4DR3T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr3T00
4B3RT 1N34T 4LF5T 4DUZT 4LFAT 4DV7T 1I94T 4AQYT 4DV6T 4YY3T 4JI1T 4JI4T 4OX9T 4DR5T 1HR0T 4LFCT 4DR4T 4LF6T 1N32T 2UXDT 1IBMT 4DR2T 2E5LT 4LF9T 4LF7T 1XNRT 4NXNT 4X65T 4NXMT 1HNXT 1XMQT 4DV4T 5LMUT 4DR3T 1XMOT 2ZM6T 4B3TT 4LFBT 4JI6T 5IWAT 1HNZT 4JV5T 4KHPT 2VQFT 1XNQT 2F4VT 4JI0T 2VQET 4LF8T 3OTOT 4DV3T 1IBLT 2UUAT 4GKKT 2UUCT 4LF4T 4JI2T 4GKJT 4DV5T 3T1HT 2HHHT 1HNWT 4DR1T 4DV0T 4JI5T 4B3MT 4K0KT 4DV1T 2UXBT 4B3ST 2UUBT 4X64T 1N36T 4DUYT 4DR7T 3T1YT 1FJGT 4DR6T 2UXCT 1N33T 4X62T 1IBKT 4JI3T 1J5ET 4YHHT 4X66T 4JI8T 5LMNT 5BR8T 4JYAT 4JI7T 4DV2T 2UU9T
chains in the Genus database with same CATH superfamily
5JDHA 2K24A 5HEJA 3NZPA 4IE6A 2YN6A 4DUZT 2KMFA 5L3DB 2ZM2A 1YD8G 3RH3A 1LRZA 2X0YA 2XSAA 5CFBA 4LMJA 4I0UA 2B76A 2X68A 5FXXA 4OK0A 3ZLIA 2W63A 5JTGA 3RQWA 2JQ9A 1WRDA 2PTFA 4DVDA 1ZP0A 4ZEYA 2BS2A 5L3GB 3U3IA 2ZM6T 4O4LE 3C64A 4A98A 2BVLA 1W0BA 3PU3A 2VQET 4MHCA 1D0XA 2C5JA 4GIWA 3AEGA 3I9YA 2UUAT 5FNVE 5FXZA 3Q5WA 4ZXLA 2NWBA 2CHNA 4H9PC 4MFRA 3UUMA 4PJNA 1FEWA 2DL1A 2KT9A 3KV4A 3CIRA 1ZEEA 1VCSA 2LJLA 2X51A 2IDOB 3HL6A 1KK7A 2VK9A 5LB7B 4CN1A 3C4XA 2L9QA 2DWGA 4X1IE 2M67A 4OFZA 2BG9E 4DIDB 3EI0A 3H3MA 3ZSSA 4ZI2C 1WYBA 2SPCA 4JYAT 4G2AA 2MTQA 4EOZB 3ONLC 2JQQA 4EYUA 4U72A 1JNZA 4LF5T 3N2GE 3HR0A 3N9NA 4ERRA 3H37A 4KX6A 3AE9A 3WAJA 3ZN1B 3Q9DA 4YY3T 3PTRB 2VKDA 3OYXA 3FZKB 4TV8E 1OEDA 3AEAA 2VURA 3RC8A 4ISSA 2IHR1 2JQHA 5LJMA 1IJ6A 2GK9A 4BJMA 1IBMT 2RPAA 1HG5A 4IL9A 4HWDA 3K3QC 1FIOA 3QNUA 3T8OA 4GK0E 2WCAA 2LM9A 4LFBT 5FY1A 5H6RB 3AE4A 3AA1B 3FZLB 2JIWA 1U4QA 2BVMA 2LM2A 2NW8A 1HCIA 4ZZCA 3C98B 2Y48B 4L5GA 4H63H 4C90A 1WR0A 4HWHA 4AIUA 3CQCB 3AB3B 3LBXB 1X79A 2MOZA 4DUYT 1JNRA 4KHZF 3HKDE 5JREA 2VASA 1UX5A 3ESLA 4C91A 3V5UA 2V26A 3VHLA 3PUAA 1G73A 5HXCA 3UT5E 2NOXA 5FXWA 2ZLYA 1SE7A 4YSYA 2ACXA 2AE9A 4TX5A 2B1EA 4Q25A 1OXZA 5AFUL 2CM0A 3LBXA 3PU8A 3ETVA 2D5UA 1XWMA 3P8CD 1MNDA 4IHJE 4NUUA 2CWYA 3BQLA 3I0OA 2V6YA 2ZM8A 5DJQC 3IHRA 5CGMA 5IHYA 5LBQB 1UGOA 4HTEA 2JRKA 3DP7A 5L2LA 1HR0T 4CN4A 2CMRA 4V1Av 3UU8A 2HPJA 4IL4A 1YQ3A 4JEUB 1MNEA 1SUMB 4EV6A 3EUHA 4PJMA 1XMQT 4O4IE 3ANWB 5J0ZA 3ONJA 3AXJB 4LF8T 4F8HA 1WCRA 5AQSB 2JPFA 4ZS3A 1KEYA 4HFHA 2Y6XA 3FB2A 1BR0A 2H88A 2YDQA 4UIGA 3KINB 4I50E 5KDMC 3AECA 2IIUA 2LEHA 2XQ6A 4EXTA 3AE5A 3ANWA 2W0GA 2J62A 4U74A 3AE1A 2WWVA 1IZNB 4FJOA 4WBNE 2UXNB 2G0UA 2NTXA 4UVCB 4JI3T 4YHHT 2CEAA 2ACZA 3LK42 2X9YA 4JI8T 3UU3A 1CHUA 1BR1A 4EEDA 4IDOA 1MMNA 3SOLA 2MYSA 2WDVA 5IYZE 1W0AA 2LSYA 3RX6A 4LFAT 4DO0A 4XBFB 2V7LA 2K48A 5BMVE 2VWAA 4KBMB 1E2AA 3ZKRA 4YLHA 4DMWA 4ZI3C 4J2CA 5ABEA 2BBHA 4HWIB 4QX8B 2LKHA 1D1BA 5AQUB 3CMLA 2VB6A 4N78D 3E22E 4LF7T 5FL1A 4O2AE 2XM2A 5HEOA 2H3RA 3ZT5A 5AQGB 3UUNA 4YSZA 1HTJF 3F31A 3PDYA 3Q5DA 3OTOT 2DWKA 5HAXA 2VL8A 1H7CA 3FXEB 3UU6A 4JI2T 3O1JA 4QHOA 4DV5T 4EEBA 3CKDA 2JMKA 2LRKA 3M3ZB 1N36T 4DR7T 1FJGT 4IREA 2XAQB 2LSGA 3ZPOA 2WDRA 4QXBB 3FZMB 3HKEE 4IIJE 5TAOA 4AKIA 