2LOPA

Backbone structure of human membrane protein tmem14a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Transmembrane protein 14A
total genus 29
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03647 Tmemb_14 Transmembrane proteins 14C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lopA00
2LOPA 2LOSA
chains in the Genus database with same CATH superfamily
5FY0A 3RX6A 5FY1A 2WY2A 3CMLA 5CFBA 3NZQA 1BR0A 2K5BB 1MMGA 5ABFA 1FEWA 3BK9A 5HEOA 3CK6A 4WNKA 2E2AA 3K3NA 4LMJA 5AQPB 1T7SA 4YTMA 3QNUA 4H9OC 2YDQA 5AQQB 1HNWT 2V6YA 5J0ZA 2MPKA 2LSIA 2VL0A 4QXCB 4HFBA 3OVUA 4ZI7E 4LFAT 4ZEYA 5ABEA 1MIVA 2PBIA 3CQCB 3DJBA 4HFCA 5LYJE 3ONXA 2V8SV 3KVBA 3ZYMA 4GKKT 5JTGA 5LXTE 4WYVA 5FXXA 2BKNA 4TV9E 2X0HA 3KBUA 3EI0A 2V7JA 5DJQC 3PUWF 4ZI2D 4AQFA 3EUHA 3K3QC 2XQ5A 4QWNB 2QRXA 4X20E 2IUBA 3AEBA 3N9LA 3ONJA 4ILAA 3Q9DA 4U2ZA 2CE7A 2IHR1 2LHNA 3ZMVB 4ANJA 4PJJA 4YTNA 4H63H 5AQFB 4AISA 5LMUT 2KNDA 4LMLA 3QB5A 5FP3A 4ILUA 5JDQA 3N2GE 5L3GB 4DV3T 3ZYKA 5HXCA 3HR0A 3QK6A 2YEVC 4ILBA 3F57A 5AFUL 2DWKA 1X9BA 4HFHA 4NPPA 1KNRA 4U33A 4LF8T 5KX5E 1YKEB 5H6RB 5CJ5A 4LMKA 2LKGA 4PK5A 4I0UA 2VKDA 4Z8XA 2J1DG 4G63A 2FUPA 2RA1A 2WZIA 3GA8A 2BKPA 4KP3C 4X1YE 5F5WA 2YKSA 3EHZA 4DV6T 2M67A 1WRDA 1IAPA 5HEHA 4BJNA 3OJAA 4QH4A 5LHHB 4HE8A 2CWOA 3VR8A 5HAXA 2H89A 3P4WA 4PAGA 5FKYA 4YHHT 2CEAA 2PG8A 2QYWA 4TN7B 1HTJF 2VB6A 2YDSA 1IZNB 1T72A 2ZM8A 3IF8B 3BQLA 1XDPA 2JRKA 2KZ7B 5LMNT 4GOUA 2JIWA 2EHOA 3ZLIA 1LVKA 3LK2B 1FMVA 4X1IE 4XBFB 2DI4A 4WZXA 3CWZB 4ZI3C 3F2EA 3RIUA 4EB6E 1XMQT 5HWYA 1J5WA 2XAHB 4JEHB 4YSXA 2E5VA 4ZS2A 4DMVA 2PTFA 3MXZA 5M4YA 2V5DA 2H7OA 5LG3A 5IUXA 2DCFA 1UUSA 3L39A 2UUAT 5HWXA 2DNXA 5F8PA 4EYUA 2DWGA 2NW9A 4DO0A 4XZCA 3CQGB 4UEMA 1HG5A 3SFEA 1OXZA 1ZHCA 4E7ZA 4EYYR 1XNQT 1IJ6A 2K9AA 3H3MA 3NBXX 3PE0A 1O3XA 1HF8A 4DV1T 1OEDA 2XAGB 2UXXB 2XZEA 4OFZA 2M6BA 1YW0A 