1T98A

Crystal structure of mukf(1-287)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
274
structure length
266
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
publication title The MukF subunit of Escherichia coli condensin: architecture and functional relationship to kleisins.
pubmed doi rcsb
source organism Escherichia coli
total genus 100
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t98A01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1t98A02
2L01A 1XGMA 1U5TA 2FMLA 3GW2A 4OMZA 2ESHA 3F23A 1FP1D 1Q1HA 1UHWA 2V79A 4EVIA 1CF7B 4O5VA 4P9UA 1FBSA 3WTYC 3WG9A 3BJOA 2XAFA 3E6DA 3K9TA 4OIOF 1KU2A 1FPQA 3KP6A 1ZN2A 4OOIA 3LWFA 2RNJA 5KVRA 2F5EA 4HV5A 2FMYA 3BJ6A 1ON1A 1FT9A 3TDZC 3B73A 4M9ZA 2EK5A 2XUBA 1O7LA 3BWGA 4IRHA 1IXCA 2ZNZA 4G8XA 3V8LA 3LA2A 2MA3A 1P2FA 1TW3A 1J59A 2W84A 5D4SA 5J8CA 1TLHB 1LDJA 1QZZA 2J5PA 1FNNA 3PFIA 3RDIA 1O7FA 2MH9A 4GCVA 3V8JA 2CYYA 5JR3A 2JSCA 4A6EA 3RKYA 1G3YA 1FWZA 3CTAA 4WWCA 4WCGA 1QNTA 4HLXA 2GQQA 2V6CA 2BBYA 1TQMA 5FD5A 1PUEE 5ILSA 1FYMA 2EV6A 2NNYA 2V1XA 1XD7A 5BMZA 4OINF 3E5UA 2ELHA 1I27A 2MLKA 2R3SA 5DEQA 5E1XA 5E8IA 4IRIA 4NHJA 1B6AA 1HW5A 2PFBA 3MCZA 4M6YA 3ZQ7A 3O2PE 4EGZA 2RQPA 3F3XA 2FA5A 2M1BA 2YX7A 4HX7A 1EH6A 2L54A 1UHMA 2NYXA 4G94A 1KU7A 3D5LA 5CVUA 1HKSA 3BJAA 1BI2A 3MEXA 4AD9A 3GZ6A 1LNWA 4I01A 3GXOA 3HSRA 2RDPA 2ZBKA 1W5SA 2CGPA 3CO6C 3N97A 4BAYA 1T2KA 5DUKA 5HLIA 2QWWA 4LJZF 4RGSA 2JT1A 3CUOA 4WXHA 4EJVA 2VBZA 4EGYA 1IN5A 1SD7A 1ZYRF 2HTJA 2V9VA 2NAZA 1S7OA 5FO5A 1O3QA 5ICEA 4ESFA 4A0ZA 2XKOA 4L18B 3R0AA 3MQ0A 1IN6A 3TO9A 4HF0A 3ZMVA 3R6SA 3IHUA 1P4WA 2ISYA 1HW1A 1REPC 2K7LA 2W85A 3WE2A 1IF1A 3DFGA 2A6HF 4WF2A 3WTXC 4WK8F 5BOXA 3PQKA 1ZG3A 2XROA 1LQ1A 4P55A 3M1EA 3DPLC 5ERIA 3GFJA 2DAOA 3M8FA 3QAHA 5TRDA 1QQIA 2O03A 5ILUA 1BI1A 3GFIA 2HFHA 4CICA 4KNYA 3P7NA 4ZH4F 2DQRA 2STWA 2GXGA 3D0SA 3V7SA 1ZREA 3TO6A 3PQJA 1O57A 1IZ1A 1HW2A 1J5YA 4ZYHA 4UVBA 2M8EA 3CDHA 4XRFA 3MFKA 3IC7A 2D1HA 5FLXZ 1R1VA 3FM5A 1LEBA 3BDDA 4EJUA 3KETA 4DQ2A 1SFEA 5D4RA 1BBYA 2F2EA 5K1YA 2AXLA 2MC3A 2P5KA 3NRVA 5D6FA 4OIPF 1FBQA 1S7AA 2CSOA 4AIJA 3R4KA 2ZFWA 3Q9SA 2VE8A 1BJAA 1R36A 5EEGA 4HV6A 5FD6A 1FC3A 4LD5A 2D2WA 3WTUC 3K1PA 3KP2A 1W7PB 5CVJA 4KA4A 4BQAA 3J7AO 2YU3A 3L9FA 4HDUA 4KN4X 2YPRA 5BPDA 1H9TA 2IPQX 5CVRA 2PJPA 3ZPLA 2FEZA 1QPMA 3QP6A 3W6KB 2PI0A 4IXAA 2QQBA 1PP7U 2ZXJA 3I54A 3ZP5A 1IAWA 2M87A 3U2RA 5E20A 3GFMA 4BYYA 3ERED 1IN8A 1UCRA 1K79A 3RTRA 2V1UA 4K2EA 1MDMB 5LHGA 4CXFA 4HOBA 2PLYA 3JTGA 1HQCA 1O3SA 2O61A 3GZ5A 3I71A 2EWNA 4A6DA 1GXQA 5K5OA 4ENMA 2HYGD 2XHKA 1BN5A 3GX4X 1KQ9A 5AIQA 4R1HA 4Q4ZF 1P4AA 3WTVC 1W7PD 5CJ9A 4RB0A 3I64A 4QLCU 4MNUA 1RZ4A 1T6SA 2W57A 5J8FA 1ZG5A 1YG2A 1FOKA 5LLQA 4U0WA 4AIKA 2MD5A 3E6CC 2VBWA 1STZA 1J2XA 4MEXF 2VODA 2KRFA 1BI3A 2A68F 4U7BA 4U0YA 1A04A 3QPHA 2EFOA 5K5RA 5LRSA 1V4RA 2PEXA 1KQ0A 5E8GA 5DV5A 4JQFA 2ETHA 3JW4A 2PBIA 3NQOA 4Q47A 5AONA 1ZRFA 3R60A 2FOKA 2IRFG 2JPCA 5DYMA 5DCMB 2OZUA 2QVOA 1K6OA 1HBXG 1Z05A 1XMKA 2QENA 1GVJA 2DO7A 3FM3A 3F8NA 5F6FA 2HZTA 3M9AA 4Y17A 1AOYA 1B59A 5E17F 4M73A 2WV0A 1YFHA 4LLNA 1YIOA 2HKOA 3TO7A 3M8EA 5D5UB 2LF8A 3JSOA 4LLLA 3WTSC 1KU3A 3GEZA 2FRHA 2Y48A 4CYDA 2RC4A 3FXUA 4BHBA 4Z2YA 5DDGA 1SMTA 2OQRA 2F5CA 4KT5C 2QYOA 3P9CA 1R58A 2EB7A 1UB9A 3O3KA 2PMUA 4ENJA 1XGOA 4MQVA 3FZVA 5BQTA 4P96A 2E1NA 2M45A 3SQNA 1S29A 5J6XA 2IW5A 4L9NA 3COAC 2FE3A 2QBYB 1IXRC 3GYHX 1R22A 2M5WA 2CFXA 1JHFA 3F8FA 1YTYA 3DQVC 4RGXA 3N4MA 1ZAOA 3J80Z 1XN7A 4YIIA 1FSEA 3LA7A 1ZH5A 1FSHA 3WTWC 4E70A 2H09A 3J81K 1KU9A 3ZMDA 2ZMEA 4Q5SF 1QZYA 1MGTA 2WC2A 3DXJF 5L3EA 2QM3A 3L2CA 4XSXF 3T1BA 2GXBA 1BOAA 4YFXF 2STTA 3FMSA 4KYWA 3DPTA 2FF4A 1MJ9A 3OOPA 2P8TA 2OU2A 2Z3YA 1OYWA 2LDUA 4LG0A 2LNBA 4HYEA 1WI9A 5IT9K 3SZPA 2C6YA 3LQRA 1RIOH 3AAFA 3R61A 3TQNA 3SFZA 2RKHA 3U1DA 2H27A 4AIHA 4IF4A 5HS7A 5L3GA 1P6RA 2XAQA 3HHGA 1DPUA 2HS5A 3QOPA 1P92A 1FLIA 3F6OA 2FSWA 3SXYA 4ON0A 2KKOA 2CO5A 2VC1A 3JAMK 4BXUA 4A12A 2RGVA 2P4WA 4LB6B 1G3SA 1G3WA 1B1BA 4IJAA 5D8KB 1ON2A 1XGNA 4BHCA 1U8RA 4CZZA 3T0YA 2ZO4A 4CDGA 2EFQA 1O3TA 3QPTA 3K1NA 3CLOA 3DKWA 1O3RA 5AIPA 1VTNC 2GA1A 4KDPA 4KMFA 3FX3A 5HS9A 1YQAA 1F5TA 1MKMA 1KA8A 3FXRA 4HZFA 2DTRA 2JPBA 4HAMA 5LHIA 1J0RA 3G3ZA 3GVAA 2OAZA 5HDNA 4NQWA 1H0MA 5FFXA 1W5TA 1TW2A 5A2QZ 4LLGF 2VC0A 2O0YA 4I0AA 4IPAA 4YFNF 1TTYA 4MQ9F 3I5UA 4GYIA 3K1MA 5L3BA 1KGSA 3LAJA 3BOQA 2GWRA 1R23A 5HLGA 1FX7A 4LK1F 2A3SA 3L09A 2BGCA 4EQQA 3CO7C 3DV8A 3T5XA 3ROUA 4M9SA 4A0YA 5FFZA 3WTTC 2VOPA 2A5YB 2BYVE 2EJRA 2VT3A 3TDUC 2VN2A 5JI6A 3ECOA 1USSA 3C18A 4GYGA 3HYIA 1XSDA 3LQQA 4KFCA 4FHTA 4ESBA 1I1SA 2ISZA 2YSRA 4M9XA 1OYIA 2Z33A 4B8XA 2K02A 1JHHA 1HKTA 5HOOA 4G7HF 3GUDA 1ONVA 2FU4A 3F8BA 3WU0A 2D45A 3DP7A 1D8KA 1F4KA 2O6GE 2BE5F 3GO5A 1TBXA 5JHUA 2XIGA 3T8RA 4ENKA 1UFMA 1XSXA 3RJPA 1K78A 2A69F 4D0PA 3U9GA 1B9MA 2OA4A 5D8LB 5ILVA 2O8XA 4ETSA 2Q8KA 1R5HA 1WSUA 2ZKZA 2DPUA 2P7CB 3NEUA 4G9YA 2XKPA 2VXZA 2GAUA 1FY7A 2XAGA 1ZGAA 1YW9A 4ZZDA 2UZKA 1T39A 2OZ6A 2CQKA 4YG2F 1IXSB 5HS8A 3BY6A 2NRAC 4YIFA 1IN7A 2CG4A 1OYYA 1HXDA 4WXDA 