4DR3T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr3T00
4JI8T 4DV7T 4YHHT 4LF7T 4LF4T 1IBKT 4DUZT 5BR8T 1I94T 4JYAT 1HR0T 4JI0T 4DV3T 4JI2T 1J5ET 1FJGT 4JV5T 2UUCT 1HNWT 4JI1T 4X65T 3T1YT 4GKKT 4DR5T 4LF5T 4LFAT 4NXNT 4X66T 2UUAT 4K0KT 2UXBT 1IBLT 4DR3T 4JI3T 3T1HT 4LF9T 4NXMT 4LFBT 2F4VT 1XNQT 2UU9T 1N33T 2E5LT 4DR2T 4DR4T 4KHPT 2HHHT 1XMOT 5LMNT 2UUBT 2UXDT 4DV0T 2UXCT 1N34T 4LF6T 1HNXT 4JI7T 4DR7T 4JI5T 3OTOT 4DV5T 1XMQT 4B3TT 4DR6T 2VQET 4JI4T 1HNZT 4DV6T 4AQYT 4DV4T 5IWAT 4DV2T 1N36T 1IBMT 4LFCT 4B3ST 4DR1T 4X64T 1XNRT 4JI6T 4B3MT 4DV1T 4B3RT 4GKJT 4OX9T 4LF8T 2ZM6T 4YY3T 1N32T 4DUYT 2VQFT 5LMUT 4X62T
chains in the Genus database with same CATH superfamily
4GOUA 3ETUA 3SOLA 1SHZC 4IE4A 5GONE 4F8HA 1W09A 5JREA 2A9UA 4X64T 4X5TA 4BJNA 4AKIA 5AQUB 1MIWA 3PDYA 3JADA 5F5WA 3PUZF 5LJMA 1D0XA 2NW8A 3C50A 3ONLC 5FY7A 2CLYC 4PJJA 1IJ6A 1SE7A 2NW7A 4DUZT 3V5SA 3LBXA 5BR8T 3FXEB 1NWMX 2C5IT 2AE9A 4TWDA 2BBHA 5JDLA 1HR0T 2LSIA 1S94A 1VOMA 3A5XA 3RIFA 2IMLA 1T7SA 3AEGA 4EZ4A 4IE0A 2XAGB 1HNZT 1XDOA 4GYSA 1J5ET 4X1IE 2WBLA 4A56A 1J5WA 3PJAA 3RIAA 1BR0A 3E0ZA 2X0HA 1WR6A 3EABA 3HA4A 2E9XC 4EIWA 4WBNE 3TLWA 3H3MA 5IUXA 2C5JA 3FZHB 3RPUA 2UUCT 3I1AA 3N5LA 4X65T 4EYUA 1T98A 2XAJB 5L3GB 2N2NA 3LK2B 3CMLA 4AKRB 3AECA 2YDRA 5FMNA 5J2TE 3D0TA 2R6GF 1U4QA 4HFHA 3DTOA 4GK5E 4NPPA 5EK3A 3ZN1B 4HFBA 4CZZB 3TLVA 4LFAT 2YU2A 4UF0B 4X66T 3I9YA 3HKCE 2UUAT 5LYJE 2FBWA 2J1DG 3A7MA 4UF0A 3TKLB 2WMOA 3JC6D 3MACA 2WWUA 2X66A 2W62A 5EK4A 5JR9C 2KZ7B 4NXMT 5ABHA 4LFBT 5AQPB 1QSDA 2YDSA 4CI3B 1FMVA 4I50E 4KI0F 4I4TE 4PJLA 4EEDA 2LHRA 3AA1B 4ISSA 2OA5A 4HFVA 2WU5A 4M1PA 2DNXA 5ABFA 4PK4A 4DBQA 2B1EA 4H63V 3UFGA 3PUWF 4AKGA 1U5PA 4DR4T 4IT4A 3CKDA 3L3PA 1R8IA 2HPJA 3ETVA 3N9QA 5C3JA 3UUXB 2UUBT 3UTKA 4ILBA 1W0AA 3RQWA 2WSSV 3RF1A 2ZM8A 2YDQA 2YOEA 3PE0A 3AVSA 5JDGA 2FJDA 2QGSA 4UV9B 2PTFA 2IDOB 3AE8A 2E5VA 4KHZF 3KFWX 3FBLA 1W9RA 2E9XA 4UR9A 1KNRA 2OV9A 3N2OA 5ABGA 5C8YE 4JI5T 2WDQA 3QK6A 5HCMA 3SFEA 2V1DB 3VRBA 3CK6A 4TN7B 1ZKEA 3CQGB 4TUYE 3ZYLA 4YTNA 2VQET 4EV6A 4DV6T 2VURA 3E08A 2XY8B 3NVOA 4EAHA 5JDQA 3HKBE 3JAEA 5HYAA 4CI2B 2CMRA 4A98A 1OEDB 3F2EA 3K1SA 4MLKA 4QKNA 2FJBA 4YT0A 2DL1A 3HL6A 3LK3B 3O4XE 4HFIA 4JEUB 4X20E 3RYCE 2BG9C 2ZM2A 3ZPOA 5HEJA 4CQIA 5L2LA 3VR9A 1IBMT 2Q9QD 5JR9A 3K8PC 3R84B 4DR6T 3RQUA 2NR4A 2XQ9A 5IHYA 1YKEB 2CM0A 3DP7A 3MK7C 2XASB 4KMCA 1OXZA 4IL4A 4PK6A 3AE7A 4JI6T 4CXYA 3B57A 1B7TA 2K3WA 5LP6E 4DV1T 2YINA 4MBQA 1QLBA 2UXNB 5LB7B 5HWYA 5FXWA 4B3RT 1WYCA 4ZI7E 5L3DB 5FXXA 4O4HE 2IHR1 4KP3C 3K3NA 4ISTA 4UVCB 4YSZA 2CLYB 5J2UE 4U7IA 3Q5EA 4WYVA 2VKJA 3KINB 5LBMA 5L4EA 4I0UA 1M7KA 2EHOA 2Y8DA 3ABVA 3Q5WA 3ZKRA 2W2UA 2PG8A 2X0LB 3AB3B 1WRDA 3PV0F 3EDVA 2BKOA 4IL9A 4BA9A 4DR1T 2V6YA 2YEVC 2WDVA 2BDEA 3RKGA 2FJAA 2KSRA 2XQ5A 4AKHA 4LF7T 5HXSA 5LGUB 3L8RA 3NKZA 4ZHQE 4LF4T 3C51A 4V1Av 4WZXA 2E8IA 4YSYA 4JYAT 1ZP0A 3AE5A 2MOZA 2Z6EA 1AJ3A 3RI5A 2MTQA 4JI0T 1Z8UA 4DV3T 4GYRA 2P9BA 3C98B 3G06A 3O1IA 3AE4A 