4DR3T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr3T00
3OTOT 4DV3T 4DV0T 4X66T 1N32T 4K0KT 4X64T 4DV6T 2UXCT 2UXDT 2UUBT 4JI7T 4OX9T 4YY3T 4YHHT 4B3TT 2UXBT 4NXNT 4LFAT 1FJGT 4LF7T 4JI5T 4DV5T 4LF5T 4JI6T 4GKKT 2VQFT 4DUZT 4DR4T 4LFCT 4DUYT 4DR2T 2VQET 1I94T 4DR5T 4JI8T 1N36T 2HHHT 4GKJT 1IBLT 4JI3T 4DR1T 4X62T 1HNZT 2UUCT 4DR6T 3T1HT 4JI1T 4B3MT 1HR0T 2UU9T 4LF6T 1J5ET 4DR3T 4JI4T 4B3ST 4DV1T 1N33T 1HNWT 1HNXT 4LF4T 2UUAT 4DV4T 5BR8T 4LFBT 4JI2T 4X65T 5LMNT 1XNRT 4JV5T 4JYAT 1N34T 1IBKT 4AQYT 4NXMT 4JI0T 2ZM6T 5LMUT 1XMQT 4B3RT 2E5LT 1XNQT 1XMOT 4DV7T 4DR7T 3T1YT 4LF9T 2F4VT 4KHPT 4LF8T 4DV2T 5IWAT 1IBMT
chains in the Genus database with same CATH superfamily
3F31A 3OJAA 3RH3A 2FBWA 3ZMVB 3JC6D 2CXLA 2YDRA 2FJBA 3AEDA 4I55E 3ZN0B 4H9QC 2LKHA 3I0OA 4UXNB 4V1Av 3CQXC 3LFMA 2DNXA 3ZMTB 4M1PA 3RLFF 5L4EA 4DV0T 1N32T 1GQEA 3O4XE 4PW8A 3NZQA 2J1DG 2E9XD 1MMDA 1MMGA 4WZXA 5L3FB 1HTJF 1FIOA 1VRBA 3EI0A 5FVLA 4YY3T 4DBQA 4OYKA 1MIWA 2IDOB 3UUXB 3PTRB 3ZCIA 3UU8A 2ZLYA 4B3TT 3LK2B 2V7JA 4U2YA 2JIWA 2XSAA 3KFWX 1FEWA 3PUZF 2WDRA 1E1HB 2QRXA 4TWDA 2VKHA 3E22E 4OYJA 4GOUA 1EZ3A 1HFAA 2E9XA 2EHOD 3ZCJA 1SHZC 4HWHA 4ZHQE 2E5LT 3AA1B 1ZV4X 3CIRA 2BVMA 2D9DA 2VVSA 3QUJA 4PK6A 4TWFA 4PNIA 3EVYA 5E0OA 3ZMUB 5ABFB 4DUZT 2IIUA 2W67A 4AXPA 4LFCT 4TZ4C 3O9XA 2V6XA 3B5MA 5HEOA 2XHEB 3HKCE 4YHJA 4DIDB 2ES0A 2LM2A 2LSIA 3IBPA 3OVUA 5AQGB 1W0AA 1S35A 2PJQA 1IJ6A 4L9IA 3ZJ2A 4Z91A 3GA8A 2V7IA 3B57A 3N9LA 3ZT6A 4YT0A 3I1AA 2VURA 2VASA 4IGUA 5LHIB 4GKJT 3ANWB 2H3RA 3R6NA 4EOZB 2ODUA 3C4ZA 3ONJA 4AKLA 4JI8T 1VCTA 2LKGA 2YN6A 4Q25A 2K48A 2H7VC 2XM2A 2LSKA 2XQ9A 2JMHA 2Y6XA 3JAFA 5EK3A 4XAXB 5AQPB 4QH1A 4HEAA 5HEUA 1YKHB 5FY0A 2YINA 3UFEA 3ZJ1A 3P7IA 3VRBA 4Z90A 3ZT7A 3Q5DA 5CGMA 2HPJA 2UXNB 4H9PC 4O4HE 5L3BB 1D0ZA 1BR2A 3N9OA 4JI4T 4XBFB 3NWIA 2MOZA 2XQ7A 3CMLA 4B3ST 2LSYA 4DV1T 2WSSV 3RYFE 3N9MA 3CVRA 5AQTB 5JR9B 4P09A 3ZKRA 4JLEA 2DI4A 3I0QA 2JRKA 5CA0E 1BR4A 2L9QA 2FJAA 4FI5A 1D1AA 3IA3A 3O1HA 2OLTA 2CHOA 2Q9QD 2V6YB 3MJXA 4IIJE 3DJBA 4X1KE 5FL0A 3K3OA 3RYHE 2CMRA 3AE3A 4QWNB 3LBXB 3PDYA 1E2AA 2WY2A 2W62A 4I4TE 4I0UA 3FXEB 4O2BE 4LF4T 4ZI3C 3RX6A 1W9RA 4HTEA 4DV4T 3A8YC 5LJMA 5HXCA 2X9YA 1KNZA 4WBOA 3NRXA 4YSYA 3OBVE 3SFDA 3FHNA 2JJ9A 1CUNA 1YXRA 2CBIA 2EHOA 2SPCA 3BQLA 2WAUA 5HAXA 4JYAT 1Y01A 4UIGA 2X51A 3QB5K 3HA4A 2LT3A 5CB4E 3SRZA 1XZYA 5A1LA 5LXTE 3ZC0A 2PG8A 2X0LB 4O4IE 3K8PC 2K5BB 1QLBA 2K24A 2XM1A 2HH7A 3PURA 3ABVA 3AE5A 5HXRA 3UU6A 1IBKT 2FJEA 2JQHA 4A56A 4EEBA 2W66A 4JI0T 2VKJA 3KBUA 3QNUA 3PUSA 2ZM6T 4IE5A 5LMUT 2C5JA 1SUMB 1WR6A 3RHWA 1MMAA 1KFYA 4IE0A 1ZHCA 4TX5A 4WYVA 1XMOT 3UU4A 5LA6E 3ONXA 2VK9A 2X67A 4YSZA 3EDUA 4I50E 4C90A 3AB3B 4ASKA 2Y8DA 1VCSA 3E0ZA 2IHR1 4AKHA 3HKEE 1UX5A 3UUBA 2JQKA 4CXWA 3RQWA 3RIAA 4QH5A 3SS1A 1R8IA 2XAQB 5C8YE 1MMNA 2XAFB 3ZN1B 4EYUA 4X1YE 1HG5A 4MBQA 5AQRB 3UQ7A 2LOSA 1DU2A 5L3DB 2KINB 1OEDC 2MYSA 3AEBA 1LVFA 3OTOT 3NKZA 5F3JA 4DV6T 3OYXA 3AE8A 1KEYA 3LBXA 2LM9A 4ILUA 2D5UA 