1T98A

Crystal structure of mukf(1-287)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
274
structure length
266
Chain Sequence
b'VPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome partition protein mukF
molecule tags Cell cycle
source organism Escherichia coli
publication title The MukF subunit of Escherichia coli condensin: architecture and functional relationship to kleisins.
pubmed doi rcsb
total genus 100
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t98A01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1t98A02
1BI3A 2G9WA 2D45A 3NQOA 5JI6A 3FHZA 1YG2A 3ML6A 5E17F 3RI4A 1P4XA 1GVJA 4ESJA 1VTNC 4ESBA 4MTDA 1Z6TA 1J75A 1FOKA 1QZYA 3O3KA 3QU6A 1E17A 4YFXF 1MJAA 1P4WA 1U6GA 4BAYA 1HW5A 5LHHA 2M8EA 1WQ2A 2DPDA 2FBHA 4L5IA 3GX4X 1WSUA 1WI9A 2GA1A 1LDDA 4CICA 1XCBA 1Q1HA 4ZH4F 1MZBA 4I01A 3WTTC 1O3TA 1BC8C 1LVAA 1UCRA 3ZMSA 4LFUA 1ZG3A 4RAYA 3K1PA 2P5VA 1KGSA 3ERED 1IF1A 3QAHA 5ED4A 4MQ9F 3IHUA 4KIBA 2GIVA 2CQKA 1I6XA 1LDJA 2RVCA 2PMHA 3F6VA 2W84A 3ABUA 4BNCA 4LGWA 1LQ1A 1J9IA 1B4AA 1R1TA 3T8RA 5L3FA 1KU7A 3E5QA 4CYDA 2DI3A 4IHTA 2D1VA 5DCMB 2DO7A 2DQLA 2IT0A 2FEZA 5DCFA 1ZRFA 3Q9VA 3GXOA 2QZ8A 1JHFA 2A68F 4B8XA 1B59A 2JPBA 4UUVA 1SD7A 3KZZA 2O8XA 1XSDA 1USTA 3FMSA 1BI1A 4G6QA 1TTYA 4IHSA 4L9JA 5FD6A 5FO5A 5KK1A 3LAJA 4WWCA 1FBUA 2FMYA 4O5VA 4KYWA 2XV4S 1YW9A 2XIGA 3I54A 5F6FA 1F9NA 4RB2C 5ICGA 4UV9A 5CVUA 2IP2A 2QENA 1LJ9A 1B6AA 5DD4A 4LG0B 3F8NA 3GW2A 4AIHA 5LEJA 4A6EA 5ILUA 1NHAA 1G3SA 2E1NA 2CG4A 2ZMEA 2OAZA 3ULQB 2HQNA 3R60A 3P9IA 1T38A 2BGCA 3SFZA 3LFKA 4EMSA 2COMA 1PP7U 2O6GE 1C0WA 1WRJA 2LNBA 2M1BA 2JRTA 2V79A 1OYWA 1XB4A 4KUMA 2KRFA 5KVRA 4Y15A 4L0YB 1IN5A 1R1UA 2DW4A 4KFCA 3BY6A 3JAMZ 5BS6A 5BMZA 1ZN2A 2CSOA 1D5VA 3JSOA 1FT9A 1SD5A 3BJAA 3E6BA 3GUDA 4AD9A 1R22A 3K2ZA 3RTRA 5E8IA 3L9FA 3RJPA 4N9HA 4UHTA 3HOTA 3KLOA 1RNLA 2HZTA 3WU0A 4M71A 4AVPA 1IRFA 2L4MA 5D6FA 5LGNA 4XBFA 2VT3A 4OOIA 5FFZA 2L02A 4CDGA 4H0EA 1YIOA 1G3WA 2X4HA 1UHMA 2K4JA 4EJTA 1ZLJA 2VE9A 4NQWA 1YYVA 4Z2YA 2A3SA 4HV6A 2OD5A 4KMUX 1BM9A 2F5CA 4M72A 4YFNF 5FLXZ 3BJOA 1HKQA 4MEYF 4O6JA 1BIBA 4RGSA 4A5NA 4U7BA 3E6MA 2JTVA 3CUQC 4U0YA 3WTZA 1X3UA 3BP8A 3WTSC 1XGNA 2DU9A 3CUQB 1HW1A 4EVIA 1R5HA 3EQLF 4XLNF 1JE8A 2WC2A 3BWGA 3JW4A 1KYWA 3CO6C 3B73A 4EJWA 5JR3A 2G7UA 3U9GA 2ELHA 2ZXJA 3Q5FA 2VC1A 3HRSA 2IRFG 1PDNC 2VN2A 2HDCA 3RYRA 4GXOA 3LWFA 3GYHX 4EJOA 2RN7A 1LB2A 4XLPF 1QPMA 1IXSB 5L3CA 1U3EM 3MEXA 3H92A 5L3GA 1RI7A 4G7HF 5ILSA 4WXHA 3KP3A 3FM5A 1FNNA 2V9VA 4OIQF 2G7HA 2ZBKA 2PEXA 5HLGA 2GXBA 4IXAA 1G4DA 3FZVA 1I27A 2PG4A 2E1CA 3KLNA 5E8GA 3V7RA 1ONVA 1W5TA 2KIFA 3FXUA 3R4KA 4L0ZB 1HKTA 2FRHA 4M73A 2Z5UA 3LA3A 1O3QA 1O57A 4O3MA 1YW8A 1YLFA 5JHUA 4ZYDA 5EEGA 4GGGA 3BOQA 2ETHA 4HAMA 2QM3A 3IWFA 4NB5A 2MH2A 1R7JA 2Z99A 1ULYA 2A6HF 4KNYA 5BPIA 3LQQA 4S05A 1P6RA 5J6XA 3DF8A 1P2FA 2MBFA 4ZYEA 2BYVE 2L4AA 1DUXC 1I5ZA 1KQ9A 1QNTA 3MCZA 1S7OA 1QZZA 3HRUA 2MLKA 2QYOA 3TO9A 1LEBA 4HQMA 1QBJA 1G6NA 4IJAA 1O7FA 3IWZA 3WG9A 1Z1DA 1OKRA 3C1DA 4LLLA 2Q0OA 3N4MA 4ZYHA 4A0XA 3ZMUA 1FPQA 1RUOA 3J81Z 4EV0A 3MAJA 3K9TA 1PUEE 2EJRA 2P6TA 3CTAA 3K69A 4L5JA 3FF5A 2XGXA 1USSA 4A6DA 1H9GA 4U0WA 4HF1A 2ZCWA 3J81K 5LLQA 2VOOA 2DLLA 5E1XA 5E1ZB 2DK8A 3JSPA 3CUQA 2IJLA 5HLHA 4PZJA 1FC3A 2GAUA 4LJZF 2YX4A 3R61A 3CJNA 3RYPA 2PN6A 4ENJA 1W5SA 3E5UA 1O3SA 2XAJA 4A2UA 4UVBA 3WE3A 1D3YA 4MNUA 2L01A 1QQIA 4RS8A 5H20A 2O0YA 1IXCA 2BBYA 2FXAA 3FX3A 5IT3A 3VB2A 1UFMA 2EV0A 2XUBA 3S2WA 2B0LA 2Q2EA 2CW0F 5HS7A 3E97A 1W4MA 2O61A 1U5TA 4WK8F 1ZYRF 4A0YA 2QWWA 3M8FA 1O3RA 4BXUA 1IN4A 5LBQA 4P5OA 2MD5A 4UVCA 1ZRCA 2X0LA 3T5XA 4IRGA 1H9TA 4YIFA 4FX4A 3HIFA 3VFZA 4EGYA 3LAPA 5HDKA 2LKPA 1MGTA 4EJVA 3JTGA 1J7KA 5DV5A 2RC4A 3CUOA 4D0PA 4U0VA 3ZMDA 2ACJA 2VXZA 3TOBA 1RIOH 1SFEA 2EWNA 4GO1A 5HS9A 3K1NA 1IN7A 2JPCA 5LGUA 3HSFA 5L3DA 3BZ6A 3O6BB 4PGHA 2Y75A 2ZKZA 5HDNA 3EUHA 2VBYA 1OPCA 1TQIA 3RDIA 1YTYA 5DD8A 4CGZA 4F7ZA 4UNOA 1ZH5A 3J80K 2YU3A 2W24A 4U88A 5HS8A 3GFJA 5LHIA 3HOSA 2R7DA 4KN7X 3I0TA 2MC3A 1FSHA 2OZUA 4FHTA 1FY7A 1KQ8A 3LA7A 1ON2A 3DFGA 5CVIA 5EEHA 4U7DA 1BIAA 1BBYA 1OMIA 4R1HA 4A5MA 2A5YB 4P55A 2NNNA 2JSCA 1XDUA 3SQNA 3T1BA 4LLGF 1J2XA 2HYFA 2ZNYA 3IKVA 3IKTA 4P9FA 2ZJ2A 4BQAA 1MKMA 4XSZF 2UWMA 1AOYA 2BV6A 4M6YA 2EFQA 4BH9A 2MA3A 2XAFA 5ICCA 1K6OA 4M9XA 5AIPA 2MLGA 1HW2A 1BN5A 1J59A 5LEKA 1U8RA 5FFXA 4LK0F 2FMLA 3KFWX 2P5KA 1GHCA 1LDKB 1BJAA 3RKWA 5TJJA 3DKWA 1STZA 5HVQC 4ASNA 1F4KA 1KU3A 2KKOA 4EM0B 3OV8A 3HHGA 2D2WA 2VONA 1W7PB 3REOA 1R1VA 3I71A 1TNSA 2EA2A 2HS5A 2VBXA 3QRFF 2AXLA 1I1GA 1P4AA 3E6CC 3B02A 5E18F 2HKXA 1R58A 2XVCA 1ON1A 2GA2A 3HRTA 2ZO4A 4I0AA 1CGPA 1ZGJA 4CHUA 2KIMA 3R0AA 4EQQA 2FBKA 5DYMA 4Y13A 2DQRA 2HFHA 3G73A 2NNYA 3RPQA 5BQTA 3R0JA 4HW0A 3L09A 4KA4A 3F8BA 4HX4A 2K7LA 2UXNA 5D4RA 2RQPA 5IT9Z 2NAZA 4L9NA 1T39A 4S04A 1SMTA 1U5TB 4EM1A 4HDUA 3OOPA 1W7PD 4LB6B 1K78B 1HBXG 3F22A 1R5GA 2GZWA 2R3SA 1D8KA 2DFIA 3TKYA 1FBQA 1ZGAA 2FF4A 3WODF 4Q48A 2VT2A 1TQPA 2CFXA 3PFIA 5LRRA 3I59B 2A69F 3FXQA 1YO5C 2EK5A 5K5QA 3DPTA 3KEQA 1XMKA 3KP7A 1IRGA 3GWZA 1Z91A 2UZKA 