1T98A

Crystal structure of mukf(1-287)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
274
structure length
266
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The MukF subunit of Escherichia coli condensin: architecture and functional relationship to kleisins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
total genus 100
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t98A01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1t98A02
2WC2A 2W25A 5E1XA 2ZCWA 1XGMA 2F2EA 4IHTA 1YS7A 3JTGA 2WV0A 2XKOA 3HTSB 1BIBA 5LRRA 2IA1A 1ZRDA 3GYHX 3IWZA 4WK8F 3K1PA 3L7WA 1ZG5A 4L18B 4P9FA 4M74A 2CQKA 5J8FA 4ESBA 3IRRA 2GXBA 1G3YA 1O57A 2PI0A 3JSPA 4AVPA 3BWGA 2D1HA 2DK8A 1SMYF 5DUIA 3E6MA 5FO5A 1PUEE 3LWFA 4LLNA 1TW3A 3NRVA 3AAFA 2M45A 4KDPA 5H6QA 2GXGA 3EDPA 4HDUA 2DQLA 3L09A 4I0AA 2EFNA 1YIOA 1IXRC 2QUFA 1WRJA 5H6RA 1USTA 1JHHA 2O3FA 2CFXA 4EJWA 1YG2A 2EFOA 4I2OA 2P4WA 3EQLF 1IN8A 3M7GA 1SFUA 3LA7A 4KMUX 4Q5SF 3WTTC 4HV6A 3GFJA 5HLGA 1OMIA 5FD6A 3RIRA 2IW5A 4UVBA 1TQMA 4LFUA 3I64A 5F6FA 1QNTA 2VXZA 4YIIA 3R6SA 4GGGA 3E6DA 3HSRA 5HDKA 4O6JA 1IF1A 3KLOA 3COAC 2CSOA 4JK1X 3ERED 2ZNYA 3WTYC 3BDDA 3SZTA 4GYIA 4I98B 2O6GE 3GZ5A 1O3RA 1MKMA 5L3DA 1LNWA 5ICEA 1ZG3A 3JAMK 4WF2A 5LGTA 5DDGA 2EFPA 2HKOA 4UV8A 2A3SA 3HTUA 2GQQA 4NQWA 2CGPA 3RPUA 3BPXA 3F3XA 3HYIA 2ZO4A 4MNUA 3VOEA 2FMLA 2MBFA 4IF4A 4ENJA 3M1EA 1IW7F 4GCVA 4N0BA 1RNLA 3E3VA 2Z99A 3WU1B 2FOKA 1WI9A 3KFWX 2MA3A 1G3WA 2VT2A 5JHUA 3R4KA 2KRFA 4K2EA 2QQAA 3WE2A 3BJOA 3CTAA 4EM1A 5LRSA 3F8NA 1STZA 1LDKB 2V1UA 4MHGA 1H9TA 2K02A 4N9HA 1R22A 1ZLKA 2K4JA 5FD5A 1YTYA 1GXQA 3F72A 4IRIA 3HRMA 5J6XA 4QLCU 1L0OC 4RGUA 3QPTA 2FSWA 4XLPF 3WTSC 6PAXA 3GX4X 4KT5C 2HWVA 2EFWA 2KJBA 3VB2A 3LFKA 1R1TA 2M8EA 5L3EA 1IRFA 3GUDA 3E97A 4RAZA 4TV7A 2QQBA 2OAZA 1A04A 1P2FA 3J80K 3SHFA 2AS5F 1ZLJA 5E17F 5HLIA 3KEQA 3HSFA 1DPUA 3LQQA 2OD5A 2DPUA 1UCRA 4DQ2A 1B1BA 5D4RA 2A5YB 2XAGA 4L9JA 1X3UA 3L9FA 1R36A 1OKRA 1HXDA 5BS6A 4L0ZB 4G8XA 1E17A 2ZFWA 3B73A 4BH9A 5A2QK 1FP2A 5ERIA 5E18F 3KETA 1OYIA 5BOXA 5FFZA 1K6OA 4Y17A 4AIHA 4CYDA 3F6VA 3GF2A 2ELHA 1ZYRF 4JQFA 3O2PE 2P7CB 4O5VA 2E7WA 1IN6A 4MTDA 2L4MA 3J81Z 3REOA 4ASNA 5LHIA 5K5RA 2DPDA 3QPHA 2H6BA 2KIFA 2XAQA 4GO1A 2BE5F 2XV4S 2HTJA 1ON2A 4U0YA 3HOTA 4E70A 3B02A 1ZH5A 5DCMB 2FE3A 5E8IA 3DFGA 2ZNZA 2GIVA 2HGCA 1YW8A 2NS0A 3DP7A 1J5YA 3HRTA 3SZPA 4HX7A 3ZN0A 1YYVA 4LK0F 4UUVA 4CZZA 4FX4A 2V6CA 1RI7A 2NNYA 5LLQA 3WGGA 1FBUA 3J7AO 4HYEA 5CVVA 2QVOA 4BHCA 4NHJA 1I1GA 1BC8C 2MH2A 4WX9A 2ISZA 3ECHA 3RJPA 4YG2F 1F4KA 2EA2A 2BGCA 2H09A 1HKTA 3P9IA 5H20A 4KN7X 2BEOA 4HLXA 4EJOA 5LHHA 1B4AA 2VT3A 3RI4A 1XDSA 3HUGA 3F8MA 3JTHA 5CVRA 5DCMA 1BI2A 3N4MA 4LB6B 4ZYEA 4WXDA 1H0MA 5ICFA 4ENKA 2G7HA 2FU4A 2Y48A 5D5UB 3MCZA 1ON1A 1BI3A 2CG4A 3MEXA 3ZMTA 3FMRA 1UFMA 4M6YA 1I6XA 2M1BA 4RB3C 2DFIA 3T5XA 2MC3A 3GEZA 3K2ZA 2RQPA 5K5QA 3U1DA 1HW2A 5BPIA 1LB2A 3E6BA 2V79A 2L01A 3RYRA 3GW2A 3RPQA 3CUQB 5AONA 3W6KB 1ODDA 4PZJA 3E5XA 3GLXA 4I7HA 2YU3A 2F5EA 1W5TA 3ABTA 1YO5C 5DV5A 2FMYA 2HDCA 1FZPB 2FXAA 1S6LA 1SMTA 4EGZA 2COMA 1PDNC 2Z3YA 1H9GA 3SQNA 3P9KA 3T1BA 2DU9A 2HOEA 2W24A 4EM2A 2J5PA 1UHWA 2ISYA 3QU3A 4BYYA 1ZHFA 1K79A 1Z7UA 2STWA 3T8TA 5CVUA 2HEOA 3V7CA 3DF8A 4PGHA 2HZTA 3PQJA 3VODA 1D5VA 1KQ9A 4ZH4F 4U7DA 1S8NA 4AWXB 1U5TB 2OU2A 4IHSA 2RKHA 3DEUA 2AXLA 3M8EA 3ML6A 1E2XA 1XCBA 4U88A 1HW1A 1J75A 3IWFA 5D6EA 1EH6A 3ZQ7A 2O03A 1XB4A 4HA8A 2HYFA 3D0SA 3WTVC 2J5OA 3FXRA 3G73A 4YFXF 1W7PA 2ACJA 1YFHA 3CO6C 3H3ZA 4L9TA 1BIAA 2PG4A 4XLNF 3CUQA 4XBFA 5BQTA 4EVIA 1O7LA 4ON0A 5BMZA 1V4RA 5K5OA 1TQIA 2OZ6A 3I4PA 4EM0B 5K1YA 4N9IA 3HSEA 2A6HF 2X0LA 4HF1A 4A0XA 1IUYA 1D8KA 1PP7U 4M9XA 3GFIA 3F6OA 5LBQA 3F21A 1T2KA 5CLSA 5LGUA 2GAUA 1T39A 4OINF 2W57A 2JPCA 2PQ8A 2QWWA 2DT5A 2FNAA 1RUOA 5E8GA 3WTUC 2PJPA 1KYWA 2HQRA 4IXAA 5ED4A 2P6SA 2E1NA 4RB1A 3TDUC 2CW0F 4CICA 2QQ9A 4OMYA 2BYVE 1Z05A 4MGRA 1UB9A 1V3FA 1YS6A 3BPVA 3QP5A 3EETA 3RKYA 4CDGA 1FYLA 3R60A 4BHBA 4KIGA 1I27A 3E6CC 2HR3A 2DLLA 1KA8A 2DI3A 1Z6TA 5HVQC 1FT9A 3KP4A 5JR3A 4CXFA 3T8RA 5F1RA 1XSVA 2MH9A 1XD7A 2W84A 3SFZA 1I1SA 1OYYA 2K7LA 5CJ9A 1QZZA 2VC0A 2BBYA 2EV5A 3S2WA 4CGZA 3FM5A 2BV6A 4LMYA 2EFQA 3LA2A 1QQIA 1LEBA 1WKMA 1O3QA 5FB2A 1ZREA 2H6CA 1J7KA 4FX0A 4UVAA 1Z9CA 2FNPA 2A6EF 1Z1DA 4HV5A 2HQNA 5HS8A 1LDDA 1W4MA 1DPRA 3QP6A 2JSCA 4ZZLA 1NHAA 5LEKA 2EWNA 3V8LA 2HYGD 3TOAA 2C6YA 3FMSA 4EJUA 3FX3A 2L4AA 3KP6A 1CGPA 2XAFA 2RVCA 5CYVA 2D2WA 2IA2A 3FMQA 1MD0A 1G3SA 4XRFA 5DD8A 2VBYA 5JI6A 2STTA 2K4BA 3DXJF 3N97A 4WCGA 4P55A 5LEJA 2PBIA 3TO9A 1HSTA 3CO7C 3IKVA 5HOOA 1TNSA 2O8XA 4OMZA 2VC1A 2DO7A 2YX7A 2Z5UA 4KUMA 4RGRA 5E1ZB 3KE2A 4HOBA 3GXOA 5L3BA 2B0LA 5FGMA 2KIMA 3Q9SA 3WTWC 3HHHA 3K9TA 3K1NA 3CDHA 1RUNA 2OZUA 2P5LC 1XSXA 1KQ8A 2RDPA 1I5ZA 3KP2A 2EV6A 3FZVA 3GFMA 3QRFF 1KQ0A 2IA0A 4ENNA 2G7UA 5ILVA 4KNYA 1OPCA 5TRDA 2FBHA 1XSDA 1W7PB 2RN7A 3LA3A 3P9CA 2UZKA 1FP1D 1LQ1A 1WQ2A 3JSOA 1BN5A 3L2CA 3DV8A 2PEXA 3IRQA 2V1DA 3C7JA 2G9WA 3ZP5A 4AIKA 3MFKA 3I0TA 4RGXA 4PCQA 1TQPA 1XGOA 3ROUA 2LF7A 1R58A 3OOPA 4B09A 3J81K 2QBYA 