3AE3A 4IDQA 5HWXA 3OJAA 3AXJA 3JAFA 4N78D 4TV9E 1WYBA 4ZOLE 5FKYA 4DVDA 1HX8A 1VCSA 3I0OA 3PUSA 3VKGA 3ZMZB 4P0AA 2CWOA 2JJ9A 3AAAB 3IBPA 4ERRA 2VL8A 3V5UA 5AQMB 3AEDA 4HWDA 1HNWT 1EZ3A 2JPFA 3RRCA 3T1YT 5KXJA 4GKKT 2V8SV 2BG9A 2DCFA 5CA0E 5ABFB 3ONJA 3TLTA 1D1BA 3LJCA 3KVAA 2WMNA 3GN5A 1LVFA 2H89A 1QUUA 4BAYB 5HEGA 1T8BA 4ZI3C 4NXNT 4G63A 4GK0E 3H37A 3CQXC 3OPCA 4NUUA 4ILCA 3OYXA 3K3OA 3PTRB 2LRLA 3O1JA 4ZS3A 4DR3T 1US7B 1LVKA 2KXPB 3T1HT 3ZMTB 2BVMA 5BMVE 4E7ZA 2CWYA 5LA6E 3AEFA 2CHNA 4OYKA 3UULA 1HF8A 4EOZB 4ZI2C 4PK5A 4IHJE 3VRAA 1OEDC 3AE9A 2Q9QA 1XNQT 2UU9T 5AQJB 5KX5E 3ZJ1A 3QB5A 3F57A 3T8OA 3CX6B 4I43B 2IC6A 4BJMA 2E9XD 1YQ3A 2VKHA 2WAUA 3PUVF 4ZZCA 4KHPT 4DIDB 2A2FX 2NOXA 4HE8A 3JC6C 4TV8E 1ZHCA 3OYZA 4UVAB 5AQGB 3Q9DA 4AXPA 2HN1A 2JQQA 3P50A 4HWFA 2UXDT 3CQCB 3O9XA 3NWIA 4CN6A 4OK0A 1J1JA 1E2AA 5LBQB 1MMGA 1Y64B 2Y48B 3NZQA 2XPKA 1M62A 3AA7B 3HR0A 4O8SA 4U72A 4JI7T 3FZKB 4QX8B 5FL0A 2H7VC 5KDMC 2LSYA 3P4PA 3P4QA 5L3FB 4DO0A 3R6NA 2CXDA 2VKOA 5AQSB 4U3CA 3WAKA 3ZMUB 4AKLA 4CN4A 4L5GA 4AISA 4JI4T 1SA0E 1D0YA 5JVDE 3BQIA 4DMVA 1UK5A 3RC3A 2LEHA 2LT3A 4PFOA 4U74A 3N9OA 5JDNA 4XAXB 3RIUA 5JRCA 2D2SA 2CE7A 3MA9A 2QA7A 4F6RC 2XM2A 2CCQA 2PFVA 3OKQA 2BKPA 1HTJF 3CPZA 2A3DA 2IC9A 2X68A 4GIWA 5EZYE 2M6IA 3UFEA 5FVKA 2LSGA 2ODVA 3C4XA 2YKSA 4IE7A 4JUYA 3NBXX 4NUVA 5JDFA 1UURA 2CHOA 3AVRA 3BK9A 3BQKA 2H7OA 3PUGA 2I6HA 3PUYF 4HEAA 5HXCA 3TLUA 3PU8A 3IA3A 3ZMSB 5AQRB 2K5BB 2XAQB 2W00A 3AEEA 1X9BA 4A5XA 4B3MT 2XAFB 2E9XB 5FY1A 2WQYA 3DJBA 2HH7A 1G8XA 2V7IA 2PBIA 4UVBB 3UUMA 4OFZA 2WCAA 2W4XA 4A97A 3H3AA 2OLTA 2Y6XA 3IHRA 2BVLA 5AQOB 4AQFA 2ZM6T 4IIJE 1HS7A 4HGAA 4QXHB 3AXJB 3HKEE 1NAFA 4H9SE 5HXRA 4IE6A 2VQFT 1KFYA 5LMUT 4IDNA 5H6QB 5E0OA 4C91A 2X9WA 3ESLA 3EHZA 3P4WA 4QXBB 3VR8A 4C90A 1T72A 2J62A 2PJQA 3AAEB 4AQGA 2D5UA 3RX6A 3UUNA 4DV5T 4JI8T 2D9DA 2LOPA 4EB6E 2QRXA 1HCIA 1ZOYA 2A72A 2EHOD 2VB6A 3CIRA 2CPTA 2BG9E 1X79A 4FI5A 4XZCA 3UU3A 4TWFA 2JQ9A 3N9NA 3MXZA 4CXWA 1IBKT 4TX5A 1ZEEA 4I55E 5AQNB 3GA8A 3ZN0B 4UEMA 2FUPA 2AXDS 2I59A 4O4JE 4P0BA 3P7IA 5FNVE 3ZJ2A 2DI4A 4DMWA 5C2TA 1MMDA 2VK9A 3ZSTA 4YHJA 1KNPA 2SPCA 5FXZA 5HXHA 3OVUA 4TNVA 3EVYA 4KX6A 1WR0A 4ZEYA 5L3BB 5TAOA 1YW0A 1LRZA 2FJEA 4HWCA 1XWMA 1FMWA 3Q5XA 4JV5T 3PURA 2N1GA 2WP9A 2N9DA 1WFDA 4PAGA 5L3CB 5L4HA 1WLXA 2WZHA 5FXVA 4UELA 2W66A 3J9X1 5F8PA 3IF8B 4IDOA 4HFEA 2KNDA 2UXXB 2V7LA 3KBUA 2YK0A 3AA0B 3PUXF 4DR5T 4XBFB 4HTEA 5IYZE 3RH3A 2DHRA 3CX7B 4H63H 5AQIB 5JRCB 4QX7B 4AQFC 2LOSA 2YN6A 2XZEA 4YJ3E 2JQHA 3QOFA 1UX5A 2BS3A 2QYWA 2WY2A 3CWZB 3KVBA 4O4IE 5AQKB 4IE5A 5HEUA 3ZYMA 3ZT6A 2UXBT 3KV4A 2H88A 3ANWB 3ZC1A 2V7MA 4ANJA 1NEKA 4KUMB 2V6XA 5LJNA 5JH7E 4COFA 2JMKA 2ZMAA 3FBZA 3LG7A 3RYHE 2KMFA 2LM2A 5CA1E 5JQGE 1JNZA 2X0YA 1N33T 2XSAA 5AQFB 4H9RC 2CXLA 2G0UA 4L9IA 4HFDA 1VCTA 3GWHA 3UT5E 2MBGA 3SFDA 1MMAA 3CVRA 3ZC0A 4ILAA 3ANWA 3LDQB 2NTXA 2XSBA 4KBMB 5LMNT 1LKXA 3SRZA 3ZT5A 3U78A 4H9NC 2C5KT 3C4ZA 5FYMA 2LM9A 2WB5A 3FZFB 5DJQC 3RRWA 3X1DA 