2L9QA 2WWUA 2Y6XA 3AE3A 2IDOB 3CVRA 2BVLA 2X0LB 1ZKEA 3GN5B 3HKDE 2WMOA 4TUYE 5AQMB 5HXEA 3C4WA 4JI3T 3N2OA 3JAFA 5LG4A 1MMAA 1XZYA 2VWAA 4GK0E 2D9DA 1J1JA 1HFAA 1NAFA 2W2UA 1CHUA 4TV8E 4NIQA 4CI3B 5ADXL 2NW7A 4JV5T 4U74A 4AKLA 2DLRA 4ZHQE 3B5MA 2KT9A 4KHZF 1ZOYA 1LKXA 2LHRA 3O1HA 4BAYB 2XQYA 3AE9A 4U7YA 2Q9QB 3AECA 3R84B 4LF6T 5AQTB 2LLYA 3HA4A 4IE6A 3I9YA 5AQLB 2V6XA 2IC6A 2VASA 4LF9T 1FJGT 3JADA 2UXBT 4YT0A 4DR5T 2CM0A 3ZC0A 2XAQB 2NW8A 3JCFA 3K8PC 4UF0A 2WMNA 4DV0T 3H37A 2BZBA 1QUUA 4X66T 2WS3A 4CI1B 3EAMA 1GQEA 3CX8B 3N9PA 3UUMA 5ETWA 1HNXT 4B3TT 4QXHB 2IAKA 3DTOA 4AQGA 2LJLA 5LCYA 4FJOA 4YJ3E 2OLTA 3A8YC 1BR1A 2LE8A 3QB5K 4JUYA 3UU3A 3IEEA 3MZKB 3ZC1A 5LGNB 2WU5A 3RYFE 3AAAB 3KV9A 5LB7B 5CA0E 4YTPA 1N33T 4KBMB 4MALA 2N2NA 3RQUA 4O4HE 2OV9A 3ZN1B 5JDGA 3VHLA 3I1AA 1HX8A 1KEYA 2JMKA 5JDMA 3QOFA 3GWHA 5L3CB 3ONLC 2J47A 5HEJA 2ZM6T 3MA9A 3AXJA 5LBQB 4EEDA 4ZZBA 4Z90A 3TLUA 3VKGA 3AAIA 4DV7T 1G73A 4GYRA 4A97A 1HNZT 2IIUA 2XTLA 3UT5E 1WR6A 5AQHB 4DR3T 3EVYA 2CMRA 2RP4A 3FZLB 2EHOC 3D0TA 5JR9B 3KFWX 3AEAA 5HCJA 4JI0T 3N9OA 1V9DA 4I4TE 4UR9A 5JH7E 3ETUA 2C5KT 2CHNA 2XY8B 4JBWF 3SS1A 4TNVA 2LT3A 3P8CD 4HFDA 2ZLYA 3LG7A 2LEHA 4UV9B 4OHFA 3EABA 2BS4A 4AIUA 5JDFA 3UU8A 3RYIE 1HG2A 3AE6A 1WLXA 3FZMB 1W09A 2NP9A 3AA0B 1OEDE 3PDYA 4CN6A 4LFCT 1MNDA 2JJ9A 1YQ4A 3CIRA 3V5UA 3ZCJA 3T1YT 4DR4T 5BMVE 3HL6A 3UQ4A 3AE5A 2B1EA 1J5ET 5C2TA 3V5SA 4B6XA 5FVLA 4DBQA 4ZZCA 4LFBT 4TX5A 5FL0A 3P4PA 4CZZB 2H3RA 3PTRB 5AQKB 1BR4A 4ADZA 2X9WA 1AJ3A 1E2AA 2XQ6A 4L0RA 1KF6A 2QVAA 2JMHA 2WDVA 4KMCA 2V7KA 3OKQA 4UXNB 1YKHB 3TLVA 2WB5A 4QH5A 5L3BB 4IDQA 4ZXLA 4BA9A 4QX8B 1N36T 1JNRA 1UK5A 2W63A 4AI6A 2WSSV 3CKDA 2V1DB 3PUGA 3W15B 5F3JA 5AQVB 4IIJE 4P09A 4PFPA 2OA5A 3AA7B 1SE7A 5GONE 3ZEFB 1SHZC 4GK5E 4UF0B 1ZV4X 2XPKA 4CN4A 4DR7T 3LK42 5CGMA 2VVNA 4E7SA 3RIAA 5AQRB 3HKCE 1VCTA 4AQYT 2UXCT 3VRAA 