4DR3T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr3T00
1IBMT 4YHHT 4DUYT 1IBKT 5IWAT 2ZM6T 5BR8T 4DV4T 4LFAT 4KHPT 4JI3T 5LMNT 4DV7T 4OX9T 4LF7T 4DR6T 4X66T 4LF6T 4JI1T 1FJGT 4LFCT 1I94T 1N32T 4DV1T 4JI5T 4B3TT 4DV6T 4DR2T 4DR5T 4DV5T 1XNRT 4JI6T 4X62T 2VQET 4AQYT 4DV2T 4NXMT 5LMUT 4X65T 4LF9T 4LF5T 3T1YT 4YY3T 4JI7T 2HHHT 2UUAT 1XMOT 2UXCT 4JI0T 4DR1T 1IBLT 2F4VT 4DV3T 4DR4T 3T1HT 1N36T 4JI8T 4JI4T 2UU9T 1HNWT 4B3RT 4JV5T 1XNQT 2UUCT 2VQFT 4NXNT 2UXDT 4GKKT 2UUBT 4GKJT 1HNZT 4B3ST 4B3MT 4DR7T 4K0KT 4DUZT 4JYAT 1HR0T 4DR3T 1N34T 1HNXT 1N33T 2E5LT 4LF4T 1J5ET 3OTOT 4JI2T 4LFBT 4DV0T 2UXBT 4LF8T 1XMQT 4X64T
chains in the Genus database with same CATH superfamily
1U5PA 5JVDE 1JNRA 2V7IA 2WDVA 3ZMZB 3ZC0A 3KV5A 3SWHA 4OYJA 2WU5A 4E7ZA 3FB2A 4QXBB 3F31A 3WAKA 2WQYA 3L3PA 5F5WA 4NXMT 3VHLA 4ZI3C 5LHHB 2X51A 4O4JE 1CHUA 5AQOB 3U78A 4CI3B 3ZSSA 3ANWB 2IDOB 4CXXA 2JMKA 2V1DB 3PUWF 4JI0T 2KZ7B 1XZYA 3N2GE 2PBIA 4EYUA 4TWHA 4ZZBA 3M65A 2XTLA 1HNWT 2K9AA 4J2CA 5E0OA 3ZSTA 4UR9A 3QOFA 1S94A 5CGMA 5L2LA 4ZHQE 1HNZT 4EYYR 2I59A 3MK7C 5L4EA 3DTOA 3NKZA 1IZNB 5AFUL 2V7JA 3P4WA 4H9OC 4HFHA 2Q9QA 1VRBA 4AKGA 4UF0A 4DMWA 2QRXA 5FY7A 2CXFA 5JDFA 2W61A 4H9RC 4U2ZA 4PJJA 2X0LB 3RF1A 2LRLA 3L09A 1YD8G 3AAIA 2PG8A 5HXCA 2BS3A 5EZYE 4YFSA 5L3DB 4KHPT 3RYFE 3P4SA 3AECA 4DR6T 2KINB 1FJGT 3AAAB 3AE5A 3NWIA 3P4QA 1D0YA 3RX6A 1MMAA 3N2OA 4X62T 5CA1E 5LHIB 1KNRA 5IUXA 4TZ4C 4QXCB 3PUSA 3C4WA 3TLSA 5AQGB 4I43B 1OEDB 5M4YA 3B5MA 3X1DA 3JAFA 2L8KA 2CCQA 1D0XA 5LCYA 4G63A 5FXWA 5AQQB 4X1KE 4NXNT 3KINB 5FL0A 4AKRB 2PFVA 4HFCA 3LJCA 2JQHA 5H6RB 5HAXA 4IIJE 2XQYA 4QXHB 4V1Av 3N5LA 4BAYB 5JDGA 4LF8T 2V5CA 4HN9A 4UELA 3K3NA 1UUSA 2KSRA 4YHHT 1LKXA 3NVOA 3KFWX 3PUXF 4ILCA 3CQGB 3I9WA 2QVAA 1R8IA 4H9PC 3MXZA 4LF6T 1U4QA 2I6HA 2LSKA 2A3DA 5AQTB 4DV1T 5FXVA 1NEKA 4IDOA 1X9BA 4LMLA 5AQMB 2ACXA 3QK6A 3WAJA 4L5GA 3IA3A 4EEDA 5LOVE 4C91A 3TLTA 3LDQB 4HE8A 2HHHT 3ZT6A 1SA0E 3CK6A 1OWAA 1SE7A 2CWOA 3ESLA 5L3GB 2CPTA 2M6BA 3T1HT 3IEEA 4JI4T 2UU9T 4B3RT 3GA8A 1KFYA 5LBQB 5FKYA 2XM2A 4ZS3A 2RA1A 3K1SA 2WAUA 5C2TA 2L9QA 2V6XA 1L0VA 5L4HA 4TN7B 1N34T 2EHOA 4EGWA 2OV9A 1HF8A 2UXBT 4EXTA 4M1PA 4XBFB 2C5JA 2VVNA 3D0TA 3AE1A 3J7Yq 5KX5E 4HGAA 3RIFA 1WYBA 3ZMSB 4X5TA 5JRCA 4DO0A 2D9DA 5HEHA 5LJNA 3ZC1A 3CWZB 3P50A 3I1AA 3HL6A 4ISTA 2BKOA 1ZOYA 1YXRA 4DIDB 3EABA 1EZ3A 5J1GA 4OFZA 1FMWA 1YW0A 3RH3A 1KK7A 1UGOA 1HG2A 4LF5T 3VRAA 4B6XA 1HTJF 2LJLA 4P1NA 2BZBA 2VB6A 4IGUA 2VL0A 5HXHA 3UU6A 3FBZA 1HX8A 4Q25A 2IC6A 2NR4A 1IBLT 3E0ZA 4DVDA 1ZV4X 3C50A 1D1BA 5GONE 2IMLA 2H88A 3P7IA 1DU2A 1D1CA 4UV9B 2M67A 1J1JA 3F57A 3ZPOA 4AKLA 4BJNA 2DWGA 3GN5A 3OTOT 2X9XA 2P9BA 4ZI2D 1MIWA 1XMQT 4XZCA 3N2KE 4X64T 2NOXA 3C51A 2KNDA 2XAJB 3SRZA 2Q9QC 4AISA 2VVSA 3ZYLA 4HWFA 2UXXB 4LFCT 2J47A 4B3TT 2BG9A 2RP4A 2NP9A 4CN4A 4DV6T 2V6YB 3CX7B 3JAEA 1D0ZA 2N1GA 1QLBA 2WZIA 1OEDE 2DNXA 2KWIB 4JI7T 4DBRA 3AE3A 2LSYA 3UFEA 5JDLA 4F6RC 1YQ4A 3P8CD 5DABA 5HYAA 4HFDA 3UQ7A 2ODUA 2YN6A 