3TO7A 5FD5A 2F5EA 4CO8A 1FX7A 3BJ6A 4LLNA 3SHFA 3C7JA 1L0OC 3E6DA 5HOOA 2CO5A 5ILVA 1S8NA 2P4WA 4L9TA 4HV5A 2YR2A 1REPC 5H6RA 3M1EA 3ROUA 2FQ3A 5J8FA 3KETA 3GLXA 2FNAA 4QWQA 1FWZA 2PJPA 1FLIA 2P7CB 4RB1A 4I02A 2ADUA 2EFOA 2Z9OA 1FYMA 2H94A 4A12A 4G9YA 1S7AA 2CYYA 1MD0A 4GYGA 4HYEA 3WTUC 1KYZA 4LD5A 3JAMK 1SD6A 1T98A 2LDUA 3RIRA 2O3FA 2QQ9A 1BOAA 5TRDA 2EFPA 1UB9A 1YS6A 2QLZA 3EETA 4AIKA 3ECHA 1Z6RA 4RB3C 4MTEA 3WTYC 1JHHA 2QBYB 2GQQA 1SD4A 2J5PA 2QBYA 5CLSA 4QLCU 2ESNA 1BI2A 1TW2A 3GFMA 3WGIA 3DP7A 2P5LC 5A2QZ 5BPDA 2EB7A 2XKOA 4I7HA 3V8KA 5FB2A 3QPHA 3TOAA 3ECOA 4HOBA 3W6KB 1Y0UA 5HDGA 3J7AO 3FMQA 1SFXA 4LMYA 3V8JA 1ZRDA 2FOKA 3I64A 2QQBA 4ON0A 3T0YA 3DEUA 4R8HA 5CVJA 4FX0A 4UV8A 1UHWA 1XGMA 2STWA 1ZG1A 4MHGA 3COAC 2HQRA 2LSOA 3R6SA 3ZQ7A 4ZZDA 2F5FA 2FE3A 3GO5A 1YQAA 5D5XB 3FM3A 1QGPA 1K78A 4HLYA 5L3EA 4OIRF 5D8KB 3IRRA 4ESFA 2NRAC 4TV7A 5DEQA 1J0RA 2RKHA 3V4GA 2M87A 5L3BA 3HTSB 3ZMZA 1XGSA 4A0ZA 4UXNA 3F72A 5DUIA 3WTVC 5D5WB 1MJBA 3PQJA 4IRHA 1ZLKA 1XN7A 3NRVA 3KP5A 3KZYA 4BHPA 1XSVA 2H27A 3QP6A 4HQEA 4N0BA 2BE5F 5AIQA 1FP2A 3RKXA 1HSTA 5DUKA 4I98B 2O03A 3TGNA 1JGSA 4KIFA 5D8LB 5J8CA 2DPUA 2P7VB 4XSXF 2ISZA 3RPUA 2H6CA 1HKSA 3MQ0A 1KU9A 2EA4A 4BYYA 2ZFWA 2L54A 1R00A 2STTA 3L2CA 3GFLA 1K79A 3KP2A 2VBWA 1B1BA 2IA1A 1O7LA 1G3TA 1G3YA 3ABTA 3EYYA 1EH7A 5CVVA 3QU3A 3F8FA 2YPRA 3RKYA 2F5DA 4IF4A 2Z3YA 1SFUA 4G6DA 3TDUC 3BPXA 1T0FA 1S29A 1TW3A 1KU2A 1XMAA 3KE2A 4M9SA 2XAHA 3K1MA 4OMZA 5K1YA 3JTHA 2DT5A 1DPRA 3E3VA 1EH6A 2DBBA 3LQRA 2OBPA 1E2XA 3HRMA 4M74A 1R36A 3HSEA 1YW7A 2HR3A 2EV6A 5ICFA 3L7WA 4RGRA 4G94A 1HSJA 1P92A 3WTWC 3MFKA 3MZYA 3F8CA 2HKOA 5FGMA 2RGVA 3HHHA 3V7CA 2Y0MA 3AAFA 2KIUA 4I2OA 3CDHA 3M7GA 4HX7A 4ETSA 4L18B 2PLYA 3O2PE 1FYLA 1FP1D 2VODA 2QQAA 4GCVA 5ICEA 3HSRA 1B9NA 1W7PA 4MQVA 4RGUA 3WE2A 1ZG5A 2Q8KA 5LHGA 2H09A 2A61A 5D5UB 2FNPA 3F3XA 2EFWA 1HQCA 1U5TC 1DDNA 1XDSA 4WXDA 3MWMA 3HYIA 2XASA 4IPAA 5BOXA 1YFHA 2IA2A 4OIPF 1B9MA 3I4PA 4ZYGA 2ZMEB 2W25A 4M9ZA 4PGGA 3BROA 2RV8A 2HGCA 2QVOA 1DP7P 3WGHA 1FZPB 2FU4A 4HDVA 3C3WA 2UXXA 2WV0A 2V6CA 4N9IA 3ZP5A 1MDMA 4HF2A 2VOPA 1EV7A 4OU0A 2P8TA 2VC0A 3DV8A 5IT9K 2MH9A 3ZMTA 2PMUA 4Y17A 4K2EA 3FWEA 4P9UA 2D1HA 4HLXA 3ISPA 4B09A 5ERIA 3F21A 4G7ZF 3F6OA 2EV5A 2W85A 3Q9SA 1T2KA 1CF7B 3V7SA 3KCCA 1EH8A 3SXYA 3QP5A 1U78A 1FYKA 3N97A 2M30A 5DDGA 3WTXC 1XD7A 3TQNA 2XHKA 4RGXA 3J80Z 2DAOA 2YX7A 1TBXA 2K86A 1TQMA 3I59A 2JZYA 1D8JA 4EJUA 1PP8F 4BHBA 1YS7A 4Q5SF 3GF2A 3KP4A 3BDDA 3IL2A 4WX9A 2LF7A 1ZARA 4LB5A 1Z9CA 2E7WA 3DQVC 1OYIA 2HOEA 2ESHA 1ZAOA 2PI0A 4EGZA 1ZREA 5E1WA 3KEOA 2TDXA 4KDPA 4CZZA 4OINF 1KA8A 5CVRA 1RZ4A 4JQFA 3VOEA 1FSEA 4AIJA 4Q4ZF 4PDKA 3GZ6A 1K7AA 4NHJA 4P96A 1DPUA 1A04A 4G8XA 3VODA 2OU2A 1ODDA 2K27A 2A07F 1TLHB 3TDZC 3KP6A 1SMYF 3F23A 3NEUA 1WWXA 4M6XA 1IZ1A 1IN8A 2OQRA 4R79A 3MZHA 1RUNA 2HYGD 1T6SA 2VBZA 4KICA 2KJCA 3U2RA 3W6JB 2H6BA 2L3DA 2BEOA 4ZZLA 3SZTA 4IRIA 3BPVA 3ELKA 4YIIA 3QOPA 3D0SA 3M9AA 1IUYA 3H3UA 5FLXK 4ENKA 1HXDA 1MDMB 2J5OA 2IW5A 4HF0A 2RNJA 3FXRA 1S3JA 2V1XA 4WF2A 2XROA 5CYVA 2IPQX 1I1SA 1V4RA 4DQ2A 2K4BA 3GFIA 2JT1A 2F2EA 3CLOA 1QO0D 1F1ZA 2FBIA 5AONA 1ZHFA 4KN4X 4G7OF 1V3FA 4XRFA 4GYIA 2WTEA 4ENMA 2QUFA 2HWVA 4L9VA 1J5YA 2GXGA 3P9KA 1SAXA 3C18A 4LG0A 5JFRA 1BC7C 3WGGA 4WXCA 3PQKA 4I09A 1OR7A 2K02A 2XAQA 3ZN1A 3L00A 1AWCA 3EYIA 1XSXA 1IAWA 2R7FA 2PBIA 3EDPA 2XAGA 4RAZA 4PCQA 4CXFA 2CGPA 1LEAA 2Z33A 1Z05A 1GXPA 3HTUA 1BI0A 2M45A 4HBLA 1XCVA 2HEOA 2C6YA 4I0BA 3HUGA 2OZ6A 4DNCA 2EFNA 5JVTA 2FSWA 2GWRA 3I58A 3M8EA 3I53A 6PAXA 2WWYA 5A2QK 4LK1F 4UVAA 3LSTA 2DTRA 2FA5A 4YG2F 5LRSA 1GXQA 1H0MA 2CWEA 1IN6A 3LA2A 5HLIA 2M5WA 4HX8A 2LF8A 4ENNA 2DK5A 4OMYA 4HA8A 2PFBA 4IVNA 5E20A 3CO7C 2AS5F 4KMFA 3K0LA 4AWXB 4JBAA 4OIOF 4EM2A 3T8TA 3ZMVA 2ZNZA 3TO6A 1R23A 4MGRA 4HZFA 5F1RA 3ZN0A 1MJ9A 3F8MA 3G3ZA 2NYXA 5DCMA 1TNTA 1Z7UA 4JK1X 4KIGA 1WKMA 3QPTA 2NS0A 2HTSA 2YSRA 1F5TA 1IW7F 2A6EF 2E7XA 2XKPA 2IVMA 5D6EA 1CF7A 3DPLC 3IRQA 3WU1B 5K5RA 3E5XA 3SZPA 4BHCA 4KT5C 4FT8A 3P7NA 1U2WA 5LGTA 3GVAA 4RB0A 1FBSA 3IC7A 1XGOA 1IXRC 2OA4A 5D5VB 3U1DA 2ISYA 2V1UA 3V8LA 1S6LA 2P6SA 3GZ5A 1LNWA 4Q47A 4MEXF 3I5UA 5F64A 1KQ0A 3FMRA 1OYYA 2HTJA 2OQGA 4WCGA 3DXJF 3P9CA 1JXSA 4E70A 5D4SA 2KJBA 2W57A 1L3LA 2XRNA 2Y48A 2VE8A 5CJ9A 3VEPA 2V1DA 3D5LA 5H6QA 2RDPA 3GEZA 2PQ8A 2IA0A 3ZPLA 3H3ZA 4YFKF 5K5OA
chains in the Genus database with same CATH superfamily
