1T98A

Crystal structure of mukf(1-287)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
274
structure length
266
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome partition protein mukF
publication title The MukF subunit of Escherichia coli condensin: architecture and functional relationship to kleisins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 100
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t98A01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1t98A02
3SZTA 2WV0A 2J5OA 2IT0A 2BBYA 3P9IA 5D8LB 2IPQX 2M8EA 3F3XA 3ZQ7A 2ZJ2A 1Z6TA 2V1DA 5E8IA 1HXDA 4HQEA 4HX7A 3LAPA 4IXAA 4GCVA 2PQ8A 4U7DA 3O3KA 3KEQA 5BPDA 3N97A 4RB0A 2W85A 3GWZA 1OYYA 2XUBA 5LHHA 3GZ5A 3BJ6A 1X3UA 3E3VA 4XSXF 1FX7A 2CG4A 4GYIA 4I09A 3I54A 2ADUA 2F5DA 4P96A 3WE2A 3CLOA 3GFJA 5ICCA 3KP3A 3I53A 1E2XA 2FA5A 2Q2EA 5HVQC 3BDDA 2COMA 3P9KA 2AXLA 3VB2A 5CYVA 5CVUA 3E6DA 1J0RA 3V8JA 2HQRA 3BY6A 4AIJA 1SD6A 5CVRA 4CO8A 5D8KB 2A69F 4JK1X 1KU3A 3BPXA 2DLLA 5D6EA 3PQKA 3QPHA 2R3SA 3FZVA 3K9TA 2QBYA 1U6GA 3RKWA 2VC0A 2A6EF 3I0TA 3C7JA 2VE8A 1MZBA 3KLOA 2DPDA 2O8XA 3U1DA 2GZWA 4IPAA 4LB5A 3HHHA 1EH7A 1LVAA 3HRUA 4TV7A 2L54A 1FYMA 1R22A 1KQ0A 2D45A 1BI1A 4M6XA 3TO7A 3LSTA 1QBJA 3BJOA 2XAGA 5HLGA 3DP7A 1YW7A 1MKMA 3WTSC 2HQNA 3ABUA 3ISPA 1J2XA 4RGUA 4CZZA 3ZPLA 3MEXA 2G7UA 1O3RA 5HS9A 3TOAA 1AWCA 5HDGA 2O61A 2FNPA 3JAMZ 2EFNA 3P9CA 4L5IA 2CSOA 2E7WA 1LEBA 2ZFWA 5E17F 4WXDA 4M73A 3J81K 5JHUA 4UNOA 4CICA 1FYKA 2QLZA 5D5VB 2W24A 1FNNA 3EUHA 2NNYA 2P6SA 4R79A 2CFXA 5J8CA 4ZH4F 1U78A 3MZYA 5CJ9A 3HRTA 2K27A 1WQ2A 1Z1DA 3QU6A 4OIRF 4MQ9F 3SFZA 1W5SA 3WU1B 5LGTA 3R6SA 5HS7A 2QZ8A 2P7VB 3L00A 2LF8A 5ED4A 3K2ZA 2XKPA 1EH8A 2QQAA 4N9HA 2F2EA 2XRNA 1R1VA 1QPMA 1DPRA 2XAQA 1BBYA 2NYXA 1V4RA 3DEUA 2HGCA 3E5XA 1UFMA 4CHUA 4G6DA 2FXAA 2XAJA 1BC7C 1QO0D 3S2WA 1MGTA 5D6FA 3F21A 3EQLF 5EEGA 1P4WA 3KETA 4UXNA 5H6QA 4LGWA 4S05A 3RYRA 3FMQA 1U5TC 1HBXG 2G7HA 1BIAA 1YW9A 5D4SA 4RB1A 4FHTA 1ZGAA 3DKWA 3C3WA 4M9SA 3TGNA 3E6MA 3FXRA 4CGZA 2HYGD 4ASNA 1GVJA 1W7PD 4L0ZB 1K79A 3R4KA 3G73A 3CDHA 4KN4X 1EV7A 4Y13A 2CW0F 1FYLA 5L3FA 2HWVA 1R23A 2IP2A 2JSCA 1RUNA 3F8NA 4EQQA 5BQTA 5BS6A 3DQVC 2W57A 5DD4A 3DV8A 5CVJA 4MTEA 5A2QZ 1MJ9A 2OQRA 2P6TA 5F64A 2KIUA 4ZZLA 3TOBA 1O3SA 3RDIA 4BAYA 1ZG1A 2C6YA 4HLXA 5K1YA 3E97A 2UWMA 2L02A 5IT9Z 3F8MA 2E7XA 2D2WA 4RB3C 1XD7A 3J7AO 3I59B 2FU4A 2VODA 2QYOA 1YIOA 2DO7A 1W4MA 4KFCA 1QGPA 2JPCA 1IN5A 2ESNA 2BE5F 4HLYA 4F7ZA 3HHGA 5FGMA 3H3ZA 3LWFA 5DCMA 4HDUA 1L0OC 1W5TA 2XVCA 1SFUA 2VBYA 3WTVC 4BYYA 3IRRA 2F5FA 4HQMA 4A5MA 5L3GA 2VN2A 1PP7U 3T1BA 4LD5A 1YFHA 2L4MA 2YU3A 3V4GA 4A0XA 3CO7C 1XB4A 1A04A 1XSDA 2XHKA 1H9GA 3FXQA 3KFWX 5JI6A 1T0FA 2O03A 1KYWA 4EM2A 3R0AA 3NRVA 2BGCA 2H94A 4KDPA 2VBXA 5DCFA 3RKYA 4ENJA 1B1BA 2OU2A 2MA3A 4OMYA 1KU7A 1UCRA 5EEHA 3GVAA 2AS5F 1F1ZA 1SD5A 2Y75A 1OYIA 1KQ8A 1MJBA 1ZRDA 5CLSA 1Z7UA 1SD4A 5L3EA 5ICFA 1QZYA 4OINF 3WTZA 4OIQF 4G8XA 2TDXA 3FMSA 3RTRA 1LDDA 2GQQA 4Y17A 2FE3A 1LEAA 1J59A 3ROUA 1RNLA 3BPVA 3D5LA 2CYYA 3I5UA 4HA8A 5HOOA 4LMYA 3ELKA 3E5QA 1ZLJA 5ICGA 1STZA 5E20A 2K02A 1FY7A 2DI3A 3W6JB 3WTUC 5BMZA 1XGSA 1K6OA 5H6RA 5DDGA 1SMTA 2EV6A 2F5CA 3KE2A 2GXBA 2ETHA 3WE3A 3BZ6A 3MAJA 2Z99A 3DPLC 2VE9A 2HTSA 4MEXF 1XDSA 1SD7A 2QVOA 1TBXA 1GHCA 4RAYA 3ZMZA 3HSFA 2PLYA 5J6XA 4L9TA 2PI0A 4O3MA 5JR3A 4IF4A 4KICA 3RPQA 1J5YA 4HF1A 2PJPA 1XGOA 4L0YB 1Z6RA 3T0YA 1F4KA 3Q9VA 5IT3A 1ZARA 3IRQA 4KIBA 4A0YA 1BI0A 2VT3A 3ZMDA 3JAMK 3I4PA 2P7CB 3RI4A 2PFBA 3E6CC 2E1NA 1XCBA 3V7SA 2M30A 2FF4A 2PBIA 4A12A 2RN7A 4LLLA 2VXZA 2CQKA 2V1XA 4EJTA 4LK1F 3FHZA 1HW1A 3M1EA 3W6KB 1QNTA 2LKPA 2Z9OA 4N9IA 3GW2A 3E6BA 2HFHA 5E1ZB 4I01A 2R7DA 1XDUA 1WI9A 4G94A 1R5HA 1Z9CA 3V8LA 2K86A 2FRHA 1W7PA 4HV5A 4HAMA 1ZYRF 1R1UA 1KYZA 1I1SA 1DUXC 2K4BA 3D0SA 5BOXA 4EJUA 2A6HF 4HYEA 1G4DA 3EYYA 2EJRA 2O3FA 1NHAA 1IZ1A 1FWZA 2D1VA 2M5WA 3TO6A 1WKMA 2EA2A 1BN5A 2ZNYA 4M6YA 3DFGA 1OYWA 4WF2A 2XV4S 4LFUA 4R8HA 3QU3A 2Z33A 1T39A 1LDKB 4ESFA 4AIHA 4EJVA 4Z2YA 3PFIA 1ONVA 3CTAA 2UXXA 3MCZA 1ZRCA 4HDVA 3TQNA 2L01A 3SZPA 3GFIA 1YS6A 4XLPF 3LQQA 4XRFA 4ETSA 1XSVA 1KA8A 2VOPA 2GA1A 3HIFA 2ZCWA 2ACJA 3ZMSA 3F6VA 4OU0A 2GWRA 1CGPA 4EVIA 2P4WA 2XAHA 4I98B 3DXJF 1P92A 1T38A 1ZGJA 3B02A 3ECOA 4KNYA 4LK0F 4XBFA 3QP6A 3SHFA 4BHPA 1XSXA 2XROA 2Y48A 4MQVA 4EGZA 1OMIA 4HV6A 3P7NA 4BHBA 4D0PA 4U0YA 4HX4A 5A2QK 2RQPA 2FEZA 4CYDA 1I1GA 3U9GA 1CF7A 3OOPA 4OIOF 3HOTA 5JFRA 3R61A 4L18B 3DPTA 3RPUA 3LAJA 3I59A 5LRRA 4HF0A 3R60A 1IW7F 2V6CA 1U3EM 5IT9K 4O6JA 2LSOA 2D1HA 2DK8A 1S29A 4U88A 3SXYA 3HUGA 2FBIA 1IN7A 4A2UA 2ZMEA 3ERED 4HX8A 3V7RA 4Q48A 2ZO4A 3LA2A 1ZG5A 5LGUA 3HOSA 5TJJA 5L3DA 3GO5A 2V9VA 4MEYF 2FMLA 3N4MA 2LDUA 3KZYA 2DT5A 3WGHA 4KIGA 1O3QA 1D8KA 3GFMA 1R36A 2JTVA 3V7CA 3M8EA 1U2WA 2FBKA 3GLXA 4HOBA 4RS8A 3KEOA 2MD5A 1HKTA 2V79A 1Y0UA 2MH9A 2STTA 2XAFA 2FQ3A 2Y0MA 3JTHA 5ILUA 3WTWC 3I58A 1BI2A 2BYVE 3O2PE 3K69A 4NHJA 4UV8A 4LLGF 4LJZF 2ZKZA 2VOOA 2H6CA 4HW0A 1P4AA 3KP7A 4IRGA 4DQ2A 2KIFA 3CO6C 5HDKA 2FSWA 4BHCA 2NAZA 2DW4A 2HKOA 4KYWA 5BPIA 3HRSA 2X4HA 5LRSA 