4DV3T 4ZI3D 3JCFA 2XQ9A 2YU1A 1MIVA 1KNPA 2E2AA 1B7TA 1S35A 4PK6A 5JR9C 5HXSA 4EB6E 3SS1A 1MNDA 3RIAA 2YDSA 4YHJA 4EOZB 2M6IA 2WP9A 1HR0T 3U3IA 4IDPA 2KT9A 4GIWA 2XUEA 3LK42 2Z6EA 1D1AA 3HR0A 4QWNB 3ETVA 1E7PA 3A8YC 2JIWA 4MALA 1WLXA 3UQ4A 5EK2A 4CZZB 1YQ3A 3ETUA 2RPAA 2VKOA 5DQVA 2HPLA 5AQFB 3HKDE 1Y64B 2NW9A 3RPUA 4DV7T 2A2FX 2LOSA 2I0MA 1XDPA 1T98A 4ANJA 4KX6A 3EDUA 5AQRB 2LE8A 2ZLYA 3FZKB 4O2BE 3OYXA 3ZCIA 3ZEFB 4UVBB 3AXJA 2E9XC 2CXDA 5LBMA 3O4XE 3C98B 1NWMX 4GK5E 4AIUA 2UUAT 3QB5A 2XHEB 4DBQA 2CHNA 3IBPA 4ASKA 5FYMA 3C64A 4YJ2E 1VCSA 1GQEA 4C90A 2V7LA 2NW8A 3NRYA 3H37A 4QHOA 1ZP0A 3PU8A 3N9OA 5DQWA 4PJNA 3O1HA 1G8XA 3RKOA 2BVLA 2VURA 4CXYA 2A72A 3RI5A 3VR8A 4KP3C 2PTFA 4ILBA 1UK5A 4MHCA 2WB5A 4HFIA 3N9MA 3FZLB 2BS2A 4NUUA 1VOMA 2H89A 4L0RA 1UCUA 2EHOC 5DJQC 2KMFA 5HWYA 4UF0B 3TKLB 2CWYA 4JI5T 3ZJ2A 3NRXA 4DMVA 4P0BA 4IE0A 3RYHE 4WBNE 3DP7A 4DV2T 3FZFB 2E8IA 2VKDA 4CI1B 3ZLIA 3Q9DA 2HPJA 4PW8A 3AA6B 2WM9A 4UVAB 2DI4A 2WU2A 4WZXA 4YTPA 3V5UA 1T7SA 2LHNA 3OPCA 2LSGA 2DHRA 4IDZA 3CMLA 3KVBA 2FUPA 2FBWA 3TLUA 3K3OA 2UXDT 1WR0A 3LSVA 2GK9A 5JR9B 2MYSA 3O1JA 2DLRA 3AB3B 4Z8XA 4DUZT 3DJBA 1WYCA 2IIUA 5LXTE 3AE7A 4EEBA 1OEDA 3CX8B 2WWUA 1MMDA 5AQLB 1IBKT 4AQGA 3AEFA 5CA0E 4O4IE 5BR8T 2FJAA 5LP6E 3RYCE 3UU5A 4GYSA 4GOUA 2NW7A 5LMNT 4OX9T 5JH7E 5HCJA 2J62A 2G0UA 3SOLA 4A5XA 5FVKA 5C8YE 1VCTA 5A1LA 2JJ9A 4G2AA 5JDHA 4DV5T 2WS3A 3K3QC 3AE4A 2E9XB 3UUXB 3SFEA 3CQCB 2BG9C 2FJDA 4F8HA 3VRBA 2H7OA 3I9YA 2HN1A 2E5VA 3N9QA 3UTKA 1SUMB 3ZN0B 4CXWA 3AE2A 2OLTA 3B57A 5KXJA 1WCRA 4WBOA 3BQIA 3CQXC 4HFEA 3KVAA 5L3BB 1HG5A 5LA6E 4TNVA 4GKJT 4I4TE 1YKEB 4B3ST 1V9DA 5F3JA 5FL1A 4HWHA 4U33A 3VKHA 4JI2T 4TV8E 3QB5K 2BS4A 3I0QA 2WWVA 3UU3A 3KV9A 4H9NC 1QUUA 2LM2A 5HWXA 1IBMT 4H9QC 2WBLA 4PNIA 3G06A 4HFVA 1X79A 3H3AA 2LRKA 2W67A 3JADA 3OKQA 5FXZA 4IE6A 3ZKRA 4L9IA 3ZYKA 1I94T 5ABFB 1NAFA 3RC3A 2ACZA 4A98A 2VASA 2YU2A 1W0BA 4ILAA 4Z91A 3ZN1B 4U72A 2XAHB 1XWMA 1WRDA 3LK2B 3P4PA 4AKIA 5ABHA 1YKHB 3CVRA 3QNUA 3RIUA 1N36T 3VKGA 2JQKA 4P0AA 3KV4A 2LT3A 5IHYA 5ABGA 1MMGA 1UX4A 5LJMA 4HWDA 5C3JA 4QKNA 4JEHB 1UX5A 1HNXT 4LF4T 4U7IA 2X66A 5J2UE 3AE8A 1MIYA 3B13A 1W9RA 3IF8B 2XY8B 3RKGA 4ADZA 4AQFA 3R6NA 4PJLA 2WMNA 4KBMB 2X68A 5HCMA 1M62A 3GN5B 3IHRA 2DWKA 3TLVA 2CEAA 4X20E 4HFBA 4EAHA 4DR2T 4DR5T 3EI0A 3PJAA 1J5WA 3ZMVB 5LGUB 2WSSV 3FBLA 3PDYA 2SPCA 4HWIB 2XSBA 4IHJE 1WR6A 3LBXA 4KI0F 3T1YT 4IDQA 3RQWA 5CB4E 1IJ6A 3O9XA 4YT0A 3UT5E 2BG9B 4HTEA 4GYRA 2IHR1 2ODVA 2E9XD 4AI6A 2YDQA 4P09A 4JV5T 4YJ3E 5L3CB 5F8PA 3OYZA 1WFDA 2WDRA 2V6YA 3JC6C 4X1IE 4X1YE 4I0UA 2CMRA 4EIWA 2IAKA 2WDQA 3UFGA 1N33T 2E5LT 2CBIA 4NPPA 2N2NA 5HEGA 2YDRA 5J2TE 1BR2A 4IREA 4O8SA 3W15B 3K8PC 5HEJA 1US7B 3HKCE 2X9YA 5JTGA 3M3ZB 2XQ8A 3FZHB 1O3XA 2YEVC 3EAMA 1XDOA 3EHZA 3LFMA 1N32T 4PFPA 3ZJ1A 2W62A 4E7SA 5LG4A 4ERRA 2C0SA 3AEGA 1G73A 1MNEA 2XQ3A 1XNRT 4MBQA 2VQET 2XQ7A 2EHOD 2C5KT 3PTRB 2CHOA 3QC9A 3J9X1 2D0UA 4K0UA 5ETWA 3E08A 5JREA 2CXLA 2CE7A 1CUNA 3ONXA 5L3EB 