1T98A

Crystal structure of mukf(1-287)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
274
structure length
266
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The MukF subunit of Escherichia coli condensin: architecture and functional relationship to kleisins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
total genus 100
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t98A01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1t98A02
4M73A 2DQLA 1LEAA 1TNTA 4MNUA 1ZLKA 2BYVE 1C0WA 2Z3YA 2UZKA 3LA2A 2QQAA 2VBYA 3V8LA 4I2OA 5CYVA 1R36A 3LQQA 4U0WA 2QLZA 1KU3A 3KETA 4CDGA 2IJLA 4F7ZA 4UNOA 2O0YA 5A2QZ 3GFMA 5ICGA 3BPXA 3TOBA 1MD0A 5IT9Z 4HQEA 3KZYA 3M8EA 5HLHA 5LEKA 3WG9A 3FM5A 3HSEA 4RGXA 2LDUA 1O57A 1PP7U 3NRVA 3WU0A 3T1BA 2RN7A 2UXXA 1KQ9A 3TO7A 3FXQA 4GCVA 4OOIA 4A5NA 3HIFA 4EM1A 2BE5F 1ONVA 3KEQA 4UV9A 1IRFA 5LGUA 4XRFA 2AXLA 4ASNA 2UWMA 1DPUA 2EFNA 4RS8A 4O5VA 3I59A 5HDNA 4BNCA 1KU2A 1B6AA 4I7HA 1J59A 3COAC 2A3SA 4L9JA 3RTRA 2GIVA 5HS8A 5ICFA 2P7CB 3HHHA 1ZHFA 3IWFA 4P5OA 2JT1A 2ZMEB 5FFXA 4HDUA 1BIBA 4M9SA 3FMSA 2OD5A 1TTYA 1B9MA 3MEXA 4A2UA 2HZTA 5HDKA 4H0EA 3HRMA 4PCQA 3WTUC 1FP1D 5ICCA 3FWEA 5JR3A 3ZPLA 4G6DA 2FNAA 2QM3A 2JRTA 2MH2A 2ACJA 5L3DA 1Z9CA 1W5TA 2COMA 1JHHA 2VONA 4LK0F 5LRRA 4PZJA 1FBSA 5IT3A 3F3XA 1P4XA 3K1NA 3QP6A 3N97A 1YG2A 5KVRA 4AWXB 1QZZA 3BY6A 3MQ0A 1FP2A 2FRHA 3ABTA 3ML6A 4UV8A 4B8XA 1RIOH 1EH6A 1BM9A 4BYYA 1V4RA 4BHPA 4L5JA 5D8LB 4MEXF 1HQCA 1SD6A 2E1CA 3REOA 4WWCA 2X0LA 5L3EA 4M6YA 3DP7A 2CW0F 1OR7A 1GXQA 2OU2A 2A61A 2ZBKA 1U5TB 3CDHA 4YFXF 2XVCA 2XKPA 1F5TA 2A69F 3C7JA 5ILSA 1QNTA 2ISZA 3GLXA 3ZMTA 4WF2A 1TW2A 4FT8A 3TGNA 3VFZA 3MZHA 4HF1A 3QP5A 2DBBA 1CGPA 3RKXA 1G6NA 4YFNF 2XKOA 2DO7A 4I0AA 4Q4ZF 1QBJA 4GYIA 1FT9A 1I1SA 1O7FA 1JE8A 4DNCA 2LSOA 2M30A 5KK1A 1J9IA 3M1EA 2OAZA 3GUDA 3SXYA 3RPQA 1EV7A 2D45A 3E6MA 1A04A 1NHAA 5E1XA 1ZG1A 3K69A 1U3EM 2L02A 2RC4A 2XAGA 3FXRA 4EGYA 2A6HF 2EA2A 1J75A 3BJ6A 5LHHA 1EH8A 3K1MA 1E17A 3QPHA 2W85A 3J80K 1B1BA 2H94A 4HF0A 1B4AA 2P5VA 4ETSA 3R4KA 1XCBA 1H0MA 5FLXK 4WXDA 1XCVA 4KMFA 1UCRA 2CQKA 3GO5A 1HBXG 3KP3A 3GZ5A 3QOPA 3KCCA 3CO6C 4D0PA 1T6SA 2PEXA 2V9VA 3ECOA 1K79A 3BP8A 2VT3A 2ZNYA 2WV0A 4Z2YA 2OZ6A 1D8JA 4UXNA 5IT9K 1IN6A 2ETHA 1K78B 3BJOA 3DKWA 1H9GA 2W84A 4WXHA 3FZVA 3MCZA 2OQGA 4GXOA 2L4MA 3WTVC 2K4BA 1L0OC 1ON2A 2CSOA 4I02A 1SD5A 5HLGA 1BI1A 2VC1A 5ERIA 3TO6A 4CGZA 5F64A 4I09A 4G6QA 3QU3A 3QU6A 1R5HA 4RB0A 3MZYA 5BMZA 3RYRA 4EJWA 3TOAA 2XAFA 3CUQA 1J0RA 1J7KA 4P9UA 4NHJA 3HOSA 2ESHA 3KP4A 3LA3A 4UVBA 5L3GA 5BOXA 3DXJF 1R00A 3V7RA 2HQNA 5DCFA 5EEHA 4E70A 3N4MA 3KZZA 2Z99A 3WU1B 5K1YA 5CJ9A 3WTWC 4LMYA 4B09A 4HBLA 1F4KA 2R7DA 2KIFA 2XHKA 4YG2F 1TQMA 4HX8A 2XASA 1KA8A 4OIRF 4KUMA 4RGUA 2XAJA 4A0XA 4A6DA 3GX4X 1PP8F 1L3LA 5ICEA 1IN8A 2EFOA 4OIOF 2MC3A 3LAJA 1XD7A 4G9YA 3TDZC 1RUOA 2M5WA 3PFIA 3HSFA 1KU9A 1SAXA 3RI4A 5K5OA 2FMYA 2QBYA 1VTNC 4M6XA 4RGRA 3SZTA 5D8KB 2DT5A 1OMIA 2EK5A 2CYYA 1YS7A 3ABUA 1B59A 2DFIA 4YIIA 2RQPA 3T8RA 4KFCA 4GGGA 2Z33A 2PMUA 1YS6A 2ISYA 1FC3A 2L3DA 3M8FA 1HW2A 1ZYRF 3J7AO 1OYIA 4IPAA 3F8FA 3H92A 4Q47A 2Q0OA 2W24A 1CF7B 2OQRA 1PDNC 4CZZA 1FSHA 4TV7A 4I0BA 3QRFF 2PI0A 5H6QA 2XROA 1QQIA 2Y48A 3BWGA 2FOKA 4EJTA 5HDGA 2Z5UA 4GYGA 4LGWA 1AOYA 4IJAA 1YYVA 1LDJA 5AONA 2NS0A 3GXOA 3GZ6A 1QPMA 3I54A 4AIJA 4GO1A 5JI6A 2V79A 3BJAA 5DCMA 2PFBA 2KIMA 2EV0A 4G94A 4U88A 4CICA 3VB2A 5JFRA 4AVPA 1QO0D 2IRFG 3WGGA 2CGPA 2HYGD 4ZYGA 3CLOA 4A6EA 3AAFA 4UVAA 3V7SA 1T38A 2B0LA 2MLGA 3H3ZA 4QLCU 3CUQB 3C18A 3ZMUA 4EVIA 4O3MA 5H20A 4PGGA 3EYIA 1FZPB 3KLNA 1MDMA 2QWWA 2JTVA 1RUNA 3O3KA 2M87A 4LG0A 3RPUA 5FO5A 4OMYA 1IN5A 1YLFA 2ZFWA 1ULYA 2PLYA 1WRJA 2Y0MA 1SD7A 5E8GA 4BQAA 4LG0B 1MZBA 2FSWA 4HOBA 4A0YA 3IRRA 5LGTA 4KNYA 1I5ZA 2HQRA 4Y17A 1YW7A 2WWYA 4MQVA 5BQTA 1DDNA 3M9AA 5E18F 5J8CA 1SFXA 3ZP5A 4LLLA 2NNNA 3VODA 1BC7C 2DPUA 2VBZA 1FNNA 1MDMB 3Q9VA 2A68F 4ESJA 3B73A 1S6LA 4L0ZB 4Q5SF 5DDGA 3TO9A 2BBYA 5LGNA 1WI9A 1TQIA 1ZLJA 2KRFA 3JAMZ 2IP2A 1ZRFA 5D6FA 4ENNA 4O6JA 4HW0A 5E1WA 3IL2A 3SQNA 5HOOA 1ZGJA 2FBHA 3FF5A 3WE3A 4S04A 2D1HA 2ZO4A 5CVRA 1UB9A 3F8NA 1YIOA 3JTHA 2RVCA 5DEQA 2D2WA 2YX7A 2BEOA 4DQ2A 1YQAA 2QQBA 4KIGA 3RJPA 1WWXA 5LHIA 2IA2A 2PG4A 1IXRC 2P6SA 1UHMA 3J81K 4HF2A 2OZUA 5TJJA 4RB3C 1R7JA 3JSOA 1J2XA 3DV8A 2BGCA 2ZCWA 3T5XA 3I4PA 3LWFA 1MJBA 2E7WA 4Q48A 4RB2C 1U8RA 1R1TA 2KJBA 2K7LA 2NRAC 1P6RA 2GZWA 1AWCA 2HEOA 1XGMA 3F72A 1T98A 4IHSA 2MD5A 2VBWA 4N9IA 4MQ9F 2VT2A 2BV6A 1O7LA 5F1RA 5FD5A 3JSPA 1X3UA 3CUOA 2YSRA 2A6EF 5DUIA 3CJNA 1ZH5A 2HDCA 3KFWX 4BH9A 5BS6A 4A5MA 3WODF 1EH7A 5D6EA 4EMSA 2VC0A 2F5DA 2RKHA 3E5QA 3WTZA 4OU0A 3M7GA 3RDIA 2MH9A 1XDSA 1XMAA 4ENMA 1RZ4A 3PQKA 3G3ZA 4ENKA 4XBFA 4CHUA 1Z6TA 4KMUX 4OIPF 2FNPA 3QAHA 3DF8A 4N9HA 1Z7UA 2LF7A 3WTTC 1BBYA 3Q5FA 3GFJA 3L7WA 1BJAA 2HYFA 1F9NA 4HYEA 3E6BA 1HSJA 2ESNA 1KGSA 3U2RA 4MTEA 1UHWA 2F5FA 2XUBA 3L2CA 2DI3A 5BPDA 1XN7A 4R79A 3G73A 3I5UA 2EFPA 4LJZF 2K02A 3OOPA 3HOTA 1R22A 4KICA 2MA3A 1O3RA 1I1GA 3EUHA 2JPCA 2GXGA 1IN7A 4A0ZA 1I27A 2H27A 4LK1F 2O3FA 5DD4A 