5ICCA 5L3FA 4UXNA 4IHSA 1RI7A 1G3TA 3T8TA 5DD4A 3ABUA 1CF7A 3KCCA 3TGNA 4A5NA 1AWCA 1HSJA 4GO1A 2DK5A 4R79A 3WODF 5F1RA 4M71A 4OIRF 1TQPA 4F7ZA 4HF1A 4U7DA 2OBPA 1Z7UA 3CUQC 3FXQA 2E7XA 1QGPA 1JE8A 3I59B 4L9TA 1U3EM 2P5VA 3FMQA 3VODA 2HOEA 5LGNA 4EM2A 1Z6TA 2Q0OA 1BIAA 2J5OA 5LEJA 1L0OC 4L5IA 2FBKA 2R7DA 4U0VA 3HOTA 2ESNA 5IT9Z 2HWVA 3KP7A 1T98A 4I7HA 1QO0D 1U5TC 3HSFA 3CUQB 4UUVA 2UXNA 3HTSB 1XB4A 3E5XA 3QU3A 3KEQA 1LDKB 2K27A 5FB2A 2QLZA 3QRFF 2DT5A 2A61A 3P9KA 1U5TB 4EJOA 3JAMZ 4EV0A 5K5QA 1BI0A 4A0XA 4PGGA 3HIFA 5H6RA 1ZRCA 1J75A 3DF8A 4ESJA 1LDDA 2OQGA 1OPCA 2P7VB 4PDKA 1YYVA 5BS6A 2D1VA 2Q2EA 3IKTA 2CWEA 2E7WA 1Y0UA 4N0BA 1FP2A 2HDCA 1YLFA 4HF2A 1BIBA 2HKXA 3KE2A 2F5DA 2DQLA 2HQRA 3IWZA 1T38A 2HGCA 2XAHA 1R00A 3HRSA 2K4BA 1WRJA 2TDXA 1XCBA 1E17A 4KIBA 5L3CA 1PP8F 2DI3A 4IHTA 1RUOA 1FZPB 5JVTA 2O3FA 1GXPA 4RS8A 4EJTA 3WE3A 3V8KA 1I6XA 1P4XA 4Y15A 2Y75A 1R5GA 4I98B 4RB2C 4LK0F 4CHUA 3RIRA 3IL2A 1F1ZA 3SHFA 3FHZA 3VOEA 1ZARA 1EV7A 4I02A 3LAPA 1ZLKA 1EH7A 2A6EF 2QZ8A 3TOAA 2RN7A 3VFZA 2BV6A 2KIMA 5FLXK 3QP5A 4LMYA 3V7CA 3BROA 2JRTA 2F5FA 3TOBA 2IA0A 4M6XA 2VBYA 4KICA 3OV8A 2NNNA 3ZMSA 5E1WA 1RUNA 4I0BA 4XLNF 3JSPA 2P6TA 3I4PA 2UXXA 2X0LA 1XSVA 2MLGA 2L02A 2VT2A 4RAZA 4IRGA 3FF5A 1EH8A 4LFUA 4HBLA 1W7PA 4YFKF 2PMHA 1SMYF 3E3VA 2EFNA 1RNLA 4ZYGA 5TJJA 2X4HA 1I5ZA 4PZJA 1J7KA 2NS0A 3EDPA 2ZNYA 4KIGA 3V4GA 3E6MA 5CYVA 2PQ8A 3IWFA 1WWXA 1MDMA 1I1GA 2IT0A 5D5VB 1B4AA 3S2WA 2MBFA 5LBQA 4R8HA 2IA1A 1DPRA 3HSEA 5D5XB 3WU1B 1BM9A 3ML6A 5HDGA 3ZMUA 4MTDA 4BHPA 4CO8A 3BPXA 4G7ZF 4O3MA 2XRNA 1KQ8A 2LF7A 2XASA 3SZTA 3ZN1A 3G73A 2DK8A 3ECHA 3L00A 4UV8A 2DLLA 2LKPA 3V7RA 4JBAA 4RGRA 4AVPA 3C1DA 1W4MA 1LVAA 3H3UA 3BPVA 2YX4A 2XGXA 3L7WA 2KIFA 3ELKA 2R7FA 3WTZA 4MGRA 5D5WB 1PDNC 2YR2A 3F22A 5F64A 1V3FA 3MWMA 4ZYDA 5H6QA 2W25A 5DCMA 4L0ZB 1OKRA 3FWEA 1IRGA 3HOSA 4HX4A 1KYWA 2P6SA 2COMA 2K86A 3ZMTA 4S04A 1HKQA 1G6NA 4RGUA 1IUYA 4HX8A 3GF2A 2EFPA 4UV9A 1IRFA 2ADUA 4PCQA 3I53A 2ZCWA 4EMSA 3CJNA 3W6JB 4MEYF 3O6BB 5LEKA 1NHAA 1X3UA 3DEUA 1K7AA 2ACJA 1Z9CA 4S05A 1SD4A 3C3WA 1XDUA 2DW4A 4RB3C 1E2XA 3MAJA 2DFIA 1USTA 5E1ZB 4HA8A 2PG4A 2V1DA 2RVCA 3EYIA 2H6CA 4GGGA 3ZN0A 3ULQB 1YO5C 3IRQA 5ICGA 2GZWA 1D3YA 3MZHA 3ISPA 5LGTA 4Q48A 2FQ3A 5D6EA 2QBYA 4NB5A 2Y0MA 4AWXB 4FX0A 2FBHA 2GA2A 5CVIA 3ABTA 2VONA 3RYRA 4RAYA 2M30A 1GHCA 1C0WA 4MTEA 3KFWX 1U2WA 3HHHA 3J80K 2QUFA 3TKYA 2XAJA 1G4DA 4XLPF 2FBIA 1OMIA 1BC8C 3I0TA 1R7JA 2XV4S 3E5QA 1JGSA 1T0FA 2FNAA 4G6QA 1TNSA 1J9IA 2CW0F 3IKVA 3RYPA 3WGGA 3VEPA 1ZHFA 2VE9A 1U78A 1HSTA 1MD0A 2EV5A 1LB2A 1YW7A 3HRMA 4A5MA 4UNOA 1LJ9A 4I2OA 3RPUA 3KZYA 3KLNA 5FGMA 1Z6RA 2L4MA 1IN4A 4ASNA 4LB5A 3HRTA 2LSOA 2L3DA 1R1TA 4BH9A 2OD5A 4OMYA 2G7UA 5LGUA 3VB2A 1Z1DA 4WX9A 4WXCA 4A2UA 3QU6A 6PAXA 4I09A 4ZZLA 1FYLA 3H3ZA 5LRRA 1XGSA 4UHTA 4L0YB 2E1CA 3JTHA 4B09A 3F8CA 2KJBA 3EQLF 2A07F 2UWMA 2HR3A 3J81Z 4HW0A 2JZYA 2ZMEB 4GXOA 1SAXA 1SFUA 5H20A 4QWQA 5E18F 5JFRA 3B02A 5HDKA 2DU9A 5EEHA 4DNCA 2KJCA 4LG0B 1DUXC 4HLYA 2WWYA 2HTSA 1FBUA 2EA4A 4RB1A 1ODDA 4KN7X 5DCFA 2RV8A 2IP2A 5L3DA 1D8JA 5A2QK 4CGZA 3KP5A 2VOOA 4XSZF 2HQNA 1S3JA 2WTEA 2IJLA 4HQMA 2G7HA 1DDNA 3REOA 4M72A 4P9FA 2IVMA 2JTVA 4Y13A 4P5OA 2EFWA 2MH2A 3F8MA 4L5JA 4U88A 4ENNA 2GIVA 2P5LC 4KMUX 1MJAA 1S8NA 2Z99A 3HTUA 1TNTA 2QQ9A 2AS5F 5KK1A 4UVAA 2DPDA 1JXSA 3BP8A 1BC7C 3KLOA 4HQEA 3F72A 5DUIA 4PGHA 4EJWA 3Q9VA 1S6LA 5DD8A 3FMRA 5LHHA 3RKXA 5HLHA 5ED4A 1SD6A 3K2ZA 3K0LA 3WGHA 4IVNA 3WGIA 3GFLA 4TV7A 1WQ2A 1U6GA 4M74A 3IRRA 4JK1X 3RPQA 4FX4A 1H9GA 2FNPA 3EETA 4LGWA 4N9HA 5CLSA 1L3LA 3KP4A 2IA2A 3GLXA 5IT3A 3KEOA 2BEOA 3BZ6A 3HRUA 4KUMA 1YS6A 1ZG1A 1B9NA 1WKMA 1XDSA 4XBFA 4EM0B 1CGPA 1FYKA 2Z5UA 2QQAA 1D5VA 3R0JA 3P9IA 2HYFA 4UVCA 1YW8A 2HEOA 1XMAA 3E6BA 1Z91A 2G9WA 5CVVA 1XCVA 3RKWA 3I58A 3LA3A 3F21A 1ZLJA 5ICFA 3F6VA 4O6JA 4ZYEA 4H0EA 1QBJA 1ZRDA 3M7GA 3KZZA 1YS7A 3LFKA 3GWZA 2Z9OA 4KIFA 2H6BA 1SD5A 5BPIA 2KIUA 4G7OF 1OR7A 3ZMZA 4FT8A 1SFXA 3RI4A 1K78B 3LSTA 3Q5FA 1MZBA 2B0LA 4N9IA 3I59A 2VBXA 4L9VA 3MZYA 5HVQC 1R1UA 1F9NA 2XVCA 3KP3A 4MHGA 1KYZA 2EV0A 1IW7F 3EUHA 1DP7P 3K69A 4HDVA 4OIQF 3EYYA 3HUGA 4L9JA 2EA2A 3CUQA 1ULYA 2L4AA 2PN6A 2FXAA 2K4JA 1TQIA 3H92A 4G6DA 4BNCA 2W24A 2ZJ2A 1MJBA 1LEAA 3C7JA 2H94A 3E97A 1ZGJA 4OU0A 4EM1A 2DBBA
chains in the Genus database with same CATH superfamily