4P0BA 4JI7T 2XSBA 3MXZA 4DBQA 3KBUA 4UEMA 3TLUA 2PJQA 4HE8A 2J47A 5CA1E 4G63A 4TV9E 4KP3C 1Z8UA 4AQYT 3OJAA 2ZMAA 2V7IA 3ZJ1A 3ZEFB 3RKGA 5C2TA 2XM1A 4AKRB 4IDPA 3C4WA 2XHEB 4KI0F 4BAYB 3A5XA 2WY2A 4AKLA 5LYJE 2K5BB 2W2UA 1HNXT 3QB5K 3UFEA 4HFVA 3FXDB 5ETWA 5CJ5A 3GMIA 2XJ7A 2N9DA 1WLXA 2XQ4A 1KNZA 3RYIE 1GQEA 3RYHE 4CXXA 4B3MT 2L8KA 5LG3A 4E7ZA 2P9BA 2UUBT 1VOMA 1J5WA 1IAPA 3IA3A 2UXCT 1E7PA 1N33T 3HKBE 4PFOA 1HX1B 3CQXC 3N9LA 1KFYA 1YKHB 3MZKB 2NP9A 5KMGP 5CA0E 4HN9A 4WW0A 4PK5A 3A8YC 2XPKA 5HEHA 3ZN0B 2J4GA 1XZYA 2XQ9A 3P4QA 5FVLA 2UU9T 4MBQA 3QOFA 5JDMA 2CA5A 4YT0A 5KX5E 2XQAA 3DJBA 2LSKA 2JMHA 4OYKA 3Q5XA 5JRCB 5LG4A 1DU2A 3MK7C 4AQGA 5AQFB 3N2KE 5E0OA 1Y01A 3B13A 2CHOA 4AI6A 3V5SA 4YSXA 4TZ4C 2W67A 5LOVE 5DQWA 4PK6A 4PFPA 1AJ3A 5JRCA 2WZIA 2E9XC 4P09A 1LVFA 4FI5A 3HKCE 3L39A 1UX4A 1NWMX 1FMVA 2ODUA 5FYMA 3UU5A 3ZYKA 2LHRA 4A97A 3J9X1 5AQVB 1OEDE 3IF8B 3P4SA 2UXXB 3ONXA 5LJNA 3M65A 3P4WA 2NTYA 3U78A 2FUPA 1SHZC 2BS4A 4U33A 3MACA 5AQRB 1HX8A 5HCJA 1T72A 4H9OC 4TN7B 3OKQA 3AAIA 5LGUB 4HWFA 1VCTA 1X9BA 3TKLB 4B3RT 3X1DA 4QX7B 3RLFF 3KBTA 2LLYA 3LG7A 1UCUA 2BDEA 4COFA 5DQVA 1OEDB 3BQKA 5IUXA 3PE0A 5F5WA 2Y8DA 2MAWA 3RI5A 2WB5A 4U31A 1SA0E 3NWIA 3NRYA 5AQTB 4ZI3D 3KVAA 3OPCA 3ZMTB 5LGNB 3KV6A 4EGWA 4I4TE 4I55E 4IT4A 5FXVA 3AVSA 4DR3T 2XQ8A 5FMNA 3H3AA 5FKYA 4CZZB 2H7OA 5LNKA 2DLRA 1MIVA 3N9QA 5JH7E 2LSIA 5M4YA 2YU2A 4UF0B 1W09A 2HN1A 2R6GF 5LCYA 1T8BA 3RRWA 5AQKB 4H9NC 1S35A 3O9XA 4X1YE 2K9AA 4IDZA 3PUXF 4Z91A 5LGTB 1IBKT 4ZS2A 5AQQB 3I9WA 3FBZA 2LE8A 3KV9A 4UF0A 1MMAA 3VRBA 2L3LA 4GOUA 2VKOA 3ZMUB 2FJEA 3RQUA 2ODVA 3N9PA 2XQ5A 2YK0A 2YU1A 2V6YB 4OHFA 4B6XA 3TLSA 4JI1T 2CWOA 2YEVC 5HXSA 4MALA 2M6IA 3ZSTA 1VRBA 2E8IA 3G06A 1XDOA 2UXDT 2X67A 4PW8A 1UURA 2E5LT 2IUBA 2YOEA 1XNRT 4NXNT 5L3CB 3JCFA 3N5LA 3AE2A 3AEBA 2XAJB 5LMUT 3RHWA 3VRAA 3LK3B 1US7B 4O4JE 3PJAJ 1XNQT 2BKNA 4DV3T 5ABHA 4EIWA 2RP4A 4K0UA 3JAEA 1HF8A 5LA6E 1S94A 2D0TA 3PUQA 4IE7A 2HHHT 4YJ3E 5C8YE 2CRBA 5AQHB 4K0KT 4EZ4A 3PUGA 5AQMB 5HCMA 2CXFA 2BZBA 3R84B 2BS3A 4IGUA 3UFGA 5EZYE 4QKNA 4L9IA 2VKHA 4H9QC 5FY0A 1YKEB 4ADZA 3RIUC 2QA7A 3F57A 4ILBA 3KV5A 2XQYA 3EAMA 3RRCA 3ZC0A 2BBJA 4ANJA 2WU2A 4DV7T 4HFCA 2A2FX 5CB4E 3UUXB 2KLQA 4QH4A 5HWXA 4JI4T 5EK2A 3TLWA 2ES0A 4KMCA 5J1GA 3NVOA 4HFDA 4JLEA 3CX8B 1ZOYA 1I6ZA 1N32T 1EZ3A 2E9XA 5FVKA 2C5KT 2EHOC 5HYAA 2IAKA 4YFSA 4X65T 1YW0A 2VVNA 4HWCA 4DV4T 1XMOT 3MKDA 4YHJA 5LXTE 2V6XA 5AQIB 5IWAT 4JI0T 4I43B 1YXRA 2XAGB 3VR8A 3CX7B 3RC3A 5L47A 2X0LB 1HNWT 3VKHA 3QUJA 2E9XD 4DR1T 4BA9A 3VR9A 3CK6A 2X9WA 4GYRA 3ZYLA 3E0ZA 4TNVA 3UU4A 1HG2A 4A56A 1FMWA 3EDUA 3S4UA 3SFDA 5LHHB 2LSJA 4XZCA 4PNIA 2CBJA 4A5XA 4YJ2E 2RA1A 4L0RA 1T7SA 1D1CA 4ILUA 3ZCIA 3Q5EA 4WNKA 4U3CA 2J1DG 2V8SV 2FJDA 2XAFB 4LFCT 4LF9T 1IJ5A 4UV8B 2V7KA 1M7KA 4BJNA 2WU5A 4ASKA 2W00A 3F2EA 1D0ZA 3CX6B 3FZFB 3VU7H 3KVBA 2N1GA 3ABVA 5AQLB 4UV9B 2V7MA 1QUUA 1MIWA 1NEKA 2F4VT 2Q9QC 2CE7A 1HFAA 3VKGA 2UUCT 3LDQB 4XAXB 1G8XA 2KWIB 4TWFA 2JQKA 3PUSA 