4DV7T 2JQQA 2QDRA 3VDCA 1NQJA 2Y0OA 1LU2A 3NAPA 1AR91 1LHWA 2V72A 4XAEA 3HR0A 5I91A 2WN3A 1CAUA 1UW8A 3FZHB 4LF5T 2Y6JA 2GMPA 3LCPA 1EAH1 1HB2A 4MGZE 1JTZX 1MNDA 3TWIA 3CK6A 2WZEA 1S0GA 1NCQC 1SZBA 2PAKA 4U2AA 4C8DA 2XJSA 2QQJA 4YGBA 3OBZA 3SXWA 3O1OA 5FZ6A 4B7EA 2YBKA 3TLWA 1SLTA 2ZMAA 3ILNA 2ARXA 3WD5A 2WT1A 4IREA 1S2BA 4HPKA 2KWHA 1GNZA 1K42A 2NW7A 3KMHA 5F8PA 5LMNT 4PI2A 4TV9E 1G7YA 3O1SA 5JAXA 2ET1A 2SLIA 3ME2A 1ULCA 3MW4A 5FO8B 4DUXA 1W09A 4WM7C 1U5IA 3PLQA 1SEFA 2D5UA 2WY2A 4CEWB 4FFFA 2HYXA 1KF6A 1BR2A 2X66A 4BHPA 3VBHC 3C3VA 5L4EA 3U1XA 4GH4C 2LM2A 5LWBA 1OKOA 4I30A 5LZ6A 1H6YA 2YDEA 3NRUA 4DR7T 4FAGA 2J1SA 3PDYA 4Q25A 4AEDB 1RUI3 4OYJA 5HV0A 4NPLA 1ACCA 4BA6A 1K5MA 1Q8VA 3RYFE 5J7MA 1M06G 1X79A 4JI2T 2ZKNA 4O4LE 5FZCA 4AEDA 2ZM2A 2JICA 2WS92 2VUJA 2IXJA 3LIHA 2H0VA 5D8AB 1P8JA 1Y9GA 3F2ZA 4ORFA 4JVAA 2Y33A 2E2AA 4DV1T 5FY9A 1A8MA 3VL9A 4V2WA 1PM4A 2ADEA 4JQRA 4QPGB 4IEZA 4AKLA 5LG3A 4FPHA 1LGCA 2YK0A 4A3ZA 5T54A 2VL8A 5FNVE 3AFKA 2GP3A 5LYJE 3ZYBA 3GA8A 3MXZA 5D8AA 1O5UA 4LBLA 1YQ6A 4J25A 3UUXB 3ILFA 4LHNA 4YG3A 5HCFA 1XMQT 1C1FA 3O0XA 4HZFA 2YB7A 4QH5A 3RX6A 2ZLYA 3LSDA 1LODA 4H63H 1EV11 2FCUA 1TZOA 3PIJA 3HKBE 3NW4A 2Y6FA 3P1IA 1OC1A 3O1PA 5FYVA 3V5UA 4CP2A 3ZYGA 3WP3A 2WZIA 5FVKA 1O5LA 4CZZB 3PUQA 2VMHA 2RS32 4CCNA 5LHIB 3WDTA 4OUSA 1GWKA 5BV6A 2JQ9A 3ZMNA 1REDA 4NUBA 1SG3A 4A6SA 4FPYA 1DDLA 1YD8G 1Y43B 4LLFA 2WO7A 5FOJB 5FZBA 3V5SA 1AL21 3TB0A 2Q1FA 4DMVA 2XAFB 1VBE3 2JG8C 4CPBA 5JR9C 4IGOA 4HG6B 5H9SA 1R081 4OHVA 4YW7A 2VMDA 5G05L 1NCQA 3ZKUA 3AP4A 3WUDA 1OD3A 3ZEFB 2XQ3A 1YFXA 1W2UA 2FUPA 3PJYA 1MMGA 2D5HA 3ECQA 3I2DA 3C7HA 3EHKA 4D7TA 4A42A 2RDNA 3OG2A 4Q4W2 5FPUA 4Y5SA 1KJLA 4WM7A 1H6XA 3JXSA 2WA4A 2A6XA 3WAJA 1V6OA 4A2UA 4WNKA 4Q29A 3RQWA 2FJAA 3VBHA 2WU5A 1T2XA 2Y6LA 2Q1MA 1C8M2 2B42B 3SH4A 4A4AA 2R043 3FZLB 1RHI1 4YZ3A 2BWAA 5FP9A 5KHKA 1XE7A 4L11A 4QX2A 3Q5EA 4LF9T 3UT5E 3HQXA 2WS3A 1VBB1 2R072 3NNMA 3B94A 4ISQA 2DU1A 2AEZA 3GCXA 4WM8B 3POWA 4EN9B 2OPWA 2YN6A 4I0WB 4C0BA 5DQVA 4B4RA 4AI2A 3A8YC 4ZPIA 2G9FA 2P9BA 4LLOA 4QM9A 1MVQA 1UNBA 4OHFA 3RHWA 3O1HA 5E0OA 5DJQC 5AQHB 2ZCWA 2NW9A 3A23A 2LRLA 1RXFA 1XWMA 4QQLA 5AC92 2C26A 4S2GA 1XNAA 4WM8A 4OCTA 2VZ3A 4IETA 3R6SA 3TLSA 4M0NA 1HB3A 2Y6XA 2A71A 2WZPP 3EO6A 1YUDA 3V64A 1QGLA 3FL7A 2CDPA 5T52A 1C4RA 4NIQA 5FL1A 3I59A 1N32T 1UY1A 3WHUA 3S30A 3KVAA 2FMYA 3O7OA 3WW1A 3RIUC 1X7NA 3MACA 5C70A 3KF5A 4WVWA 1OMIA 4HKOA 2JB4A 4XUOA 1D0ZA 4O4IE 5ANQA 3CJIB 3SCGA 4XUNA 1QHDA 2QQNA 3UJOA 1CUNA 2UWCA 5IVEA 1KITA 4HFBA 2K46A 3T1LA 1MEC1 5C3RA 1JN2P 3RJ2X 5JCTA 5FY0A 4MADA 4IQPA 3K1SA 1WKYA 4YFSA 3NNFA 3CJIA 1WMDA 1OF4A 2B8MA 3AVSA 5FPLA 5JR9A 4G2AA 3KZ4C 2UU9T 3BQKA 2XHEB 3F31A 1L7RA 3I7DA 2P1BA 4NMIA 1UU5A 4UBHA 2ZX1A 3NJZA 1R093 2QQOA 3I3DA 2E32A 4OYKA 5L7OB 1N36T 3W58A 3MPPG 4NAOA 4Y33A 1PVXA 1W9WA 1H4HA 1GZTA 3L8RA 3HI2A 1GQEA 1KD7A 3PJAJ 1DZQA 2E6VA 3PU3A 2EXJA 3CQOA 3T1HT 3U75A 5T5LA 3DYPA 3ACFA 4KI0F 2RHPA 5LOVE 4AR2A 1G9CA 4MSVA 2LKHA 3UFGA 3M3QA 4L99A 5AQSB 2B45X 4LMFA 2QQKA 2QRXA 2RM21 1ZV4X 3HT2A 2V5DA 1I6XA 1ULPA 3MK7C 2E33A 2JDMA 2Q8DA 3JC6C 3WDWA 3CWZB 2QFEA 1NX9A 2DF7A 3MV11 5EK4A 2NQYA 3ZXFA 1HN1A 1UURA 5EYXA 4O65A 4DR6T 3LA3A 2V7JA 5FK7A 2KM2A 1W0OA 2HWF3 2VQAA 2VNVA 2VL0A 3FFQA 4KBZA 3VL8A 1WMEA 3RZLA 4IE7A 4JRLA 1JOJA 1KEYA 2TNFA 2VXRA 3SH3A 3C64A 3UU3A 3MICA 2VNOA 1TNFA 1RJ8A 1FATA 1NCRC 1DZTA 2WNEA 2KZ7B 4YTMA 2WQ8A 1GNYA 2P5BA 3B01A 2WQYA 3MKDA 5A6ZA 3KV4A 2W2IA 2WS91 4AGGA 4HL0A 2IVIB 3GF6A 3DPRB 2CMRA 2D97A 3DTOA 4IEVA 1F4AA 2JG9B 3CIRA 1BVP1 3WW4A 1XDOA 3FHQA 4P9YA 4P5HA 4UV9B 2A9UA 2YUEA 5FZLA 5J1GA 2IDOB 3NNGA 2E9XD 3IAPA 5DG1A 3ATGA 4PJYA 2XQXA 5KXDA 2HEYF 1AX0A 2XJUA 2ZMLA 3ZSSA 1SLBA 4P00B 4YG6A 4QX0A 3CX7B 4BIFA 2VB6A 2BNMA 1AYN1 2JIGA 4BZ4A 5BPXA 4YM0A 2JEMA 3WQ0A 2PJQA 2TBVA 1A6CA 3AE2A 3WP6A 3RWNA 2LSYA 1QJX2 2A72A 3ZC1A 5KXBA 4YHJA 2N9DA 4FFGA 2ZBJA 2CLYC 3A0KA 4K0KT 2XWBB 2PQSA 1DP0A 5FAXA 3EUHA 4AKRB 2ZGMA 2JX9A 3IEEA 5M4YA 2RS31 5C9AB 5BNOB 3SEEA 1W3XA 2OYZA 5EIYB 2GH8A 1BK1A 3KT1A 2WM9A 2FJBA 2J47A 4HONA 4AKIA 2XL7A 4DV2T 5GZEA 1LTEA 3MIHA 2OXBA 3RJRA 1YWKA 2XHNA 4E7ZA 1LOBA 4K21A 5LY2A 3E0ZA 1WLCA 1J1JA 1KJRA 5CFCC 1T7SA 3AE8A 4PT6A 4CCDA 5F5IA 3DV8A 3PUAA 2X9YA 4OUEA 1VBE2 5AQJB 3UT0A 3NKTA 3ACIA 4XXPA 3PJAA 5FZ3A 2VBPA 3DKQA 1ENQA 1QU0A 1UIKA 1H2KA 1XNKA 3MFCA 4RQPC 1RUF3 1J5WA 5IHYA 5ISLA 1CESA 3OGGA 2DCYA 5FMCA 4HOOA 2WO2A 4Q4W1 3AE9A 2WDRA 2FDIA 1PNGA 3AEFA 3ZMZB 4O4JE 3B93A 1QOOA 1M4WA 2RMU3 3M3IA 