2L01A 5F08A 3RZDJ 3H36A 4UXNB 1XGMA 1U0JA 1U5TA 2FMLA 3GW2A 4OMZA 2ESHA 2CJJA 4BY7J 3JRHA 3F23A 5HXHA 1FP1D 2OCCH 1Q1HA 1UHWA 2LBFA 2V79A 5J1RA 1RR8C 3KINB 3P4WA 4EVIA 4DIQA 5JLWA 1CF7B 1MBEA 4O5VA 4P9UA 4IE7A 2MFZA 2LTPA 3DEEA 5DJQC 1FBSA 2NXNB 3WTYC 3WG9A 3HOXJ 4U7YA 3BJOA 5HXCA 4ZOLE 2XAFA 3E6DA 3K9TA 3T1HT 4OIOF 1KU2A 3HC7A 2XPWA 1FEWA 4F93B 4X64T 4IKFA 1FPQA 3H5RA 2W4SA 3KP6A 1ZN2A 2Y9YA 4OOIA 3L2VA 3FBLA 3RKGA 3LWFA 3K8PC 2RNJA 1OXZA 3MKWB 5KVRA 4O4HE 3TLVA 2F5EA 4D1QA 2UUZA 4XKBA 4HV5A 2XQ8A 3AG2H 3ONQA 1LVFA 2ID6A 5LMNT 2FMYA 3C4ZA 4GIWA 3BJ6A 1ON1A 1FT9A 4JI1T 3TDZC 5HLTA 3B73A 4M9ZA 5AQUB 2LG4A 2EK5A 5DQVA 1YW0A 4IOCF 2XUBA 1O7LA 4C2TA 4FI5A 3BWGA 2K9SA 4IRHA 4C3IJ 4HG2A 2QA7A 1IXCA 2ZNZA 4G8XA 4NNJA 3V8LA 2VK9A 3OVUA 4J2CA 3LSVA 4LIVA 2HOTA 3LA2A 1FMWA 4HE8A 3GTJJ 2BHYA 2MA3A 5LMUT 1P2FA 1TW3A 1J59A 2VQLA 2E19A 2W84A 5D4SA 5J8CA 5BNGA 3LNQA 1TLHB 1VNDA 2M8GX 4BE0A 1LDJA 1MIJA 2IGOA 1QZZA 3J9X1 2J5PA 1FNNA 3PFIA 2JN6A 3RDIA 1O7FA 2MH9A 4IHYA 1LRZA 3PURA 4OWRB 4GCVA 4WNKA 3V8JA 1YJNI 2CYYA 3RQ4A 4A3JJ 2WZIA 5JR3A 4L9IA 2JSCA 3F2EA 3CF5F 2H3RA 4A6EA 5B3SH 3RKYA 3AE7A 1G3YA 2UXNB 3AXJB 1FWZA 5JDHA 4LFAT 3CTAA 4WWCA 4WCGA 5CA1E 1HG5A 4QKNA 4QXCB 1QNTA 3K4CA 4HLXA 4DV0T 2GQQA 5FKKA 2V6CA 2BBYA 1TQMA 3MKLA 1HCIA 2IBDA 2EQRA 3S3MA 4O4JE 2X6YA 4ISSA 5FD5A 3MVPA 1PUEE 3JRBA 2VIXA 5ILSA 1QA6A 5FL0A 1FYMA 2EV6A 2NNYA 2V1XA 2BY1A 2VQHA 2CUJA 1VQ7I 2XQ5A 4XAXB 3KVAA 4OYJA 1XD7A 5BMZA 4B3AA 2GIZA 1XDOA 4OINF 4XM3A 3E5UA 4XZCA 2ELHA 1I27A 2Z1DA 2MLKA 2R3SA 2HNHA 4G2AA 5DEQA 5E1XA 3U21A 5E8IA 3K2AA 1K4SA 4IRIA 3C98B 4NHJA 2DWKA 3KYDB 1B6AA 3SZGA 1HW5A 2PFBA 3MCZA 4B3ST 4H9SE 4BXFA 3H9QA 2KLOA 1ENHA 3UR3C 2HPIA 3HGGA 3A5XA 4M6YA 2H89A 4GKJT 3P4RA 4ILUA 2VL0A 3ZQ7A 2H7VC 2QSHX 1X1BA 1X1DA 2XGEA 1JKQC 5H6RB 3RYHE 5AQTB 5LCYA 3O2PE 2P81A 2RQPA 3PL8A 4EGZA 2CBIA 5FXVA 3RH3A 4U74A 3F3XA 2FA5A 2YU2A 3ZT5A 3PDYA 2M1BA 4NDLA 2YX7A 3ZQIA 3A1YA 4HX7A 1EH6A 2LSGA 1SE7A 2L54A 1UHMA 4TWDA 2NYXA 1HDDC 3N05A 4G94A 1KU7A 3D5LA 5CVUA 1HKSA 3LK42 2FJBA 3BJAA 3CDLA 2PMZA 1BI2A 2DDBA 3MEXA 3DBLB 3PTRB 4PJLA 4AD9A 3GZ6A 2Q2EB 1LNWA 3HM5A 3OWTA 4I01A 4E7KA 2W4XA 3DTOA 2L7KA 3VRAA 2CUEA 4DV5T 3GXOA 2QKMB 3HSRA 2E5NA 4N4OB 3A01B 2RDPA 2ZSHB 2ZB9A 4QSHA 2ZBKA 2RP4A 1W5SA 3BQIA 3NVOA 4P0BA 2H8WA 4EXTA 3BR3A 3JCFA 3SWHA 3TKLB 3QB5A 2CGPA 1SANA 1R4MB 2KMUA 3LBXB 3CO6C 4QHOA 5JREA 3N97A 4IO9F 4BAYA 3AE3A 4I43B 2OF7A 5DUKA 5HLIA 2ECBA 2QWWA 4LJZF 1T2KA 3SFDA 4YTPA 5LFAA 4LF9T 3BTLA 5A1LA 4JI8T 4RGSA 5AQOB 2JT1A 1MBHA 3CUOA 4XLFA 5F3JA 4JLEA 1OEDE 4WXHA 4EJVA 2VBZA 4EGYA 5FY1A 2BBJA 1IN5A 1SD7A 1ZYRF 2HTJA 2V9VA 2NAZA 2F5VA 3TP3A 3ZQQA 4I99C 1S7OA 2XF7A 5FO5A 1O3QA 5ICEA 1Y6IA 4ESFA 4A0ZA 3KZIC 2XKOA 4L18B 2XAHB 1HX8A 3VKHA 3R0AA 3MQ0A 1IN6A 2H7OA 3HOUJ 2YK0A 3TO9A 1GLNA 5AQFB 4HF0A 3ZMVA 3R6SA 3OYBA 2E5LT 2Y0SA 3OS2A 3IHUA 3VRBA 1P4WA 2VURA 2DLRA 1OEDA 4GYSA 2ISYA 3SS1A 5L3CB 1HW1A 1REPC 2MOZA 4HWCA 2K7LA 2W85A 3WE2A 1VOMA 1IF1A 1B8IA 1K61A 2A05A 3H0GJ 5HNHA 3DFGA 2A6HF 4WF2A 3WTXC 2JA7J 4IOAF 4MBQA 2WADA 3RX6A 2R7ZJ 4WK8F 1D0ZA 5BOXA 4CI1B 3X1DA 2HYJA 1E1HB 3PQKA 1ZG3A 5ABFB 2XROA 2DTZA 3AE1A 4UR9A 3WAJA 1LQ1A 4P55A 2B76A 3JCUC 3M1EA 3DPLC 5ERIA 1KONA 3GFJA 4IDNA 2DAOA 5HEJA 2D0UA 1M62A 1VQPI 4DR3T 3M8FA 3B57A 3QAHA 5TRDA 2OCEA 1QQIA 4FTHA 5FXZA 2O03A 3MK7C 5ILUA 1BI1A 3GFIA 2HFHA 4BJ6C 1MSEC 2NS8A 2R7RA 3CCSI 4CICA 4KNYA 4XLEA 2K9NA 1ETVA 4IE4A 3P7NA 4ZH4F 2LD5A 1W0TA 2DQRA 4PFOA 4QIWN 2GXGA 3BR1A 3D0SA 2DOAA 3V7SA 3TO6A 1ZREA 2STWA 1IDZA 2XB0X 1O57A 3PQJA 4JI6T 4Z90A 1IZ1A 3E1SA 1J5YA 3OSGA 1HW2A 3OS1A 2IHR1 2WU5A 2WB1A 3JRAA 3BR0A 1X2NA 2IS6A 4ZYHA 4UVBA 2R93J 2M8EA 1JNZA 3HKBE 3CDHA 3A2KA 2FQ4A 4O4IE 4XRFA 3LOCA 3MFKA 3IC7A 2D1HA 3G6EI 4BL0B 3H5AA 2LKXA 2VWAA 5FLXZ 3W2AA 1R1VA 3FM5A 1LEBA 3RHWA 1N32T 2IGKA 4A3CJ 3BDDA 2X1DA 4PUSA 4EJUA 4DQ2A 3KETA 1SFEA 5IYDJ 4UUTA 3E08A 3ZPOA 2VKOA 5D4RA 4PFPA 2R5YB 1BBYA 4L5GA 2F2EA 5K1YA 4CN4A 2AXLA 5KDMC 2CXFA 2AQFA 1YOVB 3RGLA 1YXRA 3NWSA 1OR7C 1JNRA 2MC3A 3HGYA 4ISTA 1EF4A 2P5KA 2R7XA 3NRVA 1BR2A 3OMYA 3HL6A 5D6FA 2DI4A 3DTIA 4OIPF 1FBQA 2XPUA 1S7AA 3UQ7A 3ZMSB 5KX5E 2CSOA 4HPQA 4CCNA 4AIJA 3R4KA 1QUUA 2ZFWA 1IV6A 1R5ID 2VE8A 3Q9SA 2QSGX 1BJAA 4MIMA 1R36A 1A35A 2HOSA 1QLBA 2ZLYA 3AAEB 3I9YA 5TAOA 5EEGA 4KHZF 1JJ8C 3L2UA 4HV6A 4CN1A 1J5ET 3UUBA 5FD6A 4QPOA 2EIJH 2O8KA 2TRTA 2FJ1A 4NC8A 2V7JA 2UXXB 4FCYA 1FC3A 2IGMA 2X0LB 4A56A 4LD5A 4EYYR 4EYUA 2LY9A 2D2WA 3WTUC 2PFVA 3K1PA 3KP2A 1W7PB 3DTKA 3GTGJ 5CVJA 3F0CA 4KA4A 2WZHA 4BQAA 3KDSE 2G0EA 5EZHA 3J7AO 2YU3A 3EUHC 2UUBT 3L9FA 1ORKA 5FVKA 4NC7A 2A2FX 4HDUA 3MXZA 4KN4X 1Y1VJ 2YPRA 5BPDA 1H9TA 2IPQX 2CH0A 1YX5A 4LITA 5CVRA 2PJPA 3ZPLA 4RDUA 2FEZA 2PJRB 1QPMA 4PK6A 5EDNA 5IP7J 1WCRA 3QP6A 3W6KB 2PI0A 4IXAA 2JQ9A 3PUXF 2R7QA 5GPAA 2DA1A 4H63H 2QQBA 1PP7U 3PUVF 1IBLT 1MMDA 2ZXJA 5KXJA 2PMZN 3N9NA 3VR8A 2HDDA 2O5RA 3JR9A 3I54A 2OPTA 3ZP5A 2R6GF 3IUOA 1IAWA 3C4WA 2Y69H 4MALA 2M87A 3U2RA 4CN6A 4M3EA 5E20A 2X9DA 2YDSA 2BS2A 3GFMA 4U33A 3G1LA 4BYYA 2C0SA 3ERED 2HHHT 1IN8A 1UCRA 3OYEA 1K79A 3RTRA 2V1UA 4K2EA 1MDMB 2DXIA 2GBYA 5LHGA 4HOBA 4CXFA 2PLYA 3JTGA 1HQCA 1O3SA 2O61A 2ZFUA 1OCTC 3GZ5A 4KJZA 3TEDA 5JQGE 3ZCOA 1S72I 4EEDA 2F6CA 4DUZT 1AKHB 2VPLA 4HFDA 3I71A 4IHXA 3CKDA 3KPHA 2EWNA 4A6DA 1GXQA 3B6AA 3G1MA 4L5EA 5K5OA 2CQQA 2F4MB 3FHNA 2HYGD 4FE4A 5HNFA 2NS7A 5C3EJ 4ENMA 2XHKA 1W09A 1WR6A 2VVNA 3PJAJ 5LBQB 2BW3B 1BN5A 2M7BA 3GX4X 5FJ8J 4U31A 3SRZA 2B63J 1Y64B 3F57A 4RA2A 2CWYA 3N2KE 1KQ9A 5AIQA 4D9JA 4COFA 3D5RC 3CCVI 2NW7A 4R1HA 4Q4ZF 2Y8DA 2L9QA 3CC7I 4IHJE 3CC2I 3ZMUB 3R84B 2NWBA 1P4AA 3ZT7A 2X85A 1W7PD 3TL4X 3WTVC 5CJ9A 1X1CA 4RB0A 2W2UA 1TWAJ 3I64A 4QLCU 4MNUA 3I56I 2XASB 1SVOA 5LNKA 3UNGC 1RZ4A 1T6SA 3E7LA 5LXTE 2VQET 2BY3A 4M3BA 2W57A 4ZC3A 3ZN1B 