2PBIA 2BG9C 4JEHB 4JI5T 4DV1T 2CBIA 2V1DB 5ADXL 4UVAB 5LP6E 4X64T 4UR9A 3L3PA 4DR6T 2VL0A 3ZYMA 4NUVA 1O3XA 3PUZF 3O1IA 2KNDA 1R8IA 4IDNA 3AAEB 2E5VA 4X1KE 3OYZA 2X0HA 5J2TE 3N2OA 3BK9A 4ISTA 3B5MA 2D0UA 4ZOLE 1D0YA 3FHNA 3P4PA 2W62A 2XAHB 4HFEA 5ABFB 2YDRA 1NENA 3AA7B 2XUEA 1T98A 3KDSE 2KSRA 3NBXX 2XQ3A 3HI2A 4DNDA 1MMDA 3ZMSB 1MIYA 3RF1A 5JDQA 3I1AA 3TLTA 5FY7A 4AISA 2IMLA 4GK5E 3RYCE 4WYVA 5ABFA 3EABA 4YXDA 1QLBA 2DCFA 2MPKA 4Z90A 3SRZA 3N9OA 3RYFE 3LFMA 3MA9A 3D0TA 3P4RA 5H6QB 5EK4A 4U2ZA 1L0VA 4DBRA 2C5IT 1U5PA 3RIUA 3AE6A 4NIQA 4HGAA 5JDFA 1QSDA 3L09A 4B3ST 2KWHA 2EHOB 4WZXA 3UUBA 4IE5A 3OBVE 2VKJA 3JC6C 3LK2B 3AE3A 4ZHQE 4ILCA 3SWHA 2XY8B 5A1LA 4HKAA 3Q2MA 3GWHA 3IEEA 1WFDA 4JUYA 4CI3B 2WBLA 2EHOA 1I94T 3CWZB 4DV6T 4P1NA 2IW5B 5L3BB 2KINB 2KXPB 1OWAA 5JQGE 3UULA 2WAUA 4AQFC 4MLKA 5J2UE 3RGLA 2A3DA 3PV0F 4DR2T 3CVRA 3EVYA 2QVAA 2I6HA 3R6NA 1BR2A 2VVSA 3ZC1A 5JR9C 2CLYC 4QH1A 3IBPA 2EHOD 3WAKA 3K3NA 3AA0B 4QXCB 2WWUA 2V5DA 2M6BA 1BR4A 1ZHCA 2LHNA 5JDLA 4H63V 3ZT7A 3JADA 4GKJT 2W66A 5C3JA 2NR4A 3W15B 2LKGA 2FJBA 5L4HA 3RIAA 3WI3A 1LVKA 5L4EA 3T1YT 4EAHA 2WQYA 4CXYA 3AEFA 2Q9QB 4X66T 5LBMA 2XZEA 4TUYE 4PAGA 2OA5A 1D1AA 1UUSA 3ZT6A 3AE8A 2BG9B 2CPTA 3LSVA 5AQNB 2BKOA 1Y64B 3PURA 2YKSA 1XDPA 3NZQA 3C4ZA 4JBWF 4P0AA 3NKZA 2BKPA 2OLTA 4DR5T 2LT3A 2Q9QA 4DR4T 1KNRA 2QYWA 3K3OA 2Z6EA 2HPLA 2BG9A 2WP9A 3PUVF 1NAFA 2C0SA 2A9UA 5JVDE 1WR6A 4JV5T 2VQFT 2WM9A 3QC9A 2WSSV 3UQ4A 3EHZA 2D2SA 3PUWF 3SFEA 4HFBA 3C51A 5HXHA 4QWNB 3K8PC 2Q9QD 1ZV4X 2X9HA 2DNXA 2UXBT 3AE7A 5FL0A 4OYJA 3AVRA 3HA4A 3A7MA 1HS7A 2NW9A 5KXJA 4CQIA 4Z8XA 3ZMZB 3MJXA 4F6RC 2ZM0A 2A72A 5GONE 4AXPA 2LRLA 2H7VC 2E2AA 1N34T 3CQGB 2YINA 2N2NA 3EDVA 5AQOB 3GA8A 4M1PA 3ZCJA 3BQIA 5F8PA 3B57A 4OX9T 3N9MA 2E9XB 3FBLA 4X5TA 3AAAB 2LOSA 4QXHB 4U2YA 3E08A 4EB6E 4NXMT 2WZHA 4IE4A 3RKOA 2NW7A 2V7JA 4YTNA 2V5CA 5HEUA 2YDSA 5ABGA 4GKKT 5JDNA 3AXJA 2X66A 5JDGA 2PFVA 2K3WA 2WDQA 2PG8A 1CUNA 4TWHA 3TLVA 3ZJ2A 3K1SA 3PUYF 2CCQA 4PJJA 2DI4A 2FBWA 4KUMB 5JR9B 5L3EB 2CLYB 5L3FB 1E1HB 3NRXA 4QH5A 5HWYA 2HN2A 5F3JA 3JC6D 1M62A 4TWDA 3UTKA 4AQFA 3KFWX 3AEEA 3P50A 3FZHB 4PK4A 4O4HE 5JR9A 4NPPA 3QK6A 2IC9A 4O8SA 2WMNA 4EZHA 2I59A 4ZZBA 1V9DA 5HEGA 2KZ7B 4YTMA 3OVUA 2HH7A 4E7SA 1UK5A 2MBGA 3RPUA 4UXNB 1HNZT 1OEDC 3UQ7A 5LHGB 3AEDA 3O1HA 5LHIB 5DABA 1B7TA 3LJCA 4IDQA 4LF4T 4O2BE 2QGSA 3T1HT 3QB5A 4CXWA 2IC6A 3SS1A 2WS3A 2WMOA 4ZI2D 4UVBB 1KF6A 3J7Yq 3P7IA 4AKGA 4AKHA 5AQJB 1J5ET 4X20E 3JAFA 2JJ9A 3RIFA 1LKXA 5LMNT 4CI1B 4GYSA 2QRXA 5EK3A 2XTLA 5AQPB 1YQ4A 1WYCA 2AXDS 4TNWA 4HEAA 2CXLA 2X9XA 3PJAA 4WBOA 3DTOA 3AA6B 2D9DA 4LMKA 2OV9A 1MMGA 2W4XA 4LF6T 4LMLA 4UELA 4YTPA 4U7IA 1Z0PA 2H89A 5FP3A 4IE0A 2XQ7A 4B3TT 2DHRA 4JI6T 5HXRA 4KHPT 4H9RC 5HXEA 3GN5B 3L8RA 4CI2B 4EYYR 4ZI7E 1IBLT 4CN6A 1KNPA 2CXDA 3ETUA 3C50A 4DV0T 4DMVA 4ILAA 2I0MA 2W61A 3O4XE 2LOPA 4PJLA 4X62T 3I0QA 4HFIA 3GN5A 4H9SE 1J1JA 4U7YA 2XASB 2FJAA 3CPZA 1ZKEA 5BR8T 1W9RA 3ZMVB 4DV2T