5ABEA 4H9SE 4UXNB 4O4LE 4TV9E 4OYKA 4DR4T 4ZS2A 1IAPA 3KV6A 1ZKEA 2XZEA 3MJXA 2VWAA 4HKAA 3AAEB 5LGTB 1Y01A 4DR3T 3UU4A 3RC8A 4UIGA 4LMKA 2D5UA 5AQSB 4DUYT 2Y48B 5L3FB 3A5XA 2YKSA 4U7YA 5BMVE 2VKJA 2YINA 4DV4T 5FMNA 3ANWA 4N78D 3T8OA 4JI3T 3L39A 1KNZA 4ZI7E 5LHGB 5KMGP 4JI1T 5FP3A 2K24A 4H63V 1OXZA 3PUGA 5AQNB 1M7KA 5TAOA 3Q5XA 2XSAA 5HEOA 3OJAA 2CM0A 1BR4A 2XASB 4JI6T 2BDEA 4AQYT 5LMUT 4A97A 3OVUA 2LLYA 3AVRA 4IT4A 3UUNA 2Q9QB 3S4UA 4U31A 5KDMC 2DCFA 2JQ9A 2JQQA 2ZM0A 4ZEYA 5CJ5A 2WCAA 3BK9A 2F4VT 1LVFA 4CQIA 4JI8T 2A9UA 3R84B 1FEWA 2XAQB 3Q2MA 2Y6XA 4WYVA 3NZPA 3ZCJA 2XAFB 3GWHA 2VQFT 3CPZA 3RRWA 4GKKT 2UUBT 4PFOA 4IE5A 2MBGA 5AQJB 4PK5A 3LK3B 2XQAA 3RIUC 4A56A 3BQKA 4DNDA 3KBUA 4IL4A 4LFBT 4TX5A 4IL9A 3AEAA 4IE7A 2V8SV 2DL1A 3EVYA 2LM9A 5AQPB 5HEUA 2ZM6T 2CRBA 2K48A 5EK3A 5FY1A 3MA9A 2VKHA 2LHRA 5JR9A 2NTYA 4PJMA 3N9NA 2WMOA 4BA9A 5LGNB 4FI5A 4Z90A 4AQFC 4PK4A 2W4XA 1MMNA 4HEAA 2X9HA 4LF9T 2QA7A 5AQHB 2XPKA 3FXDB 1LRZA 2BG9E 2ZM8A 1AJ3A 2V7MA 4CI2B 1XMOT 3PJAJ 1W0AA 3HKBE 2N9DA 4JUYA 2UXCT 2IC9A 2MAWA 3PE0A 2HN2A 4YLHA 3KBTA 2BVMA 4I50E 1XNQT 2C5IT 3HI2A 1UURA 4QH4A 4YSXA 3FZMB 4GK0E 3TLWA 2KLQA 2X0YA 4U74A 2K3WA 1HFAA 2YK0A 3PUAA 3RYIE 3UUBA 5L47A 4B3MT 1BR0A 2UXNB 4JYAT 3AEEA 2E9XA 5EK4A 2J1DG 5JDQA 3QUJA 3MACA 1E2AA 4YSZA 3KDSE 4EV6A 5CFBA 2XQ6A 3CX6B 3I0OA 1LVKA 4LFAT 5FXXA 2JPFA 2XQ5A 3PURA 4YXDA 3PU3A 3AEDA 1ZHCA 4TWFA 1JNZA 1BR1A 3NZQA 2CLYC 2LKHA 4TNWA 3ZT7A 3C4XA 2X0HA 2W66A 4MFRA 1T72A 4KUMB 4KMCA 2EHOB 4YY3T 2W00A 2WZHA 3RHWA 3VR9A 4ILUA 2XAGB 2NWBA 1HCIA 4ZOLE 2D0TA 5JDMA 3CIRA 4JBWF 4UEMA 2JRKA 3UU8A 2Q9QD 5JRCB 5ABFA 1FIOA 4TUYE 2AE9A 2UUCT 4ZZCA 2NTXA 4IE4A 5JDNA 5JQGE 4UVCB 2Y8DA 2X67A 4H63H 4AXPA 1NENA 3HKEE 3Q5DA 4COFA 3PUVF 1Z0PA 2B1EA 4U3CA 3EUHA 2IW5B 2LKGA 1FMVA 1IJ5A 4DV0T 2KWHA 4LMJA 3JC6D 4QX7B 4JEUB 5FY0A 4EZHA 5IYZE 2JMHA 5IWAT 2B76A 2H3RA 5AQUB 3EDVA 4OK0A 4FJOA 4YTNA 4TWDA 2VL8A 4X66T 2X9WA 2YOEA 4ZXLA 3WI3A 5AQVB 2AXDS 3AE6A 3FHNA 3V5SA 4AKHA 5ADXL 3C4ZA 4QX8B 4X65T 2BBHA 2WY2A 3OBVE 2LOPA 3PUYF 3ZT5A 3H3MA 2V5DA 2MPKA 2CBJA 2CA5A 5LNKA 3SFDA 3HA4A 1T8BA 1E1HB 4DR1T 3VU7H 2KXPB 1H7CA 4EZ4A 4CN6A 2ZM2A 3NBXX 4QH1A 2J4GA 3LBXB 2IUBA 2W63A 5LYJE 2FJEA 2K5BB 4U2YA 4JLEA 3RLFF 4WW0A 2ZMAA 4NUVA 4K0KT 2LEHA 3RRCA 4MLKA 5AQKB 5J0ZA 2W0GA 3ONLC 2MOZA 1J5ET 5HXRA 3F2EA 4QH5A 3AE9A 3BQLA 4YTMA 4UV8B 3N9LA 2QGSA 3AA0B 3MZKB 3ZMUB 3ABVA 4OHFA 3UULA 1SHZC 3LG7A 3RGLA 3ZMTB 3FXEB 2BKNA 2LSJA 2D2SA 2H7VC 1KF6A 2ES0A 3AA1B 4IDNA 5FNVE 3UUMA 4LF7T 3P4RA 1KEYA 4O4HE 4KHZF 2OA5A 2V7KA 3MKDA 5FVLA 3PUZF 2CLYB 4BJMA 3AEBA 4I55E 3CKDA 3GMIA 2MTQA 1I6ZA 3N9PA 2LSIA 1OEDC 4NIQA 3AA7B 1ZEEA 4CN1A 2XQ4A 2BKPA 2HH7A 2QYWA 1HS7A 2L3LA 2FJBA 1W09A 3AVSA 5LG3A 3Q5EA 2XM1A 5HXEA 5LB7B 2R6GF 4XAXB 5AQIB 3PV0F 2BBJA 3A7MA 1QSDA 4ZI2C 4YSYA 3RQUA 3PUQA 1Z8UA 3ONJA 4PAGA 4HWCA 4WNKA 4ISSA 3O1IA 4DR7T 2PJQA 1HX1B 4O2AE 3ZYMA 3AXJB 3L8RA 3Q5WA 2W2UA 3E22E 2XJ7A 2VK9A 2V26A 5H6QB