1HTJF 5J8FA 2ZSIB 4DZJA 2FUPA 3RIAA 3ZGKA 1ZG5A 5C4JJ 3ONLC 1YG2A 4RMNA 2E5VA 2YUSA 2V8SV 3PUGA 2LHNA 4UV8B 1FOKA 5DQWA 5LLQA 2ZM6T 4U0WA 3LSKA 2EHOB 3V5SA 2IS2A 1YJ9I 2LRDA 4AIKA 3AKZA 3PUZF 2MD5A 2FX0A 1IZNB 2VJ4A 4YJ3E 4O8SA 4O4LE 5ADXL 1FTTA 3E6CC 1U4QA 1KF6A 2VBWA 1STZA 1J2XA 4MEXF 2VODA 2XAFB 2KRFA 1BI3A 1VRBA 2A68F 2WB5A 1QPIA 4U7BA 4LIUA 5GTHC 3OBVE 1GT0C 4JI5T 2DFFA 3P4QA 4U0YA 2J47A 1A04A 3QPHA 2EFOA 2WQYA 1OCPA 4XKCA 2A3DA 4OYKA 3H3VK 4YSZA 5K7FA 4D7MA 3BQKA 4BACA 3K10A 5K5RA 3ABKH 1S9HA 5J47A 1G73A 1X9BA 2NOJB 4NIQA 1NK3P 3HKDE 5LRSA 2JA6J 1V4RA 2PEXA 4IL9A 1KQ0A 4UB8C 2VUMJ 4ZI2C 5E8GA 5DV5A 2BG9A 2RREA 3PNVA 4JQFA 3IA3A 2ETHA 3JW4A 2PBIA 3NQOA 5JTGA 3ZXSA 3HI2A 1XMXA 4Q47A 3GTOJ 1WLXA 5AONA 3JAFA 3RC3A 4RLFA 4OAYA 1CQTA 1ZRFA 3R60A 3QC9A 2FOKA 1VQ4I 2IRFG 2VL8A 4CYCA 2HZDA 2CMRA 5J2TE 2JPCA 2HXIA 5DYMA 4A3DJ 2X9HA 5H6QB 5DCMB 1LE8A 5AQGB 1MNMC 5FXWA 2MG4A 2OZUA 2QVOA 2MABA 1ZGWA 5M5WJ 3LMMA 3RQWA 5KMGP 2OV9A 3AVRA 3CMMA 3OIQA 3QOEA 1K6OA 1HBXG 2BS3A 2CRBA 4ILBA 3ZMTB 1Z05A 1XMKA 2QENA 1GVJA 2XQAA 3TP0A 2DO7A 2XPVA 3FM3A 3FZMB 5AQJB 1R71A 3P8CD 3F8NA 4E6KG 4ZI3D 5F6FA 5FKMA 2HZTA 2KZVA 3M9AA 3IEEA 4EIWA 4Y17A 1AOYA 2XQ4A 1B59A 5E17F 2XSBA 3Q0WA 4M73A 2WV0A 2LP0A 4UV9B 1JGGA 2EHOD 1YFHA 3ZR8X 4LLNA 1YIOA 3N9PA 2HKOA 5B1BH 2CWOA 4YTMA 4IGUA 2VKVA 3TO7A 3LSGA 1K4TA 3M8EA 4IDPA 2KLQA 4KITB 2JQ7A 1M1EB 3LDQB 4ZDOA 3HKEE 2L8KA 3K70C 3OYJA 3A0BC 5D5UB 2LF8A 1SHZC 5J40A 3JSOA 4LLLA 1W0UA 3CD6I 2IMLA 3UU8A 1S5LC 3NWTA 4N4NB 3WTSC 4LMLA 1KU3A 3UU6A 3GEZA 3K3QC 4HFEA 1SVLA 2FRHA 2Y48A 4K0UA 4CYDA 2ODUA 2RC4A 3A03A 3FXUA 4BHBA 4Z2YA 5DDGA 4UY8I 5E3NA 3BC8A 1SMTA 3PIOF 2OQRA 2F5CA 5CKTA 1N78A 2M6BA 3ZC0A 3UQ4A 4KT5C 2QYOA 2K9QA 3P9CA 3H3MA 1Y39A 1R58A 2EB7A 2FJAA 1UB9A 2WY2A 4IE6A 4YHHT 1NENA 3O3KA 2L7ZA 1UHSA 2PMUA 4ENJA 1XGOA 4BE2A 4MQVA 3M1CA 2CM0A 1OFCX 4LG3A 2V1DB 5HEUA 4YTNA 4PJNA 3FZVA 1W36C 2GK9A 1N77A 5BQTA 4P96A 3ZN0B 2ZXIA 4TV9E 2E1NA 2KMFA 3NZQA 2VASA 5LD2C 4RAFA 2KDZA 1SUMB 1OQYA 2M45A 3SQNA 2N2NA 2XZEA 1S29A 2GXAA 5KCMA 1T95A 2UU9T 2BKOA 1NWMX 1N36T 4NC6A 3ZRGA 2HVQA 3WG7H 5J6XA 3AEFA 5LGTB 2IW5A 4L9NA 2JRKA 4CI3B 3BQZA 3GMEA 4X66T 3HOYJ 3COAC 4ZI2D 1XG1A 2FE3A 1I6HJ 4YIRX 2M4GA 1CHUA 2QBYB 3FXEB 1IXRC 3OJAA 4FJOA 1HNXT 2X48A 2UXCT 4JV5T 3GYHX 1R22A 3OYZA 4YXDA 2M5WA 2CFXA 2NVQJ 5ABFA 2K3WA 3FZHB 3I4MJ 4BEHA 2M0CA 3FISA 1WJDA 3BQLA 3L39A 3VR9A 2YINA 5AQHB 1JHFA 3F8FA 1YTYA 3DQVC 4RGXA 3M8JA 3N4MA 3PUQA 1ZAOA 2C5KT 3J80Z 2FD5A 2ZJQF 1VQ5I 3UTKA 3JRIA 4H63V 1XN7A 1HF8A 2I0MA 4YIIA 2CHNA 2CHOA 3VSKA 1FSEA 3K4KA 2JVHA 3LA7A 2ZM8A 1ZH5A 3H9JA 1FSHA 3WTWC 3CQXC 4WBOA 2E2HJ 4E70A 2H09A 2LK2A 3CC4I 3J81K 2JPFA 1KU9A 1Z67A 3W3CA 2RPAA 2ES0A 2XAJB 3KIOA 3N2OA 3ZMDA 1MIWA 2XF6A 2ZMEA 4Q5SF 4AQYT 1QZYA 1X1AA 2Q9QC 3CESA 1MGTA 1U9NA 1F36A 3GTPJ 2WC2A 1XZYA 2CQ7A 3DXJF 5L3EA 5AQPB 2QM3A 2V6YA 3CCYA 4FISA 3L2CA 4XSXF 3T1BA 2GXBA 2HPLA 4YY3T 1BOAA 4YFXF 2STTA 3FMSA 1VFCA 4KYWA 3DPTA 2FF4A 2QVAA 5JDMA 4X1KE 5IHYA 1IUFA 3VKGA 3M4OJ 3SYTA 1MJ9A 3OOPA 2P8TA 1N25A 1XMOT 2OU2A 2Z3YA 1OYWA 2F4OB 2LLYA 1XC5A 4IL4A 2WBMA 2LDUA 4LG0A 2LNBA 1HCRA 3AL0B 3HOZJ 4XRMA 5B5EC 4HYEA 1WI9A 3C64A 2DMQA 1N34T 2EIKH 5IT9K 3MKYB 5FRMA 3SZPA 3RZOJ 3EHZA 3Q5DA 1FMVA 3UU3A 1E3HA 2C6YA 3LQRA 1RIOH 3AAFA 3R61A 3TQNA 3SFZA 5IOZA 2RKHA 5B1AH 4XICA 2YS9A 1E3OC 1V9DA 2Q9QB 3HPGA 3U1DA 2H27A 1ZR4A 3OR1C 2CV0A 5JR9B 4M3FA 4AIHA 2C5JA 1QVTA 2DODA 2I5UA 4BQQA 2K9LA 3GTKJ 4IF4A 2K5CA 1RESA 1UG0A 1QVUA 5HS7A 3AA6B 3AE2A 5L3GA 4ZZCA 2E1MC 1P6RA 2X6XA 2XAQA 1YHQI 3HHGA 4IDZA 3P4PA 1UAAA 2CFOA 2KIQA 3OY9A 4KT6A 5LGUB 1DPUA 4HFHA 2HS5A 2K9AA 2ODVA 2YDQA 2JWTA 3QOPA 1U9OA 4X20E 1DGWY 1TWCJ 4UF0A 3RKOA 5FY0A 2JSPA 4ZI7E 1P92A 1FLIA 3F6OA 5E0OA 2FSWA 3CX7B 5HYAA 5LG3A 1UJ8A 3SXYA 4A3EJ 4D5CA 4ON0A 1ZR2A 2KKOA 2MSYA 2WDQA 3I9V2 3RYIE 2CO5A 1F43A 1D0XA 2VC1A 3JAMK 2KNDA 1MBJA 5FLVA 4E4HA 4BXUA 2LR8A 4A12A 5AQNB 4DMWA 1PUFA 2LHRA 1US7B 5LOVE 2PG8A 3ESWB 2RGVA 5FKOA 2P4WA 2BDEA 3RKQA 4LB6B 1G3SA 1W5CC 1G3WA 2CXLA 4YRVA 3Q2MA 1B1BA 4IHVA 2BZTA 2N9DA 1MW7A 2VVSA 3AG3H 1BR1A 4IJAA 3JADA 5D8KB 1ON2A 3ZCIA 3ZYKA 1YE9A 3HPHA 1XGNA 4GFBA 1Z7LA 4BHCA 5JRCB 1FIPA 1U8RA 2XQ7A 2R4GA 3H9GA 4CZZA 1ETYA 4B6XA 4EEBA 4DV3T 3T0YA 3OOUA 4HSRA 4BBSJ 1XWMA 4I50E 5F04A 4A3LJ 2ZO4A 1ACIA 3HG9A 3UUMA 4DV2T 1U8BA 2TCTA 3O8GA 4CDGA 4B3TT 2EFQA 3LSHA 4QXBB 1O3TA 2MTQA 4S0HB 3QPTA 3RPUD 4ASKA 3K1NA 5ABGA 3CLOA 3S8PA 3DKWA 3QWLA 1O3RA 4ZTFA 4LF6T 4DV6T 3QNUA 2KINB 3BCAA 4DYQA 5AIPA 2YU1A 1Y0NA 1VTNC 3OS0A 2GA1A 3S14J 5HAXA 2LOOA 4KDPA 4KMFA 4ABZA 2GOXB 3FX3A 5HS9A 1TWGJ 1YQAA 3CJQB 3LL7A 1MKMA 5EZGA 2QA4I 1F5TA 1KA8A 2VXDA 3FXRA 3ONJA 4HZFA 2DTRA 2XSDC 2JPBA 4HAMA 5LHIA 1VQNI 1J0RA 3G3ZA 3GVAA 3AG1H 2KT0A 2OAZA 5F1JA 1NG7A 2CLYC 3C50A 5HDNA 3Q5WA 4F92B 4NQWA 1H0MA 3ZC1A 5FFXA 3AFHA 2V7MA 1JTXA 1TW2A 1W5TA 5A2QZ 4LLGF 2VC0A 2HVRA 3FK7A 4D7NA 4KHPT 1TWHJ 2O0YA 4I0AA 4A3MJ 4HFIA 1SA0E 5L3DB 2DJIA 4IPAA 4YFNF 1TTYA 4MQ9F 2JMHA 4BDZA 3I5UA 3X2QH 3EDVA 4ZZBA 4GYIA 2NVUB 5F0FA 4Y4RA 2F4IA 3K1MA 4CCOA 1VCTA 