3KZZA 1Z91A 1FLIA 4Q47A 3CUOA 3ZP5A 4M74A 3J80K 3GUDA 1PDNC 1RUOA 5FLXZ 4FT8A 1LB2A 5FB2A 4KN7X 2EB7A 3REOA 1TW2A 4JQFA 1JHHA 1B4AA 3VODA 2QQBA 2DTRA 4ENKA 1H9TA 3KCCA 3MQ0A 1ZG3A 2GIVA 5K5RA 3CUQC 2EFOA 4P9UA 2MLKA 2F5EA 1KQ9A 4YIFA 4PDKA 3OV8A 5LLQA 1EH6A 2DQRA 3HSRA 4G6QA 4LB6B 1B59A 1YW8A 2P8TA 1ZH5A 4M9XA 2JZYA 1KU9A 1R58A 2KKOA 5D5UB 1ZRFA 2PMUA 3F6OA 3ZMVA 4IRHA 2J5PA 4GO1A 3F72A 5ILVA 2FMYA 3GF2A 5DV5A 3TDUC 1FPQA 1G3SA 5E1WA 1J9IA 3ZN1A 5L3BA 4FX0A 1I5ZA 1I6XA 1LNWA 2ZNZA 3K1NA 2RV8A 4QLCU 4UVCA 4I0AA 1HKQA 1B6AA 3HSEA 1KU2A 4OIPF 4UVAA 1R7JA 3E5UA 3WU0A 2VONA 1USSA 1U8RA 1TQPA 4PZJA 4BXUA 1O7LA 1WWXA 3LFKA 4I7HA 1BIBA 4MNUA 1IN8A 3WGGA 4QWQA 5FO5A 5F6FA 2MH2A 4AD9A 1BM9A 2Q0OA 1OKRA 2IA1A 2L3DA 4IHSA 1HSJA 3TDZC 3MZHA 2WC2A 1IF1A 2GXGA 2ZXJA 4ENNA 3IWZA 2EK5A 1S7AA 2P5LC 4WWCA 3LQRA 1YG2A 4RAZA 4UV9A 4E70A 1S7OA 2XGXA 4KIFA 1IAWA 2MLGA 2H09A 4L9JA 1USTA 2GA2A 3WTXC 1YQAA 2OZ6A 1XMKA 3QRFF 4G7OF 4XSZF 2HZTA 2BV6A 2HEOA 4YFXF 2IRFG 4AWXB 2HDCA 5KK1A 1FSEA 3B73A 3L2CA 4B09A 2HTJA 3HRMA 2HKXA 4WXCA 2IA2A 4ESBA 1XGMA 2A3SA 3DF8A 4FX4A 4KMFA 2GAUA 2OAZA 5K5QA 1D8JA 3GYHX 3QP5A 2RVCA 1P2FA 4L9VA 1GXQA 5JVTA 3FF5A 2IJLA 1I27A 1FP1D 2ESHA 1R00A 1ZAOA 1MDMB 1U5TB 2XASA 4EM1A 4KA4A 4KT5C 3HYIA 4U7BA 1RI7A 2JPBA 5HS8A 3M7GA 5D5WB 1H0MA 5DUIA 1XGNA 1MD0A 1S6LA 1J7KA 2DFIA 4ESJA 3COAC 3QAHA 5CVIA 3IL2A 1ZHFA 1FC3A 4IHTA 2O6GE 1WSUA 3QOPA 2A5YB 2VBZA 4MTDA 1GXPA 2LF7A 1SAXA 5F1RA 2HYFA 3ZN0A 3U2RA 2X0LA 3I64A 2KIMA 5HLIA 5FFZA 1SFXA 1FOKA 4G9YA 3BP8A 1ULYA 2O0YA 2XIGA 2KRFA 2JT1A 3IKVA 4P5OA 2YPRA 4ENMA 5H20A 5D5XB 2M87A 1K78B 1HQCA 2YR2A 3L7WA 1FZPB 3O6BB 1C0WA 2HS5A 3GFLA 4LG0B 4IJAA 2E1CA 3K0LA 4H0EA 3HTSB 1F5TA 3CUQB 4M71A 4EM0B 2FBHA 1YYVA 2MC3A 4L9NA 4P9FA 1QZZA 2VC1A 3Q9SA 1R5GA 2OZUA 2H6BA 1V3FA 1JE8A 5D4RA 5AIQA 2ZBKA 4KUMA 4BQAA 4DNCA 2RGVA 3RKXA 5FD5A 1T6SA 4RGXA 1O57A 1RZ4A 1DP7P 3AAFA 4P55A 2NS0A 4EGYA 4A5NA 1T2KA 1DDNA 2OD5A 4PGHA 2EFQA 1T98A 3BOQA 5LBQA 4YFKF 2PEXA 1HW5A 3LA7A 3WTTC 4AIKA 1E17A 5E1XA 1BI3A 1WRJA 1FBQA 3LA3A 3EDPA 4ZYGA 1ODDA 3KP6A 2W84A 5DEQA 1FT9A 4OOIA 2Z3YA 3L9FA 3C18A 4K2EA 1QQIA 2IW5A 1JXSA 4ZYDA 3I71A 4HBLA 1F9NA 4ZYEA 1IRGA 1S8NA 3G3ZA 5AONA 3IWFA 1REPC 5FLXK 2VBWA 4Q5SF 3SQNA 1Q1HA 4EMSA 1J75A 3NEUA 3KP4A 2YSRA 1BJAA 3FWEA 2DQLA 1G3YA 3RIRA 2A61A 1HW2A 4G7ZF 3KLNA 5LEJA 2A68F 4S04A 2UZKA 4UHTA 4L5JA 3TKYA 3VFZA 4Y15A 3L09A 2EFPA 1XN7A 4XLNF 6PAXA 1Z05A 1IN4A 3ABTA 4WXHA 2PN6A 4GGGA 3VEPA 4NB5A 4WX9A 4HZFA 5AIPA 1ON2A 1G3TA 4CDGA 3H3UA 2FNAA 4UVBA 1W7PB 2CWEA 3GZ6A 2RNJA 3FM5A 3F8BA 1VTNC 3M8FA 4LLNA 5J8FA 4AVPA 1ON1A 4O5VA 1UHMA 2STWA 1FBSA 1YS7A 2EWNA 2QBYB 3RYPA 2CO5A 1ZLKA 4M72A 5LGNA 4BH9A 2DBBA 4Q4ZF 1B9MA 3WGIA 5DUKA 3ZMTA 2RC4A 1D3YA 1G3WA 4IRIA 3MFKA 2P5KA 3BJAA 4A6EA 3V8KA 2WWYA 3JTGA 3IHUA 4M9ZA 1TQIA 5FFXA 5E8GA 4ZYHA 4N0BA 5K5OA 1FSHA 2EV0A 4RGRA 1S3JA 1TW3A 4HF2A 4GXOA 2KJCA 4RGSA 3FMRA 3VOEA 1HSTA 3KP2A 1XCVA 4R1HA 3R0JA 2XKOA 2A07F 2IVMA 1TLHB 2R7FA 1IXCA 3J81Z 2DU9A 3WODF 4KMUX 5HDNA 1OR7A 2B0LA 3NQOA 1FP2A 3T5XA 4ON0A 3ECHA 2EV5A 4U0VA 4YG2F 3JSOA 2H27A 2NNNA 2PG4A 2EFWA 5LEKA 3QPTA 4IVNA 4MGRA 4BNCA 1IXSB 4UUVA 5LHGA 4I2OA 1CF7B 3WTYC 1B9NA 1LJ9A 1UHWA 3WG9A 1P4XA 4A0ZA 3PQJA 2ISYA 2L4AA 3ML6A 2P5VA 2RDPA 3K1MA 1IN6A 1RIOH 4RB2C 4I02A 1MDMA 1U5TA 3FX3A 1TNSA 4OMZA 1XMAA 5KVRA 2ZMEB 1ZN2A 3FM3A 3JW4A 1DPUA 1R1TA 1TNTA 5ICEA 4WK8F 2QQ9A 2Q8KA 1O3TA 3CJNA 1TTYA 3ZMUA 1OPCA 4ZZDA 2Z5UA 1L3LA 1O7FA 1LDJA 3C1DA 3GXOA 1AOYA 1BOAA 3EYIA 3MWMA 1PP8F 5ERIA 2ISZA 5FD6A 5DYMA 2OBPA 1SFEA 2VT2A 2YX4A 2UXNA 1MJAA 5DD8A 2LNBA 2V1UA 3BWGA 3IKTA 2RKHA 4CXFA 2OQGA 5L3CA 4JBAA 3RJPA 1IRFA 1UB9A 3T8TA 3IC7A 2EA4A 1ZREA 1K78A 5E18F 2QWWA 2QUFA 3K1PA 2IA0A 2KJBA 3EETA 4LG0A 3KP5A 3BROA 4PCQA 1PUEE 2FOKA 2QENA 5CVVA 2DK5A 3CUQA 1BC8C 2CGPA 1KGSA 4YIIA 2ELHA 4NQWA 2DPUA 3H92A 4EV0A 2QM3A 1FBUA 3ULQB 2NRAC 2MBFA 3Q5FA 3J80Z 2K7LA 2JRTA 5HLHA 4PGGA 2K4JA 1P6RA 4G7HF 3F8FA 2PMHA 1IUYA 2DAOA 4B8XA 1G6NA 3GX4X 4A6DA 2YX7A 4WCGA 1YTYA 4EJOA 2WTEA 1TQMA 1D5VA 4YFNF 4U0WA 4EJWA 1YLFA 3F23A 3FXUA 5TRDA 2M45A 4MHGA 1K7AA 1JGSA 2W25A 1SMYF 2BEOA 3F22A 2HR3A 2M1BA 3T8RA 5ILSA 4I0BA 2HOEA 1IXRC 2OA4A 2G9WA 3M9AA 1HKSA 3TO9A 3JSPA 1YO5C 1JHFA 3HTUA 5LHIA 5DCMB 3GEZA 1LQ1A 4GYGA 3F8CA
chains in the Genus database with same CATH superfamily