2WCAA 3KV4A 4X66T 2UXCT 2BBJA 2NW8A 2YK0A 1AJ3A 2KT9A 2X9WA 4JI7T 3H3AA 2CWYA 2G0UA 4HWDA 4OX9T 4EYYR 5FXXA 4QH4A 5F8PA 2RPAA 3C64A 2LRKA 3P8CD 4LFAT 2W61A 3M65A 2CM0A 4QX7B 5CFBA 2ZM8A 4X20E 4EGWA 3RIUC 1MIVA 5LBQB 3QB5A 3N2KE 4TN7B 1YD8G 1V9DA 4HFHA 1US7B 3WI3A 4HFBA 2J62A 2WMOA 4EB6E 5H6RB 2H89A 2RP4A 5FY7A 5L4HA 2VQFT 2BS2A 1T8BA 2LJLA 3BK9A 2YDSA 4ISSA 5JVDE 4Z8XA 3J9X1 5EK2A 2WDVA 5FNVE 3VR8A 3J7Yq 2K3WA 4KBMB 5F5WA 5KMGP 3LSVA 1E7PA 5J2TE 4XZCA 5AQKB 5JDFA 4DR2T 2CXDA 1I94T 4ADZA 1OEDE 2I0MA 2BG9B 5KXJA 3LG7A 2NOXA 3AA0B 1IBLT 2XQ6A 5DQWA 2WDQA 3RRWA 2KXPB 3CX6B 5JDMA 4EZ4A 4X64T 2JMKA 3FB2A 4CN1A 3C50A 4DR1T 4HGAA 3L39A 4G63A 4NUVA 4IDZA 4X62T 4IE7A 3M3ZB 3PUYF 1HNZT 4JBWF 2L3LA 3A7MA 3GWHA 4B3MT 1W0BA 3TLUA 3V5SA 4DV5T 1LVKA 2KZ7B 3AXJB 2UU9T 4P0BA 2QGSA 1UURA 1ZEEA 1J5ET 4DR3T 2H88A 2A9UA 1HF8A 1D0YA 3FXDB 3NRYA 4QKNA 3JC6C 4U2ZA 3X1DA 3E08A 4U31A 3RYIE 2QYWA 2ZM2A 2NTYA 4WW0A 3TKLB 1G8XA 2PBIA 4ZZCA 1QUUA 2LLYA 4HFEA 1WYBA 4QX8B 3RIFA 2MBGA 4CI1B 5FL1A 5HXHA 3I9WA 2B1EA 3JAEA 2CRBA 2WZIA 3RYCE 2LRLA 3ZLIA 4BJMA 2YU1A 4LMKA 3C4WA 5FXWA 4DNDA 2DWGA 3ZYMA 2CLYC 2P9BA 2NTXA 5JDQA 3U78A 5JRCB 2UUAT 4X1IE 2X66A 3IHRA 3ZSTA 3MK7C 1WLXA 1T98A 2YOEA 4K0UA 4UVCB 5AQNB 4HWFA 2IAKA 2JQ9A 1WYCA 3N2GE 2AXDS 5IYZE 4ZEYA 2LEHA 5AFUL 3JCFA 2VWAA 5LMNT 1XNRT 4JV5T 2M6IA 5LB7B 3VHLA 5FYMA 4IL9A 2V5CA 4MHCA 4WNKA 2NW9A 5EK4A 3PUAA 3UULA 3W15B 2XQ4A 5LP6E 4CQIA 2K9AA 4EEDA 5ABFA 4P1NA 4BAYB 3ZMZB 2J47A 5LJNA 2M67A 5H6QB 5IHYA 4AQYT 4NXMT 4HE8A 4X5TA 2NWBA 4DMWA 1IJ5A 2BG9A 5AQMB 4B3RT 5HEGA 1SE7A 3O1IA 4AKRB 1SA0E 3EAMA 4YSXA 5JDLA 2OA5A 2WP9A 2EHOB 4YFSA 1ZKEA 2XASB 4H9SE 1XNQT 1T7SA 5TAOA 4YJ2E 2XUEA 4HN9A 2BVLA 4F8HA 2IMLA 2WWUA 5KX5E 4DR7T 2NP9A 4AKIA 2I6HA 3NZPA 5HWXA 3ZMSB 2XY8B 3AVRA 4IDPA 2UXXB 2XQAA 4IREA 3MZKB 2CEAA 4KHPT 3HI2A 4YTPA 3DP7A 4ZOLE 3UQ4A 1G73A 2BS4A 3P4SA 5IWAT 3WAKA 1IBMT 4IL4A 2WB5A 2BG9E 2WQYA 4YTMA 4YHHT 4IDOA 4U72A 3N9QA 3TLTA 4U74A 2E5VA 3C98B 4U33A 4DV3T 2V1DB 4ZS2A 3AA6B 3L09A 2ACZA 2KWIB 4PK4A 5C2TA 1KF6A 1X79A 1YQ4A 2JPFA 2WM9A 3PJAA 5HWYA 2W0GA 2V7KA 5LHGB 1KNPA 4AQGA 2UXDT 3AE7A 3Q5XA 2FJDA 5L47A 4H9RC 4HWIB 4YJ3E 3RKOA 5AQHB 4L0RA 3WAJA 4GK0E 4NIQA 3U3IA 1KK7A 3KV5A 2UXBT 4ILBA 4JEUB 2BZBA 4HFIA 4TUYE 4LF7T 1U4QA 4PAGA 1L0VA 5GONE 4LF5T 4EV6A 3L3PA 3P4WA 4OK0A 2XAJB 4EXTA 2DLRA 3AAIA 1UGOA 2IW5B 4L5GA 2DCFA 3ETVA 4GKKT 3HKDE 5JTGA 2V8SV 2IC9A 2X68A 3KV9A 2A72A 4EZHA 2C0SA 3G06A 4ZXLA 2XTLA 3AEAA 3KV6A 4QXBB 5AQOB 4DUYT 1KNRA 3B13A 4PK5A 2AE9A 5FVKA 3RQUA 5HYAA 1CHUA 1BR0A 2X9XA 3K1SA 1JNZA 3OYZA 5AQVB 3ZT5A 2E9XC 2VQET 2HN2A 4DR5T 4WBNE 4COFA 4UVAB 5LNKA 4AISA 2X9HA 3RPUA 4KX6A 3ESLA 3RGLA 4UF0A 3ZYKA 1OXZA 3JADA 1YKEB 2VB6A 2CPTA 2KLQA 2PTFA 5BMVE 3K3QC 4KHZF 5AQJB 4A97A 4ZI3D 3VKGA 3SFEA 5ABHA 2DL1A 4UV8B 4JI1T 2BKNA 5HCJA 3H3MA 4IE4A 2A3DA 5JQGE 2C5KT 2IC6A 2XQ8A 4LMJA 4TWHA 5CJ5A 5AQLB 4LF6T 1J5WA 4A98A 2YEVC 2WWVA 4CI3B 1NENA 2LHRA 3FBLA 3FZFB 5EZYE 2ACXA 4H9NC 3RI5A 