5L3BA 1KGSA 5LBMA 3KYCB 4LMJA 3ZT6A 3LAJA 3BOQA 2GWRA 4RBOA 1XX5A 1R23A 2DMPA 5HLGA 5FP3A 3AE8A 2WS3A 5L4EA 1VQ8I 2CMPA 1FX7A 3PUYF 4LK1F 1OISA 2A3SA 3AEBA 3L09A 2CQNA 1XPXA 2BGCA 4EQQA 5IP6A 1BL0A 3CO7C 1E7PA 3FB2A 3ABMH 4Z91A 4TN7B 3DV8A 2KZGA 2CLYB 1NAFA 3LSPA 2X68A 1X3WB 1W0AA 2QGSA 3T5XA 3ETUA 4BA9A 2PTFA 2WV1A 1M7KA 3ROUA 1H8AC 2KHMA 5EJCA 4M9SA 2IUBA 1UZCA 3BG7A 4A0YA 4UEMA 2O7OA 5FFZA 2B9SA 4HGAA 3WTTC 2JUCA 2BG9C 1XDPA 2VOPA 2A5YB 3IF8B 2BYVE 3DU5A 3PUBA 5DTDA 2UUCT 2EJRA 2JA2A 4WZXA 2VT3A 2W00A 2Q1ZB 3TW6A 2KP6A 2WSSV 2ZM0A 4X5TA 2BY0A 2W7NA 4EGWA 3TDUC 4ILCA 3PNYA 2VN2A 5JI6A 3ECOA 3K4NA 2NVTJ 2CUFA 2B1EA 1USSA 2ZMAA 3C18A 3I3LA 1B72A 3QPSA 3H37A 3TLWA 2BKNA 4GYGA 4YSYA 3HYIA 1XSDA 3LQQA 1A6IA 4UVAB 4KFCA 4FHTA 3ANWA 2R5ZB 2EZLA 2M67A 2WMOA 4H9RC 4ESBA 2BHZA 1I1SA 5EGOB 1VQKI 1FOWA 5KNLA 1ZKEA 4PSWA 2ISZA 2YSRA 4PK4A 4M9XA 3CCQI 3GTQJ 1OYIA 3EAMA 2Z33A 4B8XA 2MYSA 2V5DA 3ZOBA 3BR6A 5JDFA 4JX6A 3CPZA 3VSLA 2K02A 1HFAA 3Q5EA 1JHHA 4PSXA 1HKTA 5HOOA 4G7HF 3S93A 5LHHB 3GUDA 1ONVA 2FU4A 2DJNA 3F8BA 3WU0A 4CCKA 2D45A 4O2AE 1MNEA 3GTMJ 2QF7A 3DP7A 5FROA 1D8KA 4IX7A 1F4KA 2O6GE 4JP0A 1FIOA 3S3NA 2BE5F 2QEXI 3GO5A 2E9XA 3HEFA 2EZIA 1OCZH 4HNTA 2R92J 2CA5A 1TBXA 3RC8A 4KBMB 5JHUA 5GONE 5CB4E 3IAM2 5J4VA 2XIGA 1JUMA 3T8RA 2IS1A 3ABLH 3BG3A 4ENKA 1UFMA 2IGNA 5F8PA 3RIUA 3DU6A 4IQJA 3GZNB 1XSXA 3UT5E 3RJPA 1K78A 1T7SA 2ECCA 1WPKA 2A69F 4B4CA 4D0PA 4J19A 3U9GA 4WBNE 4UUSB 3MJXA 2D5UA 4XRSA 4BUPA 5EG0B 1B9MA 2YOEA 2OA4A 3OYHA 4IT4A 4GRIA 4F55A 5D8LB 2H1KA 5ILVA 4EATA 2O8XA 1IO2A 1APLC 2KWHA 3RIFA 5AQKB 1Y8QB 4KUMB 4C9YA 4ETSA 1WRDA 5LJNA 1LKXA 2Q8KA 4DV4T 1R5HA 1WSUA 2JA8J 2X66A 2EILH 3QPLA 4ZS3A 4XBFB 4JEUB 2JQKA 2ID3A 5IY5H 2ZKZA 4B48A 1IGNA 2DPUA 3G2BA 2P7CB 3NEUA 3GLLA 4G9YA 3OYGA 2XKPA 2ZXWH 2VXZA 4IE0A 1MIVA 2GAUA 3CZ6A 2HN1A 4U7IA 1FY7A 2XAGA 5FMNA 3DEWA 1ZGAA 4DBRA 5M3MJ 1YW9A 2J1DG 4HTEA 4ZZDA 1MSFC 2XF5A 2UZKA 1T39A 2OZ6A 1FJLA 2XM1A 2CQKA 4YG2F 4X1IE 2GOMA 1P7IA 4UVCB 3L2RA 1IXSB 5H2FC 3BY6A 5HS8A 3BLYA 2NRAC 1AA7A 5HWXA 4LFBT 4F52A 2VJIA 4MO7A 2DCEA 1X1PA 2XDVA 4YIFA 1IN7A 2WWVA 2CG4A 1OYYA 1OJLA 3ETVA 3BG5A 2W67A 1WJCA 1HXDA 5IPAA 4WXDA 2HQ5A 5ICCA 5L3FA 2MD0A 3G06A 3K7AJ 1ETKA 2MPKA 3OL4A 4HNUA 4UXNA 4IHSA 1RI7A 2Z6EA 2P9BA 1YRNB 4YSXA 3FXJA 2CV1A 2X9XA 1G3TA 1T72A 4HFBA 1DU2A 1Z3YA 3T8TA 5DD4A 3ABUA 3Q5XA 1UGOA 1CF7A 3KCCA 3I0QA 1O4XA 3MA9A 3RLFF 2BXZA 2LH9A 3TGNA 1WGXA 4A5NA 2DT7B 4BJ5C 1AWCA 4XLHA 1HSJA 1R4NB 4D5FA 4JI0T 4GO1A 1VQMI 4MFRA 4Y7NJ 2DK5A 3KEYA 4R79A 5FLMJ 4PW8A 3WODF 5F1RA 1TC3C 3ZMZB 4LF5T 4M71A 5GTIC 4RM2A 1TL8A 5LB7B 1RR7A 4OIRF 3K1SA 1TQPA 2DT6A 4C3HJ 4F7ZA 1LFUP 4HF1A 4U7DA 1S35A 4ZXLA 2OBPA 1Z7UA 3CUQC 5FVLA 3FXQA 4V2FA 2E7XA 1IRXA 1QGPA 1JE8A 3I59B 4L9TA 1U3EM 3R6NA 4B3RT 4C2MJ 5J3LA 2R7VA 2EH3A 2P5VA 5J0ZA 1R9TJ 3FMQA 3CCMI 3NARA 4XONA 1ERDA 2RAEA 2XQYA 3RYCE 4A5XA 3MD2A 4B43A 3VODA 2HOEA 5LGNA 3W6VA 1X3ZB 4M1PA 1Z6TA 4EM2A 2Q0OA 1BIAA 3PSFA 5KAFC 3AVSA 2J5OA 1K6YA 1L0OC 2MW8A 4L5IA 2FBKA 4XQFA 5LEJA 2R7WA 3S2HJ 5JHFA 3PO3J 4JUYA 2R7DA 4U0VA 2LMDA 3HOTA 4XNFA 5EF6A 3PU8A 3GN5B 4ILAA 1FJGT 2AO9A 2ESNA 3D5SC 3DKXA 5IT9Z 2HWVA 3G4SI 3KP7A 3PO2J 4C3JJ 1T98A 2XPKA 2X67A 4I7HA 1QO0D 1WVRA 3DBRB 1U5TC 3HUGB 3NAUA 3HSFA 3ONXA 5AQRB 3CUQB 4UUVA 2EPFA 3LSJA 2UXNA 3HTSB 2CEAA 2FJEA 3AXJA 1VZ0A 3CK6A 2F4VT 4ITVA 3EPZA 1XB4A 3E5XA 1X4PA 1FEXA 2EZKA 2HXOA 3GBGA 3QU3A 4HWDA 1FOXA 3KEQA 3CMLA 5KHDA 1LDKB 3OPCA 4IDOA 4KP3C 4M6VA 4A97A 4XORA 3ZYMA 2LRLA 1YQ4A 2XUEA 3UULA 2ACZA 2DWGA 3B6CA 2LSYA 1XNRT 2V1NA 2ICWG 1N75A 2K27A 4CCJA 2JMWA 2K24A 3C4XA 3K3NA 5FB2A 1S94A 3CJRB 2QLZA 4AKLA 4CXXA 4MLKA 2L7MP 3SEQA 2OJED 2IAIA 3HJEA 1X58A 3QRFF 1A36A 2DT5A 3FKJA 5C4XJ 5IWAT 2A61A 5J1YA 4QWNB 2K3PA 3P9KA 1U5TB 2FUG2 5FKLA 1NEKA 3T8OA 2JQQA 2LBFB 2LSJA 1AJ3A 4EJOA 3JAMZ 3DLAA 3JREA 4EV0A 5F0CA 5F5WA 1VQ6I 5K5QA 1BI0A 4A0XA 4PGGA 1OLTA 1UMQA 3HIFA 2IC9A 2W62A 5H6RA 1TZLA 1ZRCA 3LSRA 4KMCA 3FXOA 3DF8A 1J75A 3RRCA 3G1OA 1J09A 4DO0A 4ESJA 5KAIC 5TISC 1OCOH 4JYKA 5LJMA 1NTCA 5JH7E 3J7YJ 4LF7T 5E3OA 2X0YA 1LDDA 2OQGA 3ZSTA 1GDTA 1OPCA 1YQ3A 2P7VB 3K4LA 4PDKA 3E22E 4HFVA 5JDLA 3O9XA 1YYVA 3FKIJ 2YN6A 5EK4A 1HNZT 3AE4A 5BS6A 2D1VA 4CCMA 2Q2EA 3IKTA 1YD8G 2CWEA 2WP9A 3CF2A 3A01A 3WHBA 3AEGA 3RCOA 4UIGA 3MN2A 1X19A 3F9KA 2E7WA 1Y0UA 1DGRM 1RKTA 4XR6A 4AQFA 1R8IA 5C8YE 3LBXA 4MLOA 2X1EA 2V9PA 2EBIA 3Q9DA 4N0BA 1P7JA 1FP2A 4CCLA 4F6RC 4JX5A 2OC6A 3Q0UA 1YLFA 4XRSG 2HDCA 3ZQHA 4HF2A 1BIBA 1MH4A 4V19K 1RRJA 3JAEA 1QU3A 2HKXA 4XK4A 5HEGA 3KE2A 2F5DA 2DQLA 2HQRA 3IWZA 1T38A 2HGCA 3PJAA 4NXMT 4BQNA 3HOWJ 4J01A 1ZK8A 3OYAA 4IE5A 3ZCJA 3OYMA 1BW6A 2XAHA 2ZJPF 2E2AA 3VPRA 3BK9A 3DCFA 2WAFA 1R00A 1DP3A 3HRSA 2K4BA 4XL9A 1WRJA 2TDXA 2XQ6A 1XCBA 4Y52J 3ESLA 4ANJA 1E17A 5CGMA 3CCEI 4KIBA 3PFYA 5IYBJ 2V6EA 5L3CA 3AE6A 2DN0A 1PP8F 1OWAA 2DI3A 3FZFB 3IH3A 4IHTA 1RUOA 4DBQA 1FZPB 3H0DA 2LKGA 4X1EA 5EK3A 5AQQB 4A93J 2BY2A 1UX4A 5JVTA 2O3FA 1GXPA 4RS8A 1MIYA 2JMKA 1HR0T 3FBZA 4KX6A 4HN9A 4EJTA 1RKWA 2GM4A 5JVDE 1XNQT 1QHGA 2JIWA 3WE3A 3BQYA 1V55H 