4DR3T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr3T00
4LF8T 4LFAT 4DR5T 4DV2T 4JI0T 4DR7T 4JI3T 2ZM6T 1HNWT 1FJGT 4B3ST 4GKJT 1N34T 2VQET 1IBMT 4K0KT 4YHHT 1XNQT 2UXCT 2UUBT 4B3RT 4DR2T 4DR6T 4DUZT 4DV6T 2F4VT 1HNXT 4KHPT 4JV5T 2VQFT 4LF6T 4NXMT 2UUAT 4LF5T 2E5LT 4NXNT 5IWAT 4LF4T 1I94T 5LMNT 1HNZT 4JI7T 4B3TT 2HHHT 4JI2T 4JI6T 2UXDT 4JYAT 3T1HT 4OX9T 4LFCT 4LFBT 5BR8T 2UUCT 4DV3T 4JI1T 5LMUT 3T1YT 4X62T 4X65T 4DV1T 1N36T 4JI4T 3OTOT 4JI5T 4GKKT 1N32T 1J5ET 4DR4T 1HR0T 4JI8T 2UXBT 4DV0T 1IBKT 4AQYT 4DV4T 4LF7T 4X66T 1N33T 4DV5T 1XNRT 4X64T 4DUYT 4YY3T 4DR3T 1IBLT 4DV7T 1XMOT 4B3MT 4DR1T 2UU9T 4LF9T 1XMQT
chains in the Genus database with same CATH superfamily
4ZI3C 2PFVA 3A7MA 1G8XA 2KMFA 1D0YA 2XPKA 5LGNB 2WAUA 3PUAA 1T72A 4ZS2A 2LSKA 1J5WA 4LMKA 4H9NC 4PK4A 2CEAA 2W63A 1ZV4X 4KHPT 2FUPA 4HFEA 3P7IA 3UQ7A 3GN5B 5HCMA 3CQCB 2E5LT 2WZIA 1S94A 2OV9A 2LLYA 4P0AA 2YDQA 2E9XD 2N2NA 4GYSA 4LMJA 3Q9DA 5AQKB 5FXXA 2BS3A 4PK5A 4JI2T 3B13A 2BG9E 4QX8B 2RPAA 2XZEA 3RH3A 4O4HE 3I0OA 2IMLA 4HFBA 2Q9QB 1R8IA 4JI5T 3F57A 4NUVA 4KMCA 2JMHA 4GK5E 2KT9A 2MAWA 5DQWA 1VCTA 4IE7A 4QXHB 1KNRA 2J4GA 1T7SA 4ZI3D 4X64T 3HI2A 3RRWA 1XMOT 3CIRA 3IBPA 2IIUA 4A97A 3I9YA 2WB5A 2IC6A 3UT5E 4AQFA 1YQ3A 2V6YB 3Q2MA 4IE5A 4GK0E 5JRCA 1YXRA 2LJLA 2YU1A 3EI0A 5JDFA 2W0GA 4YHHT 3NKZA 5LBMA 3ZCJA 4C90A 4O4IE 1IZNB 5JDHA 2DCFA 2L3LA 4I55E 3OPCA 5HAXA 5HEOA 4LF4T 2C0SA 3N2KE 3CK6A 3RRCA 3AEFA 5HWXA 2WS3A 4TWFA 3RLFF 1E1HB 3LJCA 4HGAA 3RX6A 2BG9C 1MMAA 2JQ9A 4CXWA 3B57A 3AA1B 5HEHA 1UURA 3PUQA 2V26A 5JQGE 2V7KA 2D9DA 3U78A 4U7IA 1FMWA 5CB4E 5HXEA 2EHOC 4NIQA 1DU2A 3N9QA 1M7KA 4CZZB 2OA5A 3LDQB 2H88A 1UCUA 2QRXA 5L47A 4LF8T 2C5KT 5LNKA 5AQJB 4EZHA 4X20E 4JI3T 2E9XB 3P50A 1KK7A 5FVKA 3ZKRA 2X51A 3VRBA 3PUZF 2ODVA 3PTRB 4ASKA 3N5LA 4EYYR 4UV9B 5IHYA 2X0HA 1IJ5A 3AA0B 2FJEA 5AQHB 4NXMT 3WAKA 1S35A 3TKLB 3M3ZB 2LM9A 5LMNT 4B3TT 1LVKA 4BAYB 2JQQA 3AEGA 4ANJA 1OEDE 3P4SA 3SS1A 2YN6A 5BR8T 5F5WA 2YDSA 2QYWA 5FNVE 3RQWA 3PUGA 3O1IA 4ZZBA 2XTLA 4X65T 3KV6A 2EHOD 2M6IA 3AA7B 3BK9A 5JR9B 4TV8E 3U3IA 4JLEA 5DABA 5CGMA 3C4WA 2IDOB 1MIVA 4JBWF 1IBKT 1Y01A 4HWCA 3VKGA 1V9DA 4LF7T 3ZC1A 5DJQC 4UVBB 2CXLA 2PJQA 2W67A 3JCFA 4WW0A 4XBFB 4TNVA 4HWDA 2GK9A 2W4XA 4CI1B 3ZJ2A 2M6BA 4B3ST 2YKSA 4E7ZA 3ANWB 5FXZA 2WU5A 3LBXB 2CCQA 3ZN1B 4OHFA 5LHHB 2CBIA 4HN9A 4QX7B 1HG2A 4I50E 1SHZC 2Q9QA 2V7MA 4G63A 2C5IT 2HN1A 3PJAJ 4YJ3E 2M67A 4PNIA 3HKDE 2NW9A 3PUYF 1MMDA 1HF8A 4MALA 2XAQB 4PJJA 4QXBB 4AKGA 3VR8A 4UIGA 3V5UA 4TN7B 1D1BA 2XQ8A 4TUYE 5M4YA 4CXXA 3ZLIA 2B1EA 4EEBA 3AECA 4PFOA 4JI1T 3X1DA 4CN6A 2RP4A 4QXCB 5LG4A 2V6YA 2R6GF 3TLWA 2LSJA 1XWMA 2LT3A 2CHNA 3WI3A 5AFUL 4DR4T 5LXTE 3R6NA 3MXZA 4DIDB 2YU2A 4DV4T 1QUUA 1WLXA 2IAKA 4EIWA 2LOPA 5AQOB 4UF0B 1MIWA 3EDUA 3N9OA 2CA5A 2FBWA 2XAJB 4AKLA 2J62A 5ABFB 3RF1A 1CHUA 4HWHA 4QH1A 1HTJF 2BG9B 4HTEA 3I1AA 3RIAA 2XQ5A 4DR2T 3DTOA 3UFGA 4LF6T 1UX4A 3L09A 1HX1B 3G06A 4ZI2C 2WWVA 2EHOB 4UVAB 3VU7H 1HNZT 2K48A 3VRAA 