2WDRA 2V6YB 2WP9A 3TLSA 4JI7T 2WM9A 3E22E 3IBPA 3ZMTB 2Q9QA 4GIWA 3ZMUB 3Q5XA 4KX6A 3ZT6A 4YJ2E 4MFRA 3K1SA 3UFGA 2XQ7A 2WAUA 2XAFB 3AEEA 3LFMA 3AXJB 4PW8A 3VRBA 2XHEB 1IBLT 2NTXA 4PJMA 5J1GA 3LJCA 4UELA 2A2FX 1OEDC 3L09A 2LSYA 3FZKB 5AQUB 3RGLA 3AEFA 1ZEEA 2BBHA 2LSGA 2Z6EA 3C64A 1E7PA 3SOLA 3T8OA 3VKHA 3B13A 3N9QA 3QC9A 3L8RA 4HWCA 4O4LE 4X65T 5C3JA 3PJAA 2MAWA 1HCIA 1FIOA 2LRLA 2MOZA 3IHRA 3K3OA 4G2AA 4O4IE 2XQ4A 3UULA 4HN9A 3ZJ2A 4M1PA 4F6RC 1IBKT 4HWHA 4HWIB 2AXDS 4YY3T 4JI5T 4K0UA 3FHNA 3LBXA 2W67A 2V7LA 1VCSA 3PURA 4ZS3A 5AQNB 1XDOA 4WBOA 5EZYE 2X67A 1N32T 2SPCA 4PK6A 2PFVA 3AE2A 2V7MA 2BG9E 3EDUA 4HWDA 4UVAB 5DQVA 2UU9T 2CCQA 4PNIA 4K0KT 5LP6E 2BS3A 2Q9QC 1IBMT 2CBIA 4LF7T 3AA6B 4HEAA 3RI5A 2CRBA 2ACZA 3BQIA 3KBTA 3TLWA 1KK7A 2NR4A 4BJMA 5IWAT 3BQKA 1NWMX 2YN6A 1W0BA 2X9XA 3C51A 5JR9C 2JQ9A 1ZP0A 3AVRA 5HYAA 3H3AA 2JQKA 2YOEA 4H9QC 4YHJA 5L4EA 4JI6T 1H7CA 2CXFA 2XM2A 4YSZA 4ZI2C 1VRBA 3B57A 4N78D 2CLYC 2KMFA 1T8BA 3RRWA 4DBRA 3HKEE 3UQ7A 2J62A 3E0ZA 3NWIA 2IW5B 4EGWA 5JQGE 5LJMA 5FL1A 4DUYT 2YK0A 2VKOA 2E9XD 3PU3A 2MBGA 3ANWA 3ABVA 2KINB 4ILCA 4EAHA 3CQXC 4TZ4C 2W62A 3OBVE 3PUVF 4NUUA 4I55E 2WCAA 3C50A 4TWHA 3RKOA 1QLBA 3OYZA 4NXNT 2XUEA 4DR6T 1Z0PA 1IJ5A 4PJLA 4O8SA 3ZT5A 2XJ7A 3P50A 4OYKA 1MNEA 5JDNA 4IE7A 5IYZE 2C0SA 3ZN0B 5ABHA 4YLHA 1D1CA 2YINA 5FXVA 3OTOT 2VKHA 5LNKA 1L0VA 3S4UA 5JRCA 3WI3A 2KWIB 2XASB 4GYSA 2VVSA 4P0BA 3NRYA 3A5XA 1HS7A 2UXNB 2WBLA 1US7B 5AQIB 2EHOB 5HCMA 1R8IA 2VQET 2K24A 4L5GA 2QA7A 3AB3B 3NVOA 4O4JE 3RIUC 5HEUA 3C4XA 3O9XA 5FXWA 4I43B 2JPFA 4DMWA 2MYSA 4FI5A 2H88A 2KLQA 1NENA 2FJBA 3PJAJ 4IGUA 4QKNA 1S94A 2L8KA 5DQWA 3ZSSA 4HGAA 3N9NA 4EZHA 5J2TE 4IREA 2I59A 3ZPOA 2XQAA 2VL8A 1G8XA 2A72A 2V7IA 3EDVA 1EZ3A 2A3DA 2X66A 4U3CA 5FYMA 2XSBA 3MKDA 3AE7A 4MBQA 5JREA 4DIDB 2B76A 2UUCT 5BR8T 2HH7A 2LM9A 2BS2A 2X0YA 4X5TA 4AXPA 1MIWA 3KV4A 