1A34A 1ST8A 1D4VB 3ZIWA 2VW1A 4YHHT 1QJU2 1C8M1 2LW8A 4WBNE 3P7IA 1NCRB 2V7IA 4LBQA 3SQOA 4QD2A 3FZFB 1LEMA 4AI3A 1WCRA 2BZDA 2XUMA 5FP4A 1JOPA 3VBRC 3THCA 5ABGA 3J9SA 2V7LA 3MHZA 5L3CB 4M3CF 1RINA 1XYOA 1UMHA 2B7YA 2R071 1NCRA 4LNVA 1UD1A 3IPVA 4QXKA 4W50A 5F5AA 3EDVA 4NPPA 2AXDS 2OX0A 4R9CA 4V1PA 1QXRA 2YC2A 3AB3B 2UUCT 3E1F1 4NROA 5AC91 4DXRA 3ZYKA 4DEVA 3VD7A 1PZ7A 3O14A 4CDUC 5H9RA 4CUBA 2I45A 4U74A 3WXPA 2A3YA 3LGRA 3KDSE 2H6CA 5JOZA 1ZZ8A 1W2OA 1AL0G 2CLYB 5LP6E 4BM8A 4RR3C 2PHFA 5AFEA 2ZX2A 1L0VA 1STMA 4NPMA 5BNPC 4RHV3 1J84A 4MZUA 4YJ3E 3MIFA 1JHJA 5IVJA 1KGYA 2V7MA 3THPA 2GNMA 2HH7A 3B3QE 4ZI2D 4OULA 1OVSA 3RPUA 1ZZBA 5L9RA 3LJCA 2H7VC 2UXXB 2Q9QC 2XJQA 3T1YT 3H8XA 3ZVXA 4U72A 2VVDA 2EXKA 2OS2A 5FP3A 1SFNA 4TWHA 2C9KA 5FUPA 1GUIA 5T5OA 4QPIC 4PI0A 4E8DA 1NLRA 4PK5A 2VMFA 3CDZB 3EQEA 3BK9A 1D1BA 4GWIA 1XNDA 1SUMB 4J1WA 3T0DA 3AMPA 5AQKB 4IXLA 2D6PA 2BS3A 2WDVA 2XQ5A 2JMKA 2UYAA 1SLAA 2V6YA 4F3JA 1ZA4A 2VZTA 3MF6A 3I97A 4JLEA 3HPNA 4QH1A 5CU1A 3W15B 1VAVA 3IIAA 4H14A 2WIIB 4RQPA 4LUMA 1UPSA 4XZUG 5TAOA 2WWJA 4YYOA 1GP4A 4PFOA 5LGTB 5EP9A 4AXPA 3OY8A 3KGZA 3DN7A 4LKEA 3WDVA 2C24A 1ENRA 3ZSLA 5LASA 4JRAA 4O4HE 3FBZA 1B7TA 3Q8BA 1D1CA 1JUIA 1ZA7A 5JH7E 3RZJA 3GBFA 1CAWA 4QB1A 1YI7A 2HN2A 3JUUA 5FZ4A 3HNMA 1GOGA 3HL6A 1FAYA 2MTQA 3ZJ1A 2XG3A 4OUMA 5HXRA 3UU5A 3ZMOA 1VAMA 5FCCA 2ZM0A 1MS5A 1O91A 4OLLA 4WYVA 4FPEA 3ZC0A 3MW3A 3AZYA 4OI4A 2L3LA 2XM1A 1QJFA 3EHZA 4CDUA 3MFAA 5LG4A 5ETWA 1QF3A 3ZN5A 2Z6EA 1G9AA 5C3OA 4TWFA 3AEDA 3ZDSA 3WNPA 4BQ2A 1MR5A 2H89A 3HN1A 4IEUA 3PMEA 4Z2WA 2A73B 3MGUA 5LBEA 1PMIA 3TKLB 1PMJX 2DWRA 1RUG2 4XJAA 3ACHA 1F5JA 1BCXA 4J2CA 3ES4A 4PJJA 3WNXA 2D3SA 3ZSKA 1SBFA 5FQ0B 3ZT7A 5I0RA 5BNPA 5IAVA 4L9BA 4AAXA 2XXZA 4P0BA 1AX2A 1SFYA 4BIOA 2Y60A 1SPPA 4CRQA 4IL7A 2J4GA 1UYPA 3QH7A 4KWJA 1IQDC 2ID4A 1QJX1 2WBKA 4O61A 2PHTA 3W5MA 5CEHA 2Q9QA 5HXEA 3HNBM 4OFGA 2BP6A 1IG3A 3HQUA 4AFBA 4LF4T 4QX8B 2ZPXA 2ZGTA 1I5PA 5C3SA 4YY3T 1F2NA 4PQ9A 3X1DA 3APBA 4DXSA 3CHXA 4QPIA 4YNIA 1JMUB 5KXEA 3IA3A 2H6BA 3E5XA 4JHTA 3LKJA 3HOBA 5LBCA 2V8SV 3FZKB 3IZOA 2L8KA 4QPWA 4EN6B 4QXCB 3PUWF 5E88A 5CG9A 2VKOA 4AYUA 3SKVA 3DECA 5HEOA 2VASA 4KBBA 4LE3A 4UOJA 3WQ7A 3GM8A 1VBD3 1UCXA 4XJ9A 1ZBE3 2VR4A 4Z8XA 3GBWA 1W9SA 2R063 2X68A 3IDAA 1FEWA 4UR9A 1QH7A 3LEIA 3RF1A 2EAAA 2QDNA 1IBMT 5JQGE 4X20E 1F9KA 1QJY3 3VBOC 2VL4A 1G8XA 4JCKA 1MIVA 3FMGA 4Q0PA 1AR83 1U12A 4ARXA 4Z90A 4LBJA 3FLRA 4HN1A 5LB7B 2W46A 4CU9A 3AMMA 2N2NA 1QNYA 5KWRA 2M6IA 4GIWA 1QJU1 1YKEB 3BOWA 4JI7T 2D9DA 3ILRA 4DO0A 4EROA 3ASIA 2J1UA 2OVUA 1OF3A 1IPJA 5FIXA 2W00A 4AIUA 3ALQA 1WWYA 4GXLA 4I0BA 2VTXJ 1NE6A 3GXUA 4YWAA 4HGAA 2B46X 2E7AA 4IE6A 4P9IA 3EXUA 1US7B 2BG9C 2OW4A 3LFMA 2PELA 5FZOA 2VULA 5HXCA 1DCSA 2YG0A 2D0TA 4LK6A 3K3QC 5T55A 3O4XE 2IC1A 1DG6A 1UOGA 1I3HA 2QVAA 5JMCA 4F83A 2BBAA 1IS3A 3WLUA 1QJEA 2D6LX 3P50A 4GK0E 1V70A 3RZKA 2NOXA 4EEDA 2IFWA 3AL6A 1Z0HA 4DR5T 2PAEA 4F8AA 2BGCA 1I6ZA 2FZ1A 2CYFA 2WYSA 2PFWA 3AB0A 4TLFA 2VZVA 4DMWA 4IEYA 1LGNA 3I2KA 4CCJA 1UOJA 4U36A 1YEWA 4GWMA 4LMKA 3DKWA 2OQ6A 4I0UA 3B5MA 1W6PB 1PVC2 2XKPA 4DUYT 1CAVB 2P6CA 5A7NA 2D5FA 5IK5A 4LHKA 2QGSA 1VLNA 4XFBA 2ZMKA 4RHV2 4XYXA 1PGW2 3OUIA 4Q0VA 1OEDC 2WNUC 4KGQA 3UYJA 3B5LB 2G9ZA 2SBAA 1CAVA 3GWHA 1D2QA 2LSKA 1LKNA 1RUD1 3DXTA 4C90A 2ZM6T 4CEYB 2CU5A 1C5HA 3OB8A 5H9PA 5A70A 4AQFC 2VMCA 2D93A 3D82A 2K24A 4TNVA 4QHZA 1W9FA 2J22A 1WA4A 5HXMA 3AX4A 1I9RA 2R6QA 2HHHT 3MUY1 2NYYA 3JD72 4BCUA 3M1HA 4YZ1A 1PX4A 4LHSA 4IV1B 1C1LA 4AEJA 3K4ZA 1M62A 1X82A 2DFBA 3JB8A 3VBFC 3VBOA 3C8XA 4LBMA 1GOFA 3AKPA 4COWA 3AE7A 1TG7A 4DPNA 2AENA 3B02A 3AP9A 2AACA 1GNHA 2ATFA 2NM1A 4HWFA 3CVRA 4A56A 4IV1A 1W2AX 2AE9A 1OXZA 4JI1T 2YV8A 1TNRA 3NV3A 4GAZA 1K45A 4LQRA 5DXDA 3THDA 1ASJ3 3I0QA 1MIYA 1JZ6A 1ZEEA 3J7MA 5FYIA 1Z7S2 2YYOA 1W90A 4E4DX 2YKSA 3RLFF 3IT8A 3GCWA 4QB6A 3AEBA 4AVAA 2WNOA 3OD4A 3AJZA 5A7WB 4H3WA 2CV6A 3WI3A 5GLTA 2BG9A 2CXFA 2D44A 2J62A 1N1VA 1WCQA 2HPJA 2JDYA 3P4PA 4H7LA 1ZRCA 1R64A 4A41A 1MQTC 5DZEA 2Y64A 1UX7A 4FTEA 4FP2A 1NXMA 4Q1PA 1IZ3A 3FHIB 5B4XA 2YU2A 2EICA 1SA0E 4UFJA 1J3PA 1NY72 3ZFEC 4HKAA 5L2LA 4HSLA 1VCSA 1MMDA 2HWB3 5JOXA 1FMD3 1IBKT 1MPXA 3AMQA 5LY1A 4CSWA 3AM2A 3VZOA 4BXSV 5J37A 2YGMA 3M3EA 3KCXA 4Y5Z0 4NUUA 1OWAA 2PLV3 3CJXA 4PQQA 3ZMUB 5C7GA 2BOIA 1GQHA 4A45A 2ZABA 5FV3A 2WQ4A 3C7FA 4Q4Y1 2HH9A 1RUG1 5FXXA 1HQNA 1J1TA 2A3DA 4XQDA 2JD4A 3IB3A 2VMIA 3ZXGA 1HJGA 2XY8B 4LF6T 5HCBA 1DGWA 2WFF3 3R6NA 1H0BA 1S2KA 1OH4A 2WA3A 4XE9A 4AAPA 5A3WA 3LEKA 