1FEWA 3ZMSB 1IJ6A 3RC3A 3AEAA 1CUNA 4IE0A 5FL1A 4DV3T 3KVBA 4IREA 3GA8A 3SFDA 5AQFB 4UXNB 4UVCB 4JUYA 2JJ9A 3FXDB 2FJAA 4PJNA 5HYAA 5JDMA 3OTOT 2XQYA 2LSGA 2WMNA 5KMGP 1D0ZA 2E9XC 3KV5A 2YINA 3PDYA 2RA1A 2ZM2A 2DWKA 3UUMA 4YY3T 3B5MA 4DR3T 2Z6EA 4LF9T 1XMQT 3NVOA 2IW5B 1ZOYA 3PE0A 4DNDA 2YK0A 2NW8A 2BBHA 2BZBA 4N78D 1U4QA 3H3MA 1FJGT 2VVSA 5FVLA 2H7OA 3P8CD 3CX8B 4DR6T 3AAAB 3KV4A 5JDQA 2BVMA 3ZSTA 1Y64B 4L5GA 3ONJA 3ZMUB 4JV5T 4U7YA 5LGUB 2WY2A 2W00A 2VK9A 4ILCA 5JR9A 1XDOA 3ONXA 2UUAT 4LF5T 2P9BA 4CXYA 3N9NA 2XQ4A 3MK7C 5IWAT 2V7LA 4NUUA 4U74A 5H6QB 2VKJA 5JR9C 4PFPA 1VRBA 2V6XA 1UK5A 2X9YA 3I0QA 5LJMA 1I6ZA 3JC6D 4IDOA 1KF6A 4LFBT 1H7CA 4UELA 3AE6A 1YW0A 3QC9A 2CPTA 4DVDA 3LK2B 4CI2B 2X9XA 5L3DB 4AKHA 3LFMA 3LBXA 1ZEEA 2CHOA 2YDRA 2MBGA 1SUMB 1J5ET 4ZS3A 3O9XA 3IF8B 3ETUA 3PUWF 3KFWX 3HKBE 4ZXLA 4EOZB 3E08A 2Y8DA 2YOEA 4DO0A 1QSDA 3IEEA 1J1JA 2DWGA 3GWHA 4IL9A 1WCRA 3N2GE 2PBIA 3CQGB 5J2TE 4IHJE 1VOMA 5KXJA 2DLRA 1NAFA 2N9DA 2ACZA 4XAXB 3CWZB 4HEAA 3RQUA 2ZM0A 3ZYLA 1W0BA 3AEBA 2NWBA 1HFAA 3PUVF 5JDGA 1T98A 1MMGA 4O8SA 2NP9A 4IT4A 3AAEB 4QKNA 2BKPA 4UF0A 5AQVB 3T1HT 2D0UA 3Q5EA 3UU5A 2OLTA 5ABFA 3C4XA 4GIWA 2CWOA 3UQ4A 2BG9A 4O2BE 3OJAA 3QUJA 1GQEA 2XM2A 2D2SA 3IA3A 3OVUA 2K3WA 4UR9A 2X68A 2W2UA 3AE4A 1E2AA 3RC8A 2LRLA 4AQYT 2ES0A 3UFEA 5HXHA 3D0TA 2XM1A 5HCJA 2I6HA 5LG3A 5LCYA 3FZLB 4L9IA 1ZHCA 4WNKA 2EHOA 2WDRA 3K3OA 4HWIB 5FY7A 4LFAT 1FMVA 4HFIA 2JPFA 3SOLA 3E22E 4DV2T 3QK6A 4U3CA 3C4ZA 3QNUA 2UXNB 5ABEA 4ADZA 1BR1A 3ZT7A 1UUSA 4ZI7E 4U2ZA 3O4XE 5ABHA 1US7B 4I43B 2FJBA 3RHWA 2ACXA 1UX5A 2LSIA 2CE7A 3NZPA 2YEVC 4AXPA 3VR9A 5ABGA 5KDMC 2XSBA 3FZMB 2XQAA 2DNXA 2BS2A 3OBVE 2VL8A 4OX9T 3UU6A 3ZMTB 3TLSA 2QA7A 3FXEB 3PU8A 4LMLA 5CFBA 3AXJA 3KVAA 3LK3B 2XY8B 5HEJA 3N9PA 1HR0T 2UXBT 5L3CB 3MZKB 1SA0E 4ILBA 3ZC0A 2ZMAA 4B3MT 2UU9T 3S4UA 5ETWA 2NR4A 4WYVA 4EXTA 5AQLB 4H9OC 5AQRB 3LSVA 5L3BB 2E2AA 3GN5A 4OK0A 3AVRA 1LKXA 3EHZA 3HA4A 3ZYKA 4HFVA 4Z91A 2VKDA 4IL4A 4I4TE 5L2LA 3FBZA 3ZMZB 3L39A 5AQIB 3AA6B 3SWHA 3CX7B 2VKHA 5J2UE 2WMOA 3J9X1 2N1GA 3LK42 2UXDT 3KBTA 4H9RC 3UUBA 3GMIA 3K3NA 3T1YT 5FXWA 5FMNA 2IC9A 3RYFE 2I0MA 2DHRA 5HXSA 4U72A 3J7Yq 3C50A 4GKKT 1N32T 5L3GB 3R84B 4JEUB 3NBXX 1OEDC 4O4JE 2KLQA 3A8YC 3MACA 1N33T 3M65A 1EZ3A 2XAGB 5C3JA 2L9QA 2H3RA 2NOXA 4ZOLE 3AE9A 4IDZA 5L3FB 2HN2A 4WBNE 2JMKA 5J0ZA 1FIOA 4AIUA 1Z0PA 5IUXA 1Z8UA 3MJXA 3UUXB 3UULA 3N2OA 3UUNA 4HE8A 4TZ4C 3RIUC 3OYXA 2UXCT 2UUBT 5DQVA 4B3RT 2LSYA 4DUZT 2WSSV 2KWHA 1MNDA 5F8PA 5JRCB 4GYRA 1HX8A 2A9UA 2BVLA 4ZZCA 3ZT5A 4Z8XA 3VKHA 3P4PA 2BS4A 3AEDA 2XHEB 5AQTB 2B76A 4U2YA 4QH5A 5LGTB 5LHIB 4JYAT 5FY1A 4EGWA 3T8OA 4WZXA 1T8BA 2LKHA 2NTXA 1WFDA 1NWMX 4KX6A 2AE9A 3CVRA 5HWYA 2V5DA 2XUEA 2LKGA 3ESLA 4A56A 2LM2A 2DL1A 4JI8T 5EZYE 4YSYA 5CA1E 4NPPA 4L0RA 4O2AE 2ODUA 4J2CA 2E9XA 4HFHA 1IAPA 3JC6C 3OYZA 2XAFB 3P4WA 4G2AA 3ZSSA 5AQQB 3CMLA 3KINB 5LA6E 4A98A 4PJLA 3AB3B 1XZYA 4TV9E 4DR5T 1LVFA 4AI6A 4H63H 4GKJT 3C51A 1N34T 3EAMA 1IBMT 2V1DB 