chains in the Genus database with same CATH topology
4B3RT 1N34T 4LF5T 4DUZT 4LFAT 4DV7T 1I94T 4AQYT 4DV6T 4YY3T 4JI1T 4JI4T 4OX9T 4DR5T 1HR0T 4LFCT 4DR4T 4LF6T 1N32T 2UXDT 1IBMT 4DR2T 2E5LT 4LF9T 4LF7T 1XNRT 4NXNT 4X65T 4NXMT 1HNXT 1XMQT 4DV4T 5LMUT 4DR3T 1XMOT 2ZM6T 4B3TT 4LFBT 4JI6T 5IWAT 1HNZT 4JV5T 4KHPT 2VQFT 1XNQT 2F4VT 4JI0T 2VQET 4LF8T 3OTOT 4DV3T 1IBLT 2UUAT 4GKKT 2UUCT 4LF4T 4JI2T 4GKJT 4DV5T 3T1HT 2HHHT 1HNWT 4DR1T 4DV0T 4JI5T 4B3MT 4K0KT 4DV1T 2UXBT 4B3ST 2UUBT 4X64T 1N36T 4DUYT 4DR7T 3T1YT 1FJGT 4DR6T 2UXCT 1N33T 4X62T 1IBKT 4JI3T 1J5ET 4YHHT 4X66T 4JI8T 5LMNT 5BR8T 4JYAT 4JI7T 4DV2T 2UU9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R T;  1N34 T;  4LF5 T;  4DUZ T;  4LFA T;  4DV7 T;  1I94 T;  4AQY T;  4DV6 T;  4YY3 T;  4JI1 T;  4JI4 T;  4OX9 T;  4DR5 T;  1HR0 T;  4LFC T;  4DR4 T;  4LF6 T;  1N32 T;  2UXD T;  1IBM T;  4DR2 T;  2E5L T;  4LF9 T;  4LF7 T;  1XNR T;  4NXN T;  4X65 T;  4NXM T;  1HNX T;  1XMQ T;  4DV4 T;  5LMU T;  4DR3 T;  1XMO T;  2ZM6 T;  4B3T T;  4LFB T;  4JI6 T;  5IWA T;  1HNZ T;  4JV5 T;  4KHP T;  2VQF T;  1XNQ T;  2F4V T;  4JI0 T;  2VQE T;  4LF8 T;  3OTO T;  4DV3 T;  1IBL T;  2UUA T;  4GKK T;  2UUC T;  4LF4 T;  4JI2 T;  4GKJ T;  4DV5 T;  3T1H T;  2HHH T;  1HNW T;  4DR1 T;  4DV0 T;  4JI5 T;  4B3M T;  4K0K T;  4DV1 T;  2UXB T;  4B3S T;  2UUB T;  4X64 T;  1N36 T;  4DUY T;  4DR7 T;  3T1Y T;  1FJG T;  4DR6 T;  2UXC T;  1N33 T;  4X62 T;  1IBK T;  4JI3 T;  1J5E T;  4YHH T;  4X66 T;  4JI8 T;  5LMN T;  5BR8 T;  4JYA T;  4JI7 T;  4DV2 T;  2UU9 T; 
#chains in the Genus database with same CATH topology
 5JDH A;  2K24 A;  5HEJ A;  3NZP A;  4IE6 A;  2YN6 A;  4DUZ T;  2KMF A;  5L3D B;  2ZM2 A;  1YD8 G;  3RH3 A;  1LRZ A;  2X0Y A;  2XSA A;  5CFB A;  4LMJ A;  4I0U A;  2B76 A;  2X68 A;  5FXX A;  4OK0 A;  3ZLI A;  2W63 A;  5JTG A;  3RQW A;  2JQ9 A;  1WRD A;  2PTF A;  4DVD A;  1ZP0 A;  4ZEY A;  2BS2 A;  5L3G B;  3U3I A;  2ZM6 T;  4O4L E;  3C64 A;  4A98 A;  2BVL A;  1W0B A;  3PU3 A;  2VQE T;  4MHC A;  1D0X A;  2C5J A;  4GIW A;  3AEG A;  3I9Y A;  2UUA T;  5FNV E;  5FXZ A;  3Q5W A;  4ZXL A;  2NWB A;  2CHN A;  4H9P C;  4MFR A;  3UUM A;  4PJN A;  1FEW A;  2DL1 A;  2KT9 A;  3KV4 A;  3CIR A;  1ZEE A;  1VCS A;  2LJL A;  2X51 A;  2IDO B;  3HL6 A;  1KK7 A;  2VK9 A;  5LB7 B;  4CN1 A;  3C4X A;  2L9Q A;  2DWG A;  4X1I E;  2M67 A;  4OFZ A;  2BG9 E;  4DID B;  3EI0 A;  3H3M A;  3ZSS A;  4ZI2 C;  1WYB A;  2SPC A;  4JYA T;  4G2A A;  2MTQ A;  4EOZ B;  3ONL C;  2JQQ A;  4EYU A;  4U72 A;  1JNZ A;  4LF5 T;  3N2G E;  3HR0 A;  3N9N A;  4ERR A;  3H37 A;  4KX6 A;  3AE9 A;  3WAJ A;  3ZN1 B;  3Q9D A;  4YY3 T;  3PTR B;  2VKD A;  3OYX A;  3FZK B;  4TV8 E;  1OED A;  3AEA A;  2VUR A;  3RC8 A;  4ISS A;  2IHR 1;  2JQH A;  5LJM A;  1IJ6 A;  2GK9 A;  4BJM A;  1IBM T;  2RPA A;  1HG5 A;  4IL9 A;  4HWD A;  3K3Q C;  1FIO A;  3QNU A;  3T8O A;  4GK0 E;  2WCA A;  2LM9 A;  4LFB T;  5FY1 A;  5H6R B;  3AE4 A;  3AA1 B;  3FZL B;  2JIW A;  1U4Q A;  2BVM