2VUDA 1UL9A 2XJRA 4QQOA 1D0YA 3KHBA 5IK4A 3N36A 1TMF3 3RC8A 1FOD3 2RE9A 1OEDA 2WNUA 4A7KA 1DQ0A 1VP6A 1Q43A 1QDCA 1ULGA 3MJXA 5CFDB 3QD6A 3AE4A 3B9CA 3PUGA 3CZUA 2F6BA 5FZGA 4P14A 1SBDA 2DLRA 1S94A 2WCAA 5F5WA 5FYSA 2XBO3 4AQFA 5JZGB 2AZ5A 2V6XA 4N9IA 3T09A 1GZCA 2JE9A 5CFDA 2P4EA 1ULOA 2RR13 4P1NA 4OYUA 4H9RC 2ZGSA 5JZGA 4XABA 2VCMA 3VBFA 2JDZA 1CGPA 4DEQA 3OYZA 2AUYA 4UFMA 3QNUA 2ZS6B 5LA6E 3POJA 2O8OA 2WDQA 2NN8A 1JYXA 3UL2A 1OLRA 2WNVC 2ZGQA 2ZJCA 3WSOA 1VBD2 3KCCA 2BU9A 5IFTA 2A70A 1LOEA 3ZXAC 3ZSJA 4E4SA 4Y1UA 2XJ7A 3DYMA 4B4QA 1IOAA 5DAQA 2EHOD 2DDUA 5FZ7A 4HWDA 3ZIXA 4DV3T 1QJY2 2UXCT 4K1YA 4HLTA 1UOFA 4IT4A 1PK6C 1PZ9A 4XIKA 4DBRA 1HFAA 3VBUC 2PTMA 3UGHA 3AZZA 1AR82 4ATEA 4IL9A 4LTAA 3GZUC 3AECA 4P0AA 3DGTA 2HWC2 4Z1VA 3P5BA 4PF1A 3LPGA 4G9SB 4UBGA 2DCJA 4XHXA 5DUXA 1MQTA 4EOZB 3JADA 1ZZ6A 3NVCA 2DVBA 5ABJB 1CPMA 2FDFA 4FVVA 3T3YA 2DTWA 5JSPA 2XLGA 4RD7A 5FBZA 4KWUA 2XH6A 3ZFEA 4MLKA 2RS13 5FZIA 1QJZA 1TME3 4KHPT 1V6NA 4KUMB 5GZGA 3SITA 5JDNA 1LEDA 1J1LA 3RDIA 5JVDE 5ABJA 1W6MA 2FCVA 3LIGA 2VK9A 2DUOA 3J7HA 2X5IC 1PX3A 5ABHA 3S7EA 4CXXA 4YTNA 5FO7B 4ANJA 2XAHB 2A6VA 1JHNA 1M7KA 3SCFA 2YXSA 2D2SA 3ZMVB 3H8RA 3FC0A 4ILCA 2GC1A 2B9UA 3RGLA 3BIWE 4TN7A 2J1AA 2JDKA 2A7AA 4M3CE 5LRSA 4DR3T 2XSAA 2H0BA 5I8TA 1AF9A 4AI9A 3K46A 4AVSA 3RZHA 1OI6A 3ZOIA 1OFSA 4IV3C 4Z91A 1PVC1 1JI6A 3JQXA 2JDAA 1VCTA 3BQIA 2JE8A 4OI1A 1CPNA 3N35A 1KK7A 1YQ5A 4DV0T 2XUEA 2H3RA 5IFPA 4YW3A 1QXPA 4RHV1 4OHWA 2OUHA 4GB32 1PGW1 5ABFB 4PLNA 2LT3A 3ES1A 3AXEA 1OLQA 3O0WA 5L3DB 4DB5A 2EF6A 2PAMA 2KMFA 4UYBA 4GQ7A 1ZYBA 2CSGA 5ABEA 5GLUA 4RS5C 4MHUA 2VU9A 3BB6A 2D3PA 3O1UA 2ODVA 5HEJA 4MGQA 5EV7A 1VRBA 3P4RA 1Y64B 2L9QA 1BEV3 2V5YA 2WO3A 3ZSEA 5ABFA 1NLSA 2XASB 1YFUA 4D3WA 3KF3A 5I93A 1JYIA 2DUQA 3EDUA 4XJWA 1RUNA 3JBG3 1E7PA 2D6OX 2YPJA 4QX5A 3UU4A 1DF0A 3WW3A 3JD71 2GN7A 1OSGA 5FJKA 4EWEA 5J96B 3F57A 2R16A 3HBKA 3AA0B 1PO23 3AZXA 5APAA 3P6BA 2WNVA 1LOGA 2ENRA 3WP4A 2ILMA 5LBMA 4BA9A 4AZZA 1PK6B 2QUOA 1J3RA 4E7SA 3VBUB 3KS7A 4CE8A 2OQ7A 3MUZ1 1HNWT 3BUCA 1VBC2 2DCFA 5BNNC 3IHRA 1J58A 1CQ9A 4ADZA 3WDYA 3LOBA 1RUJ2 3UQ4A 3VHOA 5AQGB 4AI6A 1RITA 1HN0A 1PK6A 5FKBA 4NIIA 2XTLA 3VBUA 4HFCA 1O6UA 5IUQA 1Z7S1 1LHNA 1CX1A 4AF9A 3T0BA 4K0UA 3PUZF 5J98B 4N7UA 2Y6HA 3AAAB 4YGEA 2BBHA 4AWDA 2YMZA 1ASJ2 2W91A 3HWJA 1REFA 1MZ5A 2E9XB 3UKTA 1WGPA 2E5LT 1EUTA 2EIEA 1OQEA 4JZRA 2VURA 4IESA 5HEHA 3FFZA 2PHDA 4QQHA 1VE0A 2UXDT 3IAQA 3WVJA 4Q8KA 2QA7A 4YSXA 5BXXA 4BWOA 5JI9A 5F5QA 4ZS2A 2C0SA 2HWD1 3ESLA 2E9XA 1D7PM 3N9PA 1LESA 5C5TA 3ZDVA 5C8CB 1IG0A 3T1MA 4ONUA 3N2KE 1WR6A 4ILBA 1NY71 4IEQA 2H7OA 1VALA 2YDSA 2CY6A 5F3IA 1O8PA 1YCIA 3VUOA 2LJLA 4XF3A 3BU0A 1UMZA 2WO1A 4K7JA 2VMEA 2ZX4A 3MA9A 4XBFB 2XLFA 4YVSB 4D7YA 1AXZA 5J2TE 2GSYA 2Z5WA 3USUB 2HWB2 2PFVA 2ZEYA 1I94T 2PLV2 5KX5E 4CP9B 4JDMA 3N9NA 4FI5A 3ETQA 4OI0A 4YVSA 4ZXKA 4ZU5A 1C28A 4IV3A 3W21A 2IMLA 3MW2A 4FCAA 4E2GA 3HEIA 1SHWB 4COVA 2R7EB 3VKMA 2PA7A 4JHZA 2W1QA 3OVUA 1UWWA 1X8EA 2GZWA 2EXHA 3MEPA 4YZ2A 4N53C 1XDPA 4CP9A 1RYYA 3DJBA 3KGLA 1J3QA 4HWIB 2WFF2 1YQ2A 4QX7B 4ISSA 3LDKA 4BQXA 1OVPA 4LA2A 2VAUA 4ZZBA 1VBA1 2I07B 4N78D 1HXS2 4D69A 2HEWF 2HWE3 5KC5A 1FOD2 3C7EA 1RUC3 4EJRA 4D6QA 5JXIA 3AE1A 3SNMA 5J36A 1IS5A 2XQ4A 4QX7A 2R1DA 3VRBA 1RUH1 3GZAA 1UX6A 4YRDA 3P4WA 2UWAA 3E22E 5BNNB 1F31A 2XBO2 5CYYA 1JU4A 5DMYA 3PVEA 2ZKLA 2QNKA 3QACA 4D7SA 3U07A 5JDFA 1UYXA 4LO7A 2FBWA 4DUWA 2V1DB 2WT0A 4MVTA 2FMDA 1Q3EA 3E5UA 3J7NA 4AVVA 4CUGA 3RYKA 5BYNA 3AC0A 5BNNA 1N33T 3AAIA 2AH2A 1FI2A 4ILAA 3TN92 2ZX0A 3VRAA 3JZVA 3VKFC 2DCKA 2VC9A 1FNZA 3NV1A 4GYRA 2JIWA 5FXVA 1N1TA 5KR7A 1SDWA 4EZHA 5HEGA 5E6HA 1VJ2A 1MNEA 2QZ2A 4EN7B 3PTRB 4JGZB 4XFIA 4BXFA 5JLVA 1SLCA 1VIWB 2Y0IA 4JGYB 3P3PA 4YZ5A 1V6MA 3WG4A 3H7YA 4P9LA 1WCUA 1PMHX 1XMOT 2HWC1 1HDKA 4JTOA 5T3NA 3OEBA 2RJLA 3ETVA 4JGYA 2SPCA 1H1MA 3RYIE 4I09A 4KHZF 2ORZA 1VRH3 3JAEA 3NBXX 3ETUA 5LK7B 4DQAA 5A7PA 2XVKA 3WF2A 1NOVA 1UYYA 2ZAAA 1JZ5A 2OA5A 5EK3A 4YSZA 1ZBA3 3SFEA 1PIV3 2RJKA 2D3RA 2CBIA 3IWZA 2BKPA 4ES8A 2UURA 2RS12 2YEVC 2VBBA 2WWVA 3B57A 4DNYA 2JE7A 1Q8QA 4LOTA 4MO3M 2Q0AA 2FHRA 1DFQA 2ES3A 2Q8CA 4CEWC 1LOAA 2I6HA 3S5QA 1AVBA 3PTYA 4Q1RA 3KV5A 4A7YA 2B76A 4TXWA 4Z82A 3UKVA 3D0JA 1UOBA 1YIPA 4YG0A 3LK2B 1D4M3 2JWPA 1H7CA 4AEDC 2OPKA 4Z07A 4N53A 3B7MA 1LHOA 3WNNA 3HT1A 4QXBA 5A7OA 4I3GA 3T2OA 4P09A 5JRCA 3CQGB 1V6IA 3AP6A 3W20A 1UXZA 1FJGT 4UW5A 4E2QA 4GB31 3FB2A 4O2BE 3D4KA 1WR0A 1Y7BA 2LSJA 1NENA 1HRI3 5D8AC 3I3EA 1JZ4A 4LO6B 4KU7A 2WZR3 