4F8HA 2X67A 5LHGB 3P4QA 1NEKA 2ZLYA 1WYBA 3AE8A 4H63V 3RGLA 3UU4A 1O3XA 2WDQA 2XQ7A 1W9RA 2WBLA 2LHNA 3AE3A 1U5PA 3H37A 4P0BA 5AQGB 5AQNB 2K24A 1MMNA 2VKOA 3E0ZA 3QB5K 4KUMB 4HFCA 4AKIA 4WBOA 2E8IA 4MHCA 1WYCA 3PUSA 1JNRA 4ZHQE 3JAEA 3L3PA 1KNPA 2CBJA 3VHLA 2XJ7A 2DI4A 2MTQA 4IDNA 1MIYA 4FJOA 4AKRB 1YQ4A 2H89A 1VCSA 2LRKA 3ONLC 3F31A 2BKOA 3FZFB 3ANWA 2JQKA 2V7JA 4JI0T 2PTFA 3C98B 2LHRA 3PU3A 3F2EA 5EK3A 2CM0A 3HKCE 4IGUA 4PAGA 1L0VA 5FL0A 5C8YE 3HKEE 3CX6B 1KFYA 2LOSA 2XAHB 3KDSE 2F4VT 4QWNB 5JH7E 3AVSA 2LEHA 2CWYA 4H9PC 3OKQA 2K9AA 4IE4A 3UU8A 1HG5A 4YTMA 1OEDB 4ISSA 3NZQA 5A1LA 3QB5A 4UEMA 1B7TA 3K3QC 3EDVA 4JI7T 2BBJA 2K5BB 4CQIA 4BJNA 2WCAA 5AQUB 2KWIB 4KI0F 2WM9A 4OYKA 2A3DA 3SRZA 3SFEA 2X9HA 2KZ7B 1KEYA 2KXPB 3I9WA 4ILAA 2AXDS 1N36T 1YKHB 4YHJA 1QLBA 4IDQA 4TNWA 5LOVE 2CMRA 5FKYA 4TX5A 4EZ4A 5LBQB 1D0XA 3L8RA 4IDPA 4DBRA 4ILUA 3ZCIA 4AQFC 4DV7T 1M62A 5LYJE 5JTGA 1UGOA 1WRDA 3ZEFB 2X66A 4X1IE 5CA0E 3NRYA 3CQXC 4V1Av 1W0AA 4DR7T 3MKDA 5AQPB 2WZHA 5C2TA 2KINB 2PG8A 4YJ2E 1KNZA 1NENA 4DV6T 2I59A 2D0TA 4U33A 3Q5XA 3PV0F 4PK6A 3ZJ1A 1WR0A 3RIFA 5GONE 4U31A 3JAFA 4EYUA 2JIWA 3HR0A 3TLVA 3KBUA 2QVAA 1I94T 4HWFA 3W15B 2ZM8A 4BA9A 2IHR1 4XZCA 5L3EB 3TLUA 4P1NA 3FZHB 5FYMA 2XQ9A 4IIJE 4TWDA 4YXDA 4BJMA 4FI5A 1JNZA 2A72A 2VL0A 5AQSB 4EEDA 4C91A 3CKDA 3HL6A 5LJNA 1OXZA 4X1KE 3C64A 4KP3C 1XNRT 1WR6A 1BR0A 2MPKA 5L4HA 4YLHA 2FJDA 1XDPA 3O1HA 3TLTA 1OWAA 4GOUA 2LE8A 5CJ5A 2L8KA 5F3JA 3EVYA 4KBMB 2WU2A 1BR4A 3RKOA 3AE2A 2KSRA 5L4EA 4ERRA 1X9BA 1HNXT 5JVDE 2JRKA 3UTKA 2HH7A 3FHNA 4QHOA 3NRXA 4B6XA 2CLYC 4NXNT 2J1DG 4O4LE 3DJBA 4F6RC 5KX5E 4Q25A 3ZN0B 3QOFA 4YT0A 2HHHT 1G73A 3BQKA 5IYZE 4LFCT 4H9QC 2BKNA 2W66A 2UUCT 3DP7A 1LRZA 3MA9A 4TWHA 3PUXF 1YD8G 2XQ3A 2HPJA 5AQMB 2VWAA 5EK4A 4PJMA 2VASA 4DV1T 3AE1A 3LG7A 1MNEA 4YFSA 1YKEB 3Q5WA 2E5VA 4MBQA 3KV9A 4YSZA 4DV0T 4Z90A 4DV5T 2BDEA 3IHRA 2JQHA 1AJ3A 3BQLA 2XASB 2V8SV 1OEDA 1E7PA 4OYJA 4EV6A 2Y6XA 4JEHB 5FXVA 3RI5A 3FZKB 2ZM6T 1HNWT 4KHZF 3UU3A 3H3AA 3FBLA 3WAJA 4DMVA 3N9MA 2VQET 2VURA 2Q9QC 2WWUA 5JDLA 2G0UA 2VQFT 3RIUA 4YTNA 4CN4A 3ZT6A 1HCIA 2UXXB 4EAHA 2X0LB 1ZP0A 2WP9A 2SPCA 2QGSA 2X0YA 2VB6A 4CN1A 3AE5A 4JI6T 5JDNA 1W09A 2NW7A 3NWIA 1ZKEA 5JREA 1BR2A 4AISA 2WDVA 3RPUA 5LMUT 1HS7A 3FB2A 4X62T 4EB6E 3K1SA 4DBQA 3AE7A 2NTYA 2CXFA 4IE6A 3ABVA 4DUYT 4X5TA 3V5SA 3K8PC 4E7SA 2H7VC 5TAOA 5J1GA 3PJAA 4DMWA 2Q9QD 3CPZA 4A5XA 4COFA 4AQGA 2IUBA 2C5JA 1D1AA 2D5UA 5E0OA 5LB7B 3ETVA 4K0KT 1XNQT 2W62A 2CXDA 4HFDA 2VVNA 5EK2A 3JADA 5BMVE 5FP3A 2V7IA 3P4RA 5FY0A 2A2FX 2HPLA 3N9LA 3AEEA 4HKAA 5HXRA 4H9SE 2KNDA 4YSXA 4MLKA 2W61A 4YTPA 5HXCA 3A5XA 4ZEYA 4PW8A 3ZPOA 3BQIA 4X1YE 3RYHE 4UV8B 3Q5DA 4QH4A 3AAIA 2XQ6A 5LP6E 3O1JA 3RYCE 5HEUA 5ADXL 4JI4T 2X9WA 4MFRA 1SE7A 2J47A 3ZMVB 2V5CA 4K0UA 1D1CA 4CI3B 3RYIE 2Y48B 3PURA 4OFZA 3AXJB 2WQYA 2XSAA 4X66T 2MYSA 5HEGA 1X79A 2CLYB 4M1PA 3ZYMA 4ISTA 2MOZA 1IBLT 3EUHA 3EABA 3RKGA 4ZI2D 5H6RB 2CRBA 4P09A 4DR1T 4I0UA