chains in the Genus database with same CATH topology
1IBMT 4YHHT 4DUYT 1IBKT 5IWAT 2ZM6T 5BR8T 4DV4T 4LFAT 4KHPT 4JI3T 5LMNT 4DV7T 4OX9T 4LF7T 4DR6T 4X66T 4LF6T 4JI1T 1FJGT 4LFCT 1I94T 1N32T 4DV1T 4JI5T 4B3TT 4DV6T 4DR2T 4DR5T 4DV5T 1XNRT 4JI6T 4X62T 2VQET 4AQYT 4DV2T 4NXMT 5LMUT 4X65T 4LF9T 4LF5T 3T1YT 4YY3T 4JI7T 2HHHT 2UUAT 1XMOT 2UXCT 4JI0T 4DR1T 1IBLT 2F4VT 4DV3T 4DR4T 3T1HT 1N36T 4JI8T 4JI4T 2UU9T 1HNWT 4B3RT 4JV5T 1XNQT 2UUCT 2VQFT 4NXNT 2UXDT 4GKKT 2UUBT 4GKJT 1HNZT 4B3ST 4B3MT 4DR7T 4K0KT 4DUZT 4JYAT 1HR0T 4DR3T 1N34T 1HNXT 1N33T 2E5LT 4LF4T 1J5ET 3OTOT 4JI2T 4LFBT 4DV0T 2UXBT 4LF8T 1XMQT 4X64T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM T;  4YHH T;  4DUY T;  1IBK T;  5IWA T;  2ZM6 T;  5BR8 T;  4DV4 T;  4LFA T;  4KHP T;  4JI3 T;  5LMN T;  4DV7 T;  4OX9 T;  4LF7 T;  4DR6 T;  4X66 T;  4LF6 T;  4JI1 T;  1FJG T;  4LFC T;  1I94 T;  1N32 T;  4DV1 T;  4JI5 T;  4B3T T;  4DV6 T;  4DR2 T;  4DR5 T;  4DV5 T;  1XNR T;  4JI6 T;  4X62 T;  2VQE T;  4AQY T;  4DV2 T;  4NXM T;  5LMU T;  4X65 T;  4LF9 T;  4LF5 T;  3T1Y T;  4YY3 T;  4JI7 T;  2HHH T;  2UUA T;  1XMO T;  2UXC T;  4JI0 T;  4DR1 T;  1IBL T;  2F4V T;  4DV3 T;  4DR4 T;  3T1H T;  1N36 T;  4JI8 T;  4JI4 T;  2UU9 T;  1HNW T;  4B3R T;  4JV5 T;  1XNQ T;  2UUC T;  2VQF T;  4NXN T;  2UXD T;  4GKK T;  2UUB T;  4GKJ T;  1HNZ T;  4B3S T;  4B3M T;  4DR7 T;  4K0K T;  4DUZ T;  4JYA T;  1HR0 T;  4DR3 T;  1N34 T;  1HNX T;  1N33 T;  2E5L T;  4LF4 T;  1J5E T;  3OTO T;  4JI2 T;  4LFB T;  4DV0 T;  2UXB T;  4LF8 T;  1XMQ T;  4X64 T; 
#chains in the Genus database with same CATH topology
 1U5P A;  5JVD E;  1JNR A;  2V7I A;  2WDV A;  3ZMZ B;  3ZC0 A;  3KV5 A;  3SWH A;  4OYJ A;  2WU5 A;  4E7Z A;  3FB2 A;  4QXB B;  3F31 A;  3WAK A;  2WQY A;  3L3P A;  5F5W A;  4NXM T;  3VHL A;  4ZI3 C;  5LHH B;  2X51 A;  4O4J E;  1CHU A;  5AQO B;  3U78 A;  4CI3 B;  3ZSS A;  3ANW B;  2IDO B;  4CXX A;  2JMK A;  2V1D B;  3PUW F;  4JI0 T;  2KZ7 B;  1XZY A;  3N2G E;  2PBI A;  4EYU A;  4TWH A;  4ZZB A;  3M65 A;  2XTL A;  1HNW T;  2K9A A;  4J2C A;  5E0O A;  3ZST A;  4UR9 A;  3QOF A;  1S94 A;  5CGM A;  5L2L A;  4ZHQ E;  1HNZ T;  4EYY R;  2I59 A;  3MK7 C;  5L4E A;  3DTO A;  3NKZ A;  1IZN B;  5AFU L;  2V7J A;  3P4W A;  4H9O C;  4HFH A;  2Q9Q A;  1VRB A;  4AKG A;  4UF0 A;  4DMW A;  2QRX A;  5FY7 A;  2CXF A;  5JDF A;  2W61 A;  4H9R C;  4U2Z A;  4PJJ A;  2X0L B;  3RF1 A;  2LRL A;  3L09 A;  1YD8 G;  3AAI A;  2PG8 A;  5HXC A;  2BS3 A;  5EZY E;  4YFS A;  5L3D B;  4KHP T;  3RYF E;  3P4S A;  3AEC A;  4DR6 T;  2KIN B;  1FJG T;  3AAA B;  3AE5 A;  3NWI A;  3P4Q A;  1D0Y A;  3RX6 A;  1MMA A;  3N2O A;  4X62 T;  5CA1 E;  5LHI B;  1KNR A;  5IUX A;  4TZ4 C;  4QXC B;  3PUS A;  3C4W A;  3TLS A;  5AQG B;  4I43 B;  1OED B;  5M4Y A;  3B5M A;  3X1D A;  3JAF A;  2L8K A;  2CCQ A;  1D0X A;  5LCY A;  4G63 A;  5FXW A;  5AQQ B;  4X1K E;  4NXN T;  3KIN B;  5FL0 A;  4AKR B;  2PFV A;  4HFC A;  3LJC A;  2JQH A;  5H6R B;  5HAX A;  4IIJ E;  2XQY