4BPZA 3DEMA 2JDUA 5GLVA 2YFZA 3M7AA 2IAKA 2O14A 4QPGC 3V0AB 2BZBA 4CP1A 4CDQB 4UT5A 3AEGA 1R1ZA 3ENRA 4IGPA 5DQ0A 4XBNA 2ZZQA 5SV5A 2BGPA 2H88A 4X1YE 3U14A 4AKHA 1BEV2 2GDFA 1W9TA 2UY8A 2XAGB 1GKBA 3M3OA 4CCEA 5EZWA 3ANWA 1DGLA 1RIRA 4Q0SA 2FQPA 4YM3A 4JYAT 2CE7A 2RS52 4W8JA 4HFHA 4UV8B 1AR93 3JQWA 3WT3A 1U5PA 4C91A 1VBC1 1J59A 1EAH3 3GJAA 4JUYA 1HRV2 4YM2A 4CCKA 4LJHA 1RUJ1 3MPBA 1XSRA 3AL5A 4ZHNA 1FT9A 3T2TA 5FYCA 2WWSA 2X29A 3QH6A 3ZSTA 1JU3A 4HFDA 5KDMC 4CTEA 4FOYA 3ZYRA 1VB2A 2Y8KA 3NJYA 4R9DA 3GGLA 1Y01A 3OPWA 5FXZA 1R8IA 2ARBA 4IGQA 3L39A 4Y24A 4PIYA 1B09A 1IJ5A 5BUVA 3NNJA 2OKXA 3OUHA 5FMDA 3AP5A 2PHXA 4P9WA 3BCWA 4Y1VA 2MEV1 2IUBA 5FPXA 5IVVA 4ZZ5A 4Y4YA 5LCWL 5K8SA 4F7ZA 1DBNA 1SCRA 2IW5B 2Y6GA 2VW2A 5KHJA 1RVF3 1POV3 5A33B 4XMIA 2A1XA 4KGGA 2QQIA 3HMYA 2XJTA 3NRXA 3QC9A 2XAJB 3HR9A 4E4HA 1T6BX 1FYUA 4CEWA 5AFUL 5DUUA 5CADA 4AFAA 3RZMA 5AQLB 5JDBA 2VXJA 2OV9A 5A33A 3NQHA 3T4VA 5L3GB 5E89A 2AREA 3ZKRA 4V1Av 3M8LA 1SACA 4CCOA 4NWVA 2E53A 4PBPA 5FYBA 1LR5A 4OZOA 3KD4A 1QIQA 2EA7A 2VE1A 3A22A 2ZHNA 3MBWA 5L4HA 1IZNB 4JI8T 4OVEA 4HN9A 5FR3A 3PUSA 3PUYF 3ST7A 3LFIA 5C6CA 5FYZA 3H50A 1GR3A 3UQ7A 5C3JA 5AQPB 2LE8A 4AW7A 4X6QB 4XC9A 3ZFFB 2VCAA 2KNDA 4WM8C 1T98A 1S55A 2CHHA 4R52A 4B3MT 4FI9A 2W92A 3NV2A 3TNQA 2Q5TA 2PYTA 2F4PA 1KFUL 4XQ4A 3OBAA 3ZXDA 1HXS1 3A7MA 2WFPA 1V9U2 2BQPA 1CZVA 1EV13 4N9HA 4XF4A 4YT0A 4QPGA 1US3A 4Q4X3 4KL1A 3ZFFA 1FOD1 3A21A 4ZS3A 1S2EA 2VTFA 3ACGA 2G0UA 5A6YA 2CWSA 4E4ZA 1ZZ9A 3WY6A 2OT7A 4XZCA 3M70A 4Q0UA 2WKKA 3IM0A 1RUC2 4Q4V1 3I2GA 3S6PA 4L0RA 1S0CA 2XQRA 2Z79A 3VHLA 5L73A 3PUHA 4B29A 2YHJA 4NWWA 2IC9A 5FRAA 4LO5B 4L9IA 2VOWA 3VV1A 2CTVA 1AL23 2WABA 2K5BB 5DUWA 2BYVE 1S0BA 3ACLA 3I4IA 3ZYLA 1JYVA 3TN91 3MZHA 3L3PA 1R083 3CJIC 2CHNA 2Y26A 4DRRA 1G8WA 5HPOA 1LCLA 1N3OA 3IDCB 5DAPA 3BKZA 3KHCA 1YJLA 3KQ4B 4B7KA 5FYUA 1WW6A 4IDZA 5CA6A 1ND3B 3J8F1 5LMUT 3KQRA 2R6GF 1GSLA 4NE9A 4HVQA 4XDOA 5FDBA 2JENA 3N9MA 2YC4A 5LBQB 2WC2A 4HK8A 4N43B 4QDRA 4LULA 2LRPA 1ND3A 1RXGA 5FVLA 4OHXA 5L7OC 1XE0A 2VZSA 3H1MA 2LSGA 4JKLA 1MZEA 1VMJA 1AHSA 3DCQA 3FX3A 1XSQA 4TV8E 3ZFGB 2PQQA 2ZGLA 1RHI3 4NIDA 5BR8T 5DQWA 5IAXA 1VMHA 2X10A 2QQUA 4NHKA 3W9AA 5HXVA 4TWDA 1W0BA 1VRH2 4B4PA 4NJ4A 4YFWA 4DXTA 2FJDA 2PG8A 2V4AA 4Y3OA 2RS11 1VBB3 3ZFGA 3BVCA 4AFCA 4EQVA 3LF7A 2NWBA 2JECA 3AYEA 3NRYA 3WNLA 5D1IA 4QM8A 2ODUA 3KV9A 3JC6D 1X9TA 2W52A 2ADDA 1PIV2 3Q8FA 1NKGA 2P6HA 2WR9A 5CKMA 5GM0A 3N7LA 2QBXA 2E8IA 1W06A 1YNAA 3L09A 2V26A 2ZGUA 4ISTA 1AR62 2UXBT 3BPSA 3QUJA 2W3JA 3WZ1A 1YQ4A 1NYWA 3RFRA 3RGBA 3DXUA 4GMP1 4LIVA 5HWYA 3RG0A 4WVMB 4ZONA 4Z92B 2ZEZA 1YXRA 2W94A 3JU9A 4LBQD 4HMZA 1JZ8A 3RH3A 1JNRA 1S0FA 4YARA 5LHHB 1AYM1 2XQ8A 3RI8A 1U4QA 1POQA 5DDJ1 4HKLA 5LW9A 4XXAA 4UEMA 2PHUA 4XBQA 3VLBB 4MGIE 4WZFA 4DFSA 4NHYA 3J9X1 4FPCA 3NVOA 1HF8A 4B3NA 4H55A 5KBFA 5AQTB 3DPRC 3O1RA 4P9GA 3UUBA 4AVBA 1N1SA 3MYXA 4FTBA 2JG9C 4BK4A 5FWEA 2MHFA 1JODA 4DR2T 1QH6A 2IXKA 3IMMA 1IKQA 5JIUA 4PCRA 1MMNA 3CKDA 3ZCJA 2DURA 4DNDA 3WCSA 4YVWB 5CIRA 3VKGA 1PGL1 4CVUA 2WZR2 3MV01 1W6NB 1JH5A 3C4WA 2DVDA 2YINA 4KI5M 1O4YA 3K48A 1BMV2 1H1IA 4QPYA 5JDMA 3OBTA 5FZ0A 5HCMA 2RS51 4K40A 3DP7A 3NWKA 3RZGA 3LDBA 2C6SA 4UVBB 4YVWA 1N47A 4Y1ZA 1W6NA 1LB2A 4E8CA 1UY2A 4U31A 1FPN3 4GZ9A 1HRV1 5J48A 3PHMA 4XOGA 3POFA 4Q8LA 5FZMA 1AR92 5JREA 3AP7A 4YGCA 2W47A 4AVTA 1K12A 5C9AC 2LHNA 5FWJA 5BNOC 1OOPB 1G9BA 2E26A 2VMGA 3CLPA 4RA0A 4R8HA 1OPMA 2LM9A 4MH0E 4BU2A 3TNPB 2RM23 4QDSA 1RGSA 1H2LA 4YSYA 5L7OA 2CAVA 4DV5T 2BUKA 2JJ6A 3NL1A 5T50A 2J1DG 3NKGA 1FMVA 3C7OA 3Q2MA 1DGRA 3WQ1A 3VZNA 4FSJA 5CKNA 1DIWA 2P3YA 2HPLA 3NSTA 4AHXA 5A32B 2NTXA 4L0PA 4EAHA 5IVBA 1V6JA 3UKNA 3WG2A 2WU2A 4ASKA 5A80A 1APNA 3RRCA 1C5IA 1BQPA 3EYPA 4K3UA 4PLMA 3KBUA 1R1A3 5EJ3A 2IXHA 2L9LA 1QSDA 1RL3A 1DZRA 5F3EA 3HVDA 3CPZA 1JZ3A 2HEVF 1RVF2 2VKJA 2LRKA 2WS93 4XDQA 1VR3A 1RUI2 2HYKA 4QX1A 1B35B 5DAVA 2QVSB 3FN9A 2FCTA 1Y9MA 1XNRT 2VBDA 2IIUA 1W8FA 2XJPA 3BPZA 1J5ET 3PV0F 2C5JA 2IWGB 3P8CD 1W28A 4YFZA 5DG2A 3GHNA 3EAMA 1S1AA 3WX5A 2V09A 4BDVB 1B35A 1YJKA 2RDSA 2OLTA 1AYN3 3SEPA 5LJNA 3DPRA 4META 1ZHCA 2W67A 1GQGA 3CQCB 1RUOA 1YKHB 2JG9A 2W95A 5AQMB 3H8OA 1V9U1 2EHOB 4YPJA 3ZMSB 5EXOA 2JKXA 1G86A 4QMAA 3T2PA 4SLIA 1XZYA 1OT5A 3RYCE 3NZQA 3D3AA 5A3PA 2KSRA 4JEHB 4DUVA 4DXZA 1EZ3A 2DWGA 4HK9A 1RUE3 4TWTA 4Q4X2 1YQ8A 1RUC1 4QAWA 5B2GB 2RS33 1E5IA 3BQLA 2YBPA 3R4SA 2GP5A 1JYTA 1T6GC 2ZGOA 3ZYIB 5HBAA 3OPZA 5A3TA 3ITQA 5L3BB 2CL2A 3H42B 4ASLA 1W3VA 1ZOYA 4NIAA 5JOYA 2CA5A 