4HLYA 3H92A 4HF0A 4KIFA 1L3LA 4HQMA 2Z9OA 3M9AA 1U78A 3RKXA 1SD6A 5HDNA 4G7OF 4A5MA 4IVNA 1YQAA 1XMKA 3C3WA 4M72A 2YR2A 2R7FA 4L5IA 1R7JA 2A61A 2M5WA 4FHTA 3ZPLA 1DP7P 1U2WA 3FM3A 3HRUA 3Q9VA 2JPBA 3WG9A 4OIPF 1J2XA 2TDXA 1XMAA 1IAWA 4NB5A 2CYYA 2L3DA 2Y0MA 3H3UA 2Q0OA 4HQEA 2RV8A 2WTEA 2QZ8A 2XVCA 2KIUA 4HDVA 4D0PA 4LK1F 1B6AA 4G9YA 1K7AA 5HLHA 2IJLA 4UVCA 1ZGJA 2UXNA 3ZMDA 3MWMA 3MQ0A 2FBKA 3F8BA 2XIGA 1B59A 1FPQA 1FY7A 1IN4A 3WTZA 2Z33A 2GZWA 3RYPA 2GA1A 4G7HF 1ZRFA 3ZMSA 3JW4A 2XASA 3ELKA 1KU2A 3DPTA 1F5TA 2DBBA 2VOOA 1W5SA 4ETSA 2VBWA 1S29A 2O0YA 3LQRA 3F8FA 4LLLA 3ULQB 2DW4A 3BJAA 3GFLA 1RIOH 4G6QA 4RB2C 2KKOA 2A69F 2WWYA 4OOIA 4YFNF 2IVMA 1F1ZA 5JFRA 1P4AA 5D4SA 1G4DA 5ILSA 2A68F 4BAYA 3F22A 2YPRA 4KIBA 4MEYF 3KZZA 4HZFA 4KMFA 5A2QZ 1J0RA 4BQAA 5CVJA 3GVAA 1MJBA 4MEXF 4L5JA 1B9NA 1FYMA 1YW9A 4R79A 2DK5A 1S7AA 4B8XA 1U5TA 3BJ6A 3I59A 2LF8A 1XCVA 1KGSA 2EB7A 1FC3A 2VE8A 4U7BA 4O3MA 2YX4A 4RAYA 3NQOA 4ZYGA 3MAJA 3P7NA 3R61A 5DD4A 2ZMEB 1BI1A 1EH8A 5BPDA 5HS7A 5EEGA 1JGSA 4IRHA 2ZBKA 3U9GA 5KK1A 2XKPA 5F64A 1FBSA 4L9VA 2Q8KA 4UNOA 5KVRA 4XSXF 4R8HA 5HDGA 5FFXA 4AD9A 1KYZA 2ESNA 2DTRA 2D1VA 2RNJA 1REPC 5D5WB 5TJJA 3BZ6A 1QGPA 4I0BA 5D8LB 4H0EA 3OV8A 3FF5A 3V7RA 3WTXC 3W6JB 2P7VB 4HBLA 4YFKF 2HFHA 3GWZA 3F23A 3E5QA 1XGSA 1MDMB 4KFCA 2DQRA 2A07F 3RKWA 3ZMZA 4BXUA 4PGGA 3EYIA 1ZARA 2QBYB 3QU6A 1W7PD 1SAXA 1GVJA 5DUKA 3HHGA 3IC7A 3TOBA 3K1MA 5IT9Z 4JBAA 2P6TA 3V7SA 4G94A 5ICCA 1QZYA 4I09A 2H27A 1J59A 1MZBA 3HOSA 1P4XA 1C0WA 1R5HA 2X4HA 2HTSA 1TW2A 3I71A 2XHKA 3LAPA 5HS9A 4OIOF 4F7ZA 3BP8A 5D5VB 5L3GA 1JHFA 3VEPA 1LJ9A 2QLZA 3KP5A 2P5VA 4YIFA 1G6NA 1OYWA 1LVAA 1P6RA 2H94A 4LB5A 2OA4A 2E7XA 1FBQA 1KU3A 4M9SA 3WGIA 3BOQA 2EJRA 1CF7B 1IXSB 1K78B 5LHGA 3O3KA 3GO5A 2K86A 4KICA 1Z6RA 1J9IA 2PLYA 3LSTA 4KYWA 4LGWA 1TBXA 2HS5A 2LDUA 1QPMA 2FA5A 4LG0A 3FXUA 2XAJA 1U8RA 3E5UA 2LNBA 4A6EA 2VONA 1KU7A 3ABUA 2Q2EA 3FHZA 3GZ6A 4KA4A 1SFXA 2DAOA 2PFBA 3D5LA 1SD4A 2M87A 1D3YA 2VE9A 2OQRA 4EV0A 4UV9A 4DNCA 4OU0A 1R1UA 4U0WA 2QM3A 4Y15A 4MQVA 1O3TA 3WU0A 1QO0D 4A12A 4P9UA 3TO7A 4OIQF 2FF4A 1B9MA 1Q1HA 5IT9K 5D6FA 2F5DA 3VFZA 4A5NA 3I54A 4Z2YA 1BOAA 2E1CA 1ZN2A 1IN5A 1FWZA 4AIJA 5L3CA 3IL2A 4ZYDA 2ADUA 2LSOA 1SFEA 2QENA 1IN7A 1R00A 1FX7A 1F9NA 3KZYA 2Y75A 2RGVA 3ZN1A 5J8CA 2IPQX 3L00A 4Q48A 4I02A 1TNTA 2L54A 3C18A 1FNNA 5E20A 3HIFA 3DQVC 3LAJA 1HW5A 5L3FA 2K27A 3KP7A 1HSJA 2ZMEA 1BBYA 2NAZA 3WGHA 2JRTA 3HRSA 2MLKA 5DYMA 1P4WA 1T38A 2IRFG 1TLHB 4HW0A 3TO6A 2EA4A 3TKYA 1IRGA 4G6DA 3DKWA 3ZMVA 1EV7A 1YW7A 5D5XB 1SD5A 3R0JA 4HX8A 5CVIA 1FYKA 4RS8A 4EGYA 3K69A 2L02A 4BHPA 3QAHA 1S7OA 4M6XA 5IT3A 2ETHA 3IHUA 5JVTA 3RDIA 2P8TA 2PMHA 3I53A 3I5UA 1USSA 2VODA 4IPAA 2FEZA 3TDZC 1Y0UA 3BROA 1XDUA 1CF7A 1U6GA 3EUHA 3TQNA 2GA2A 3ISPA 1ZGAA 1O3SA 1LEAA 2JT1A 2EV0A 2GWRA 4M71A 4M9ZA 1VTNC 1WWXA 1ULYA 3Q5FA 2V9VA 3M8FA 2R7DA 5E1WA 3V4GA 1OR7A 4U0VA 1XGNA 1IXCA 4QWQA 4S04A 4A0YA 1ZRCA 4EJTA 1T0FA 4HX4A 2YSRA 1R1VA 2UXXA 5FLXK 4OIRF 1T6SA 4L9NA 5ICGA 3JAMZ 4M73A 2UWMA 2NNNA 4WWCA 1UHMA 4ESJA 2IT0A 2O61A 1KU9A 2XAHA 1ZG1A 1MJAA 3I59B 4I01A 2PMUA 4LD5A 2V1XA 3MZHA 1HKQA 1ONVA 4CO8A 3EYYA 3FWEA 4MTEA 1TTYA 4GXOA 3KEOA 2MD5A 5AIPA 2PN6A 3CUQC 2ESHA 1XN7A 2KJCA 3WE3A 1HQCA 2RC4A 2XUBA 1P92A 2VBXA 4G7ZF 4P96A 4GYGA 4A6DA 1MJ9A 2F5FA 1D8JA 3O6BB 4LLGF 4EJVA 2ZKZA 3T0YA 4Y13A 3G3ZA 1G3TA 2XGXA 4RGSA 4RB0A 1BC7C 3PFIA 1FSEA 1R5GA 1JXSA 1T98A 2FBIA 1MDMA 2QYOA 4ZYHA 3I58A 4A2UA 3ZMUA 1FOKA 2LKPA 3KLNA 3CUOA 2NRAC 2OBPA 2MLGA 4Q47A 4Q4ZF 3RTRA 1U5TC 4WXCA 3SXYA 1SD7A 3BY6A 1AWCA 1PP8F 2NYXA 5D8KB 1U3EM 2FRHA 3FXQA 5ILUA 4HF2A 2CO5A 4PDKA 3ECOA 2JZYA 4HAMA 3K0LA 1GXPA 4CHUA 3J80Z 2IP2A 1GHCA 2OQGA 5EEHA 5AIQA 3PQKA 1ZAOA 3QOPA 2EK5A 4ESFA 4LJZF 4LG0B 5DEQA 3TGNA 2VOPA 5LGNA 4IRGA 4BNCA 2ZXJA 3DPLC 1WSUA 2XRNA 4FT8A 3MZYA 4S05A 3NEUA 3WODF 2HKXA 1BI0A 4KN4X 1BJAA 4UHTA 1DDNA 1K78A 3CJNA 1RZ4A 3KP3A 1R23A 2VN2A 2M30A 2XROA 1AOYA 1QBJA 1FSHA 1BM9A 1HBXG 4ENMA 3C1DA 1HKSA 3V8JA 1YLFA 1IZ1A 4P5OA 4A0ZA 1JE8A 4EQQA 1EH7A 4WXHA 3V8KA 1DUXC 4XSZF 3KCCA 4R1HA 4IJAA 4MQ9F 3IKTA 2FQ3A 3F8CA 5FLXZ 1O7FA 2ZJ2A 2F5CA 4ZZDA 1Z91A 4EMSA 2W85A 2JTVA 2CWEA 1LDJA 4UXNA 2VBZA 3U2RA 3R0AA 1MGTA 1S3JA 2R3SA 5DCFA 2D45A 1FLIA 2P5KA 3CLOA 4L0YB
chains in the Genus database with same CATH superfamily