A;  4QXH B;  4V1A v;  3N5L A;  4BAY B;  5JDG A;  4LF8 T;  2V5C A;  4HN9 A;  4UEL A;  3K3N A;  1UUS A;  2KSR A;  4YHH T;  1LKX A;  3NVO A;  3KFW X;  3PUX F;  4ILC A;  3CQG B;  3I9W A;  2QVA A;  1R8I A;  4H9P C;  3MXZ A;  4LF6 T;  1U4Q A;  2I6H A;  2LSK A;  2A3D A;  5AQT B;  4DV1 T;  5FXV A;  1NEK A;  4IDO A;  1X9B A;  4LML A;  5AQM B;  2ACX A;  3QK6 A;  3WAJ A;  4L5G A;  3IA3 A;  4EED A;  5LOV E;  4C91 A;  3TLT A;  3LDQ B;  4HE8 A;  2HHH T;  3ZT6 A;  1SA0 E;  3CK6 A;  1OWA A;  1SE7 A;  2CWO A;  3ESL A;  5L3G B;  2CPT A;  2M6B A;  3T1H T;  3IEE A;  4JI4 T;  2UU9 T;  4B3R T;  3GA8 A;  1KFY A;  5LBQ B;  5FKY A;  2XM2 A;  4ZS3 A;  2RA1 A;  3K1S A;  2WAU A;  5C2T A;  2L9Q A;  2V6X A;  1L0V A;  5L4H A;  4TN7 B;  1N34 T;  2EHO A;  4EGW A;  2OV9 A;  1HF8 A;  2UXB T;  4EXT A;  4M1P A;  4XBF B;  2C5J A;  2VVN A;  3D0T A;  3AE1 A;  3J7Y q;  5KX5 E;  4HGA A;  3RIF A;  1WYB A;  3ZMS B;  4X5T A;  5JRC A;  4DO0 A;  2D9D A;  5HEH A;  5LJN A;  3ZC1 A;  3CWZ B;  3P50 A;  3I1A A;  3HL6 A;  4IST A;  2BKO A;  1ZOY A;  1YXR A;  4DID B;  3EAB A;  1EZ3 A;  5J1G A;  4OFZ A;  1FMW A;  1YW0 A;  3RH3 A;  1KK7 A;  1UGO A;  1HG2 A;  4LF5 T;  3VRA A;  4B6X A;  1HTJ F;  2LJL A;  4P1N A;  2BZB A;  2VB6 A;  4IGU A;  2VL0 A;  5HXH A;  3UU6 A;  3FBZ A;  1HX8 A;  4Q25 A;  2IC6 A;  2NR4 A;  1IBL T;  3E0Z A;  4DVD A;  1ZV4 X;  3C50 A;  1D1B A;  5GON E;  2IML A;  2H88 A;  3P7I A;  1DU2 A;  1D1C A;  4UV9 B;  2M67 A;  1J1J A;  3F57 A;  3ZPO A;  4AKL A;  4BJN A;  2DWG A;  3GN5 A;  3OTO T;  2X9X A;  2P9B A;  4ZI2 D;  1MIW A;  1XMQ T;  4XZC A;  3N2K E;  4X64 T;  2NOX A;  3C51 A;  2KND A;  2XAJ B;  3SRZ A;  2Q9Q C;  4AIS A;  2VVS A;  3ZYL A;  4HWF A;  2UXX B;  4LFC T;  2J47 A;  4B3T T;  2BG9 A;  2RP4 A;  2NP9 A;  4CN4 A;  4DV6 T;  2V6Y B;  3CX7 B;  3JAE A;  1D0Z A;  2N1G A;  1QLB A;  2WZI A;  1OED E;  2DNX A;  2KWI B;  4JI7 T;  4DBR A;  3AE3 A;  2LSY A;  3UFE A;  5JDL A;  4F6R C;  1YQ4 A;  3P8C D;  5DAB A;  5HYA A;  4HFD A;  3UQ7 A;  2ODU A;  2YN6 A;  4DV3 T;  4ZI3 D;  3JCF A;  2XQ9 A;  2YU1 A;  1MIV A;  1KNP A;  2E2A A;  1B7T A;  1S35 A;  4PK6 A;  5JR9 C;  5HXS A;  4EB6 E;  3SS1 A;  1MND A;  3RIA A;  2YDS A;  4YHJ A;  4EOZ B;  2M6I A;  2WP9 A;  1HR0 T;  3U3I A;  4IDP A;  2KT9 A;  4GIW A;  2XUE A;  3LK4 2;  2Z6E A;  1D1A A;  3HR0 A;  4QWN B;  3ETV A;  1E7P A;  3A8Y C;  2JIW A;  4MAL A;  1WLX A;  3UQ4 A;  5EK2 A;  4CZZ B;  1YQ3 A;  3ETU A;  2RPA A;  2VKO A;  5DQV A;  2HPL A;  5AQF B;  3HKD E;  1Y64 B;  2NW9 A;  3RPU A;  4DV7 T;  2A2F X;  2LOS A;  2I0M A;  1XDP A;  1T98 A;  4ANJ A;  4KX6 A;  3EDU A;  5AQR B;  2LE8 A;  2ZLY A;  3FZK B;  4O2B E;  3OYX A;  3ZCI A;  3ZEF B;  4UVB B;  3AXJ A;  2E9X C;  2CXD A;  5LBM A;  3O4X E;  3C98 B;  1NWM X;  4GK5 E;  4AIU A;  2UUA T;  3QB5 A;  2XHE B;  4DBQ A;  2CHN A;  3IBP A;  4ASK A;  5FYM A;  3C64 A;  4YJ2 E;  1VCS A;  1GQE A;  4C90 A;  2V7L A;  2NW8 A;  3NRY A;  3H37 A;  4QHO A;  1ZP0 A;  3PU8 A;  3N9O A;  