2CU7A 3I4MJ 4DR5T 3RQUA 1QZEA 2W4XA 4I43B 3SZTA 2WV0A 2J5OA 1UHSA 2IT0A 4G63A 2BBYA 3O8HA 3P9IA 4H9QC 4EZHA 3PUVF 2E9XA 3TBIA 2ODVA 2XGCA 3RI5A 1IAPA 5D8LB 4KHPT 5F04A 2BZBA 3TLVA 2IPQX 1MNDA 2M8EA 2EZIA 3F3XA 1JUMA 3TL4X 5L3GB 5IUXA 3ZQ7A 3BTCA 3ZQHA 2ZJ2A 2DWGA 4LIUA 4PJMA 1SC7A 1OEDC 3LSVA 2L7MP 1AU7A 1Z6TA 2BS3A 2V1DA 1DU2A 4LG3A 5E8IA 2W4SA 1HXDA 2XY8B 5L3BB 3DCFA 4H9NC 3LDQB 5B5EC 4HQEA 2VL0A 2O8KA 2D9DA 4PK6A 4HX7A 4U72A 3SEZA 1E0EA 4F92B 3LAPA 3U21A 2A9UA 4IXAA 2KQRA 4GCVA 3RYIE 4DVDA 3DLAA 2NWBA 4Z90A 1Z77A 2PQ8A 1WJEA 3OYGA 2VPRA 4U7DA 3RLFF 3O3KA 3ZQQA 3KEQA 5BPDA 2IAKA 1HDPA 2BKNA 3N97A 4ERRA 3CP8A 4RB0A 2YEVC 2ID6A 4UVAB 2W85A 3GWZA 2WWVA 2LSKA 2JPFA 4C3HJ 3AXJB 1OYYA 4WZXA 2XUBA 5LHHA 3GZ5A 4BDYA 4X1YE 2EZHA 3BJ6A 1X3UA 3E3VA 4XSXF 3AE6A 1FIPA 1FX7A 1MW7A 2CG4A 1IV8A 4GYIA 2NVQJ 4I09A 3I54A 3MD2A 2ADUA 3QB5K 3JCFA 2F5DA 4P96A 4AI6A 3WE2A 4XONA 4B44A 1W0BA 3FIWA 3CLOA 4UB8C 4RA2A 3GFJA 3ZSTA 5ICCA 3S93A 3KP3A 4DNDA 3I53A 1E2XA 5FKYA 2FA5A 2Q2EA 3K4NA 1A6QA 2YINA 2DFFA 3VRBA 4AM3A 3A01A 2ZJRF 1FOYA 3BDDA 3G1OA 5HVQC 1TC3C 2COMA 2VQET 5JR9C 3P9KA 5DTDA 2VLAA 2EHOD 2K3WA 2AXLA 3VB2A 3V5UA 5CYVA 5CVUA 4YHJA 3E6DA 5GAGJ 1J0RA 3V8JA 4GIWA 4DBQA 2HQRA 3LK2B 4QXHB 1IO2A 2NW9A 3BY6A 3D5SC 4IE4A 2MYSA 2WB1N 4ZS2A 3QODA 4AIJA 3UUNA 1SD6A 5CVRA 4CO8A 5D8KB 2A69F 4JK1X 4B3TT 4U74A 5L3EB 5ABHA 4K0KT 1KU3A 1W5CC 3BPXA 2DLLA 1JKPC 3CCSI 3IA3A 3MKZA 5D6EA 1K4SA 3ZEFB 3KX2A 3SFEA 3PQKA 4JI8T 3GTGJ 1WHUA 3QPHA 2BKPA 2UV1A 2R3SA 4JX4A 3JRIA 1N25A 3FZVA 3K9TA 2QBYA 2VXDA 1U6GA 1D5YA 1JI8A 3RKWA 2VC0A 2A6EF 3FHNA 3DTIA 4HSRA 4AQFA 4HWHA 3RC8A 3BTJA 3HZJA 3I0TA 1M62A 3C98B 3PDYA 2K48A 4YHHT 3C7JA 2RQQA 4QH4A 4IOCF 2JVHA 5BMVE 4X64T 4HWCA 5C8YE 2VE8A 3NBXX 1MZBA 2LRLA 3KLOA 3OYIA 4RBOA 4X1EA 4PSWA 1Q1VA 3AEEA 5HXHA 2JUCA 5M5YJ 4KBMB 2DA2A 2DPDA 2BG9A 2O8XA 3LSMA 4C90A 2EZLA 1WJFA 3U1DA 2A05A 2GZWA 4IPAA 4LB5A 5H6RB 5FRNA 2V7LA 1XZYA 3J7YJ 2X0HA 4HG2A 4ZDOA 2LYCA 2JN6A 2E35A 2PX9A 3HHHA 1QVUA 4N4NB 2V8SV 5CA1E 1EH7A 4AVZA 1LVAA 1H88C 3HRUA 3PURA 5CPRB 1ETXA 4TV7A 2EZKA 2L54A 2XQ5A 2DMNA 2QF7A 2K40A 1R22A 1FYMA 2V5DA 1KQ0A 3KINB 2DT6A 1XMXA 5C3JA 4HN9A 2XHEB 2D45A 2X85A 3SFDA 1WFXA 1BI1A 1EZ3A 4M6XA 3UU5A 2VJJA 3TO7A 5JDQA 3NRYA 4PUSA 1X1BA 3LSTA 1QBJA 3BJOA 2OLTA 2XAGA 3AVSA 3AAIA 2XAUA 5HLGA 4QIWN 4P09A 3DP7A 1YW7A 1W36D 3TLTA 3ZMZB 2MABA 5JREA 1MKMA 2XGDA 3WTSC 2YDQA 2HQNA 1SHZC 4HFHA 4IDOA 3ABUA 5JRCA 4NC6A 1SFKA 1M7KA 3ISPA 1J2XA 4PAGA 2CWOA 5K7FA 4RGUA 2DJNA 4CZZA 3ZPLA 4KX6A 1TWAJ 4WNKA 3MEXA 3S17J 2X1EA 4L0RA 3U3IA 2ZM6T 4L5EA 2G7UA 3TW7A 2LOOA 4C2MJ 1ZGWA 5HS9A 1O3RA 4JBWF 4B6XA 5LNKA 4MFRA 3TOAA 1ZK8A 5CJ5A 4MHCA 1YD8G 3A8YC 1AWCA 2DTZA 3HR0A 5HDGA 2QSHX 2O61A 1N32T 4HKAA 2TRTA 5DQVA 5FJ8J 3GZNB 2MG4A 4E7ZA 2FNPA 4CQIA 1VCTA 3JAMZ 2EFNA 3AAEB 4HWDA 5HEGA 3P9CA 4JUYA 2KLQA 5L2LA 3NWTA 2CSOA 4L5IA 1M1EB 2E7WA 5FNVE 1LEBA 3DTEA 2R93J 2ZFWA 5E17F 4WXDA 2WWUA 2R7QA 4M73A 5IYCJ 5JHUA 3J81K 4UNOA 4CICA 1FYKA 2WQYA 3LNQA 2QLZA 3A02A 3PJAA 2DMUA 3B5MA 4PNIA 5D5VB 2W24A 1BW5A 1FNNA 1JTYA 1ZKGA 3EUHA 1X4OA 4Z8XA 2JQHA 2NNYA 1VRBA 2P6SA 2M4GA 4R79A 4H9RC 1WRDA 3QUJA 2CFXA 4I0UA 1HCRA 4ZI2D 5J8CA 2R7XA 1MIJA 2DI4A 5LMUT 4ZH4F 2XRLA 1U78A 3MZYA 2BDEA 5CJ9A 3GN5A 2VKHA 3BTIA 3H35A 3HRTA 4NC8A 3K4BA 1OFCX 2BHZA 2LY2A 3I56I 3CDLA 2K27A 3ZRGA 2V6YA 4DR7T 2OTJI 2F4OB 1WQ2A 1Z1DA 1WR6A 2JQKA 3OYEA 3QU6A 4OIRF 4MQ9F 1YJNI 3ZYMA 3W2WA 3SFZA 1W5SA 3EHZA 5AQIB 3WU1B 1ZKEA 3AE2A 4O2BE 5LGTA 2CXFA 2QGSA 3PNYA 5JDFA 1BR0A 4UUTA 3R6SA 2J1DG 3ZSSA 5ABFB 5HS7A 1MBHA 4P1NA 2HQAA 2QZ8A 4D7NA 2P7VB 3ASOH 3L00A 3PUAA 4XOPA 2LF8A 2JA7J 4X62T 5ED4A 3K2ZA 2XKPA 4F52A 4CYCA 1EH8A 2QQAA 3BTLA 1AA7A 1JGGA 3AE5A 4N9HA 2F2EA 1LRZA 3M65A 2XRNA 5EZGA 3CCEI 1R1VA 2HHHT 4C91A 1QPMA 3KIOA 3RIUA 3AG4H 3UTKA 4FE4A 2XQAA 5F3JA 1DPRA 4EAHA 1MBKA 3ONXA 1XNRT 1FOXA 4JYKA 3HPHA 3FZLB 3Q0VA 2XAQA 1BBYA 3UT5E 2NYXA 5IP6A 1V4RA 3DEUA 1EF4A 2HGCA 3E5XA 3MZ8A 4BQQA 1UFMA 4MLKA 4CHUA 2BZTA 1GV2A 4XR6A 4G6DA 5FRMA 3L8RA 1XDPA 2KPMA 4GFBA 2FXAA 2XAJA 2Y31A 2Q9QA 1BC7C 1QO0D 1UUSA 1GT0C 2L3LA 3B6CA 3S2WA 4XL9A 4XZCA 4CXWA 4XQFA 2PFVA 1MGTA 2M6IA 5D6FA 4GRIA 3HOXJ 2HXIA 2FOWA 3F21A 3NKZA 3Q2MA 3EQLF 5EEGA 1P4WA 3KETA 4UXNA 5H6QA 4LGWA 2RNGA 3RYRA 3FMQA 4S05A 2CV2A 2M67A 1U5TC 3ZQFA 4GK5E 2LRKA 1HBXG 5KCMA 3S1RJ 2G7HA 5FXZA 3OTOT 4A3CJ 2QVAA 4ZTJA 1BIAA 1N36T 1YW9A 2CFOA 5D4SA 4DZPA 3PUSA 2X9WA 4RB1A 4FHTA 3I3LA 4TV8E 1ZGAA 5EK2A 3DKWA 2NVUB 2X68A 3C3WA 2OV9A 2WA0A 3OR2C 2G0EA 4M9SA 3TGNA 3B57A 3E6MA 2L0KA 3FXRA 2PMZN 4CGZA 2HYGD 2L9VA 1G8XA 3H5NA 1GVJA 4ASNA 2UXXB 5IP7J 1R49A 3LK42 2E2HJ 2JRMA 3RX6A 4X65T 3PU8A 4AYBA 1W7PD 2ZLYA 5HNFA 2Y0SN 4IT4A 4L0ZB 2LEHA 1K79A 3PE0A 3R4KA 4F93B 3G73A 2CW8A 3CDHA 4KN4X 5J47A 2JA8J 1EV7A 5AQLB 3ZLIA 4Y13A 3QC9A 3RIFA 2CW0F 4G6TB 5L3FA 2HWVA 1FYLA 3EPZA 1JTXA 3U1KA 4ANJA 1R23A 3D1NI 3SZGA 5FKOA 1W0TA 2IP2A 4XLHA 2JSCA 2WBMA 3F8NA 1RUNA 3ZMSB 4A69C 1OEDB 1LE8B 4EQQA 5BQTA 5BS6A 3KBUA 2WAUA 2XAHB 2BS2A 1SE7A 4U2YA 3DQVC 4EXTA 4AC0A 2W57A 5DD4A 2XQ6A 3DV8A 2B63J 4DUYT 5CVJA 2VQCA 2ECCA 2BW3A 1QUUA 5FL0A 4S0HB 4MTEA 2WDVA 3DTOA 5A2QZ 4XBFB 4XAXB 1MJ9A 2OQRA 2DL1A 2P6TA 3KVAA 3PNTA 2Y48B 3JRHA 1Z8UA 3Q0UA 3HKCE 4QXBB 5JDHA 2RA1A 5F64A 3N9LA 2KIUA 2JMKA 4O4JE 2LHRA 2KDZA 4IKFA 3I55I 2N9DA 4ZZLA 3IEEA 3TOBA 3G4SI 5KAIC 3OS1A 3W2VA 1VQ5I 3BG7A 1O3SA 3RDIA 4BAYA 4Z6YA 2IDOB 1ZG1A 2NR4A 2C6YA 4HLXA 5K1YA 3EDVA 1NENA 4HFCA 1JUSA 4DYQA 3OPCA 3E97A 1E3OC 2L02A 3VSKA 2UWMA 1RKTA 3F8MA 5GPCA 5E3OA 5KNLA 2E7XA 4A3JJ 5IT9Z 5DQWA 4RLQA 2D2WA 2E60A 4RB3C 3GTMJ 2WBLA 4OX9T 1S72I 1XD7A 2BY2A 3L2WA 3ZGKA 3J7AO 3ZR8X 5JR9B 2OV7A 3I59B 2FU4A 2VODA 4E6KG 3CCJI 4AKRB 2QYOA 3BR2A 2BY0A 1YIOA 2DO7A 3N9QA 2LFBA 1W4MA 1T7SA 3QYBA 4ZOLE 4JYAT 4PSXA 