2WC2A 2W25A 2WU2A 2X85A 4IHVA 5E1XA 2ZCWA 5GAGJ 1XGMA 5E3NA 4H9RC 2F2EA 3IAS2 4CH7A 4IHTA 3J7AY 4NIQA 5C4XJ 1W36D 1Y6IA 1YS7A 1XMXA 4NPPA 3JTGA 5LFAA 2WV0A 2R92J 3PUZF 2XF6A 5HAXA 2XKOA 3HTSB 4AKIA 5LHIB 3AB3B 2Q9QA 3SJMA 1AU7A 1BIBA 3D0TA 5LRRA 1DU6A 1IJ6A 4MFRA 3HEFA 1PJRA 2IA1A 1ZRDA 1FOYA 2Y31A 3GYHX 3IWZA 2NW9A 5LCYA 5E3OA 2L5QA 4DUYT 4WK8F 3K1PA 1WR0A 4HWFA 3L7WA 1ZG5A 3S1NJ 1IUFA 4LF4T 2GOXB 3C2GA 4JEHB 4TUYE 3HPHA 4L18B 4P9FA 1HX1B 3PU3A 2DFFA 3VPRA 3N2GE 3QNUA 5HEGA 4JOMA 4KUMB 3ZJ1A 2W61A 3JRHA 3CMEI 4QWNB 4ILAA 3FZHB 2DA6A 4JYKA 4M74A 2CQKA 3V42A 4ESBA 5J8FA 3IRRA 3QWLA 4I4TE 2GXBA 1G3YA 1O57A 3UUNA 2PI0A 4HNTA 4HFBA 3JSPA 4AVPA 3BCAA 4IDNA 3DEWA 1POGA 3BWGA 1MSEC 1YRNB 3VKHA 2D1HA 2DMPA 3KINB 2DK8A 1WYBA 1SMYF 5DUIA 3E6MA 4XOTA 3ABKH 5FO5A 3EUHC 2IXSA 4GOUA 2WAEA 2XM1A 2JJ9A 1PUEE 3TLWA 2J4GA 3LWFA 1FEWA 2VKOA 2MTQA 1HNXT 2JQ9A 3CESA 4LLNA 1TW3A 3NRVA 1X58A 3AAFA 2Y9ZA 3CX7B 4RLQA 3Q3SA 3D5RC 2M45A 2XQ8A 4PFPA 2JMKA 4KDPA 4TWDA 1IJWC 2R7UA 4LMKA 1HNZT 1HCIA 5H6QA 1JTXA 2GXGA 2HPMA 1S7EA 5DQVA 3EDPA 4HDUA 2DQLA 1CQTA 1U9NA 3H3VK 2F6CA 3L09A 4I0AA 2EFNA 1YIOA 1IXRC 3QOEA 3C98B 2QUFA 1WRJA 2WY7Q 4FE7A 2VKVA 4CXXA 5H6RA 4DR6T 1USTA 1JHHA 5IY5H 2O3FA 2CFXA 3DTOA 4DR3T 1HX8A 5GPCA 4EJWA 4AKRB 2OTJI 4CI1B 1YG2A 2EFOA 4I2OA 2P4WA 3I3LA 3EQLF 1IN8A 3S1RJ 3M7GA 4PSXA 2CU7A 3LA7A 1SFUA 4X65T 5GAHJ 3JC6D 4Y52J 4ILCA 4A3EJ 3DCFA 3WHBA 4KMUX 4Q5SF 1P7JA 1WYCA 2X1DA 3WTTC 4HV6A 3GFJA 1EF4A 5HLGA 3NVOA 2LK2A 1ZKGA 3ETVA 1Z67A 4Z6YA 4MLKA 3BR0A 2XSDC 1DU0A 1BR2A 1OMIA 5FD6A 3RIRA 3ZQQA 5E0OA 2IW5A 2Q1ZB 2CPTA 2ZLYA 1QPIA 4UVBA 1TQMA 1IG7A 4LFUA 3G1MA 2GK9A 3FKIJ 3LK2B 3I64A 5F6FA 1QNTA 2BHZA 2CS3A 4BJ6C 3AEBA 1MBFA 3OL3A 2K9SA 3CJQB 1MSFC 2VXZA 4YIIA 2LOOA 3R6SA 4OX9T 4GGGA 1YQ4A 3E6DA 5ADXL 1SVOA 3HSRA 2BXZA 3FDYA 4O6JA 3KLOA 3TMOA 5HDKA 1IF1A 3LJCA 4UELA 4RA2A 1PYVA 2M0MA 5K7ZA 3COAC 3CCRI 2V7IA 3ZCIA 4ZS3A 2CSOA 4JK1X 3OIQA 1EKEA 2ZNYA 3WTYC 3ERED 2J62A 1VNDA 4V2FA 3BDDA 3LK42 4IHJE 3SZTA 4B3XA 4H63V 4GYIA 3OJAA 2E1OA 4I98B 1E2AA 3LSRA 2O6GE 2WV1A 3GZ5A 1MKMA 5L3DA 1O3RA 3QOFA 4JI4T 1LNWA 2D0UA 4DVDA 5ICEA 1V54H 1ZG3A 2VK9A 3PSFA 4LF9T 3JAMK 3OY9A 2A3DA 4WF2A 5LD2C 5LGTA 2DDAA 5DDGA 2I59A 2X9HA 2EFPA 3GTPJ 2HKOA 2D5VA 4UV8A 4HFDA 2KRHA 4XKVA 2A3SA 2KXPB 3HKDE 1T56A 1FEXA 4B3RT 4FETA 4UV8B 2DODA 3HTUA 2GQQA 2WMNA 4COFA 4NQWA 2CW7A 2CGPA 3RPUA 2V6YB 2V7LA 3BPXA 4TNVA 3F3XA 1ZEEA 2WWVA 3I0OA 2IW5B 2CJJA 2JJ7A 3HYIA 2ZO4A 3LOCA 2JQQA 3RIFA 3T8OA 4MNUA 1OEDB 2M34A 3VOEA 3O9XA 2FMLA 2MBFA 4BQNA 3K3OA 3KBTA 3HGYA 1Q1VA 4IF4A 4ENJA 3M1EA 2KHMA 4MHCA 5JDMA 2V7MA 1IW7F 5FKKA 2R7WA 2ID6A 4GCVA 4TV9E 3UU3A 4XZCA 5J2UE 4N0BA 1RNLA 2FX0A 2QGUA 2I0MA 3DU5A 3NRXA 4Q25A 3E3VA 2Z99A 3WU1B 2FOKA 1WI9A 2E8IA 4D7MA 4OAZA 3KFWX 2YEVC 2MA3A 2L9SA 1O3XA 4JI2T 2V5CA 2XC7A 1R5ID 1ETVA 1G3WA 2VT2A 4LIUA 4DYRA 5JHUA 3R4KA 3KV5A 4KP3C 4JV5T 1TWFJ 2KRFA 2ZMAA 2A5WA 4JP0A 4K2EA 3RGLA 2JIWA 3H36A 2QQAA 3WE2A 3K1SA 3BJOA 2BY1A 3CTAA 3QK6A 3UUMA 4EM1A 4IKFA 2OLTA 3BCBA 5K7FA 4AU7A 5LRSA 5L3BB 3F8NA 5HEJA 5FKMA 4YJ3E 3EDUA 1STZA 1LDKB 2E2IJ 5F0FA 4MHGA 2VKHA 1H9TA 3ZOBA 2V1UA 1DGWY 2HXOA 3RZOJ 2XAUA 3S2HJ 2K02A 4GYSA 4A97A 4D1QA 4N9HA 1R22A 4ZOLE 1R71A 4QX7B 3NKZA 4Y4RA 2RQQA 4CCMA 3A4CA 5J4VA 2E19A 3OWTA 1ZLKA 3RLFF 5GP9A 2K4JA 4FJOA 5FD5A 3ZRGA 3ZC0A 4U72A 1YTYA 2DWGA 1GXQA 1J5ET 3BZCA 3OS0A 1RRJA 3F72A 2HN2A 5LHGB 4IRIA 3RRCA 2R7VA 2VJ4A 4P1NA 3KX2A 3VYTB 2LMDA 5M5XJ 2LY1A 4ERRA 4JX4A 4EZ4A 3HRMA 5J6XA 4G6TB 2C5JA 1D5YA 4QLCU 2XQYA 1L0OC 2JWTA 1A5JA 3ONJA 5LYJE 1ZELA 1UCUA 4RGUA 5FXWA 4GK5E 5FP3A 5B66C 2GBYA 1FOWA 2DOFA 3JCUC 3AFHA 3QPTA 2DT7B 2FSWA 4XLPF 1Y1VJ 3WTSC 6PAXA 4P0AA 4JX5A 3GX4X 2UXXB 4KT5C 2HWVA 1WJAA 3U1KA 2KJBA 2EFWA 3C50A 4LF5T 1FMVA 3VB2A 2VL8A 2P9BA 2B76A 3UTKA 2JUCA 3LFKA 1ZP0A 2VQET 1XMOT 2XASB 1R1TA 2M8EA 2ZFUA 2QA4I 3AAAB 4M1PA 5L3EA 4DJAA 2E36A 1IRFA 3GUDA 5HXSA 3HUGB 3OMYA 2JQ7A 5H6QB 3E97A 1WJBA 2XGCA 4RAZA 5C4JJ 3FHNA 4TV7A 4F3QA 1T72A 4BJMA 5C3EJ 5L3DB 5LNKA 2QQBA 5CB4E 5E79C 2L2OA 5IP9J 2MYSA 2OAZA 3KEYA 1A04A 1P2FA 2NOGA 4Y33A 3J80K 1UGOA 3KDSE 4II3A 1HC8A 3SHFA 2HI3A 2AS5F 1F43A 2NR4A 3GTJJ 1AA7A 3QPSA 1ZLJA 3AAIA 5H6RB 3RZDJ 1JJ6C 5KHDA 5GTIC 5E17F 5HLIA 5J4YA 2W0GA 3DWLE 2MFZA 1Y1WJ 2LTPA 3KEQA 3H5RA 1SEUA 1JKPC 3VR8A 3PUXF 2LFBA 2IBDA 3HSFA 3RX6A 1DPUA 3LQQA 2OD5A 2X6WA 3I4MJ 1MIVA 2E9XB 2DPUA 1UCRA 2YN6A 3ZMTB 4DQ2A 2X0HA 5JREA 4CSWA 1B1BA 1NK2P 4CQIA 5D4RA 2A5YB 3HDDA 1HR0T 5GAEJ 4A3FJ 3KV6A 4XNFA 3ZQIA 2XAGA 2COBA 4KBMB 4L9JA 1JT6A 3DKXA 3QC9A 1X3UA 3L9FA 1HNWT 2RPAA 4ZI2D 3ZQGA 1R36A 3AEEA 1OKRA 2WP9A 2LKXA 1HXDA 5JHFA 5EK4A 5BS6A 4XIDA 4QPQA 3J9X1 3SFEA 2KDOA 4L0ZB 5C3JA 1PVEA 1IRZA 1XX5A 4G8XA 2LM9A 2EZIA 1E17A 2ZFWA 1MNMC 2CUZA 3B73A 3DEEA 3QQAA 2V26A 4BH9A 4GRIA 1YITI 2VL0A 5A2QK 1KF6A 2VWAA 3A0BC 1FP2A 1M1EB 2ZM6T 5ERIA 5E18F 3IH3A 3OYXA 4TV8E 4FISA 3KETA 1OYIA 5BOXA 5FFZA 1KNPA 4O4JE 2YDSA 1K6OA 3ASOH 5BNGA 4EGWA 4Y17A 4O2AE 4AIHA 1J09A 4CYDA 3PUQA 4JUYA 3F6VA 2WAFA 4A3CJ 3GF2A 5J1UA 1DP3A 4O2BE 3A01A 2Y69H 5FXVA 1NG6A 5HWYA 2UUBT 4AUXA 4I6ZA 2FJAA 2ELHA 1MIJA 3CC7I 3CPZA 1VQ9I 1ZYRF 4JQFA 5TGTA 3S93A 3O2PE 2P7CB 1WR6A 3RIUA 4O5VA 5L4EA 2E7WA 1IN6A 4MTDA 2E2HJ 2L4MA 5ABFA 3J81Z 3REOA 5AQGB 5JDQA 2MGQA 3ZMUB 2UUAT 1FIPA 4ASNA 4YSYA 5LHIA 5K5RA 1V5EA 4A3GJ 1WJEA 4AKLA 3MVPA 2DPDA 2KDZA 1UX5A 3QPHA 2H6BA 2X0LB 3AA6B 4F8HA 2XRLA 2HDDA 2KIFA 3SOLA 1WZ2A 2GOMA 2XAQA 4GO1A 2BE5F 5HNFA 2XV4S 4JX6A 3UUXB 3RH3A 4FCYA 2HTJA 3JAEA 2R5ZB 1ON2A 2C0SA 2VQLA 4U0YA 5EK2A 3TP3A 3HOTA 4E70A 3H0DA 3K70C 2FUPA 1OCRH 3G1OA 1BR1A 5B1AH 2Q9QD 1JUMA 4HKAA 4QX8B 2FD5A 2X1EA 3B02A 4A3MJ 3P4QA 5LJNA 1DGRM 3HB9A 1ZH5A 2ZB9A 4PUSA 2H7VC 2VVNA 5DCMB 4TZ4C 4ZEYA 4YELA 5EZYE 2CXFA 1AKHB 2FE3A 4U3CA 4DR5T 2KT9A 5E8IA 3DFGA 1E3OC 3BR6A 