4EZHA 2JMHA 2YU1A 2BS4A 5LCYA 2BZBA 5J1GA 5LXTE 1N34T 2X9YA 5JR9B 2IAKA 4EXTA 4UXNB 3ZYKA 2BKNA 1HG5A 2L8KA 2XQ7A 3P8CD 2W63A 3PJAJ 4HFCA 1D1AA 4L0RA 5DQWA 5AQVB 5EK2A 1E7PA 2MYSA 3P4RA 4H9QC 4PJNA 1S35A 1IAPA 2RPAA 3KV6A 2W61A 2K9AA 3OBVE 4DV4T 2MAWA 3GN5B 5LNKA 5IWAT 5ADXL 1YKHB 4IDPA 4PW8A 2KWIB 3I9WA 4Q25A 1VRBA 3Q2MA 1OEDE 4WNKA 3E22E 3HKDE 2DWKA 5CJ5A 4JLEA 1V9DA 2VL0A 3L09A 4E7SA 5L47A 5CB4E 4B6XA 3QUJA 2KWHA 5ETWA 4B3ST 2CBIA 3VKHA 4ASKA 1XNRT 2ZLYA 1WCRA 3N2GE 2L3LA 4J2CA 4EGWA 3UQ7A 3W15B 2KLQA 2KINB 4P1NA 4U7YA 4HKAA 1DU2A 3PU3A 1KK7A 4YXDA 4OX9T 2B76A 3EI0A 3AA6B 4OHFA 3S4UA 4CN1A 5DQVA 2VVNA 5FY0A 2JIWA 2X9XA 5J0ZA 2WU2A 2XQYA 2LSJA 4ZS2A 4YY3T 3L39A 3FZLB 4CXXA 5HXEA 5M4YA 1N32T 5DABA 4DUYT 2QVAA 3HI2A 2WWVA 2LSKA 5AFUL 4JBWF 3AE1A 1MNDA 2WZIA 3CX8B 3EDUA 1YQ4A 3FHNA 2RA1A 5AQTB 3VHLA 1KF6A 3NZPA 4U31A 4X1KE 3U3IA 4U2ZA 2KT9A 2EHOB 2LHNA 2V6YB 4YTMA 4DV7T 2XM1A 2XAHB 3WI3A 1MNEA 2J4GA 3EUHA 4YHHT 2IUBA 3GMIA 1XDPA 4U33A 1UUSA 4YSXA 1UCUA 1XZYA 1Y01A 4QWNB 3ZLIA 2RP4A 5JTGA 3PUAA 2C0SA 1I94T 5HEHA 4QHOA 2J47A 3KV9A 3FXDB 3WAJA 3UU5A 4ZZBA 2XHEB 3N9MA 1KEYA 3BQLA 4OYJA 3ZCIA 4AIUA 2IIUA 3SWHA 4WW0A 4JI2T 2NTYA 1W0BA 3ZMVB 3B5MA 1D0ZA 5LG4A 2ACZA 1FJGT 5FL1A 2Q9QC 2XUEA 1BR4A 2CRBA 2K48A 3AE2A 4P09A 3TLSA 4DBRA 2E2AA 2VKDA 3KDSE 4QH1A 4YTPA 5KMGP 4FJOA 3A8YC 1D1CA 4JI1T 3EAMA 2LJLA 4K0UA 3LFMA 2HN2A 5LGNB 2CEAA 2DLRA 2EHOC 3MZKB 3N9LA 3RLFF 1HX1B 2X51A 2LKGA 2LRKA 4H9OC 4O2BE 3RHWA 4IREA 4ZI2D 2X9HA 4IDZA 4EEBA 2NP9A 5LG3A 3RIUC 4LMLA 5FVLA 2XTLA 3UU8A 4ADZA 4LF5T 1KNZA 1GQEA 5ABEA 4K0KT 3JCFA 1UGOA 1CHUA 3AAIA 2IW5B 1IBLT 5A1LA 1H7CA 5CGMA 4G2AA 4JI3T 2WDRA 2XQAA 3KBTA 3M3ZB 5HCJA 2CBJA 3SS1A 3UU4A 4LF9T 4HWHA 3AEAA 2BG9B 4LMKA 3RKOA 3B13A 1O3XA 5FP3A 1BR2A 1G73A 2Q9QB 5AQQB 3AE6A 5CFBA 4PNIA 4U2YA 2F4VT 4EYYR 3ONXA 3M65A 3N2KE 2W67A 4O2AE 3C64A 5F3JA 5LHHB 4DR2T 2DWGA 3ZEFB 2E5LT 2V5CA 3QC9A 5LHIB 2WM9A 4YFSA 2D0TA 2V5DA 2XQ8A 2BBJA 2JQKA 1MIYA 3FZMB 1IJ5A 2X67A 5LHGB 2HHHT 1Z0PA 1XMOT 2LKHA 3P4SA 3UUBA 3QNUA 2JRKA 4MALA 5LGTB 2D0UA 2H3RA 2HPLA 2LE8A 4QH5A 2ACXA 1BR1A 3VU7H 3ZT7A 1OWAA 4DNDA 4DV0T 4PFPA 2UXCT 2ES0A 3LK42 5AQLB 4QH4A 2L9QA 5JDHA 2K24A 3PUQA 5AQHB 4LF6T 4MFRA 4PJMA 4WBOA 2NWBA 2W0GA 1HNXT 3J7Yq 4DR7T 5H6RB 2CXFA 1I6ZA 3OTOT 1XMQT 4B3TT 2XJ7A 5JDMA 2V26A 3FB2A 4UIGA 3UU6A 4AQYT 1CUNA 2V7KA 1L0VA 3UQ4A 2MPKA 2WS3A 3QB5K 4LMJA 2CA5A 4O4LE 5LOVE 3N9PA 4JEHB 4Z91A 4UV8B 4ZXLA 4Z90A 3ZSSA 4YJ2E 1SUMB 1FEWA 4AI6A 3NRYA 4TNWA 2VASA 4DV2T 1MIVA 1N36T 5HEOA 5L3EB 3RYIE 3K3QC 3I0QA 2BS2A 2M6BA 5HAXA 3LSVA 4ZI3D 2XQ4A 3IEEA 4ILUA 4LFCT 4IGUA 1MMNA 4H9PC 4HN9A 1E1HB 2NW9A 1HG2A 3MKDA 4MHCA 3KV5A 3MJXA 2V7JA 4NIQA 1NENA 2M67A 3ZCJA 2XQ3A 1UX4A 4TWHA 3RGLA 2GK9A 3RYFE 1FIOA 1YD8G 3Q5DA 4GKJT 1JNRA 2ODUA 2VVSA 4LF8T 2XQ6A 1ZV4X 2VWAA 4HWIB 1HFAA 4QXCB 3F31A 4CI1B 3RC8A 3LBXB 1YXRA 3C4WA 3AEBA 2I0MA 4Z8XA 2LLYA 1IZNB 3O1HA 1OEDA 4TZ4C 3NRXA 4YLHA 4X1YE 4X62T 2ZM0A