2LSJA 3MA9A 4TV8E 4DBRA 1NEKA 1H7CA 1N36T 3V5UA 5JREA 1N33T 3UTKA 3F57A 2WBLA 2Z6EA 3CX7B 4G2AA 2V6YA 3AECA 5KDMC 3RC8A 2PFVA 4U3CA 3GN5A 2WU2A 3PV0F 2YDQA 3PUGA 1HNXT 3AE2A 1HS7A 2D0TA 2VKDA 4KI0F 1I6ZA 4EAHA 4H9OC 3TLVA 3SOLA 2QVAA 2FUPA 2MPKA 1WCRA 3AAEB 5JR9A 4KUMB 5JR9C 4ISTA 4IT4A 2VKOA 5JH7E 4HWCA 3CPZA 4O4JE 4I43B 2E9XB 5L3EB 3RRCA 4LFBT 3EDVA 2M6BA 3R84B 3ZC1A 4JI2T 4X65T 5J0ZA 5FKYA 3OKQA 2HPLA 1Y64B 4BJNA 4GK5E 4NUUA 4ANJA 3HKBE 2LE8A 4O4LE 4UELA 1Z0PA 2KWHA 3TLWA 2XJ7A 4N78D 4QXHB 1OEDB 1N34T 4ERRA 1ZOYA 3PUXF 3ZYLA 2RA1A 1D1BA 3PJAJ 1XMQT 3KDSE 2Q9QC 3VKHA 1NWMX 2BG9C 3AA7B 3QOFA 3UUNA 4CN4A 5LG3A 1O3XA 2V7MA 2VL0A 4YLHA 4H63V 3ZSSA 1MNDA 5LHHB 1OWAA 2DHRA 2E2AA 2QA7A 2X0YA 3Q5EA 2ODVA 4OFZA 3ANWA 2NW7A 5ABGA 3UU5A 5LG4A 3UUMA 5ETWA 5HEHA 4LF9T 4FJOA 5LBMA 3CKDA 2KSRA 2N1GA 3BQIA 2CWOA 2XQ5A 1MNEA 3P4PA 4KMCA 2F4VT 3EABA 2I59A 1BR1A 2BDEA 4YTNA 4LF8T 5L3GB 4CXXA 5DQVA 1WRDA 1ZP0A 4E7SA 3IEEA 4KP3C 1YQ3A 1HG2A 2DWKA 3N2OA 3FZHB 2XQ3A 4CI2B 3FZKB 2XAGB 2XAHB 3BQKA 5JRCA 1W09A 4U7IA 5HCMA 3FZLB 3FZMB 4CN6A 3GN5B 4E7ZA 4K0KT 3VU7H 3HL6A 5AQQB 1M7KA 3P50A 3PE0A 5ADXL 3N9NA 5M4YA 4QHOA 2UUBT 3P4RA 2B76A 4GIWA 4NPPA 3AVSA 3MXZA 3OPCA 4QXCB 5LOVE 4ZZBA 3S4UA 4ZI2D 3CQGB 4HFDA 4J2CA 3NBXX 3EHZA 1B7TA 1T72A 2KMFA 3DTOA 4UV9B 4YXDA 5IUXA 4NXNT 1FJGT 1MIYA 1S94A 2V7LA 2GK9A 3N5LA 4JI5T 4UR9A 4BA9A 3AE1A 2Q9QB 1Z8UA 2YU2A 1JNRA 3KBTA 5DABA 2BS3A 3LDQB 3I9YA 3KVBA 1VOMA 3N9PA 3CWZB 3PUWF 4UVBB 5L2LA 4AKGA 4JI6T 3C51A 1FMWA 4EIWA 2W63A 5ABEA 2XSBA 3LJCA 5J1GA 2ZM0A 4DR4T 4AI6A 4CZZB 4ZI7E 4CXYA 2KNDA 3ONLC 2A2FX 4O8SA 4PFOA 5AQUB 3RC3A 4AIUA 2J4GA 3F2EA 4U7YA 4A5XA 2NR4A 2CA5A 2V26A 2XPKA 4HFCA 2EHOC 3D0TA 4ILCA 3ETUA 4MLKA 3T8OA 1XDOA 3O1JA 5FP3A 2HHHT 4JI3T 3IF8B 3K3NA 4GYSA 4TV9E 3UFGA 5LGNB 2D2SA 4TNWA 3AE4A 3AE9A 2CCQA 1NAFA 2CE7A 3AEFA 3AAAB 1YW0A 3KINB 1HCIA 1UX4A 3L8RA 3T1HT 2UUCT 4DR6T 1LKXA 5J2UE 5LGTB 3SWHA 4IE6A 1HR0T 5AQFB 3PUVF 2HN1A 3QC9A 3RKGA 1LRZA 1FMVA 3RF1A 1UUSA 4ILAA 4B6XA 4HFVA 3GMIA 5C3JA 3LK3B 3ZPOA 2V5DA 4OHFA 5JDGA 2LHNA 5LYJE 1XWMA 3HR0A 3VRAA 1XDPA 3A5XA 3AEGA 3CK6A 2ZMAA 2WU5A 2H7OA 2D0UA 3PUQA 4PFPA 4ZS3A 5LGUB 5FXZA 2E8IA 4IDNA 1UK5A 1HNWT 1D0XA 4MFRA 2BKPA 4LMLA 3ZEFB 5HXSA 4F6RC 2W2UA 1D1CA 2W00A 1U5PA 4IDQA 5FY1A 1UCUA 1OEDA 3C4XA 1QSDA 3CQCB 2MAWA 2XQYA 4HKAA 4TNVA 3VR9A 4MALA 2L8KA 2WS3A 5BR8T 1HX8A 2VL8A 3H37A 1X9BA 2Q9QA 2LSGA 3KVAA 3Q5WA 3Q9DA 3UU3A 3UT5E 4C91A 2BKOA 3CX8B 4DVDA 5HEJA 2YKSA 3AEEA 2R6GF 2JQQA 3Q2MA 4AQFC 4AQFA 5HXEA 2BBHA 3FBZA 2CLYB 2N2NA 3MACA 1WFDA 4PJLA 5L3CB 1IAPA 2LOPA 2XZEA 5FMNA 3RIUA 4IHJE 4DMVA 1J1JA 3LK42 4UF0B 5AQSB 2CBJA 5AQIB 4P0AA 2WMNA 4JUYA 2C5IT 2VVNA 5FXVA 3EUHA 3MKDA 3P4QA 4PJJA 5JDNA 2Y48B 3NVOA 2CXFA 1HX1B 4DO0A 5DJQC 4DV7T 3T1YT 3PU3A 4GYRA 5LCYA 3QK6A 2IUBA 3AE6A 3PU8A 1M62A 4PJNA 4PJMA 4O2AE 2W4XA 2X0HA 4UEMA 5CA1E 4JEHB 4H63H 1IZNB 2N9DA 3AXJA 2WZHA 1WR0A 2CHNA 5JDHA 4DV2T 2MTQA 2OV9A 3TLSA 4ZI2C