chains in the Genus database with same CATH topology
4LF8T 4LFAT 4DR5T 4DV2T 4JI0T 4DR7T 4JI3T 2ZM6T 1HNWT 1FJGT 4B3ST 4GKJT 1N34T 2VQET 1IBMT 4K0KT 4YHHT 1XNQT 2UXCT 2UUBT 4B3RT 4DR2T 4DR6T 4DUZT 4DV6T 2F4VT 1HNXT 4KHPT 4JV5T 2VQFT 4LF6T 4NXMT 2UUAT 4LF5T 2E5LT 4NXNT 5IWAT 4LF4T 1I94T 5LMNT 1HNZT 4JI7T 4B3TT 2HHHT 4JI2T 4JI6T 2UXDT 4JYAT 3T1HT 4OX9T 4LFCT 4LFBT 5BR8T 2UUCT 4DV3T 4JI1T 5LMUT 3T1YT 4X62T 4X65T 4DV1T 1N36T 4JI4T 3OTOT 4JI5T 4GKKT 1N32T 1J5ET 4DR4T 1HR0T 4JI8T 2UXBT 4DV0T 1IBKT 4AQYT 4DV4T 4LF7T 4X66T 1N33T 4DV5T 1XNRT 4X64T 4DUYT 4YY3T 4DR3T 1IBLT 4DV7T 1XMOT 4B3MT 4DR1T 2UU9T 4LF9T 1XMQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 T;  4LFA T;  4DR5 T;  4DV2 T;  4JI0 T;  4DR7 T;  4JI3 T;  2ZM6 T;  1HNW T;  1FJG T;  4B3S T;  4GKJ T;  1N34 T;  2VQE T;  1IBM T;  4K0K T;  4YHH T;  1XNQ T;  2UXC T;  2UUB T;  4B3R T;  4DR2 T;  4DR6 T;  4DUZ T;  4DV6 T;  2F4V T;  1HNX T;  4KHP T;  4JV5 T;  2VQF T;  4LF6 T;  4NXM T;  2UUA T;  4LF5 T;  2E5L T;  4NXN T;  5IWA T;  4LF4 T;  1I94 T;  5LMN T;  1HNZ T;  4JI7 T;  4B3T T;  2HHH T;  4JI2 T;  4JI6 T;  2UXD T;  4JYA T;  3T1H T;  4OX9 T;  4LFC T;  4LFB T;  5BR8 T;  2UUC T;  4DV3 T;  4JI1 T;  5LMU T;  3T1Y T;  4X62 T;  4X65 T;  4DV1 T;  1N36 T;  4JI4 T;  3OTO T;  4JI5 T;  4GKK T;  1N32 T;  1J5E T;  4DR4 T;  1HR0 T;  4JI8 T;  2UXB T;  4DV0 T;  1IBK T;  4AQY T;  4DV4 T;  4LF7 T;  4X66 T;  1N33 T;  4DV5 T;  1XNR T;  4X64 T;  4DUY T;  4YY3 T;  4DR3 T;  1IBL T;  4DV7 T;  1XMO T;  4B3M T;  4DR1 T;  2UU9 T;  4LF9 T;  1XMQ T; 
#chains in the Genus database with same CATH topology
 4ZI3 C;  2PFV A;  3A7M A;  1G8X A;  2KMF A;  1D0Y A;  2XPK A;  5LGN B;  2WAU A;  3PUA A;  1T72 A;  4ZS2 A;  2LSK A;  1J5W A;  4LMK A;  4H9N C;  4PK4 A;  2CEA A;  2W63 A;  1ZV4 X;  4KHP T;  2FUP A;  4HFE A;  3P7I A;  3UQ7 A;  3GN5 B;  5HCM A;  3CQC B;  2E5L T;  2WZI A;  1S94 A;  2OV9 A;  2LLY A;  4P0A A;  2YDQ A;  2E9X D;  2N2N A;  4GYS A;  4LMJ A;  3Q9D A;  5AQK B;  5FXX A;  2BS3 A;  4PK5 A;  4JI2 T;  3B13 A;  2BG9 E;  4QX8 B;  2RPA A;  2XZE A;  3RH3 A;  4O4H E;  3I0O A;  2IML A;  4HFB A;  2Q9Q B;  1R8I A;  4JI5 T;  3F57 A;  4NUV A;  4KMC A;  2JMH A;  4GK5 E;  2KT9 A;  2MAW A;  5DQW A;  1VCT A;  4IE7 A;  4QXH B;  1KNR A;  2J4G A;  1T7S A;  4ZI3 D;  4X64 T;  3HI2 A;  3RRW A;  1XMO T;  3CIR A;  3IBP A;  2IIU A;  4A97 A;  3I9Y A;  2WB5 A;  2IC6 A;  3UT5 E;  4AQF A;  1YQ3 A;  2V6Y B;  3Q2M A;  4IE5 A;  4GK0 E;  5JRC A;  1YXR A;  2LJL A;  2YU1 A;  3EI0 A;  5JDF A;  2W0G A;  4YHH T;  3NKZ A;  5LBM A;  3ZCJ A;  4C90 A;  4O4I E;  1IZN B;  5JDH A;  2DCF A;  2L3L A;  4I55 E;  3OPC A;  5HAX A;  5HEO A;  4LF4 T;  2C0S A;  3N2K E;  3CK6 A;  3RRC A;  3AEF A;  5HWX A;  2WS3 A;  4TWF A;  3RLF F;  1E1H B;  3LJC A;  4HGA A;  3RX6 A;  2BG9 C;  1MMA A;  2JQ9 A;  4CXW A;  3B57 A;  3AA1 B;  5HEH A;  1UUR A;  3PUQ A;  2V26 A;  5JQG E;  2V7K A;  2D9D A;  3U78 A;  4U7I A;  1FMW A;  5CB4 E;  5HXE A;  2EHO C;  4NIQ A;  1DU2 