chains in the Genus database with same CATH topology
4JI8T 4DV7T 4YHHT 4LF7T 4LF4T 1IBKT 4DUZT 5BR8T 1I94T 4JYAT 1HR0T 4JI0T 4DV3T 4JI2T 1J5ET 1FJGT 4JV5T 2UUCT 1HNWT 4JI1T 4X65T 3T1YT 4GKKT 4DR5T 4LF5T 4LFAT 4NXNT 4X66T 2UUAT 4K0KT 2UXBT 1IBLT 4DR3T 4JI3T 3T1HT 4LF9T 4NXMT 4LFBT 2F4VT 1XNQT 2UU9T 1N33T 2E5LT 4DR2T 4DR4T 4KHPT 2HHHT 1XMOT 5LMNT 2UUBT 2UXDT 4DV0T 2UXCT 1N34T 4LF6T 1HNXT 4JI7T 4DR7T 4JI5T 3OTOT 4DV5T 1XMQT 4B3TT 4DR6T 2VQET 4JI4T 1HNZT 4DV6T 4AQYT 4DV4T 5IWAT 4DV2T 1N36T 1IBMT 4LFCT 4B3ST 4DR1T 4X64T 1XNRT 4JI6T 4B3MT 4DV1T 4B3RT 4GKJT 4OX9T 4LF8T 2ZM6T 4YY3T 1N32T 4DUYT 2VQFT 5LMUT 4X62T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 T;  4DV7 T;  4YHH T;  4LF7 T;  4LF4 T;  1IBK T;  4DUZ T;  5BR8 T;  1I94 T;  4JYA T;  1HR0 T;  4JI0 T;  4DV3 T;  4JI2 T;  1J5E T;  1FJG T;  4JV5 T;  2UUC T;  1HNW T;  4JI1 T;  4X65 T;  3T1Y T;  4GKK T;  4DR5 T;  4LF5 T;  4LFA T;  4NXN T;  4X66 T;  2UUA T;  4K0K T;  2UXB T;  1IBL T;  4DR3 T;  4JI3 T;  3T1H T;  4LF9 T;  4NXM T;  4LFB T;  2F4V T;  1XNQ T;  2UU9 T;  1N33 T;  2E5L T;  4DR2 T;  4DR4 T;  4KHP T;  2HHH T;  1XMO T;  5LMN T;  2UUB T;  2UXD T;  4DV0 T;  2UXC T;  1N34 T;  4LF6 T;  1HNX T;  4JI7 T;  4DR7 T;  4JI5 T;  3OTO T;  4DV5 T;  1XMQ T;  4B3T T;  4DR6 T;  2VQE T;  4JI4 T;  1HNZ T;  4DV6 T;  4AQY T;  4DV4 T;  5IWA T;  4DV2 T;  1N36 T;  1IBM T;  4LFC T;  4B3S T;  4DR1 T;  4X64 T;  1XNR T;  4JI6 T;  4B3M T;  4DV1 T;  4B3R T;  4GKJ T;  4OX9 T;  4LF8 T;  2ZM6 T;  4YY3 T;  1N32 T;  4DUY T;  2VQF T;  5LMU T;  4X62 T; 
#chains in the Genus database with same CATH topology
 4GOU A;  3ETU A;  3SOL A;  1SHZ C;  4IE4 A;  5GON E;  4F8H A;  1W09 A;  5JRE A;  2A9U A;  4X64 T;  4X5T A;  4BJN A;  4AKI A;  5AQU B;  1MIW A;  3PDY A;  3JAD A;  5F5W A;  3PUZ F;  5LJM A;  1D0X A;  2NW8 A;  3C50 A;  3ONL C;  5FY7 A;  2CLY C;  4PJJ A;  1IJ6 A;  1SE7 A;  2NW7 A;  4DUZ T;  3V5S A;  3LBX A;  5BR8 T;  3FXE B;  1NWM X;  2C5I T;  2AE9 A;  4TWD A;  2BBH A;  5JDL A;  1HR0 T;  2LSI A;  1S94 A;  1VOM A;  3A5X A;  3RIF A;  2IML A;  1T7S A;  3AEG A;  4EZ4 A;  4IE0 A;  2XAG B;  1HNZ T;  1XDO A;  4GYS A;  1J5E T;  4X1I E;  2WBL A;  4A56 A;  1J5W A;  3PJA A;  3RIA A;  1BR0 A;  3E0Z A;  2X0H A;  1WR6 A;  3EAB A;  3HA4 A;  2E9X C;  4EIW A;  4WBN E;  3TLW A;  3H3M A;  5IUX A;  2C5J A;  3FZH B;  3RPU A;  2UUC T;  3I1A A;  3N5L A;  4X65 T;  4EYU A;  1T98 A;  2XAJ B;  5L3G B;  2N2N A;  3LK2 B;  3CML A;  4AKR B;  3AEC A;  2YDR A;  5FMN A;  5J2T E;  3D0T A;  2R6G F;  1U4Q A;  4HFH A;  3DTO A;  4GK5 E;  4NPP A;  5EK3 A;  3ZN1 B;  4HFB A;  4CZZ B;  3TLV A;  4LFA T;  2YU2 A;  4UF0 B;  4X66 T;  3I9Y A;  3HKC E;  2UUA T;  5LYJ E;  2FBW A;  2J1D G;  3A7M A;  4UF0 A;  3TKL B;  2WMO A;  3JC6 D;  3MAC A;  2WWU A;  2X66 A;  2W62 A;  5EK4 A;  5JR9 C;  2KZ7 B;  4NXM T;  5ABH A;  4LFB T;  5AQP B;  1QSD A;  2YDS A;  4CI3 B;  1FMV A;  4I50 E;  4KI0 F;  4I4T E;  4PJL A;  4EED A;  2LHR A;  3AA1 B;  4ISS A;  2OA5 A;  4HFV