chains in the Genus database with same CATH topology
3OTOT 4DV3T 4DV0T 4X66T 1N32T 4K0KT 4X64T 4DV6T 2UXCT 2UXDT 2UUBT 4JI7T 4OX9T 4YY3T 4YHHT 4B3TT 2UXBT 4NXNT 4LFAT 1FJGT 4LF7T 4JI5T 4DV5T 4LF5T 4JI6T 4GKKT 2VQFT 4DUZT 4DR4T 4LFCT 4DUYT 4DR2T 2VQET 1I94T 4DR5T 4JI8T 1N36T 2HHHT 4GKJT 1IBLT 4JI3T 4DR1T 4X62T 1HNZT 2UUCT 4DR6T 3T1HT 4JI1T 4B3MT 1HR0T 2UU9T 4LF6T 1J5ET 4DR3T 4JI4T 4B3ST 4DV1T 1N33T 1HNWT 1HNXT 4LF4T 2UUAT 4DV4T 5BR8T 4LFBT 4JI2T 4X65T 5LMNT 1XNRT 4JV5T 4JYAT 1N34T 1IBKT 4AQYT 4NXMT 4JI0T 2ZM6T 5LMUT 1XMQT 4B3RT 2E5LT 1XNQT 1XMOT 4DV7T 4DR7T 3T1YT 4LF9T 2F4VT 4KHPT 4LF8T 4DV2T 5IWAT 1IBMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO T;  4DV3 T;  4DV0 T;  4X66 T;  1N32 T;  4K0K T;  4X64 T;  4DV6 T;  2UXC T;  2UXD T;  2UUB T;  4JI7 T;  4OX9 T;  4YY3 T;  4YHH T;  4B3T T;  2UXB T;  4NXN T;  4LFA T;  1FJG T;  4LF7 T;  4JI5 T;  4DV5 T;  4LF5 T;  4JI6 T;  4GKK T;  2VQF T;  4DUZ T;  4DR4 T;  4LFC T;  4DUY T;  4DR2 T;  2VQE T;  1I94 T;  4DR5 T;  4JI8 T;  1N36 T;  2HHH T;  4GKJ T;  1IBL T;  4JI3 T;  4DR1 T;  4X62 T;  1HNZ T;  2UUC T;  4DR6 T;  3T1H T;  4JI1 T;  4B3M T;  1HR0 T;  2UU9 T;  4LF6 T;  1J5E T;  4DR3 T;  4JI4 T;  4B3S T;  4DV1 T;  1N33 T;  1HNW T;  1HNX T;  4LF4 T;  2UUA T;  4DV4 T;  5BR8 T;  4LFB T;  4JI2 T;  4X65 T;  5LMN T;  1XNR T;  4JV5 T;  4JYA T;  1N34 T;  1IBK T;  4AQY T;  4NXM T;  4JI0 T;  2ZM6 T;  5LMU T;  1XMQ T;  4B3R T;  2E5L T;  1XNQ T;  1XMO T;  4DV7 T;  4DR7 T;  3T1Y T;  4LF9 T;  2F4V T;  4KHP T;  4LF8 T;  4DV2 T;  5IWA T;  1IBM T; 
#chains in the Genus database with same CATH topology
 3F31 A;  3OJA A;  3RH3 A;  2FBW A;  3ZMV B;  3JC6 D;  2CXL A;  2YDR A;  2FJB A;  3AED A;  4I55 E;  3ZN0 B;  4H9Q C;  2LKH A;  3I0O A;  4UXN B;  4V1A v;  3CQX C;  3LFM A;  2DNX A;  3ZMT B;  4M1P A;  3RLF F;  5L4E A;  4DV0 T;  1N32 T;  1GQE A;  3O4X E;  4PW8 A;  3NZQ A;  2J1D G;  2E9X D;  1MMD A;  1MMG A;  4WZX A;  5L3F B;  1HTJ F;  1FIO A;  1VRB A;  3EI0 A;  5FVL A;  4YY3 T;  4DBQ A;  4OYK A;  1MIW A;  2IDO B;  3UUX B;  3PTR B;  3ZCI A;  3UU8 A;  2ZLY A;  4B3T T;  3LK2 B;  2V7J A;  4U2Y A;  2JIW A;  2XSA A;  3KFW X;  1FEW A;  3PUZ F;  2WDR A;  1E1H B;  2QRX A;  4TWD A;  2VKH A;  3E22 E;  4OYJ A;  4GOU A;  1EZ3 A;  1HFA A;  2E9X A;  2EHO D;  3ZCJ A;  1SHZ C;  4HWH A;  4ZHQ E;  2E5L T;  3AA1 B;  1ZV4 X;  3CIR A;  2BVM A;  2D9D A;  2VVS A;  3QUJ A;  4PK6 A;  4TWF A;  4PNI A;  3EVY A;  5E0O A;  3ZMU B;  5ABF B;  4DUZ T;  2IIU A;  2W67 A;  4AXP A;  4LFC T;  4TZ4 C;  3O9X A;  2V6X A;  3B5M A;  5HEO A;  2XHE B;  3HKC E;  4YHJ A;  4DID B;  2ES0 A;  2LM2 A;  2LSI A;  3IBP A;  3OVU A;  5AQG B;  1W0A A;  1S35 A;  2PJQ A;  1IJ6 A;  4L9I A;  3ZJ2 A;  4Z91 A;  3GA8 A;  2V7I A;  3B57 A;  3N9L A;  3ZT6 A;  4YT0 A;  3I1A A;  2VUR A;  2VAS A;  4IGU A;  5LHI B;  4GKJ T;  3ANW B;  2H3R A;  3R6N A;  4EOZ B;  2ODU A;  3C4Z A;  3ONJ A;  4AKL A;  4JI8 T;  1VCT A;  2LKG A;  2YN6 A;  4Q25 A;  2K48 A;  2H7V C;  2XM2 A;  2LSK