2JQ7A 1BI3A 1WR6A 2FOWA 4JI3T 1OJLA 3R84B 2DCEA 2H8RA 2G9WA 2D45A 3B57A 3NQOA 5IP6A 2DA5A 5JI6A 3FHZA 3AG1H 2HVQA 1YG2A 3ML6A 3KYDB 3RI4A 5E17F 1P4XA 1WYBA 3S4UA 5CGMA 1GVJA 2DYRH 4GDFA 4ESJA 2AQFA 2XZEA 3OYGA 1VTNC 3HKEE 3A2KA 4ESBA 4MTDA 5HYAA 1W9RA 5HEJA 1HX1B 4B3ST 4FISA 1YJNI 1Z6TA 1J75A 4XLCA 4FJOA 2ID3A 2NVUB 1FOKA 3D1NI 1SUMB 1QZYA 2CW7A 3O3KA 3QU6A 3CC7I 3PJAA 3PUWF 1E17A 4YSXA 2HI3A 4YFXF 4BGDA 2DOEA 1MJAA 1P4WA 1U6GA 4BAYA 3O4XE 2F4IA 2EBIA 3J7AY 2V6YA 5FKYA 3LJCA 1HW5A 2YDRA 3T1HT 5LHHA 5TGTA 3SYTA 3AE8A 2CQ7A 3OL3A 2M8EA 1WQ2A 1NK2P 4JI4T 2DPDA 2UUBT 1U8BA 1SVMA 2LKHA 2FBHA 3ABLH 4BEHA 4L5IA 4XLEA 3GX4X 1WSUA 2WU5A 2DJIA 4KMCA 3GTJJ 1WI9A 2GA1A 1LDDA 3OYIA 1XZYA 4IL6C 3K4MA 4CICA 2LKGA 1XCBA 3ZJ2A 1Q1HA 4ZH4F 5GADJ 1I6ZA 3ZR8X 2BW3B 1MZBA 4I01A 3WTTC 1O3TA 1BC8C 1HTJF 1LVAA 2OCCH 1Z3YA 1UCRA 3ZMSA 2NOGA 2LHRA 4LFUA 5KXJA 1V5EA 1ZG3A 4AYBN 4RAYA 4B3AA 2CMPA 1GT0C 2M4GA 3CCJI 1VQ9I 3K1PA 3ZQFA 2XQYA 2P5VA 3CMEI 4J00A 5FLVA 3RKGA 4YTMA 2ZSIB 1KGSA 1OCCH 3AG3H 3ERED 1IF1A 3QAHA 4IHWA 2PMZN 3QOFA 3V5SA 2CLYC 5ED4A 2RNGA 3IHUA 4MQ9F 3PE0A 1JUSA 3LBXB 4DUZT 1VQPI 2AHQA 1XS9A 3RRCA 1GLNA 3H5AA 3AVRA 5LGNB 5HXRA 3OTOT 4QH4A 3WHBA 3KYLA 3GZNB 4TX5A 2HOTA 4KIBA 2GIVA 2CQKA 2XB5A 2K24A 2OTJI 1ZR2A 1I6XA 1LDJA 2RVCA 2PMHA 1CQTA 3G1LA 3F6VA 2IBDA 2W84A 3ABUA 4BNCA 4O4HE 2VKEA 2WAQN 2HU9A 2A05A 4LGWA 3AG4H 1LQ1A 3RSNA 1J9IA 1B4AA 1R1TA 2E34A 3MZKB 3T8RA 5L3FA 3PUBA 1KU7A 3AE1A 1ZQ3P 3E5QA 5L3DB 3BR2A 4CYDA 2DI3A 3QOEA 5J4VA 2D1VA 4IHTA 5DCMB 1LFUP 2DO7A 5KDMC 5CB4E 2DQLA 1WZ2A 2O9LA 2IT0A 5EJCA 4PJ0C 5AQOB 2XQ3A 2FEZA 2LLYA 4GYRA 3ZEFB 5JR9B 2FX0A 5DCFA 3HA4A 3BQYA 1WJEA 4IX7A 1OQYA 2X6OA 1ZRFA 2X9YA 2ZJPF 4IKFA 3Q9VA 3GXOA 1WJ5A 2LKXA 4ADZA 2LG4A 2QZ8A 3TW6A 1A35A 1JHFA 1RR8C 2A68F 2CJJA 4B8XA 2ZC2A 1RKWA 1NENA 1B59A 2JPBA 5FKOA 3OY9A 4UUVA 1MIJA 2JRMA 1SD7A 4WNKA 3KZZA 3MKWB 2R5ZA 2O8XA 2IGKA 3KINB 2DHRA 1XSDA 1GQEA 2Q2EB 1USTA 2E8IA 3QB5K 3G6EI 1H7CA 3FMSA 4XN3A 1BI1A 1UG2A 4JBWF 4G6QA 1TTYA 2QVAA 3P4SA 3PU8A 4XRSA 2BG9A 2V6EA 4IHSA 2NW8A 1M1EB 1MBHA 4L9JA 1HG5A 5ETWA 1R4MB 1GDTA 4LFAT 3BR5A 5FD6A 1D1BA 1UAAA 2MD0A 2AO9A 5C2TA 2ZSHB 5FO5A 3OYMA 4GFBA 4A93J 2OUMA 1AJ3A 4UB8C 4AC0A 4HWHA 5GONE 5KK1A 3Q5XA 4H9QC 3LAJA 2DDAA 3ZQCA 1IJWC 4WWCA 2B63J 1FBUA 2FMYA 4O5VA 4KYWA 2E60A 1YW9A 1RETA 2XV4S 3PNYA 2XIGA 3I54A 2LOSA 5F6FA 1MBFA 1F9NA 2R6GF 3A5XA 2FJBA 2QGUA 4HPQA 2L7FP 2OV7A 1N34T 1WVRA 5DTDA 2BBJA 2D0TA 4JEUB 4RB2C 4WBNE 4DOZA 5ICGA 4UV9A 3OKQA 3CX7B 5CVUA 2PX9A 2IP2A 2QENA 3FXJA 1LJ9A 1B6AA 5DD4A 4B43A 4LG0B 3AA7B 3F8NA 3S3NA 3HI2A 2DXIA 3GW2A 3QUJA 4X65T 2HOSA 1NEKA 5J1YA 4AIHA 2W63A 3CX8B 2CV2A 1KNPA 5LEJA 4A6EA 5ILUA 3PV0F 3TLWA 1NHAA 1G3SA 2E1NA 2CG4A 2ZMEA 2LP0A 2OAZA 5AQSB 1VQ4I 4A5XA 5JH7E 1YOVB 1T72A 2GXAA 1MH3A 1LVFA 5KNLA 2ID6A 4IEJA 3ULQB 2HQNA 3R60A 3TL4X 3P9IA 1T38A 1R8IA 3ONLC 2HYJA 5AQQB 4B47A 4H9SE 2W1OA 1UGOA 2X1DA 2X9WA 4A3DJ 1PJRA 2BGCA 4YSYA 2JSPA 3EABA 3NBXX 2C0SA 2UXDT 1MNDA 3LSVA 1IDZA 2I59A 3SFZA 5J3LA 3LFKA 2BOLA 1BJZA 4D9JA 4EMSA 2COMA 4KITB 2X1EA 5EDNA 3OS1A 1WCMJ 1PP7U 4BDYA 1K61A 2O6GE 3EVYA 1X1DA 3H9QA 4IHYA 2YN6A 1C0WA 4CCKA 5FXZA 4DV4T 4RLFA 4I50E 1WRJA 2LNBA 2M1BA 2JRTA 2V79A 5K7ZA 3HKCE 1LPQA 1YRNA 1OYWA 1XB4A 4FETA 4KUMA 1VQ8I 2KRFA 3E1SA 5IOYA 5KVRA 2YK0A 4Y15A 4L0YB 5JTGA 2XQAA 4ITVA 1IN5A 3DTIA 1R1UA 4XKVA 2DW4A 4UEMA 4KFCA 2KDOA 1P7IA 2ELKA 3BY6A 3JAMZ 5BS6A 5BMZA 5LP6E 4TN7B 1ACIA 1ZN2A 2K3WA 4NXNT 2YUSA 3NZQA 2CSOA 1D5VA 3JSOA 1FT9A 1JUMA 3F2EA 3OVUA 1SVOA 4C91A 4D5FA 1SD5A 2IAIA 4XLAA 3DPUA 2L9QA 3BJAA 3O8HA 3ZGKA 2QEXI 1VQLI 1YI2I 3NKZA 3VRAA 3E6BA 3GUDA 2YS9A 1R22A 4XOTA 4AD9A 3K2ZA 4UUSB 3P4RA 2LFBA 3RTRA 1T95A 3AE2A 4IREA 4U33A 4ZDOA 5F0FA 5E8IA 5DJQC 3VYRB 3L9FA 3RJPA 4N9HA 4EB6E 2KMFA 4JI6T 3ZQHA 5FVLA 4ASKA 4UF0A 4NC7A 4UHTA 3HOTA 3GTPJ 1U9NA 3KLOA 1E7PA 2CE7A 2JMHA 4DJAA 2E9XB 1FTZA 2RAEA 4XBFB 1RNLA 3AFHA 1BR1A 2HZTA 3WU0A 4M71A 2QRXA 2VI6A 1P7JA 2KRHA 4AVPA 1IRFA 3S1NJ 3RF1A 2L4MA 5D6FA 1TL8A 1W0AA 2BZBA 2DWGA 5LGNA 4XBFA 2E9XA 3BG5A 3RH3A 3ONQA 2EZKA 1OR7C 2VT3A 1VF9A 4OOIA 1SEUA 5FFZA 2L02A 4CDGA 4H0EA 3PIOF 3NWSA 1MSEC 4CZCA 3GTKJ 1IDYA 1D0ZA 1YIOA 1G3WA 2K5CA 2X4HA 2H88A 3CVRA 1IBKT 1HFAA 5HCMA 4HSTA 1ORKA 4EGWA 5AQJB 3M3YJ 4II2A 1UHMA 2K4JA 3LSHA 3UUXB 2VQET 3HKZA 4EJTA 1ZLJA 2VE9A 4NQWA 3OS2A 1YYVA 3MZ8A 4D7MA 4C2UA 1TZLA 3FHNA 1RESA 4Z2YA 2A3SA 5FLMJ 2XTLA 4HV6A 5F04A 2X66A 2XQ4A 4NBQA 3FZKB 3HL6A 4TV9E 5FY1A 1DQUA 3HL2A 1JJ8C 3IAM2 2FQ4A 1RR7A 4B6XA 2R7OA 3G1MA 1QVUA 2OD5A 3FK7A 4KMUX 2XB0X 1BM9A 4Y3OA 2KXPB 2F5CA 2W48A 2Y31A 4M72A 2X48A 3BG6A 2VJIA 2ACZA 4W97A 3PUFA 3SDGA 3BR6A 3K10A 2JWTA 3PJRA 4LF5T 4YFNF 1X1CA 5FLXZ 2LRKA 4DO0A 2HDWA 1XDOA 3BJOA 1HKQA 2V9PA 4MEYF 4O6JA 1BIBA 3ZMZB 4RGSA 3PJAJ 2DCFA 2K5BB 2CQNA 1A6QA 2N1GA 5F3JA 2L0KA 1X2MA 1Z77A 4JYKA 3CCRI 4A5NA 4QTRA 2R7WA 2VJ4A 4U7BA 2E2JJ 1EKEA 3PTRB 3E6MA 1BW5A 2JTVA 2QKLB 3CUQC 4U0YA 1MIWA 3RC3A 3WTZA 1X3UA 3DU6A 2W7NA 4IHVA 2IS1A 2XAUA 5FKNA 4ISTA 3BP8A 3ERMA 3OSFA 3LDQB 2K9SA 3WTSC 1XGNA 3ZN1B 2DU9A 3CUQB 1HW1A 3B6CA 2W62A 1SE7A 4EVIA 1R5HA 5AQKB 2QF7A 3CC4I 3EQLF 4XLNF 2D5VA 4AIDA 2VPRA 3S3MA 1JE8A 2WC2A 1A31A 3BWGA 3JW4A 1KYWA 3CO6C 2ZXIA 2EH3A 3B73A 2Z16A 4EJWA 3K4LA 1XG1A 5JR3A 4WYVA 1KNZA 5K7FA 2G7UA 1RPWA 4QPQA 2LD5A 2JJ9A 4ZYAA 3U9GA 2ELHA 2ZXJA 5IWAT 3Q5FA 2IDOB 3CPZA 2VC1A 3HRSA 4ANJA 3CX6B 2FJ1A 3OMYA 2Y2ZA 2KNDA 2IGOA 2TRTA 3AECA 2IRFG 2LM9A 1YD8G 4P0BA 5IUXA 1PDNC 2NR4A 2ZB9A 2VN2A 4PFPA 2HDCA 3RYRA 3OYCA 5F27A 5GP9A 4GXOA 3CMYA 2QYWA 1FMVA 3H3AA 1B72A 5LHIB 3L2VA 4XMYA 5GTIC 1UHSA 4U2ZA 3TLTA 5EZHA 3MKZA 5EG0B 3LWFA 3GYHX 4EJOA 3I4MJ 1O3XA 2VK9A 4RLQA 3BR0A 3KVBA 3DKXA 3PUZF 3Q5WA 2YEVC 2RN7A 3HUGB 2F48A 3ABMH 1LB2A 5HNFA 