4OHYA 1OXCA 4S2DA 2Y34A 1YW0A 1KS4A 3FLPA 2C4XA 1QOSA 3ROUA 1DQ5A 3VU7H 4IUGA 5K0UB 1GYKA 2AEYA 1GFF2 3VDBA 4GJYA 1NZCA 1D2SA 5C9AA 5BNOA 4UXNB 1W8NA 3ZPYA 4BJMA 3KV6A 5HCJA 3C4ZA 5K7PA 1ULEA 2BKOA 4PF5A 3QLQA 2O1QA 3KINB 2YBSA 2XL9A 2NZ9A 5K0UA 2X67A 4AHWA 4EE2A 4DV4T 1H8TB 3D0TA 4Q0QA 3P4SA 1C3HA 4Q4W3 5A3OA 3J4UH 4M3CB 4E27A 1H8VA 3AA7B 1LAJA 5L36A 2CXLA 1SHZC 5GLZA 4UVAB 4WVZA 3H8UA 4O9EA 1DHKB 1H8TA 4NR1A 1CAXB 1C8M3 4MV2A 2ZGPA 5EQUA 2YC0A 1W8HA 3BYWA 2RDRA 4M3CA 4I01A 4XEZA 4XDPA 5ERLA 4D8MA 4Y1XA 2RDQA 4BLIA 3UFEA 2Q8OA 2E7QA 4IE0A 4HBNA 4ZHQE 4UFLA 1CAXA 2W0XA 2YGLA 2ZTNA 3TBDA 4NUVA 2A3XA 2R073 1OA3A 1LRHA 5F2WA 1MS1A 2ES0A 3G6JB 3H0OA 3FUOA 3CBNA 1LVKA 2R042 4LFAT 3TYJA 5AQIB 2KA3A 3D5OA 1PIV1 1LOCA 1PNFA 2PXJA 3PIGA 2MPKA 5JVVA 3LD8A 3GN5B 4A98A 1H2MA 1ULDA 1AJKA 1NAFA 4YM1A 3W5NA 4EGWA 4QU1A 5AC93 1AR61 4UF0B 4ZXLA 1ZRFA 1T72A 4FOWA 1HG2A 4CP0A 4UW4A 4LPLA 1OLME 1WLWA 4AQ2A 1HB1A 3GN5A 5FP7A 2R32A 3MIDA 4HEAA 2CXDA 2LS6A 4UF0A 1COV3 5CG8A 2E51A 1Q8PA 1IS6A 3QBQA 2WT2A 2FDGA 3O12A 2RJ2A 4IEOA 2AGSA 2R49A 4K1ZA 1WW4A 4ZXEA 3ORJA 4AK3A 1A78A 5LJMA 1W6QB 2D6NA 3AKTA 4FXKB 3SH5A 1H4GA 2A3WA 4JDOA 3PDQA 4YZ4A 1E5SA 3VHRA 4XILA 1XU1A 1SLLA 4GKJT 5CISA 1JS9A 3ZN0B 1W6QA 2VWAA 1G9FA 1DQ1A 2UU8A 1UIJA 4FAHA 2WZR1 3WF3A 1HG5A 2ZGNA 4CDWB 2X05A 2V7KA 3T8OA 4D0QA 1NT0A 3RKOA 2W08A 5HXSA 3KM5A 3N7JA 3BOPA 2WINB 2QQPA 2X9XA 5GLWA 1H9PA 3B69A 5LXTE 2MPFA 5JUVA 4EB6E 3ZR6A 5IT6A 3I2IA 1C8NA 4LIUA 2I2SA 1IKPA 1WD3A 3GBGA 4X66T 3ZPOA 1OQ1A 1TEIA 2QQMA 3OBVE 3SOLA 1ND2B 2W61A 5A6QA 1U0AA 5E16A 1XBFA 4O7XA 5HXHA 2DL1A 3PVNA 1URXA 4UAPA 1ZZ7A 4QU2A 2PBIA 5LHGB 1FPN2 5JDHA 1ZRRA 4HPKB 1R092 1ND2A 4GJZA 3QB5A 3GALA 3WUCA 3O9XA 1UGOA 2XZEA 2TUNA 2LALA 1JYNA 2GH2A 4AHYA 2ZA9A 5L19A 3N2GE 3NJXA 4JI0T 3OPCA 1F35A 1NEKA 3LB9A 2RM22 5FP8A 4GKXA 5K9YA 4W6XA 1JYCA 1KFXL 1T8BA 4NRQA 3M3ZB 4XUPA 5E1RA 1NA1B 3FJSA 1UY3A 3TEYA 2XVGA 4KH9A 4NXMT 1U5YA 3CX8B 2GNDA 4WZCA 3B00A 1K5MB 4QX3A 3U37A 4CQIA 3POEA 2ZEXA 4BK5A 4ZI7E 5FZDA 5ACA3 1OA4A 3ONLC 3SRZA 2Y48B 1GWLA 1NA1A 2O0OA 4CDXB 5IWAT 1REEA 1YI9A 4QDQA 3WNOA 3WDUA 4LT5A 1CWPA 5EFUA 4JKKA 4AE2A 1ODNA 1RVF1 1UKGA 1POV1 5A3MA 1YFYA 1SBEA 3I2JA 1R1A2 1MS9A 3AEEA 4L8QA 4PDWB 2HWF2 4CU8A 2QZ3A 5F39A 5T5JA 3C51A 4HFEA 1RUI1 4KU8A 4M4PA 2P3IA 4BQ1A 1W2TA 5EHDA 1CZSA 4GIQA 4R9BA 4CDXA 3BALA 5JI7A 4X8PA 2NMNA 4Z8BA 4IDPA 1MS4A 4LMJA 3LWCA 3H1YA 4PDWA 4JI6T 5LBFA 1F8VA 4R4ZA 4H9OC 3EB7A 4KX6A 4L5GA 4DR4T 2E31A 5F6LB 3HKEE 3ZR5A 1WCKA 2IXIA 5SV8A 2BG9E 1O3QA 3BTXA 3UNPA 1UK5A 2CRBA 3OF1A 1NG0A 1YRZA 4QKFA 5F3GA 2ZHLA 3I2HA 4G63A 1QJX3 2GALA 1AYN2 4CUCA 4KG8A 3CIHA 4GKKT 2ZEWA 1E57A 1UZYA 4ZKTB 4IHJE 1BK0A 4BMBA 5A3LA 3AE5A 3ZN4A 1HQLA 3N2OA 3ZT5A 4Q4X1 5FQ0A 4IEWA 4FOVA 1LECA 3H3LA 1CJDA 1DYKA 5FYYA 3ABZA 4KP3C 3C50A 3K8PC 1OQDA 2ZGKA 1XRUA 2BVVA 3NO8A 1UX4A 1DLCA 1RUE2 2E7TA 2VNRA 4BQWA 5FO9B 5L3FB 4J6GA 3UU8A 3EI0A 2VJXA 3RRDA 4QX8A 5F2SA 4GWJA 1XC6A 4LKDA 1NCQB 4HKWA 2X0HA 4AHZA 2W0GA 3DL3A 1HX8A 4SBVA 5JPNB 3FLTA 4KMQA 2VO5A 3POSA 1ONAA 3VDDC 1W9YA 2UXNB 2EVXA 2A75A 4QXCA 4YW4A 3L9JT 1VBE1 2X09A 4D94A 4CEYC 3HNYM 1DGRN 5FPVA 5H6QB 4HFVA 4WM7B 3JCFA 5I0UA 4YGDA 1OEDE 1CONA 3AVRA 2W66A 4AQYT 2D40A 3AZWA 4MLOA 1K5JA 3OGSA 4BYYA 3VBHB 1CN1A 3GYDA 4FP3A 2UWBA 4DRVA 4GH4B 4MYEA 3SHRA 4IW3A 3VBSC 3JCIA 3H37A 5FMBA 1QJU3 5FPAA 2LHRA 3VDAA 2X9HA 4IV1C 1QY4A 1RUF2 4XVHA 2QYWA 5FZEA 3E08A 3VHPA 4XJZA 4BOWA 5EZYE 4INDA 1RMU3 4GH4A 2JDPA 1EP0A 4P9JA 4M1PA 2D98A 2RMU2 2ZHMA 2MYSA 2NW8A 4H9QC 4I50E 3EJKA 3EVYA 2R041 2IZWA 3AEAA 4LE4A 1AR73 2C5KT 3RMXA 4PJNA 1UMIA 5AQRB 1WLXA 4AKGA 5LA1A 4RFRB 2MNGA 4YW2A 2DVFA 1DQ2A 4ZU4A 1X9BA 4HTEA 1UZ0A 3K3NA 1Q8SA 5LA0A 3AYAA 3KVBA 1V6KA 4XFAA 4EN0A 4AQTA 4AQ6A 5EJ1B 4AXOA 5AQUB 4LMLA 2XM2A 3I59B 2P17A 4FBFA 1W39A 1KXGA 1O8SA 5AQFB 3AKRA 3G06A 3OKQA 4IE4A 2VOXA 1BLZA 4KBMB 1IBLT 5B4NA 5DAWA 1BHGA 2NR4A 4Q26A 4A44A 2W5FA 4A7ZA 5C5UA 2BVMA 3RMYA 2ACZA 3Q8AA 4MGSA 4Y20B 2VQUA 4Z2AA 5FY1A 2C9AA 2WB5A 1V00A 4FFIA 1MS8A 4XMAA 1G73A 3N7MA 1COV2 3CNAA 3ZKYA 3FWEA 1YYNA 2D0UA 2BGOA 1WBFA 1W03A 1UUSA 4X8NA 1WFDA 2VOKA 4Q5OA 3SCHA 3WF1A 2C5DA 4Y20A 2HBTA 1SDDB 5KMGP 3SFDA 1H1AA 2XLAA 4XFCA 3AE3A 4XAXB 1MVEA 5FY5A 1CR7A 1RUD3 4CYDA 2JG8B 5JR9B 4JQTA 4X62T 3AFGA 3OTFA 4LEJA 1MMAA 3R84B 3VDDB 4DV6T 1W6PA 3RNSA 2XB6C 4W65A 2BERA 1PZ8A 1GICA 2YROA 2ZGRA 4YLZA 2JG8A 4JAAA 2BFUL 1SMVA 4M01A 1HS7A 2NLRA 1UY0A 1CD3G 3VDDA 1KNZA 3U4SA 2GNBA 2P3KA 2DU0A 5JXHA 3RYHE 5CFDC 4QH4A 