A;  2XQ9 A;  2JMH A;  2Y6X A;  3JAF A;  5EK3 A;  4XAX B;  5AQP B;  4QH1 A;  4HEA A;  5HEU A;  1YKH B;  5FY0 A;  2YIN A;  3UFE A;  3ZJ1 A;  3P7I A;  3VRB A;  4Z90 A;  3ZT7 A;  3Q5D A;  5CGM A;  2HPJ A;  2UXN B;  4H9P C;  4O4H E;  5L3B B;  1D0Z A;  1BR2 A;  3N9O A;  4JI4 T;  4XBF B;  3NWI A;  2MOZ A;  2XQ7 A;  3CML A;  4B3S T;  2LSY A;  4DV1 T;  2WSS V;  3RYF E;  3N9M A;  3CVR A;  5AQT B;  5JR9 B;  4P09 A;  3ZKR A;  4JLE A;  2DI4 A;  3I0Q A;  2JRK A;  5CA0 E;  1BR4 A;  2L9Q A;  2FJA A;  4FI5 A;  1D1A A;  3IA3 A;  3O1H A;  2OLT A;  2CHO A;  2Q9Q D;  2V6Y B;  3MJX A;  4IIJ E;  3DJB A;  4X1K E;  5FL0 A;  3K3O A;  3RYH E;  2CMR A;  3AE3 A;  4QWN B;  3LBX B;  3PDY A;  1E2A A;  2WY2 A;  2W62 A;  4I4T E;  4I0U A;  3FXE B;  4O2B E;  4LF4 T;  4ZI3 C;  3RX6 A;  1W9R A;  4HTE A;  4DV4 T;  3A8Y C;  5LJM A;  5HXC A;  2X9Y A;  1KNZ A;  4WBO A;  3NRX A;  4YSY A;  3OBV E;  3SFD A;  3FHN A;  2JJ9 A;  1CUN A;  1YXR A;  2CBI A;  2EHO A;  2SPC A;  3BQL A;  2WAU A;  5HAX A;  4JYA T;  1Y01 A;  4UIG A;  2X51 A;  3QB5 K;  3HA4 A;  2LT3 A;  5CB4 E;  3SRZ A;  1XZY A;  5A1L A;  5LXT E;  3ZC0 A;  2PG8 A;  2X0L B;  4O4I E;  3K8P C;  2K5B B;  1QLB A;  2K24 A;  2XM1 A;  2HH7 A;  3PUR A;  3ABV A;  3AE5 A;  5HXR A;  3UU6 A;  1IBK T;  2FJE A;  2JQH A;  4A56 A;  4EEB A;  2W66 A;  4JI0 T;  2VKJ A;  3KBU A;  3QNU A;  3PUS A;  2ZM6 T;  4IE5 A;  5LMU T;  2C5J A;  1SUM B;  1WR6 A;  3RHW A;  1MMA A;  1KFY A;  4IE0 A;  1ZHC A;  4TX5 A;  4WYV A;  1XMO T;  3UU4 A;  5LA6 E;  3ONX A;  2VK9 A;  2X67 A;  4YSZ A;  3EDU A;  4I50 E;  4C90 A;  3AB3 B;  4ASK A;  2Y8D A;  1VCS A;  3E0Z A;  2IHR 1;  4AKH A;  3HKE E;  1UX5 A;  3UUB A;  2JQK A;  4CXW A;  3RQW A;  3RIA A;  4QH5 A;  3SS1 A;  1R8I A;  2XAQ B;  5C8Y E;  1MMN A;  2XAF B;  3ZN1 B;  4EYU A;  4X1Y E;  1HG5 A;  4MBQ A;  5AQR B;  3UQ7 A;  2LOS A;  1DU2 A;  5L3D B;  2KIN B;  1OED C;  2MYS A;  3AEB A;  1LVF A;  3OTO T;  3NKZ A;  5F3J A;  4DV6 T;  3OYX A;  3AE8 A;  1KEY A;  3LBX A;  2LM9 A;  4ILU A;  2D5U A;  2WCA A;  3KV4 A;  4X66 T;  2UXC T;  2BBJ A;  2NW8 A;  2YK0 A;  1AJ3 A;  2KT9 A;  2X9W A;  4JI7 T;  3H3A A;  2CWY A;  2G0U A;  4HWD A;  4OX9 T;  4EYY R;  5FXX A;  4QH4 A;  5F8P A;  2RPA A;  3C64 A;  2LRK A;  3P8C D;  4LFA T;  2W61 A;  3M65 A;  2CM0 A;  4QX7 B;  5CFB A;  2ZM8 A;  4X20 E;  4EGW A;  3RIU C;  1MIV A;  5LBQ B;  3QB5 A;  3N2K E;  4TN7 B;  1YD8 G;  1V9D A;  4HFH A;  1US7 B;  3WI3 A;  4HFB A;  2J62 A;  2WMO A;  4EB6 E;  5H6R B;  2H89 A;  2RP4 A;  5FY7 A;  5L4H A;  2VQF T;  2BS2 A;  1T8B A;  2LJL A;  3BK9 A;  2YDS A;  4ISS A;  5JVD E;  4Z8X A;  3J9X 1;  5EK2 A;  2WDV A;  5FNV E;  3VR8 A;  3J7Y q;  2K3W A;  4KBM B;  5F5W A;  5KMG P;  3LSV A;  1E7P A;  5J2T E;  4XZC A;  5AQK B;  5JDF A;  4DR2 T;  2CXD A;  1I94 T;  4ADZ A;  1OED E;  2I0M A;  2BG9 B;  5KXJ A;  3LG7 A;  2NOX A;  3AA0 B;  1IBL T;  2XQ6 A;  5DQW A;  2WDQ A;  3RRW A;  2KXP B;  3CX6 B;  5JDM A;  4EZ4 A;  4X64 T;  2JMK A;  3FB2 A;  