A;  3N9Q A;  1M7K A;  4CZZ B;  2OA5 A;  3LDQ B;  2H88 A;  1UCU A;  2QRX A;  5L47 A;  4LF8 T;  2C5K T;  5LNK A;  5AQJ B;  4EZH A;  4X20 E;  4JI3 T;  2E9X B;  3P50 A;  1KK7 A;  5FVK A;  3ZKR A;  2X51 A;  3VRB A;  3PUZ F;  2ODV A;  3PTR B;  4ASK A;  3N5L A;  4EYY R;  4UV9 B;  5IHY A;  2X0H A;  1IJ5 A;  3AA0 B;  2FJE A;  5AQH B;  4NXM T;  3WAK A;  1S35 A;  3TKL B;  3M3Z B;  2LM9 A;  5LMN T;  4B3T T;  1LVK A;  4BAY B;  2JQQ A;  3AEG A;  4ANJ A;  1OED E;  3P4S A;  3SS1 A;  2YN6 A;  5BR8 T;  5F5W A;  2YDS A;  2QYW A;  5FNV E;  3RQW A;  3PUG A;  3O1I A;  4ZZB A;  2XTL A;  4X65 T;  3KV6 A;  2EHO D;  2M6I A;  3AA7 B;  3BK9 A;  5JR9 B;  4TV8 E;  3U3I A;  4JLE A;  5DAB A;  5CGM A;  3C4W A;  2IDO B;  1MIV A;  4JBW F;  1IBK T;  1Y01 A;  4HWC A;  3VKG A;  1V9D A;  4LF7 T;  3ZC1 A;  5DJQ C;  4UVB B;  2CXL A;  2PJQ A;  2W67 A;  3JCF A;  4WW0 A;  4XBF B;  4TNV A;  4HWD A;  2GK9 A;  2W4X A;  4CI1 B;  3ZJ2 A;  2M6B A;  4B3S T;  2YKS A;  4E7Z A;  3ANW B;  5FXZ A;  2WU5 A;  3LBX B;  2CCQ A;  3ZN1 B;  4OHF A;  5LHH B;  2CBI A;  4HN9 A;  4QX7 B;  1HG2 A;  4I50 E;  1SHZ C;  2Q9Q A;  2V7M A;  4G63 A;  2C5I T;  2HN1 A;  3PJA J;  4YJ3 E;  2M67 A;  4PNI A;  3HKD E;  2NW9 A;  3PUY F;  1MMD A;  1HF8 A;  4MAL A;  2XAQ B;  4PJJ A;  4QXB B;  4AKG A;  3VR8 A;  4UIG A;  3V5U A;  4TN7 B;  1D1B A;  2XQ8 A;  4TUY E;  5M4Y A;  4CXX A;  3ZLI A;  2B1E A;  4EEB A;  3AEC A;  4PFO A;  4JI1 T;  3X1D A;  4CN6 A;  2RP4 A;  4QXC B;  5LG4 A;  2V6Y A;  2R6G F;  3TLW A;  2LSJ A;  1XWM A;  2LT3 A;  2CHN A;  3WI3 A;  5AFU L;  4DR4 T;  5LXT E;  3R6N A;  3MXZ A;  4DID B;  2YU2 A;  4DV4 T;  1QUU A;  1WLX A;  2IAK A;  4EIW A;  2LOP A;  5AQO B;  4UF0 B;  1MIW A;  3EDU A;  3N9O A;  2CA5 A;  2FBW A;  2XAJ B;  4AKL A;  2J62 A;  5ABF B;  3RF1 A;  1CHU A;  4HWH A;  4QH1 A;  1HTJ F;  2BG9 B;  4HTE A;  3I1A A;  3RIA A;  2XQ5 A;  4DR2 T;  3DTO A;  3UFG A;  4LF6 T;  1UX4 A;  3L09 A;  1HX1 B;  3G06 A;  4ZI2 C;  2WWV A;  2EHO B;  4UVA B;  3VU7 H;  1HNZ T;  2K48 A;  3VRA A;  1FEW A;  3ZMS B;  1IJ6 A;  3RC3 A;  3AEA A;  1CUN A;  4IE0 A;  5FL1 A;  4DV3 T;  3KVB A;  4IRE A;  3GA8 A;  3SFD A;  5AQF B;  4UXN B;  4UVC B;  4JUY A;  2JJ9 A;  3FXD B;  2FJA A;  4PJN A;  5HYA A;  5JDM A;  3OTO T;  2XQY A;  2LSG A;  2WMN A;  5KMG P;  1D0Z A;  2E9X C;  3KV5 A;  2YIN A;  3PDY A;  2RA1 A;  2ZM2 A;  2DWK A;  3UUM A;  4YY3 T;  3B5M A;  4DR3 T;  2Z6E A;  4LF9 T;  1XMQ T;  3NVO A;  2IW5 B;  1ZOY A;  3PE0 A;  4DND A;  2YK0 A;  2NW8 A;  2BBH A;  2BZB A;  4N78 D;  1U4Q A;  3H3M A;  1FJG T;  2VVS A;  5FVL A;  2H7O A;  3P8C D;  3CX8 B;  4DR6 T;  3AAA B;  3KV4 A;  5JDQ A;  2BVM A;  3ZST A;  1Y64 B;  4L5G A;  3ONJ A;  3ZMU B;  4JV5 T;  4U7Y A;  5LGU B;  2WY2 A;  2W00 A;  2VK9 A;  4ILC A;  5JR9 A;  1XDO A;  3ONX A;  2UUA T;  4LF5 T;  2P9B A;  4CXY A;  3N9N A;  2XQ4 A;  3MK7 C;  5IWA T;  2V7L A;  4NUU A;  4U74 A;  5H6Q B;  2VKJ A;  5JR9 C;  4PFP A;  1VRB A;  2V6X A;  1UK5 A;  2X9Y A;  3I0Q A;  