4Z91A 1MNEA 1R4NB 3KEYA 3P4QA 4XLPF 4AXPA 3CJTB 4MALA 1QPMA 1IXSB 3VSLA 4DV5T 3JRGA 2IEKA 5L3CA 1T8BA 5LHHB 2OV9A 2HVSA 1U3EM 1M7KA 3MEXA 3H92A 3RIFA 5L3GA 1RI7A 4G12A 3RQIA 4JEHB 2IAKA 2HXOA 4AISA 5AQIB 5AFUL 4G7HF 3AAIA 1X1PA 2DDBA 4UUTA 4C3JJ 3CZ6A 1W0TA 4LOCA 5ILSA 2VIXA 4WXHA 5ABEA 3WU2C 3EDVA 4N4OB 4E7JA 3KP3A 2XDVA 3CDLA 3FM5A 1HNWT 1FNNA 4HKAA 1X9BA 2EINH 1V5GA 1QHHD 3G4SI 5CA0E 2V9VA 5IYBJ 4OIQF 2KPMA 1N32T 2CXLA 2G7HA 2QA7A 4BEHB 4TNVA 4I43B 4JX4A 4HNUA 2ZBKA 3LNQA 3MN2A 1IZNB 4FI5A 3W2WA 2PEXA 5FP3A 5HLGA 2GXBA 2GIZA 4IXAA 1G4DA 1VCTA 1YW0A 4CXXA 3IF8B 2E5VA 3FZVA 2HDDA 4DR1T 4LF7T 4IE7A 2W4XA 1I3QJ 3ZRGA 2XQ7A 2XSBA 4HFCA 1XX5A 1I27A 2PG4A 2E1CA 4Y4RA 2UXXB 4JOMA 2DOFA 2X6XA 3KLNA 2KMUA 3UR3C 5E8GA 3V7RA 1ONVA 1W5TA 2KIFA 3FXUA 3R4KA 2M7BA 4L0ZB 2VJJA 4NDLA 1HF0A 1HKTA 4HFEA 3RQUA 4RAFA 2EIJH 3EUKL 2LBFA 3P4PA 5TAOA 2FRHA 1JTXA 1OCRH 3OYNA 4M73A 3CF2A 2F5VA 2Z5UA 3LA3A 4ZI7E 1O3QA 4X6AJ 3CMMA 2TCTA 3SWHA 5LNKA 4GOUA 3HC7A 1WR0A 2MBGA 4C9YA 3LSKA 4HNVA 2RREA 3U21A 3VWBA 5HXCA 1O57A 4O3MA 1YW8A 1QHGA 5GPAA 1YLFA 4JI0T 5JHUA 3N9NA 4Z8XA 2EZLA 2LTPA 4XICA 4ZYDA 5EEGA 4GGGA 3BOQA 2ETHA 4HAMA 2ECBA 2QM3A 4S0HB 1K4SA 3M65A 1BW6A 3IWFA 1DGRM 4NB5A 5LBMA 5JDGA 2MH2A 4A3FJ 5FXWA 1R7JA 3BTLA 2Z99A 2JIWA 5J47A 1ULYA 4BKXA 2A6HF 2W61A 2JA7J 2FJAA 3OBVE 5LG4A 4KNYA 5BPIA 2R4GA 2K40A 3LQQA 2ODVA 4I0UA 4S05A 1P6RA 5J6XA 2L9RA 2MFZA 2GLOA 3KV5A 1SAUA 4BACA 3DF8A 1JT6A 1QZEA 3N5LA 1P2FA 4H9RC 3SRZA 4EAHA 3FBIB 3ZLIA 1VNDA 2MBFA 4ZYEA 1HA8A 2OF7A 3K8PC 2BYVE 5HWYA 4XORA 1TC3C 3Q0UA 1W0BA 2L4AA 2E2HJ 3KBTA 1DUXC 5C8YE 1I5ZA 4BJ6C 2JMKA 1ZELA 2E2AA 3ZC0A 3ANWA 2CM0A 1KQ9A 4CH7A 4HFBA 1QNTA 1DU2A 4CSWA 4F91B 3MCZA 1S7OA 4YEJA 3L1PA 1QZZA 3HRUA 1QPIA 3ZYLA 2MLKA 2QYOA 3TO9A 1LEBA 4HQMA 2FUG2 1QBJA 4WW0A 2DOAA 1G6NA 4IJAA 1ZOYA 4XKCA 2DFEA 3ASOH 4EZHA 2I6HA 3CMLA 5FY0A 1O7FA 2XSDC 3IWZA 3WG9A 3DJBA 4IDOA 1Z1DA 2K3PA 2M34A 1OKRA 2Y0SN 1J5WA 3H1CA 5L3EB 2L5QA 3C1DA 1ZHCA 3H9GA 4LLLA 3LK3B 1ZR4A 2OPTA 2Q0OA 1T0FC 1YE9A 3N4MA 4ZYHA 2JUGA 4A0XA 4G63A 3ZMUA 2LY2A 3RIAA 4UELA 5BNGA 4QX7B 3QYFA 1FPQA 2BS3A 1RUOA 3J81Z 3RYCE 1ERDA 4EV0A 4CN1A 4JI2T 4AQYT 1RC9A 3MAJA 4JX5A 1HDDC 3A0HC 3K9TA 3OIQA 1PUEE 2V7FA 3O1IA 3RX6A 1BR4A 4DIDB 1J5ET 2EJRA 4LIUA 2GBYA 2P6TA 1GUUA 3CTAA 3K69A 1WGXA 3FF5A 4L5JA 4EEDA 2XGXA 1USSA 4A6DA 2V7IA 3E22E 2JK3A 4CA0A 1H9GA 4U0WA 4BUPA 3SOLA 4HF1A 1E0EA 3T1YT 2FUPA 2ZCWA 3J81K 2HPLA 4KHPT 4Q25A 4XONA 5LLQA 2VOOA 2J4GA 3QB5A 2IGMA 1QU3A 2BKPA 4DZPA 2DLLA 5E1XA 1B8IB 5E1ZB 3Q9DA 4ZTJA 4ZOLE 1Q1VA 5J0ZA 2UUCT 2LKSA 2K9NA 2KRCA 2DK8A 3UFGA 3K4CA 3JSPA 4DR6T 1OFCX 3AA0B 4O8SA 2NP9A 3CUQA 5HEHA 2BXZA 1MBKA 2M67A 2HN1A 2IJLA 5KX5E 5HLHA 3W2AA 4PZJA 1FC3A 3ZOBA 2DTZA 2NWBA 4HWDA 2GAUA 4LJZF 2YX4A 4C2TA 3R61A 4J19A 2V7JA 3CJNA 3RYPA 4P0AA 2PN6A 1QUUA 3RKQA 3NVOA 3S14J 4N78D 4HFVA 4BY1J 4YLHA 4ENJA 2A9UA 1W5SA 5LA6E 3A01A 4IT4A 3E5UA 1O3SA 2XAJA 4A2UA 5LD2C 2XUEA 3BR3A 3CQZJ 3N2OA 4UVBA 3WE3A 1X1AA 3ASNH 3W3CA 2XM2A 1D3YA 2DMNA 5F0CA 1E2AA 4A3MJ 1B7TA 4MNUA 2L01A 3EPZA 3KIOA 5IP7J 5EF6A 3AE9A 3K3QC 3MK7C 4MFDA 1QQIA 4BJTA 4IIJE 4RS8A 5H20A 5AQFB 2LOPA 4PJJA 3TP3A 1SFOJ 3ABVA 3MD2A 2EPFA 4M3GA 5EYRA 5LFAA 2O0YA 1IXCA 2BBYA 2QGSA 5HXHA 2FXAA 4CYCA 5HXEA 3FX3A 2UUZA 5IT3A 2R7ZJ 3VB2A 3HOYJ 2HQ5A 4LMLA 2ZM8A 4JI5T 4ZEYA 4P09A 2KISA 2HVRA 5FL1A 1UFMA 2CUFA 2EV0A 2L2OA 2WCAA 3GLLA 4H4KC 4X1EA 2W82A 3EI0A 1OEDC 2CUJA 2LMDA 2XUBA 3S2WA 5EK2A 2D2SA 2DFHA 2B0LA 3RZDJ 1JJ6C 4OAYA 2Q2EA 3LBXA 1MMNA 1XTAA 1S35A 2CW0F 4BJ5C 4GK0E 3TLUA 5HS7A 3E97A 1W4MA 2O61A 3RQWA 2LOOA 3ZKRA 1U5TA 3S15J 4WK8F 1ZYRF 1G8XA 2EQRA 2LBFB 4A0YA 2QWWA 2ES0A 2D5UA 2BHZA 3M8FA 1O3RA 2R7XA 2WU2A 4BXUA 1IN4A 4FTHA 3C98B 4NUUA 4QKNA 3K3NA 2X9XA 3O8GA 2GOXB 3A0BC 5LBQA 1OLTA 3JRBA 4P5OA 1W0UA 2MD5A 2GM4A 4GRIA 2BG9E 4X20E 5ABFB 4UVCA 3H3MA 1ZRCA 2X0LA 3T5XA 3OJAA 4IRGA 1H9TA 1UJ8A 4YIFA 4FX4A 3HIFA 2B7EA 4J01A 1X4PA 3VFZA 3CCVI 1Z0XA 3IHRA 4MLKA 3H35A 4EGYA 5GAHJ 3LAPA 4FQGA 1YRNB 5HDKA 1FIAA 1MGTA 2LKPA 4EJVA 1HNXT 3JTGA 4P1NA 1J7KA 2YINA 3M4OJ 1EJ9A 4OHFA 5DV5A 2RC4A 3CUOA 3LK2B 4ZI3C 4D0PA 4U0VA 2QA4I 1V9DA 3ZMDA 2ACJA 4RM2A 3AEGA 2O8KA 5LMUT 2VXZA 3PUGA 5JR9C 3DEEA 3P7IA 3TOBA 2PTFA 1SFEA 1RIOH 2EWNA 4YFSA 1E3PA 5L2LA 4GO1A 3AE7A 2N8GA 5HS9A 1JKOC 2DA6A 3X2QH 1LE8A 1Y39A 1NTCA 1IN7A 1X1BA 3K1NA 5J1GA 4JI1T 2JPCA 2QKMB 3UQ4A 5LGUA 3WG7H 3HSFA 5L3DA 1ETXA 3BZ6A 3O6BB 4PGHA 3TKLB 1IJ6A 2Y75A 2ZKZA 5HDNA 4KI0F 2VKDA 3IH2A 3EUHA 2VBYA 5IY5H 3BR1A 4CXWA 1OPCA 1FOWA 3LL7A 1TQIA 2BVMA 3RDIA 3GMIA 4ZHQE 2IHR1 3RIUA 1F4KA 4UR9A 1YTYA 3CJQB 5DD8A 2XJ7A 4CGZA 4NXMT 1XNRT 4F7ZA 4UNOA 1ZH5A 2XAGB 3HOZJ 3J80K 3HKBE 3ETUA 2YU3A 1WYCA 3H5RA 2W24A 3OYFA 3RRWA 4U88A 3H3VK 5HS8A 3KV9A 3GFJA 1XMOT 2R5ZB 5LHIA 3HOSA 4FCYA 2R7DA 4KN7X 5FKLA 1K83J 4ZDLA 3I0TA 2R7UA 3BQIA 4CQIA 4DR2T 2X6YA 5AQRB 3I0QA 2MC3A 1FSHA 3LSMA 3HR0A 5L4EA 1ZV4X 4CCLA 2DWKA 5K7HA 2OZUA 3SDBA 3RZOJ 3W6VA 2MYSA 1HOMA 3U1KA 3LG7A 4FHTA 1FY7A 1FIPA 1AU7A 2Y30A 2Q9QD 1N75A 3L2UA 3J7YJ 1KQ8A 3LA7A 2X6WA 1GV2A 1ON2A 3DFGA 5CVIA 