1D0YA 4YJ2E 4IIJE 3V8KA 3OYLA 2DOEA 1I6XA 1P4XA 1E3PA 4TNVA 4Y15A 2IAKA 2Y75A 4U3CA 4ZS2A 1T08B 1R5GA 4I98B 3HA4A 3L3PA 1UELB 4YLHA 4RB2C 4LK0F 4GK0E 1KNRA 3WU2C 4CHUA 1JTYA 1WJFA 1PYVA 4LMKA 3RIRA 4AKRB 3ASOH 3NRYA 3IL2A 1F1ZA 2H1LA 3SHFA 1A5JA 3FHZA 4DVDA 2V26A 4DR5T 2WMNA 3VOEA 1ZARA 1EV7A 2DYSH 4I02A 2WAUA 3LJCA 1WYCA 3AA1B 2IXSA 1IDYA 4YT0A 1WH7A 4A3IJ 2DYRH 4NBQA 3LAPA 1ZLKA 1EH7A 2A6EF 2QZ8A 2HH7A 2X9YA 3TOAA 4CH7A 2RN7A 4A3BJ 3IV5A 3VFZA 1IJ5A 2HOAA 4LFCT 5DS9A 2BV6A 2KIMA 5FLXK 4G6TB 3QP5A 4O2BE 4LMYA 4FE7A 3H35A 4CXWA 4EZHA 3HKZN 2VJJA 3V7CA 1GQEA 1OEDC 2R5YA 1ZP0A 1SVMA 2DOFA 3BROA 4C91A 2JRTA 2F5FA 3AAIA 1SEUA 3TOBA 1EZ3A 3AB3B 4U72A 2IA0A 3FIWA 4M6XA 2VBYA 4I55E 2MGQA 1RPWA 1B7TA 3A7MA 3EABA 4KICA 4BAYB 3OV8A 2NNNA 2CE7A 2NR4A 3RIUC 3N9QA 1Z21A 5E1WA 3ZMSA 1LFBA 5F0HA 1RUNA 1BOBA 1I3QJ 2WWUA 2W82A 4I0BA 2J4GA 4XLNF 3ZQCA 2K48A 2M0MA 4CXYA 2DA6A 4OFZA 2BXYA 2KQRA 4RLQA 3JSPA 2P6TA 4IEJA 1SC7A 2CW8A 3IH4A 3ZMVB 3I4PA 4QTRA 2YU9J 2IEKA 2UXXA 2X0LA 3S1MJ 3H5NA 1XSVA 1TT0A 2L02A 2MLGA 2VT2A 4RAZA 4IRGA 3OIPA 3FF5A 4BKXA 1OEDB 2KWIB 2AHQA 5JDQA 1EH8A 4LFUA 3CIRA 2R7OA 1I94T 1B8IB 4HBLA 1W7PA 4BJMA 3N5LA 3JRCA 3HOVJ 3RRWA 2VB6A 3DTEA 4YFKF 3C2BA 2DFHA 2JRMA 2QKLB 3S15J 2PMHA 1WFXA 2JA5J 2CQXA 5HXSA 2KT9A 1VI0A 1SMYF 2KL4A 3E3VA 3K70D 2EFNA 1Z77A 2PJRA 4W97A 1RNLA 3EI0A 4ZYGA 4MHCA 2NTYA 2MAWA 1Q1VA 2X4HA 5TJJA 4FASD 4DOZA 4BJTA 4AIUA 1I5ZA 4PZJA 3SJMA 1J7KA 2ZJRF 2NS0A 4B44A 1VQOI 3WHCA 4ZTJA 2A72A 4XLCA 3ZQFA 3EDPA 5HWYA 1L0VA 5CFBA 2ZNYA 3OYKA 2NP9A 3QB5K 4KIGA 2WY7Q 3V4GA 3T1YT 2E5ZA 3E6MA 5CYVA 4DV7T 2PQ8A 3IWFA 5HODA 4HWHA 1WWXA 1V5FA 3K4BA 1MDMA 3C51A 5LA6E 3ZJ1A 5M5XJ 2E60A 2XAUA 2OTLI 3P4SA 1MMGA 4OHFA 1I1GA 3H1CA 2IT0A 1YX3A 3EUKL 4F8HA 4UVBB 2HI3A 1MNDA 5K7ZA 2XHEB 1AKHA 1W36D 5D5VB 2LEHA 1NK2P 1B4AA 3S2WA 5GAHJ 2MBFA 2M2EA 5IP9J 2XQ3A 4AU7A 5LBQA 4R8HA 2BW3A 2DA5A 4MFDA 2IA1A 1PVEA 1DPRA 2IS4A 2E35A 3HSEA 4HEA2 4JOMA 2XY8B 2X6OA 4YELA 5D5XB 3AAAB 3B5MA 1KNZA 2V7FA 3WU1B 1BM9A 1Z8UA 4QX8B 4DYRA 4DYCA 4Z8XA 3AECA 3ML6A 1EA3A 5HDGA 2E2JJ 2VKHA 3ZMUA 4MTDA 4PK5A 2X6WA 4BHPA 3BPXA 4CO8A 3OL3A 3BTCA 4G7ZF 2A5WA 4O3MA 3RI5A 4B1RA 2XRNA 1KQ8A 2LF7A 2XASA 3SZTA 3N9OA 3ZN1A 4AYBA 2XB5A 3G73A 3PUAA 3S4UA 3ZKRA 2DK8A 2UXBT 5L4HA 4IREA 1UURA 2N1GA 3ECHA 3L00A 2E1MB 4TUYE 3Q3SA 1V5EA 2BKPA 4UV8A 1R49A 2DLLA 2LKPA 2EHOA 3V7RA 4C30A 3UUNA 4JBAA 4FQGA 2RNGA 2LM2A 1WJ5A 4RGRA 3P50A 5CQEA 3D0TA 4AVPA 5CA0E 1D1CA 3C1DA 1W4MA 2XGCA 3TLSA 1LVAA 2L9SA 4AM3A 2M9HA 3S3OA 2CUZA 2Q9QD 3H3UA 3BPVA 2YX4A 1HA8A 1ETWA 1KFYA 2XGXA 3BZCA 3L7WA 5GP9A 4IL6C 4BU2A 2XJ7A 2KIFA 5GADJ 1ZV4X 4DZPA 2W61A 4H9NC 3ELKA 1FTZA 1JUSA 2R7FA 2LVSA 3WTZA 1U5PA 2V7LA 2W66A 3SOLA 5IOYA 3CMAI 1UCUA 1LFPA 1XTAA 2KPMA 4MGRA 3D1NI 3I0OA 5D5WB 1PDNC 1IJWC 2YR2A 5J4YA 2P0WA 4AC0A 3CX8B 1MBGA 3S17J 1DU0A 2A6TA 4DV1T 3F22A 5HEOA 5F64A 5EEAA 1V3FA 3MWMA 5AQMB 5HEHA 4NUBA 4II3A 4ZYDA 2E2IJ 5H6QA 5JDNA 3IP4B 5LGNB 2W25A 2MC4A 1A31A 1UK5A 5DCMA 4HKAA 4JI7T 4L0ZB 4H9PC 1OKRA 1ETXA 2L9RA 2DA7A 3FWEA 1IRGA 4OK0A 3LSMA 3HOSA 3RYFE 3HKCE 5HXEA 2Y31A 4HX4A 3O4XE 3O1IA 1KYWA 2P6SA 4I4TE 2HQAA 3HR0A 5LHGB 2COMA 2K86A 5FYMA 3ZMTA 1O3XA 3IAS2 2YKSA 2HDWA 2KRHA 4S04A 4H9QC 3BG6A 3KBTA 1HKQA 3TBIA 1G6NA 4RGUA 4JI4T 1IUYA 4HWIB 4IZZA 4HX8A 5C2TA 3FXKA 1YIJI 1X2MA 3GF2A 2RA1A 4NUVA 2EFPA 2K40A 4UV9A 2LLKA 4B3MT 3FDYA 2BVMA 2WAQN 1RETA 3KYLA 1IRFA 2ADUA 4PCQA 3I53A 2R7UA 2ZCWA 4EMSA 3CJNA 3W6JB 4MEYF 3RF1A 4BDYA 3O6BB 2CS3A 2VQCA 1N33T 3BG9A 3M3YJ 5LEKA 3GMIA 2PJQA 1NHAA 1Z0XA 1WFDA 1X3UA 3SDBA 3DEUA 1K7AA 1HC8A 3QK6A 2ACJA 4WW0A 3DLLF 2NVXJ 1Z9CA 3EUAA 4S05A 2LFBA 2DDAA 1JKPC 1SD4A 2LYCA 1LVKA 4AUXA 3CCUI 1TT5B 1UG2A 3ZJ2A 2Y9ZA 1KEYA 4DR7T 1VCSA 3C3WA 5HXRA 2R7TA 4Z6YA 1XDUA 2DW4A 3AE9A 4AQFC 4RB3C 3PUSA 3V5UA 1E2XA 2DA4A 3MAJA 2V4JC 2DFIA 2EIMH 3ASNH 4CSWA 2IC6A 3TLTA 4C90A 4HNVA 1USTA 5E1ZB 4HA8A 3CP8A 2PG4A 2I6HA 2V1DA 1JI8A 2UV1A 2RVCA 4B47A 1POGA 3EYIA 2WCAA 3DJBA 3MACA 4M3GA 4IDQA 5HCMA 3SFEA 4QX7B 2H6CA 4GGGA 3ZN0A 4X0GA 3DPUA 2VKJA 1J5WA 3ULQB 3BZKA 1YO5C 1PJRA 2DA3A 4Y33A 3CWZB 3IRQA 5ICGA 2GZWA 5LP6E 1D3YA 1QHHD 4V2GA 2W48A 3MZHA 1X4OA 5FXXA 1I50J 2DMTA 3C2GA 4XOPA 3ZQGA 1T33A 3L1PA 3ISPA 2Z16A 1RC9A 5B66C 4Q48A 5LGTA 2LM9A 3W2VA 2FQ3A 3ZLIA 1MMAA 3P5JA 2BG9B 3FZLB 1ZKGA 5D6EA 2CW7A 2CXDA 5LG4A 2VLAA 1T8BA 4HFCA 4TX5A 5ETWA 2QBYA 4DR6T 3FXLA 4NB5A 2Y0MA 4AWXB 3JC6C 5CJ5A 4CYCB 3PUWF 3PU3A 2LE8A 3N9MA 2NOGA 1LE8B 4TNWA 4FX0A 5E3MA 4TWFA 3QUJA 2FBHA 3IH2A 2GA2A 5CVIA 3ABTA 5AQIB 2LREA 2K9MA 4E7HA 2VONA 3RYRA 4RAYA 2M30A 1GHCA 4OX9T 4I76A 5E3LA 3AA0B 1HOMA 1MMNA 1C0WA 4MTEA 3KFWX 4KI0F 3N9LA 1U2WA 2XQ9A 3HHHA 3J80K 3CX6B 3HZJA 1DQUA 2QUFA 4AYBN 1HF0A 2V9KA 4DW6A 3NRXA 3CMEI 1G59A 2YEVC 3TKYA 4G63A 1HDPA 2XAJA 3G71I 2LKHA 1SFOJ 1D1AA 1G4DA 2E34A 2FJDA 2W0GA 4XLPF 2L3LA 2WDVA 1Y56A 4II2A 3UKGA 2FBIA 3QYEA 1OMIA 1ZELA 4PJ0C 1BC8C 3CP2A 3FBNB 2F48A 2LKSA 1R7JA 2XV4S 3E5QA 3I0TA 2HVSA 1NG6A 2LOPA 3CQCB 4H9OC 1JGSA 3S16J 2HU9A 2I8DA 3A4CA 1T0FA 2ZM2A 4IQ4A 2FNAA 4G6QA 3AA7B 