5LJM A;  1I6Z A;  3JC6 D;  4IDO A;  1KF6 A;  4LFB T;  1H7C A;  4UEL A;  3AE6 A;  1YW0 A;  3QC9 A;  2CPT A;  4DVD A;  3LK2 B;  4CI2 B;  2X9X A;  5L3D B;  4AKH A;  3LFM A;  3LBX A;  1ZEE A;  2CHO A;  2YDR A;  2MBG A;  1SUM B;  1J5E T;  4ZS3 A;  3O9X A;  3IF8 B;  3ETU A;  3PUW F;  3KFW X;  3HKB E;  4ZXL A;  4EOZ B;  3E08 A;  2Y8D A;  2YOE A;  4DO0 A;  1QSD A;  3IEE A;  1J1J A;  2DWG A;  3GWH A;  4IL9 A;  1WCR A;  3N2G E;  2PBI A;  3CQG B;  5J2T E;  4IHJ E;  1VOM A;  5KXJ A;  2DLR A;  1NAF A;  2N9D A;  2ACZ A;  4XAX B;  3CWZ B;  4HEA A;  3RQU A;  2ZM0 A;  3ZYL A;  1W0B A;  3AEB A;  2NWB A;  1HFA A;  3PUV F;  5JDG A;  1T98 A;  1MMG A;  4O8S A;  2NP9 A;  4IT4 A;  3AAE B;  4QKN A;  2BKP A;  4UF0 A;  5AQV B;  3T1H T;  2D0U A;  3Q5E A;  3UU5 A;  2OLT A;  5ABF A;  3C4X A;  4GIW A;  2CWO A;  3UQ4 A;  2BG9 A;  4O2B E;  3OJA A;  3QUJ A;  1GQE A;  2XM2 A;  2D2S A;  3IA3 A;  3OVU A;  2K3W A;  4UR9 A;  2X68 A;  2W2U A;  3AE4 A;  1E2A A;  3RC8 A;  2LRL A;  4AQY T;  2ES0 A;  3UFE A;  5HXH A;  3D0T A;  2XM1 A;  5HCJ A;  2I6H A;  5LG3 A;  5LCY A;  3FZL B;  4L9I A;  1ZHC A;  4WNK A;  2EHO A;  2WDR A;  3K3O A;  4HWI B;  5FY7 A;  4LFA T;  1FMV A;  4HFI A;  2JPF A;  3SOL A;  3E22 E;  4DV2 T;  3QK6 A;  4U3C A;  3C4Z A;  3QNU A;  2UXN B;  5ABE A;  4ADZ A;  1BR1 A;  3ZT7 A;  1UUS A;  4ZI7 E;  4U2Z A;  3O4X E;  5ABH A;  1US7 B;  4I43 B;  2FJB A;  3RHW A;  2ACX A;  1UX5 A;  2LSI A;  2CE7 A;  3NZP A;  2YEV C;  4AXP A;  3VR9 A;  5ABG A;  5KDM C;  2XSB A;  3FZM B;  2XQA A;  2DNX A;  2BS2 A;  3OBV E;  2VL8 A;  4OX9 T;  3UU6 A;  3ZMT B;  3TLS A;  2QA7 A;  3FXE B;  3PU8 A;  4LML A;  5CFB A;  3AXJ A;  3KVA A;  3LK3 B;  2XY8 B;  5HEJ A;  3N9P A;  1HR0 T;  2UXB T;  5L3C B;  3MZK B;  1SA0 E;  4ILB A;  3ZC0 A;  2ZMA A;  4B3M T;  2UU9 T;  3S4U A;  5ETW A;  2NR4 A;  4WYV A;  4EXT A;  5AQL B;  4H9O C;  5AQR B;  3LSV A;  5L3B B;  2E2A A;  3GN5 A;  4OK0 A;  3AVR A;  1LKX A;  3EHZ A;  3HA4 A;  3ZYK A;  4HFV A;  4Z91 A;  2VKD A;  4IL4 A;  4I4T E;  5L2L A;  3FBZ A;  3ZMZ B;  3L39 A;  5AQI B;  3AA6 B;  3SWH A;  3CX7 B;  2VKH A;  5J2U E;  2WMO A;  3J9X 1;  2N1G A;  3LK4 2;  2UXD T;  3KBT A;  4H9R C;  3UUB A;  3GMI A;  3K3N A;  3T1Y T;  5FXW A;  5FMN A;  2IC9 A;  3RYF E;  2I0M A;  2DHR A;  5HXS A;  4U72 A;  3J7Y q;  3C50 A;  4GKK T;  1N32 T;  5L3G B;  3R84 B;  4JEU B;  3NBX X;  1OED C;  4O4J E;  2KLQ A;  3A8Y C;  3MAC A;  1N33 T;  3M65 A;  1EZ3 A;  2XAG B;  5C3J A;  2L9Q A;  2H3R A;  2NOX A;  4ZOL E;  3AE9 A;  4IDZ A;  5L3F B;  2HN2 A;  4WBN E;  2JMK A;  5J0Z A;  1FIO A;  4AIU A;  1Z0P A;  5IUX A;  1Z8U A;  3MJX A;  3UUX B;  3UUL A;  3N2O A;  3UUN A;  4HE8 A;  4TZ4 C;  3RIU C;  3OYX A;  2UXC T;  2UUB T;  5DQV A;  4B3R T;  2LSY A;  4DUZ T;  2WSS V;  2KWH A;  1MND A;  5F8P A;  5JRC B;  4GYR A;  1HX8 A;  2A9U A;  2BVL A;  4ZZC A;  3ZT5 A;  4Z8X A;  3VKH A;  3P4P A;  2BS4 A;  3AED A;  2XHE B;  5AQT B;  2B76 A;  4U2Y A;  4QH5 A;  5LGT B;  5LHI B;  4JYA