4CN1 A;  3C50 A;  4DR1 T;  4HGA A;  3L39 A;  4G63 A;  4NUV A;  4IDZ A;  4X62 T;  4IE7 A;  3M3Z B;  3PUY F;  1HNZ T;  4JBW F;  2L3L A;  3A7M A;  3GWH A;  4B3M T;  1W0B A;  3TLU A;  3V5S A;  4DV5 T;  1LVK A;  2KZ7 B;  3AXJ B;  2UU9 T;  4P0B A;  2QGS A;  1UUR A;  1ZEE A;  1J5E T;  4DR3 T;  2H88 A;  2A9U A;  1HF8 A;  1D0Y A;  3FXD B;  3NRY A;  4QKN A;  3JC6 C;  4U2Z A;  3X1D A;  3E08 A;  4U31 A;  3RYI E;  2QYW A;  2ZM2 A;  2NTY A;  4WW0 A;  3TKL B;  1G8X A;  2PBI A;  4ZZC A;  1QUU A;  2LLY A;  4HFE A;  1WYB A;  4QX8 B;  3RIF A;  2MBG A;  4CI1 B;  5FL1 A;  5HXH A;  3I9W A;  2B1E A;  3JAE A;  2CRB A;  2WZI A;  3RYC E;  2LRL A;  3ZLI A;  4BJM A;  2YU1 A;  4LMK A;  3C4W A;  5FXW A;  4DND A;  2DWG A;  3ZYM A;  2CLY C;  2P9B A;  2NTX A;  5JDQ A;  3U78 A;  5JRC B;  2UUA T;  4X1I E;  2X66 A;  3IHR A;  3ZST A;  3MK7 C;  1WLX A;  1T98 A;  2YOE A;  4K0U A;  4UVC B;  5AQN B;  4HWF A;  2IAK A;  2JQ9 A;  1WYC A;  3N2G E;  2AXD S;  5IYZ E;  4ZEY A;  2LEH A;  5AFU L;  3JCF A;  2VWA A;  5LMN T;  1XNR T;  4JV5 T;  2M6I A;  5LB7 B;  3VHL A;  5FYM A;  4IL9 A;  2V5C A;  4MHC A;  4WNK A;  2NW9 A;  5EK4 A;  3PUA A;  3UUL A;  3W15 B;  2XQ4 A;  5LP6 E;  4CQI A;  2K9A A;  4EED A;  5ABF A;  4P1N A;  4BAY B;  3ZMZ B;  2J47 A;  5LJN A;  2M67 A;  5H6Q B;  5IHY A;  4AQY T;  4NXM T;  4HE8 A;  4X5T A;  2NWB A;  4DMW A;  1IJ5 A;  2BG9 A;  5AQM B;  4B3R T;  5HEG A;  1SE7 A;  3O1I A;  4AKR B;  1SA0 E;  3EAM A;  4YSX A;  5JDL A;  2OA5 A;  2WP9 A;  2EHO B;  4YFS A;  1ZKE A;  2XAS B;  4H9S E;  1XNQ T;  1T7S A;  5TAO A;  4YJ2 E;  2XUE A;  4HN9 A;  2BVL A;  4F8H A;  2IML A;  2WWU A;  5KX5 E;  4DR7 T;  2NP9 A;  4AKI A;  2I6H A;  3NZP A;  5HWX A;  3ZMS B;  2XY8 B;  3AVR A;  4IDP A;  2UXX B;  2XQA A;  4IRE A;  3MZK B;  2CEA A;  4KHP T;  3HI2 A;  4YTP A;  3DP7 A;  4ZOL E;  3UQ4 A;  1G73 A;  2BS4 A;  3P4S A;  5IWA T;  3WAK A;  1IBM T;  4IL4 A;  2WB5 A;  2BG9 E;  2WQY A;  4YTM A;  4YHH T;  4IDO A;  4U72 A;  3N9Q A;  3TLT A;  4U74 A;  2E5V A;  3C98 B;  4U33 A;  4DV3 T;  2V1D B;  4ZS2 A;  3AA6 B;  3L09 A;  2ACZ A;  2KWI B;  4PK4 A;  5C2T A;  1KF6 A;  1X79 A;  1YQ4 A;  2JPF A;  2WM9 A;  3PJA A;  5HWY A;  2W0G A;  2V7K A;  5LHG B;  1KNP A;  4AQG A;  2UXD T;  3AE7 A;  3Q5X A;  2FJD A;  5L47 A;  4H9R C;  4HWI B;  4YJ3 E;  3RKO A;  5AQH B;  4L0R A;  3WAJ A;  4GK0 E;  4NIQ A;  3U3I A;  1KK7 A;  3KV5 A;  2UXB T;  4ILB A;  4JEU B;  2BZB A;  4HFI A;  4TUY E;  4LF7 T;  1U4Q A;  4PAG A;  1L0V A;  5GON E;  4LF5 T;  4EV6 A;  3L3P A;  3P4W A;  4OK0 A;  2XAJ B;  4EXT A;  2DLR A;  3AAI A;  1UGO A;  2IW5 B;  4L5G A;  2DCF A;  3ETV A;  4GKK T;  3HKD E;  5JTG A;  2V8S V;  2IC9 A;  2X68 A;  3KV9 A;  2A72 A;  4EZH A;  2C0S A;  3G06 A;  4ZXL A;  2XTL A;  3AEA A;  3KV6 A;  4QXB B;  5AQO B;  4DUY T;  1KNR A;  3B13 A;  4PK5 A;  2AE9 A;  5FVK A;  3RQU A;  5HYA A;  1CHU A;  1BR0 A;  2X9X A;  3K1S A;  1JNZ A;  3OYZ A;  5AQV B;  3ZT5 A;  2E9X C;  2VQE T;  2HN2 A;  4DR5 T;  4WBN