A;  2WU5 A;  4M1P A;  2DNX A;  5ABF A;  4PK4 A;  4DBQ A;  2B1E A;  4H63 V;  3UFG A;  3PUW F;  4AKG A;  1U5P A;  4DR4 T;  4IT4 A;  3CKD A;  3L3P A;  1R8I A;  2HPJ A;  3ETV A;  3N9Q A;  5C3J A;  3UUX B;  2UUB T;  3UTK A;  4ILB A;  1W0A A;  3RQW A;  2WSS V;  3RF1 A;  2ZM8 A;  2YDQ A;  2YOE A;  3PE0 A;  3AVS A;  5JDG A;  2FJD A;  2QGS A;  4UV9 B;  2PTF A;  2IDO B;  3AE8 A;  2E5V A;  4KHZ F;  3KFW X;  3FBL A;  1W9R A;  2E9X A;  4UR9 A;  1KNR A;  2OV9 A;  3N2O A;  5ABG A;  5C8Y E;  4JI5 T;  2WDQ A;  3QK6 A;  5HCM A;  3SFE A;  2V1D B;  3VRB A;  3CK6 A;  4TN7 B;  1ZKE A;  3CQG B;  4TUY E;  3ZYL A;  4YTN A;  2VQE T;  4EV6 A;  4DV6 T;  2VUR A;  3E08 A;  2XY8 B;  3NVO A;  4EAH A;  5JDQ A;  3HKB E;  3JAE A;  5HYA A;  4CI2 B;  2CMR A;  4A98 A;  1OED B;  3F2E A;  3K1S A;  4MLK A;  4QKN A;  2FJB A;  4YT0 A;  2DL1 A;  3HL6 A;  3LK3 B;  3O4X E;  4HFI A;  4JEU B;  4X20 E;  3RYC E;  2BG9 C;  2ZM2 A;  3ZPO A;  5HEJ A;  4CQI A;  5L2L A;  3VR9 A;  1IBM T;  2Q9Q D;  5JR9 A;  3K8P C;  3R84 B;  4DR6 T;  3RQU A;  2NR4 A;  2XQ9 A;  5IHY A;  1YKE B;  2CM0 A;  3DP7 A;  3MK7 C;  2XAS B;  4KMC A;  1OXZ A;  4IL4 A;  4PK6 A;  3AE7 A;  4JI6 T;  4CXY A;  3B57 A;  1B7T A;  2K3W A;  5LP6 E;  4DV1 T;  2YIN A;  4MBQ A;  1QLB A;  2UXN B;  5LB7 B;  5HWY A;  5FXW A;  4B3R T;  1WYC A;  4ZI7 E;  5L3D B;  5FXX A;  4O4H E;  2IHR 1;  4KP3 C;  3K3N A;  4IST A;  4UVC B;  4YSZ A;  2CLY B;  5J2U E;  4U7I A;  3Q5E A;  4WYV A;  2VKJ A;  3KIN B;  5LBM A;  5L4E A;  4I0U A;  1M7K A;  2EHO A;  2Y8D A;  3ABV A;  3Q5W A;  3ZKR A;  2W2U A;  2PG8 A;  2X0L B;  3AB3 B;  1WRD A;  3PV0 F;  3EDV A;  2BKO A;  4IL9 A;  4BA9 A;  4DR1 T;  2V6Y A;  2YEV C;  2WDV A;  2BDE A;  3RKG A;  2FJA A;  2KSR A;  2XQ5 A;  4AKH A;  4LF7 T;  5HXS A;  5LGU B;  3L8R A;  3NKZ A;  4ZHQ E;  4LF4 T;  3C51 A;  4V1A v;  4WZX A;  2E8I A;  4YSY A;  4JYA T;  1ZP0 A;  3AE5 A;  2MOZ A;  2Z6E A;  1AJ3 A;  3RI5 A;  2MTQ A;  4JI0 T;  1Z8U A;  4DV3 T;  4GYR A;  2P9B A;  3C98 B;  3G06 A;  3O1I A;  3AE4 A;  3AE3 A;  4IDQ A;  5HWX A;  3OJA A;  3AXJ A;  3JAF A;  4N78 D;  4TV9 E;  1WYB A;  4ZOL E;  5FKY A;  4DVD A;  1HX8 A;  1VCS A;  3I0O A;  3PUS A;  3VKG A;  3ZMZ B;  4P0A A;  2CWO A;  2JJ9 A;  3AAA B;  3IBP A;  4ERR A;  2VL8 A;  3V5U A;  5AQM B;  3AED A;  4HWD A;  1HNW T;  1EZ3 A;  2JPF A;  3RRC A;  3T1Y T;  5KXJ A;  4GKK T;  2V8S V;  2BG9 A;  2DCF A;  5CA0 E;  5ABF B;  3ONJ A;  3TLT A;  1D1B A;  3LJC A;  3KVA A;  2WMN A;  3GN5 A;  1LVF A;  2H89 A;  1QUU A;  4BAY B;  5HEG A;  1T8B A;  4ZI3 C;  4NXN T;  4G63 A;  4GK0 E;  3H37 A;  3CQX C;  3OPC A;  4NUU A;  4ILC A;  3OYX A;  3K3O A;  3PTR B;  2LRL A;  3O1J A;  4ZS3 A;  4DR3 T;  1US7 B;  1LVK A;  2KXP B;  3T1H T;  3ZMT B;  2BVM A;  5BMV E;  4E7Z A;  2CWY A;  5LA6 E;  3AEF A;  2CHN A;  4OYK A;  3UUL A;  1HF8 A;  4EOZ B;  4ZI2 C;  4PK5 A;  4IHJ E;  3VRA A;  1OED C;  3AE9 A;  2Q9Q A;  1XNQ T;  2UU9 T;  5AQJ B;  5KX5 E;  3ZJ1 A;  3QB5 A;  3F57 A;  3T8O A;  