T;  5FY1 A;  4EGW A;  3T8O A;  4WZX A;  1T8B A;  2LKH A;  2NTX A;  1WFD A;  1NWM X;  4KX6 A;  2AE9 A;  3CVR A;  5HWY A;  2V5D A;  2XUE A;  2LKG A;  3ESL A;  4A56 A;  2LM2 A;  2DL1 A;  4JI8 T;  5EZY E;  4YSY A;  5CA1 E;  4NPP A;  4L0R A;  4O2A E;  2ODU A;  4J2C A;  2E9X A;  4HFH A;  1IAP A;  3JC6 C;  3OYZ A;  2XAF B;  3P4W A;  4G2A A;  3ZSS A;  5AQQ B;  3CML A;  3KIN B;  5LA6 E;  4A98 A;  4PJL A;  3AB3 B;  1XZY A;  4TV9 E;  4DR5 T;  1LVF A;  4AI6 A;  4H63 H;  4GKJ T;  3C51 A;  1N34 T;  3EAM A;  1IBM T;  2V1D B;  4F8H A;  2X67 A;  5LHG B;  3P4Q A;  1NEK A;  2ZLY A;  1WYB A;  3AE8 A;  4H63 V;  3RGL A;  3UU4 A;  1O3X A;  2WDQ A;  2XQ7 A;  1W9R A;  2WBL A;  2LHN A;  3AE3 A;  1U5P A;  3H37 A;  4P0B A;  5AQG B;  5AQN B;  2K24 A;  1MMN A;  2VKO A;  3E0Z A;  3QB5 K;  4KUM B;  4HFC A;  4AKI A;  4WBO A;  2E8I A;  4MHC A;  1WYC A;  3PUS A;  1JNR A;  4ZHQ E;  3JAE A;  3L3P A;  1KNP A;  2CBJ A;  3VHL A;  2XJ7 A;  2DI4 A;  2MTQ A;  4IDN A;  1MIY A;  4FJO A;  4AKR B;  1YQ4 A;  2H89 A;  1VCS A;  2LRK A;  3ONL C;  3F31 A;  2BKO A;  3FZF B;  3ANW A;  2JQK A;  2V7J A;  4JI0 T;  2PTF A;  3C98 B;  2LHR A;  3PU3 A;  3F2E A;  5EK3 A;  2CM0 A;  3HKC E;  4IGU A;  4PAG A;  1L0V A;  5FL0 A;  5C8Y E;  3HKE E;  3CX6 B;  1KFY A;  2LOS A;  2XAH B;  3KDS E;  2F4V T;  4QWN B;  5JH7 E;  3AVS A;  2LEH A;  2CWY A;  4H9P C;  3OKQ A;  2K9A A;  4IE4 A;  3UU8 A;  1HG5 A;  4YTM A;  1OED B;  4ISS A;  3NZQ A;  5A1L A;  3QB5 A;  4UEM A;  1B7T A;  3K3Q C;  3EDV A;  4JI7 T;  2BBJ A;  2K5B B;  4CQI A;  4BJN A;  2WCA A;  5AQU B;  2KWI B;  4KI0 F;  2WM9 A;  4OYK A;  2A3D A;  3SRZ A;  3SFE A;  2X9H A;  2KZ7 B;  1KEY A;  2KXP B;  3I9W A;  4ILA A;  2AXD S;  1N36 T;  1YKH B;  4YHJ A;  1QLB A;  4IDQ A;  4TNW A;  5LOV E;  2CMR A;  5FKY A;  4TX5 A;  4EZ4 A;  5LBQ B;  1D0X A;  3L8R A;  4IDP A;  4DBR A;  4ILU A;  3ZCI A;  4AQF C;  4DV7 T;  1M62 A;  5LYJ E;  5JTG A;  1UGO A;  1WRD A;  3ZEF B;  2X66 A;  4X1I E;  5CA0 E;  3NRY A;  3CQX C;  4V1A v;  1W0A A;  4DR7 T;  3MKD A;  5AQP B;  2WZH A;  5C2T A;  2KIN B;  2PG8 A;  4YJ2 E;  1KNZ A;  1NEN A;  4DV6 T;  2I59 A;  2D0T A;  4U33 A;  3Q5X A;  3PV0 F;  4PK6 A;  3ZJ1 A;  1WR0 A;  3RIF A;  5GON E;  4U31 A;  3JAF A;  4EYU A;  2JIW A;  3HR0 A;  3TLV A;  3KBU A;  2QVA A;  1I94 T;  4HWF A;  3W15 B;  2ZM8 A;  4BA9 A;  2IHR 1;  4XZC A;  5L3E B;  3TLU A;  4P1N A;  3FZH B;  5FYM A;  2XQ9 A;  4IIJ E;  4TWD A;  4YXD A;  4BJM A;  4FI5 A;  1JNZ A;  2A72 A;  2VL0 A;  5AQS B;  4EED A;  4C91 A;  3CKD A;  3HL6 A;  5LJN A;  1OXZ A;  4X1K E;  3C64 A;  4KP3 C;  1XNR T;  1WR6 A;  1BR0 A;  2MPK A;  5L4H A;  4YLH A;  2FJD A;  1XDP A;  3O1H A;  3TLT A;  1OWA A;  4GOU A;  2LE8 A;  5CJ5 A;  2L8K A;  5F3J A;  3EVY A;  4KBM B;  2WU2 A;  1BR4 A;  3RKO A;  3AE2 A;  2KSR A;  5L4E A;  4ERR A;  1X9B A;  1HNX T;  5JVD E;  2JRK A;  3UTK A;  2HH7 A;  3FHN A;  4QHO A;  3NRX A;  4B6X A;  2CLY C;  4NXN T;  2J1D G;  4O4L E;  3DJB A;  4F6R C;  5KX5 E;  