5DQW A;  4PJN A;  3O1H A;  1G8X A;  3RKO A;  2BVL A;  2VUR A;  4CXY A;  2A72 A;  3RI5 A;  3VR8 A;  4KP3 C;  2PTF A;  4ILB A;  1UK5 A;  4MHC A;  2WB5 A;  4HFI A;  3N9M A;  3FZL B;  2BS2 A;  4NUU A;  1VOM A;  2H89 A;  4L0R A;  1UCU A;  2EHO C;  5DJQ C;  2KMF A;  5HWY A;  4UF0 B;  3TKL B;  2CWY A;  4JI5 T;  3ZJ2 A;  3NRX A;  4DMV A;  4P0B A;  4IE0 A;  3RYH E;  4WBN E;  3DP7 A;  4DV2 T;  3FZF B;  2E8I A;  2VKD A;  4CI1 B;  3ZLI A;  3Q9D A;  2HPJ A;  4PW8 A;  3AA6 B;  2WM9 A;  4UVA B;  2DI4 A;  2WU2 A;  4WZX A;  4YTP A;  3V5U A;  1T7S A;  2LHN A;  3OPC A;  2LSG A;  2DHR A;  4IDZ A;  3CML A;  3KVB A;  2FUP A;  2FBW A;  3TLU A;  3K3O A;  2UXD T;  1WR0 A;  3LSV A;  2GK9 A;  5JR9 B;  2MYS A;  3O1J A;  2DLR A;  3AB3 B;  4Z8X A;  4DUZ T;  3DJB A;  1WYC A;  2IIU A;  5LXT E;  3AE7 A;  4EEB A;  1OED A;  3CX8 B;  2WWU A;  1MMD A;  5AQL B;  1IBK T;  4AQG A;  3AEF A;  5CA0 E;  4O4I E;  5BR8 T;  2FJA A;  5LP6 E;  3RYC E;  3UU5 A;  4GYS A;  4GOU A;  2NW7 A;  5LMN T;  4OX9 T;  5JH7 E;  5HCJ A;  2J62 A;  2G0U A;  3SOL A;  4A5X A;  5FVK A;  5C8Y E;  1VCT A;  5A1L A;  2JJ9 A;  4G2A A;  5JDH A;  4DV5 T;  2WS3 A;  3K3Q C;  3AE4 A;  2E9X B;  3UUX B;  3SFE A;  3CQC B;  2BG9 C;  2FJD A;  4F8H A;  3VRB A;  2H7O A;  3I9Y A;  2HN1 A;  2E5V A;  3N9Q A;  3UTK A;  1SUM B;  3ZN0 B;  4CXW A;  3AE2 A;  2OLT A;  3B57 A;  5KXJ A;  1WCR A;  4WBO A;  3BQI A;  3CQX C;  4HFE A;  3KVA A;  5L3B B;  1HG5 A;  5LA6 E;  4TNV A;  4GKJ T;  4I4T E;  1YKE B;  4B3S T;  1V9D A;  5F3J A;  5FL1 A;  4HWH A;  4U33 A;  3VKH A;  4JI2 T;  4TV8 E;  3QB5 K;  2BS4 A;  3I0Q A;  2WWV A;  3UU3 A;  3KV9 A;  4H9N C;  1QUU A;  2LM2 A;  5HWX A;  1IBM T;  4H9Q C;  2WBL A;  4PNI A;  3G06 A;  4HFV A;  1X79 A;  3H3A A;  2LRK A;  2W67 A;  3JAD A;  3OKQ A;  5FXZ A;  4IE6 A;  3ZKR A;  4L9I A;  3ZYK A;  1I94 T;  5ABF B;  1NAF A;  3RC3 A;  2ACZ A;  4A98 A;  2VAS A;  2YU2 A;  1W0B A;  4ILA A;  4Z91 A;  3ZN1 B;  4U72 A;  2XAH B;  1XWM A;  1WRD A;  3LK2 B;  3P4P A;  4AKI A;  5ABH A;  1YKH B;  3CVR A;  3QNU A;  3RIU A;  1N36 T;  3VKG A;  2JQK A;  4P0A A;  3KV4 A;  2LT3 A;  5IHY A;  5ABG A;  1MMG A;  1UX4 A;  5LJM A;  4HWD A;  5C3J A;  4QKN A;  4JEH B;  1UX5 A;  1HNX T;  4LF4 T;  4U7I A;  2X66 A;  5J2U E;  3AE8 A;  1MIY A;  3B13 A;  1W9R A;  3IF8 B;  2XY8 B;  3RKG A;  4ADZ A;  4AQF A;  3R6N A;  4PJL A;  2WMN A;  4KBM B;  2X68 A;  5HCM A;  1M62 A;  3GN5 B;  3IHR A;  2DWK A;  3TLV A;  2CEA A;  4X20 E;  4HFB A;  4EAH A;  4DR2 T;  4DR5 T;  3EI0 A;  3PJA A;  1J5W A;  3ZMV B;  5LGU B;  2WSS V;  3FBL A;  3PDY A;  2SPC A;  4HWI B;  2XSB A;  4IHJ E;  1WR6 A;  3LBX A;  4KI0 F;  3T1Y T;  4IDQ A;  3RQW A;  5CB4 E;  1IJ6 A;  3O9X A;  4YT0 A;  3UT5 E;  2BG9 B;  4HTE A;  4GYR A;  2IHR 1;  2ODV A;  2E9X D;  4AI6 A;  2YDQ A;  4P09 A;  4JV5 T;  4YJ3 E;  5L3C B;  5F8P A;  3OYZ A;  1WFD A;  2WDR A;  2V6Y A;  3JC6 C;  4X1I E;  4X1Y E;  4I0U A;  2CMR A;  4EIW A;  2IAK A;  2WDQ A;  3UFG A;  1N33 T;  2E5L