3DQVC 4RB1A 4A12A 3LAPA 2JPBA 3ERED 3F6OA 3HRUA 3F8CA 2R3SA 2Q8KA 3T8TA 1S7AA 3Q9SA 4XSXF 3LFKA 3MFKA 4I01A 1KU7A 2ZKZA 4ESFA 3I59B 1FYKA 3R61A 4WCGA 2V1UA 4KIFA 1W7PB 5H6RA 3V7CA 5F6FA 1HW5A 2FU4A 4CXFA 2EJRA 4MHGA 3RKWA 2PQ8A 4HX4A 3FM3A 2XV4S 3FX3A 1OYWA 2HKXA 3WTYC 3L00A 1R58A 1JGSA 3VOEA 4HV5A 3KP7A 5D5WB 4XLPF 1STZA 1YW8A 1QGPA 3TKYA 3IRQA 2P5LC 5D4SA 4WK8F 1Z91A 2W57A 4AD9A 4L0YB 3NQOA 3C3WA 3KP2A 4IRIA 2ZNZA 2F2EA 3I71A 1W7PA 4G7OF 4HLXA 2X4HA 1YW9A 1BI0A 4PDKA 1HKTA 2XAHA 2C6YA 2IPQX 4FX4A 3GYHX 2ZJ2A 4M71A 3SFZA 3RYPA 1FX7A 1O3QA 2M1BA 2NAZA 5JVTA 3BPVA 2DQRA 4EJOA 5D5UB 1P2FA 2RDPA 1IN4A 5E8IA 2AS5F 2O6GE 3DPLC 3RIRA 4KN4X 1KYWA 3K2ZA 3P9CA 4ZYHA 1JXSA 3GEZA 2ELHA 2P5KA 3LSTA 2QQ9A 1ZREA 4HQMA 2H6BA 2QYOA 4OINF 2QENA 4HA8A 2P7VB 1U5TA 1XMKA 4P96A 1R23A 1K7AA 5BPIA 2HGCA 3WTSC 3U1DA 1S8NA 4LB5A 1Y0UA 1P92A 1BC8C 1DUXC 5LEJA 4BHCA 3FMQA 2GQQA 3E5XA 2EFWA 2HS5A 1G3YA 1TBXA 3GWZA 5AIQA 3JW4A 2IT0A 3S2WA 4HLYA 1UFMA 1ZN2A 1LVAA 5FGMA 1K6OA 1F1ZA 2R7FA 4JQFA 5HS9A 3GFLA 1W4MA 2HTSA 3O6BB 3V8JA 5E17F 2EV6A 2J5OA 2TDXA 4R1HA 2IW5A 3V4GA 2EFQA 4P9FA 4EM2A 1FSEA 2VE9A 2PMHA 5HLIA 1BI3A 1LQ1A 2RV8A 4KN7X 2MBFA 4RAZA 1TQPA 6PAXA 4ZH4F 1RI7A 2O03A 2XRNA 5CVJA 2H09A 2IA1A 4CYDA 4WX9A 4KT5C 2VXZA 1QZYA 3K0LA 4AIKA 4ZZLA 1R1UA 1FYLA 2DPDA 4QWQA 4ZYDA 5ED4A 1MJAA 2KIUA 1ZRCA 2XAQA 1FBUA 3GVAA 4U7BA 1LJ9A 2VN2A 1ZAOA 1GHCA 3KEOA 3F22A 4HX7A 1IRGA 1G3WA 3LQRA 3GF2A 1CF7A 2G7HA 3CO7C 2FXAA 2VE8A 3P9IA 3WGHA 2PBIA 2JZYA 4FX0A 4EJVA 5J6XA 4IRHA 3IC7A 1OYYA 4MTDA 2FEZA 3JTGA 1YTYA 1WSUA 2DLLA 2YU3A 2FBKA 4JBAA 4FHTA 1XGNA 3L09A 4IHTA 3HYIA 1HXDA 2EWNA 3DPTA 4KDPA 3T0YA 2O61A 1W7PD 1WKMA 2HR3A 2KKOA 4MEYF 4NQWA 5ILVA 1SMTA 2VOPA 1Z1DA 2IVMA 3P7NA 2DK8A 1XSVA 5DUKA 1ON1A 5LLQA 1R5GA 1FWZA 4L9TA 1KYZA 4KA4A 1HW1A 4EV0A 2A5YB 1USSA 2KJCA 1B9NA 4ZYEA 5E1ZB 1IZ1A 3IWZA 1IF1A 3R0AA 1ZRDA 2PJPA 2FA5A 4RGSA 1IAWA 1V3FA 3F8MA 1FLIA 4LD5A 2CFXA 4HDVA 4XSZF 2P4WA 2RNJA 4KIBA 4M74A 5L3BA 3TDUC 1FY7A 3HRSA 1XGSA 5DV5A 3E5UA 4HAMA 1HSTA 1FOKA 5ILUA 3I58A 1S3JA 2IA0A 5CVVA 5D4RA 1ZG5A 2YR2A 3E6DA 3L9FA 4G8XA 3BROA 3ZN1A 3KP6A 4ZZDA 4JK1X 3CUQC 1U6GA 4ESBA 4BXUA 3HHGA 1O3SA 2GWRA 5D5VB 2WC2A 2GAUA 3ULQB 2YPRA 4LLNA 2QBYB 3BOQA 4UHTA 1IUYA 4YIFA 2CWEA 1USTA 3LA7A 3ISPA 3IHUA 1Q1HA 1YFHA 2LKPA 2VBXA 1K78A 1DP7P 2J5PA 1LDKB 2WTEA 5E20A 5HVQC 5L3CA 3B02A 4HV6A 4EQQA 1GXPA 5K5RA 1T2KA 2Q2EA 3ZMSA 3BDDA 3U9GA 2P6TA 1G3TA 2L01A 1XSXA 3IKVA 4S05A 3JAMK 4I98B 4L9VA 4UUVA 4L5IA 4RAYA 3I64A 3J80Z 4M9XA 1IW7F 2GA2A 3E3VA 5DCMB 5FD6A 3GW2A 3ELKA 3F23A 1Z05A 3HSRA 3EQLF 4OMZA 5FLXZ 2V1DA 1WQ2A 3H3UA 5LHGA 5HS7A 2QUFA 2E7XA 1MGTA 2EV5A 2H6CA 2G9WA 5DYMA 2W25A 3ZN0A 2GXBA 2PN6A 5AIPA 1D3YA 3ROUA 3GFIA 1U5TC 1G4DA 2M8EA 2HOEA 2QZ8A 1U2WA 2OBPA 4WXCA 1TW3A 2DW4A 4L9NA 3E97A 2MLKA 3PQJA 3D5LA 4EJUA 2M45A 4L18B 3W6KB 2Y75A 3K9TA 1BIAA 3EYYA 5A2QK 5CVUA 2LNBA 2L54A 4Y15A 4P55A 3I53A 1HKSA 3HTSB 2G7UA 4G7ZF 4R8HA 3I0TA 5EEGA 2K86A 3FMRA 3HTUA 3KLOA 4AIHA 4ENJA 2K4JA 3ECHA 1OKRA 3SZPA 1XSDA 2FMLA 2DAOA 3FHZA 3J81Z 2RGVA 1Z6RA 3RKYA 2EB7A 2HTJA 3K1PA 2V1XA 1U78A 4LFUA 4MGRA 3ZMZA 5CLSA 1RNLA 4Y13A 4CO8A 5L3FA 3WTXC 2FE3A 4ON0A 4XLNF 3TQNA 2ZXJA 1G3SA 2HKOA 3R60A 5FFZA 5DD8A 2VODA 4M72A 5CVIA 2GA1A 3D0SA 1H9TA 2CO5A 4M9ZA 1ODDA 2HWVA 3O2PE 1KQ0A 2YX4A 3CTAA 1XDUA 3FXUA 1XGOA 2DTRA 5LRSA 1LNWA 1XB4A 1R1VA 1TNSA 1REPC 1ZARA 2CG4A 1P4AA 1ZGAA 4EGZA 3MAJA 3MWMA 2XIGA 3SHFA 3F8BA 2EA4A 1LEBA 2FF4A 1IXCA 1SFUA 5K5QA 4U0VA 2XGXA 2NNYA 3NEUA 1S7OA 2D1VA 1LDDA 2FQ3A 4YFKF 1YO5C 3WE2A 1D8KA 4U0YA 5LBQA 4UVCA 2E1NA 5D5XB 1MKMA 3DFGA 1P4WA 4KYWA 2DK5A 4IF4A 3DEUA 3KE2A 3P9KA 1SD4A 2DU9A 2P8TA 1HKQA 2HFHA 3ZMDA 1PUEE 3F21A 3R0JA 3IKTA 3E6CC 1FPQA 2QVOA 1KQ8A 2STWA 2O8XA 3EDPA 1LB2A 1IXSB 1O3TA 4PGHA 1FYMA 3ZMVA 4BAYA 2V6CA 1JHFA 1GVJA 2STTA 4LLGF 2UXNA 1OPCA 2LF8A 1MJ9A 1BOAA 1SFEA 3BZ6A 2JSCA 4IRGA 5FB2A 4LB6B 4OIQF 1FBQA 4IXAA 5JHUA 4G7HF 1E2XA 2OA4A 2VOOA 3EETA 5J8FA 4IVNA 3HUGA 3OV8A 3VEPA 2A07F 4HZFA 3QPTA 3W6JB 1SMYF 1I6XA 3R6SA 2L4AA 2NYXA 1S29A 3HRTA 4EM0B 3V8KA 2Z9OA 1DPRA 1T0FA 3ZQ7A 4U7DA 2FBIA 4K2EA 4BHBA 4NB5A 2ADUA 2F5EA 2K27A 1BI2A 2ZMEA 1T39A 3KP5A 1ZG3A 1W5SA 3C1DA 3WGIA 5TRDA 1J5YA 1BN5A 1TLHB 2F5CA 3F6VA 4N0BA 1D5VA
chains in the Genus database with same CATH superfamily