A;  2LM2 A;  2NW8 A;  1HCI A;  4ZZC A;  3C98 B;  2Y48 B;  4L5G A;  4H63 H;  4C90 A;  1WR0 A;  4HWH A;  4AIU A;  3CQC B;  3AB3 B;  3LBX B;  1X79 A;  2MOZ A;  4DUY T;  1JNR A;  4KHZ F;  3HKD E;  5JRE A;  2VAS A;  1UX5 A;  3ESL A;  4C91 A;  3V5U A;  2V26 A;  3VHL A;  3PUA A;  1G73 A;  5HXC A;  3UT5 E;  2NOX A;  5FXW A;  2ZLY A;  1SE7 A;  4YSY A;  2ACX A;  2AE9 A;  4TX5 A;  2B1E A;  4Q25 A;  1OXZ A;  5AFU L;  2CM0 A;  3LBX A;  3PU8 A;  3ETV A;  2D5U A;  1XWM A;  3P8C D;  1MND A;  4IHJ E;  4NUU A;  2CWY A;  3BQL A;  3I0O A;  2V6Y A;  2ZM8 A;  5DJQ C;  3IHR A;  5CGM A;  5IHY A;  5LBQ B;  1UGO A;  4HTE A;  2JRK A;  3DP7 A;  5L2L A;  1HR0 T;  4CN4 A;  2CMR A;  4V1A v;  3UU8 A;  2HPJ A;  4IL4 A;  1YQ3 A;  4JEU B;  1MNE A;  1SUM B;  4EV6 A;  3EUH A;  4PJM A;  1XMQ T;  4O4I E;  3ANW B;  5J0Z A;  3ONJ A;  3AXJ B;  4LF8 T;  4F8H A;  1WCR A;  5AQS B;  2JPF A;  4ZS3 A;  1KEY A;  4HFH A;  2Y6X A;  3FB2 A;  1BR0 A;  2H88 A;  2YDQ A;  4UIG A;  3KIN B;  4I50 E;  5KDM C;  3AEC A;  2IIU A;  2LEH A;  2XQ6 A;  4EXT A;  3AE5 A;  3ANW A;  2W0G A;  2J62 A;  4U74 A;  3AE1 A;  2WWV A;  1IZN B;  4FJO A;  4WBN E;  2UXN B;  2G0U A;  2NTX A;  4UVC B;  4JI3 T;  4YHH T;  2CEA A;  2ACZ A;  3LK4 2;  2X9Y A;  4JI8 T;  3UU3 A;  1CHU A;  1BR1 A;  4EED A;  4IDO A;  1MMN A;  3SOL A;  2MYS A;  2WDV A;  5IYZ E;  1W0A A;  2LSY A;  3RX6 A;  4LFA T;  4DO0 A;  4XBF B;  2V7L A;  2K48 A;  5BMV E;  2VWA A;  4KBM B;  1E2A A;  3ZKR A;  4YLH A;  4DMW A;  4ZI3 C;  4J2C A;  5ABE A;  2BBH A;  4HWI B;  4QX8 B;  2LKH A;  1D1B A;  5AQU B;  3CML A;  2VB6 A;  4N78 D;  3E22 E;  4LF7 T;  5FL1 A;  4O2A E;  2XM2 A;  5HEO A;  2H3R A;  3ZT5 A;  5AQG B;  3UUN A;  4YSZ A;  1HTJ F;  3F31 A;  3PDY A;  3Q5D A;  3OTO T;  2DWK A;  5HAX A;  2VL8 A;  1H7C A;  3FXE B;  3UU6 A;  4JI2 T;  3O1J A;  4QHO A;  4DV5 T;  4EEB A;  3CKD A;  2JMK A;  2LRK A;  3M3Z B;  1N36 T;  4DR7 T;  1FJG T;  4IRE A;  2XAQ B;  2LSG A;  3ZPO A;  2WDR A;  4QXB B;  3FZM B;  3HKE E;  4IIJ E;  5TAO A;  4AKI A;  4P0B A;  4JI7 T;  2XSB A;  3MXZ A;  4DBQ A;  3KBU A;  4UEM A;  3TLU A;  2PJQ A;  4HE8 A;  2J47 A;  5CA1 E;  4G63 A;  4TV9 E;  4KP3 C;  1Z8U A;  4AQY T;  3OJA A;  2ZMA A;  2V7I A;  3ZJ1 A;  3ZEF B;  3RKG A;  5C2T A;  2XM1 A;  4AKR B;  4IDP A;  3C4W A;  2XHE B;  4KI0 F;  4BAY B;  3A5X A;  2WY2 A;  4AKL A;  5LYJ E;  2K5B B;  2W2U A;  1HNX T;  3QB5 K;  3UFE A;  4HFV A;  3FXD B;  5ETW A;  5CJ5 A;  3GMI A;  2XJ7 A;  2N9D A;  1WLX A;  2XQ4 A;  1KNZ A;  3RYI E;  1GQE A;  3RYH E;  4CXX A;  4B3M T;  2L8K A;  5LG3 A;  4E7Z A;  2P9B A;  2UUB T;  1VOM A;  1J5W A;  1IAP A;  3IA3 A;  2UXC T;  1E7P A;  1N33 T;  3HKB E;  4PFO A;  1HX1 B;  3CQX C;  3N9L A;  1KFY A;  1YKH B;  3MZK B;  2NP9 A;  5KMG P;  5CA0 E;  4HN9 A;  4WW0 A;  4PK5 A;  3A8Y C;  2XPK A;  5HEH A;  3ZN0 B;  2J4G A;  1XZY A;  2XQ9 A;  3P4Q A;  5FVL A;  2UU9 T;  4MBQ A;  3QOF A;  5JDM A;  2CA5 A;  4YT0 A;  5KX5 E;  2XQA A;  3DJB A;  2LSK A;  2JMH A;  