T;  2CBI A;  4NPP A;  2N2N A;  5HEG A;  2YDR A;  5J2T E;  1BR2 A;  4IRE A;  4O8S A;  3W15 B;  3K8P C;  5HEJ A;  1US7 B;  3HKC E;  2X9Y A;  5JTG A;  3M3Z B;  2XQ8 A;  3FZH B;  1O3X A;  2YEV C;  3EAM A;  1XDO A;  3EHZ A;  3LFM A;  1N32 T;  4PFP A;  3ZJ1 A;  2W62 A;  4E7S A;  5LG4 A;  4ERR A;  2C0S A;  3AEG A;  1G73 A;  1MNE A;  2XQ3 A;  1XNR T;  4MBQ A;  2VQE T;  2XQ7 A;  2EHO D;  2C5K T;  3PTR B;  2CHO A;  3QC9 A;  3J9X 1;  2D0U A;  4K0U A;  5ETW A;  3E08 A;  5JRE A;  2CXL A;  2CE7 A;  1CUN A;  3ONX A;  5L3E B;  5ABE A;  4H9S E;  4UXN B;  4O4L E;  4TV9 E;  4OYK A;  4DR4 T;  4ZS2 A;  1IAP A;  3KV6 A;  1ZKE A;  2XZE A;  3MJX A;  2VWA A;  4HKA A;  3AAE B;  5LGT B;  1Y01 A;  4DR3 T;  3UU4 A;  3RC8 A;  4UIG A;  4LMK A;  2D5U A;  5AQS B;  4DUY T;  2Y48 B;  5L3F B;  3A5X A;  2YKS A;  4U7Y A;  5BMV E;  2VKJ A;  2YIN A;  4DV4 T;  5FMN A;  3ANW A;  4N78 D;  3T8O A;  4JI3 T;  3L39 A;  1KNZ A;  4ZI7 E;  5LHG B;  5KMG P;  4JI1 T;  5FP3 A;  2K24 A;  4H63 V;  1OXZ A;  3PUG A;  5AQN B;  1M7K A;  5TAO A;  3Q5X A;  2XSA A;  5HEO A;  3OJA A;  2CM0 A;  1BR4 A;  2XAS B;  4JI6 T;  2BDE A;  4AQY T;  5LMU T;  4A97 A;  3OVU A;  2LLY A;  3AVR A;  4IT4 A;  3UUN A;  2Q9Q B;  3S4U A;  4U31 A;  5KDM C;  2DCF A;  2JQ9 A;  2JQQ A;  2ZM0 A;  4ZEY A;  5CJ5 A;  2WCA A;  3BK9 A;  2F4V T;  1LVF A;  4CQI A;  4JI8 T;  2A9U A;  3R84 B;  1FEW A;  2XAQ B;  3Q2M A;  2Y6X A;  4WYV A;  3NZP A;  3ZCJ A;  2XAF B;  3GWH A;  2VQF T;  3CPZ A;  3RRW A;  4GKK T;  2UUB T;  4PFO A;  4IE5 A;  2MBG A;  5AQJ B;  4PK5 A;  3LK3 B;  2XQA A;  3RIU C;  4A56 A;  3BQK A;  4DND A;  3KBU A;  4IL4 A;  4LFB T;  4TX5 A;  4IL9 A;  3AEA A;  4IE7 A;  2V8S V;  2DL1 A;  3EVY A;  2LM9 A;  5AQP B;  5HEU A;  2ZM6 T;  2CRB A;  2K48 A;  5EK3 A;  5FY1 A;  3MA9 A;  2VKH A;  2LHR A;  5JR9 A;  2NTY A;  4PJM A;  3N9N A;  2WMO A;  4BA9 A;  5LGN B;  4FI5 A;  4Z90 A;  4AQF C;  4PK4 A;  2W4X A;  1MMN A;  4HEA A;  2X9H A;  4LF9 T;  2QA7 A;  5AQH B;  2XPK A;  3FXD B;  1LRZ A;  2BG9 E;  2ZM8 A;  1AJ3 A;  2V7M A;  4CI2 B;  1XMO T;  3PJA J;  1W0A A;  3HKB E;  2N9D A;  4JUY A;  2UXC T;  2IC9 A;  2MAW A;  3PE0 A;  2HN2 A;  4YLH A;  3KBT A;  2BVM A;  4I50 E;  1XNQ T;  2C5I T;  3HI2 A;  1UUR A;  4QH4 A;  4YSX A;  3FZM B;  4GK0 E;  3TLW A;  2KLQ A;  2X0Y A;  4U74 A;  2K3W A;  1HFA A;  2YK0 A;  3PUA A;  3RYI E;  3UUB A;  5L47 A;  4B3M T;  1BR0 A;  2UXN B;  4JYA T;  3AEE A;  2E9X A;  5EK4 A;  2J1D G;  5JDQ A;  3QUJ A;  3MAC A;  1E2A A;  4YSZ A;  3KDS E;  4EV6 A;  5CFB A;  2XQ6 A;  3CX6 B;  3I0O A;  1LVK A;  4LFA T;  5FXX A;  2JPF A;  2XQ5 A;  3PUR A;  4YXD A;  3PU3 A;  3AED A;  1ZHC A;  4TWF A;  1JNZ A;  1BR1 A;  3NZQ A;  2CLY C;  2LKH A;  4TNW A;  3ZT7 A;  3C4X A;  2X0H A;  2W66 A;  4MFR A;  1T72 A;  4KUM B;  4KMC A;  2EHO B;  4YY3 T;  2W00 A;  2WZH A;  3RHW A;  3VR9 A;  4ILU A;  2XAG B;  2NWB A;  1HCI A;  4ZOL E;  2D0T A;  5JDM A;  3CIR A;  4JBW F;  4UEM A;  2JRK A;  3UU8 A;  2Q9Q D;  5JRC B;  5ABF