E;  4COF A;  4UVA B;  5LNK A;  4AIS A;  2X9H A;  3RPU A;  4KX6 A;  3ESL A;  3RGL A;  4UF0 A;  3ZYK A;  1OXZ A;  3JAD A;  1YKE B;  2VB6 A;  2CPT A;  2KLQ A;  2PTF A;  5BMV E;  3K3Q C;  4KHZ F;  5AQJ B;  4A97 A;  4ZI3 D;  3VKG A;  3SFE A;  5ABH A;  2DL1 A;  4UV8 B;  4JI1 T;  2BKN A;  5HCJ A;  3H3M A;  4IE4 A;  2A3D A;  5JQG E;  2C5K T;  2IC6 A;  2XQ8 A;  4LMJ A;  4TWH A;  5CJ5 A;  5AQL B;  4LF6 T;  1J5W A;  4A98 A;  2YEV C;  2WWV A;  4CI3 B;  1NEN A;  2LHR A;  3FBL A;  3FZF B;  5EZY E;  2ACX A;  4H9N C;  3RI5 A;  2LSJ A;  3MA9 A;  4TV8 E;  4DBR A;  1NEK A;  1H7C A;  1N36 T;  3V5U A;  5JRE A;  1N33 T;  3UTK A;  3F57 A;  2WBL A;  2Z6E A;  3CX7 B;  4G2A A;  2V6Y A;  3AEC A;  5KDM C;  3RC8 A;  2PFV A;  4U3C A;  3GN5 A;  2WU2 A;  3PV0 F;  2YDQ A;  3PUG A;  1HNX T;  3AE2 A;  1HS7 A;  2D0T A;  2VKD A;  4KI0 F;  1I6Z A;  4EAH A;  4H9O C;  3TLV A;  3SOL A;  2QVA A;  2FUP A;  2MPK A;  1WCR A;  3AAE B;  5JR9 A;  4KUM B;  5JR9 C;  4IST A;  4IT4 A;  2VKO A;  5JH7 E;  4HWC A;  3CPZ A;  4O4J E;  4I43 B;  2E9X B;  5L3E B;  3RRC A;  4LFB T;  3EDV A;  2M6B A;  3R84 B;  3ZC1 A;  4JI2 T;  4X65 T;  5J0Z A;  5FKY A;  3OKQ A;  2HPL A;  1Y64 B;  4BJN A;  4GK5 E;  4NUU A;  4ANJ A;  3HKB E;  2LE8 A;  4O4L E;  4UEL A;  1Z0P A;  2KWH A;  3TLW A;  2XJ7 A;  4N78 D;  4QXH B;  1OED B;  1N34 T;  4ERR A;  1ZOY A;  3PUX F;  3ZYL A;  2RA1 A;  1D1B A;  3PJA J;  1XMQ T;  3KDS E;  2Q9Q C;  3VKH A;  1NWM X;  2BG9 C;  3AA7 B;  3QOF A;  3UUN A;  4CN4 A;  5LG3 A;  1O3X A;  2V7M A;  2VL0 A;  4YLH A;  4H63 V;  3ZSS A;  1MND A;  5LHH B;  1OWA A;  2DHR A;  2E2A A;  2QA7 A;  2X0Y A;  3Q5E A;  2ODV A;  4OFZ A;  3ANW A;  2NW7 A;  5ABG A;  3UU5 A;  5LG4 A;  3UUM A;  5ETW A;  5HEH A;  4LF9 T;  4FJO A;  5LBM A;  3CKD A;  2KSR A;  2N1G A;  3BQI A;  2CWO A;  2XQ5 A;  1MNE A;  3P4P A;  4KMC A;  2F4V T;  3EAB A;  2I59 A;  1BR1 A;  2BDE A;  4YTN A;  4LF8 T;  5L3G B;  4CXX A;  5DQV A;  1WRD A;  1ZP0 A;  4E7S A;  3IEE A;  4KP3 C;  1YQ3 A;  1HG2 A;  2DWK A;  3N2O A;  3FZH B;  2XQ3 A;  4CI2 B;  3FZK B;  2XAG B;  2XAH B;  3BQK A;  5JRC A;  1W09 A;  4U7I A;  5HCM A;  3FZL B;  3FZM B;  4CN6 A;  3GN5 B;  4E7Z A;  4K0K T;  3VU7 H;  3HL6 A;  5AQQ B;  1M7K A;  3P50 A;  3PE0 A;  5ADX L;  3N9N A;  5M4Y A;  4QHO A;  2UUB T;  3P4R A;  2B76 A;  4GIW A;  4NPP A;  3AVS A;  3MXZ A;  3OPC A;  4QXC B;  5LOV E;  4ZZB A;  3S4U A;  4ZI2 D;  3CQG B;  4HFD A;  4J2C A;  3NBX X;  3EHZ A;  1B7T A;  1T72 A;  2KMF A;  3DTO A;  4UV9 B;  4YXD A;  5IUX A;  4NXN T;  1FJG T;  1MIY A;  1S94 A;  2V7L A;  2GK9 A;  3N5L A;  4JI5 T;  4UR9 A;  4BA9 A;  3AE1 A;  2Q9Q B;  1Z8U A;  2YU2 A;  1JNR A;  3KBT A;  5DAB A;  2BS3 A;  3LDQ B;  3I9Y A;  3KVB A;  1VOM A;  3N9P A;  3CWZ B;  3PUW F;  4UVB B;  5L2L A;  4AKG A;  4JI6 T;  3C51 A;  1FMW A;  4EIW A;  2W63 A;  5ABE A;  2XSB A;  3LJC A;  5J1G A;  2ZM0 A;  4DR4 T;  4AI6 A;  4CZZ B;  4ZI7 E;  4CXY A;  2KND A;  3ONL C;  2A2F X;  4O8S A;  4PFO A;  5AQU B;  