3CX6 B;  4I43 B;  2IC6 A;  4BJM A;  2E9X D;  1YQ3 A;  2VKH A;  2WAU A;  3PUV F;  4ZZC A;  4KHP T;  4DID B;  2A2F X;  2NOX A;  4HE8 A;  3JC6 C;  4TV8 E;  1ZHC A;  3OYZ A;  4UVA B;  5AQG B;  3Q9D A;  4AXP A;  2HN1 A;  2JQQ A;  3P50 A;  4HWF A;  2UXD T;  3CQC B;  3O9X A;  3NWI A;  4CN6 A;  4OK0 A;  1J1J A;  1E2A A;  5LBQ B;  1MMG A;  1Y64 B;  2Y48 B;  3NZQ A;  2XPK A;  1M62 A;  3AA7 B;  3HR0 A;  4O8S A;  4U72 A;  4JI7 T;  3FZK B;  4QX8 B;  5FL0 A;  2H7V C;  5KDM C;  2LSY A;  3P4P A;  3P4Q A;  5L3F B;  4DO0 A;  3R6N A;  2CXD A;  2VKO A;  5AQS B;  4U3C A;  3WAK A;  3ZMU B;  4AKL A;  4CN4 A;  4L5G A;  4AIS A;  4JI4 T;  1SA0 E;  1D0Y A;  5JVD E;  3BQI A;  4DMV A;  1UK5 A;  3RC3 A;  2LEH A;  2LT3 A;  4PFO A;  4U74 A;  3N9O A;  5JDN A;  4XAX B;  3RIU A;  5JRC A;  2D2S A;  2CE7 A;  3MA9 A;  2QA7 A;  4F6R C;  2XM2 A;  2CCQ A;  2PFV A;  3OKQ A;  2BKP A;  1HTJ F;  3CPZ A;  2A3D A;  2IC9 A;  2X68 A;  4GIW A;  5EZY E;  2M6I A;  3UFE A;  5FVK A;  2LSG A;  2ODV A;  3C4X A;  2YKS A;  4IE7 A;  4JUY A;  3NBX X;  4NUV A;  5JDF A;  1UUR A;  2CHO A;  3AVR A;  3BK9 A;  3BQK A;  2H7O A;  3PUG A;  2I6H A;  3PUY F;  4HEA A;  5HXC A;  3TLU A;  3PU8 A;  3IA3 A;  3ZMS B;  5AQR B;  2K5B B;  2XAQ B;  2W00 A;  3AEE A;  1X9B A;  4A5X A;  4B3M T;  2XAF B;  2E9X B;  5FY1 A;  2WQY A;  3DJB A;  2HH7 A;  1G8X A;  2V7I A;  2PBI A;  4UVB B;  3UUM A;  4OFZ A;  2WCA A;  2W4X A;  4A97 A;  3H3A A;  2OLT A;  2Y6X A;  3IHR A;  2BVL A;  5AQO B;  4AQF A;  2ZM6 T;  4IIJ E;  1HS7 A;  4HGA A;  4QXH B;  3AXJ B;  3HKE E;  1NAF A;  4H9S E;  5HXR A;  4IE6 A;  2VQF T;  1KFY A;  5LMU T;  4IDN A;  5H6Q B;  5E0O A;  4C91 A;  2X9W A;  3ESL A;  3EHZ A;  3P4W A;  4QXB B;  3VR8 A;  4C90 A;  1T72 A;  2J62 A;  2PJQ A;  3AAE B;  4AQG A;  2D5U A;  3RX6 A;  3UUN A;  4DV5 T;  4JI8 T;  2D9D A;  2LOP A;  4EB6 E;  2QRX A;  1HCI A;  1ZOY A;  2A72 A;  2EHO D;  2VB6 A;  3CIR A;  2CPT A;  2BG9 E;  1X79 A;  4FI5 A;  4XZC A;  3UU3 A;  4TWF A;  2JQ9 A;  3N9N A;  3MXZ A;  4CXW A;  1IBK T;  4TX5 A;  1ZEE A;  4I55 E;  5AQN B;  3GA8 A;  3ZN0 B;  4UEM A;  2FUP A;  2AXD S;  2I59 A;  4O4J E;  4P0B A;  3P7I A;  5FNV E;  3ZJ2 A;  2DI4 A;  4DMW A;  5C2T A;  1MMD A;  2VK9 A;  3ZST A;  4YHJ A;  1KNP A;  2SPC A;  5FXZ A;  5HXH A;  3OVU A;  4TNV A;  3EVY A;  4KX6 A;  1WR0 A;  4ZEY A;  5L3B B;  5TAO A;  1YW0 A;  1LRZ A;  2FJE A;  4HWC A;  1XWM A;  1FMW A;  3Q5X A;  4JV5 T;  3PUR A;  2N1G A;  2WP9 A;  2N9D A;  1WFD A;  4PAG A;  5L3C B;  5L4H A;  1WLX A;  2WZH A;  5FXV A;  4UEL A;  2W66 A;  3J9X 1;  5F8P A;  3IF8 B;  4IDO A;  4HFE A;  2KND A;  2UXX B;  2V7L A;  3KBU A;  2YK0 A;  3AA0 B;  3PUX F;  4DR5 T;  4XBF B;  4HTE A;  5IYZ E;  3RH3 A;  2DHR A;  3CX7 B;  4H63 H;  5AQI B;  5JRC B;  4QX7 B;  4AQF C;  2LOS A;  2YN6 A;  2XZE A;  4YJ3 E;  2JQH A;  3QOF A;  1UX5 A;  2BS3 A;  2QYW A;  2WY2 A;  3CWZ B;  3KVB A;  4O4I E;  5AQK B;  4IE5 A;  5HEU A;  3ZYM A;  3ZT6 A;  2UXB T;  3KV4 A;  2H88 A;  3ANW