4OYK A;  3Q5X A;  5JRC B;  5LG4 A;  1DU2 A;  3MK7 C;  4AQG A;  5AQF B;  3N2K E;  5E0O A;  1Y01 A;  3B13 A;  2CHO A;  4AI6 A;  3V5S A;  4YSX A;  4TZ4 C;  2W67 A;  5LOV E;  5DQW A;  4PK6 A;  4PFP A;  1AJ3 A;  5JRC A;  2WZI A;  2E9X C;  4P09 A;  1LVF A;  4FI5 A;  3HKC E;  3L39 A;  1UX4 A;  1NWM X;  1FMV A;  2ODU A;  5FYM A;  3UU5 A;  3ZYK A;  2LHR A;  4A97 A;  3J9X 1;  5AQV B;  1OED E;  3IF8 B;  3P4S A;  2UXX B;  3ONX A;  5LJN A;  3M65 A;  3P4W A;  2NTY A;  3U78 A;  2FUP A;  1SHZ C;  2BS4 A;  4U33 A;  3MAC A;  5AQR B;  1HX8 A;  5HCJ A;  1T72 A;  4H9O C;  4TN7 B;  3OKQ A;  3AAI A;  5LGU B;  4HWF A;  1VCT A;  1X9B A;  3TKL B;  4B3R T;  3X1D A;  4QX7 B;  3RLF F;  3KBT A;  2LLY A;  3LG7 A;  1UCU A;  2BDE A;  4COF A;  5DQV A;  1OED B;  3BQK A;  5IUX A;  3PE0 A;  5F5W A;  2Y8D A;  2MAW A;  3RI5 A;  2WB5 A;  4U31 A;  1SA0 E;  3NWI A;  3NRY A;  5AQT B;  4ZI3 D;  3KVA A;  3OPC A;  3ZMT B;  5LGN B;  3KV6 A;  4EGW A;  4I4T E;  4I55 E;  4IT4 A;  5FXV A;  3AVS A;  4DR3 T;  2XQ8 A;  5FMN A;  3H3A A;  5FKY A;  4CZZ B;  2H7O A;  5LNK A;  2DLR A;  1MIV A;  3N9Q A;  5JH7 E;  2LSI A;  5M4Y A;  2YU2 A;  4UF0 B;  1W09 A;  2HN1 A;  2R6G F;  5LCY A;  1T8B A;  3RRW A;  5AQK B;  4H9N C;  1S35 A;  3O9X A;  4X1Y E;  2K9A A;  4IDZ A;  3PUX F;  4Z91 A;  5LGT B;  1IBK T;  4ZS2 A;  5AQQ B;  3I9W A;  3FBZ A;  2LE8 A;  3KV9 A;  4UF0 A;  1MMA A;  3VRB A;  2L3L A;  4GOU A;  2VKO A;  3ZMU B;  2FJE A;  3RQU A;  2ODV A;  3N9P A;  2XQ5 A;  2YK0 A;  2YU1 A;  2V6Y B;  4OHF A;  4B6X A;  3TLS A;  4JI1 T;  2CWO A;  2YEV C;  5HXS A;  4MAL A;  2M6I A;  3ZST A;  1VRB A;  2E8I A;  3G06 A;  1XDO A;  2UXD T;  2X67 A;  4PW8 A;  1UUR A;  2E5L T;  2IUB A;  2YOE A;  1XNR T;  4NXN T;  5L3C B;  3JCF A;  3N5L A;  3AE2 A;  3AEB A;  2XAJ B;  5LMU T;  3RHW A;  3VRA A;  3LK3 B;  1US7 B;  4O4J E;  3PJA J;  1XNQ T;  2BKN A;  4DV3 T;  5ABH A;  4EIW A;  2RP4 A;  4K0U A;  3JAE A;  1HF8 A;  5LA6 E;  1S94 A;  2D0T A;  3PUQ A;  4IE7 A;  2HHH T;  4YJ3 E;  5C8Y E;  2CRB A;  5AQH B;  4K0K T;  4EZ4 A;  3PUG A;  5AQM B;  5HCM A;  2CXF A;  2BZB A;  3R84 B;  2BS3 A;  4IGU A;  3UFG A;  5EZY E;  4QKN A;  4L9I A;  2VKH A;  4H9Q C;  5FY0 A;  1YKE B;  4ADZ A;  3RIU C;  2QA7 A;  3F57 A;  4ILB A;  3KV5 A;  2XQY A;  3EAM A;  3RRC A;  3ZC0 A;  2BBJ A;  4ANJ A;  2WU2 A;  4DV7 T;  4HFC A;  2A2F X;  5CB4 E;  3UUX B;  2KLQ A;  4QH4 A;  5HWX A;  4JI4 T;  5EK2 A;  3TLW A;  2ES0 A;  4KMC A;  5J1G A;  3NVO A;  4HFD A;  4JLE A;  3CX8 B;  1ZOY A;  1I6Z A;  1N32 T;  1EZ3 A;  2E9X A;  5FVK A;  2C5K T;  2EHO C;  5HYA A;  2IAK A;  4YFS A;  4X65 T;  1YW0 A;  2VVN A;  4HWC A;  4DV4 T;  1XMO T;  3MKD A;  4YHJ A;  5LXT E;  2V6X A;  5AQI B;  5IWA T;  4JI0 T;  4I43 B;  1YXR A;  2XAG B;  3VR8 A;  3CX7 B;  3RC3 A;  5L47 A;  2X0L B;  1HNW T;  3VKH A;  3QUJ A;  2E9X D;  4DR1 T;  4BA9 A;  3VR9 A;  3CK6 A;  2X9W A;  4GYR A;  3ZYL A;  3E0Z A;  4TNV A;  3UU4 A;  1HG2 A;  4A56 A;  1FMW A;  3EDU A;  3S4U A;  3SFD