3E22E 4AQGA 3A4CA 4KFCA 3ABMH 1QGPA 2JPCA 3CJQB 1IN5A 2M2EA 4BA9A 2BE5F 2ESNA 3HUGB 4HLYA 4TNVA 3DWLE 5FROA 4F7ZA 1B7TA 3HHGA 1HG5A 2HZDA 2B76A 2DA4A 5FGMA 5LP6E 3H3ZA 2L7FP 1PVEA 3AG3H 3HOZJ 3Q5EA 4O4HE 5J1RA 3DBRB 3LWFA 5DCMA 4HDUA 1WCRA 4GYSA 2FJBA 3TLUA 1L0OC 1LFPA 3ZJ2A 3BQZA 4U31A 4DV7T 1W5TA 2XVCA 1SFUA 4H9SE 5LGUB 2VBYA 3BR6A 1E3PA 4XIDA 1E2AA 1OEDE 2Z2SB 1WR0A 3JRCA 1O3XA 3WTVC 2LSJA 1J5WA 3OYCA 5L3DB 2XZEA 4BYYA 3L2QA 2IC9A 3IRRA 2IGMA 2OCCH 3ASNH 2X6OA 2N8GA 4BL0B 2F5FA 4HQMA 5DABA 4GOUA 3KV5A 4A5MA 5L3GA 2VN2A 3ZQLA 4MFDA 1PP7U 3TLSA 4LF9T 2EHOA 1NH3A 3T1BA 3NVOA 2K5BB 4A93J 2XSAA 4G2AA 2GOXB 4LD5A 1BA5A 5LOVE 3CF2A 1YFHA 2VUMJ 2DYSH 2L4MA 2ZM2A 3ESLA 2YU3A 3RGLA 3RPUD 3V4GA 2BOLA 1GVDA 3GTKJ 1MMGA 2M0MA 4A0XA 3CO7C 1XB4A 5FKMA 1MH3A 1X4PA 4UVBB 1A04A 1XSDA 4D1QA 4IHYA 1WH5A 1ETYA 2XHKA 3CQGB 1H9GA 3GCMA 3FXQA 3KFWX 1VZ0A 5JI6A 4B48A 2WY2A 4TX5A 1T0FA 2HVRA 3K4MA 3MVPA 2O03A 1KYWA 4Y52J 2XPUA 3LMMA 2X6WA 3NWIA 1DGWY 4EM2A 3MKWB 2XAFB 3R0AA 3AXJA 4B3ST 3NRVA 2NOJB 2BGCA 2H94A 2N2NA 1U9OA 4U87A 3K8PC 1P7JA 1EJ9A 1MIWA 2X0YA 4BE0A 4QPQA 3IF8B 1SANA 4ZC3A 3V42A 4HFVA 4KISA 4CI3B 4XRSG 1FOWA 5F08A 3C64A 4KDPA 3BT9A 1UX4A 4KJZA 2ZC2A 4ISTA 4LMKA 1X1CA 3NRXA 2VBXA 5DCFA 3RKYA 1SUMB 4ENJA 5EGOB 2FBWA 2E5VA 4UV8B 4IHWA 2M8GX 4DMVA 4EGWA 1VQPI 3FZHB 4EZ4A 3HOYJ 2E9XC 1B1BA 2OU2A 2MA3A 3FBIB 4ZDPA 1KU7A 3K4LA 1UCRA 4DZJA 5EEHA 3GVAA 3N9NA 3H9QA 1WZ2A 3JCUC 3S3OA 2D5VA 3SOLA 4AKIA 3FK6A 1F1ZA 1SD5A 2Y75A 3BR1A 4B3AA 2AS5F 1YOVB 1WLXA 2CBJA 1MNEA 5E3NA 2DCFA 5LG3A 5EK3A 2EILH 4BE2A 2XSBA 1I6ZA 1MNMC 1UX5A 3HKDE 1OYIA 1WH7A 2XPVA 1JKQC 1KQ8A 1MJBA 5FXXA 2KZVA 1X1AA 2C5KT 3DU5A 1ZRDA 5CLSA 2M34A 1SD4A 1Z7UA 5L3EA 1ETWA 1QA6A 5ICFA 1QZYA 4OINF 3WTZA 3IV5A 1KK7A 4OIQF 2GIZA 3ANWB 4G8XA 3N5LA 1VQKI 2R7SA 3LBXB 3LSRA 1ZP0A 2TDXA 3FMSA 1YX5A 3RTRA 1LDDA 1WYBA 2GQQA 4Y17A 3OBVE 2X1CA 2VKJA 2FE3A 4NBQA 1LEAA 1J59A 3ROUA 1RNLA 2IGOA 3CX7B 3U78A 3BPVA 3D5LA 2CYYA 3I5UA 4HA8A 5CQEA 5EF6A 4LMYA 3ELKA 5JLWA 3E5QA 5HOOA 2I8DA 1ZLJA 3PUQA 3VWBA 5IYZE 1OCZH 3BR3A 1YJWI 5LBMA 3HXLA 5ICGA 1HX1B 1STZA 5E20A 1Z21A 2K02A 2GLOA 3H3AA 1FY7A 4OMYA 4X6AJ 1GLNA 4E7HA 2R7WA 2DI3A 1R9TJ 3DJBA 3W6JB 3DBHB 3WTUC 5BMZA 1L0VA 5EG0B 3OOUA 3FZMB 2JJ7A 2MSYA 2F6CA 4DW6A 1Y0NA 3RYFE 2LBFB 5JDGA 4ZZCA 2IMLA 1XGSA 1K6OA 3VU7H 5H6RA 5DDGA 1SMTA 2EV6A 3RKOA 2MD0A 2F5CA 3F31A 3DPUA 4KI0F 2IGKA 5LMNT 5FY7A 4CCOA 3QB5A 4EEDA 3KE2A 2GXBA 1E3HA 2K9NA 2ETHA 3WE3A 2IIUA 2F4VT 3BZ6A 1IRZA 3MAJA 1A6IA 4DOZA 2Z99A 3DPLC 2K9SA 1CHUA 4CUGA 2VE9A 2CBIA 2HTSA 4HFEA 4EOZB 3QYFA 3ZXSA 4MEXF 4B47A 1VQNI 1XDSA 3KYLA 3OYNA 1FJLA 4DR2T 4ASKA 1SD7A 2QVOA 3CJRB 1TBXA 2F5VA 1GHCA 4RAYA 1V5EA 5LXTE 4FCYA 3ZMZA 4W1UA 3LSGA 4O2AE 3HSFA 2PLYA 4IHJE 3SRZA 5J6XA 4AKHA 4L9TA 2E2IJ 4B3RT 3EUAA 3O1JA 3S16J 2QKLB 2PI0A 4O3MA 4EIWA 3DKYA 5JR3A 1D1AA 1LUJB 2H8WA 4IF4A 1Z0PA 4KICA 3RPQA 3C4WA 3ZMVB 2MFZA 1J5YA 2CUFA 2E1MC 1RR8C 2KL4A 2E5ZA 4HF1A 3IUOA 3TMOA 2PJPA 1N78A 1XGOA 4E7LA 4L0YB 2XGEA 4I6ZA 2BG9C 1Z6RA 2YDRA 4AKGA 4DBRA 3T0YA 1F4KA 3CCLI 5CFBA 4XRSA 3Q9VA 2CS3A 3IAM2 3L3PA 3L2RA 5EDNA 2HN2A 5IT3A 2OA5A 1ZARA 4JI0T 1QHGA 1QRYA 3IRQA 1VF9A 1R71A 2XB0X 4KIBA 3H0DA 3ETVA 4A0YA 4J01A 1BI0A 3H5AA 3QPSA 3EABA 3RQ4A 3ZN1B 3SYTA 3GTJJ 2VT3A 3ZMDA 3JAMK 3I4PA 2P7CB 3RI4A 3L2VA 3N9PA 2KXPB 5FY0A 2PFBA 2ZJQF 5E3MA 5IP9J 3H3MA 2DFHA 2W82A 3E6CC 3P5JA 5F1JA 4JI4T 2E1NA 1XCBA 4OYKA 4UVCB 1P7IA 2CUZA 3H5RA 2HYJA 1B8IB 3ZCJA 3HGGA 4WBNE 1MBJA 2KT0A 4ZTFA 4CZCA 3S1QJ 2WADA 2W67A 5J2TE 2H3RA 3V7SA 2ICWG 3RH3A 5B66C 1N33T 2M30A 2FF4A 2PBIA 3G71I 4A12A 2JQ7A 2E34A 2RN7A 3AEFA 2Z16A 4GKJT 4H9PC 2BVMA 1MSFC 3QNUA 4LLLA 4D5CA 2VXZA 2CQKA 2V1XA 1B72B 2WM9A 4EJTA 4LK1F 2CHOA 3QOEA 3OL3A 1HW1A 2VJIA 3FHZA 1KNRA 5ABFA 3M1EA 2XM2A 2D0TA 1MBEA 3W6KB 1QNTA 1LVKA 2VQGA 3JAEA 2LKPA 2Z9OA 2XUEA 3KVBA 1R5ID 3CC2I 4N9IA 3GW2A 3GTQJ 3E6BA 2HFHA 5E1ZB 1LFBA 2E2AA 3BZKA 3AE9A 1V55H 4I01A 4UF0B 2R7DA 1XDUA 1WI9A 1LVFA 3UUXB 1SAUA 4G94A 4TZ4C 1R5HA 1Z9CA 4NUUA 3V8LA 1WJBA 2K86A 2FRHA 4XRMA 1W7PA 3D5RC 5F8PA 3RYCE 3S32A 3I0OA 2DCEA 4HV5A 2NW8A 5IYBJ 2LM9A 4H63V 4BACA 5AQRB 4HAMA 2IHR1 5B1BH 1ZYRF 1HDDC 1UURA 1R1UA 1KYZA 2FJ1A 4IQ4A 3AE4A 2LH9A 3EUHC 1KZHA 3W15B 3MK7C 4L5GA 2ACZA 2DA7A 5FVKA 1I1SA 3HL2A 1DUXC 2K4BA 4B1RA 3LK3B 4IO9F 3D0SA 5BOXA 4EJUA 2W62A 4UV9B 2A6HF 2CJJA 3KEYA 4IX7A 5CB4E 4HYEA 1G4DA 3EYYA 2K85A 3HA4A 2UUBT 3HL6A 1AJ3A 2EJRA 1FIOA 5LFAA 4UEMA 2O3FA 2EQRA 5FXWA 4NXMT 1NHAA 2IXSA 2WMOA 3JC6C 4IE6A 1E7PA 1IZ1A 1N34T 4I55E 1FWZA 2D1VA 2M5WA 3TO6A 1WKMA 3JRFA 2EA2A 1BN5A 2ZNYA 4M6YA 3DFGA 1OYWA 5AQFB 2LRDA 3K3QC 4HFBA 1D1CA 1K83J 4WF2A 2DN0A 2XV4S 4LFUA 4R8HA 3QU3A 5EEAA 2Z33A 1T39A 4KITB 4IHVA 3MZKB 5ABGA 1LDKB 4ESFA 4AIHA 5IOZA 2YUSA 3CQXC 1ETVA 2K3FA 4BU2A 4EJVA 4RM2A 4Z2YA 3PFIA 1ONVA 1D0ZA 4B43A 3CTAA 2UXXA 3MCZA 1ZRCA 2HU9A 4HDVA 4JI6T 3CC4I 3TQNA 2BVLA 4HEAA 2L01A 4A5XA 3SZPA 3GFIA 2XQ4A 2CQXA 1XG1A 3AA6B 1YS6A 4XLPF 5AQNB 3PO2J 3LQQA 4XRFA 5DS9A 4ETSA 1Y1WJ 1AHDP 5LHGB 1XSVA 1KA8A 3T1HT 4TWHA 2VOPA 5J40A 2KRHA 