2ZNZA 4M3FA 3SFIA 2GIVA 3DLAA 3LFMA 2HGCA 4YY3T 1YW8A 2NS0A 3DP7A 4BQQA 3AL0B 1J5YA 3HRTA 1W0TA 3SZPA 1V5GA 4CCJA 4O8SA 2Y0SN 2IGKA 4HX7A 3ZN0A 4HNVA 1R8IA 3B13A 1YYVA 4LK0F 4UUVA 5JLWA 3WG7H 3RIAA 4CZZA 1KONA 4PJNA 5DTDA 4FX4A 2V7FA 2LRKA 1UHSA 2QSFX 2V6CA 2Z6EA 5C8YE 4BKXA 5CA1E 1RI7A 5HXHA 3OYJA 2NNYA 1A6QA 1A35A 5LLQA 3J7Yq 1OWAA 3OYBA 3A2KA 4KX6A 3WGGA 4IQJA 2NVQJ 1FBUA 1W0BA 3LDQB 2R7ZJ 3J7AO 3P50A 4HYEA 5CVVA 2XY8B 3X1DA 3TLUA 2QVOA 4XR6A 2R5ZA 1M62A 4BHCA 5EEAA 3PUGA 1FJLA 1I1GA 2KFDA 5F1JA 3KPHA 1BC8C 4NHJA 3PUWF 1H89C 2MH2A 3SEZA 2RNGA 5JDLA 4B44A 4WX9A 2ISZA 4KHZF 2DTZA 3ZEFB 3ECHA 3RJPA 4YG2F 2BDEA 3IH2A 2ELKA 3HKZN 1F4KA 2EA2A 2BGCA 2H09A 2LG4A 2HVRA 1HKTA 1HF8A 1JT0A 5FJ8J 3TKLB 3P9IA 1ENHA 3Q5XA 1YIJI 5H20A 4KN7X 4BQOA 2DMUA 1LPQA 2BEOA 2K9QA 4IZZA 4HLXA 1X1AA 3HL6A 4EJOA 5LHHA 1B4AA 2VT3A 3CF2A 3RI4A 4E7HA 1A6IA 1VQKI 1XDSA 2V4JC 3HUGA 5FVLA 3F8MA 3JTHA 4HSRA 5CVRA 2K85A 5DCMA 3HKBE 2VI6A 4FASD 4O4LE 1BI2A 3RC3A 3BR3A 3N4MA 2CV2A 1HA8A 1XDPA 2E9XA 2CBIA 2IMLA 5B3SH 3PUAA 4JI3T 4LB6B 4CYCA 4LFBT 5DM6F 4X20E 4ZYEA 3PJAA 2W00A 2BZTA 4WXDA 1H0MA 4CCKA 5ICFA 1XNRT 3BQIA 2NOJB 4ENKA 4DO0A 2G7HA 2FU4A 4PSWA 5KNLA 2BKPA 2Y48A 3FK7A 5D5UB 2H8RA 3EVYA 3N9NA 3PV0F 3MCZA 4EOZB 5KAFC 3FK6A 1E7PA 1ON1A 1WCMJ 1U4QA 4JI7T 3ZYKA 3PDYA 2OA5A 1BI3A 3NWIA 5CJ5A 5AQQB 1YQ3A 2CG4A 2WMOA 3MEXA 3ZMTA 3FMRA 3PSIA 1UFMA 3Q0WA 4UB8C 2R7SA 5AFUL 4GIWA 1L0VA 5ABGA 3UUBA 2CHOA 4M6YA 1I6XA 2M1BA 4RB3C 2DFIA 2RREA 3T5XA 2MC3A 3GEZA 2LBFB 4H9SE 3V5UA 5IP6A 3G1LA 1H8AC 4BY1J 3G6EI 1GUUA 3K2ZA 3K10A 4BEHB 1ACIA 3K3NA 2RQPA 5K5QA 4ZTFA 3EABA 3P4SA 1QZEA 1R49A 1VOMA 3LBXA 4X5TA 2JVGA 3U1DA 1HW2A 3M3YJ 3I9WA 5BPIA 2IIUA 4E7IA 1ZOYA 3KYCB 2B1EA 4PAGA 1ITYA 5AQRB 1LB2A 5KDMC 5CGMA 1A31A 3Q0UA 3RHWA 4XN3A 3E6BA 2V79A 2WZIA 4NDLA 1PUFA 3HKEE 2HQAA 4HEAA 2L01A 3RYRA 2DYRH 3GW2A 1AHDP 3RPQA 2CRGA 5AQIB 3CUQB 2M7AA 2W1OA 5AONA 3W6KB 1ODDA 5LGUB 5BR8T 1JI8A 4PZJA 3E5XA 3GLXA 4I7HA 4CI2B 2YU3A 2F5EA 1W5TA 3ABTA 1YO5C 3NARA 3QB5K 5HYAA 1N32T 1BW6A 2FMYA 5DV5A 4IX7A 4HFCA 2J1DG 3DJBA 3HGGA 3PUBA 2HDCA 1U8BA 1K83J 4Z90A 5IYZE 3I4NJ 4UIGA 1FZPB 1HCRA 2BKOA 5AQVB 2FXAA 4I99C 1S6LA 3H35A 3IV5A 4HSTA 1SMTA 3MKZA 4EGZA 3VYRB 4XRMA 2COMA 1PDNC 2Z3YA 3AE7A 3PU8A 1H9GA 3SQNA 3P9KA 2PJRA 1X1DA 3S32A 3T1BA 2LR8A 3PE0A 5F04A 3VHLA 2DU9A 2BVMA 2HOEA 2W24A 4EM2A 2KZ7B 2N1GA 3I1AA 2J5PA 4UY8I 1UHWA 2ISYA 3QU3A 4BYYA 1ZHFA 1R4NB 4B3AA 2WY2A 1K79A 3O1IA 2R7RA 5FLVA 3K4JA 4IOAF 3BG7A 4E4HA 1Z7UA 2STWA 3T8TA 3UQ4A 2K3PA 4UXNB 5CVUA 2HEOA 2BBHA 4N4OB 3V7CA 3DF8A 5LGNB 4PGHA 4A3BJ 3FXEB 3L2UA 1XS9A 2HZTA 3IAM2 5JTGA 1XTAA 2ECCA 1TWAJ 3PQJA 3C2BA 4BBRJ 3UU4A 3VODA 1D5VA 2DFEA 1KQ9A 2AQFA 4ZH4F 4XLCA 2DHRA 3EDVA 4ZI2C 4U7DA 5AQFB 5DM7F 1JUSA 2ZM0A 5FY7A 1S8NA 2DA2A 4H63H 3UU5A 1UZCA 1TZLA 2R5YB 4AWXB 1U5TB 2Y48B 2OU2A 4QPOA 3ZPOA 4IHSA 2RKHA 1SVLA 2AXLA 3DEUA 3M8EA 3AG3H 3ML6A 1E2XA 1OEDE 4II2A 1HLVA 1ETWA 1MW7A 4U7IA 3RF1A 1KFYA 1XCBA 4KJZA 4U88A 1HW1A 1J75A 1WHUA 3N2OA 3IWFA 4JI5T 2JPFA 3L2RA 3FB2A 4H9OC 4NC7A 4N4NB 5D6EA 1LRZA 1QUUA 3BTLA 2DJNA 2O5RA 2WS3A 1J5WA 1Z3XA 3RRWA 4U2ZA 1EH6A 3ZQ7A 3PL8A 2O03A 1T08B 1XB4A 4WBOA 2CXDA 4B4CA 4X1KE 1W5CC 3ANWB 4HA8A 1WRDA 3OVUA 1X3ZB 1OQYA 1M7KA 3AVSA 4HWIB 2XSAA 3UFGA 1N75A 3T1YT 2HYFA 2LY9A 3D0SA 3WTVC 2J5OA 3FXRA 3G73A 4YFXF 2OV7A 4MFEA 3A1YA 4HG2A 3NAUA 1W7PA 4A69C 2ACJA 3GLLA 3CO6C 1YFHA 5LBMA 3H3ZA 4W1UA 3L2QA 2X9XA 4L9TA 2OV9A 1BIAA 2PG4A 5GTHC 4U7YA 4X64T 2M2EA 4XLNF 3CUQA 1Z21A 3HKCE 4OAYA 4XBFA 5BQTA 4EVIA 2BY2A 1O7LA 4RM3A 4ON0A 4XBFB 4PJ0C 5BMZA 2H1LA 2LM2A 4AYBA 1V4RA 4YEJA 2DA1A 4AKHA 5K5OA 1I3AA 1MBGA 1TQIA 3BC8A 2OZ6A 5JLXA 4CN1A 3I4PA 3ZYMA 2OJED 5KCMA 2CXLA 4EM0B 4JBWF 4QH4A 3CQZJ 5K1YA 2FUG2 4N9IA 1QRYA 3HSEA 4DR1T 2A6HF 3AECA 3RQWA 2X0LA 3ZN1B 4IE5A 4YFSA 1Y8QB 3TLTA 3GTLJ 1OFCX 4C2MJ 4AVZA 1NENA 2AO9A 2PJRB 3BQKA 1R4MB 4HF1A 1B7TA 4IE6A 1O4XA 3BLYA 4A0XA 1WPKA 1IUYA 2XHEB 5KXJA 1D8KA 4RBOA 2B7EA 5LP6E 3I0QA 4X1YE 2CE7A 1PP7U 4M9XA 1ETXA 4RAFA 1TWHJ 3GFIA 2QYWA 1R9TJ 4Y3OA 2XF5A 5F27A 2LYCA 2HHHT 1E1HB 4MFDA 4XL9A 2XZEA 4NXNT 3K2AA 3F6OA 3QPLA 5LBQA 2VVSA 4JI1T 3L8RA 3S17J 3OPCA 2DMNA 3JCFA 3F21A 1T2KA 5CLSA 2R93J 5LGUA 2GAUA 1T39A 4OINF 2H7OA 2W57A 2JPCA 2PQ8A 2QWWA 2DT5A 2FNAA 1UELB 4A56A 4KHPT 4WBNE 5LXTE 1RUOA 3G4SI 2K5BB 5E8GA 3WTUC 5DABA 3GBGA 4ISSA 4J19A 2UXBT 4KISA 4I55E 4C90A 4ABZA 2XPVA 3I55I 4TX5A 1N25A 5EDNA 1EA3A 1Z7LA 2V6EA 5JR9A 2WA0A 3PFYA 1KYWA 2HQRA 4B47A 2PJPA 3BQZA 3HOUJ 4U33A 4IXAA 1VQ4I 3K4NA 5ED4A 1WCRA 4CZZB 2YDQA 2P6SA 2E1NA 4RB1A 3O8GA 3CP8A 3TDUC 5FKYA 2CW0F 4PJJA 3A0HC 1A36A 2SPCA 4DV6T 4F6RC 1W1WE 3GTQJ 4CICA 2QQ9A 4OMYA 2FJEA 2X51A 3B6CA 2BYVE 3E0JB 4CXYA 4FTHA 2XQ6A 4UEMA 2X48A 3X2QH 3CCEI 1Z05A 2W82A 1SANA 4MGRA 1S5LC 1SA0E 3W6VA 4OFZA 5K7HA 1IV8A 1UB9A 1W09A 1V3FA 1YS6A 3BPVA 3QP5A 3EETA 4HPQA 3RKYA 3W2WA 4CDGA 4E7SA 1FYLA 5LMNT 2KSRA 3R60A 1OCOH 4AM3A 3FBZA 4BHBA 4KIGA 2JA7J 3OIOA 1VQMI 3I56I 1I27A 3E6CC 3CIRA 3VKGA 2LVSA 2XPWA 2HR3A 2EZKA 4TWFA 2DLLA 3GTOJ 1QLBA 3AEDA 1ZR2A 1KA8A 