A;  5LHH B;  2LSJ A;  4XZC A;  4PNI A;  2CBJ A;  4A5X A;  4YJ2 E;  2RA1 A;  4L0R A;  1T7S A;  1D1C A;  4ILU A;  3ZCI A;  3Q5E A;  4WNK A;  4U3C A;  2J1D G;  2V8S V;  2FJD A;  2XAF B;  4LFC T;  4LF9 T;  1IJ5 A;  4UV8 B;  2V7K A;  1M7K A;  4BJN A;  2WU5 A;  4ASK A;  2W00 A;  3F2E A;  1D0Z A;  3CX6 B;  3FZF B;  3VU7 H;  3KVB A;  2N1G A;  3ABV A;  5AQL B;  4UV9 B;  2V7M A;  1QUU A;  1MIW A;  1NEK A;  2F4V T;  2Q9Q C;  2CE7 A;  1HFA A;  3VKG A;  2UUC T;  3LDQ B;  4XAX B;  1G8X A;  2KWI B;  4TWF A;  2JQK A;  3PUS A;  2PBI A;  2BG9 C;  4JEH B;  4JI5 T;  4DV1 T;  2CBI A;  2V1D B;  5ADX L;  4UVA B;  5LP6 E;  4X64 T;  4UR9 A;  3L3P A;  4DR6 T;  2VL0 A;  3ZYM A;  4NUV A;  1O3X A;  3PUZ F;  3O1I A;  2KND A;  1R8I A;  4IDN A;  3AAE B;  2E5V A;  4X1K E;  3OYZ A;  2X0H A;  5J2T E;  3N2O A;  3BK9 A;  4IST A;  3B5M A;  2D0U A;  4ZOL E;  1D0Y A;  3FHN A;  3P4P A;  2W62 A;  2XAH B;  4HFE A;  5ABF B;  2YDR A;  1NEN A;  3AA7 B;  2XUE A;  1T98 A;  3KDS E;  2KSR A;  3NBX X;  2XQ3 A;  3HI2 A;  4DND A;  1MMD A;  3ZMS B;  1MIY A;  3RF1 A;  5JDQ A;  3I1A A;  3TLT A;  5FY7 A;  4AIS A;  2IML A;  4GK5 E;  3RYC E;  4WYV A;  5ABF A;  3EAB A;  4YXD A;  1QLB A;  2DCF A;  2MPK A;  4Z90 A;  3SRZ A;  3N9O A;  3RYF E;  3LFM A;  3MA9 A;  3D0T A;  3P4R A;  5H6Q B;  5EK4 A;  4U2Z A;  1L0V A;  4DBR A;  2C5I T;  1U5P A;  3RIU A;  3AE6 A;  4NIQ A;  4HGA A;  5JDF A;  1QSD A;  3L09 A;  4B3S T;  2KWH A;  2EHO B;  4WZX A;  3UUB A;  4IE5 A;  3OBV E;  2VKJ A;  3JC6 C;  3LK2 B;  3AE3 A;  4ZHQ E;  4ILC A;  3SWH A;  2XY8 B;  5A1L A;  4HKA A;  3Q2M A;  3GWH A;  3IEE A;  1WFD A;  4JUY A;  4CI3 B;  2WBL A;  2EHO A;  1I94 T;  3CWZ B;  4DV6 T;  4P1N A;  2IW5 B;  5L3B B;  2KIN B;  2KXP B;  1OWA A;  5JQG E;  3UUL A;  2WAU A;  4AQF C;  4MLK A;  5J2U E;  3RGL A;  2A3D A;  3PV0 F;  4DR2 T;  3CVR A;  3EVY A;  2QVA A;  2I6H A;  3R6N A;  1BR2 A;  2VVS A;  3ZC1 A;  5JR9 C;  2CLY C;  4QH1 A;  3IBP A;  2EHO D;  3WAK A;  3K3N A;  3AA0 B;  4QXC B;  2WWU A;  2V5D A;  2M6B A;  1BR4 A;  1ZHC A;  2LHN A;  5JDL A;  4H63 V;  3ZT7 A;  3JAD A;  4GKJ T;  2W66 A;  5C3J A;  2NR4 A;  3W15 B;  2LKG A;  2FJB A;  5L4H A;  3RIA A;  3WI3 A;  1LVK A;  5L4E A;  3T1Y T;  4EAH A;  2WQY A;  4CXY A;  3AEF A;  2Q9Q B;  4X66 T;  5LBM A;  2XZE A;  4TUY E;  4PAG A;  2OA5 A;  1D1A A;  1UUS A;  3ZT6 A;  3AE8 A;  2BG9 B;  2CPT A;  3LSV A;  5AQN B;  2BKO A;  1Y64 B;  3PUR A;  2YKS A;  1XDP A;  3NZQ A;  3C4Z A;  4JBW F;  4P0A A;  3NKZ A;  2BKP A;  2OLT A;  4DR5 T;  2LT3 A;  2Q9Q A;  4DR4 T;  1KNR A;  2QYW A;  3K3O A;  2Z6E A;  2HPL A;  2BG9 A;  2WP9 A;  3PUV F;  1NAF A;  2C0S A;  2A9U A;  5JVD E;  1WR6 A;  4JV5 T;  2VQF T;  2WM9 A;  3QC9 A;  2WSS V;  3UQ4 A;  3EHZ A;  2D2S A;  3PUW F;  3SFE A;  4HFB A;  3C51 A;  5HXH A;  4QWN B;  3K8P C;  2Q9Q D;  1ZV4 X;  2X9H A;  2DNX A;  2UXB T;  3AE7 A;  5FL0 A;  4OYJ A;  3AVR A;  3HA4 A;  3A7M A;  1HS7 A;  2NW9 A;  5KXJ A;  4CQI A;  4Z8X A;  3ZMZ B;  3MJX A;  