4M73A 3OY9A 2DQLA 4XL9A 3VYSB 1LEAA 1TNTA 2ME0A 2WY8Q 4MNUA 4XKBA 3J7AY 3AE5A 5B1AH 4U7YA 3U78A 5ADXL 2W7NA 4OK0A 2BG9E 4PNIA 4EYYR 4QIWN 2BG9B 2K85A 4H9PC 2CWYA 2WAUA 1ZTRA 2BW3B 4JEUB 4JEHB 4O4LE 4QXHB 1A31A 3TL4X 2M6IA 1ZLKA 2UXBT 2BYVE 5LCYA 3LBXB 1KONA 4KJZA 1C0WA 2Z3YA 2UZKA 3LA2A 3PE0A 2DOEA 2QQAA 4DR6T 2VBYA 5HAXA 3V8LA 3ESWB 4I2OA 2WS3A 2ZXIA 3HOZJ 3I3LA 2AQFA 5CYVA 3UULA 4HNTA 1R36A 2WAEA 2WQYA 3ETVA 4UIGA 3LQQA 4DBRA 4U0WA 4JI7T 2QLZA 3FXJA 1KU3A 3WG7H 4CDGA 1D1CA 2DJNA 2IJLA 4F7ZA 2H1LA 2O0YA 4XLFA 3KETA 2QSGX 2WAQN 3GFMA 4PSWA 5ICGA 5FJ8J 3NWSA 2BY0A 5A2QZ 1POGA 2DA4A 2Q9QA 3VKGA 3BG6A 3BPXA 3TOBA 1MD0A 5IT9Z 4HQEA 3KZYA 3OS1A 2DN0A 3M8EA 3AEFA 5HLHA 5LEKA 3E0JB 1Y39A 1WFDA 2WZIA 4RDUA 5EEAA 1ZR4A 3GTJJ 4YHHT 1VQ4I 3WG9A 2E2HJ 1GV2A 3FM5A 3HSEA 3I0OA 4TWDA 1ETQA 2LDUA 4RGXA 3GTGJ 5KX5E 4YFSA 1O57A 5AQTB 3H36A 2EZLA 4A3EJ 3OIQA 4KUMB 4F91B 1PP7U 2AHQA 3NRVA 3DBRB 3T1BA 3WU0A 4WBOA 2HHHT 2RN7A 2K5BB 3OL3A 2UXXA 3EUHC 3X2QH 2IAKA 3OJAA 1KQ9A 3TO7A 4IT4A 2M4KA 3FXQA 4MO7A 4GCVA 3QK6A 4YSZA 4OOIA 4A5NA 3A8YC 3HIFA 4EM1A 3BZCA 5LB7B 2BE5F 1ONVA 4DBQA 2PJRB 2XQ5A 3KEQA 1S72I 4LF7T 4UV9A 1IRFA 5LGUA 2O5RA 4FE7A 4XRFA 2JK3A 3M4OJ 3B13A 3RIUA 3RYHE 2AXLA 3UQ7A 2KISA 2QQ8A 3BTCA 4ASNA 3HBLA 5HCMA 2UWMA 4PAGA 5K7ZA 2VURA 2NR4A 3CJTB 2SPCA 4ABZA 5J1RA 1DPUA 2EFNA 4RAFA 2IC9A 4EZ4A 4WBNE 3ZT5A 2FJDA 4RS8A 3CDLA 4O5VA 1IJ6A 3NRYA 2L7FP 2KPMA 2XQ9A 3I59A 5HDNA 2W0GA 3JAFA 4K0UA 4BNCA 4BY1J 1KU2A 3O1IA 3CX7B 3VPRA 2BDEA 1B6AA 4I7HA 1B72B 5IHYA 2OV9A 2KRHA 3ZKRA 2UUAT 1J59A 3I9V2 4HFCA 3COAC 2DA7A 2K3WA 2A3SA 3C4ZA 4HFHA 4L9JA 1H7CA 1XDPA 3CDIA 4JYKA 5E3MA 3RTRA 2BS2A 3RF1A 4A97A 2GIVA 3A1YA 4X64T 4AYBN 1QU3A 4W1UA 2WDVA 2CJJA 5HS8A 4IO9F 5ICFA 2W62A 2X9YA 2XQ4A 3ANWA 4ADZA 2DNXA 5ABEA 1AA7A 2P7CB 3HHHA 4QH1A 3MVPA 4BJTA 1M62A 3ZR8X 2ME6A 3PDYA 1ZHFA 2NWBA 2V7KA 3IWFA 5F3JA 5AQMB 3ZC1A 4P5OA 3OSGA 1K4SA 2JT1A 2ZMEB 3B6AA 5FFXA 3BTJA 4HDUA 1W0AA 2XGDA 2I6HA 1BIBA 3CLQA 4U74A 4YSXA 5AQJB 4M9SA 5E0OA 3RSNA 2CLYB 3PO3J 3FMSA 1YKEB 3P4QA 3RYIE 3S14J 2OD5A 1TTYA 4HTEA 1B9MA 2VKHA 3MEXA 3RYCE 4YXDA 4A2UA 2V4JC 1T7SA 3NBXX 2XAQB 2O8KA 2HZTA 1IRXA 2F4IA 5HDKA 3C4WA 3ZEFB 2H8WA 2B76A 5K7HA 4D5CA 5FROA 4H0EA 3OVUA 4MHCA 2R7QA 3QPSA 4AIUA 3HRMA 4PCQA 3G2BA 4B3AA 3WTUC 1FP1D 5ICCA 1IDZA 3FWEA 5A1LA 2LY9A 3IAS2 5JR3A 1OQYA 4IHVA 3ZPLA 4G6DA 1YXRA 2FNAA 2QM3A 2JRTA 3LOCA 2MH2A 3GA8A 2BKOA 4QXBB 5GP9A 2ACJA 5L3DA 2EQRA 5C4JJ 1WZ2A 3KV5A 4ZDPA 1Z9CA 3LK42 4CCMA 3AA6B 1W5TA 3AE6A 2COMA 4B47A 5EG0A 1JHHA 3AL0C 1GT0C 4LK0F 2VONA 5LRRA 3MJXA 1BR0A 4PZJA 1FBSA 2IS6A 5IT3A 3F3XA 1P4XA 2YN6A 5F0CA 3K1NA 3QP6A 3IH2A 3N97A 1HC8A 1YG2A 5KVRA 1XWMA 4AWXB 2BXZA 1MSEC 2OUMA 3K7AJ 2AXDS 2CBIA 3QB5K 1QZZA 3BY6A 3MQ0A 4HEAA 2IMLA 3FXKA 1VQPI 1FP2A 5HWXA 1U5PA 3EDVA 1QSDA 3UR3C 3C98B 2FRHA 3CX6B 4BAYB 1VZ0A 4M3BA 5FKKA 4Y52J 3ABTA 4PJNA 3ML6A 4UV8A 2HVRA 4B8XA 4AI6A 1MMAA 3HZJA 4XNFA 2Y0SA 4E7ZA 2FX0A 1RIOH 5IP9J 2EPFA 2X6YA 4MLKA 4IE5A 1EH6A 2E5VA 1BM9A 4BYYA 3Q9DA 3OYJA 4QH4A 2ZLYA 1V4RA 1FTTA 4BHPA 3DPUA 3CC4I 3BQKA 3FZHB 3KBUA 2C5JA 2WSSV 4C2MJ 4L5JA 5D8LB 2XQYA 3EAMA 4KHZF 2ZFUA 4TN7B 1V5FA 1MBFA 1I3AA 3KYDB 4II2A 4MEXF 3AE8A 1BL0A 5IUXA 1HQCA 1SD6A 1WJDA 2E1CA 3REOA 4WWCA 2X0LA 2XZEA 2HZDA 4M6YA 3DP7A 1Z3YA 5L3EA 1MNMC 1UK5A 2LY1A 1HCIA 4O8SA 2CW0F 3N9PA 2R5ZA 1Y8QB 1OR7A 4QX8B 5FKMA 4Z8XA 3J7ZI 1QPIA 1GXQA 2V7JA 3AA7B 5L3FB 3BQYA 2H7OA 2OU2A 2XASB 2ACZA 4AUXA 1XC5A 2OJED 2A61A 2KT9A 5F8PA 1ENHA 1SHZC 1W36C 2A2FX 2V6YA 2ZBKA 2M3AA 1U5TB 2BY2A 5H2FC 3WAKA 3IBPA 3CDHA 2EIKH 2KZVA 4EYUA 1OCRH 2HN2A 3G06A 4P1WA 4YFXF 2XVCA 3A7MA 1Z77A 2QSFX 2XKPA 2LSJA 1F5TA 3VR8A 2A69F 2DOAA 3SFDA 2B1EA 3C7JA 5AFUL 5ILSA 3FZLB 1QNTA 5EZHA 2ISZA 5HCJA 5L3GB 3O9XA 1S94A 2CLYC 5LFAA 4DW6A 4A93J 3GLXA 2F48A 4QHOA 2XF7A 4X5TA 1D0XA 3HM5A 4C3IJ 3C51A 1R9TJ 3ZMTA 4WF2A 1TW2A 4AQFA 4ZS3A 2D5VA 1MH3A 3IUOA 2JQ7A 3TMOA 4FT8A 1WFXA 3TGNA 3VFZA 3MZHA 2KZ7B 2V7IA 1A35A 2UXXB 1H8AC 3QP5A 2LP0A 4HF1A 2NP9A 5FVLA 4B6XA 3CQCB 4BKXA 3OSFA 3ABLH 2DBBA 2VJJA 1X19A 1CGPA 2CV0A 3RKXA 3CJRB 1G6NA 3NARA 3ONXA 1WJ5A 4YFNF 4GDFA 2BW3A 4M3DA 2YDQA 2XKOA 2X0YA 2DO7A 5FKNA 3H3VK 4I0AA 4Q4ZF 3S16J 4A3DJ 2G0UA 3PSIA 2Z16A 2W4XA 3E08A 3EVYA 3PUGA 5L4HA 1QBJA 3PUBA 2BY1A 1G2HA 2K5CA 3HOUJ 5F5WA 5F0FA 2LSKA 4DR1T 3ZPOA 2OCCH 2IGMA 4GYIA 5FY0A 2LRDA 4LFAT 1FT9A 4B3RT 1I1SA 2P81A 2X1CA 3KPHA 2NVUB 5F0HA 3OYLA 3JADA 2Y8DA 1VF9A 1O7FA 3K3OA 4AQYT 3G6EI 1JE8A 4DNCA 1WJBA 2LSOA 2DT6A 2M30A 3M1EA 5KK1A 1J9IA 2IDOB 3F57A 2OAZA 4XR6A 3V5SA 2VKEA 4B48A 4Y7NJ 4HWHA 3GUDA 2DCEA 3ZSTA 1HS7A 3BR3A 2OTJI 3SXYA 2WBLA 3RPQA 5J47A 1EV7A 4I99C 2D45A 2CMPA 4A98A 3HJEA 3AEGA 4Y3OA 3E6MA 2LKGA 4DO0A 4XQFA 5LGTB 3AG3H 1A04A 3PJRA 2PMZN 3JRHA 2OV7A 1NHAA 2VL0A 1D0YA 5E1XA 3KZIC 3KYCB 1ZG1A 5K7FA 3AECA 3CQGB 3K69A 1U3EM 2XAGA 2L02A 2RC4A 1Y6IA 4PFPA 3FXRA 1JNZA 4EGYA 2A6HF 5J3LA 2A9UA 3AAIA 2Y31A 2EA2A 2ZSIB 4ZS2A 3CWZB 3OPCA 2KZGA 2GIZA 1J75A 4L5EA 3HKZA 3HKEE 2NW7A 1PUFB 4D1QA 2NVXJ 3BJ6A 5LHHA 4UF0A 3F31A 5J2UE 1RETA 5EGOB 5AQUB 1EH8A 3K70D 1X1CA 3K1MA 3C50A 3PM1A 4YEJA 4JI4T 1E17A 3S1RJ 2QA7A 4IOCF 2QYWA 4C9YA 3L3PA 3QPHA 2W85A 1UJ8A 2XSDC 1OCTC 4M3GA 1N36T 2V26A 3BCAA 3ANWB 3J80K 1JKOC 1OLTA 2Y9YA 2ZXHA 3FDYA 1ETXA 4U3CA 1B1BA 3ZLIA 4YJ2E 4YTNA 2X67A 4OYKA 3LSIA 2H94A 3AEAA 4X1IE 1HOMA 4HF0A 2KLQA 4BJMA 2XQ3A 1B4AA 3HB9A 3HL2A 2P5VA 2PFVA 5AQIB 4X1KE 4ETSA 1WJCA 3R4KA 2BBHA 1XCBA 4ZI3D 1H0MA 3HKBE 4CQIA 4ZZCA 5FLXK 5M5XJ 3LSPA 3T8OA 3A4CA 2E2IJ 4A56A 1UG0A 4WXDA 3ZQGA 1XCVA 4KMFA 1UCRA 3KBTA 2CQKA 3HEFA 2L9VA 3AG1H 3GO5A 4UUSB 4HSRA 1SUMB 3AE7A 4DR2T 1HBXG 5HXRA 3KP3A 3RCOA 4HWCA 3GZ5A 3QOPA 3KCCA 3QYBA 3CD6I 3CO6C 4D0PA 3PUQA 4L9IA 3K4KA 1LFPA 1T6SA 2PEXA 4IQJA 3WAJA 3WU2C 5AQPB 2V9VA 5AQLB 3ECOA 2L7MP 1SFKA 3UU3A 