2DI3A 5LMUT 1Y39A 1Z6TA 5HVQC 1FT9A 3KP4A 4HWCA 2E5NA 5JR3A 4HTEA 3ZGKA 4CXFA 2AXDS 3P5JA 3SWHA 1RC9A 2X66A 3HG9A 1OJLA 3LL7A 3T8RA 3CCMI 2H8WA 2TRTA 5F1RA 3C4WA 1XSVA 2MH9A 1XD7A 1HDPA 2W84A 2WWUA 1WJ5A 3SFZA 4XQFA 2PMZN 1I1SA 3GTKJ 1OYYA 2K7LA 2OPTA 1J1JA 5CJ9A 1QZZA 2XPKA 4EIWA 3NZPA 2VC0A 1W0AA 3PUSA 2BBYA 2EV5A 2AHQA 2MG4A 5A1LA 4J2CA 2Y6XA 3S2WA 4YSXA 4AXPA 4CGZA 5IYDJ 3FM5A 2LHNA 2BV6A 3HZJA 2YK0A 2L3LA 1E0EA 4LMYA 2F4OB 3OSFA 4XOPA 1X4PA 2BG9E 4DIDB 4E6KG 2XAQB 2F4IA 2MAWA 2EFQA 4WYVA 3LA2A 1QQIA 3ABLH 1LEBA 3LSMA 2K24A 3IBPA 1WKMA 1O3QA 2XAJB 5FB2A 1ZREA 5AQUB 4V2GA 2H6CA 5IYCJ 4B3MT 1IDYA 1J7KA 4FX0A 1D0YA 2O9LA 4BXXJ 2Q9QB 2XF7A 4UVAA 3CQXC 4IDPA 1Z9CA 2FNPA 2YDRA 2A6EF 2EIMH 1Z1DA 2FJBA 4HV5A 3KV9A 2HQNA 2I10A 3TEDA 5HS8A 3MA9A 1LDDA 1W4MA 4JI0T 5TAOA 2M7BA 3GTMJ 2WDQA 1NWMX 2WADA 1ZHCA 2AQEA 4CN4A 1DPRA 1I39A 4NQWB 3L2WA 4AQYT 3QP6A 3F0CA 1QVUA 3EUAA 5CPRB 4J01A 5HEUA 3TW6A 2HH7A 4TNWA 2JSCA 5CA0E 3JRIA 2DI4A 2C5IT 4A3DJ 5L3CB 3FXKA 3EHZA 4ZZLA 1NHAA 1WJFA 5CQEA 4QH1A 2LSGA 4ZI3D 2E60A 2UXNB 5LEKA 2EWNA 2VJ5A 3V8LA 3CCJI 4EATA 5IYBJ 2HYGD 2IGOA 2M9HA 3S1QJ 1HOMA 1OXZA 2XTLA 3TOAA 1Z0PA 3I9YA 2C6YA 3FMSA 4E7ZA 2JQKA 4EJUA 2E9XC 3JAFA 3FX3A 1TWCJ 2L4AA 2Z2SB 1G2HA 4NC6A 5DJQC 3CF5F 2W2UA 1OLTA 2V9KA 3KP6A 3PNTA 1CGPA 2BBJA 5HCMA 4DR7T 2XAFA 4LFCT 2RVCA 5L3FB 5CYVA 4CCLA 2D2WA 2IA2A 3FMQA 3M1CA 1MD0A 1G3SA 2LBFA 4XRFA 5DD8A 3CWZB 4GYRA 2VBYA 1ZV4X 2MC4A 5JI6A 2K4BA 1B8IA 2O8KA 3ZQFA 2STTA 2CBJA 2W7NA 3U3IA 2NOXA 4O4HE 5AQHB 3DXJF 3K7AJ 4PJLA 4WCGA 3N97A 3RKOA 5JH7E 4XRSA 2CQXA 3H9GA 4LFAT 4P55A 2WU5A 2NVYJ 2OTLI 3K3QC 5LEJA 2L7FP 1XPXA 5LHHB 1X3WB 3CD6I 3FZMB 2PBIA 2DCEA 3ZSTA 3TO9A 3LK3B 1HSTA 4DMVA 3LBXB 2WB5A 1TT0A 1UMQA 3CO7C 4OYKA 3IKVA 4BE1A 2B63J 4QSHA 5HNHA 5HOOA 1TNSA 1TT5B 2WY8Q 4O4IE 3OS1A 4YSZA 4H9QC 2O8XA 4OMZA 1RKTA 4BU2A 1JKOC 2VC1A 2DO7A 2YX7A 2Z5UA 4KUMA 4RGRA 5E1ZB 5GONE 1VQ7I 3KE2A 4HOBA 3GXOA 3H1CA 5L3BA 2D5UA 2LSYA 2B0LA 2BKNA 4LMLA 3RQ4A 2A9UA 3SRZA 5FGMA 3SZGA 2VQGA 2KIMA 3Q9SA 3G71I 4EYUA 4C91A 3PNVA 3WTWC 4G63A 3HHHA 3MXZA 4V1Av 2E9XD 1GLNA 2K40A 3CMAI 3K9TA 4F92B 3VDXA 3K1NA 1JNRA 3CDHA 2HXIA 1RUNA 2OZUA 2P5LC 2NW7A 1E3HA 1LVFA 3QUJA 1XSXA 1KQ8A 4EAHA 2RDPA 1I5ZA 2KINB 2X6XA 1SC7A 4RLFA 3KP2A 4MALA 2EV6A 3FZVA 2BOLA 3DBHB 5LJMA 2LKSA 3GFMA 3UT5E 3QRFF 1FMWA 2MW8A 4A3LJ 4XICA 1KQ0A 2IA0A 4ENNA 2G7UA 3FZLB 5ILVA 4KNYA 1BJZA 4ITVA 4NNJA 2XJ7A 4UVBB 1S72I 4IREA 3OTOT 2IUBA 1OPCA 1U0JA 1Y56A 4DBRA 5TRDA 5AQMB 2FOWA 3JRFA 2KLOA 1GVDA 2WAQN 2FBHA 3CKDA 2E71A 1XSDA 4BS9A 1BR0A 4I0UA 1W7PB 4HFEA 3PM1A 2N2NA 2ECBA 3O4XE 2RN7A 3LA3A 3P9CA 3OYGA 4WZXA 1YD8G 1QSDA 2UZKA 1W0UA 1FP1D 4DR4T 1MIYA 1WQ2A 1LQ1A 4CCOA 2XQ5A 3JSOA 1BN5A 1IZNB 3L2CA 2HNHA 1YX5A 3ZT6A 3DV8A 3FBIB 2M0CA 3ZN0B 5EYRA 2CWYA 3SS1A 2PEXA 3K4BA 3IRQA 3IH4A 2KQRA 1IC8A 4HFVA 2V1DA 2ZSHB 4UF0A 3C7JA 3F9KA 2BG9B 4YXDA 2G9WA 3ZP5A 4AIKA 3GMEA 2VJIA 1R6RA 4J00A 5C44J 3MFKA 1HF0A 1NTCA 5IUXA 4XKBA 3I0TA 4RGXA 4BXFA 2WDRA 4X1IE 4PCQA 2VXDA 1TQPA 1XGOA 3ROUA 1OCTC 4BJNA 4B1RA 4DYQA 2N9DA 4MLOA 2I6HA 4U2YA 4DV7T 2LF7A 1R58A 3OOPA 4B09A 3J81K 3CDIA 3KZIC 2E5LT 2QBYA 5JQGE 2CQNA 2QSGX 3FBLA 4HLYA 3H92A 4HF0A 3MZ8A 4KIFA 4LMJA 4LIVA 3ANWA 3T1HT 1LUJB 2R7OA 2XPUA 1L3LA 4HQMA 1B8IB 2CV0A 2Z9OA 4WW0A 5HWXA 3ZCJA 3M9AA 1RR8C 2NVUB 2G0EA 3IUOA 1U78A 2CUEA 3OYLA 3RKXA 1SD6A 4ISTA 5HDNA 2QGSA 3BZKA 1T8IA 3DTKA 4G7OF 4A5MA 3V5SA 3OR2C 4DZPA 4IVNA 2NVXJ 2LKHA 3ZC1A 3AA1B 1IV6A 2CMRA 1YQAA 2L9VA 1XMKA 4XONA 2OF7A 2IEKA 2E34A 3C3WA 1QA6A 2IDOB 4IIJE 4M72A 2YR2A 3RQIA 3UFEA 2R7FA 5EGOB 1IBKT 1ETYA 4L5IA 3SEQA 2P0WA 1R7JA 2YKSA 2A61A 2M5WA 2K9AA 5ABEA 4AI6A 4FHTA 2L7ZA 1JJ8C 4IT4A 1XMQT 1VRBA 4QH5A 4ZI7E 2D9DA 5J2TE 4JLEA 3ZPLA 1DP7P 1U2WA 1MMAA 3FM3A 3HRUA 1W36C 2L7MP 3JRCA 3N9QA 5ABFB 4C9YA 2DOEA 3Q9VA 4BE2A 1YRNA 2JPBA 3MN2A 5F0HA 3VRBA 1ZR4A 3WG9A 2WM9A 3HOXJ 1RPWA 3CDLA 3LNQA 4DV0T 3IA3A 4OIPF 4BBSJ 1J2XA 3UU8A 2TDXA 5IOZA 1XMAA 3DLLF 1IAWA 1APLC 3TL4X 3FZFB 4IDZA 4K0KT 4NB5A 1X1CA 2CYYA 2L3DA 2Y0MA 2QVAA 5M4YA 3JRAA 3H3UA 2HDWA 1YW0A 4A3IJ 3FIWA 2Y9YA 2K9NA 3F57A 2Q0OA 3CC4I 2HN1A 1VQLI 3AE3A 4JEUB 4HQEA 2E35A 2RV8A 5FRMA 2WTEA 2QZ8A 5FLMJ 3AAEB 2M4KA 2XVCA 5FXXA 4X1EA 2ZJQF 2KIUA 4P09A 4HDVA 1WFDA 2LKGA 2LHRA 5FY0A 4BEHA 4D0PA 5HEHA 5EZHA 2BY3A 4LK1F 3AE4A 3S8PA 1B6AA 2CFOA 4LF7T 2ACZA 2CV1A 1UAAA 2GM4A 2M6BA 5GPAA 4X62T 4G9YA 4H9PC 4XLAA 3SDGA 5F08A 5LA6E 2X1CA 2PG8A 1X1PA 1K7AA 5HLHA 2R7TA 2L9RA 1YHQI 1D0XA 1US7B 1RKWA 5KX5E 1HG5A 4DV5T 5DS9A 3CZ6A 4JI6T 1VQPI 1TC3C 2IJLA 4UVCA 4GFBA 1ZGJA 3CMYA 5EG0B 1H88C 3HOYJ 2JMWA 2UXNA 3BG3A 3PO3J 1Y64B 3ZMDA 3MWMA 3HM5A 3WAKA 5JRCB 4PNIA 3MQ0A 4HE8A 2FBKA 1GV2A 3F8BA 2XIGA 4KI0F 2NTYA 3CCVI 5CFBA 4YTPA 5FKLA 1B59A 2YU9J 3BR2A 1FPQA 1FY7A 1K4SA 3E1SA 4ZZBA 4QTRA 4YTMA 2K3WA 5IPAA 4U87A 3CX8B 1IN4A 2M8GX 3WTZA 4IGUA 4AYBN 2Z33A 4AQFA 3RI5A 3FXDB 2GZWA 2X9DA 2RA1A 1MBKA 3RYPA 5IWAT 2GA1A 4G7HF 1ZRFA 2ZM2A 1NAFA 2VQFT 3ZMSA 1I94T 3ABMH 1S94A 3JW4A 2XASA 2JMHA 3F31A 3NZQA 2M4GA 2I8DA 4BJ5C 3ELKA 1KU2A 3DPTA 