5EJCA 3C4ZA 3O4XE 2GA1A 3HIFA 1LFUP 2ZCWA 2R5YB 2ACJA 5DJQC 4FQGA 2DHRA 2OC6A 3K70D 3ZMSA 3F6VA 2JA5J 3ZQGA 1ZTRA 1A35A 2IAIA 2DOFA 4OU0A 2GWRA 2LD5A 3OYLA 1LE8A 1CGPA 2QA7A 3N9MA 4EVIA 2P4WA 2XAHA 4I98B 1X9BA 4QX8B 3DXJF 2HOSA 3OYBA 1EA3A 3OYHA 4AISA 1RR7A 3S14J 1P92A 5M3FJ 1TT0A 1X3WB 3G2BA 1T38A 1ZGJA 3B02A 3MJXA 5LA6E 3ECOA 2DWKA 1NG6A 4KNYA 1NG7A 3CZ6A 4LK0F 4XBFA 3FXEB 3QP6A 4KT6A 3SHFA 3N2OA 4WYVA 4BHPA 1XSXA 2Y8DA 2YOEA 2XROA 2Y48A 4MQVA 3TW6A 2N1GA 4NUBA 4E7JA 1KNPA 2HXOA 4EGZA 4N78D 2ZXHA 4C2TA 3V5SA 4IE0A 5CKTA 2IS6A 1OMIA 2XASB 2WV1A 5M5WJ 4DR4T 4HV6A 3P7NA 4C30A 4BHBA 2ZXWH 2ME0A 4D0PA 3OYKA 1GDTA 4BXXJ 1KF6A 4U0YA 4HX4A 4OHFA 3LSJA 5A2QK 3CQCB 5M5XJ 2H7VC 3AEAA 3PUZF 4BGDA 1Z0XA 2RQPA 4IGUA 2FEZA 3PL8A 1XNQT 2Y6XA 2LVSA 2M7BA 3BQYA 4ZEYA 3CMLA 4CYDA 1I1GA 1JJ8C 2YU1A 2LMDA 3LL7A 3U9GA 2DJIA 1CF7A 3OOPA 4IDZA 4OIOF 4OAZA 3PV0F 4YJ3E 2Y9YA 3HOTA 5JFRA 3R61A 3CF5F 4L18B 2M4KA 1YIJI 3DPTA 3OYDA 3RPUA 3LAJA 5JR9A 3HC7A 3I59A 2OUMA 4LF8T 5LRRA 4HF0A 3R60A 3TEDA 2PJRB 3FXJA 2W48A 1IW7F 2V6CA 1U3EM 1V5GA 3GTOJ 5IT9K 4O6JA 2LSOA 2HPIA 2D1HA 2DK8A 4DO0A 2HVQA 1S29A 3A5XA 1T33A 4U88A 4NIQA 3SXYA 2K9AA 2VWAA 4DV1T 3HUGA 4PW8A 2FBIA 1RKWA 1IN7A 4A2UA 4YEJA 4A3GJ 2ZMEA 4XN3A 2CV0A 3ERED 4HX8A 3VKGA 3V7RA 3ZN0B 3G1LA 2DNXA 2X0LB 4Q48A 2CWYA 2B9SA 1SVLA 2ZO4A 2WAQA 4BJNA 1QLBA 1ZR2A 4TUYE 1OR7C 3LA2A 4Y4RA 4EYYR 2IGNA 4A3IJ 2ME6A 1XX5A 2DDBA 3WHBA 1Y64B 1ZG5A 3ZT5A 1ZOYA 5LGUA 2JMHA 3HOSA 5AQPB 5TJJA 2DMTA 2EBIA 3L1PA 3HKEE 5EZYE 1YX3A 2KIQA 4A3EJ 1JKRC 3HOUJ 1A5JA 4E4HA 3UULA 5L3DA 3GO5A 4M3BA 1IJWC 5J4YA 4M3FA 2V6XA 1HOMA 3MKDA 5HNHA 1SA0E 4QTRA 2V9VA 1N77A 1ZELA 4MEYF 2FMLA 4YELA 1BR1A 2CRGA 3N4MA 2X66A 1EKEA 3OJAA 1UZCA 2R7OA 2LDUA 3AG1H 1YQ4A 2WAEA 3OMYA 3H3VK 4A3MJ 3KZYA 3M8JA 4PJ0C 2DT5A 2MW8A 3WGHA 4KIGA 2MOZA 1O3QA 3NAUA 1D8KA 3OSGA 3FXDB 3GFMA 1R36A 2HNHA 2JTVA 2JMWA 3PUYF 3RQWA 4X1KE 2O7OA 3VYUB 4PJLA 3ONJA 1X2MA 4OAYA 2F4IA 5KAFC 3QQAA 2I59A 2LC2A 2KP6A 3V7CA 3M8EA 1U8BA 2K24A 1U2WA 2O5RA 2Q1ZB 2FBKA 3GLXA 4P0BA 4HOBA 2MPKA 4RS8A 2R5ZB 2XSJC 1I94T 3KEOA 2MD5A 1HKTA 2V79A 1JKOC 1Y0UA 3TP0A 3CCRI 2MH9A 2RAEA 2STTA 1APLC 2XAFA 4KUMB 4XLAA 2FQ3A 2V7MA 3A1YA 2Y0MA 4B3XA 4PK5A 1Z3YA 5AQSB 2MBGA 3CCQI 2ECBA 2XB5A 3JTHA 1TWGJ 4CCJA 2QSFX 5ILUA 3H9GA 3WTWC 5KHDA 2NW7A 3OYZA 5KDMC 4MO7A 3M4OJ 3I58A 3S3NA 1BI2A 4EATA 2BYVE 2YDSA 2KLOA 3O2PE 3K69A 3JRBA 4NHJA 2R0QC 2J47A 5EGOA 4UV8A 4LLGF 4LJZF 4FE7A 2ZKZA 2VOOA 2KSRA 2CH0A 2H6CA 2VKDA 4XM3A 4AYBN 2FUPA 4HW0A 1WFDA 3RYHE 1X58A 5LBQB 1WCMJ 1P4AA 2AXTC 3KP7A 3RZDJ 4FISA 2EHOC 2ELKA 4PK4A 4IRGA 3AA7B 4O4LE 4GKKT 2XPKA 4DV6T 2BG9B 4DQ2A 2KIFA 4UUSB 3HDDA 3CO6C 5HDKA 4UY8I 5HEOA 1MH4A 3IP4B 1GQEA 2FSWA 1HR0T 2E1OA 3CMYA 3CESA 3PM1A 2NAZA 4BHCA 4RDUA 4HTEA 4BEHA 3H1CA 2CXLA 3FZKB 3VHLA 3CIRA 2DW4A 2AHQA 2K5CA 2HKOA 3C2BA 4KYWA 2X6XA 1R6RA 5BPIA 3RF1A 2HOAA 3HRSA 3MN2A 3ANWA 2X4HA 5LRSA 3ABKH 3KZZA 5IYDJ 4QXCB 1T0FC 2ES0A 1Z91A 1FLIA 4Q47A 3CUOA 4CI2B 3Q5XA 2ZJPF 1I39A 4Y33A 3ZP5A 4JI7T 4CXXA 4HNTA 2L7ZA 4GK0E 3KBTA 3ONLC 3AAAB 5L47A 2WS3A 2O9LA 4M74A 3J80K 2SPCA 3GUDA 1PDNC 3WHCA 2IW5B 2KRCA 5AQJB 3QOFA 1BR2A 1RUOA 5FLXZ 3IH4A 4FT8A 5JDMA 1LB2A 5FB2A 4DGWB 4KN7X 2EB7A 2MGQA 5TISC 4B4CA 3REOA 4CZZB 1TW2A 4JQFA 3J7AY 5LB7B 1JHHA 1B4AA 2JIWA 5EG0A 3VODA 2GOMA 1J5ET 2LBFA 4FETA 2QQBA 1IJ6A 2DMQA 2DTRA 3PSFA 4ENKA 2L9SA 1H9TA 4E7KA 2R92J 3KCCA 4UR9A 3PIOF 2E2JJ 3MQ0A 2A2FX 1ZG3A 2GIVA 4FI5A 2E5LT 5K5RA 1U4QA 3CUQC 5GAEJ 1OXZA 1XC5A 2X9XA 2F48A 3I1AA 1FJGT 3D0TA 2IEKA 2EFOA 3CCVI 4P9UA 2W7NA 2FJAA 5J0ZA 2MLKA 2F5EA 3ZQIA 4DV5T 2JJ9A 1KQ9A 5JVGF 1IRXA 4YIFA 1A31A 4BJ5C 5LJNA 3ONQA 2HVSA 3VYTB 4PDKA 3OV8A 3UR3C 2WB5A 3OYAA 3AL0C 4ZI3C 5LLQA 2QYWA 4BJMA 1EH6A 3GMEA 2DQRA 3S1NJ 3HSRA 4HFDA 3RKGA 4G6QA 3HEFA 4LB6B 1W36C 1VQ4I 1Y39A 3R84B 3RC3A 5IWAT 2X6YA 3K1SA 1B59A 1YW8A 4KHZF 2P8TA 2CW7A 5FKKA 3PUGA 3I0QA 4BJ6C 1ZH5A 1HC8A 4M9XA 2JZYA 1KU9A 1R58A 2KKOA 5D5UB 1ZRFA 4U2ZA 3QWLA 2PMUA 2BG9E 5FYMA 3F6OA 1X3ZB 4BY7J 3JAFA 2LY9A 3OS2A 3BG9A 3ZMVA 2KMUA 2LLYA 4IRHA 5C2TA 5LG4A 1MMNA 4JX5A 1IBLT 3M07A 2J5PA 2W00A 2I0MA 4GO1A 4HEA2 3F72A 5ILVA 2FMYA 3GF2A 2CCQA 5DV5A 4U7YA 5ETWA 2MAWA 2LSYA 3RRWA 1OCCH 4XOTA 1X1DA 4C2UA 5AQKB 3WAKA 4XK4A 1TL8A 3S15J 3TDUC 1FPQA 4HGAA 3LSHA 1OISA 2KZGA 4DR3T 4NC7A 2WZIA 1HNZT 4HWFA 1G3SA 5E1WA 3RQIA 1J9IA 4CYCB 3ZN1A 2LTPA 5L3BA 4JI3T 3Q0WA 2ZFUA 4FX0A 2VI6A 2PJQA 2XQ3A 1I5ZA 4FASD 1I6XA 3A03A 4C3JJ 3EAMA 1LNWA 2JK3A 2K9MA 2LOPA 2UXCT 2ZNZA 4D5FA 3UU6A 3K1NA 2XQ9A 2RV8A 4Y7NJ 4QLCU 3K6GA 5FKNA 3UFEA 4UVCA 2RREA 3F9KA 4I0AA 1B8IA 1T72A 4JOMA 1HKQA 2IC6A 1US7B 2XAQB 1B6AA 3HSEA 1KU2A 4OIPF 5HEHA 5JVDE 4UVAA 1R7JA 4DV0T 3QYEA 2CQQA 2IUBA 5ADXL 3E5UA 3WU0A 1IC8A 2BS4A 5F0CA 2VONA 1USSA 1FMVA 5B3SH 1NWMX 2W0GA 1IDZA 5E3LA 1U8RA 1RETA 4DV4T 1TQPA 4XKVA 5GPAA 4D9JA 4PZJA 4BXUA 1O7LA 4DJAA 4I50E 1WWXA 2QGUA 1OCOH 3LFKA 4I7HA 4EB6E 2P81A 1BIBA 3E1SA 1RPWA 4MNUA 1NAFA 1IN8A 4CA0A 2XPWA 3BR0A 3A2KA 3WGGA 3JC6D 4YSZA 5LGNB 3ZCOA 3FBLA 4U7IA 4UF0A 4QWQA 5FO5A 2DT7B 4Y3OA 4HWIB 1ETQA 