5FUIA 3DUIA 3VBSB 4AFDA 4CEYA 3WQBA 1FPN1 3EABA 2ZZJA 3WCRA 3OYWB 5JZGC 1JUHA 1R091 4TYSA 5HV4A 4AQSA 4BLJA 1XE8A 1G6NA 1GANA 2UYBA 4PLOA 1KNPA 4JI5T 3HIFA 4XF9A 3PVOA 4LF7T 4K6BA 3VBSA 2VOTA 5DN2A 1UYZA 4COYA 3OYWA 4I2OA 2A2FX 1XYPA 2HJIA 3WNMA 4ASMB 1Y4WA 2PHWA 1QQP3 4NPRA 1OA2A 5ANNA 5HWXA 2EIBA 3IKWA 2LM3A 4YW6A 4OMCA 4QB2A 4IGUA 3H3ZA 1BVVA 4H63V 5IVYA 5LB6A 3OBRA 1WBLA 3RZZA 2VG9A 1DQ6A 2K48A 1O3RA 4K9SA 1V9DA 2BRTA 2WRAA 3QOFA 2WLPA 2DTYA 3L2YA 1CIWA 3RI9A 3N7KA 4W6WA 4BISA 1CHUA 3FHAA 4UFHA 1R1A1 5ACA2 2HWF1 2GK9A 2VW0A 2BDRA 2ARCA 5A7WA 4ERRA 4DIDB 4U2YA 5LNKA 3MO4A 3ON7A 1PO13 4Y22B 2ZAHA 4LR4A 2QQVA 4IDQA 4CN6A 2W39A 3FZ3A 2W63A 4O2AE 4Q4Y3 2CM0A 1RUG3 3SC7X 5ABJC 2Q30A 1CIYA 1OUXA 2XWJB 3Q5XA 5EK2A 3BU7A 2BDEA 3UUNA 4Y22A 5C71A 3S7IA 1XOYA 4LUKA 4AI0A 4QGLA 2VVEA 3RIUA 2Q1ZB 1ZZCA 3TLVA 3VZKA 3J7LA 5IWFA 1Y9QA 4MGYE 2ZX3A 1W8UA 3SS1A 3WV6A 3R05A 3B9IA 4HVOA 4DINB 4I3PA 1WW5A 4GALA 4C1WA 1OBNA 3ONXA 5J09A 2JIJA 3F2EA 4EWAA 2RA1A 3TLUA 5IATA 4X64T 4B3TT 1LOFC 4L97A 1D0HA 5EWSA 4IL4A 1RUE1 4OI2A 5FLJA 1BR4A 1V0AA 1LKXA 3R4DB 3EBRA 3CX6B 3AAEB 3Q9OA 1X8MA 3FBLA 4D6SA 5LEKA 3O1TA 2VQ0A 4DBQA 2QJVA 3N9OA 1GV9A 2W1SA 3FUQA 2DWKA 4BQ3A 5JSOA 4A97A 1LHVA 3RPQA 3WR0A 1S0JA 1FV3A 2AC1A 1BKZA 4GD4A 4ZZ8A 3FXEB 2GC3A 3GHMA 1L7LA 1O3XA 2XGXA 4AQGA 3SLIA 4EEBA 1ZBE2 2N1GA 2JKBA 5GONE 5L47A 2R062 4OFZA 4WZXA 1MZFA 3UUMA 5J1XA 4MFRA 4XTPA 5AQVB 5F37A 4MXVA 1X33A 4PFPA 3C98B 4ZOLE 4LBQB 4YLHA 3PURA 3S4UA 1RUF1 3OTOT 3WOGA 4LBNA 4N90A 3CL1A 4CCLA 4X6RB 2I74A 1OH3A 4QXHB 3VHNA 3I1AA 5CKQA 1GZWB 1N3PA 4IEXA 3WHTA 2JMHA 4D6RA 2Z4FA 3E97A 2CWYA 2RMU1 2C0ZA 3HJRA 4TNWA 3IPVB 3I2OA 2YZ4A 1RMU2 5CJ5A 4YTPA 4QXHA 1XQNA 2BTVC 3H9AA 1OUSA 1GZWA 5LCYA 3TLTA 1GQPA 2VM9A 4H7MA 4XFGA 4LA3A 2ORXA 3Q9DA 3ZSMA 5A1AA 2E9XC 1BR1A 1IGOA 4BAYB 3J7Yq 4AGRA 4MHCA 1AR72 4CI2B 4ZI3D 3UGGA 1WZXA 2O8QA 4AI8A 3MIBA 4IDNA 2VQFT 1C57A 1WMXA 4AG4A 2CWOA 1QLBA 4NHXA 3I9WA 2WJSA 2Y38A 5FYHA 2CGOA 2FD8A 2YPDA 2EIGA 3KFWX 3PUXF 2GU9A 2UUAT 1UKRA 5JXGA 4PJMA 1W05A 5C8CC 1Y3TA 1DYPA 4M4RA 1D0XA 2JQKA 1GMMA 3TEWA 4NXNT 1KFYA 1U5ZA 5IK7A 3SISA 2OA2A 1UAIA 1AJOA 2B39A 5FPBA 1COV1 3IDEA 4XFHA 5C8WA 2HBUA 2JRKA 1PVC3 4QKNA 4K8RB 2G1MA 4JI4T 4XPVA 1WCSA 5FMNA 5BMVE 2WZHA 4YVSC 3S5AA 2CCQA 1Z0PA 1BBT3 1QKQA 1X36A 1LOFA 1K3IA 2CHOA 3Q8EA 5BY5A 4Y26A 3E6CC 4HN0A 1UF2C 4XCBA 4NOTA 3FHNA 3VR9A 2EAKA 3OGRA 4P08A 2XVLA 5FKYA 1A3KA 3MI8A 2VVNA 2WL1A 5CFCB 5FK8A 3A5XA 4HT1T 4JX0A 5LEJA 4OX9T 2V6YB 4PW8A 1SQ4A 1I5ZA 1RUD2 3H1WA 4CZSA 4A5XA 4JTNA 1NZIA 4EXTA 4H9NC 3JD73 4TUYE 2X53S 4MGTA 3O1JA 4ARYA 2LOSA 3HN3A 2XOMA 3BN6A 4RQPB 5CFCA 2J1TA 5A1LA 4RL7A 4R4XA 1AZDA 3VD4A 5KXJA 5FBJA 1ZVFA 5L9VA 4PK6A 4CXWA 4RYDA 4FPLA 1TQ5A 3PL0A 5F1RA 2KWIB 1JXNA 3OY8B 2VKDA 3LEMA 4CU7A 4UW3A 5JWPA 2VNGA 4TLGA 5G04L 5LA2A 3PE0A 4COUA 1MIWA 2WP9A 2AR6A 1BYHA 1Z7S3 2VECA 3K4DA 2YU1A 1ZRIA 4GMP0 3MF9A 4J1XA 5FZ9A 1W8WA 1CAWB 4IDOA 1EPZA 5IK8A 3VBRB 1JNZA 4UI9L 1DYOA 1L3JA 4TZDA 3PJQA 3SWHA 4NHMA 5KXCA 5CZKA 2W68A 2BVLA 1QQP2 2FJEA 5F9TA 2VD7A 4RFT0 1HIXA 3PUIA 1XNCA 5A3UA 1YIFA 3HBZA 3VBRA 2HWD3 1KDMA 1HNZT 2VVSA 1TVGA 4WVVA 3RRWA 4A3XA 1N34T 4LXLA 2CPTA 3VB9A 4JGZC 4BJ0A 3ZXJA 2YDQA 3N4MA 4UFKA 3RS6A 4CDUB 3R4UA 1JW6A 4RGAA 4JGYC 4FPFA 5ACA1 5FZKA 2ETEA 2D7FA 5JIAA 2XDVA 5IYZE 3AA6B 1O4ZA 3INAA 2BEOA 4YW1A 2HLEA 4WBOA 4N7IA 4O8SA 1E5RA 2X51A 3A0NA 3OD0A 2Y8DA 4RR3B 3BI3A 3V65A 1UO9A 5C8CA 3O1IA 3T30A 1JYWA 1PO12 2R1BA 1JBCA 4YXDA 4I02A 5BNPB 4XF0A 4ZZCA 3IDBB 1MZ6A 3ZT6A 4ZI2C 1Z8UA 3HKDE 1YLLA 3ZMTB 1FMD2 3ZYJB 1SPPB 4NIHA 1SE7A 5HAXA 1O4TA 4RR3A 4Q4Y2 4EYYR 5JDLA 2Q9QB 1IPKA 1UX5A 4XJ8A 1GZ9A 1XNQT 1WUVA 2A6YA 4XZPA 3USUA 2Y6KA 3GZTB 4XETA 3OGVA 4QPIB 3LPFA 4B1MA 5I0SA 2QQWA 3FZMB 4XF1A 3ZCIA 1VBA3 1BXHA 4K8FA 4C1XA 4KQ7A 3LK42 2A6WA 2VZ1A 4XIOA 3IF8B 2GMMA 4ZY9A 4F8HA 4DVDA 3CF6E 2VPVA 2RVAA 1HV0A 2VZUA 2XJVA 1DU3D 3VKOA 1RUH3 1TMF2 3KT4A 1FX5A 5FZ1A 3POYA 2QCSB 1Q56A 3D8CA 3V0BB 1E2AA 3RYRA 1ALYA 1US2A 4AI1A 1GP5A 1ENSA 3GMIA 4EV6A 3P3NA 3VZMA 2LLYA 4JEUB 2PN5A 1RB8G 4ATFA 3U10A 4E2SA 3KSCA 2IXLA 3OPTA 4JV4A 4PNIA 2DCTA 4FQ4A 2RV9A 3V0BA 3AK0A 2RR12 3I54A 3PUVF 3RSJA 1UZZA 3Q5DA 3C7GA 2WN2A 4HSJA 4CDQC 1VBD1 1ZBE1 4HFIA 1XU2A 1S0EA 5FLHA 1QMJA 5HI0A 3U11A 2NP0A 2R061 3IIIA 5FL0A 2BFUS 2CBJA 4NRPA 3AA1B 3NZPA 4XACA 2XQ9A 1UU4A 5K4LA 4JV5T 4G4FA 5GZDA 1AUYA 1XNBA 2LOPA 5FY8A 1ZP0A 1WCDJ 1QJY1 4DS0A 5FXWA 3UU6A 2OZJA 3LZZA 3AKQA 1PGSA 3HA4A 1OLMA 2HWC3 3WW2A 1FNYA 1H2NA 1WA6X 