1F5TA 2DBBA 2VOOA 5J1YA 1KK7A 1W5SA 2V6XA 4ETSA 1WJCA 2PFVA 3N9OA 3OOUA 3ZXSA 2VBWA 1S29A 2VJJA 1KEYA 2V6YA 3HI2A 1X9BA 3HKZA 2O0YA 1IAPA 3LQRA 4ZXLA 3F8FA 3PO2J 1JTYA 4LLLA 1FOXA 3CP2A 1YOVB 3ULQB 1WI3A 2DW4A 3BJAA 3DKYA 3GFLA 1VFCA 2H89A 1RIOH 1FIAA 3AA0B 3KVBA 4DR2T 1VCTA 2V1NA 2MD0A 2K3FA 4G6QA 2IC9A 1XC5A 4RB2C 2WB1N 2KKOA 2HOSA 3Q2MA 4RM2A 2A69F 2WWYA 2KL4A 4QKNA 4OOIA 2E2AA 4UVCB 1JUPA 3H9QA 4YFNF 2Z16A 2IVMA 3CCQI 4E7JA 1F1ZA 5JFRA 4IL9A 3AL0C 5FKOA 3Q5DA 2V9PA 1P4AA 5D4SA 3R6NA 1WH7A 1G4DA 3K8PC 1LKXA 5ILSA 3IF8B 2A68F 4BAYA 3F22A 1I6HJ 3GZNB 2YPRA 4KIBA 5C2TA 1OCPA 2DLRA 3B6AA 4MEYF 3KZZA 4HZFA 4KMFA 4KITB 1J0RA 5A2QZ 1MBJA 4BQAA 3VYUB 2F48A 3NRYA 5CVJA 1G73A 5M3MJ 3CK6A 3ONXA 3BQYA 4C2TA 4AQGA 3GVAA 1MJBA 4MEXF 3HXLA 3K4MA 4L5JA 2Q9QC 1B9NA 2DNXA 1FYMA 3MMYB 3ONQA 3OYHA 4ZHQE 2W4SA 4BACA 1VQ8I 3M4OJ 2ZXIA 4ILUA 1YI2I 1JGGA 1MBHA 2R0QC 4C30A 1YW9A 3WU2C 3AG4H 4CCNA 3QODA 3MKLA 4R79A 2JN6A 2QSHX 1G59A 1VZ0A 2DK5A 1S7AA 2L0KA 3MZKB 2IGNA 3Q9DA 4B8XA 4LF6T 1U5TA 3AE5A 3BJ6A 3I59A 3HBLA 4G2AA 2LF8A 4U74A 2HU9A 2GLOA 3GN5A 4DV3T 4ANJA 1XCVA 2XQ7A 1KGSA 1EJ9A 1VQ5I 2EB7A 1FC3A 2VE8A 2QF7A 3K4KA 4U7BA 3JRDA 3D1NI 4O3MA 4FQGA 2YX4A 4RAYA 2AXTC 3EI0A 4IE7A 4XLHA 4MO7A 3NQOA 2BS4A 1T0FC 2DMTA 3CMLA 4ZYGA 5L47A 2L9NA 1GT0C 3MAJA 3P7NA 4B48A 3R61A 3W2VA 5IHYA 5DD4A 2ZMEB 2XAFB 1SUMB 3OYMA 2F5VA 2VKDA 5CKTA 2W67A 4AC0A 1XG1A 1BI1A 1EH8A 5BPDA 3O1JA 5LBQB 5EEGA 5HS7A 1JGSA 4IRHA 2XDVA 2ZBKA 3U9GA 5KK1A 2M6IA 1ERDA 2XKPA 4PJMA 5F64A 2E1MC 1KNRA 2LLYA 4MIMA 5FRNA 3BR5A 4YRVA 1IJ5A 1FBSA 4H9NC 4L9VA 2Q8KA 4UNOA 3C4ZA 4I43B 3ZT7A 1N34T 3VR9A 5TISC 2WSSV 4UVAB 5KVRA 3HC7A 4XSXF 1GDTA 3UULA 5JDGA 4BL0B 2KRCA 4R8HA 2HVSA 5HDGA 5FFXA 4AD9A 2E5VA 1KYZA 3FXJA 2ESNA 3P7IA 2OCEA 3P4PA 2DTRA 1JKQC 3P4WA 2L9QA 4WNKA 2D1VA 5LB7B 2RNJA 3MKYB 1REPC 1UJ8A 2WB1A 3S15J 3CQGB 5HXRA 5D5WB 5TJJA 2YU2A 3BR1A 3BZ6A 1QGPA 4DBQA 1TWGJ 2DCFA 4AIUA 2EZHA 4I0BA 3ZT5A 5D8LB 4H0EA 3OV8A 4IE0A 3N5LA 3FF5A 5J1GA 3V7RA 2ODVA 3WTXC 3W6JB 2P7VB 4N78D 4HBLA 4XM3A 3NWTA 2LOPA 4A98A 4AKGA 2IGMA 4YFKF 2HFHA 2HPLA 3GWZA 3F23A 3E5QA 3AE9A 1XGSA 1MDMB 4KFCA 2OUMA 2DQRA 2BY0A 5CQGA 3OYEA 2O7OA 4CUGA 3RKWA 3ZMZA 4BXUA 1JKRC 4PGGA 2A07F 3K6GA 1LE8B 3H37A 2DDBA 2K9LA 5J1RA 4OHFA 3BT9A 4A5XA 3EYIA 1ZARA 1HG2A 4HRIA 1S35A 2QBYB 5HEOA 2KLQA 3QU6A 4CZCA 3GWHA 1W7PD 2NS7A 2BHYA 1SAXA 1GVJA 4ZDOA 5B1BH 4KT6A 3U21A 5DUKA 3HHGA 2H88A 2HYJA 3IC7A 2HZDA 3TOBA 2H1KA 4DZJA 3K1MA 2LRLA 5IT9Z 5J0ZA 1UURA 4JBAA 4QIWN 3K70D 5F0CA 3ZMSB 2P6TA 3V7SA 3IP4B 4G94A 5ICCA 1Z8UA 1AJ3A 3ZLIA 3NWSA 2ICWG 2WDVA 1QZYA 2VB6A 4I09A 3AE6A 2EINH 2H27A 4EEBA 2UXDT 1J59A 4ZI3C 1FTTA 4HN9A 5L2LA 1MZBA 1X1BA 1I50J 4DIQA 3HOSA 1P4XA 3FZKB 3S4UA 1C0WA 4S0HB 4CYCB 2N8GA 2LEHA 1R5HA 2X4HA 2IS1A 3UU6A 4DNDA 2HTSA 1ZQ3P 3A8YC 1TW2A 4P1WA 2YS9A 2XQ9A 3MACA 3I71A 4ZTJA 2XHKA 1X4OA 4CA0A 4YIRX 4PK6A 2DA3A 3LAPA 5HS9A 2NVTJ 4YHHT 4X0GA 3J7YJ 5M5YJ 4OIOF 4F7ZA 1HDDC 2L8KA 3BP8A 3AEGA 5D5VB 5L3GA 1JHFA 1CUNA 4NXMT 3VEPA 2HQ5A 4Y7NJ 1LJ9A 3PUVF 2QLZA 4UR9A 2IS6A 3KP5A 2P5VA 4YIFA 1G6NA 1OYWA 2MOZA 1LVAA 1P6RA 1MMNA 2H94A 4C2UA 3N2KE 4LB5A 4DUZT 3RKQA 1B72A 1DQUA 5B5EC 2OA4A 2E7XA 3CCSI 4I50E 5GADJ 2MPKA 4XORA 1FBQA 1KU3A 2LD5A 2BS2A 4M9SA 5J47A 3W2AA 3WGIA 3BOQA 2CMPA 2EJRA 2CEAA 2XUEA 3CX6B 4UF0B 1OEDC 4QXCB 1CF7B 1T33A 3OYKA 1WH5A 4K0UA 1WVRA 4TWHA 2V8SV 1QHGA 1IXSB 3ZQLA 2UUCT 1LFBA 2VQHA 1K78B 3VWBA 5LHGA 2JK3A 4LITA 2A72A 5AQPB 4UUTA 4M3EA 5J40A 3O3KA 3LMMA 5KAIC 3GO5A 2K86A 5HXCA 4ADZA 4KICA 2W63A 1Z6RA 3RPUD 1J9IA 2PLYA 3GMIA 2UU9T 4IEJA 3MKDA 1NH3A 3LSTA 4X66T 2P81A 3N05A 4KYWA 3W15B 4EXTA 2HOTA 4LGWA 1TBXA 2HS5A 4IHWA 4DV2T 3L3PA 2ZJPF 4IL4A 2LRDA 3H5NA 3MK7C 2LDUA 1QPMA 2FA5A 2DJIA 4LG0A 3FXUA 2BG9C 2A05A 2XAJA 1U8RA 3E5UA 3ZYLA 2LNBA 4D5CA 3LG7A 4A6EA 3IEEA 2XGEA 3QYFA 2EHOA 2PX9A 4UUSB 3H0GJ 2VONA 1KU7A 4L5GA 4OYJA 3ABUA 2Q2EA 4U31A 3A03A 3FHZA 3GZ6A 4KA4A 3BTCA 4BY7J 3EAMA 3AA7B 2D2SA 1SFXA 3VSLA 2CHNA 2DAOA 3S3MA 2PFBA 2YUSA 3D5LA 2FBWA 2QA7A 3JC6C 5L4HA 4HEA2 4AIDA 1SD4A 2M87A 1FIOA 3OYAA 1D3YA 3ETUA 2VE9A 2OQRA 3AEAA 1GQEA 4HWHA 4EV0A 2KZVA 4UV9A 4DNCA 1IO2A 2JQHA 4OU0A 1R1UA 5IOYA 4HGAA 4U0WA 3OYDA 4EYYR 3PUYF 3BTJA 2QM3A 3H3MA 4Y15A 4X6AJ 4MQVA 3WU0A 1O3TA 5JDNA 2YU1A 1QO0D 3PURA 3D5SC 3MJXA 4BUPA 3KVAA 2W4XA 1UG0A 2MSYA 4A12A 4RDUA 2X67A 2XQAA 2MBGA 2Y30A 3S3OA 3AE8A 4ILBA 4ZJZA 4P9UA 3GA8A 2BZBA 3TO7A 3Q5WA 5EK3A 3OYCA 2VLAA 2FF4A 2KP6A 4OIQF 2UXCT 3LSKA 1B9MA 4A3JJ 1V9DA 4D5FA 3C2HA 4HWDA 1Q1HA 4HFIA 2R4GA 3R84B 2KIQA 1UG2A 5IT9K 4NUUA 5D6FA 2F5DA 3VFZA 3P4RA 5KMGP 4A5NA 4YTNA 2X6YA 5JDFA 1B72B 3I54A 3VU7H 1VCSA 3FXOA 4Z2YA 1BOAA 2E1CA 3RYIE 1SE7A 4XKCA 2BS3A 3CCYA 4BDYA 3CJRB 3JADA 3ABVA 1ZN2A 1IN5A 1FWZA 3HJEA 3C64A 4AIJA 2JA8J 5ETWA 3UQ7A 2LP0A 4ZS2A 1V5FA 1X2NA 2JRMA 1I3QJ 5L3CA 4LOCA 3QYEA 3IL2A 1Z0XA 2ZXHA 2A2FX 2X68A 2ZMEC 4ZYDA 4IDQA 3L2VA 1IBLT 1YE9A 2ADUA 3AG1H 2LSOA 1SFEA 5JVGF 4BA9A 4B3ST 2QENA 3MKWB 3CCUI 2EIJH 5M5WJ 3C4XA 1IN7A 1ETQA 4IHYA 4NC8A 1YKHB 1MMDA 2KISA 9ANTA 4RMNA 2E1MB 