B;  3ZC1 A;  2V7M A;  4ANJ A;  1NEK A;  4KUM B;  2V6X A;  5LJN A;  5JH7 E;  4COF A;  2JMK A;  2ZMA A;  3FBZ A;  3LG7 A;  3RYH E;  2KMF A;  2LM2 A;  5CA1 E;  5JQG E;  1JNZ A;  2X0Y A;  1N33 T;  2XSA A;  5AQF B;  4H9R C;  2CXL A;  2G0U A;  4L9I A;  4HFD A;  1VCT A;  3GWH A;  3UT5 E;  2MBG A;  3SFD A;  1MMA A;  3CVR A;  3ZC0 A;  4ILA A;  3ANW A;  3LDQ B;  2NTX A;  2XSB A;  4KBM B;  5LMN T;  1LKX A;  3SRZ A;  3ZT5 A;  3U78 A;  4H9N C;  2C5K T;  3C4Z A;  5FYM A;  2LM9 A;  2WB5 A;  3FZF B;  5DJQ C;  3RRW A;  3X1D A;  4EZH A;  2JMH A;  2YU1 A;  2BS4 A;  5LCY A;  2BZB A;  5J1G A;  5LXT E;  1N34 T;  2X9Y A;  5JR9 B;  2IAK A;  4EXT A;  4UXN B;  3ZYK A;  2BKN A;  1HG5 A;  2L8K A;  2XQ7 A;  3P8C D;  2W63 A;  3PJA J;  4HFC A;  1D1A A;  4L0R A;  5DQW A;  5AQV B;  5EK2 A;  1E7P A;  2MYS A;  3P4R A;  4H9Q C;  4PJN A;  1S35 A;  1IAP A;  2RPA A;  3KV6 A;  2W61 A;  2K9A A;  3OBV E;  4DV4 T;  2MAW A;  3GN5 B;  5LNK A;  5IWA T;  5ADX L;  1YKH B;  4IDP A;  4PW8 A;  2KWI B;  3I9W A;  4Q25 A;  1VRB A;  3Q2M A;  1OED E;  4WNK A;  3E22 E;  3HKD E;  2DWK A;  5CJ5 A;  4JLE A;  1V9D A;  2VL0 A;  3L09 A;  4E7S A;  5L47 A;  5CB4 E;  4B6X A;  3QUJ A;  2KWH A;  5ETW A;  4B3S T;  2CBI A;  3VKH A;  4ASK A;  1XNR T;  2ZLY A;  1WCR A;  3N2G E;  2L3L A;  4J2C A;  4EGW A;  3UQ7 A;  3W15 B;  2KLQ A;  2KIN B;  4P1N A;  4U7Y A;  4HKA A;  1DU2 A;  3PU3 A;  1KK7 A;  4YXD A;  4OX9 T;  2B76 A;  3EI0 A;  3AA6 B;  4OHF A;  3S4U A;  4CN1 A;  5DQV A;  2VVN A;  5FY0 A;  2JIW A;  2X9X A;  5J0Z A;  2WU2 A;  2XQY A;  2LSJ A;  4ZS2 A;  4YY3 T;  3L39 A;  3FZL B;  4CXX A;  5HXE A;  5M4Y A;  1N32 T;  5DAB A;  4DUY T;  2QVA A;  3HI2 A;  2WWV A;  2LSK A;  5AFU L;  4JBW F;  3AE1 A;  1MND A;  2WZI A;  3CX8 B;  3EDU A;  1YQ4 A;  3FHN A;  2RA1 A;  5AQT B;  3VHL A;  1KF6 A;  3NZP A;  4U31 A;  4X1K E;  3U3I A;  4U2Z A;  2KT9 A;  2EHO B;  2LHN A;  2V6Y B;  4YTM A;  4DV7 T;  2XM1 A;  2XAH B;  3WI3 A;  1MNE A;  2J4G A;  3EUH A;  4YHH T;  2IUB A;  3GMI A;  1XDP A;  4U33 A;  1UUS A;  4YSX A;  1UCU A;  1XZY A;  1Y01 A;  4QWN B;  3ZLI A;  2RP4 A;  5JTG A;  3PUA A;  2C0S A;  1I94 T;  5HEH A;  4QHO A;  2J47 A;  3KV9 A;  3FXD B;  3WAJ A;  3UU5 A;  4ZZB A;  2XHE B;  3N9M A;  1KEY A;  3BQL A;  4OYJ A;  3ZCI A;  4AIU A;  2IIU A;  3SWH A;  4WW0 A;  4JI2 T;  2NTY A;  1W0B A;  3ZMV B;  3B5M A;  1D0Z A;  5LG4 A;  2ACZ A;  1FJG T;  5FL1 A;  2Q9Q C;  2XUE A;  1BR4 A;  2CRB A;  2K48 A;  3AE2 A;  4P09 A;  3TLS A;  4DBR A;  2E2A A;  2VKD A;  3KDS E;  4QH1 A;  4YTP A;  5KMG P;  4FJO A;  3A8Y C;  1D1C A;  4JI1 T;  3EAM A;  2LJL A;  4K0U A;  3LFM A;  2HN2 A;  5LGN B;  2CEA A;  2DLR A;  2EHO C;  3MZK B;  3N9L A;  3RLF F;  1HX1 B;  2X51 A;  2LKG A;  2LRK A;  4H9O C;  4O2B E;  3RHW A;  4IRE A;  4ZI2 D;  2X9H A;  4IDZ A;  4EEB A;  2NP9 A;  5LG3 A;  3RIU C;  4LML A;  5FVL A;  2XTL A;  3UU8 A;  4ADZ A;  4LF5 T;  1KNZ A;  1GQE A;  5ABE A;  4K0K T;  3JCF A;  1UGO A;  1CHU A;  3AAI A;  2IW5 B;  1IBL