1VQKI 5LB7B 1W36C 4GIWA 2WB5A 1HC8A 3Q5EA 5EEHA 4ZXLA 4NPPA 2MC4A 1BIAA 4U7DA 2ODUA 5AQNB 3O1HA 2XQ6A 1UZCA 4B1RA 4KJZA 1A36A 1Y64B 2VL0A 1XPXA 2CWOA 4IL9A 2VPLA 2W67A 1BBYA 3KVAA 2WMNA 3OYEA 2RPAA 4BQQA 1YKHB 2V9KA 3OIPA 3GTOJ 2CCQA 1OMIA 4R1HA 2CRBA 2F4VT 3MMYB 4A5MA 1ZK8A 2A5YB 1VQ5I 4CI2B 4QWNB 4U7YA 1IBMT 4P55A 3FXOA 4BQNA 2NNNA 2JSCA 1XDUA 4E6KG 5C4JJ 1K4TA 2XASB 3UFEA 1YJWI 3AL0B 2X9HA 3AE4A 3SQNA 3T1BA 4LLGF 1J2XA 2HYFA 2XPUA 5GAGJ 2LM2A 3FZLB 1KF6A 2XF6A 3TLVA 2ZNYA 3IKVA 3JAFA 2E5LT 3M3ZB 1YHQI 4RMNA 3IKTA 2ZJRF 4P9FA 2ZJ2A 4BQAA 1MKMA 4XSZF 3AVSA 2A72A 4KT6A 2MAWA 1VZ0A 2UWMA 1AOYA 3S1MJ 1SFKA 2BV6A 2XGEA 3ZQQA 4XLFA 2PJRA 4M6YA 2EFQA 3P4WA 4BH9A 3H36A 4CCJA 3HKDE 2MA3A 2XAFA 3FISA 3R6NA 3T8OA 3SFIA 5ICCA 2K9LA 4M9XA 1K6OA 5AIPA 2MLGA 1HW2A 1BN5A 3RYIE 1J59A 2WZHA 2L7KA 4QHOA 1AA7A 1WRDA 5LEKA 1U8RA 5FFXA 1WH5A 4LMJA 2UXCT 1Y8RB 4LK0F 2FMLA 5JDMA 2D9DA 3KFWX 2H7VC 1W36D 2P5KA 1GHCA 1LDKB 1BJAA 3K4KA 3ZT7A 4OFZA 3RKWA 1UMQA 5TJJA 2XSAA 3DKWA 2LSYA 2DMPA 2VKHA 1STZA 3AEDA 4DUYT 3DKYA 3AE6A 5HVQC 3N9LA 4ASNA 4E7LA 5IYZE 3UULA 1N25A 3CP8A 3FK6A 4CYCB 1KU3A 2KKOA 4EM0B 5E79C 3OV8A 3HHGA 3G1OA 2D2WA 2ME6A 4BXFA 1LE8B 1NAFA 2KL4A 1UUSA 3KZIC 3KV4A 4QH1A 5TISC 2VONA 2CWYA 1W7PB 1WJBA 3REOA 1EF4A 1VQMI 5J2TE 5JREA 1R1VA 3I71A 1TNSA 4E7HA 5IYDJ 4LF6T 2EA2A 2HS5A 2VBXA 4Z6YA 3QRFF 1HX8A 2AXLA 1I1GA 1P4AA 3E6CC 3B02A 3I0OA 5E18F 2HKXA 3UU3A 4E7SA 1TWGJ 4MFEA 1R58A 2XVCA 1IGNA 4C2MJ 3DTOA 1ON1A 2GA2A 4M3DA 3HRTA 2ZO4A 4I0AA 1G59A 5B66C 2R7RA 1ZGJA 3CCSI 1CGPA 4CHUA 2KIMA 3R0AA 4EQQA 4KISA 2FBKA 2HNHA 5DYMA 3AXJB 3H37A 3N9OA 4Y13A 4A3JJ 2DQRA 1HNZT 4DR7T 4C3IJ 2HFHA 4XM3A 2XPKA 3G73A 4V2GA 2NNYA 3RPQA 4CCMA 2VKVA 5BQTA 3R0JA 2BDEA 2VWAA 4HW0A 3UUNA 4CUGA 3GTLJ 2KFDA 3L09A 4KA4A 4UVCB 3F8BA 3LFMA 3G06A 1POGA 4HX4A 5EGOB 2K7LA 2UXNA 4TWDA 5D4RA 2R7VA 2RQPA 5IT9Z 2J1DG 2K9AA 4KP3C 5LXTE 2NAZA 4L9NA 3OS0A 3MACA 1T39A 4F52A 4S04A 3ONXA 3PUSA 4AQFA 1SMTA 1U5TB 2RQQA 4XKWA 5FKMA 4EM1A 4HDUA 3OOPA 4YJ3E 1W7PD 2NVYJ 5LOVE 4LB6B 2WY8Q 2XGCA 2WB1N 2MG4A 1NH3A 1K78B 2CMRA 1ZKEA 2LSJA 3K3OA 4XLHA 2Y6XA 3JREA 4F6RC 1LRZA 3HKZN 1N36T 1HBXG 2MABA 3F22A 1R5GA 3NZPA 2VXDA 2GZWA 3K2AA 5M5XJ 5LJMA 2R3SA 1D8KA 2DA4A 2OC6A 1XMQT 3VU7H 2M9HA 2DFIA 4Y33A 1FBQA 3TKYA 1ZGAA 2Y8DA 2FF4A 3WODF 2IC9A 4A3KJ 4Q48A 3ZSTA 5JDNA 2VT2A 1TQPA 5A1LA 2E1MC 4QXCB 5LHGB 2KIQA 3C4WA 2CFXA 3PFIA 4PNIA 5LRRA 3I59B 4XZCA 3W15B 2LR8A 2A69F 3FXQA 1YO5C 2KLQA 2BY1A 1SA0E 3CQGB 3AE5A 2PFVA 4X64T 2EK5A 4IOCF 3U78A 5K5QA 2VURA 4IDPA 3DPTA 3PFYA 3A02A 3I1AA 3KBUA 2LREA 1JNZA 5AQUB 3KEQA 4HWFA 1XMKA 2HZDA 2XGDA 2W66A 3KP7A 5DABA 4DMWA 4M1PA 1IRGA 3GWZA 1Z91A 5FRNA 2D0UA 2R93J 1KONA 2UZKA 1IC8A 4WBOA 5JR9A 1X3WB 3HJEA 4A3EJ 3OYAA 2L9SA 4HGAA 3TO7A 4HTEA 5FD5A 5L3BB 4V19K 4DMVA 3GA8A 5L47A 3NWIA 2F5EA 3PNVA 2LT3A 4IGUA 4CO8A 2C5JA 2VQLA 1FX7A 3BJ6A 4H63H 3CCEI 4LLNA 3KYCB 3QODA 5DM6F 3SJMA 2F4MB 2AE9A 3CP2A 5E3NA 2XQ8A 3SHFA 1Z67A 3C7JA 3EUHC 1L0OC 3E6DA 1ITYA 4IDQA 3A03A 4I76A 3VYUB 5HOOA 2CO5A 5ILVA 1ETWA 1S8NA 3PU3A 4HN9A 2P4WA 1X2NA 4M3EA 4L9TA 4I6ZA 4HV5A 2YR2A 4BQOA 5IOZA 1TP4A 1G2HA 1REPC 5H6RA 5LG3A 4PSXA 1VQ6I 3M1EA 2EZIA 1NG7A 2FQ3A 3ROUA 5J8FA 4PJMA 2JQQA 1MNMC 3CWZB 4ERRA 3KETA 4D5CA 3GLXA 2FNAA 3BQZA 4Y7NJ 3P8CD 5EZGA 4QWQA 4AUXA 1A6IA 1FWZA 4L0RA 2VLAA 2KWHA 2ZXHA 3FXEB 2CV0A 2PJPA 5FL0A 1FLIA 2ZLYA 4XRMA 1D1AA 1Y56A 4UUSA 4RB1A 2P7CB 1X58A 4BBSJ 5JDFA 4I02A 2WWUA 4A3LJ 2ADUA 2BXYA 2ELJA 4IE0A 2EFOA 2XF7A 2DMQA 4YSZA 2Z9OA 1FYMA 4EEBA 4OK0A 2H94A 2XQ5A 4XOPA 3AXJA 2KT9A 5JVDE 2BW3A 3GCMA 4A12A 3HZJA 4G9YA 2WMOA 1S7AA 3L2RA 2PG8A 4V1Av 2KLOA 2KP6A 1JTYA 2CYYA 1TWFJ 2ME0A 4PUSA 1OEDE 4QX8B 4JI7T 1MD0A 4K0KT 2KZVA 4GYGA 3C51A 4HRIA 3HPHA 3BZKA 4X1KE 4HYEA 3OYXA 3WTUC 3BZCA 2E19A 1KYZA 5F1JA 3X1DA 4LD5A 1BL0A 4I99C 4UF0B 3JAMK 5HLTA 1IRZA 5BR8T 1SD6A 2CXFA 2Q9QA 4PSWA 4IOAF 1T98A 2LDUA 3GWHA 5FXXA 3RIRA 2O3FA 2QQ9A 1BOAA 5TRDA 2EFPA 1NWMX 2GOMA 1UB9A 1YS6A 2Q9QB 2XQ9A 2EHOB 3W2VA 2QLZA 3EETA 2X0LB 4AIKA 3ECHA 1Z6RA 4RB3C 2XAFB 3O1JA 4YHJA 4DR3T 4MTEA 3NARA 4F55A 3AE3A 1H88C 2DA1A 1PUFA 3WTYC 1JHHA 2J62A 2WDVA 2QBYB 5FMNA 5CQGA 3BG7A 2GQQA 1VI0A 1SD4A 5DS9A 1J1JA 1WFXA 2FD5A 2J5PA 2PJQA 4QH5A 2QBYA 5CLSA 5AQGB 5FXVA 4QLCU 5IP9J 1IBLT 2ESNA 3FKIJ 4HWCA 2XAHB 3ZJ1A 2WAQA 4X66T 1BI2A 4X1IE 4QSHA 1UURA 1TWCJ 5JRCB 2K85A 1VCSA 1TW2A 3HM5A 2DYSH 4FE7A 3GFMA 3WGIA 2CV1A 1D0XA 3RYFE 3DP7A 2P5LC 2NXNB 3BQLA 5M4YA 1QVTA 5A2QZ 5H2FC 5BPDA 2I8DA 2EB7A 2XKOA 3LMMA 2IUBA 4EXTA 4I7HA 3V8KA 5FB2A 2MGQA 3QPHA 5F5WA 5M3MJ 2P9BA 2Z2SB 5J1UA 1R71A 3TOAA 5EK4A 3ECOA 2BKOA 4HOBA 1XDPA 2CH0A 1W09A 2EHOD 3W6KB 3D5SC 1ETYA 1Y0UA 5HDGA 4MBQA 2F6CA 2E5ZA 5CKTA 5HCJA 3J7AO 4I55E 3FMQA 4PK5A 5IYCJ 2Y69H 3GTGJ 1SFXA 4KBMB 1Y1WJ 1FEXA 2LRDA 3OR1C 4LMYA 4ZDPA 3V8JA 2EILH 1ZRDA 1UX4A 1IJ5A 3FXKA 1BR0A 2FOKA 2CS3A 3DTKA 2CBJA 3I9V2 4ISSA 2KHMA 4NNJA 3I64A 2QQBA 4ON0A 2YU2A 4GKJT 4DBQA 5M5YJ 3D0TA 3ZSSA 3T0YA 2JVHA 5JDLA 4JI8T 3DEUA 3DTEA 2KWIB 3VR9A 4R8HA 5CVJA 2R7TA 4U72A 1HF8A 4FX0A 4UV8A 4AVZA 2E2IJ 1UHWA 