3OYIA 1R00A 5F3JA 4M3DA 3F2EA 4UB6C 2EH3A 3JREA 4MBQA 1FX7A 2EPFA 5FMNA 1F9NA 3KZYA 2KPMA 2Y75A 2LLKA 2RGVA 2CLYC 3UNGC 3O1HA 4QXBB 2DA7A 4IL6C 3ZN1A 1QVTA 4PK4A 3WI3A 5J8CA 5F8PA 2IPQX 3FXMA 3LSJA 3L00A 3M8JA 2XSBA 4Q48A 5E3MA 4I02A 1LE8A 5JVDE 1TNTA 1Z3YA 2L54A 3C18A 1DU2A 3AEFA 1FNNA 5E20A 3CC2I 2MABA 3HIFA 3A7MA 4QXHB 4LF8T 3DQVC 3RIUC 2GXAA 1EZ3A 1N78A 3LAJA 1HW5A 5L3FA 1YJNI 3A5XA 2K27A 2EHOD 2K48A 3KP7A 2CCQA 1HSJA 2LSIA 2ZMEA 2NTXA 1F36A 1BBYA 3TBIA 4D7NA 4PFOA 2NAZA 1TP4A 3RYFE 1IGNA 2J47A 3WGHA 2JRTA 3HRSA 1OR7C 4W97A 5AQOB 2MLKA 3JRBA 3PTRB 5DYMA 4E7KA 2IS4A 1P4WA 4PW8A 3M07A 1T38A 1MMGA 2QQ8A 2IRFG 4ZDLA 1TLHB 1SAUA 4HW0A 3FKJA 3TO6A 2NW8A 2EA4A 3TKYA 2VQCA 1IRGA 4G6DA 3AXJB 3DKWA 1MIWA 3ZMVA 4CN6A 4QHOA 1EV7A 5EG0A 1JNZA 2RP4A 3KBUA 1YW7A 1XNQT 5EGOA 3G2BA 3VSKA 5D5XB 1SD5A 3R0JA 2V7KA 3PIPF 3SYTA 4ZZCA 4HX8A 5CVIA 2VURA 4IDOA 1K6YA 3N9LA 1YKEB 3KV4A 3B57A 1UUSA 2BW3B 3ZQHA 2NXNB 5HLTA 4RS8A 3OS2A 1BR4A 3K69A 4EGYA 1FYKA 2JA5J 3S14J 3HA4A 2DYSH 3AE2A 2L02A 4BHPA 3QAHA 5ABHA 1OCZH 1S7OA 4M6XA 5IT3A 2ETHA 1RETA 1ETKA 5BMVE 1KNZA 2JA2A 3CMMA 3IHUA 5JVTA 5JR9C 1MNDA 4I76A 2ME6A 3EPZA 3RDIA 1ZTRA 2P8TA 4XMYA 1P7IA 2PMHA 3NBXX 3K4LA 1OISA 1BL0A 3I53A 4V19K 2HVQA 3I5UA 2LSJA 4ZC3A 2WQYA 1USSA 2VODA 2KWIB 4IPAA 5M3FJ 4EZHA 2EHOB 4A93J 1SHZC 2WZHA 3QB5A 3S3NA 3OIPA 5J3LA 2I5UA 4XKWA 2WAUA 2FEZA 4BJTA 3TDZC 4F93B 1Y0UA 3BROA 3RCOA 1CHUA 4M3BA 4BGDA 2ES0A 2R5YA 1XDUA 2DXIA 1CF7A 3EUKL 2E5ZA 2W48A 2LOSA 4ZYAA 1XDOA 1GV5A 1RR7A 2JUGA 1U6GA 3HPGA 5AQSB 2CLYB 3EUHA 3HL2A 1S9HA 3ESWB 3LSVA 1LFPA 3TQNA 2V7JA 1ETOA 2GA2A 3ISPA 2VKJA 1ZGAA 3I9V2 2LSKA 1O3SA 1MNEA 2CA5A 1NG7A 2EIKH 3ZSSA 1LEAA 2GIZA 2JT1A 2EV0A 2GWRA 4M71A 4M9ZA 4DGWB 5EF6A 4IO9F 1K4TA 1MBEA 4NUVA 3SFDA 4B6XA 2WCAA 1VTNC 5AQNB 1N77A 2XM2A 4KMCA 4Z91A 1WWXA 1ULYA 3Q5FA 1T7SA 2V9VA 3M8FA 2R7DA 5E1WA 4F91B 3WHCA 3V4GA 3S16J 3CQCB 1OR7A 4U0VA 1XGNA 2EILH 3SDBA 2LJLA 4HFHA 1HFAA 1IXCA 4QWQA 4S04A 4EV6A 2QCOA 3KIOA 4A0YA 5HCJA 1ZRCA 4EJTA 3E0ZA 1MH3A 1T0FA 4M3GA 4XRSG 4HX4A 3UR3C 2YSRA 5DQWA 1U5PA 4GKJT 4CXWA 1R1VA 3OYFA 5FL1A 2UXXA 5FLXK 4OIRF 1T6SA 4ZDPA 3BG9A 4L9NA 5ICGA 3JAMZ 2WBLA 4M73A 2DOAA 1K61A 2KNDA 2UWMA 3VYSB 2CQQA 2NNNA 2ODUA 5AQKB 4WWCA 2LC2A 1UHMA 1ZGWA 4ESJA 2IT0A 1RESA 1D1CA 4DW6A 5F5WA 2EQRA 1KU9A 2O61A 4D9JA 2UUZA 2HPIA 5FROA 1VQ6I 3ZMVB 3N9PA 2ZC2A 3OL4A 1AKHA 2R7QA 2Y0SA 1LVKA 2XAHA 3AG2H 3L1PA 3TP0A 2DN0A 1XWMA 1Y8RB 3L39A 5AQTB 2XB0X 2JSPA 1FTZA 1ZG1A 3WAJA 2JA6J 1SVMA 1MJAA 3I59B 2ACXA 1WJDA 2YINA 1V55H 3TW7A 4JI8T 3RYHE 2CH0A 2NP9A 4I01A 4L5EA 4HNUA 3JRGA 2PMUA 1VQNI 3ASNH 4LD5A 1XZYA 4YHJA 2V1XA 3MZHA 3A02A 5JR9B 2ELJA 1WFXA 2X6OA 4NBQA 1HKQA 3LSPA 1ONVA 4CO8A 2CRBA 3EYYA 3U78A 5L3GB 4Z8XA 4XAXB 2H3RA 1X2MA 1N33T 4TN7B 4FI5A 4H4KC 3FWEA 3PIOF 3OSGA 4MTEA 4DV1T 1TTYA 2XQ4A 4GDFA 2IC6A 2PTFA 4YT0A 1SFOJ 1TL8A 1VI0A 2NWBA 4GXOA 3W3CA 3CLQA 2QKMB 3KEOA 2MD5A 5AIPA 2Y2ZA 1H7CA 2LT3A 2PN6A 2FQ4A 2TCTA 3CUQC 4DYCA 3ERMA 2JRKA 2ESHA 2EZLA 1XN7A 2JVHA 2M3AA 3OR1C 4C3HJ 2KJCA 3WE3A 2M67A 4DMWA 1HQCA 2RC4A 2XUBA 1P92A 3KYDB 2VBXA 4G7ZF 1UX4A 1ZKEA 3Q5EA 1G8XA 5AQJB 5FXZA 4P96A 2DA4A 4UV9B 4CI3B 3KYLA 4GYGA 3BTIA 4A6DA 3OBVE 1E3PA 3FISA 2CW8A 1P9QC 2DT6A 2KZGA 4C3IJ 4BDZA 1YX3A 1BW5A 5EZGA 3ZQCA 1YXRA 3RYCE 1MJ9A 2CUFA 4M6VA 1PUFB 1MH4A 3JR9A 5JRCA 2F5FA 1D8JA 3DU6A 3O6BB 1VQOI 1IBMT 2QRXA 1OEDA 2ZSIB 4LLGF 4EJVA 2ZKZA 2BW3A 4EEDA 5FKNA 3T0YA 2BG9A 3OKQA 4AISA 5FYMA 4Y13A 3G3ZA 2X9YA 5H2FC 3RSNA 4P0BA 2G0UA 1G3TA 2XGXA 4RGSA 5HODA 3HOVJ 2CM0A 1HS7A 3A01B 3VRAA 4RB0A 3PFIA 1BC7C 1FSEA 3HOZJ 1R5GA 1JXSA 2W66A 1T98A 1QU3A 3ZMZB 4DOZA 3GCMA 3CCLI 2FBIA 1MDMA 2F4VT 2OCCH 2VASA 2QYOA 4ZYHA 3I58A 2XAGB 4A2UA 2ZJRF 3ZMUA 3AE1A 1FOKA 2LKPA 3KLNA 2Y8DA 3CUOA 2NRAC 3LSHA 3ZJ2A 1QHHD 2CUJA 3CJTB 2OBPA 3P8CD 3K4CA 1U9OA 2MLGA 3UKGA 1ORKA 3HOWJ 4Q47A 4Q4ZF 1D1BA 3M3ZB 2C5KT 2W62A 2X9WA 1IRXA 2VIXA 4GK0E 2L7KA 3RTRA 4L0RA 1U5TC 4WXCA 3SXYA 1SD7A 3FXLA 3B5MA 2BXYA 3BY6A 4F55A 1AWCA 1PP8F 2EHOC 3G06A 4YJ2E 4B3TT 3BG5A 3ESLA 2F4MB 1BOBA 2NYXA 1WGXA 5D8KB 1N36T 1U3EM 1VF9A 2FRHA 4XLFA 3FXQA 3DTEA 2RAEA 3ZKRA 4A3KJ 2E2JJ 4IQ4A 4JYAT 5ILUA 2NS8A 3DBLB 4HF2A 3PJRA 1YJ9I 4IHXA 2CO5A 2DL1A 3DTIA 4IOCF 4PDKA 2BVLA 3ECOA 2JZYA 1Z77A 3QYBA 2FJ1A 3MD2A 3PUFA 4HAMA 3K0LA 2PJQA 2HOAA 2AE9A 1ZK8A 4RAGA 2LH9A 1NEKA 3GN5B 1BA5A 4EEFG 5FVKA 1GXPA 1WLXA 3E7LA 4YLHA 2OC6A 3ZCOA 4CHUA 2X0YA 3J80Z 4BAYB 5FY1A 3BK9A 2ME0A 1Y01A 4F52A 1X79A 2CWOA 2WBMA 2IP2A 2XSJC 1SFKA 1LFUP 1GHCA 3AVRA 2OQGA 2Z1DA 4UUSA 5EEHA 5AIQA 3BG6A 3LSIA 2R7XA 3PQKA 1ZAOA 3E22E 4L9IA 4DV4T 1D0ZA 3QOPA 2EK5A 2VPRA 4ESFA 4OK0A 4LJZF 4LG0B 5DEQA 3TGNA 1MMSA 2VOPA 1Y0NA 2KMFA 5L3EB 4XLEA 2XQ3A 5LGNA 2DA5A 4IRGA 5IP7J 4BNCA 2ZXJA 3DPLC 1WSUA 5E3LA 1X19A 3E08A 5FL0A 2VUMJ 5LGTB 4C3JJ 4XN0A 2DWKA 2V1DB 4BE0A 2XRNA 4FT8A 2ZM8A 3C51A 3RC8A 2IAIA 1HTJF 3MZYA 2R6GF 4S05A 2LREA 3NEUA 3WODF 2HKXA 3BQLA 3HR0A 1BI0A 1D1AA 4KN4X 3AKZA 3TLSA 1YJWI 1BJAA 2DMQA 4UHTA 2KMUA 3DBRB 1T95A 1T8BA 2VKEA 1DDNA 1K78A 3CJNA 2B9SA 2KWHA 1RZ4A 3KP3A 