5HCHA 2A6ZA 3A4UA 5C3PA 3RI5A 1AR81 5FZOB 1D1AA 3H3AA 3AZVA 2DBNA 2JPFA 3VN4A 1HCIA 2WLQA 2VZOA 3MDPA 4JGZA 4COFA 1WLDA 2LROA 3NNLA 1HR0T 4HWCA 4P02B 4JC1A 1RMU1 4DIQA 2I59A 3VZJA 5CAZA 2VQET 2IC6A 2DVGA 2K2SA 4CPBD 2XR4A 2VH9A 1UXXX 2BNNA 2VZQA 5DAXA 2Q4SA 1J83A 4N8MA 2MBGA 4KWKA 4URAA 5AVPA 5FYMA 2OIIA 3LDRA 1S35A 1AR71 1NQDA 4U7YA 1LNSA 1VMFA 4XCAA 1FXZA 4KNCA 3AE6A 5HYAA 3RQ0A 4H2AA 1HJFA 5GJ6A 3LEGA 5IW0A 3WG1A 5IVCA 2CGPA 1TME2 5I0TA 5L3EB 4JBWF 5JR7B 2FDJA 5IHRA 2MOZA 4QKBA 2VZPA 2KXLA 2XQYA 3LSVA 1QEXA 4HFSA 3ZN1B 2A5ZA 3CQXC 1LHUA 2KINB 4ILUA 2XPKA 3RQUA 2FZ2A 5FPZA 1YFWA 4MHRA 5JXJA 5GKAC 4OK0A 1V6LA 2G9GA 2J1EA 3IMNA 3V56A 3VKHA 3OCPA 5LRRA 4GB33 4AVCA 4RGKA 2DI4A 5C33A 2WBLA 1S4CA 4QQPA 5FMOL 2VCBA 4LBKA 3DF0A 5FJHA 4X65T 1BBT2 2RG4A 2CAUA 2EIDA 5JDQA 3OUJA 4AFMA 2P34A 5A7QA 2FDKA 4ISRA 2DCZA 4FQZA 4XTMA 1ODMA 1MS0A 2VZRA 3OEAA 4PJLA 1SCSA 2KR2A 3QOPA 2WMOA 3ZFFC 3ZN6B 4DY5A 5F3CA 3M3CA 5F32A 1NUKA 3VBOB 3S57A 4EN8B 4L92A 2WZ8A 5KHGA 1YQCA 3QK6A 1OPOA 3ZXKA 4X5TA 3V0AA 5FLIA 4LK7A 4CDQA 4S2HA 3KT7A 1VBC3 3ZN6A 3ZM8A 3NV4A 4FTSA 4ZEYA 3D6EA 4LF8T 5CA1E 3LDQB 5I8YA 3JBG2 2QE3A 1IS4A 2XQ7A 4PIXA 4FPJA 1RUJ3 2E5VA 3I0OA 1PO22 4R9AA 1LVFA 1GWMA 5JPMB 5IYYA 1YHFA 1X9PA 4I43B 4UW6A 1UPIA 3IN9A 4BQ4A 1AXKA 4DR1T 4X1KE 2OZ6A 3WG3A 1GP6A 2V5CA 1RC6A 2NMOA 5DABA 1BJQA 2RPAA 3NMBA 3WINE 1HB4A 2XPJA 1UZVA 4PK4A 2BG9B 1W04A 4NAMA 3RVHA 4F6RC 2FBEA 1SLIA 3UTKA 2DV9A 1QQP1 2EXIA 1ASJ1 2WQZC 2R0HA 4OMDA 3ZYPA 3M2MA 4DMIA 4XUTA 4ES9A 3OGJA 3THTA 4EWDA 3RYPA 4GULA 2MEV3 3BTZA 2W4XA 2GN3A 4QT6A 2WAUA 1QNWA 2VTXA 4DUZT 1ND3C 2NP9A 5C3QA 2HWD2 3GZEA 4LKFA 3ZXEA 2V4VA 3WAKA 3C4XA 5IUXA 3O0VA 1SFPA 1G9DA 1KDKA 2B1EA 2KXPB 1ZX5A 2BW8A 4FFHA 5FYTA 2OUJA 2TEPA 4N43C 1UN1A 1OD5A 1N1YA 3NJVA 5JR2A 5L9BA 1F5FA 2DNXA 2YY1A 1FV2A 1EPWA 3FE5A 5HCAA 2ZACA 1LULA 3K3OA 3ETPA 5E8AA 4RN5A 1PO11 3ZXLA 3ZFGC 2VVFA 5FREA 1EY2A 3U4XA 2C5IT 4KWLA 2HWB1 5CVRA 1FMD1 3T0AA 3RIFA 2XONA 2ET7A 3K2OA 4TX5A 2PLV1 3UULA 4I0AA 2F4VT 1IPSA 2G19A 2WSUA 3U0ZA 2XHKA 5CGMA 4NVPA 4QGNA 4H9SE 1OEDB 2WNUB 5T5PA 1F4HA 4JI3T 2C1FA 1HKDA 5ADXL 2CNAA 4XBLA 4P9XA 2BWCA 2W62A 5LGNB 1HXS3 1W0AA 2WFF1 3TEXA 3WP5A 5C4WC 1DGWX 4GYSA 2Z42A 4B1LA 3K75B 1VBA2 3JB4C 2K3WA 1W0PA 1TMF1 4BQ5A 2ACXA 3POIA 4UELA 1W6OB 4IERA 4B6XA 4S2FA 3CZJA 4GKYA 3OSDA 3AMHA 2X0LB 4Q4V3 3VBFB 2IVJA 1LU1A 4JKMA 3HKCE 2GC0A 1RUH2 2HWE2 2XBO1 3ZO0B 3GDBA 2I0MA 3KCYA 2JJ9A 3KWVA 4UFIA 5FZHA 1JZ7A 1W6OA 4ZU7A 2B4KA 4Y4RA 4UVCB 2JQHA 5KHHA 4B3ST 1VB4A 1IQAA 1W2NA 2RR11 5AVAA 3TN93 3VZLA 5TSWA 4DY3A 2CDOA 3LBXB 1POV0 3BIEA 1VPHA 5A1FA 5F5CA 2WYFA 1PHMA 3I49A 3MLJA 3OJAA 3TAYA 4DOUA 4MX3A 2P3JA 4YVWC 3BTYA 3J8F3 1AJ3A 2ZHKA 2W1WA 4I55E 2YOEA 2X8KA 1NE4A 3LBXA 2ZXQA 4P5YA 4FPOB 5CBLA 3USSA 3L2HA 3VD3A 4MXWB 5AQNB 3RC3A 3K4AA 1VAKA 4GA9A 3S0MA 4L2NA 3CKHA 4MUVA 4O9GA 4MGKE 1MQTB 2IHR1 3BGAA 3I3QA 1DLLA 5GALA 1XPWA 5IJRA 5KC6A 4U3CA 1WW7A 4M0HA 4MXWA 1L7QA 1X50A 3AYDA 4YW5A 3ZFEB 3A7QA 4AISA 2B5HA 4WV8A 3AYCA 3WF0A 3SMHA 2HN1A 3C2UA 1E5HA 1OOPC 3UK9A 3PMSA 3ABVA 1W6MB 4LO4B 5DZFA 1LENA 3I9YA 4NN0A 5F6KA 4N43A 3UGFA 5LA9A 5FUNA 3RIAA 3KBTA 4OQ9A 1LJ7A 2D6MA 5DZGA 1O3SA 2P37A 5I0DA 4IIJE 4ITCA 3I3MA 3HQRA 1WRDA 1DQ4A 2UUBT 4H9PC 2V73A 1FIOA 4HVRA 2W87A 1TME1 2BOJA 1W9RA 2WUHA 1HTJF 4EZ4A 1KNRA 4TN7B 2DYCA 1ZBA2 4LBOA 3Q5WA 1WD4A 3HD8B 3ZX7A 3AXJB 1QWRA 1H30A 1QUUA 2XAQB 2DUPA 4I4TE 3M4FA 1H9WA 4GMP3 1XNTA 4FPKA 4BH9A 1BZWA 2VGDA 3H7JA 3WNKA 3QB5K 1EUUA 5C4WB 3I2FA 1YQ3A 1F15A 3LE0A 4URTA 1AYM3 5CFBA 1ZKEA 3AXJA 5DDJ3 5CB7A 4X1IE 2B9VA 5DUVA 2WMNA 4HE8A 3LAGA 5IVFA 5CB4E 3CMGA 3ZYFA 4QHBA 3O1MA 5C4WA 3TRSB 4M00A 2E63A 4K20A 1D4M2 3BODA 1Z78A 4WVMA 1B35C 4Q2FA 2NPIA 1BBT1 4QWNB 4LFBT 3LA7A 5I8SA 3UESA 5EYYA 1UQXA 3T2QA 5FFOC 4QKDA 1W99A 3LK3B 3E5QA 4QHOA 3I8TA 3LQCA 5FTTC 2M6BA 1ZREA 3LOIA 5A7SA 3ONJA 3ZYMA 2WNVB 1KS5A 4QWNA 3MZKB 1AX1A 4G3YC 1HRI2 1MEC3 3ZJ2A 2RS53 5CA0E 1BEV1 3N3HA 3J26N 5LBBA 3CMLA 1D0GA 2JB8A 2EHOC 2WSSV 1HW5A 5DPNA 2M67A 2BVBA 1HRV3 3JBG1 2BJSA 2IXCA 3EMRA 4PBOA 2BBJA 1GOHA 1HQWA 2VUAA 3W59A 1PO21 1GU3A 2QTWB 3G7DA 4FPGA 5JSRA 4PHZA 4LITA 5JTGA 1HX6A 3K51A 2WWUA 2DHRA 5FZFA 2R0FA 3MIGA 1VOMA 4U33A 5FY7A 2F4LA 4MG2A 1I1EA 4KG0A 1EAH2 3URFA 4IEPA 3M65A 5HEUA 4W4ZA 4XQWA 4ZI3C 5K0UC 5A3NA 2XKOA 4CA9A 1O59A 1OOPA 2J7MA 2LKGA 4RSUA 2JDHA 2D43A 1XXNA 2X5IB 1W8OA 2F17A 5FZ8A 1OURA 1GLHA 5EPAA 2J42A 2ZM8A 1IAPA 1H8TC 2MEV2 4B8EA 1CX4A 3U3IA
chains in the Genus database with same CATH topology