4Q25 A;  3ZN0 B;  3QOF A;  4YT0 A;  2HHH T;  1G73 A;  3BQK A;  5IYZ E;  4LFC T;  4H9Q C;  2BKN A;  2W66 A;  2UUC T;  3DP7 A;  1LRZ A;  3MA9 A;  4TWH A;  3PUX F;  1YD8 G;  2XQ3 A;  2HPJ A;  5AQM B;  2VWA A;  5EK4 A;  4PJM A;  2VAS A;  4DV1 T;  3AE1 A;  3LG7 A;  1MNE A;  4YFS A;  1YKE B;  3Q5W A;  2E5V A;  4MBQ A;  3KV9 A;  4YSZ A;  4DV0 T;  4Z90 A;  4DV5 T;  2BDE A;  3IHR A;  2JQH A;  1AJ3 A;  3BQL A;  2XAS B;  2V8S V;  1OED A;  1E7P A;  4OYJ A;  4EV6 A;  2Y6X A;  4JEH B;  5FXV A;  3RI5 A;  3FZK B;  2ZM6 T;  1HNW T;  4KHZ F;  3UU3 A;  3H3A A;  3FBL A;  3WAJ A;  4DMV A;  3N9M A;  2VQE T;  2VUR A;  2Q9Q C;  2WWU A;  5JDL A;  2G0U A;  2VQF T;  3RIU A;  4YTN A;  4CN4 A;  3ZT6 A;  1HCI A;  2UXX B;  4EAH A;  2X0L B;  1ZP0 A;  2WP9 A;  2SPC A;  2QGS A;  2X0Y A;  2VB6 A;  4CN1 A;  3AE5 A;  4JI6 T;  5JDN A;  1W09 A;  2NW7 A;  3NWI A;  1ZKE A;  5JRE A;  1BR2 A;  4AIS A;  2WDV A;  3RPU A;  5LMU T;  1HS7 A;  3FB2 A;  4X62 T;  4EB6 E;  3K1S A;  4DBQ A;  3AE7 A;  2NTY A;  2CXF A;  4IE6 A;  3ABV A;  4DUY T;  4X5T A;  3V5S A;  3K8P C;  4E7S A;  2H7V C;  5TAO A;  5J1G A;  3PJA A;  4DMW A;  2Q9Q D;  3CPZ A;  4A5X A;  4COF A;  4AQG A;  2IUB A;  2C5J A;  1D1A A;  2D5U A;  5E0O A;  5LB7 B;  3ETV A;  4K0K T;  1XNQ T;  2W62 A;  2CXD A;  4HFD A;  2VVN A;  5EK2 A;  3JAD A;  5BMV E;  5FP3 A;  2V7I A;  3P4R A;  5FY0 A;  2A2F X;  2HPL A;  3N9L A;  3AEE A;  4HKA A;  5HXR A;  4H9S E;  2KND A;  4YSX A;  4MLK A;  2W61 A;  4YTP A;  5HXC A;  3A5X A;  4ZEY A;  4PW8 A;  3ZPO A;  3BQI A;  4X1Y E;  3RYH E;  4UV8 B;  3Q5D A;  4QH4 A;  3AAI A;  2XQ6 A;  5LP6 E;  3O1J A;  3RYC E;  5HEU A;  5ADX L;  4JI4 T;  2X9W A;  4MFR A;  1SE7 A;  2J47 A;  3ZMV B;  2V5C A;  4K0U A;  1D1C A;  4CI3 B;  3RYI E;  2Y48 B;  3PUR A;  4OFZ A;  3AXJ B;  2WQY A;  2XSA A;  4X66 T;  2MYS A;  5HEG A;  1X79 A;  2CLY B;  4M1P A;  3ZYM A;  4IST A;  2MOZ A;  1IBL T;  3EUH A;  3EAB A;  3RKG A;  4ZI2 D;  5H6R B;  2CRB A;  4P09 A;  4DR1 T;  4I0U A; 
#chains in the Genus database with same CATH homology
 4LF8 T;  4LFA T;  4DR5 T;  4DV2 T;  4JI0 T;  4DR7 T;  4JI3 T;  2ZM6 T;  1HNW T;  1FJG T;  4B3S T;  4GKJ T;  1N34 T;  2VQE T;  1IBM T;  4K0K T;  4YHH T;  1XNQ T;  2UXC T;  2UUB T;  4B3R T;  4DR2 T;  4DR6 T;  4DUZ T;  4DV6 T;  2F4V T;  1HNX T;  4KHP T;  4JV5 T;  2VQF T;  4LF6 T;  4NXM T;  2UUA T;  4LF5 T;  2E5L T;  4NXN T;  5IWA T;  4LF4 T;  1I94 T;  5LMN T;  1HNZ T;  4JI7 T;  4B3T T;  2HHH T;  4JI2 T;  4JI6 T;  2UXD T;  4JYA T;  3T1H T;  4OX9 T;  4LFC T;  4LFB T;  5BR8 T;  2UUC T;  4DV3 T;  4JI1 T;  5LMU T;  3T1Y T;  4X62 T;  4X65 T;  4DV1 T;  1N36 T;  4JI4 T;  3OTO T;  4JI5 T;  4GKK T;  1N32 T;  1J5E T;  4DR4 T;  1HR0 T;  4JI8 T;  2UXB T;  4DV0 T;  1IBK T;  4AQY T;  4DV4 T;  4LF7 T;  4X66 T;  1N33 T;  4DV5 T;  1XNR T;  4X64 T;  4DUY T;  4YY3 T;  4DR3 T;  1IBL T;  4DV7 T;  1XMO T;  4B3M T;  4DR1 T;  2UU9 T;  4LF9 T;  1XMQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...