T;  5A1L A;  1H7C A;  5CGM A;  4G2A A;  4JI3 T;  2WDR A;  2XQA A;  3KBT A;  3M3Z B;  5HCJ A;  2CBJ A;  3SS1 A;  3UU4 A;  4LF9 T;  4HWH A;  3AEA A;  2BG9 B;  4LMK A;  3RKO A;  3B13 A;  1O3X A;  5FP3 A;  1BR2 A;  1G73 A;  2Q9Q B;  5AQQ B;  3AE6 A;  5CFB A;  4PNI A;  4U2Y A;  2F4V T;  4EYY R;  3ONX A;  3M65 A;  3N2K E;  2W67 A;  4O2A E;  3C64 A;  5F3J A;  5LHH B;  4DR2 T;  2DWG A;  3ZEF B;  2E5L T;  2V5C A;  3QC9 A;  5LHI B;  2WM9 A;  4YFS A;  2D0T A;  2V5D A;  2XQ8 A;  2BBJ A;  2JQK A;  1MIY A;  3FZM B;  1IJ5 A;  2X67 A;  5LHG B;  2HHH T;  1Z0P A;  1XMO T;  2LKH A;  3P4S A;  3UUB A;  3QNU A;  2JRK A;  4MAL A;  5LGT B;  2D0U A;  2H3R A;  2HPL A;  2LE8 A;  4QH5 A;  2ACX A;  1BR1 A;  3VU7 H;  3ZT7 A;  1OWA A;  4DND A;  4DV0 T;  4PFP A;  2UXC T;  2ES0 A;  3LK4 2;  5AQL B;  4QH4 A;  2L9Q A;  5JDH A;  2K24 A;  3PUQ A;  5AQH B;  4LF6 T;  4MFR A;  4PJM A;  4WBO A;  2NWB A;  2W0G A;  1HNX T;  3J7Y q;  4DR7 T;  5H6R B;  2CXF A;  1I6Z A;  3OTO T;  1XMQ T;  4B3T T;  2XJ7 A;  5JDM A;  2V26 A;  3FB2 A;  4UIG A;  3UU6 A;  4AQY T;  1CUN A;  2V7K A;  1L0V A;  3UQ4 A;  2MPK A;  2WS3 A;  3QB5 K;  4LMJ A;  2CA5 A;  4O4L E;  5LOV E;  3N9P A;  4JEH B;  4Z91 A;  4UV8 B;  4ZXL A;  4Z90 A;  3ZSS A;  4YJ2 E;  1SUM B;  1FEW A;  4AI6 A;  3NRY A;  4TNW A;  2VAS A;  4DV2 T;  1MIV A;  1N36 T;  5HEO A;  5L3E B;  3RYI E;  3K3Q C;  3I0Q A;  2BS2 A;  2M6B A;  5HAX A;  3LSV A;  4ZI3 D;  2XQ4 A;  3IEE A;  4ILU A;  4LFC T;  4IGU A;  1MMN A;  4H9P C;  4HN9 A;  1E1H B;  2NW9 A;  1HG2 A;  3MKD A;  4MHC A;  3KV5 A;  3MJX A;  2V7J A;  4NIQ A;  1NEN A;  2M67 A;  3ZCJ A;  2XQ3 A;  1UX4 A;  4TWH A;  3RGL A;  2GK9 A;  3RYF E;  1FIO A;  1YD8 G;  3Q5D A;  4GKJ T;  1JNR A;  2ODU A;  2VVS A;  4LF8 T;  2XQ6 A;  1ZV4 X;  2VWA A;  4HWI B;  1HFA A;  4QXC B;  3F31 A;  4CI1 B;  3RC8 A;  3LBX B;  1YXR A;  3C4W A;  3AEB A;  2I0M A;  4Z8X A;  2LLY A;  1IZN B;  3O1H A;  1OED A;  4TZ4 C;  3NRX A;  4YLH A;  4X1Y E;  4X62 T;  2ZM0 A; 
#chains in the Genus database with same CATH homology
 4JI8 T;  4DV7 T;  4YHH T;  4LF7 T;  4LF4 T;  1IBK T;  4DUZ T;  5BR8 T;  1I94 T;  4JYA T;  1HR0 T;  4JI0 T;  4DV3 T;  4JI2 T;  1J5E T;  1FJG T;  4JV5 T;  2UUC T;  1HNW T;  4JI1 T;  4X65 T;  3T1Y T;  4GKK T;  4DR5 T;  4LF5 T;  4LFA T;  4NXN T;  4X66 T;  2UUA T;  4K0K T;  2UXB T;  1IBL T;  4DR3 T;  4JI3 T;  3T1H T;  4LF9 T;  4NXM T;  4LFB T;  2F4V T;  1XNQ T;  2UU9 T;  1N33 T;  2E5L T;  4DR2 T;  4DR4 T;  4KHP T;  2HHH T;  1XMO T;  5LMN T;  2UUB T;  2UXD T;  4DV0 T;  2UXC T;  1N34 T;  4LF6 T;  1HNX T;  4JI7 T;  4DR7 T;  4JI5 T;  3OTO T;  4DV5 T;  1XMQ T;  4B3T T;  4DR6 T;  2VQE T;  4JI4 T;  1HNZ T;  4DV6 T;  4AQY T;  4DV4 T;  5IWA T;  4DV2 T;  1N36 T;  1IBM T;  4LFC T;  4B3S T;  4DR1 T;  4X64 T;  1XNR T;  4JI6 T;  4B3M T;  4DV1 T;  4B3R T;  4GKJ T;  4OX9 T;  4LF8 T;  2ZM6 T;  4YY3 T;  1N32 T;  4DUY T;  2VQF T;  5LMU T;  4X62 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...