1XGMA 1MIVA 4LF4T 2JRKA 1KZHA 1D5YA 2STWA 3S3OA 3WAKA 4G6TB 1ZG1A 4MHGA 1JKRC 2YU1A 1ZTRA 3COAC 3DBLB 2HQRA 2H3RA 2LSOA 3R6SA 3ZQ7A 4ZZDA 2F5FA 2FE3A 4U7IA 2DLRA 3GO5A 1YQAA 3V42A 5D5XB 3FM3A 3IV5A 3MKYB 3Q5DA 1QGPA 1K78A 1X79A 4HLYA 3SFEA 2WQYA 5L3EA 4AQFC 4OIRF 1BR2A 1WHUA 5D8KB 3IRRA 4ESFA 2B9SA 3OL4A 2NRAC 1T56A 4AM3A 2CQXA 4DYQA 4IO9F 3V5UA 3VDXA 2W00A 4TV7A 5DEQA 1J0RA 2RKHA 3BG9A 3FDYA 4B3TT 3ZC1A 2NTYA 3V4GA 5J4YA 2M87A 5FROA 5L3BA 5HWXA 1IRXA 3HTSB 1Z0PA 3ZPOA 3ZMZA 4XN0A 4TUYE 3EUAA 2M0MA 3AEFA 1XGSA 1JI8A 4A0ZA 2XY8B 4UXNA 3F72A 2CHNA 1JT0A 5DUIA 3WTVC 5D5WB 1VQNI 3G71I 4A3IJ 1MJBA 4DV6T 4CXYA 2AQEA 3HB9A 3PQJA 4IRHA 1IO2A 1CHUA 1FMWA 1ZLKA 3I9YA 1WPKA 3VSKA 1V55H 1XN7A 3NRVA 2I10A 3KP5A 3KZYA 3CK6A 5DQWA 3E7LA 1Z8UA 4BHPA 2E5NA 1YXRA 2W4SA 2M6BA 2ZJQF 1XSVA 3TEDA 4B44A 2H27A 3M8JA 1OEDB 5J2UE 3LSIA 2WY2A 3QP6A 4IL4A 4HQEA 2L7MP 2M7AA 4H9NC 4N0BA 5LBQB 3K4JA 3ZT6A 1UELB 2G0UA 2JQHA 4OAZA 2BE5F 5AIQA 1OEDA 1ZEEA 3RLFF 2PJRB 2IMLA 4M3FA 5CPRB 5B1BH 5C44J 1FP2A 1MMGA 1N77A 3RKXA 1WJAA 3RPUD 3BTCA 1YKEB 1S7EA 5HAXA 5HXSA 1HSTA 5DUKA 3AEAA 2DL1A 2BZTA 2K48A 1HDPA 2BS4A 3S2HJ 3SFDA 4I98B 2O03A 3TGNA 2WA0A 2YU9J 1JGSA 3IH4A 4LF9T 4KIFA 5D8LB 2I0MA 5J8CA 1YX5A 2XAJB 1JKPC 2DPUA 2P7VB 4XSXF 2ISZA 3RPUA 3OR2C 4F3QA 3LK42 2H6CA 3A01B 1HKSA 3RCOA 4FASD 3MQ0A 2WM9A 2CEAA 4E7KA 4EYUA 1KU9A 3C50A 4XL9A 3CLQA 3OYKA 5HEOA 4ZZBA 2SPCA 2EA4A 3JCFA 4BYYA 1OWAA 5EZYE 2ZFWA 2JVGA 2L54A 5GAEJ 5C4XJ 4XNFA 1R00A 2WDRA 2STTA 3HOWJ 2IXSA 4CCOA 4QIWN 3L2CA 2JJ7A 3GFLA 3QWLA 1K79A 4BAYB 3QNUA 3KP2A 3IEEA 2VBWA 3E08A 3MVPA 3BTJA 1ZKGA 2X67A 2V7LA 1OXZA 2KQRA 2JA5J 1B1BA 1Z21A 2IA1A 2OA5A 5L4HA 1O7LA 3BT9A 3CF5F 3AEEA 3VPRA 1G3TA 1G3YA 3ABTA 3EYYA 4B48A 2R7SA 2GK9A 2HPJA 5GPCA 3HOUJ 1EH7A 5CVVA 2BKNA 3KDSE 2ZM6T 2DMTA 4DV3T 2XM1A 3QU3A 1DU6A 2N9DA 3KV6A 4HWIB 4NC8A 3F8FA 3GN5B 4Z90A 2X0YA 4EEFG 2WS3A 5FY7A 2IS6A 2YPRA 4AKIA 5C3EJ 4TV8E 1T08B 3RKYA 4XKBA 2LSKA 2F5DA 1VRBA 1Z7LA 4IF4A 3P5JA 2Z3YA 1SFUA 4G6DA 3TDUC 3J7ZI 3BPXA 2MSYA 4QXBB 4XK4A 1T0FA 1JUPA 2M4KA 2VKOA 3JAEA 3CMAI 3PUYF 3RI5A 1S29A 1TW3A 3RIUC 4COFA 1KU2A 1XMAA 3KE2A 3QQAA 4M9SA 2XAHA 2R92J 3K1MA 3Q3SA 4B3MT 3QYBA 4OMZA 3EDUA 2ZM0A 4PK6A 5K1YA 2DT6A 2Z1DA 3K70C 3JTHA 2DT5A 5E3MA 2BS2A 3C4ZA 4WZXA 2LE8A 1DPRA 4IHJE 2XPVA 3E3VA 1EH6A 4PJNA 3F9KA 2CBIA 4HFDA 2LJLA 2JN6A 1R6RA 3ZN0B 5J1RA 4YTPA 3CCYA 2DBBA 3KX2A 3LQRA 2R0QC 3KPHA 1Y6IA 2OBPA 2A6TA 5F0HA 2JQKA 1E2XA 4AKGA 1ENHA 2O5RA 3HRMA 3CQCB 4BE0A 3CD6I 1WJCA 4M74A 3AEBA 5AQPB 2WV1A 1R36A 3DLLF 3HSEA 4GYSA 3OYBA 1YW7A 3VR8A 2HR3A 3HGGA 3RC8A 2BY0A 1FJLA 2KINB 3TMOA 2EV6A 4HFIA 5ICFA 3CC2I 3L7WA 1GV5A 4RGRA 3M1CA 4G94A 1HSJA 2M3AA 3VYSB 2HHHT 3FBNB 2NW7A 1P92A 3WTWC 1TT0A 2XAQB 2G0EA 3MFKA 3S2DJ 2QQ8A 3F8CA 2M8GX 3MZYA 2BG9B 2ICWG 2L3LA 2HKOA 3DBHB 5FGMA 1FIOA 4HFHA 2RGVA 3JR9A 4A3CJ 3HHHA 3V7CA 1XNQT 4YXDA 5HODA 1N78A 1F43A 4W1UA 1Y1VJ 2Y0MA 1IV6A 5H6RB 2NOXA 1Y0NA 3NRXA 3FBZA 1I39A 2A5WA 3A1YA 2I5UA 4DZJA 3AAFA 2KIUA 3IH3A 1DU0A 3ANWB 2NS7A 2E9XD 4J2CA 4I2OA 1BOBA 5JQGE 2ACXA 1ETKA 4LFCT 3CDHA 3ESWB 3TLSA 4IHXA 4A98A 4L5EA 1YQ3A 2VQGA 3M7GA 1MSFC 4H63V 4HX7A 4ETSA 1OCZH 2RP4A 4L18B 1B72B 1X4OA 2UU9T 2PLYA 3O2PE 1D1CA 1AHDP 1FYLA 1NK3P 1FP1D 3DU5A 4A56A 2DT7B 2VODA 4DVDA 2QQAA 4GCVA 2BG9C 4IDNA 3DEWA 2QSGX 4EV6A 5ICEA 3ZQIA 2WAEA 1B9NA 1W7PA 3HSRA 4DYCA 3P50A 2CRGA 4MQVA 4RGUA 3WE2A 1ZG5A 4JP0A 3AL0C 4F8HA 3NWTA 3PNTA 2Q8KA 4DBRA 2H09A 5KAIC 5LHGA 1NG6A 4O4IE 5FKKA 2A61A 4TNWA 5D5UB 2OTLI 2FNPA 2WBMA 4OYJA 1PVEA 5JDQA 3H0GJ 2KZ7B 3F3XA 1T8IA 3AAAB 2EFWA 3VKHA 1U5TC 3DBRB 1HQCA 1XDSA 3JRCA 1DDNA 2P0WA 4EATA 4WXDA 5FYMA 2LLKA 1V54H 2IGNA 3HYIA 3MWMA 4LF8T 3N9MA 1L0VA 2XASA 4CN6A 4ILBA 4IPAA 5F8PA 3K4BA 5BOXA 3QPSA 1YFHA 1KFYA 4YY3T 1OCPA 2IA2A 4OIPF 1B9MA 3I4PA 4ZYGA 1ETOA 3GMEA 4RA2A 2V1DB 2JMWA 4XIDA 4IDZA 2ZMEB 2W25A 4M9ZA 4PGGA 3PO3J 3BROA 2RV8A 3NRYA 4EOZB 2HGCA 2L8KA 4HE8A 1X19A 2QVOA 4QXHB 1DP7P 3WGHA 1MBEA 1FZPB 3FXDB 1VQ7I 2JA2A 3CIRA 3MKLA 2VL8A 1FEWA 2FU4A 2ZMEC 4C3HJ 4YIRX 1R9TJ 1D0YA 4AKLA 5AQLB 4HDVA 3C3WA 4NUVA 4BJNA 5JVGF 2UXXA 2YOEA 3J9X1 4UB6C 3F0CA 2WV0A 2X85A 4AI6A 2V6CA 3BLYA 4N9IA 3OYLA 3ZP5A 1MDMA 4HF2A 1EV7A 2VOPA 3QK6A 4OU0A 2CHOA 2OLTA 1J09A 3H9JA 2LSIA 5CA1E 2P8TA 2VC0A 5JRCA 4A3BJ 3DV8A 4RBOA 5IT9K 2MH9A 1IV8A 2WB1A 4ZI3D 3ZMTA 2PMUA 4Y17A 4K2EA 4UVBB 2EIMH 2VQFT 2M0CA 3FWEA 3BCBA 4DV2T 4P9UA 2D1HA 1F36A 4HLXA 4L5GA 2VJ5A 5ADXL 5CFBA 3ISPA 4XR6A 4B09A 4JX6A 5ERIA 3PURA 3F21A 1M62A 2V6XA 5CJ5A 4OX9T 1YITI 5LGUB 4G7ZF 3F6OA 2EV5A 3UU6A 2W85A 5KAFC 4ILAA 2BY3A 3N2GE 1UG0A 2LVSA 4ZJZA 1IG7A 3Q9SA 1U0JA 1YX3A 4IE4A 5H6QB 1DP3A 4YELA 2HPIA 2H1LA 1EA3A 3CKDA 2V5DA 2NVQJ 3A4CA 1T2KA 1CF7B 2H8WA 2JA8J 2EIKH 4F92B 3CDIA 4ILUA 3V7SA 3UTKA 3RKOA 5EGOA 4CI1B 3KCCA 1EH8A 3AB3B 3PDYA 3CJRB 4G2AA 2YKSA 3SXYA 1I6HJ 1HCIA 1QSDA 3QP5A 1U78A 1FYKA 4AQGA 2HXIA 1Z3XA 2K9MA 5DM7F 3N97A 2M30A 1JKQC 2X68A 5B1AH 5DDGA 3WTXC 4NIQA 2LY9A 1ETVA 1T33A 2Y9ZA 2MTQA 2ECCA 1U9OA 1XD7A 1PYVA 3TQNA 1I3AA 3N9PA 1HLVA 3IBPA 2XHKA 4RGXA 3J80Z 3QC9A 