1K79A 3FZKB 4J01A 1LVKA 3BP8A 2BS4A 3S4UA 3ZYKA 2VT3A 4N4NB 2E5ZA 2CHOA 4KITB 2YU9J 1OEDB 4ZI7E 3ZYLA 3UU5A 2IS4A 1YX5A 3RQUA 1AKHB 4G2AA 2ZNYA 5LMNT 4JBWF 2WV0A 1NAFA 4Z2YA 2EZHA 2OZ6A 2YINA 3O1JA 1P9QC 2V9PA 5FVKA 1D8JA 2C5IT 4UXNA 4HNVA 3S32A 5IT9K 1I39A 5EF6A 4XOPA 1IN6A 2ETHA 1LUJB 3MKWB 1K78B 3DKWA 3BJOA 1QRYA 4CSWA 1H9GA 2E1MC 2LYCA 2W84A 2ZJQF 4WXHA 1GDTA 2IHR1 5JR9A 3K4LA 4IDNA 3FZVA 3OS0A 3EDUA 1SE7A 3B5MA 1SAUA 1WHUA 5F27A 4M1PA 3MCZA 1M7KA 2OQGA 4GXOA 2L4MA 5J0ZA 3WTVC 1YOVB 2K4BA 3GTKJ 5FY7A 1L0OC 1ON2A 2CSOA 4I02A 2CV1A 2BS3A 4HN9A 5AQHB 3QPLA 1SD5A 1TT5B 2JWTA 1BI1A 2VC1A 3TO6A 5ERIA 5HLGA 1SC7A 3LMMA 3BC8A 4YELA 4CGZA 4ILAA 5F64A 4I09A 1UGOA 4CN1A 2CS3A 5M4YA 1HCRA 1JTYA 3AA1B 2Q9QC 1R4MB 4G6QA 3QU3A 3QU6A 2VQCA 1HG2A 2P9BA 3ZCIA 1D1BA 2FJEA 1R5HA 4JOMA 2E5LT 4RB0A 1WJEA 3MZYA 5BMZA 5LJMA 1X2NA 4MFEA 4FQGA 4IE4A 3KVBA 2NVQJ 3I4NJ 3RYRA 3DLLF 3LK3B 2E9XB 1HG5A 5AQQB 4EJWA 4Q25A 2XF5A 3TOAA 2CQQA 3MKDA 5KNLA 2XAFA 3CUQA 3QB5A 5C2TA 5IY5H 2Y69H 1J0RA 1FOWA 1J7KA 4P9UA 4NHJA 2JUCA 4EV6A 3HOSA 2V1DB 1A6IA 1R49A 2ESHA 4KP3C 2XUEA 3MXZA 5L3BB 2TRTA 1WCRA 2L9RA 2XSJC 4M3EA 4LMJA 2WA0A 5HLTA 3BZKA 4I0UA 3KP4A 3LA3A 3CZ6A 4UVBA 1W09A 3UFEA 2B7EA 5FKOA 5L3GA 4JI6T 5C4XJ 5BOXA 1B7TA 1R8IA 1JT6A 3CCYA 3F9KA 4WYVA 3DXJF 1XPXA 1R00A 3LSJA 3V7RA 2EHOA 3FXDB 2I59A 2HQNA 2DDBA 2XSAA 4DVDA 2BZBA 1I94T 2HOTA 3BQIA 3C2HA 2EZKA 1TWCJ 2CXLA 1MIJA 4XKVA 5AQRB 3OYIA 5DCFA 5EEHA 3BT9A 4X20E 3C4XA 2FJ1A 4E70A 3N4MA 1CUNA 4KBMB 3KZZA 5JDHA 2Z99A 3WU1B 5K1YA 3OYFA 3FISA 4EAHA 5JH7E 4UV9B 5LGUB 1DU0A 2M7AA 3SZGA 3I56I 5CJ9A 4JI2T 3WTWC 4LMYA 4B09A 2JQQA 4HBLA 1F4KA 2R7DA 2L7KA 2KIFA 2XHKA 3BLYA 4CCNA 3PU3A 3PNVA 1TQMA 5CPRB 4YG2F 4HX8A 2XASA 3ERMA 2QEXI 4F93B 1MSFC 2VKVA 1KA8A 3DEWA 5B1BH 2R7VA 3ASNH 3K4NA 4OIRF 2CU7A 4IL9A 1HNWT 4KUMA 3VKHA 2CEAA 2BHZA 4IE0A 2X1EA 5HNFA 2ES0A 4RGUA 2XAJA 4A0XA 4A6DA 3GX4X 3CCSI 1YIJI 2A6TA 5LBQB 3SEZA 3K6GA 1PP8F 1L3LA 4BEHA 5ICEA 1IN8A 1WGXA 2EFOA 2UU9T 3ZXSA 1ETOA 4E7IA 2R7SA 4OIOF 3IHRA 2MC3A 3LAJA 1EF4A 3SFIA 1XD7A 5FKYA 2Z1DA 3O4XE 4G9YA 3L2UA 4A3FJ 4P0AA 4X1YE 3TDZC 1SA0E 1WH7A 1RUOA 2DODA 2M5WA 2CXFA 3PL8A 3AEDA 1EJ9A 1HFAA 3D0TA 3PFIA 5JDNA 4EEFG 1ZV4X 1SVOA 2WDRA 3H5RA 3HXLA 3MMYB 3HSFA 1JKRC 2VK9A 2I5UA 2J47A 1KU9A 4NC8A 4LMKA 3Q5EA 5CKTA 2CUEA 4HFBA 2C0SA 4CYCA 2M0MA 2X6OA 4DGWB 1E1HB 1SAXA 3RI4A 3C64A 5CGMA 5HYAA 1NH3A 5K5OA 2FMYA 2QBYA 1OR7C 4I50E 3JC6D 1XDOA 2HNHA 3LNQA 1VQ6I 2JJ7A 3RQ4A 1VTNC 1LRZA 1GUUA 4M6XA 1S5LC 5HODA 4RGRA 3SZTA 4IOAF 5LG3A 1RESA 5D8KB 2X68A 2DT5A 1YRNB 3TW7A 2FUPA 2VQHA 1PUFA 1JJ8C 1OMIA 3P5JA 2E35A 2HXIA 2EK5A 4XZCA 2HYJA 2LOOA 2JJ9A 2CYYA 2IEKA 2XDVA 4DV0T 1H89C 1Z0PA 4CA0A 1YS7A 3ABUA 1B59A 2LM2A 2DFIA 2K3PA 3G1OA 3RZOJ 1MNEA 3ZJ2A 1VCSA 3T1YT 1RR7A 1PJRA 4YIIA 2RQPA 2Q2EB 3T8RA 2RQQA 4KFCA 5EG0B 2V5DA 2J62A 4GGGA 1IBKT 2ECBA 3PNYA 2Z33A 3LFUA 2BVLA 2PMUA 2X9WA 1XTAA 3TBIA 1IJ5A 1YS6A 2WY2A 2ISYA 1FC3A 2L3DA 3M8FA 1HW2A 5EK2A 2WDQA 1ZKGA 1ZYRF 3J7AO 1OYIA 2Y0SN 4B4CA 4IPAA 2R6GF 3F8FA 1YJWI 4H63H 1ERDA 2A05A 3H92A 2LY2A 4Q47A 2I0MA 3FXEB 3CJQB 2Q0OA 4XKWA 2W24A 1CF7B 2OQRA 1BR1A 3H35A 1PDNC 4CZZA 4LF5T 1FSHA 4UF0B 5LHHB 4TV7A 4I0BA 3QRFF 1W5CC 2PI0A 2E19A 2DFFA 2K40A 2KRCA 3BR5A 5H6QA 1SANA 1X79A 2XROA 1TWFJ 1QQIA 2Y48A 3BWGA 3KIOA 3CK6A 3LK2B 2FOKA 3S2DJ 3R84B 3VDXA 1SFOJ 4EJTA 3H5AA 4UVCB 2G0EA 2RNGA 2Z5UA 4GYGA 4LGWA 5HDGA 1AOYA 4IJAA 1LPQA 2L9SA 4IE6A 4V1Av 4G63A 1WYCA 1YYVA 1LDJA 5AONA 1IBMT 5DTDA 2NS0A 2F5VA 1HDDC 2X9DA 2OCEA 3GXOA 2X0LB 2MW8A 2JA8J 3LG7A 4F52A 3GZ6A 1QPMA 3H9QA 3I54A 4AIJA 3W6VA 4IZZA 4IHXA 3CVRA 4C30A 1VOMA 3OYGA 4GO1A 5JI6A 5H6QB 3PU8A 2HPJA 2V79A 3BJAA 5DCMA 2PFBA 2CWOA 2KIMA 2BKNA 3RQIA 2EV0A 4UY8I 2W61A 3K3QC 3UT5E 3ONJA 3HA4A 4G94A 4U88A 4CICA 2FOWA 1I6HJ 2AE9A 2LLKA 3VB2A 5JFRA 3K4JA 2KINB 1YW0A 4F3QA 2JQKA 1AU7A 4AVPA 1QO0D 2IRFG 4NXMT 5HXSA 1YQ4A 5J1UA 3WGGA 5DM6F 1IDYA 2CGPA 1ITYA 5IYBJ 1OCZH 2HYGD 4ZYGA 4ITVA 4OAZA 3FHNA 2MPKA 2LBFB 3CC2I 3CLOA 4HWFA 1JKPC 2LE8A 1RC9A 4A6EA 1OEDA 3AAFA 3FK7A 4UVAA 2DWKA 5CA0E 3V7SA 1T38A 2GOMA 3AE9A 2E9XA 3Q0WA 2B0LA 2MLGA 3H3ZA 4QLCU 5LYJE 2J4GA 4O2AE 4ZI2D 3AKZA 1Y56A 1UAAA 3CUQB 3WHBA 2CMRA 2XAFB 3CKDA 3P4PA 5HEGA 2DMQA 2K9AA 3HKDE 3AE1A 3C18A 2JRKA 4WW0A 3ZMUA 4BBRJ 4EVIA 4O3MA 5H20A 2YK0A 5B3SH 4PGGA 3EYIA 4XMYA 2V6EA 1FZPB 4V2FA 5F04A 3QOFA 3KLNA 1MDMA 2QWWA 2JTVA 1RUNA 1Z7LA 4WNKA 3O3KA 2M87A 4LG0A 3RPUA 3PNTA 3GTLJ 5EK3A 2X6XA 4M6VA 4PUSA 2XQ7A 4ZDLA 3FBIB 2KT0A 5FO5A 2DOFA 2H1KA 4UV8B 4OMYA 1IN5A 4HWDA 1E7PA 1J1JA 4JX4A 1YD8G 1FMWA 4EXTA 4XBFB 1YLFA 3JRBA 2YU1A 2ZFWA 3GLLA 1JJ6C 3RLFF 1ULYA 1N75A 2PLYA 1WCMJ 1WRJA 2Y0MA 1DP3A 2W48A 3HOWJ 1SD7A 5E8GA 2JQ9A 4J00A 3BQLA 3IA3A 4BQAA 3MZ8A 1ETVA 4LG0B 4YTPA 5FXXA 3N5LA 3DCFA 1MZBA 4PFOA 2K3FA 4IDPA 2FSWA 3OWTA 4HOBA 1AHDP 1W0BA 4A0YA 4A3CJ 1IZNB 3IRRA 5LGTA 2HOSA 4KNYA 1I5ZA 3J7YJ 1BR4A 1YX3A 1YW7A 2F6CA 2HQRA 3ABKH 4MQVA 4Y17A 3U1KA 2WWYA 2LRLA 2E71A 3HL6A 2DA6A 3PJAA 4DR5T 5BQTA 1EA3A 1DDNA 1R5ID 2YOEA 2M8GX 4QPQA 3AVRA 1Y8RB 3M9AA 4CCLA 