4F6R C;  2ZM0 A;  2A72 A;  5GON E;  4AXP A;  2LRL A;  2H7V C;  2E2A A;  1N34 T;  3CQG B;  2YIN A;  2N2N A;  3EDV A;  5AQO B;  3GA8 A;  4M1P A;  3ZCJ A;  3BQI A;  5F8P A;  3B57 A;  4OX9 T;  3N9M A;  2E9X B;  3FBL A;  4X5T A;  3AAA B;  2LOS A;  4QXH B;  4U2Y A;  3E08 A;  4EB6 E;  4NXM T;  2WZH A;  4IE4 A;  3RKO A;  2NW7 A;  2V7J A;  4YTN A;  2V5C A;  5HEU A;  2YDS A;  5ABG A;  4GKK T;  5JDN A;  3AXJ A;  2X66 A;  5JDG A;  2PFV A;  2K3W A;  2WDQ A;  2PG8 A;  1CUN A;  4TWH A;  3TLV A;  3ZJ2 A;  3K1S A;  3PUY F;  2CCQ A;  4PJJ A;  2DI4 A;  2FBW A;  4KUM B;  5JR9 B;  5L3E B;  2CLY B;  5L3F B;  1E1H B;  3NRX A;  4QH5 A;  5HWY A;  2HN2 A;  5F3J A;  3JC6 D;  1M62 A;  4TWD A;  3UTK A;  4AQF A;  3KFW X;  3AEE A;  3P50 A;  3FZH B;  4PK4 A;  4O4H E;  5JR9 A;  4NPP A;  3QK6 A;  2IC9 A;  4O8S A;  2WMN A;  4EZH A;  2I59 A;  4ZZB A;  1V9D A;  5HEG A;  2KZ7 B;  4YTM A;  3OVU A;  2HH7 A;  4E7S A;  1UK5 A;  2MBG A;  3RPU A;  4UXN B;  1HNZ T;  1OED C;  3UQ7 A;  5LHG B;  3AED A;  3O1H A;  5LHI B;  5DAB A;  1B7T A;  3LJC A;  4IDQ A;  4LF4 T;  4O2B E;  2QGS A;  3T1H T;  3QB5 A;  4CXW A;  2IC6 A;  3SS1 A;  2WS3 A;  2WMO A;  4ZI2 D;  4UVB B;  1KF6 A;  3J7Y q;  3P7I A;  4AKG A;  4AKH A;  5AQJ B;  1J5E T;  4X20 E;  3JAF A;  2JJ9 A;  3RIF A;  1LKX A;  5LMN T;  4CI1 B;  4GYS A;  2QRX A;  5EK3 A;  2XTL A;  5AQP B;  1YQ4 A;  1WYC A;  2AXD S;  4TNW A;  4HEA A;  2CXL A;  2X9X A;  3PJA A;  4WBO A;  3DTO A;  3AA6 B;  2D9D A;  4LMK A;  2OV9 A;  1MMG A;  2W4X A;  4LF6 T;  4LML A;  4UEL A;  4YTP A;  4U7I A;  1Z0P A;  2H89 A;  5FP3 A;  4IE0 A;  2XQ7 A;  4B3T T;  2DHR A;  4JI6 T;  5HXR A;  4KHP T;  4H9R C;  5HXE A;  3GN5 B;  3L8R A;  4CI2 B;  4EYY R;  4ZI7 E;  1IBL T;  4CN6 A;  1KNP A;  2CXD A;  3ETU A;  3C50 A;  4DV0 T;  4DMV A;  4ILA A;  2I0M A;  2W61 A;  3O4X E;  2LOP A;  4PJL A;  4X62 T;  3I0Q A;  4HFI A;  3GN5 A;  4H9S E;  1J1J A;  4U7Y A;  2XAS B;  2FJA A;  3CPZ A;  1ZKE A;  5BR8 T;  1W9R A;  3ZMV B;  4DV2 T; 
#chains in the Genus database with same CATH homology
 4B3R T;  1N34 T;  4LF5 T;  4DUZ T;  4LFA T;  4DV7 T;  1I94 T;  4AQY T;  4DV6 T;  4YY3 T;  4JI1 T;  4JI4 T;  4OX9 T;  4DR5 T;  1HR0 T;  4LFC T;  4DR4 T;  4LF6 T;  1N32 T;  2UXD T;  1IBM T;  4DR2 T;  2E5L T;  4LF9 T;  4LF7 T;  1XNR T;  4NXN T;  4X65 T;  4NXM T;  1HNX T;  1XMQ T;  4DV4 T;  5LMU T;  4DR3 T;  1XMO T;  2ZM6 T;  4B3T T;  4LFB T;  4JI6 T;  5IWA T;  1HNZ T;  4JV5 T;  4KHP T;  2VQF T;  1XNQ T;  2F4V T;  4JI0 T;  2VQE T;  4LF8 T;  3OTO T;  4DV3 T;  1IBL T;  2UUA T;  4GKK T;  2UUC T;  4LF4 T;  4JI2 T;  4GKJ T;  4DV5 T;  3T1H T;  2HHH T;  1HNW T;  4DR1 T;  4DV0 T;  4JI5 T;  4B3M T;  4K0K T;  4DV1 T;  2UXB T;  4B3S T;  2UUB T;  4X64 T;  1N36 T;  4DUY T;  4DR7 T;  3T1Y T;  1FJG T;  4DR6 T;  2UXC T;  1N33 T;  4X62 T;  1IBK T;  4JI3 T;  1J5E T;  4YHH T;  4X66 T;  4JI8 T;  5LMN T;  5BR8 T;  4JYA T;  4JI7 T;  4DV2 T;  2UU9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...