4RM3A 2Z6EA 5F6FA 1PJRA 1IBMT 2MH2A 4JP0A 3ZMTB 2OCEA 4AD9A 1BM9A 4EEBA 1DQUA 2HDWA 3B6AA 2Q0OA 1OKRA 2JRKA 2XQ7A 2IA1A 3HB9A 4ZS3A 3CX8B 2L3DA 4QH1A 4IHSA 3ZC1A 1IUFA 1GV5A 1HSJA 1WVRA 3TDZC 3MZHA 3GBGA 2WC2A 4AKLA 1IF1A 3M1CA 4CCKA 2GXGA 2ZXJA 3DKXA 3PFYA 2FJDA 4ENNA 2D5UA 3IHRA 1V54H 3IWZA 2EK5A 1S7AA 5L4EA 5AQVB 2P5LC 4WWCA 3C51A 2DA6A 3RZOJ 3LQRA 1YG2A 4ILBA 4Z91A 1H7CA 3KPHA 4YLHA 2NOXA 4RAZA 4UV9A 4E70A 2IS1A 1UCUA 4IREA 1XS9A 1VQ6I 3X1DA 3AE3A 1S7OA 2CLYC 1S5LC 3AEBA 1FTZA 2XGXA 4KIFA 1IAWA 2LE8A 2MLGA 2H09A 4ITVA 3AECA 3P4WA 4L9JA 1USTA 2GA2A 3WTXC 3JADA 4TWFA 1YQAA 2OZ6A 2UUZA 3OIOA 4COFA 3GMIA 5IHYA 1XMKA 4MBQA 2JA2A 3PNVA 3QRFF 4G7OF 1ZHCA 3R6NA 4XSZF 2HZTA 2BV6A 3AFHA 2D0UA 2HEOA 2JSPA 4YFXF 2D2SA 2IRFG 2LG4A 3HKBE 5AQHB 4AWXB 1A36A 3W2AA 2WP9A 2HDCA 2VK9A 2WDQA 3GTLJ 4ILUA 1S35A 3EVYA 3H37A 1T8BA 1IG7A 2AO9A 5KK1A 1FSEA 5HYAA 1U0JA 5GAHJ 1OLTA 3B73A 2Y30A 4MFEA 3L2CA 3PJRA 3WI3A 1ZV4X 4B09A 3MACA 4CN4A 2HTJA 2NP9A 3HRMA 4W97A 3NZQA 5IPAA 2L2OA 2HKXA 4JEUB 4WXCA 2RPAA 2IA2A 4ESBA 5AQUB 1XGMA 1WJDA 2E8IA 2A3SA 3DF8A 4HPQA 4J00A 3IBPA 2R5YA 3MKYB 4RMNA 4FX4A 4KMFA 2GAUA 2ZSHB 3KV9A 1YE9A 2ODUA 2OAZA 5JTGA 5K5QA 4XKBA 1D8JA 3Q5WA 1TP4A 2XJ7A 1VQOI 3GYHX 2P0WA 3QP5A 2RVCA 1P2FA 2YS9A 2BXYA 4L9VA 3AKZA 2I5UA 1MMSA 3LFMA 1YI2I 1GXQA 5BNGA 4HRIA 2DOAA 5J2UE 2KWIB 9ANTA 4AQFC 5JVTA 2X51A 5B1AH 3FF5A 2DA5A 4M3GA 2C5JA 3UUBA 2IJLA 3J7ZI 2B1EA 2M0CA 2X48A 2EH3A 4IHXA 1I27A 1WJAA 3HKZA 3Q5DA 2V1NA 1FP1D 2AQFA 5AQQB 4L9IA 2ESHA 5JHFA 2ACXA 1R00A 4AUXA 1IV6A 1ZAOA 1MDMB 2AE9A 1U5TB 2DOEA 2XASA 4EM1A 4YRVA 4KA4A 5LD2C 2GM4A 1QPIA 4LF5T 5BR8T 1LKXA 4KT5C 2WDRA 3HYIA 2XSDC 1T56A 3FISA 4DIDB 4U7BA 2A6TA 3UU4A 1RI7A 2JPBA 2QQ8A 3K10A 1Y8QB 2CMPA 3HJEA 5HS8A 3S2DJ 4H63H 4JLEA 3M7GA 5D5WB 5TAOA 1H0MA 5DUIA 4AXPA 3N9OA 5F0FA 3ABVA 4JI2T 2LKSA 5TGTA 1XGNA 3VPRA 2L9RA 5EZHA 3W6VA 3JRGA 1MD0A 2H89A 1ERDA 3SEQA 3ZMUB 1S6LA 3OYJA 1T8IA 2LOSA 1J7KA 1G59A 5HXCA 4DUZT 4BXFA 2DFIA 4ESJA 2L9NA 3COAC 4JEHB 4II3A 1X1PA 3QAHA 5CVIA 3HBLA 3IL2A 2W61A 3O1HA 3PIPF 2EHOB 3MKLA 2PJRA 1ZHFA 1FC3A 4IHTA 5EK4A 2O6GE 3F2EA 4CCLA 1WSUA 3QOPA 1U9NA 1Y8RB 2A5YB 2VBZA 5GP9A 1IGNA 3S8PA 4MTDA 1GXPA 1YRNB 4CCMA 4HFIA 3CX6B 2FQ4A 2LF7A 1VQLI 1SAXA 3HOWJ 5F1RA 2HYFA 3QPLA 4HNUA 3GTPJ 3ZN0A 2FJEA 3U2RA 3ESWB 4YTMA 3AEDA 2UXNB 2X0LA 2HQ5A 2X9DA 5J1UA 2XF7A 3I64A 3OIPA 1TZLA 2KIMA 5HLIA 2H88A 5FFZA 3ZC0A 1SFXA 3JRAA 3CMAI 1FOKA 3CKDA 4G9YA 3BP8A 3DEWA 3O9XA 5HODA 5L3CB 1ULYA 2FD5A 2O0YA 2XIGA 1UELB 2E19A 2KRFA 2JT1A 2LKHA 4YSXA 3IKVA 5F5WA 2CMRA 4P5OA 2YPRA 3A0BC 2FX0A 4ENMA 1D0XA 2V7IA 5L4HA 2QEXI 3OR1C 4M1PA 4QH5A 5H20A 5D5XB 2M87A 4XMYA 1UMQA 4PJNA 1K78B 4TV9E 5JH7E 1HTJF 1HQCA 2YR2A 4AIDA 3L7WA 3ZOBA 1AKHB 1FZPB 4UIGA 2HPJA 1DU0A 3O6BB 2GK9A 1C0WA 2HN1A 2HS5A 2VJ5A 3GFLA 4XICA 4LG0B 4IJAA 2M9HA 2E1CA 2R4GA 1HFAA 3ZT7A 3P4RA 4CH7A 2K9LA 3NZPA 1PYVA 2E36A 1ENHA 3K0LA 4IE5A 1UG0A 1VQ8I 4CI1B 1RRJA 4JV5T 2KHMA 5IOYA 4H0EA 4JX6A 3HTSB 1F5TA 3M3YJ 2IS4A 1VFCA 4JI5T 1Y01A 4PJJA 2KZ7B 1JNRA 3CUQB 2WB1A 2H8RA 4M71A 4EM0B 2FBHA 2V6EA 2V26A 1YYVA 2MC3A 4L9NA 4MIMA 2NS8A 4I99C 3IH3A 3BLYA 4P9FA 1QZZA 2IS2A 4EV6A 2R5ZA 2KFDA 2VC1A 4NQWB 4A98A 4TWDA 3FDYA 4X20E 3KV4A 5J1GA 2KMFA 5C44J 3CJTB 3Q9SA 5K7ZA 1R4MB 1R5GA 2OZUA 2ZMEC 2KDOA 2H6BA 1V3FA 5JQGE 4P0AA 3AL0B 1JE8A 1OWAA 5D4RA 5AIQA 2ZBKA 4KUMA 4BQAA 4IQJA 2AXDS 2W1OA 2ZM8A 4BQNA 4YIRX 4DNCA 2CE7A 2ZM0A 2RGVA 2KISA 4HSTA 3OIQA 1UGOA 3UFGA 1E1HB 3RKXA 5FD5A 1T6SA 4RGXA 5JDNA 3OYFA 3PSIA 1O57A 1XDOA 4ZXLA 3SJMA 1KFYA 1RZ4A 1DP7P 3AAFA 4P55A 2A3DA 2NS0A 4EGYA 4A5NA 3S4UA 5H2FC 1T2KA 3RIUC 3VYRB 1DDNA 2LSIA 1GUUA 3PJAJ 2OD5A 2COBA 4PGHA 2WU5A 1U5PA 1VNDA 2B7EA 5J4VA 2XTLA 3K2AA 2EFQA 3QK6A 2VL8A 1T98A 3BOQA 3UKGA 5LBQA 5LCYA 4CCNA 4YFKF 2DA3A 1DP3A 2PEXA 1HW5A 3LA7A 3WTTC 4AIKA 3JREA 1ZR4A 1E17A 2V7JA 5M4YA 5E1XA 1BI3A 2YKSA 4UUSA 3OY9A 4FJOA 3CC7I 3PUWF 3EDUA 5GTIC 2CM0A 1WRJA 2Q9QC 2JUGA 3I9WA 2NXNB 4JI1T 1HG2A 1FBQA 1OEDA 2BBHA 4X1IE 1NTCA 3LA3A 2UXDT 2CQNA 2CXDA 3KZIC 3CCMI 3EDPA 3LSPA 4X66T 2HPMA 1ODDA 3CLQA 1TT5B 4ZYGA 3KP6A 2W84A 3PUXF 5HAXA 5DEQA 1S7EA 1FT9A 1Y56A 4A3BJ 3DU6A 3UU8A 2VQLA 1PUFB 3ZT6A 4OOIA 1VCSA 2EIJH 3AE7A 3FZFB 2Z3YA 3J9X1 4ZI3D 3L9FA 3P4SA 1QVTA 3C18A 3EI0A 4K2EA 2V9PA 1MBGA 3K7AJ 1QQIA 2VJ4A 1S9HA 3F57A 4CXYA 1VQMI 5FP3A 2VKOA 2UU9T 1DU6A 2NVXJ 2IW5A 1JXSA 1VI0A 3I71A 4HBLA 4ZYDA 3L2UA 3RIAA 4LF6T 3T8OA 1BJZA 1OCRH 3VRAA 4QX7B 1F9NA 1IBKT 4ILAA 4ZYAA 4H4KC 2Y2ZA 3C50A 2VASA 5LHIB 2V7FA 5CA0E 2NS7A 5CGMA 4ZYEA 1J1JA 3H9JA 1IRGA 1S8NA 3G3ZA 3W3CA 5C3EJ 2BKOA 2Y69H 5HLTA 2XF5A 1MSEC 5AONA 3IWFA 1QU3A 2VKEA 1DGRM 1REPC 4C9YA 3CDIA 5FLXK 3IH2A 4F8HA 4LMLA 5FLMJ 2LHNA 1WGXA 5AQOB 1W0AA 3OYXA 2Y9ZA 1V9DA 2VQFT 2DXIA 4DYCA 2E9XB 2XQ8A 3CCUI 2VBWA 3X2QH 4KP3C 4PFPA 4Q5SF 1YHQI 4LFBT 3SQNA 1Q1HA 2P9BA 2W66A 4EMSA 1J75A 4UELA 1R4NB 1POGA 3OWTA 3VDXA 3DTKA 3NEUA 2V1DB 1OJLA 3KP4A 5HXRA 3FKIJ 2YSRA 1BJAA 2M7AA 3FBNB 3FWEA 3K4JA 1F43A 3SFIA 2WMNA 3LJCA 4AQYT 2DQLA 3P7IA 1IDYA 5ABEA 1JT6A 2UUCT 1G3YA 4BBSJ 4GDFA 