5E18F 3TEDA 2UXCT 5FLVA 5J8CA 1SFXA 2K9MA 2RPAA 3HG9A 4BS9A 4LLLA 3ZP5A 4H9OC 2EIJH 1IAPA 3EUAA 2Y6XA 4XLAA 2NNNA 3VODA 1BC7C 5JHFA 2DPUA 5IOZA 1XMQT 1Z3XA 3AG4H 2VBZA 1Y01A 2LHRA 4B3MT 1FNNA 3N9LA 5KAFC 4PW8A 2R5YB 1MDMB 2LSGA 3UUXB 3Q9VA 2A68F 3W2AA 4ESJA 1X58A 3B73A 3ZMTB 1S6LA 4L0ZB 1B8IB 3RPUD 4ISTA 3ESLA 1YHQI 4Q5SF 5DDGA 3TO9A 1QA6A 2J1DG 5L3DB 2BBYA 2DT7B 5LGNA 1A5JA 2LLYA 2DXIA 4QX7B 4WZXA 4GKJT 1WI9A 4C91A 3KX2A 2IS1A 1JNRA 1I6ZA 1TQIA 1ZLJA 2KRFA 3M07A 3SWHA 1X9BA 1IO2A 3B57A 3JAMZ 2IP2A 1UUSA 3EABA 4I55E 5JVDE 3W15B 1ZRFA 4B3XA 5HXHA 2F4MB 4DR3T 5D6FA 4ENNA 1HF8A 2XTLA 3OYEA 4O6JA 4HW0A 5E1WA 2L7ZA 2LHNA 3VSKA 3GN5A 5DQWA 4D5FA 3SQNA 3IL2A 5HOOA 4IDOA 1ZP0A 2V7FA 1JKQC 1OXZA 1ZGJA 2JIWA 4JV5T 2FBHA 3FF5A 3WE3A 1TWHJ 2JA7J 2CUFA 2O9LA 4S04A 2D1HA 3F0CA 2ZO4A 3E0ZA 4ILBA 5CVRA 1UB9A 2L9QA 2MABA 3F8NA 1YIOA 3JTHA 1VQKI 1MBEA 2RVCA 2DTZA 2VLAA 4IHYA 3UU4A 5J2TE 2D2WA 5DEQA 2YX7A 2BEOA 2K9QA 3P4SA 1EKEA 5FKLA 4DQ2A 3ZCOA 1YQAA 2YKSA 4ZI2C 2QQBA 4KIGA 3RJPA 1WWXA 5LHIA 2IA2A 3SEQA 2CE7A 3MACA 1JUSA 1FEXA 2PG4A 1IXRC 2P6SA 2VVSA 1UHMA 4IDZA 5J1GA 1BJZA 2LMDA 3W3CA 3J81K 4HF2A 5JVGF 2UUBT 2OZUA 5TJJA 1CQTA 1WR6A 1E2AA 4RB3C 2XAJB 1R7JA 2DMPA 3J9X1 3JSOA 1J2XA 5JRCA 3TLUA 4BQNA 4IREA 3DV8A 3CMAI 1YRNA 2VQFT 3ZQHA 3H37A 3BCBA 4KT6A 2LRKA 2BGCA 3I4MJ 5ABFA 3MKLA 2ZCWA 2PMZA 5GADJ 3T5XA 3I4PA 2OA5A 5LP6E 3LWFA 3FK6A 1YI2I 4QSHA 3GZNB 1MJBA 3B6CA 2E7WA 2CHNA 2JRMA 4Q48A 4RB2C 2QKMB 3ZQLA 1U8RA 3CMLA 1R1TA 4XKCA 2WMNA 2VXDA 2KJBA 4E4HA 4XRMA 1T8IA 2XQ8A 4YT0A 2K7LA 2VL8A 1RKTA 2NRAC 4O2BE 4RLFA 3CCEI 4ZOLE 4I43B 5FMNA 1P6RA 2GZWA 1D5YA 1AWCA 2HEOA 3KV9A 1XGMA 4NQWB 3M1CA 3F72A 2HH7A 1T98A 4ZC3A 1NK2P 2FD5A 2MD5A 4IHSA 1MIVA 2VBWA 4MBQA 3HOYJ 4N9IA 4YY3T 4MQ9F 2CV2A 5M5YJ 3E7LA 5EDNA 2X85A 1OWAA 2EHOC 2VT2A 2AO9A 4ZZBA 1U0JA 3OYZA 1JUMA 2BV6A 3D5SC 3GTOJ 1O7LA 3GCMA 5F1RA 2QRXA 5J40A 5JDMA 5FD5A 2FUG2 4D7MA 2V6XA 3UFGA 2M67A 3JSPA 4BQQA 1RPWA 2LM9A 3A01A 2H7VC 1FEWA 1X3UA 3SDBA 1KEYA 1R71A 4ZHQE 3GMIA 2ZSHB 2R7WA 3TLWA 4ZXLA 1YE9A 3CUOA 2NS8A 2YSRA 2A6EF 5DUIA 4ILUA 4XLHA 3CJNA 5FXVA 1V55H 1HDPA 1ZH5A 2HDCA 5AQNB 1VQ7I 3KFWX 2XGEA 3RC3A 3SJMA 5AQKB 3SFEA 4BH9A 4B3TT 2VPLA 1X3ZB 5BS6A 5JDQA 1Q1VA 4A5MA 3ABVA 3RHWA 3WODF 1BW5A 1EH7A 3DTKA 5D6EA 4EMSA 1XMOT 5L3CB 2VC0A 1HNZT 2F5DA 2RKHA 3E5QA 3WTZA 3HKCE 1HNXT 3H3AA 1ZELA 4OU0A 3M7GA 3RDIA 1APLC 4ISSA 1HR0T 2MH9A 5LOVE 1XDSA 1XMAA 4ENMA 2LREA 1RZ4A 1DGWY 5FP3A 4OX9T 3PQKA 3G3ZA 4N4OB 4ENKA 4XBFA 1LKXA 4IL6C 4S0HB 3JRIA 3AAAB 4CHUA 4NIQA 1Z6TA 2GLOA 3LSHA 4DV1T 4KMUX 2I10A 4OIPF 2FNPA 3Q0VA 3QAHA 1IRZA 3DF8A 3CMMA 4YLHA 3P50A 4N9HA 2ACXA 4DUZT 3VRBA 1Z7UA 2LF7A 3BG3A 2BG9A 2JMHA 2KWIB 1GV5A 3WTTC 2Y30A 3BG7A 1BBYA 2WBMA 2E5NA 4LIUA 4BL0B 3GFJA 4DZJA 3Q5FA 2IC6A 3L7WA 1BJAA 2HYFA 4EEDA 2HOAA 1F9NA 4HYEA 3H9GA 5GAEJ 3VU7H 1OEDE 3E6BA 2E34A 2FJAA 1T8BA 2PTFA 2LKSA 3CCRI 4C3JJ 3RZDJ 3UU8A 4DR4T 3RC8A 1HSJA 2ESNA 5ABGA 1IC8A 3RQWA 2KMUA 1KGSA 3U2RA 4MTEA 1UHWA 3G71I 2F5FA 2XRLA 2IGKA 2XUBA 2R5YA 4XN3A 3L2CA 4Z90A 2DI3A 5BPDA 4UEMA 1XN7A 4O4HE 1QVUA 3RIFA 4R79A 3G73A 4H9QC 3I5UA 4DV6T 3N9OA 2EFPA 2ELKA 3N9MA 4LJZF 1DU2A 4ZTFA 2K02A 2XM1A 3OOPA 3HOTA 4BEHB 1U9OA 2NVYJ 5L47A 4FTHA 1R22A 4LFBT 4KICA 2MA3A 2XAGB 4KI0F 3KYLA 1P7IA 3HC7A 5E79C 1I1GA 2XGCA 3EUHA 4NBQA 5KCMA 1O3RA 2JPCA 2FBWA 3EPZA 4U31A 2GXGA 4EEBA 1IN7A 4A0ZA 1T56A 2Q9QB 1I27A 2H27A 1MIYA 2N2NA 3P7IA 1IGNA 4LK1F 5IWAT 2O3FA 5DD4A 2OF7A 2XAUA 1OEDC 3DQVC 2DCFA 4RB1A 4CN4A 1UCUA 4A12A 4U2YA 4IGUA 2EIMH 2L0KA 3LAPA 1HLVA 4BXXJ 5LXTE 3GMEA 4G12A 2E60A 4B44A 2NOXA 2JPBA 3IAM2 3F6OA 3ERED 1E0EA 5BMVE 3DBHB 3HRUA 4CZCA 1LFUP 2V7MA 3RYFE 3A02A 3F8CA 3PSFA 2R3SA 2Q8KA 2WU2A 3PUYF 3T8TA 1S7AA 3IH4A 3Q9SA 4I4TE 4XSXF 2CRBA 3LFKA 3MFKA 4I01A 1KU7A 1FIOA 3RKGA 4KMCA 2HQ5A 1F43A 3ZT6A 4ZDOA 4DYRA 4ERRA 3NZQA 1FIPA 2ZKZA 4ESFA 3I59B 3ZQCA 3R61A 4WCGA 1FYKA 2V1UA 5DABA 1VFCA 1TP4A 1W1WE 4KIFA 4BE2A 1YJNI 1K61A 4CCJA 2ZC2A 1ZEEA 2QA4I 3DU5A 1W7PB 3MZKB 5H6RA 3V7CA 1SVLA 5F6FA 1QHGA 2HDWA 1HW5A 5DJQC 2FU4A 4RBOA 5F1JA 1JI8A 4CXFA 2EJRA 4MHGA 3S8PA 4AKGA 4NXNT 2PX9A 1T33A 1Z67A 4FASD 3RKWA 2PQ8A 2QVAA 5IYDJ 3BQZA 4HX4A 3K3NA 1EZ3A 2R7ZJ 4DMVA 3FM3A 4BA9A 2XV4S 3FX3A 2F4VT 2MOZA 4UUTA 3S3MA 1OYWA 4BJ5C 2HKXA 2WAFA 4AISA 3WTYC 2Q9QD 3L00A 3N2OA 1R58A 4XLCA 1VQMI 1JGSA 4TV9E 2KL4A 3VOEA 4HV5A 3RI5A 3A5XA 3TW6A 5DM7F 1KNRA 3KP7A 5D5WB 5CQGA 4X1EA 4XLPF 1E3PA 3I55I 1HTJF 5ABFB 3CPZA 1STZA 3M8JA 5HWYA 4NC6A 1MMDA 1YW8A 1QGPA 2RP4A 2X6WA 3TKYA 4I6ZA 2X9XA 2VIXA 3IRQA 2CUJA 2CXDA 2LJLA 2P5LC 3AAEB 3I1AA 1W0UA 2LKHA 2BKPA 3KINB 2VPRA 3NZPA 1N25A 5D4SA 2PG8A 4Z6YA 2DDAA 2EZIA 4WK8F 1Z91A 4MALA 3QODA 2W57A 2IS2A 4B1RA 1MMNA 4AD9A 4QTRA 1YJ9I 4L0YB 2JA2A 4II3A 1ORKA 3NQOA 4BDYA 4PK5A 3OBVE 3C3WA 4U33A 3L8RA 3KP2A 3ZYMA 3GBGA 4IRIA 5M3MJ 2HVQA 2ZNZA 4UB8C 2F2EA 2E8IA 3I71A 3G1MA 2LTPA 1W7PA 4G7OF 2M6BA 3MKZA 2R7OA 4HLXA 2X4HA 2QSHX 4AQGA 4LG3A 1YW9A 1JGGA 4H9SE 2DA3A 3PIOF 3ZGKA 1ZR2A 1IV8A 1BI0A 4PDKA 4CCKA 4X6AJ 1HKTA 2XAHA 2C6YA 1OCCH 4V19K 3PO2J 