3WAKA 1TNSA 1J9IA 2CW0F 4CI2B 4EV6A 3IKVA 3RYPA 3U78A 3WGGA 3VEPA 3IHRA 2XRLA 1ZHFA 1W9RA 2Y48B 2VE9A 4BY1J 3M3ZB 1WHUA 1U78A 4E7JA 2M3AA 1HSTA 2OLTA 3KV5A 1ETOA 1MD0A 2EV5A 3PNTA 4W1UA 4PJMA 3J7AY 3CCLI 1WZ2A 3NKZA 4JI3T 1LB2A 1YW7A 3S1QJ 3VYTB 3OKQA 3HRMA 2AXTC 4Y3OA 4A5MA 1LJ9A 2VI6A 3HL2A 4A3KJ 4UNOA 3NBXX 2AQEA 3EVYA 1W1WE 3SFIA 4I2OA 3RPUA 2V5CA 3KZYA 1KNPA 3KLNA 2Q9QA 3K6GA 1VF9A 1WJAA 5FGMA 2DL1A 2I59A 2V6XA 4PAGA 5JR9A 4DR2T 4DR1T 1Z6RA 3BR5A 3LSIA 4HRIA 3I1AA 3VYSB 3CCRI 2L4MA 3JRGA 5FNVE 1IN4A 4ASNA 2OUMA 4I0UA 1H89C 4LB5A 2ME6A 1YI2I 2CPTA 4YEJA 3HRTA 2LSOA 2L3DA 3OYIA 3VU7H 1R1TA 4GKKT 4BH9A 1BR0A 3EDUA 1MMSA 1D1BA 1QRYA 2OD5A 1D5YA 3AE5A 2QYWA 3TMOA 2K3FA 4OMYA 2G7UA 3O8HA 4V1Av 4AXPA 3VDXA 5LGUA 3DWLE 3VB2A 1SFKA 2IW5B 3UU5A 1Z1DA 1GUUA 3UUXB 4LF4T 4WX9A 2V7IA 2V7KA 4WXCA 2ZMEC 4A2UA 4U2YA 1HNWT 2H8RA 5FY7A 2KSRA 2UUAT 2KRCA 3K4MA 3MMYB 1MH3A 4DUYT 2D9DA 1Y8RB 4NPPA 3QU6A 3KV9A 6PAXA 4I09A 4ZZLA 1FYLA 4GDFA 3H3ZA 5LRRA 2FBWA 2XSAA 1G8XA 2COBA 5EYRA 2L7FP 1XGSA 2NOXA 4UHTA 3JC6D 4L0YB 2E1CA 3JTHA 4B09A 2M7AA 3F8CA 4BEHB 4GK5E 4TV8E 4P09A 2LSIA 1IBKT 2L5QA 2KJBA 2NVYJ 3O1HA 3VYRB 1OCCH 1WCMJ 3EQLF 4EB6E 2A07F 2WM9A 3I4NJ 2GLOA 2UWMA 1I39A 2HR3A 1JJ6C 3OYXA 5ABEA 2RQQA 1T56A 2VKDA 3A0HC 3J81Z 1AHDP 3AG4H 4AIDA 4HEAA 3VHLA 1Y1WJ 2HPMA 4HW0A 5JRCA 2KXPB 1HLVA 5IYZE 2JZYA 2X51A 4A69C 2CCQA 2ZMEB 4BS9A 4GXOA 1SAXA 2XSJC 1SFUA 1IC8A 5C3JA 2J62A 2X0HA 3CDIA 4XN0A 2QCOA 5H20A 4QWQA 5CQGA 3RQUA 5L3EB 5E18F 2LOSA 3RSNA 5JFRA 1LPQA 1WR0A 2V6YB 1YKEB 4YHJA 4DIDB 4Q25A 3P7IA 3B02A 5DM7F 4QH5A 2X1CA 2WY8Q 5HDKA 2DU9A 1DU6A 4GYRA 5EEHA 3CCJI 4DNDA 3Q0VA 3KX2A 4DNCA 2KJCA 4XN3A 1WH5A 1V54H 4LG0B 3HB9A 3OTOT 1DUXC 4LF8T 4DR4T 2LC2A 2ELJA 3SEZA 4HLYA 4EEFG 2IDOB 3HKZA 2WWYA 2XGDA 4QH1A 3QYBA 2HTSA 3FK6A 1FBUA 1P9QC 2EA4A 2I10A 1ODDA 4KN7X 5DCFA 4RB1A 2RV8A 1UUSA 2K5BB 4JI2T 1FIAA 3CQGB 1ZTRA 2IP2A 2E71A 4M3DA 4RAGA 1SAUA 1IV8A 5L3DA 1D8JA 5EK2A 5A2QK 4ZI3C 4CGZA 2D2SA 2W63A 4E7IA 1BA5A 5GAGJ 3CQZJ 1GVDA 4P1NA 3KP5A 4BJNA 5L3GB 5E79C 2VOOA 4XSZF 2XAQB 4JEHB 2HQNA 2R0QC 1I3AA 2X9WA 3HDDA 2KISA 3PUFA 2EHOC 3LG7A 1S3JA 1OCRH 3S1NJ 4AKIA 1S7EA 4A3GJ 5IYCJ 1FOYA 2WTEA 2DHRA 4XKVA 4LOCA 4F91B 4UF0B 5AQLB 2IJLA 3IBPA 2LRKA 2Y0SN 2CBJA 4HQMA 2G7HA 1DDNA 4ZDPA 5DM6F 2XM2A 3REOA 4M72A 3GA8A 4K0KT 2UXDT 1BW5A 1WJEA 4P9FA 3FXMA 2VKEA 1W0BA 5J1GA 5F27A 5JDGA 3PSIA 2IVMA 2JTVA 4Y13A 2L0KA 4CQIA 5DABA 4UB6C 3QQAA 4DJAA 2XC7A 5M3FJ 1PUFB 4P5OA 2EFWA 3PM1A 4CA0A 4P1WA 2MH2A 3F8MA 2N8GA 2D0TA 3QYFA 1HG2A 4L5JA 2Y2ZA 5HCJA 1YJWI 4U88A 4P0AA 4NUUA 2ZXHA 4ENNA 2BOLA 1HS7A 4XLAA 2DCFA 4E7ZA 2GIVA 3CMYA 2P5LC 3B13A 4KMUX 1VQ9I 2R7SA 3OYNA 1MJAA 4JBWF 1JKRC 1I6ZA 3KBUA 2M4KA 2WAEA 1Z3XA 1JKOC 1S8NA 4CZZB 3K4JA 2Z99A 3HTUA 1TNTA 1GV2A 5J1UA 2QQ9A 4QPQA 4BQOA 4DGWB 4BGDA 5C44J 2AS5F 3J7Yq 1T8IA 4AI6A 2ME0A 2BG9E 3OSFA 2C5IT 5KK1A 5FRNA 3FXDB 2WA0A 4JX4A 4UVAA 2DPDA 1JXSA 5AQSB 1WJBA 2PX9A 4QH4A 3BP8A 5GPCA 3W15B 2BVLA 2R5ZA 1BC7C 1KZHA 4A98A 3KLOA 5EGOA 4BBRJ 2WB1N 4X65T 3CVRA 1K83J 2OA5A 2O9LA 3HBLA 4IHWA 2LT3A 2LSKA 2H88A 4HQEA 1H88C 3OIOA 3A02A 2JQHA 1BJZA 4X1YE 3F72A 4U2ZA 3ZSSA 5DUIA 4PGHA 3OYCA 5L47A 4EJWA 5LHIB 3Q9VA 2ZC2A 1S6LA 5DD8A 1ZQ3P 1YKHB 4TZ4C 5FL1A 3FMRA 5LHHA 1XS9A 5AQVB 2JK3A 3RKXA 5FKYA 2B7EA 5HLHA 4F3QA 3L2WA 5JVGF 9ANTA 1TWFJ 3QODA 3V42A 4UELA 4X62T 5ED4A 4NQWB 4E7SA 2BS4A 4GOUA 4EZ4A 4CUGA 1SD6A 3K2ZA 3K0LA 3WGHA 1Z0PA 4NXNT 2K85A 1E0EA 1CUNA 1GV5A 4IVNA 3WGIA 2FOWA 4AKHA 3GFLA 4TV7A 4KISA 5IUXA 1WQ2A 1U6GA 4ZDLA 1A6QA 3UFGA 2DFEA 4M74A 4ZEYA 3IRRA 1Y01A 2JVGA 4JK1X 1E2AA 4WYVA 5L3BB 3RPQA 4FX4A 4XMYA 3L8RA 1H9GA 4N78D 2FNPA 2VPRA 3EETA 4LGWA 4N9HA 4UUSA 5CLSA 2M6IA 2HN2A 5EG0A 1AU7A 1L3LA 3ZYLA 3KP4A 3S2DJ 2YDRA 2IA2A 3CLQA 2OV7A 3GLXA 4AVZA 5J2UE 5IT3A 3KEOA 1H7CA 2BEOA 3BZ6A 1X79A 2BBHA 3VWBA 3HRUA 4KUMA 2CV2A 1YS6A 3K3OA 1JT6A 2QGUA 1ZG1A 5CPRB 3N2GE 3UFEA 1KK7A 1UX5A 3ZEFB 1B9NA 1WKMA 3BCBA 1HX1B 4AISA 2A9UA 3LFMA 4AQGA 1XDSA 4XBFA 4EM0B 3A8YC 2D5VA 2QQ8A 2E36A 4FETA 2M34A 4OAZA 4RM3A 3SDGA 5ABHA 3S32A 1XMQT 4ZJZA 4X6AJ 2DNXA 2QRXA 5M4YA 1CGPA 5JLXA 2DMNA 1IAPA 3E0JB 1V5GA 2E8IA 2KZ7B 2NW9A 1FYKA 2Z5UA 2QQAA 1D5VA 4EOZB 2ELKA 3R0JA 3P9IA 4MFEA 1BR4A 5FKNA 4TWHA 2HYFA 1EJ9A 4UVCA 1YW8A 2HPJA 1EKEA 3PE0A 2HEOA 2LY2A 2Z2SB 1XMAA 3E6BA 5BR8T 3M07A 4E7LA 1B72B 4BXXJ 2OTJI 2E1OA 2VQGA 1JT0A 2SPCA 5EZYE 3TW7A 3UU4A 3CJTB 2E9XC 3M65A 2JJ7A 1Z91A 2G9WA 5CVVA 3L2QA 3U3IA 3C2HA 1XCVA 3AEAA 3OR2C 3ANWB 3RKWA 3JRDA 3I58A 1NH3A 3LA3A 3WI3A 2WU2A 3F21A 3BT9A 3RQIA 1ZLJA 1MBKA 3PV0F 1IRZA 3DKYA 4H4KC 4U87A 5ICFA 2VQFT 2CU7A 3F6VA 4O6JA 4ZYEA 2L9NA 3VYUB 5K7HA 4H0EA 1QBJA 1ZRDA 3M7GA 1ZEEA 3KV4A 3LFUA 1IBMT 2G0UA 3I9WA 1YRNA 3KZZA 3LK3B 3MZKB 2WAQA 3ERMA 1YS7A 5L2LA 3LFKA 1TP4A 3GWZA 2Y30A 2Z9OA 3F31A 4KIFA 3HXLA 4HSTA 2JUGA 2H6BA 1SD5A 1ETQA 1T0FC 1WI3A 5BPIA 2KIUA 3GCMA 2LJLA 4PNIA 4G7OF 3BTJA 1QSDA 2E9XB 1OR7A 3ZMZA 2QSFX 2LY1A 2NTXA 1VQLI 3AL0C 3KVBA 4QXHB 4JYAT 3PIPF 2XTLA 3MKDA 4YFSA 4FT8A 1SFXA 3RI4A 1LUJB 4CZCA 2DA2A 1K78B 3LSTA 3Q5FA 