4RDUA 5M3FJ 1WLXA 3AA1B 2CXDA 4UV8B 2Y0SA 2DAOA 2R7QA 5ABFA 2LSGA 2YX7A 4MO7A 1U4QA 5B3SH 1TBXA 2K86A 1JNRA 3I3LA 2WAFA 1TQMA 4PJLA 3PL8A 4XQFA 3I59A 3PUVF 3CCQI 4H9OC 2JZYA 3UU4A 2X51A 4ZC3A 4DNDA 3DLAA 1D8JA 4ILCA 1LVKA 4EJUA 1PP8F 2ZFUA 1YS7A 4BHBA 4Q5SF 3GF2A 3KP4A 3OPCA 3ZCIA 2LYCA 3CCMI 3ETVA 3BDDA 2ZMAA 1OISA 1MH4A 1XC5A 3LSGA 3IL2A 4O4JE 4WX9A 2WP9A 4YJ2E 2LF7A 4HSRA 1ZARA 2HOAA 1QRYA 4LB5A 2KT0A 3C64A 3FZMB 5CQEA 5IHYA 1Z9CA 1K6YA 2E7WA 2FJDA 2CUEA 3A7MA 1AKHB 3DQVC 1OYIA 1R49A 1UCUA 2Q1ZB 2HOEA 3AKZA 1VQOI 2ESHA 1ZAOA 4O2AE 1S5LC 2WDQA 1RKTA 2PI0A 3UUMA 2AXDS 1B8IA 2VB6A 4EGZA 1ZREA 4OYKA 2MPKA 5KMGP 5E1WA 3KEOA 3A8YC 4LFBT 2CQQA 1FJGT 2TDXA 4KDPA 1SANA 3HPGA 4CZZA 4TZ4C 4OINF 5FVKA 2A3DA 1KA8A 5CVRA 1RZ4A 4JQFA 3VOEA 2KSRA 2VQHA 5E3LA 1FSEA 4BS9A 2BBHA 4MLOA 5LMNT 4CZZB 4AIJA 4LIVA 4Q4ZF 2EHOA 4PDKA 3GZ6A 2LRLA 1K7AA 4DW6A 4NHJA 3ZMVB 4CI3B 4EYYR 2QSHX 3S1RJ 4P96A 1DPUA 4AKRB 3IAS2 4AIUA 3GTMJ 2M2EA 1A04A 1TT5B 4G8XA 1FOYA 3VODA 4BBRJ 3B13A 2OU2A 4YTNA 3I4NJ 1ODDA 3F31A 4BE1A 2A2FX 2K27A 2A07F 3SZGA 2WZIA 1TLHB 2VASA 3TDZC 5HNHA 3KP6A 3OWTA 1SMYF 3F23A 2J47A 4ABZA 1Y8QB 2HPMA 3AA6B 2NOJB 1E3HA 3NEUA 1WWXA 3QYEA 4M6XA 1IZ1A 3BK9A 2V8SV 1IN8A 1ZP0A 2H89A 2OQRA 3ONJA 2X1CA 4GKKT 4R79A 1YQ4A 3MZHA 1RUNA 4ZZCA 3S8PA 2HYGD 3OIOA 1T6SA 2DJNA 4C30A 3LSRA 3ZQLA 4HEAA 3UU8A 3B5MA 2VBZA 4KICA 2KJCA 3U2RA 1OCOH 3ABKH 3LOCA 3S16J 2WADA 3I55I 3JRDA 1Y01A 3PUQA 1WH7A 2H6BA 3W6JB 2L3DA 4PW8A 4JV5T 2UXBT 2BEOA 2QCOA 3AG2H 3EHZA 4ZZLA 3SZTA 4IRIA 1S9HA 3OYDA 4ZTFA 2V6YB 4V2FA 3JCUC 3TW7A 4Y52J 1RRJA 2DA7A 3BPVA 1OCTC 1VOMA 3ELKA 1WJFA 2LK2A 2L9NA 4YIIA 3G2BA 1WFDA 3QOPA 3LFUA 5KHDA 3D0SA 2LH9A 3M9AA 5KCMA 2R5YB 5JDHA 1A5JA 1IUYA 3H3UA 1QLBA 1V5FA 5FLXK 3ZCJA 2V4JC 3PIPF 5E3OA 3ZMSB 3ESLA 4U87A 4ENKA 2DN0A 9ANTA 4PFOA 1T7SA 4II3A 4CCNA 2HH7A 3FBLA 2IC6A 1CUNA 5LGTB 3JADA 1HXDA 3WAJA 1MDMB 2J5OA 5HEUA 3J7Yq 2P81A 2LC2A 2E1MB 2IW5A 4HF0A 2RNJA 3JC6D 4OWRB 3S93A 1SVLA 3FXRA 4BL0B 1S3JA 2E71A 2V1XA 4WF2A 5JHFA 2WBLA 2XROA 2KZGA 5CYVA 2IPQX 3C2HA 1I1SA 1V4RA 4DQ2A 2IW5B 3PUXF 2Z6EA 2K4BA 3GFIA 2JT1A 2F2EA 1HG2A 4LITA 2LEHA 5AQHB 3BC8A 3CLOA 1QO0D 2JUCA 3HG9A 1F1ZA 1X3ZB 2FBIA 1JGGA 2VUMJ 5AONA 1MIYA 5EK3A 1ZHFA 4BA9A 4NQWB 4KN4X 3OYJA 3UT5E 1O4XA 1I50J 3PSFA 1HR0T 4G7OF 3IA3A 1V3FA 4XRFA 1MMDA 4GYIA 2WTEA 3OOUA 3RHWA 4ENMA 3Q2MA 4KHZF 1S72I 2QUFA 2HWVA 3ZMTB 4L9VA 1FTTA 2O7OA 1J5YA 2GXGA 3P9KA 3I56I 1SAXA 4YRVA 3C18A 4U3CA 4LG0A 5JFRA 1BC7C 3WGGA 3K6GA 3JC6C 1IUFA 1H8AC 4H9PC 3UKGA 3FB2A 4WXCA 2NVXJ 3PQKA 4B3XA 4M6VA 4RM3A 5L3FB 1H89C 4C90A 2WWVA 1FOXA 4I09A 1OR7A 2E36A 1S94A 4F93B 2K02A 2XAQA 3ZN1A 2Y9YA 3L00A 1IAPA 2K3FA 4XRSG 1AWCA 1TWHJ 2UUAT 1BA5A 1XMXA 4UY8I 2FJEA 4DR5T 3EYIA 5C3JA 1APLC 3LSPA 1XSXA 1IAWA 5EEAA 2R7FA 3RGLA 3OSGA 4K0UA 2PBIA 3Q0VA 3EAMA 5J40A 1EZ3A 3EDPA 2LY1A 3L3PA 4DV0T 5GTHC 1XWMA 4ZS3A 1E3OC 4XAXB 3O9XA 1MBJA 2XAGA 3GN5A 3MKDA 1KNRA 4X5TA 3SEQA 4RAZA 2KDZA 3UQ7A 4MIMA 4TWFA 4TWHA 1HCRA 4PCQA 4CXFA 3U3IA 2CGPA 3WI3A 3C4XA 2CFOA 3L8RA 1LEAA 2Z33A 1Z05A 2IS2A 2CLYB 3FZFB 3HTUA 1GXPA 1BI0A 2COBA 2M45A 4HBLA 2DA3A 1XCVA 2HEOA 2BY2A 2UV1A 2C6YA 4I0BA 3HUGA 2B1EA 3RYHE 2DFFA 2QSFX 2OZ6A 2JA6J 4DNCA 3OYZA 2EFNA 3N9QA 4HNTA 1N33T 5JLWA 2CUZA 1DGWY 3DWLE 3AAEB 4BJMA 1KEYA 3TBIA 5EG0A 5JVTA 4B3RT 4FE4A 3M07A 1WCRA 2FSWA 5F08A 2GWRA 3C2GA 2DNXA 4UV9B 5DQVA 3ZYMA 3I58A 3IP4B 3M8EA 3TP0A 3I53A 1YIJI 3UNGC 1SC7A 6PAXA 2WWYA 5A2QK 4LK1F 4UVAA 1P9QC 5LCYA 5AQMB 1TWAJ 3E0JB 4HEA2 3C2BA 2XC7A 3CQXC 4MFRA 4X62T 3LSTA 2DTRA 2FA5A 5L3GB 2H7OA 4YG2F 2Q9QC 3SS1A 4KX6A 5LRSA 2C5IT 4DIQA 1GXQA 2R5YA 2WY7Q 2WAUA 2JPFA 3CCUI 2JQ9A 1H0MA 2CWEA 1IN6A 2B76A 1AKHA 2NW9A 3LA2A 3H0DA 5HLIA 1WJDA 2RA1A 5LJNA 4D7NA 2M5WA 4ZS2A 3JRFA 4HX8A 4P1WA 2ZM2A 2Y48B 1LKXA 2CA5A 2LF8A 4ENNA 2CU7A 2K9QA 2V7KA 3VRBA 2L7ZA 4UXNB 3JRAA 3BCAA 4L9IA 1ETQA 2DK5A 5E0OA 2L9VA 4OMYA 4IE6A 3UU5A 4HA8A 4YHHT 1R5ID 3FXLA 2PFBA 5FRMA 4IVNA 3DCFA 2V7MA 4PAGA 4U2YA 5E20A 3CO7C 2HQAA 2AS5F 4KMFA 3K0LA 4AWXB 4YT0A 4JBAA 1MBGA 1HS7A 1QA6A 4OIOF 3HEFA 3FXMA 3S17J 3N2KE 3MA9A 2XSJC 4EM2A 3HDDA 2C5KT 1U5PA 4X1YE 3T8TA 3JRIA 2X0HA 3ZMVA 3VKGA 1MMSA 2E9XC 4IZZA 3NAUA 2W0GA 3MXZA 5ABGA 2ZNZA 1MW7A 1R23A 3PSIA 3TO6A 1UK5A 3Q0WA 4MGRA 4HZFA 2EHOC 2XHEB 5ABHA 4KUMB 5F1RA 4U74A 1PUFB 4NUBA 5M5WJ 4N4NB 4PK4A 3QPLA 3ZN0A 3K4NA 1MJ9A 3F8MA 3G3ZA 2NYXA 3K7AJ 2V26A 5DCMA 3HOXJ 3PO2J 2OCEA 1UX5A 2W2UA 3JRHA 3MJXA 3N05A 3ZCOA 2E1OA 1TNTA 3S32A 4BU2A 3PUAA 4X0GA 2DA2A 2H1KA 1Z7UA 4JYAT 4D1QA 4O2BE 4BE2A 4JK1X 4U31A 2OJED 4O4LE 5L3CB 4KIGA 4RAGA 5LYJE 2XPWA 4DR4T 1WKMA 3QPTA 4M3BA 4DV7T 2NS0A 2HTSA 2YSRA 5B5EC 4JLEA 4DV1T 1F5TA 1IW7F 4BXXJ 2A6EF 3B6AA 1MMAA 2MW8A 1W1WE 2E7XA 3SEZA 2MOZA 5HEGA 5BMVE 2M6IA 1YJ9I 4HG2A 2XKPA 3ZYKA 2NTXA 2CW8A 2IVMA 3BQKA 3HOVJ 3K70D 4BY7J 3GTQJ 1LFBA 5D6EA 5AQTB 2DODA 4ZI2C 4AYBA 3BG3A 1CF7A 2IS4A 2WSSV 3DPLC 3CCLI 3IRQA 2CPTA 3E0ZA 4A3GJ 4AU7A 3WU1B 3L2WA 1LUJB 5K5RA 3E5XA 2BHYA 2PMZA 5JLXA 3SZPA 5AQVB 4MHCA 3VHLA 3VYTB 2F4OB 4BHCA 4UIGA 4KT5C 3RQ4A 1KK7A 3FZHB 4AKHA 4FT8A 