4CXYA 2IPQX 1MMSA 1NWMX 3K8PC 3S1MJ 4FX4A 2XPWA 1NENA 3GYHX 4U2ZA 2ZJ2A 2DYRH 1NG7A 4M71A 3SFZA 1JT0A 4X65T 3RYPA 1KNZA 3GTPJ 1FX7A 5DS9A 1O3QA 5JR9B 3OTOT 3PUWF 3DEEA 4HSTA 3AG2H 3DLAA 2H88A 2M1BA 2NAZA 3PFYA 3SDGA 3W2VA 5JVTA 4NUBA 3BPVA 5GPCA 2DQRA 3OS2A 4EJOA 3AA0B 5D5UB 1W0TA 1X1DA 3OYDA 1XG1A 3CF5F 1P2FA 2Q1ZB 2RDPA 3IP4B 1IN4A 5E8IA 2EILH 1F36A 2AS5F 1MBKA 2O6GE 2DI4A 3DPLC 3RIRA 4KN4X 1KYWA 3ZQIA 3K2ZA 3LBXA 3FKIJ 3TKLB 3P9CA 4ZYHA 3JRCA 1IBLT 1JXSA 2UXDT 3GEZA 2ELHA 5AQVB 2P5KA 3LSTA 3LSMA 2QQ9A 1L0VA 4EIWA 1ZREA 3Q5XA 4P1NA 5TGTA 3Q2MA 4HQMA 4BJNA 3SRZA 4XM3A 4UVBB 3LSGA 2H6BA 2NXNB 4TNWA 4X62T 2QYOA 2V9KA 4OINF 5KHDA 4YIRX 4BACA 2QENA 4HA8A 2P7VB 4U87A 1VQLI 5EJCA 1YKHB 1J09A 3OL4A 1U5TA 1XMKA 2XPUA 4P96A 1NK3P 1R23A 1K7AA 5BPIA 5IP6A 2N8GA 2JVGA 1VQ5I 2HGCA 3WTSC 3DJBA 2VJ5A 4F6RC 3U1DA 2QKLB 1LE8B 3VRAA 2HXOA 1S8NA 4GRIA 4LB5A 5GTHC 1Y0UA 2CPTA 2R7TA 3C2GA 4CN6A 1P92A 4ZYAA 5LD2C 1BC8C 3K4MA 4A3JJ 1DUXC 2IXSA 3AB3B 5LEJA 4BHCA 1RRJA 3FMQA 4DYQA 2GQQA 3E5XA 3N05A 1X1PA 3S93A 2DMUA 2HS5A 2EFWA 1G3YA 1TBXA 3BR1A 2W00A 3GWZA 4H9RC 3TLSA 5AIQA 3ABMH 2DMTA 3HGYA 3JW4A 3MD2A 5LNKA 1MH4A 1UHSA 5GPAA 2IT0A 3L2RA 3S2WA 4HLYA 2RREA 1UFMA 3H9JA 4OFZA 3I9YA 3RIAA 1ZN2A 1LVAA 5FGMA 1K6OA 4XOTA 3OYKA 2ZJPF 1F1ZA 2R7FA 1MBHA 4JQFA 3ASOH 5HS9A 2UXNB 4L0RA 3GFLA 5JQGE 2VI6A 4NNJA 4JX6A 3PURA 1W4MA 3ZN1B 2HTSA 2ECCA 2IUBA 3O6BB 2KNDA 3V8JA 4Y4RA 3ZQQA 3JREA 5E17F 1V54H 2UUZA 2EV6A 3WI3A 4XN0A 3CC7I 2AQEA 2J5OA 2KSRA 1PYVA 2TDXA 4R1HA 2IW5A 3V4GA 2EFQA 3PIPF 2JA5J 4TWFA 4P9FA 4EM2A 1FSEA 4GYRA 2HU9A 3BTIA 2E2JJ 1KNPA 2LVSA 3FXLA 3JC6C 4LF8T 5JDLA 2VE9A 3CMYA 3JCFA 5LJNA 2PMHA 5HLIA 2W63A 1BI3A 1LQ1A 2W2UA 4DUYT 4CXXA 3AXJB 1U9NA 2EH3A 1W36D 2RV8A 1ZHCA 4KN7X 1MIWA 2MBFA 4RAZA 1TQPA 6PAXA 1VQOI 4ZH4F 4NPPA 4UUSA 1RI7A 2O03A 1FTZA 1P7JA 2KQRA 4J19A 3BG5A 2XRNA 5CVJA 5CJ5A 2CH0A 2H09A 2IA1A 2KDZA 1K83J 2EBIA 4CYDA 2R5ZB 3HR0A 3ZC0A 4HFEA 4ZEYA 3LL7A 1B8IA 2VJIA 4WX9A 4XLEA 4KT5C 2VXZA 2MD0A 1QVTA 2JMKA 2Z6EA 3DU6A 2E1OA 3OR1C 2MFZA 2CQ7A 2LOPA 1X4OA 1A36A 1QZYA 4OWRB 3K0LA 1Z21A 4AIKA 2WMOA 3LDQB 3G1LA 2B63J 4ZZLA 4MLOA 1R1UA 4QPOA 1FYLA 2DPDA 4QWNB 4QWQA 1S35A 4ZYDA 2ZMEC 4TNVA 5GAHJ 5ED4A 5JREA 3OYHA 1MJAA 4ILCA 2KIUA 5AQOB 3ZRGA 1ZRCA 4HGAA 3NRXA 5LG4A 2XAQA 1FBUA 5HEOA 4AIDA 4CI2B 3GVAA 3ONLC 4IHJE 2R0QC 4U7BA 4AKIA 1LJ9A 4BDZA 4OHFA 4FETA 3A01B 2VN2A 1XNQT 4LIVA 1ZAOA 1GHCA 2DJIA 3KEOA 4MIMA 4HX7A 3F22A 2JQHA 1IRGA 4QXCB 1G3WA 4P0BA 2KWHA 4IE7A 3LQRA 3GF2A 2XM2A 3OYAA 3FXOA 1CF7A 3HDDA 3ZOBA 4Z91A 5J4YA 2G7HA 2JVHA 2WAQA 2FXAA 2VE8A 3CO7C 1SEUA 3P9IA 4AC0A 3R6NA 3WGHA 2K24A 4JYAT 3PUFA 1QUUA 3PJAJ 3H0GJ 5FRNA 4UNOA 2LSYA 4NUVA 1D1AA 2PBIA 4DV2T 5HEJA 5L3EB 2DA2A 2MAWA 2JZYA 2YUSA 4FX0A 4EJVA 5J6XA 4IRHA 1XX5A 3IC7A 4E7KA 1CHUA 4IDQA 1OYYA 3U3IA 4LF9T 1E3HA 2B9SA 3CCMI 4MTDA 1FOXA 3ZCJA 3AL0B 4O4IE 4BE1A 3LSKA 5C3EJ 1Y1WJ 2FEZA 3CX8B 5LHGB 1NTCA 4HRIA 2NVTJ 3JTGA 1YTYA 1WSUA 3ZSSA 2DLLA 1ZKEA 2YU3A 2FBKA 4JBAA 3I9WA 4JI8T 3RH3A 3N2GE 2L8KA 5ABHA 4FHTA 1XGNA 3L09A 1B72A 3AFHA 3HYIA 1HXDA 4IHTA 2BG9C 3ZMZB 2EWNA 3DPTA 1XMXA 1N78A 3JCUC 1YQ3A 2WU5A 4PK6A 3O1HA 2JA6J 3RGLA 2JPFA 4KDPA 4DR7T 1RKWA 1H88C 2HDDA 3VWBA 3T0YA 4I76A 2O61A 4B3ST 4TWHA 1BR2A 1W7PD 1WKMA 4QH5A 5JRCB 4NUUA 2HR3A 3QYFA 3IF8B 1UELB 2KKOA 2BOLA 2D0TA 4MEYF 3Q0UA 3UTKA 4NQWA 5ILVA 1SMTA 2VOPA 1Z1DA 2IVMA 3P7NA 2DK8A 1MNDA 3JRGA 2ZXWH 4RMNA 2W66A 3QUJA 1XSVA 5DUKA 2LSIA 1AJ3A 2ZM2A 5AQSB 2V1NA 1J5ET 9ANTA 1ON1A 5LLQA 2V7LA 4KHPT 1R5GA 3HUGB 4UB6C 2R7RA 2IGNA 4HKAA 1MBJA 1FWZA 4V2GA 2A5WA 2OPTA 4L9TA 2XJ7A 1KYZA 2KDOA 3VYUB 4K0KT 1G73A 5KMGP 3QYEA 1N33T 1ETWA 4KA4A 3S1NJ 2GXAA 2WM9A 3UNGC 1HW1A 3OOUA 1UZCA 1LFBA 4NDLA 3OYNA 1W9RA 2E2AA 2XY8B 4EV0A 3FBZA 3RIUC 2KMFA 2A5YB 3M65A 2A72A 2E9XD 2VKDA 3MA9A 4F8HA 1USSA 2KJCA 5KAIC 5JLXA 3VSLA 1B9NA 3W2WA 2DWGA 2Y9ZA 2KIQA 2KLOA 1YITI 2IW5B 4ZYEA 4LOCA 5E1ZB 2COBA 1WR0A 3CP8A 1IZ1A 1MW7A 3C2BA 3RKOA 3IWZA 1OFCX 4FISA 2VQGA 3SYTA 5IOYA 1O4XA 3E22E 3P4RA 1IF1A 3R0AA 1WYBA 1ZRDA 4CXWA 2XC7A 1D0ZA 2PJPA 4GK0E 2R92J 4COFA 2FA5A 1R4NB 1TL8A 5FRMA 2FQ4A 4RGSA 4XK4A 1V3FA 3F8MA 4E6KG 2MYSA 1IAWA 4LD5A 1FLIA 1WLXA 2CFXA 5FL1A 5FY1A 4XICA 5JR9C 5CB4E 4HDVA 4XIDA 1GVDA 4XSZF 2P4WA 2QF7A 2WADA 3N9QA 2RNJA 4KIBA 3ETUA 4M74A 4W97A 1LVFA 2JSPA 4X0GA 2WB1N 2GM4A 3ZMUB 5IP7J 4A3BJ 3S17J 2WB5A 5L3BA 3TDUC 4GIWA 1FY7A 3HRSA 4M3FA 1XGSA 3HOXJ 1T08B 4EB6E 2L5QA 4JX5A 5DV5A 3RKQA 1HX1B 1KZHA 3E5UA 1HSTA 4HAMA 5F08A 1FOKA 5ILUA 3M3ZB 2BBJA 1IUFA 3I58A 4XONA 1UX4A 2XHEB 2ODUA 1S3JA 2IA0A 5CVVA 5D4RA 1ZG5A 4LF6T 2YR2A 1WPKA 2LKXA 3E6DA 3L9FA 4ZTJA 3H1CA 1WJAA 4G8XA 4PJLA 3BROA 4ZI3C 3ZN1A 3KP6A 4ZZDA 2LC2A 4JK1X 5KDMC 2VKOA 3A0HC 3CUQC 3U21A 3VYTB 1VQNI 1U6GA 2KXPB 4ESBA 2YDRA 2ELJA 2BZTA 1S7EA 3NWTA 4BXUA 2NTYA 3HHGA 3AXJA 2X1DA 2VJ4A 5EGOA 2VVNA 1O3SA 2GWRA 5D5VB 4IX7A 2MTQA 2WC2A 2L3LA 2GAUA 1XNRT 3ULQB 1FIAA 2XSBA 5EYRA 4F92B 3H5NA 1MMGA 4RM3A 2YPRA 4E7JA 4H63V 4JUYA 4LLNA 5J4VA 3QNUA 2QBYB 4MFDA 4BXFA 5C8YE 2KHMA 3BOQA 3L39A 4UHTA 1KK7A 