1MZBA 1ZOYA 2B0LA 5LYJE 4I6ZA 4N9IA 3I59A 5BMVE 1YITI 3NWIA 2VBXA 3W2WA 4L9VA 4ZYAA 3MZYA 4XKWA 4XOTA 3BTIA 3S1RJ 1QZEA 3PJRA 5HVQC 2JJ9A 3O1JA 3NZPA 5JR9C 5TGTA 1ZHCA 2W1OA 1R1UA 4XIDA 2NW8A 1F9NA 2XVCA 2EINH 2L9VA 3KP3A 2L2OA 2AE9A 3GWHA 4MHGA 3LK2B 5AFUL 4J00A 3OYFA 4A3FJ 1KYZA 2EV0A 1IW7F 3I55I 2Y6XA 3U1KA 3OYDA 3FBIB 3ABVA 2ACXA 1J1JA 1JUPA 3GN5A 3EUHA 1DP7P 1IG7A 1G2HA 3K69A 2DMUA 3MZ8A 1IJ6A 3QOFA 4HDVA 4AKGA 4OIQF 2AXDS 2VJ5A 3GTLJ 2BZBA 5GAEJ 3EYYA 3J7ZI 3HUGA 4L9JA 2EA2A 3CUQA 1ITYA 2XAGB 3KV6A 1ULYA 4HWFA 3FZKB 4DMVA 2L4AA 2PN6A 2FXAA 2K4JA 1TQIA 3MKZA 3H92A 2MBGA 4L0RA 4PJJA 4ERRA 4BE1A 4G6DA 4BNCA 2EZHA 4ADZA 3JRFA 1WYBA 2KDOA 2W24A 2KFDA 2ZJ2A 1MJBA 2CRGA 4ZHQE 3AEDA 4B3XA 3AEEA 4EAHA 1R6RA 2WBLA 3BR2A 3DBHB 1LEAA 2E9XD 3TLUA 3C7JA 2IIUA 5M5YJ 2H94A 1MBFA 4C2UA 3E97A 3H3AA 1ZGJA 4OU0A 4G12A 4EM1A 2WDRA 2DBBA 3ZQLA 5L3FB 3E0ZA
chains in the Genus database with same CATH topology
2L01A 4UXNB 1XGMA 1U5TA 2FMLA 3GW2A 4OMZA 2ESHA 5HXHA 3F23A 1FP1D 4PNIA 1Q1HA 1UHWA 2V79A 3KINB 4EVIA 1CF7B 4O5VA 4P9UA 4IE7A 5DJQC 1FBSA 3WTYC 3WG9A 3BJOA 5HXCA 4ZOLE 2XAFA 3E6DA 3K9TA 4OIOF 1KU2A 1FEWA 1FPQA 3KP6A 1ZN2A 4OOIA 3FBLA 3LWFA 3K8PC 2RNJA 1OXZA 5KVRA 4O4HE 2F5EA 4HV5A 1LVFA 2FMYA 3C4ZA 4GIWA 3BJ6A 1ON1A 1FT9A 3TDZC 3B73A 4M9ZA 2EK5A 5DQVA 1YW0A 2XUBA 1O7LA 4FI5A 3BWGA 4IRHA 2QA7A 1IXCA 2ZNZA 4G8XA 3V8LA 2VK9A 4J2CA 3LA2A 1FMWA 4HE8A 2MA3A 1P2FA 1TW3A 1J59A 2W84A 5D4SA 5J8CA 1TLHB 1LDJA 1QZZA 3J9X1 2J5PA 1FNNA 3PFIA 3RDIA 1O7FA 2MH9A 1LRZA 3PURA 4GCVA 4WNKA 3V8JA 2CYYA 5JR3A 4L9IA 2JSCA 3F2EA 2H3RA 4A6EA 3RKYA 1G3YA 2UXNB 1FWZA 5JDHA 3CTAA 4WWCA 4WCGA 5CA1E 1HG5A 4QKNA 1QNTA 4HLXA 2GQQA 2V6CA 2BBYA 1TQMA 1HCIA 4O4JE 4ISSA 5FD5A 1PUEE 5ILSA 1FYMA 2EV6A 2NNYA 2V1XA 4XAXB 3KVAA 4OYJA 1XD7A 5BMZA 4OINF 3E5UA 4XZCA 2ELHA 1I27A 2MLKA 2R3SA 4G2AA 5DEQA 5E1XA 5E8IA 4IRIA 3C98B 4NHJA 2DWKA 1B6AA 1HW5A 2PFBA 3MCZA 4H9SE 3A5XA 4M6YA 4ILUA 3ZQ7A 2H7VC 5H6RB 3RYHE 5LCYA 3O2PE 4EGZA 2RQPA 3RH3A 5FXVA 3F3XA 2FA5A 2YU2A 3PDYA 2M1BA 2YX7A 4HX7A 2LSGA 1EH6A 2L54A 1UHMA 2NYXA 4G94A 1KU7A 3D5LA 5CVUA 1HKSA 3LK42 3BJAA 1BI2A 3MEXA 3PTRB 4AD9A 4PJLA 3GZ6A 1LNWA 4I01A 3DTOA 3GXOA 3HSRA 2RDPA 3BQIA 2RP4A 2ZBKA 1W5SA 4P0BA 4EXTA 3SWHA 3TKLB 2CGPA 5JREA 3LBXB 4QHOA 3CO6C 3N97A 4BAYA 4I43B 1T2KA 5DUKA 5HLIA 2QWWA 4LJZF 5A1LA 4RGSA 2JT1A 3CUOA 5F3JA 4JLEA 4WXHA 4EJVA 2VBZA 4EGYA 5FY1A 5EZYE 1IN5A 1SD7A 1ZYRF 2HTJA 2V9VA 2NAZA 1S7OA 5FO5A 1O3QA 5ICEA 4ESFA 4A0ZA 2XKOA 4L18B 2XAHB 1HX8A 3VKHA 3R0AA 3MQ0A 1IN6A 2H7OA 2YK0A 3TO9A 4HF0A 3ZMVA 3R6SA 3IHUA 1P4WA 2DLRA 4GYSA 2ISYA 3SS1A 5L3CB 1HW1A 1REPC 2MOZA 2K7LA 2W85A 3WE2A 1VOMA 1IF1A 3DFGA 2A6HF 4WF2A 3WTXC 4MBQA 3RX6A 4WK8F 1D0ZA 5BOXA 4CI1B 1E1HB 3PQKA 1ZG3A 2XROA 3WAJA 1LQ1A 4P55A 3M1EA 3DPLC 5ERIA 3GFJA 2DAOA 2D0UA 3M8FA 3B57A 3QAHA 5TRDA 1QQIA 5FXZA 2O03A 3MK7C 5ILUA 1BI1A 3GFIA 2HFHA 4CICA 4KNYA 4IE4A 3P7NA 4ZH4F 2DQRA 2STWA 4PFOA 2GXGA 3D0SA 3V7SA 1ZREA 5BMVE 3TO6A 3PQJA 1O57A 1IZ1A 1HW2A 1J5YA 4ZYHA 4UVBA 2M8EA 3CDHA 4O4IE 4XRFA 3MFKA 3IC7A 2D1HA 2VWAA 5FLXZ 1R1VA 3FM5A 1LEBA 3BDDA 4EJUA 3KETA 3ZPOA 4DQ2A 1SFEA 3E08A 2VKOA 5D4RA 4PFPA 1BBYA 4L5GA 2F2EA 5K1YA 5KDMC 2AXLA 2CXFA 2MC3A 4ISTA 2P5KA 3NRVA 1BR2A 3HL6A 5D6FA 2DI4A 4OIPF 1FBQA 1S7AA 3ZMSB 5KX5E 2CSOA 4AIJA 3R4KA 1QUUA 2ZFWA 3Q9SA 2VE8A 2ZLYA 1BJAA 3I9YA 1R36A 3ZC0A 3AAEB 5TAOA 5EEGA 4HV6A 5FD6A 2V7JA 2UXXB 2X0LB 1FC3A 4A56A 4EYYR 4EYUA 4LD5A 2D2WA 3WTUC 2PFVA 3K1PA 3KP2A 1W7PB 5CVJA 4KA4A 4BQAA 3KDSE 3J7AO 2YU3A 3L9FA 2A2FX 4HDUA 3MXZA 4KN4X 2YPRA 5BPDA 1H9TA 2IPQX 5CVRA 2PJPA 3ZPLA 2FEZA 4PK6A 1QPMA 3QP6A 3W6KB 2PI0A 4IXAA 4H63H 2QQBA 1PP7U 1MMDA 2ZXJA 3N9NA 3HKBE 4MALA 3I54A 3ZP5A 3C4WA 1IAWA 2M87A 3U2RA 5E20A 3GFMA 4BYYA 2C0SA 3ERED 1IN8A 1UCRA 1K79A 3RTRA 2V1UA 4K2EA 1MDMB 5LHGA 4CXFA 4HOBA 2PLYA 3JTGA 1HQCA 1O3SA 2O61A 3GZ5A 5JQGE 3I71A 3CKDA 2EWNA 4A6DA 1GXQA 5K5OA 3FHNA 4ENMA 2HYGD 4CXWA 1WR6A 2XHKA 5LBQB 1BN5A 3GX4X 3SRZA 1Y64B 3F57A 3N2KE 2CWYA 1KQ9A 5AIQA 2NW7A 4R1HA 4Q4ZF 2Y8DA 2L9QA 4IHJE 3ZMUB 3R84B 2NWBA 1P4AA 3WTVC 1W7PD 5CJ9A 4RB0A 3I64A 4QLCU 4MNUA 2XASB 5LNKA 1RZ4A 1T6SA 5LXTE 3ZN1B 2W57A 1HTJF 5J8FA 1ZG5A 1YG2A 3PUGA 2LHNA 4UV8B 1FOKA 5DQWA 5LLQA 4U0WA 2EHOB 3V5SA 4AIKA 2MD5A 1IZNB 4YJ3E 4O8SA 4O4LE 5ADXL 3E6CC 1U4QA 2VBWA 1STZA 1J2XA 4MEXF 2VODA 2XAFB 2KRFA 1BI3A 1VRBA 2A68F 3OBVE 4U7BA 4U0YA 1A04A 3QPHA 2EFOA 4OYKA 2A3DA 3BQKA 5K5RA 1G73A 3HKDE 5LRSA 1V4RA 2PEXA 1KQ0A 4ZI2C 5E8GA 5DV5A 4JQFA 2ETHA 3JW4A 2PBIA 3NQOA 3HI2A 4Q47A 1WLXA 3RC3A 5AONA 1ZRFA 3R60A 3QC9A 2FOKA 2IRFG 2CMRA 2VL8A 5J2TE 2JPCA 5DYMA 5H6QB 2X9HA 5DCMB 5FXWA 2OZUA 2QVOA 5KMGP 3AVRA 1K6OA 1HBXG 3ZMTB 1Z05A 1XMKA 2QENA 1GVJA 2DO7A 3FM3A 3P8CD 3F8NA 4ZI3D 5F6FA 2HZTA 3M9AA 3IEEA 4EIWA 4Y17A 1AOYA 1B59A 5E17F 4M73A 2WV0A 4UV9B 2EHOD 1YFHA 4LLNA 3N9PA 1YIOA 2HKOA 2CWOA 4IGUA 3TO7A 3M8EA 2KLQA 3HKEE 2L8KA 5D5UB 2LF8A 1SHZC 3JSOA 4LLLA 3WTSC 1KU3A 3GEZA 3K3QC 2FRHA 2Y48A 4K0UA 4CYDA 2ODUA 2RC4A 3FXUA 4BHBA 4Z2YA 5DDGA 1SMTA 2OQRA 2F5CA 4KT5C 2QYOA 3P9CA