4M3EA 3RIRA 5E0OA 2A61A 1HW2A 4G7ZF 3KLNA 3ERMA 3EUKL 1VQ9I 3BCAA 5LEJA 2A68F 4S04A 4RAFA 2UZKA 1T08B 2CLYB 2UXBT 4UHTA 2CRBA 1UK5A 2DA1A 2HOTA 4X5TA 2WAQN 4L5JA 2ZSIB 2DMPA 3TKYA 3VFZA 4Y15A 1BOBA 3L09A 2EFPA 5LHHB 2LLKA 4I76A 2HDDA 4YFSA 3C4XA 4V2FA 3TKLB 3VKHA 1XN7A 4ZDLA 1SVOA 4FTHA 3VR8A 4XLNF 3CD6I 3BG6A 6PAXA 4TNWA 2EIMH 1H89C 2CUJA 1WI3A 1Z05A 1Z3XA 3K3NA 1IN4A 3ABTA 5A1LA 3LFUA 4WXHA 4TN7B 2K9QA 4ABZA 1FTTA 2XC7A 2ELJA 2V9KA 3MMYB 4BQOA 3P50A 1I3QJ 1K4TA 2PN6A 5GADJ 2QRXA 4GGGA 3CCYA 3VEPA 4NB5A 1YITI 2Q2EB 4WX9A 5FLVA 1TWHJ 1ZQ3P 2E9XD 4HZFA 5AIPA 2CA5A 1ON2A 3A01B 2XM1A 1G3TA 1Y6IA 4CDGA 3FKJA 3H3UA 2V7KA 4LFAT 2LKXA 3S1MJ 2FNAA 4UVBA 4RLFA 1X19A 3HG9A 3N2KE 5CQGA 1W7PB 1YJ9I 2CWEA 4A3DJ 3AEGA 3CK6A 3GZ6A 4XLFA 2MTQA 2HI3A 4E7SA 4OK0A 3ZPOA 1N75A 5HWXA 1JJ6C 1Y1VJ 2RNJA 2XQYA 3FM5A 3F8BA 1VTNC 4ZJZA 3UQ7A 3M8FA 4BKXA 4LLNA 5LJMA 3S2HJ 2H1LA 5J8FA 3FXOA 4AVPA 1RC9A 2VIXA 1ON1A 1O4XA 4QKNA 2L7KA 4O5VA 4V2GA 3GA8A 1XMOT 3CWZB 3BCBA 1UHMA 2STWA 1FBSA 1YS7A 4YSYA 5J1YA 3LG7A 4LF4T 2EWNA 2YK0A 3FBZA 1T95A 2KINB 3L39A 4IL9A 1G73A 2QBYB 2XDVA 3DLLF 3RYPA 3AVRA 2CO5A 4E7IA 1IJ5A 1ZLKA 4M72A 5LGNA 5IY5H 4BH9A 3H0GJ 2R7RA 4O4IE 2DBBA 5HEUA 3J7Yq 1D0YA 2R7UA 1CUNA 4Q4ZF 2E1MB 1B9MA 2VVNA 3WGIA 1I3AA 2QKMB 5DUKA 3ZMTA 2RC4A 4DMWA 4P1WA 2WAFA 3HI2A 4IDPA 1D3YA 1G3WA 4IRIA 2BBJA 2JWTA 3ZYKA 1TWCJ 2CHNA 5LYJE 3MFKA 1ORKA 4II2A 2J4GA 5HEJA 2P5KA 2H1KA 2PMZA 3SWHA 4DR6T 4YXDA 3F0CA 3A0HC 3BJAA 3RCOA 4A6EA 3V8KA 2WWYA 3JTGA 1MIVA 1NEKA 5K7HA 3ZYLA 3IHUA 3OL4A 4M9ZA 4J19A 1TQIA 2Y0SA 3KV6A 4M6VA 3B13A 2NOGA 5FFXA 5E8GA 3ZJ1A 4ZYHA 4N0BA 1S94A 3CMMA 4G12A 1LPQA 5K5OA 4QSHA 4IE7A 3FK7A 3VR9A 2J62A 4XORA 4QWNB 3LBXA 5GONE 3Q3SA 4HE8A 1JUPA 1FSHA 2LM2A 4ZI7E 2EV0A 3AA0B 2K3PA 3HGYA 5FVLA 4A56A 1I50J 4RGRA 5KMGP 1S3JA 1TW3A 2Z1DA 4HF2A 4GXOA 3G06A 2XAGB 5GTHC 4Q25A 4ZHQE 1XMQT 2KJCA 1HX8A 2AQEA 3I9V2 4RGSA 3WU2C 3FMRA 3VOEA 2R7VA 2ZB9A 3BQIA 4DIQA 3FB2A 1HSTA 3KP2A 1ETOA 4ZZBA 2LP0A 1W09A 1QHHD 2QSGX 4OWRB 2V5CA 4HNVA 5JRCB 2WCAA 1XCVA 2MC4A 2LJLA 4BBRJ 3E0ZA 4DYRA 4R1HA 3C2HA 3R0JA 2XKOA 2A07F 2IVMA 2CQ7A 4BDZA 2JA6J 4YJ2E 1TLHB 2R7FA 3K4KA 4LF7T 4B3MT 1IXCA 3J81Z 4LOCA 2NTYA 2LKGA 2DU9A 5E79C 4V19K 3WODF 4KMUX 2X9YA 4EEFG 5HDNA 2NVYJ 3BQLA 4OYJA 2PTFA 1OR7A 5FMNA 3CP2A 3SS1A 4NXNT 3AE1A 2B0LA 2L8KA 3PUBA 3NQOA 1FP2A 3CPZA 3T5XA 4IIJE 4ON0A 3ECHA 2EV5A 4U0VA 4YG2F 3JSOA 2H27A 3C2GA 2NNNA 3E0JB 2PG4A 2EFWA 5LEKA 3T1YT 5JDLA 3QPTA 4IVNA 4MGRA 3OS0A 4BE1A 3GWHA 4BNCA 2DODA 4AU7A 1IXSB 4UUVA 5LHGA 3FXMA 3BZCA 1CF7B 4I2OA 5AQMB 3K70C 3WTYC 1B9NA 2CEAA 1LJ9A 3HPGA 2BXZA 5FKLA 1UHWA 3WG9A 1P4XA 2F4MB 4A0ZA 1UG2A 2I6HA 1SEUA 2KT9A 1V5FA 1ZEEA 1HNXT 3PQJA 3N05A 2ISYA 3BR5A 1WJCA 3G1MA 4BJTA 4F55A 4XKWA 3SDBA 3GN5B 2L4AA 3ML6A 4NPPA 1ITYA 4YY3T 2P5VA 2V6YB 1JT0A 3DBLB 1HA8A 5HXEA 3AG2H 2E71A 3PTRB 3E7LA 2OF7A 3BK9A 2RDPA 3OVUA 3K1MA 2CPTA 1IN6A 3PO3J 1RIOH 2LR8A 1P9QC 4RB2C 1XWMA 1YKHB 4I02A 2OPTA 1QSDA 1BR4A 1MDMA 1Z7LA 4IOAF 3M3ZB 1U5TA 4KMCA 3FX3A 1TNSA 2XF6A 2QCOA 4OMZA 5LGTB 1XMAA 3VSLA 5KVRA 3LSKA 2PG8A 2ZMEB 4MALA 3AB3B 2KWHA 4OFZA 3ZKRA 2DYRH 1ZN2A 4LMJA 2H7OA 3FM3A 4F3QA 3JW4A 1DPUA 4NDLA 1R1TA 4V1Av 4CSWA 2GXAA 4A3KJ 1TNTA 3I4NJ 4BUPA 5HCJA 4LIVA 5ICEA 4WK8F 2QQ9A 2Q8KA 3VYSB 4F6RC 1O3TA 3CJNA 3ABLH 1KONA 2VQHA 4ADZA 4UB6C 4BS9A 2A5WA 1TTYA 3A7MA 3ZMUA 1W0UA 1OPCA 2X1DA 4ZZDA 3KDSE 1MBFA 2YN6A 4ISSA 3IAS2 1HF0A 3HOVJ 2HH7A 4ZI2C 4WBOA 2Z5UA 1L3LA 1O7FA 1LDJA 3C1DA 3KYDB 1KNZA 3GXOA 4X0GA 1MMAA 1AOYA 4IZZA 1BOAA 3EYIA 3BG5A 2IBDA 3MWMA 1PP8F 3UU3A 2KNDA 3G6EI 2C5IT 3BQKA 4H9OC 2JVGA 5EYRA 5AQTB 5ERIA 2ISZA 1FEWA 3ETUA 2LT3A 5FD6A 2VB6A 1CQTA 2XAJB 5DYMA 2Q9QB 2OBPA 1I6HJ 1YRNA 1SVMA 1B72A 2HPLA 2BY3A 2VKVA 4RAGA 3JR9A 1SFEA 2VT2A 5DM6F 3MA9A 2FUG2 2YX4A 4GYRA 5HWYA 1J09A 2UXNA 1MJAA 5DD8A 1KEYA 4CN6A 4CN1A 4U33A 4UXNB 5H6QB 2DFEA 4A3FJ 3OSFA 4NUVA 2LNBA 2V1UA 3BWGA 1X79A 3IKTA 3JRDA 4J2CA 2RKHA 1XPXA 2WU2A 3N2GE 4CXFA 5F0HA 2X67A 2OQGA 3WAJA 2VPLA 5L3CA 4JBAA 3RJPA 3RHWA 4IEJA 3PUFA 3RRCA 1IRFA 1UB9A 2OTLI 2NVTJ 2DDAA 3T8TA 3E08A 4DV3T 3IC7A 3S3MA 1WJ5A 1BW6A 2RP4A 5HCMA 2QA4I 2NTXA 4DV2T 2EA4A 1ZREA 1K78A 5E18F 2QWWA 2QUFA 3K4CA 3K1PA 2VVSA 1AKHA 1RESA 2IA0A 2KJBA 4LITA 3ZCIA 2EIKH 3EETA 2TCTA 3LOCA 4D7MA 1BL0A 1F36A 1OQYA 4LG0A 3ZQCA 2ZXIA 3KP5A 3K3OA 1OCTC 3BROA 4QPOA 2L9QA 2UUAT 1NK2P 3P4QA 4IL4A 4PCQA 1K61A 1PUEE 3LSIA 2FOKA 4M3DA 3RKQA 2QENA 5CVVA 1MIYA 4A97A 1VQ7I 4DR1T 2L5QA 2DK5A 3CUQA 2ZMAA 1ACIA 1ETKA 1BC8C 5L3FB 1YW0A 3Q9DA 4XNFA 2CGPA 1OCPA 2LY1A 5FXVA 5M3MJ 2BY1A 1KGSA 5F27A 2R7ZJ 1G2HA 4YIIA 2M6BA 1TWFJ 2ELHA 3RSNA 5FY1A 2Q9QD 4XN0A 3O1IA 5AFUL 2M3AA 4NQWA 3H92A 1WPKA 2DPUA 4MLOA 3BC8A 1D1BA 1HCIA 4EV0A 2QM3A 4BEHB 3AA1B 4I4TE 1FEXA 1FBUA 1X2NA 3SDGA 1MMDA 2C0SA 3ULQB 2NRAC 2MBFA 2DLRA 5C4XJ 2LREA 3Q5FA 4XKCA 3J80Z 2K7LA 3AE8A 1SFOJ 4AIUA 2BW3B 4EYUA 4YT0A 2CV1A 4C3IJ 2JRTA 5HLHA 3GLLA 2WSSV 3H36A 4PGGA 2K4JA 3PU3A 1P6RA 1JNZA 3OYMA 2CUEA 2WZHA 1YXRA 4G7HF 3UUMA 5KXJA 3F8FA 2PMHA 5FL1A 1UAAA 1IUYA 5AQGB 4XLEA 2OJED 2DAOA 