1IUYA 5IYCJ 4YIFA 2CWEA 1E3OC 4JI5T 1USTA 3F2EA 4DV7T 2NOGA 3LA7A 2M9HA 3ISPA 1UMQA 3IV5A 1HA8A 3IHUA 1TC3C 4C90A 4BY7J 1Q1HA 2NTXA 3BG9A 3FBLA 4QKNA 2DFEA 2LKPA 2VBXA 1YFHA 1K78A 1DP7P 2J5PA 4PSXA 1LDKB 4EGWA 3EUKL 2WTEA 5E20A 5HVQC 5L3CA 3B02A 4HV6A 1U8BA 3V5UA 3VR9A 2K9NA 3CCQI 1QZEA 4IEJA 2KP6A 2ICWG 3BK9A 4C2UA 4EQQA 4J2CA 1GXPA 1NG6A 5K5RA 1T2KA 2M4GA 2Q2EA 1UURA 3KV4A 5C3JA 5IYZE 5TISC 4HNUA 3ZMSA 3BDDA 5GAGJ 2X48A 3U9GA 2P6TA 5GTIC 1WI3A 4AKRB 1G3TA 4FCYA 5L2LA 4HE8A 1FJGT 5BNGA 3OIOA 1KFYA 3PUXF 3HPHA 2L01A 2W82A 3ZT7A 1XSXA 3IKVA 4L5GA 4LMLA 2CW8A 4S05A 5HEUA 1XS9A 1UG2A 3ONQA 4I98B 3CESA 3JAMK 4GFBA 4L9VA 1NEKA 4UUVA 4L5IA 2QGSA 4RAYA 1ZGWA 3I64A 5CQEA 3J80Z 1G59A 2CM0A 1S9HA 4M9XA 2LG4A 1Y64B 2WCAA 2CQNA 1IW7F 2GA2A 3E3VA 3N9NA 1K4TA 3UUNA 4EOZB 5DCMB 4FJOA 3Q5DA 5FD6A 1TZLA 3GW2A 3KEYA 2I8DA 3ELKA 1V5GA 4JP0A 4IQ4A 3F23A 2DHRA 4O4JE 3ZMSB 5B66C 3AE3A 3KVAA 1Z05A 3HSRA 3EQLF 4OMZA 4CYCB 4KISA 4KX6A 5FLXZ 2V1DA 1OJLA 1WQ2A 3NVOA 3K2AA 3H3UA 5LHGA 5HS7A 2QUFA 2E7XA 2R4GA 2C5KT 1T72A 1FMVA 1MGTA 2DA1A 2EV5A 1ZQ3P 2H6CA 4C2TA 4XRSA 1X1AA 3AVSA 5FLMJ 1PVEA 2G9WA 3LSRA 2IBDA 3CCUI 4BJ6C 5DYMA 3GTQJ 2W25A 4BUPA 2BXYA 2N1GA 2WP9A 3ZN0A 2GXBA 2PN6A 3OMYA 1Z8UA 4PK4A 5AIPA 2NW8A 1V9DA 2R7UA 2LFBA 1D3YA 3ROUA 3GFIA 1U5TC 4RA2A 1G4DA 2M8EA 2HOEA 2QZ8A 4IL4A 3L2QA 1U2WA 2OTLI 2FJBA 2DA5A 2OBPA 4CH7A 4WXCA 2HPLA 1TW3A 2DW4A 4GOUA 2O7OA 5LBMA 4L9NA 5M3FJ 4TUYE 2RA1A 3E97A 2MLKA 4IKFA 3PQJA 4A3GJ 3D5LA 4EJUA 5FYMA 2LK2A 2P0WA 2M45A 4L18B 2ZJRF 2BHYA 3X1DA 5KXJA 5L4EA 3W6KB 2Y75A 1GLNA 3DKYA 2X51A 3K9TA 2E9XC 1LE8A 1BIAA 3L1PA 3EYYA 3K1SA 4BE0A 4DNDA 4EATA 2VWAA 5A2QK 1X4PA 5CVUA 4IIJE 2W1OA 2LNBA 2L54A 4Y15A 4P55A 4UVAB 4U72A 5JDGA 4LF4T 2E1MB 3I53A 1HKSA 3ZJ1A 1BA5A 4LITA 3HTSB 2G7UA 3RX6A 2EHOB 4AM3A 2A3DA 4G7ZF 2ZM6T 2LR8A 2XPVA 3I0TA 3CP2A 4R8HA 1VNDA 3S3NA 5FXWA 3VHLA 2M34A 5EEGA 5EZYE 2VUMJ 4AVZA 2K86A 3DTIA 3FMRA 3OYBA 4N78D 3HTUA 3KLOA 2VQET 3HI2A 2DYSH 1ETYA 1WJFA 3NAUA 4GYSA 3UUMA 4RAGA 3UQ4A 2WWUA 3DBLB 2X0HA 5AQFB 4TX5A 4AIHA 1AKHA 4JLEA 4DIDB 5HNHA 4C3HJ 4ENJA 2WWVA 4A3LJ 1HX8A 3CF2A 2K4JA 2Z2SB 3ECHA 1OKRA 3IEEA 3SZPA 1VQ9I 3O8HA 2W67A 2BY3A 1XSDA 2ZB9A 2FMLA 2DAOA 3E1SA 2OC6A 3FHZA 3FIWA 1U4QA 3J81Z 3SS1A 2RGVA 1Z6RA 2MSYA 3JRFA 4A69C 3RKYA 3K10A 2OLTA 1US7B 3ZMVB 4DV3T 2EB7A 1IJWC 4A3IJ 2EINH 2HTJA 1N34T 3K1PA 2V1XA 3BR2A 4A3MJ 1U78A 3BR0A 2Y48B 2K9SA 4LFUA 4MGRA 3Q3SA 3BR6A 3ZMZA 4H9NC 3OYXA 5CLSA 5E3LA 1RNLA 3DKXA 4XRSG 1UX5A 1VCTA 1TT0A 2IIUA 4TZ4C 1ZOYA 4XORA 4DZPA 4Y13A 3H0DA 1FJLA 3L2VA 4CI3B 2WV1A 3CQZJ 4AU7A 4CO8A 5L3FA 3WTXC 2FE3A 4ON0A 3CCLI 4XLNF 1DU6A 3GN5B 3TQNA 3HGGA 1J5WA 2ZXJA 3S3OA 4NC7A 3OR2C 4RLQA 1G3SA 2EHOD 3TLVA 3GTMJ 3ZN0B 2HKOA 3ZQFA 3R60A 4LFCT 5FFZA 4Y33A 4BQOA 3AEBA 5DD8A 2XB5A 1G8XA 1MBGA 2PJQA 5C44J 3JRAA 2VODA 3RRCA 4E7SA 3PUZF 3HPGA 4M72A 1ZK8A 5CVIA 2GA1A 3D0SA 2XQ6A 3FZFB 5H6RB 1Y1VJ 3OYMA 1H9TA 2CO5A 4M9ZA 1ODDA 5DQVA 1T0FC 4PJ0C 3LSVA 2VASA 2HWVA 4DOZA 2HN1A 3O2PE 3CTAA 1KQ0A 2K9LA 2YX4A 4AYBA 3EHZA 4PJJA 1JTXA 5LGNB 3VYRB 1XDUA 3M3YJ 3JR9A 3FXUA 1XGOA 2V5CA 2DTRA 5LRSA 1LNWA 1XB4A 1O3XA 5GONE 4A3KJ 1R1VA 2F4OB 1TNSA 2E36A 2ID6A 2YS9A 2WY7Q 4ANJA 1VRBA 1REPC 3TLTA 3Q5WA 4HFDA 3MN2A 1ZARA 3DTEA 2CG4A 4AKHA 2XAHB 5EZGA 2H8RA 1P4AA 3LFMA 1ZGAA 4YTMA 2M7BA 1IG7A 2NS7A 3MAJA 4EGZA 3QWLA 2X9HA 3MWMA 3G4SI 1IV6A 3A2KA 2IGOA 2XIGA 2LH9A 3SHFA 2ZM8A 5LMUT 2DMNA 3F8BA 2EA4A 2UV1A 1LEBA 4ASKA 2FF4A 2MC4A 4OAYA 2R93J 3PV0F 3FKJA 1IXCA 1SFUA 2PJRA 5K5QA 4U0VA 2XGXA 4CCOA 4DV5T 2LT3A 3I0QA 5E3NA 2NNYA 4FI5A 4U7IA 5FL0A 1Y0NA 1S7OA 3NEUA 3SOLA 3JAEA 4YJ3E 1OISA 2D1VA 2JMWA 2LOSA 4HFVA 2LEHA 1OCOH 3UKGA 4JI0T 5E3OA 4OYJA 1LDDA 2H89A 2FQ3A 2CFOA 4DYCA 4YFKF 1YO5C 2DLRA 1TWGJ 3WE2A 4BU2A 1D8KA 3HOVJ 2CBJA 4U0YA 5LBQA 2V6YB 3PUSA 2XPKA 4UELA 1N32T 2HPIA 4UVCA 3P4WA 5CFBA 3S1QJ 2YDSA 3GWHA 5HEHA 2E1NA 5D5XB 3BTLA 1MKMA 3DFGA 1A6QA 1P4WA 2DK5A 4IF4A 4KYWA 3CIRA 4TV8E 3PTRB 1ETKA 2HVSA 3DEUA 5TAOA 2CA5A 2GBYA 1VQ8I 3QQAA 3KE2A 4YRVA 2VKJA 4HFIA 2UUCT 3K4BA 3OYCA 3P9KA 5FXZA 3MKYB 1SVMA 2QGUA 2CW7A 2Y2ZA 4RM2A 3DTOA 3PUAA 1SD4A 1ACIA 5HXEA 2DU9A 3FZMB 1N77A 2P8TA 2WB1A 1JUPA 5J1YA 1HKQA 2HFHA 4DJAA 3ZMDA 5M5WJ 2ODVA 2VQLA 1PUEE 4PJMA 2YU2A 2ZMAA 4BGDA 4CUGA 4A5XA 3F21A 3RRWA 3R0JA 3IKTA 3E6CC 1FPQA 2DL1A 4GKKT 1TWAJ 2QVOA 1KQ8A 2STWA 3OIPA 1VI0A 5JDFA 2O8XA 2LBFA 3EDPA 1QHHD 3PUVF 2VB6A 5EK4A 1FOYA 2L9NA 2MG4A 1LB2A 5LA6E 1IXSB 1O3TA 2V8SV 4PGHA 3HKZN 1FYMA 3A0BC 3QC9A 1XZYA 5B5EC 3ZMVA 2HQAA 1KF6A 4UR9A 1X2MA 5CA1E 4BAYA 1DQUA 2V6CA 4AXPA 1V5EA 4IHWA 1JHFA 5LHIB 1GVJA 1GQEA 2STTA 4JI3T 3H3MA 2ID3A 4UXNB 3EI0A 1BOBA 3IH3A 4AKLA 1DGRM 4HWIB 1I50J 1X3WB 4H4KC 2HI3A 4X66T 1WRDA 2D9DA 3CMEI 2X66A 4LLGF 2UXNA 1OPCA 2ZM0A 2LF8A 5JTGA 3FB2A 1MJ9A 3UUBA 1BOAA 2MGQA 4XAXB 2H3RA 2BVMA 2W4SA 1SFEA 3BZ6A 2JSCA 4IRGA 4EZHA 3P8CD 2DFHA 3MK7C 5FB2A 5JLWA 4MFRA 3V42A 4LB6B 4OIQF 3CQXC 1RR8C 2CQXA 3AEEA 2JN6A 3OKQA 1FBQA 4IXAA 4CI1B 4E7LA 1OCPA 5JHUA 4G7HF 4G6TB 1E2XA 2MBGA 2CRGA 4DIQA 1K6YA 3CCJI 4DV4T 3T1HT 2JUGA 