3P7NA 4QPOA 1U2WA 3H5NA 5LGTA 2VVNA 2UXNB 4LG3A 3GVAA 4RB0A 1W5CC 4IQJA 4CN4A 3ZT5A 4GK5E 4DGWB 3D5RC 1FBSA 3IC7A 2IIUA 1XGOA 1IXRC 2N2NA 2BVLA 1WI3A 2OA4A 4I4TE 5D5VB 3ZXSA 3U1DA 2DI4A 3BTIA 3PM1A 4LMKA 4A97A 2ISYA 3K1SA 2NS8A 5FJ8J 3HBLA 2ZXWH 1VFCA 2V1UA 2V1NA 3V8LA 2FBWA 3I9WA 1S6LA 3ZQGA 3ZMUB 4A69C 4IQ4A 4E4HA 2DMUA 4UVAB 3HXLA 2P6SA 3FIWA 4E7IA 3GZ5A 3OYHA 1LNWA 4Q47A 2YDSA 4MEXF 3L2QA 2AXTC 4NC6A 3I5UA 5F64A 4E7ZA 2LHNA 1KQ0A 3FMRA 1OYYA 1I94T 1E1HB 2HTJA 2XF5A 3CESA 4BDZA 1ZGWA 2XRLA 1G73A 3S1QJ 2VKJA 3F57A 2OQGA 4WCGA 3DXJF 4DYRA 3P9CA 5FNVE 1JXSA 1SHZC 3LSJA 4E70A 5D4SA 2KJBA 3FKJA 2W57A 1L3LA 1GVDA 2XRNA 2Y48A 2VE8A 2X9DA 2V5CA 4JUYA 2NVTJ 5CJ9A 2VVSA 4IE5A 3IUOA 2YDQA 1LFPA 3VEPA 5IPAA 4EIWA 2V1DA 3D5LA 5H6QA 3WHCA 2EZHA 2RDPA 4B4CA 3GEZA 2E35A 3HGYA 2IA0A 2PQ8A 3GBGA 3ZPLA 1US7B 3H3ZA 3L39A 4ZI2D 4YFKF 2HN2A 3UUBA 4EZ4A 5K5OA 2VQCA
chains in the Genus database with same CATH topology
1BI3A 1WR6A 3R84B 2G9WA 2D45A 3B57A 3NQOA 5JI6A 3FHZA 3S4UA 1YG2A 3ML6A 5E17F 3RI4A 1WYBA 1P4XA 1GVJA 4ESJA 1VTNC 3HKEE 4ESBA 4MTDA 5HYAA 1Z6TA 1J75A 4FJOA 1FOKA 1QZYA 3O3KA 3QU6A 1E17A 4YFXF 1MJAA 1P4WA 1U6GA 4BAYA 3O4XE 3LJCA 1HW5A 5LHHA 2M8EA 1WQ2A 2DPDA 2FBHA 4L5IA 3GX4X 1WSUA 4KMCA 1WI9A 2GA1A 1LDDA 4CICA 1XCBA 3ZJ2A 1Q1HA 4ZH4F 1MZBA 4I01A 3WTTC 1O3TA 1BC8C 1HTJF 1LVAA 1UCRA 3ZMSA 2LHRA 4LFUA 1ZG3A 4RAYA 2XQYA 3K1PA 2P5VA 4HN9A 1KGSA 3ERED 1IF1A 3QAHA 3V5SA 2CLYC 5ED4A 4MQ9F 3IHUA 3PE0A 3LBXB 3RRCA 3AVRA 5LGNB 5HXRA 4TX5A 4KIBA 2GIVA 2CQKA 2K24A 1I6XA 1LDJA 2RVCA 2PMHA 3F6VA 2W84A 3ABUA 4BNCA 4O4HE 4LGWA 1LQ1A 1J9IA 1B4AA 1R1TA 3MZKB 3T8RA 5L3FA 1KU7A 3E5QA 5L3DB 4CYDA 2DI3A 4IHTA 2D1VA 5DCMB 2DO7A 5KDMC 5CB4E 2DQLA 2IT0A 2FEZA 4GYRA 3ZEFB 5JR9B 5DCFA 3HA4A 1ZRFA 2X9YA 3Q9VA 3GXOA 4ADZA 2QZ8A 1JHFA 2A68F 4B8XA 1B59A 2JPBA 4UUVA 1SD7A 4WNKA 3KZZA 2O8XA 3KINB 2DHRA 1XSDA 1USTA 2E8IA 1H7CA 3FMSA 1BI1A 4G6QA 1TTYA 3PU8A 4IHSA 2NW8A 4L9JA 1HG5A 5ETWA 5FD6A 1D1BA 5FO5A 1AJ3A 5GONE 5KK1A 3Q5XA 4H9QC 3LAJA 4WWCA 1FBUA 2FMYA 4O5VA 4KYWA 2XV4S 1YW9A 2LOSA 2XIGA 3I54A 5F6FA 1F9NA 3A5XA 2D0TA 4JEUB 4RB2C 4WBNE 5ICGA 4UV9A 3OKQA 3CX7B 5CVUA 2IP2A 2QENA 3AA7B 1LJ9A 1B6AA 5DD4A 4LG0B 4EB6E 3F8NA 3HI2A 3GW2A 3QUJA 4AIHA 2W63A 3CX8B 5LEJA 4A6EA 5ILUA 1NHAA 1G3SA 2E1NA 2CG4A 2ZMEA 2OAZA 5JH7E 1LVFA 3ULQB 2HQNA 3R60A 3P9IA 1T38A 4H9SE 2X9WA 2BGCA 3NBXX 2C0SA 1MNDA 2I59A 3SFZA 3LFKA 4EMSA 2COMA 1PP7U 2O6GE 3EVYA 5FXZA 1C0WA 4I50E 1WRJA 2LNBA 2M1BA 2JRTA 2V79A 3HKCE 1OYWA 1XB4A 4KUMA 2KRFA 5KVRA 2YK0A 4Y15A 4L0YB 1IN5A 1R1UA 2DW4A 4UEMA 4KFCA 3BY6A 3JAMZ 5BS6A 5BMZA 5LP6E 4TN7B 1ZN2A 3NZQA 2CSOA 1D5VA 3JSOA 1FT9A 3F2EA 4C91A 1SD5A 2L9QA 3BJAA 3E6BA 3GUDA 4AD9A 1R22A 3K2ZA 3RTRA 5E8IA 5DJQC 3L9FA 3RJPA 4N9HA 2KMFA 4ASKA 4UF0A 4UHTA 3HOTA 2CE7A 3KLOA 2JMHA 2E9XB 4XBFB 1RNLA 2HZTA 3WU0A 1BR1A 4M71A 4AVPA 1IRFA 2L4MA 5D6FA 2BZBA 2DWGA 5LGNA 4XBFA 2E9XA 3RH3A 2VT3A 4OOIA 5FFZA 2L02A 4CDGA 4H0EA 1YIOA 1D0ZA 1G3WA 2X4HA 3CVRA 1HFAA 1UHMA 2K4JA 3UUXB 4EJTA 1ZLJA 2VE9A 4NQWA 1YYVA 3FHNA 4Z2YA 2A3SA 2XTLA 4HV6A 2X66A 3HL6A 4TV9E 5FY1A 4B6XA 3N9LA 2OD5A 4HFVA 4KMUX 2KXPB 1BM9A 2F5CA 4M72A 4YFNF 5FLXZ 3BJOA 1HKQA 4MEYF 4O6JA 1BIBA 3ZMZB 4RGSA 2DCFA 2K5BB 2N1GA 5F3JA 4A5NA 4U7BA 3PTRB 3E6MA 1MIWA 2JTVA 3CUQC 4U0YA 3RC3A 3WTZA 1X3UA 4ISTA 3BP8A 3WTSC 1XGNA 3ZN1B 2DU9A 3CUQB 1HW1A 2W62A 4EVIA 1R5HA 3EQLF 4XLNF 1JE8A 2WC2A 3BWGA 3JW4A 1KYWA 3CO6C 3B73A 4EJWA 5JR3A 1KNZA 2G7UA 2JJ9A 3U9GA 2ELHA 2ZXJA 3Q5FA 3CPZA 2VC1A 3HRSA 4ANJA 3CX6B 2KNDA 2IRFG 2LM9A 1YD8G 4P0BA 1PDNC 2VN2A 2HDCA 4PFPA 3RYRA 5LHIB 4GXOA 1FMVA 3H3AA 3LWFA 3GYHX 4EJOA 1O3XA 2VK9A 3KVBA 3Q5WA 2YEVC 2RN7A 1LB2A 1MNEA 4XLPF 4AXPA 4MALA 1QPMA 1IXSB 5L3CA 5LHHB 1U3EM 3MEXA 3H92A 5L3GA 1RI7A 4JEHB 2IAKA 5AFUL 4G7HF 3AAIA 5ILSA 4WXHA 3EDVA 3KP3A 3FM5A 1FNNA 4HKAA 2V9VA 4OIQF 2CXLA 2G7HA 2QA7A 4I43B 2ZBKA 1IZNB 4FI5A 2PEXA 5FP3A 5HLGA 2GXBA 4IXAA 1YW0A 1G4DA 4CXXA 4DO0A 3IF8B 3FZVA 4IE7A 1I27A 2PG4A 2E1CA 2UXXB 3KLNA 5E8GA 3V7RA 1ONVA 1W5TA 2KIFA 3FXUA 3R4KA 4L0ZB 1HKTA 5TAOA 2FRHA 4M73A 2Z5UA 3LA3A 4ZI7E 1O3QA 3SWHA 5LNKA 4GOUA 2MBGA 5HXCA 1O57A 4O3MA 1YW8A 1YLFA 5JHUA 3N9NA 4Z8XA 4ZYDA 5EEGA 4GGGA 3BOQA 2ETHA 4HAMA 2QM3A 3M65A 3IWFA 4NB5A 5LBMA 5JDGA 2MH2A 5FXWA 1R7JA 2Z99A 1ULYA 2W61A 2A6HF 3OBVE 4KNYA 5BPIA 3LQQA 2ODVA 4S05A 1P6RA 5J6XA 3KV5A 3DF8A 3N5LA 1P2FA 4H9RC 3SRZA 4EAHA 3ZLIA 2MBFA 4ZYEA 3K8PC 2BYVE 5HWYA 2L4AA 3KBTA 1DUXC 5C8YE 1I5ZA 2JMKA 3ZC0A 3ANWA 2CM0A 1KQ9A 1QNTA 3MCZA 1S7OA 1QZZA 3HRUA 3ZYLA 2MLKA 2QYOA 3TO9A 1LEBA 4HQMA 1QBJA 4WW0A 1G6NA 4IJAA 4EZHA 3CMLA 5FY0A 1O7FA 3DJBA 3IWZA 3WG9A 1Z1DA 1OKRA 5L3EB 3C1DA 1ZHCA 4LLLA 3LK3B 2Q0OA 3N4MA 4ZYHA 4A0XA 4G63A 3ZMUA 4UELA 4QX7B 1FPQA 1RUOA 3J81Z 3RYCE 4EV0A 3MAJA 3K9TA 1PUEE 3O1IA 3RX6A 1BR4A 2EJRA 2P6TA 3CTAA 3K69A 4L5JA 3FF5A 2XGXA 1USSA 4A6DA 2V7IA 3E22E 1H9GA 4U0WA 3SOLA 4HF1A 2ZCWA 3J81K 2HPLA 5LLQA 2VOOA 2DLLA 5E1XA 5E1ZB 3Q9DA 4ZOLE 2DK8A 3JSPA 3AA0B 4O8SA 2NP9A 3CUQA 2M67A 2IJLA 5KX5E 5HLHA 4PZJA 1FC3A 2NWBA 2GAUA 4LJZF 2YX4A 3R61A