4B8XA 2R7TA 5C4JJ 3CQZJ 4XLCA 4YTPA 4NNJA 3TLWA 1G6NA 2LSGA 3GX4X 4A6DA 2LK2A 1FIAA 2YX7A 3BG3A 4WCGA 4BAYB 1YTYA 5J3LA 4EJOA 2WTEA 1TQMA 2VURA 2V4JC 1D5VA 4A3LJ 1HNWT 3UNGC 4IDQA 4YFNF 2WY8Q 4U0WA 2GBYA 4EJWA 1HLVA 4U3CA 1YLFA 5KX5E 1WYCA 4PFOA 2ID3A 3F23A 2E5NA 3FXUA 5TRDA 3P8CD 2R6GF 3NWSA 2M45A 4QHOA 2YU9J 4MHGA 2BHYA 1K7AA 4F91B 1JGSA 2W25A 3DEEA 4LFCT 3MXZA 1IZNB 2JQQA 4K0UA 1H8AC 1SMYF 1UJ8A 1HF8A 2G0UA 1W9RA 1HS7A 2BEOA 3F22A 2WY7Q 2HR3A 4ILCA 3WG7H 3CMEI 1PUFA 2JQ9A 3O8GA 4YTNA 2EPFA 4IDNA 2X9HA 1Z67A 5HXSA 2M1BA 1XTAA 1VOMA 3T8RA 5ILSA 3HKZN 4I0BA 4IL6C 4N4OB 5DM7F 2A72A 1YKEB 3CVRA 2HOEA 3I9YA 1NK3P 3P4PA 1IXRC 2YU2A 2OA4A 3NARA 3FXKA 2G9WA 3HM5A 3M9AA 4BY1J 1HKSA 1YQ3A 4WW0A 2I10A 1W1WE 5JLXA 1K6YA 2EINH 3TO9A 3TP3A 2W63A 3JSPA 1YO5C 1R8IA 1FMWA 1JHFA 3HTUA 3UQ4A 3OKQA 5LHIA 5DCMB 3GEZA 4O8SA 1LQ1A 2W2UA 3KYCB 3FXLA 4GYGA 3F8CA
chains in the Genus database with same CATH topology
4I43B 3SZTA 2WV0A 2J5OA 4G63A 2IT0A 2BBYA 3P9IA 4H9QC 4EZHA 2E9XA 1IAPA 5D8LB 2BZBA 2IPQX 2M8EA 1MNDA 3F3XA 5L3GB 3ZQ7A 2ZJ2A 2DWGA 4PJMA 1Z6TA 2V1DA 5E8IA 1HXDA 5L3BB 4H9NC 4HQEA 4PK6A 4HX7A 4U72A 3LAPA 4IXAA 4GCVA 3RYIE 4DVDA 2NWBA 2PQ8A 4U7DA 3O3KA 3KEQA 5BPDA 2IAKA 3N97A 4ERRA 4RB0A 2YEVC 4UVAB 2W85A 3GWZA 2LSKA 2JPFA 1OYYA 2XUBA 5LHHA 3GZ5A 4X1YE 3BJ6A 1X3UA 3E3VA 4XSXF 1FX7A 2CG4A 4GYIA 4I09A 3I54A 2ADUA 2F5DA 4P96A 3WE2A 3CLOA 3GFJA 5ICCA 4DNDA 3KP3A 3I53A 1E2XA 2FA5A 2Q2EA 2YINA 5HVQC 3BDDA 2COMA 5JR9C 3P9KA 2EHOD 2AXLA 3VB2A 3V5UA 5CYVA 5CVUA 4YHJA 3E6DA 1J0RA 3V8JA 4GIWA 4DBQA 2HQRA 3LK2B 4QXHB 2NW9A 3BY6A 4IE4A 2MYSA 4ZS2A 4AIJA 3UUNA 1SD6A 5CVRA 4CO8A 5D8KB 2A69F 4JK1X 4U74A 5L3EB 1KU3A 3BPXA 2DLLA 5D6EA 3ZEFB 3PQKA 3QPHA 2R3SA 3FZVA 3K9TA 2QBYA 1U6GA 3RKWA 2VC0A 2A6EF 3FHNA 4AQFA 3RC8A 3I0TA 3PDYA 3C98B 2K48A 3C7JA 5BMVE 5C8YE 2VE8A 3NBXX 1MZBA 3KLOA 4KBMB 2DPDA 4C90A 2O8XA 3U1DA 2GZWA 4IPAA 4LB5A 5H6RB 2V7LA 3HHHA 5CA1E 1EH7A 1LVAA 3HRUA 3PURA 4TV7A 3WAJA 2L54A 1FYMA 1R22A 1KQ0A 3KINB 4HN9A 2XHEB 2D45A 1EZ3A 1BI1A 4M6XA 3TO7A 5JDQA 3NRYA 3LSTA 1QBJA 3BJOA 3AVSA 2XAGA 3AAIA 5HLGA 4P09A 3ZMZB 3DP7A 1YW7A 5JREA 1MKMA 3WTSC 2HQNA 1SHZC 3ABUA 5JRCA 3ISPA 1J2XA 4PAGA 2CWOA 4RGUA 4CZZA 3ZPLA 4WNKA 3MEXA 4L0RA 3U3IA 2G7UA 1O3RA 4B6XA 5HS9A 5LNKA 4MFRA 3TOAA 4MHCA 1YD8G 1AWCA 3HR0A 5HDGA 2O61A 4HKAA 5DQVA 4CQIA 4E7ZA 2FNPA 3JAMZ 2EFNA 3AAEB 3P9CA 4JUYA 2KLQA 5L2LA 4L5IA 2CSOA 2E7WA 5FNVE 1LEBA 2ZFWA 5E17F 4WXDA 2WWUA 4M73A 3J81K 5JHUA 4UNOA 4CICA 1FYKA 2QLZA 4PNIA 5D5VB 2W24A 1FNNA 3EUHA 4Z8XA 2NNYA 1VRBA 2P6SA 4R79A 4H9RC 1WRDA 3QUJA 2CFXA 4ZI2D 5J8CA 2DI4A 4ZH4F 1U78A 3MZYA 2BDEA 5CJ9A 3GN5A 2VKHA 3HRTA 2K27A 1WQ2A 1Z1DA 1WR6A 3QU6A 4OIRF 4MQ9F 3ZYMA 3SFZA 1W5SA 3WU1B 1ZKEA 4O2BE 5LGTA 2CXFA 2QGSA 5JDFA 1BR0A 3R6SA 2J1DG 5HS7A 2QZ8A 2P7VB 3L00A 3PUAA 2LF8A 5ED4A 3K2ZA 2XKPA 1EH8A 2QQAA 4N9HA 2F2EA 1LRZA 3M65A 2XRNA 1R1VA 4C91A 1QPMA 3UTKA 5F3JA 1DPRA 4EAHA 3ONXA 2XAQA 1BBYA 3UT5E 2NYXA 4MLKA 1V4RA 3DEUA 2HGCA 3E5XA 1UFMA 4CHUA 4G6DA 2FXAA 2XAJA 2Q9QA 1BC7C 1QO0D 2L3LA 3S2WA 4CXWA 4XZCA 2PFVA 1MGTA 5D6FA 3F21A 3Q2MA 3EQLF 5EEGA 1P4WA 3KETA 4UXNA 5H6QA 4LGWA 4S05A 3RYRA 3FMQA 2ODVA 5HYAA 4GK5E 1U5TC 1HBXG 5FXZA 2G7HA 1BIAA 1YW9A 5D4SA 3PUSA 2X9WA 4RB1A 4FHTA 4TV8E 1ZGAA 5EK2A 3DKWA 2X68A 3C3WA 4M9SA 3TGNA 3B57A 3E6MA 3FXRA 4CGZA 2HYGD 1G8XA 4ASNA 1GVJA 2UXXB 3LK42 3RX6A 3PU8A 1W7PD 2ZLYA 4L0ZB 2LEHA 1K79A 3PE0A 3R4KA 3G73A 3CDHA 4KN4X 1EV7A 3ZLIA 4Y13A 3QC9A 2CW0F 1FYLA 5L3FA 2HWVA 4ANJA 1R23A 2IP2A 2JSCA 1RUNA 3F8NA 3ZMSB 4EQQA 5BQTA 5BS6A 3KBUA 2WAUA 2XAHB 3DQVC 4EXTA 2W57A 5DD4A 3DV8A 5CVJA 1QUUA 3DTOA 4MTEA 4XBFB 5A2QZ 4XAXB 1MJ9A 2OQRA 2P6TA 3KVAA 2Y48B 3HKCE 5JDHA 4QXBB 2RA1A 5F64A 3N9LA 2KIUA 2JMKA 4O4JE 2LHRA 2N9DA 4ZZLA 3IEEA 3TOBA 1O3SA 3RDIA 4BAYA 1ZG1A 2C6YA 4HLXA 5K1YA 3EDVA 3E97A 2UWMA 2L02A 4UIGA 5IT9Z 3F8MA 5DQWA 2E7XA 2D2WA 4RB3C 2WBLA 1XD7A 3J7AO 5JR9B 3I59B 2FU4A 2VODA 4AKRB 2QYOA 1YIOA 2DO7A 3N9QA 1W4MA 4ZOLE 3E22E 4AQGA 4KFCA 1QGPA 2JPCA 4BA9A 1IN5A 2ESNA 2BE5F 4HLYA 4F7ZA 1B7TA 3HHGA 1HG5A 5FGMA 5LP6E 3H3ZA 4O4HE 3LWFA 5DCMA 4HDUA 4GYSA 1L0OC 3ZJ2A 1W5TA 2XVCA 1SFUA 4H9SE 5LGUB 2VBYA 1O3XA 3WTVC 2LSJA 5L3DB 4BYYA 2IC9A 3IRRA 2F5FA 4HQMA 5DABA 4GOUA 3KV5A 4A5MA 5L3GA 2VN2A 1PP7U 2EHOA 3T1BA 2K5BB 4G2AA 4LD5A 5LOVE 1YFHA 2L4MA 2ZM2A 3ESLA 2YU3A 3V4GA 4A0XA 1MMGA 3CO7C 1XB4A 4UVBB 1A04A 1XSDA 2XHKA 3CQGB 1H9GA 3FXQA 3KFWX 5JI6A 4TX5A 1T0FA 2O03A 1KYWA 4EM2A 2XAFB 3R0AA 3NRVA 2BGCA 2H94A 2N2NA 3K8PC 1MIWA 3IF8B 4HFVA 4CI3B 3C64A 4KDPA 1UX4A 4ISTA 3NRXA 2VBXA 5DCFA 3RKYA 4ENJA 4UV8B 4DMVA 4EZ4A 2E9XC 1B1BA 2OU2A 2MA3A 4OMYA 1KU7A 1UCRA 5EEHA 3GVAA 3N9NA 4AKIA 3SOLA 2AS5F 1F1ZA 1SD5A 2Y75A 1WLXA 1MNEA 2DCFA 5EK3A 1UX5A 3HKDE 1OYIA 1KQ8A 1MJBA 5FXXA 2C5KT 1ZRDA 5CLSA 1Z7UA 1SD4A 5L3EA 1KK7A 5ICFA 1QZYA 4OINF 3WTZA 4OIQF 3N5LA 3ANWB 4G8XA 3LBXB 2TDXA 3FMSA 3RTRA 1WYBA 1LDDA 2GQQA 4Y17A 3OBVE 2VKJA 2FE3A 1LEAA 1J59A 3ROUA 1RNLA 3CX7B 3U78A 3BPVA 3D5LA 2CYYA 3I5UA 4HA8A 5HOOA 4LMYA 3ELKA 3E5QA 1ZLJA 3PUQA 5IYZE 5LBMA