2KFDA 4BBSJ 4HG2A 3J7Yq 2OA4A 2VOOA 3UU6A 3TP3A 3EETA 2XF6A 3AE2A 5J8FA 4ZJZA 1Z0XA 1WVRA 2N9DA 2AXTC 1R6RA 4IVNA 1M1EB 3HUGA 3OV8A 3TP0A 3VEPA 5FNVE 1I3QJ 2A07F 5BR8T 2XB0X 3A03A 4AQFC 4HZFA 3QPTA 3W6JB 1SMYF 3S15J 1QLBA 1I6XA 3KDSE 3R6SA 2IAIA 2L4AA 2CCQA 3NKZA 4HEA2 2NOJB 2NYXA 4CZZB 2TCTA 2D5UA 1S29A 3HRTA 4EM0B 4P09A 2XQAA 3V8KA 3WHCA 1X1BA 3K4CA 2Z9OA 1DPRA 4D7NA 3NWIA 1T0FA 2M0CA 2CUZA 3ZQ7A 1HF0A 4U7DA 2R7XA 2FBIA 3LJCA 4YSYA 4K2EA 1WH5A 4F55A 2D0UA 4BHBA 3O8GA 4NB5A 4YHJA 5HXCA 2M2EA 3CCVI 2ADUA 2F5EA 3D5RC 4D9JA 3FXMA 4DMWA 2QCOA 2K27A 5ETWA 1BI2A 4GK5E 2RAEA 2ZMEA 5IPAA 2LD5A 3D1NI 2K48A 1T95A 1T39A 4JI1T 2D2SA 2HPMA 3QOEA 3JRDA 3FBNB 3KP5A 2YEVC 1BW6A 1ZG3A 3KV6A 4FE4A 5AQGB 1W5SA 4HPQA 3DWLE 3S2HJ 4E7HA 3N2KE 3C1DA 4B43A 3WGIA 3L2WA 3AE4A 3K70C 5TRDA 1J5YA 2GOXB 1TLHB 1BN5A 2NW9A 2F5CA 2L2OA 3F6VA 2GK9A 2WZHA 4N0BA 1D5VA
chains in the Genus database with same CATH topology
4M73A 2DQLA 1LEAA 1TNTA 4MNUA 3U78A 5ADXL 4OK0A 4PNIA 4EYYR 4H9PC 2CWYA 2WAUA 4JEUB 4QXHB 4O4LE 4JEHB 1ZLKA 2BYVE 5LCYA 3LBXB 1C0WA 2Z3YA 2UZKA 3LA2A 3PE0A 2QQAA 2VBYA 5HAXA 3V8LA 4I2OA 5CYVA 3UULA 1R36A 3ETVA 4UIGA 3LQQA 4DBRA 4U0WA 2QLZA 1KU3A 3KETA 4CDGA 2IJLA 4F7ZA 4UNOA 1D1CA 2H7OA 2O0YA 3AA7B 3J9X1 5A2QZ 3GFMA 5ICGA 2Q9QA 3VKGA 3BPXA 3TOBA 1MD0A 5IT9Z 4HQEA 3KZYA 3M8EA 5HLHA 5LEKA 3WG9A 3FM5A 3HSEA 3I0OA 4RGXA 2LDUA 5KX5E 4YFSA 1O57A 4KUMB 1PP7U 3NRVA 3WU0A 3T1BA 4WBOA 2RN7A 2K5BB 2UXXA 2IAKA 3OJAA 1KQ9A 3TO7A 3FXQA 4GCVA 3QK6A 4OOIA 4A5NA 3HIFA 4EM1A 2BE5F 1ONVA 4DBQA 3KEQA 4UV9A 1IRFA 5LGUA 3B13A 4XRFA 3RYHE 2AXLA 4ASNA 2UWMA 4PAGA 2SPCA 1DPUA 2IC9A 4EZ4A 2EFNA 4WBNE 4RS8A 3NRYA 4O5VA 1IJ6A 3I59A 5HDNA 2W0GA 4K0UA 4BNCA 1KU2A 3O1IA 3CX7B 2BDEA 1B6AA 4I7HA 5IHYA 1J59A 3COAC 2A3SA 3C4ZA 4L9JA 1H7CA 3RTRA 2GIVA 5HS8A 5ICFA 2W62A 2X9YA 3ANWA 4ADZA 2DNXA 2P7CB 3HHHA 3PDYA 1ZHFA 2NWBA 2V7KA 3IWFA 5F3JA 3ZC1A 4P5OA 2JT1A 2ZMEB 5FFXA 4HDUA 1BIBA 4U74A 4M9SA 5E0OA 2CLYB 3FMSA 1YKEB 3RYIE 2OD5A 1TTYA 4HTEA 1B9MA 3MEXA 2VKHA 3RYCE 4A2UA 3NBXX 2XAQB 2HZTA 5HDKA 3C4WA 3ZEFB 4H0EA 4MHCA 3HRMA 4PCQA 3WTUC 1FP1D 5ICCA 3FWEA 5A1LA 5JR3A 3ZPLA 4G6DA 2FNAA 2QM3A 2JRTA 3GA8A 2MH2A 4QXBB 2ACJA 5L3DA 3KV5A 1Z9CA 3LK42 3AA6B 1W5TA 2COMA 1JHHA 2VONA 4LK0F 5LRRA 3MJXA 1BR0A 4PZJA 1FBSA 5IT3A 3F3XA 1P4XA 3K1NA 3QP6A 3N97A 1YG2A 5KVRA 4AWXB 1QZZA 3BY6A 3MQ0A 4HEAA 5HWXA 1FP2A 1U5PA 3EDVA 1QSDA 3C98B 2FRHA 3CX6B 4BAYB 3ABTA 4PJNA 3ML6A 4UV8A 4AI6A 4B8XA 1RIOH 1MMAA 4E7ZA 4MLKA 4IE5A 1EH6A 1BM9A 4BYYA 3Q9DA 2ZLYA 1V4RA 4BHPA 3BQKA 3KBUA 2C5JA 2WSSV 4L5JA 5D8LB 2XQYA 4TN7B 4MEXF 1HQCA 1SD6A 2E1CA 3REOA 4WWCA 2X0LA 5L3EA 4M6YA 3DP7A 1HCIA 4O8SA 2CW0F 3N9PA 1OR7A 4QX8B 4Z8XA 1GXQA 2V7JA 5L3FB 2OU2A 2XASB 2KT9A 2A61A 5F8PA 1SHZC 2A2FX 2ZBKA 1U5TB 3WAKA 3IBPA 3CDHA 4EYUA 4YFXF 2XVCA 2XKPA 2LSJA 1F5TA 2A69F 2B1EA 3C7JA 5AFUL 5ILSA 1QNTA 2ISZA 3O9XA 1S94A 2CLYC 4QHOA 3GLXA 1D0XA 3C51A 3ZMTA 4WF2A 1TW2A 4AQFA 4ZS3A 4FT8A 3TGNA 3VFZA 3MZHA 2KZ7B 2V7IA 2UXXB 4HF1A 3QP5A 4B6XA 2NP9A 3CQCB 2DBBA 1CGPA 3RKXA 3ONXA 1G6NA 4YFNF 2XKOA 2DO7A 4I0AA 4Q4ZF 2G0UA 3E08A 3PUGA 3EVYA 1QBJA 2LSKA 3ZPOA 4GYIA 5FY0A 1FT9A 1I1SA 2Y8DA 1O7FA 3K3OA 1JE8A 4DNCA 2LSOA 2M30A 5KK1A 1J9IA 3M1EA 3F57A 2OAZA 3V5SA 3GUDA 1HS7A 3SXYA 2WBLA 3RPQA 1EV7A 2D45A 4DO0A 3E6MA 5LGTB 1A04A 1NHAA 1D0YA 5E1XA 1ZG1A 3CQGB 3K69A 1U3EM 2L02A 2RC4A 2XAGA 4PFPA 3FXRA 4EGYA 2A6HF 3AAIA 2EA2A 4ZS2A 3CWZB 1J75A 3HKEE 2NW7A 3BJ6A 5LHHA 4UF0A 3F31A 5J2UE 1EH8A 3K1MA 3C50A 1E17A 2QA7A 3L3PA 3QPHA 2W85A 2V26A 3ANWB 3J80K 3ZLIA 1B1BA 4YJ2E 2X67A 4OYKA 4X1IE 2H94A 4BJMA 4HF0A 2KLQA 1B4AA 2P5VA 2PFVA 4X1KE 4ETSA 3R4KA 1XCBA 4ZI3D 1H0MA 3HKBE 4CQIA 5FLXK 3T8OA 4A56A 4WXDA 1XCVA 4KMFA 1UCRA 3KBTA 2CQKA 3GO5A 1HBXG 5HXRA 3KP3A 3GZ5A 3QOPA 3KCCA 3CO6C 4D0PA 3PUQA 4L9IA 1T6SA 2PEXA 3WAJA 2V9VA 3ECOA 1K79A 3BP8A 1LVKA 3ZYKA 3S4UA 2VT3A 4ZI7E 3ZYLA 4G2AA 2ZNYA 2WV0A 1NAFA 4Z2YA 2OZ6A 2YINA 3O1JA 1D8JA 2C5IT 4UXNA 5IT9K 1IN6A 2ETHA 1K78B 3BJOA 3DKWA 1H9GA 2W84A 4WXHA 5JR9A 3FZVA 3EDUA 4M1PA 3MCZA 2OQGA 4GXOA 2L4MA 3WTVC 2K4BA 5FY7A 1L0OC 1ON2A 2CSOA 4I02A 4HN9A 1SD5A 5HLGA 1BI1A 2VC1A 5ERIA 3TO6A 4CGZA 5M4YA 5F64A 4I09A 3AA1B 2Q9QC 4G6QA 3QU3A 3QU6A 2P9BA 1HG2A 3ZCIA 1D1BA 1R5HA 4RB0A 3MZYA 5BMZA 5LJMA 4IE4A 3KVBA 3RYRA 3LK3B 2E9XB 1HG5A 4EJWA 3TOAA 3MKDA 2XAFA 3CUQA 1J0RA 1J7KA 4P9UA 4NHJA 3HOSA 2V1DB 2ESHA 4KP3C 2XUEA 3MXZA 5L3BB 3KP4A 3LA3A 4UVBA 3UFEA 5L3GA 5BOXA 1B7TA 3DXJF 1R00A 3V7RA 2EHOA 3FXDB 2I59A 2HQNA 4DVDA 2BZBA 3BQIA 2CXLA 5DCFA 5EEHA 4X20E 3C4XA 4E70A 3N4MA 1CUNA 4KBMB 3KZZA 5JDHA 2Z99A 3WU1B 5K1YA 4EAHA 5JH7E 4UV9B 5LGUB 5CJ9A 3WTWC 4LMYA 4B09A 2JQQA 4HBLA 1F4KA 2R7DA 2KIFA 2XHKA 3PU3A 4YG2F 1TQMA 4HX8A 2XASA 1KA8A 4OIRF 4KUMA 3VKHA 2CEAA 4IE0A 2ES0A 4RGUA 2XAJA 4A0XA 4A6DA 3GX4X 5LBQB 1PP8F 1L3LA 5ICEA 1IN8A 2EFOA 4OIOF 3IHRA 2MC3A 3LAJA 1XD7A 3O4XE 4P0AA 4G9YA 4X1YE 3TDZC 1SA0E 1RUOA 2M5WA 2CXFA 1HFAA 3D0TA 3PFIA 5JDNA 1ZV4X 3HSFA 2VK9A 1KU9A 2C0SA 1E1HB 1SAXA 3RI4A 3C64A 5HYAA 5K5OA 2FMYA 2QBYA 4I50E 3JC6D 1LR