2IS2A 1R23A 2VN2A 2M30A 1UK5A 5LOVE 2XROA 1AOYA 5HXEA 2ID3A 1QBJA 3N9MA 1FSHA 2K9MA 4IE4A 4LG3A 3OYNA 2LE8A 3M65A 1BM9A 1HBXG 4AQFC 1FJGT 2D0TA 3RQUA 2PMZA 3PJAJ 5LG3A 5JDHA 4ENMA 3C1DA 4PK5A 1HKSA 3V8JA 1YLFA 2QEXI 1IZ1A 2XB5A 3H5AA 1OCCH 3Q0VA 4P5OA 4A0ZA 2EBIA 2VPLA 4G12A 3H3AA 3ONLC 1I6ZA 5LG4A 3PNYA 1JE8A 2HPJA 5EJCA 4EQQA 1EH7A 4WXHA 3V8KA 3H9JA 3LSGA 2UV1A 1DUXC 4XSZF 2YOEA 3KCCA 2V5DA 3O8HA 4R1HA 3S2DJ 4OWRB 3J7ZI 2LY2A 4IJAA 4MQ9F 2CQ7A 4XK4A 1KZHA 3RKGA 2Q2EB 2FQ3A 3F8CA 2XGDA 3DPUA 1O7FA 5FLXZ 2ZJ2A 3IKTA 2F5CA 4ZZDA 1Z91A 4E7LA 3S1MJ 4EMSA 2W85A 2JTVA 4NUBA 1NK3P 2CWEA 3OYZA 1LDJA 4UXNA 2DFHA 2QKLB 2VBZA 1W9RA 4EB6E 3U2RA 2FJDA 3IHRA 5AQLB 2WAQA 2ZXWH 2A6TA 2KT0A 3R0AA 3TLVA 1MGTA 2K5CA 3AXJA 3ZR8X 2IAKA 4GKKT 1S3JA 2R3SA 5DCFA 3LFUA 3CVRA 2D45A 1FLIA 2IHR1 4B43A 4ASKA 2XAHB 3GTGJ 2P5KA 3CLOA 5FNVE 4L0YB 3FBNB 4FE4A 1IDZA
chains in the Genus database with same CATH topology
2WC2A 2W25A 5E1XA 2ZCWA 1XGMA 4H9RC 2F2EA 4IHTA 1YS7A 3JTGA 2WV0A 5HAXA 4AKIA 2XKOA 3HTSB 5LHIB 3AB3B 2Q9QA 1BIBA 3D0TA 5LRRA 1IJ6A 4MFRA 2IA1A 1ZRDA 3GYHX 3IWZA 2NW9A 5LCYA 4WK8F 3K1PA 3L7WA 1ZG5A 4TUYE 4JEHB 4L18B 4P9FA 3PU3A 4AKLA 3ZJ1A 3N2GE 4KUMB 2W61A 4QWNB 4M74A 2CQKA 5J8FA 4ESBA 3IRRA 4I4TE 2GXBA 1G3YA 1O57A 3UUNA 2PI0A 3JSPA 4AVPA 3BWGA 3VKHA 2D1HA 3KINB 2DK8A 1WYBA 1SMYF 5DUIA 3E6MA 5FO5A 4GOUA 2JJ9A 1PUEE 3LWFA 1FEWA 2VKOA 2MTQA 4LLNA 1TW3A 3NRVA 3AAFA 3CX7B 2M45A 4PFPA 2JMKA 4KDPA 1HCIA 5H6QA 2GXGA 5DQVA 3EDPA 4HDUA 2DQLA 3L09A 4I0AA 2EFNA 1YIOA 1IXRC 3C98B 2QUFA 1WRJA 4CXXA 5H6RA 1USTA 1JHHA 3DTOA 2O3FA 2CFXA 1HX8A 4EJWA 4AKRB 4CI1B 1YG2A 2EFOA 4I2OA 2P4WA 3EQLF 1IN8A 3M7GA 1SFUA 3LA7A 3JC6D 1WYCA 4KMUX 4Q5SF 3WTTC 4HV6A 3GFJA 5HLGA 3ETVA 4MLKA 1OMIA 5FD6A 1BR2A 3RIRA 5E0OA 2IW5A 2ZLYA 4UVBA 1TQMA 4LFUA 2GK9A 3LK2B 3I64A 5F6FA 1QNTA 3UT5E 2VXZA 4YIIA 3R6SA 4GGGA 3E6DA 5ADXL 3HSRA 5HDKA 4O6JA 1IF1A 3KLOA 3LJCA 4UELA 3COAC 3ZCIA 4ZS3A 2CSOA 4JK1X 3ERED 2ZNYA 3WTYC 3BDDA 3LK42 4IHJE 3SZTA 4H63V 4GYIA 3OJAA 4I98B 2O6GE 3GZ5A 1O3RA 1MKMA 5L3DA 1LNWA 2D0UA 4DVDA 5ICEA 1ZG3A 2VK9A 3JAMK 2A3DA 4WF2A 5LGTA 5DDGA 2I59A 2X9HA 2EFPA 2HKOA 4UV8A 2KXPB 2A3SA 3HKDE 4UV8B 3HTUA 2GQQA 2WMNA 4NQWA 2CGPA 3RPUA 2V7LA 3BPXA 3F3XA 1ZEEA 3I0OA 2IW5B 3HYIA 2ZO4A 2JQQA 3T8OA 4MNUA 3VOEA 3O9XA 2FMLA 2MBFA 3K3OA 3KBTA 4IF4A 4ENJA 3M1EA 4MHCA 5JDMA 2V7MA 1IW7F 4GCVA 4TV9E 4XZCA 5J2UE 4N0BA 1RNLA 3NRXA 3E3VA 2Z99A 3WU1B 2FOKA 1WI9A 2E8IA 3KFWX 2YEVC 2MA3A 1O3XA 1G3WA 2VT2A 5JHUA 3R4KA 3KV5A 4KP3C 2KRFA 2ZMAA 4K2EA 2QQAA 3WE2A 3BJOA 3CTAA 3QK6A 3UUMA 4EM1A 5LRSA 5L3BB 3F8NA 4YJ3E 3EDUA 1STZA 1LDKB 2V1UA 4MHGA 2VKHA 1H9TA 4GYSA 2K02A 4N9HA 1R22A 4ZOLE 4QX7B 1ZLKA 2K4JA 4FJOA 5FD5A 3ZC0A 4U72A 1YTYA 2DWGA 1GXQA 5LHGB 3F72A 4IRIA 3RRCA 4ERRA 4EZ4A 3HRMA 5J6XA 2C5JA 4QLCU 2XQYA 1L0OC 5LYJE 1UCUA 4RGUA 5FXWA 4GK5E 5FP3A 3QPTA 2FSWA 4XLPF 3WTSC 6PAXA 3GX4X 2UXXB 4KT5C 2HWVA 3C50A 2EFWA 2KJBA 1FMVA 3VB2A 2VL8A 2P9BA 3UTKA 3LFKA 2XASB 1R1TA 2M8EA 3AAAB 4M1PA 5L3EA 1IRFA 3GUDA 5HXSA 5H6QB 3E97A 4RAZA 5LNKA 3FHNA 4TV7A 4BJMA 5L3DB 2QQBA 5CB4E 2MYSA 2OAZA 3KDSE 1A04A 1P2FA 3J80K 3SHFA 2AS5F 1ZLJA 3AAIA 5H6RB 5E17F 5HLIA 2W0GA 3KEQA 3HSFA 3RX6A 1DPUA 3LQQA 2OD5A 2E9XB 1MIVA 2DPUA 1UCRA 3ZMTB 4DQ2A 5JREA 4CQIA 1B1BA 5D4RA 2A5YB 3KV6A 2XAGA 4KBMB 4L9JA 3QC9A 1X3UA 3L9FA 4ZI2D 1R36A 1OKRA 1HXDA 5EK4A 5BS6A 3J9X1 4L0ZB 4G8XA 2LM9A 1E17A 2ZFWA 3B73A 2V26A 4BH9A 5A2QK 2VWAA 1FP2A 5ERIA 5E18F 3OYXA 4TV8E 3KETA 1OYIA 5BOXA 5FFZA 4O4JE 1K6OA 4Y17A 4O2AE 4AIHA 4CYDA 3PUQA 4JUYA 3F6VA 5FXVA 3GF2A 4O2BE 5HWYA 2ELHA 3CPZA 1ZYRF 4JQFA 1WR6A 3O2PE 2P7CB 4O5VA 2E7WA 1IN6A 4MTDA 2L4MA 3J81Z 3REOA 5JDQA 3ZMUB 4ASNA 5LHIA 5K5RA 2DPDA 1UX5A 3QPHA 2H6BA 2X0LB 3AA6B 2KIFA 3SOLA 2XAQA 4GO1A 2BE5F 2XV4S 3UUXB 3RH3A 2HTJA 5EK2A 1ON2A 2C0SA 4U0YA 3HOTA 4E70A 1BR1A 2Q9QD 4HKAA 4QX8B 3B02A 5LJNA 1ZH5A 2H7VC 4TZ4C 5DCMB 5EZYE 2CXFA 2FE3A 2KT9A 5E8IA 3DFGA 2ZNZA 2GIVA 3LFMA 2HGCA 1YW8A 2NS0A 3DP7A 1J5YA 3HRTA 4O8SA 3SZPA 4HX7A 3ZN0A 3B13A 1YYVA 4LK0F 4UUVA 4CZZA 4PJNA 4FX4A 2V6CA 2Z6EA 5C8YE 5CA1E 5HXHA 1RI7A 3J7Yq 2NNYA 5LLQA 1OWAA 3WGGA 1FBUA 3J7AO 4HYEA 5CVVA 2QVOA 4BHCA 3PUGA 4NHJA 1I1GA 1BC8C 2MH2A 5JDLA 4WX9A 2ISZA 3ZEFB 3ECHA 3RJPA 4YG2F 2BDEA 2V7IA 1F4KA 4P0AA 2EA2A 2BGCA 2H09A 1HKTA 1HF8A 3TKLB 3P9IA 3Q5XA 5H20A 4KN7X 2BEOA 4HLXA 3HL6A 4EJOA 5LHHA 1B4AA 2VT3A 3RI4A 1XDSA 3HUGA 3F8MA 3JTHA 5CVRA 5DCMA 3HKBE 4O4LE 1BI2A 3RC3A 3N4MA 2E9XA 3PUAA 4LB6B 4X20E 4ZYEA 2W00A 4WXDA 1H0MA 5ICFA 3BQIA 4ENKA 4DO0A 2G7HA 2FU4A 2Y48A 5D5UB 4EOZB 3EVYA 3N9NA 3MCZA 1ON1A 1U4QA 3ZYKA 3PDYA 2OA5A 1BI3A 2CG4A 2WMOA 3MEXA 3ZMTA 3FMRA 1UFMA 5AFUL 4GIWA 4M6YA 1I6XA 2M1BA 4RB3C 2DFIA 3T5XA 2MC3A 3GEZA 3V5UA 4H9SE 3K2ZA 3K3NA 2RQPA 5K5QA 1VOMA 3LBXA 3U1DA 1HW2A 3I9WA 5BPIA 2B1EA 4PAGA 1LB2A 5KDMC 3E6BA 2V79A 3HKEE 4HEAA 2L01A 3RYRA 3GW2A 3RPQA 3CUQB 5AONA 3W6KB 1ODDA 5LGUB 4PZJA 3E5XA 3GLXA 4I7HA 4CI2B 2YU3A 2F5EA 1W5TA 3ABTA 1YO5C 5HYAA 5DV5A 2FMYA 2J1DG 3DJBA 2HDCA 5IYZE 4UIGA 1FZPB 2FXAA 1S6LA 1SMTA 4EGZA 2CO