3RC3 A;  4AIU A;  2J4G A;  3F2E A;  4U7Y A;  4A5X A;  2NR4 A;  2CA5 A;  2V26 A;  2XPK A;  4HFC A;  2EHO C;  3D0T A;  4ILC A;  3ETU A;  4MLK A;  3T8O A;  1XDO A;  3O1J A;  5FP3 A;  2HHH T;  4JI3 T;  3IF8 B;  3K3N A;  4GYS A;  4TV9 E;  3UFG A;  5LGN B;  2D2S A;  4TNW A;  3AE4 A;  3AE9 A;  2CCQ A;  1NAF A;  2CE7 A;  3AEF A;  3AAA B;  1YW0 A;  3KIN B;  1HCI A;  1UX4 A;  3L8R A;  3T1H T;  2UUC T;  4DR6 T;  1LKX A;  5J2U E;  5LGT B;  3SWH A;  4IE6 A;  1HR0 T;  5AQF B;  3PUV F;  2HN1 A;  3QC9 A;  3RKG A;  1LRZ A;  1FMV A;  3RF1 A;  1UUS A;  4ILA A;  4B6X A;  4HFV A;  3GMI A;  5C3J A;  3LK3 B;  3ZPO A;  2V5D A;  4OHF A;  5JDG A;  2LHN A;  5LYJ E;  1XWM A;  3HR0 A;  3VRA A;  1XDP A;  3A5X A;  3AEG A;  3CK6 A;  2ZMA A;  2WU5 A;  2H7O A;  2D0U A;  3PUQ A;  4PFP A;  4ZS3 A;  5LGU B;  5FXZ A;  2E8I A;  4IDN A;  1UK5 A;  1HNW T;  1D0X A;  4MFR A;  2BKP A;  4LML A;  3ZEF B;  5HXS A;  4F6R C;  2W2U A;  1D1C A;  2W00 A;  1U5P A;  4IDQ A;  5FY1 A;  1UCU A;  1OED A;  3C4X A;  1QSD A;  3CQC B;  2MAW A;  2XQY A;  4HKA A;  4TNV A;  3VR9 A;  4MAL A;  2L8K A;  2WS3 A;  5BR8 T;  1HX8 A;  2VL8 A;  3H37 A;  1X9B A;  2Q9Q A;  2LSG A;  3KVA A;  3Q5W A;  3Q9D A;  3UU3 A;  3UT5 E;  4C91 A;  2BKO A;  3CX8 B;  4DVD A;  5HEJ A;  2YKS A;  3AEE A;  2R6G F;  2JQQ A;  3Q2M A;  4AQF C;  4AQF A;  5HXE A;  2BBH A;  3FBZ A;  2CLY B;  2N2N A;  3MAC A;  1WFD A;  4PJL A;  5L3C B;  1IAP A;  2LOP A;  2XZE A;  5FMN A;  3RIU A;  4IHJ E;  4DMV A;  1J1J A;  3LK4 2;  4UF0 B;  5AQS B;  2CBJ A;  5AQI B;  4P0A A;  2WMN A;  4JUY A;  2C5I T;  2VVN A;  5FXV A;  3EUH A;  3MKD A;  3P4Q A;  4PJJ A;  5JDN A;  2Y48 B;  3NVO A;  2CXF A;  1HX1 B;  4DO0 A;  5DJQ C;  4DV7 T;  3T1Y T;  3PU3 A;  4GYR A;  5LCY A;  3QK6 A;  2IUB A;  3AE6 A;  3PU8 A;  1M62 A;  4PJN A;  4PJM A;  4O2A E;  2W4X A;  2X0H A;  4UEM A;  5CA1 E;  4JEH B;  4H63 H;  1IZN B;  2N9D A;  3AXJ A;  2WZH A;  1WR0 A;  2CHN A;  5JDH A;  4DV2 T;  2MTQ A;  2OV9 A;  3TLS A;  4ZI2 C; 
#chains in the Genus database with same CATH homology
 3OTO T;  4DV3 T;  4DV0 T;  4X66 T;  1N32 T;  4K0K T;  4X64 T;  4DV6 T;  2UXC T;  2UXD T;  2UUB T;  4JI7 T;  4OX9 T;  4YY3 T;  4YHH T;  4B3T T;  2UXB T;  4NXN T;  4LFA T;  1FJG T;  4LF7 T;  4JI5 T;  4DV5 T;  4LF5 T;  4JI6 T;  4GKK T;  2VQF T;  4DUZ T;  4DR4 T;  4LFC T;  4DUY T;  4DR2 T;  2VQE T;  1I94 T;  4DR5 T;  4JI8 T;  1N36 T;  2HHH T;  4GKJ T;  1IBL T;  4JI3 T;  4DR1 T;  4X62 T;  1HNZ T;  2UUC T;  4DR6 T;  3T1H T;  4JI1 T;  4B3M T;  1HR0 T;  2UU9 T;  4LF6 T;  1J5E T;  4DR3 T;  4JI4 T;  4B3S T;  4DV1 T;  1N33 T;  1HNW T;  1HNX T;  4LF4 T;  2UUA T;  4DV4 T;  5BR8 T;  4LFB T;  4JI2 T;  4X65 T;  5LMN T;  1XNR T;  4JV5 T;  4JYA T;  1N34 T;  1IBK T;  4AQY T;  4NXM T;  4JI0 T;  2ZM6 T;  5LMU T;  1XMQ T;  4B3R T;  2E5L T;  1XNQ T;  1XMO T;  4DV7 T;  4DR7 T;  3T1Y T;  4LF9 T;  2F4V T;  4KHP T;  4LF8 T;  4DV2 T;  5IWA T;  1IBM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...