3ZCJA 4D6QA 3HL6A 4KP3C 1V9DA 4MBQA 2X0LB 2IW5B 4DNDA 3GWHA 3C50A 3K8PC 5LGUB 2LSKA 3A5XA 2MTQA 3VKGA 5H6RB 4FJOA 4QX7A 4PW8A 4NUVA 1UX4A 3ZJ1A 3DXTA 4C90A 5FP9A 3EUHA 4AKRB 5F2WA 2MBGA 5HXRA 3IEEA 2ES0A 3HKCE 5M4YA 4MLKA 4URAA 4BISA 5FZIA 3C4WA 5FYMA 2YINA 4WW0A 1S35A 3E22E 4EXTA 4CI1B 4KUMB 2ZM0A 4H9NC 1LVKA 5L3FB 4TUYE 2GK9A 4AQFC 2JJ9A 3ZC0A 5A7WA 3O1JA 4QX8A 5F2SA 5JDNA 4ERRA 5FZHA 2LOSA 5JDMA 2PXJA 5FZ0A 2K24A 2WM9A 3NRXA 3UT5E 3QC9A 4UVCB 5HYAA 4Y4RA 2XAJB 3DP7A 5JDFA 5JVDE 5LNKA 3LD8A 3LDBA 4UVBB 3GN5B 4E4HA 5A1LA 2V1DB 2W0GA 2L3LA 4AKIA 4HONA 5IW0A 5IVCA 1HX8A 2VK9A 5FBJA 1NAFA 5AFUL 5L3EB 3LBXB 4QU1A 4PK6A 3U78A 5DQVA 2K9AA 4CXXA 4GK5E 1UCUA 5LG4A 4CUGA 4ANJA 2LSIA 4UF0B 5ETWA 2MOZA 4CXWA 2Z6EA 2XAHB 2P9BA 5A1FA 5F5CA 2JQQA 3AAIA 4E7ZA 2W63A 1HG2A 5LY2A 3E0ZA 4O2AE 5L3GB 4OHFA 4GOUA 4V1Av 2UXNB 3OJAA 2CM0A 2KWIB 3O1HA 5E0OA 4CCOA 4QXCA 2D2SA 5DJQC 2XQYA 3ZMVB 2VKDA 2NW9A 3HR0A 3Q5XA 5FYBA 5FZMA 5EK2A 5F5IA 3UYJA 3ZN1B 3PUAA 5JREA 2X9YA 3CQXC 3GN5A 1AJ3A 2LEHA 1IZNB 4I55E 4GYRA 5FPVA 5FXVA 5H6QB 5KR7A 2BDEA 4HFVA 3UUNA 5FP7A 2KINB 2LHNA 4ILUA 5FWJA 3LBXA 4EZHA 3PE0A 4HN9A 4HEAA 2CXDA 3PUSA 4TN7A 5E6HA 4UF0A 3TKLB 1MIWA 1MNEA 3AVRA 1MNDA 3CVRA 4A56A 5FZ3A 3RC3A 2Y6XA 2YU1A 4OK0A 3PTRB 1OXZA 5FYZA 4BXFA 2LM9A 4J2CA 5IWFA 2CEAA 1LRZA 4PJJA 4BU2A 4GAZA 5FY4A 5FZ9A 5IHYA 5ISLA 3I0QA 4YJ2E 4AI9A 2LE8A 4C8DA 1MIYA 1IJ6A 1ZEEA 3VKHA 3SS1A 2KNDA 4HOOA 3PU8A 1T98A 5LJMA 2XXZA 3SWHA 3H37A 4P0BA 5FZ6A 3KVAA 5FYIA 2YBKA 5FPAA 2LHRA 2ZMAA 3BQIA 2J1DG 2X9HA 3N5LA 3ZMZB 3PDQA 2DI4A 4O4JE 1FMVA 2BVLA 2WBLA 3Q2MA 1KK7A 2VD7A 2KWHA 2XUEA 2H3RA 3MACA 3CKDA 3ONXA 2NW7A 5FZEA 5F8PA 4EIWA 2HPLA 3E08A 3F2EA 4BJNA 5CEHA 2Q9QA 5HXEA 4TV9E 1NWMX 3ETVA 2RA1A 5FJHA 5EZYE 3N9QA 2LT3A 2NTXA 4ZS3A 5A7WB 4WBNE 2SPCA 3ZN0B 5L3DB 4QX8B 2VWAA 3WI3A 3P7IA 4EAHA 5JDQA 4M1PA 3RYIE 2CXFA 1D0ZA 2V7IA 5A7QA 2KMFA 4O4IE 5IVBA 5ANQA 3RRWA 2G0UA 2D5UA 4LXLA 3NBXX 1HG5A 3ETUA 2HPJA 3I9YA 4ASKA 1BR2A 2MYSA 2ODVA 2NW8A 2V7KA 1VRBA 2X66A 1CUNA 5A7PA 4PJLA 3RRCA 2RP4A 4H9QC 3RKOA 3T8OA 4I50E 2OT7A 5FUNA 5HXSA 2EHOA 3EVYA 5FP4A 1Y64B 4XZCA 2L9QA 5IVEA 1BR4A 2WMOA 2X9XA 3KBTA 1LKXA 2V7LA 3KBUA 5L3CB 5FZKA 5LWBA 3CX6B 3AAEB 2XASB 2OA5A 5EK3A 5F3CA 1QSDA 4IIJE 2C5KT 2L8KA 5FY0A 2KLQA 5LXTE 5F3EA 4EB6E 4PJNA 4L0RA 3FBLA 4D6SA 4QXCB 5F32A 2XDVA 1WLXA 4AKGA 5IYZE 3AA6B 1WRDA 3VHLA 4UIGA 3PDYA 4YFSA 4H9PC 4DBQA 3CPZA 2VKOA 4OYJA 2YU2A 1FIOA 3N9OA 4LIUA 4WBOA 3EDUA 4HTEA 1SA0E 2IC9A 2YEVC 4O8SA 3AVSA 3K3NA 2VKJA 2X51A 3QK6A 4HKAA 5L2LA 5FJKA 3KVBA 4L9IA 3ZPOA 5FPLA 2VASA 4G2AA 1HTJF 5JR9A 2Y8DA 4EZ4A 3F57A 2K5BB 3RYFE 4TN7B 3BQKA 2DWKA 5F5AA 1E1HB 3AA0B 1MMDA 3EDVA 3Q5WA 2XHEB 3F31A 2OX0A 3B57A 3OBVE 3O1IA 5LY1A 1X79A 4CSWA 5LBMA 3SOLA 4O4LE 3ZYLA 2W61A 4BA9A 1QUUA 3L3PA 5FZCA 5CA1E 2XAQB 3AB3B 4B6XA 4NUUA 4I4TE 4Z8XA 1OWAA 4E7SA 2Q8CA 4GD4A 5HXHA 3FXEB 4OYKA 3I0OA 3ZYKA 2X68A 1FEWA 2ZM2A 4ZI2C 2OQ7A 3KV5A 1O3XA 3ZMUB 4Y33A 2PBIA 5LHGB 3HKDE 1LVFA 2DCFA 3OKQA 4IE4A 5FZAA 3ZMTB 4AQGA 2Q9QD 3IHRA 5FV3A 4I43B 4KBMB 3HI2A 5JDHA 2C5JA 5A80A 4U74A 4IE5A 5HAXA 5FXXA 4ADZA 2KT9A 2BVMA 3P8CD 5FYUA 3PU3A 2N1GA 5JQGE 2A3DA 1ZKEA 3KDSE 3LG7A 3LK2B 4IDZA 4X20E 5GONE 2NTYA 4EYYR 5FY9A 4V2WA 1H7CA 4OFZA 4X1IE 4X1KE 5JDLA 1G8XA 2Q9QB 3UUMA 1UX5A 4GJZA 4MFRA 1MIVA 2WMNA 5DABA 4AI6A 4HE8A 5IVFA 4AKLA 5CB4E 3O9XA 5FY1A 2XTLA 2CLYB 5LOVE 5F37A 4PK4A 1G73A 4XDOA 4QXBA 2YK0A 5LP6E 5A7OA 3RVHA 4K0UA 4PFPA 4F6RC 3N2GE 5LJNA 3C98B 4ZOLE 4P09A 1ZHCA 3R6NA 4YLHA 3CQGB 3N9MA 5JRCA 2VL8A 3PURA 5FNVE 3UTKA 2GP3A 3CQCB 3S4UA 3AAAB 5LYJE 1YKHB 2D0UA 5LBQB 1ZV4X 3GA8A 3MXZA 4AAPA 5A3WA 4CCLA 3N9LA 3MK7C 5FP8A 2E9XB 3ZCIA 2EHOB 2Q8DA 2N2NA 3UUXB 3FB2A 1D0YA 4O2BE 3JC6C 3ZMSB 4QXHB 4QWNB 4GIWA 1YKEB 4YJ3E 3I1AA 3RYCE 3CWZB 5IVJA 3NZQA 1WYCA 2LSGA 3LK42 5KMGP 2V7MA 4TZ4C 3RC8A 2LSJA 2JMHA 4D6RA 5EK4A 2HH7A 4DO0A 4ZI2D 2CWYA 2QA7A 3RX6A 3MJXA 5A3PA 3IF8B 2ZLYA 4TV8E 3LK3B 4DVDA 3RPUA 4CXYA 4XAXB 4JEHB 2W00A 4QHOA 3LJCA 4H63H 2WAUA 1EZ3A 3CX8B 4ZS2A 2NP9A 2DWGA 5DQWA 2C0SA 2H7VC 5FY5A 2UXXB 3PUGA 2Q9QC 3ESLA 2IAKA 3HKBE 5JR9B 4CQIA 2E9XA 5A7SA 5FZGA 4HGAA 2BZBA 5FZ1A 4ZI7E 4U72A 2DLRA 3ZYMA 3BQLA 1S94A 1MMAA 3N9PA 4IE6A 2YBPA 2OS2A 4EYUA 4QXHA 5FZDA 5FP3A 4QWNA 3R84B 3WAKA 2GP5A 3C4XA 3MZKB 5FYSA 4AQFA 1US7B 2V7JA 3ZJ2A 4IGPA 5FYVA 3LFMA 3SRZA 2Y48B 3V5UA 5LCYA 4V2VA 5FZOA 5FUPA 3N2KE 5J2UE 2B1EA 2KXPB 2XMLA 1WR6A 5HXCA 5FYTA 5A3TA 1WYBA 3Q9DA 5L3BB 2PG8A 2D0TA 5CA0E 4Y3OA