A;  1FIO A;  4TUY E;  2AE9 A;  2UUC T;  4ZZC A;  2NTX A;  4IE4 A;  5JDN A;  5JQG E;  4UVC B;  2Y8D A;  2X67 A;  4H63 H;  4AXP A;  1NEN A;  3HKE E;  3Q5D A;  4COF A;  3PUV F;  1Z0P A;  2B1E A;  4U3C A;  3EUH A;  2IW5 B;  2LKG A;  1FMV A;  1IJ5 A;  4DV0 T;  2KWH A;  4LMJ A;  3JC6 D;  4QX7 B;  4JEU B;  5FY0 A;  4EZH A;  5IYZ E;  2JMH A;  5IWA T;  2B76 A;  2H3R A;  5AQU B;  3EDV A;  4OK0 A;  4FJO A;  4YTN A;  4TWD A;  2VL8 A;  4X66 T;  2X9W A;  2YOE A;  4ZXL A;  3WI3 A;  5AQV B;  2AXD S;  3AE6 A;  3FHN A;  3V5S A;  4AKH A;  5ADX L;  3C4Z A;  4QX8 B;  4X65 T;  2BBH A;  2WY2 A;  3OBV E;  2LOP A;  3PUY F;  3ZT5 A;  3H3M A;  2V5D A;  2MPK A;  2CBJ A;  2CA5 A;  5LNK A;  3SFD A;  3HA4 A;  1T8B A;  1E1H B;  4DR1 T;  3VU7 H;  2KXP B;  1H7C A;  4EZ4 A;  4CN6 A;  2ZM2 A;  3NBX X;  4QH1 A;  2J4G A;  3LBX B;  2IUB A;  2W63 A;  5LYJ E;  2FJE A;  2K5B B;  4U2Y A;  4JLE A;  3RLF F;  4WW0 A;  2ZMA A;  4NUV A;  4K0K T;  2LEH A;  3RRC A;  4MLK A;  5AQK B;  5J0Z A;  2W0G A;  3ONL C;  2MOZ A;  1J5E T;  5HXR A;  3F2E A;  4QH5 A;  3AE9 A;  3BQL A;  4YTM A;  4UV8 B;  3N9L A;  2QGS A;  3AA0 B;  3MZK B;  3ZMU B;  3ABV A;  4OHF A;  3UUL A;  1SHZ C;  3LG7 A;  3RGL A;  3ZMT B;  3FXE B;  2BKN A;  2LSJ A;  2D2S A;  2H7V C;  1KF6 A;  2ES0 A;  3AA1 B;  4IDN A;  5FNV E;  3UUM A;  4LF7 T;  3P4R A;  1KEY A;  4O4H E;  4KHZ F;  2OA5 A;  2V7K A;  3MKD A;  5FVL A;  3PUZ F;  2CLY B;  4BJM A;  3AEB A;  4I55 E;  3CKD A;  3GMI A;  2MTQ A;  1I6Z A;  3N9P A;  2LSI A;  1OED C;  4NIQ A;  3AA7 B;  1ZEE A;  4CN1 A;  2XQ4 A;  2BKP A;  2HH7 A;  2QYW A;  1HS7 A;  2L3L A;  2FJB A;  1W09 A;  3AVS A;  5LG3 A;  3Q5E A;  2XM1 A;  5HXE A;  5LB7 B;  2R6G F;  4XAX B;  5AQI B;  3PV0 F;  2BBJ A;  3A7M A;  1QSD A;  4ZI2 C;  4YSY A;  3RQU A;  3PUQ A;  1Z8U A;  3ONJ A;  4PAG A;  4HWC A;  4WNK A;  4ISS A;  3O1I A;  4DR7 T;  2PJQ A;  1HX1 B;  4O2A E;  3ZYM A;  3AXJ B;  3L8R A;  3Q5W A;  2W2U A;  3E22 E;  2XJ7 A;  2VK9 A;  2V26 A;  5H6Q B; 
#chains in the Genus database with same CATH homology
 1IBM T;  4YHH T;  4DUY T;  1IBK T;  5IWA T;  2ZM6 T;  5BR8 T;  4DV4 T;  4LFA T;  4KHP T;  4JI3 T;  5LMN T;  4DV7 T;  4OX9 T;  4LF7 T;  4DR6 T;  4X66 T;  4LF6 T;  4JI1 T;  1FJG T;  4LFC T;  1I94 T;  1N32 T;  4DV1 T;  4JI5 T;  4B3T T;  4DV6 T;  4DR2 T;  4DR5 T;  4DV5 T;  1XNR T;  4JI6 T;  4X62 T;  2VQE T;  4AQY T;  4DV2 T;  4NXM T;  5LMU T;  4X65 T;  4LF9 T;  4LF5 T;  3T1Y T;  4YY3 T;  4JI7 T;  2HHH T;  2UUA T;  1XMO T;  2UXC T;  4JI0 T;  4DR1 T;  1IBL T;  2F4V T;  4DV3 T;  4DR4 T;  3T1H T;  1N36 T;  4JI8 T;  4JI4 T;  2UU9 T;  1HNW T;  4B3R T;  4JV5 T;  1XNQ T;  2UUC T;  2VQF T;  4NXN T;  2UXD T;  4GKK T;  2UUB T;  4GKJ T;  1HNZ T;  4B3S T;  4B3M T;  4DR7 T;  4K0K T;  4DUZ T;  4JYA T;  1HR0 T;  4DR3 T;  1N34 T;  1HNX T;  1N33 T;  2E5L T;  4LF4 T;  1J5E T;  3OTO T;  4JI2 T;  4LFB T;  4DV0 T;  2UXB T;  4LF8 T;  1XMQ T;  4X64 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...