4WW0A 5L3EB 3VR9A 4HWFA 2VQFT 2YU2A 3KDSE 1WYCA 2HPJA 2XQ3A 2G0UA 2H7VC 3IA3A 3N5LA 5LJNA 2WQYA 4ASKA 2D0TA 2XSAA 5LBMA 2ZM0A 1Y64B 2ODVA 4COFA 4KUMB 3O1IA 4ERRA 5HEGA 2BG9C 1HR0T 4B3MT 4DR1T 2DHRA 4JI1T 4O2AE 3NZPA 3ZT7A 2UUBT 1I6ZA 2BKOA 4P1NA 5AQSB 3AE1A 3J9X1 5HXHA 2XM1A 3GMIA 3RYHE 3G06A 3UU6A 2JQHA 2X68A 4HKAA 5TAOA 3QUJA 2LSKA 3JAEA 3PUZF 3P4SA 4HFIA 4KI0F 2P9BA 4CXWA 1KFYA 3J7Yq 4B3ST 2DL1A 3ZYLA 3ETVA 3PUQA 3X1DA 1U4QA 2X9HA 4P0AA 3UTKA 5FY7A 3UFEA 4X1KE 3TLTA 3RQWA 5FXZA 4IT4A 5ABFB 1Z8UA 3E08A 4UIGA 1I94T 5KMGP 4JYAT 5ABGA 1SUMB 2IMLA 2V26A 2WU2A 3CX6B 3I0OA 3RKGA 2VK9A 1SA0E 2Q9QD 4U72A 3TKLB 5HXSA 4JI8T 3RC8A 4MHCA 4DV4T 5L3FB 2NOXA 4LF5T 3F31A 1U5PA 2MTQA 3GN5A 3M3ZB 3N9MA 4QX7B 4CN1A 2CA5A 1D0YA 1OEDB 2W0GA 4F8HA 1S35A 2GK9A 3N2KE 3RPUA 2QGSA 4A56A 1FMWA 4GKJT 4ISSA 1Y01A 2K3WA 3I0QA 1D0ZA 4IE5A 2HPLA 2R6GF 1NEKA 3WAKA 4A98A 4O2BE 5JVDE 3C4ZA 4IDNA 4YXDA 5LHGB 1MMDA 2CXDA 2KSRA 2Y8DA 3JC6C 3MACA 4H63V 2X51A 4QHOA 3Q5WA 2VURA 4U31A 3KV6A 1XNRT 2W4XA 2HHHT 4X64T 1UX5A 2E9XC 3KINB 4DVDA 2K48A 2ZMAA 3U3IA 3ZJ1A 5DABA 3HI2A 1HX1B 2XQ9A 2PJQA 4C91A 2FBWA 5E0OA 1MIYA 4TWFA 5C8YE 5FVKA 5JDHA 2E9XB 3R6NA 4IE4A 4H9RC 4ZOLE 5KXJA 5J2UE 4NXMT 1DU2A 3AA1B 2IC9A 2XAJB 4AKGA 4HFVA 5CA1E 5AQGB 2E8IA 2UXDT 3RLFF 4DR2T 5LOVE 2LOPA 1D1AA 1B7TA 2V5CA 4IDOA 3AEDA 1QSDA 4TWDA 5AQJB 2BVMA 4UV8B 4A5XA 5LHIB 1UGOA 2XQ8A 3VU7H 5L47A 4QH1A 5AQOB 2L3LA 2BDEA 4DV2T 4IHJE 2LM2A 2N1GA 3SRZA 2CLYB 1OWAA 1JNZA 2ACXA 5H6QB 2W61A 4IE0A 3SWHA 3FXDB 3Q2MA 4B3RT 1WFDA 2J4GA 4NUVA 3OPCA 5JRCB 3RF1A 2EHOD 2HN2A 4PFOA 3NRXA 3CPZA 3M65A 5KDMC 3PUXF 4HFEA 3RIFA 3FBZA 3UUXB 4EOZB 5EK2A 1LVFA 2W00A 3KVAA 3FZFB 4H9PC 3NKZA 3PUAA 4PK4A 3P4QA 3PUSA 5JDLA 2N9DA 4Z91A 5HXRA 3RH3A 5LA6E 4JI4T 1M62A 1X79A 2D0UA 2I6HA 3LK3B 3Q5DA 4Q25A 4L9IA 2LSJA 3SFDA 2A9UA 2CBJA 1XWMA 2NWBA 4U2YA 1M7KA 3ZSTA 1YQ3A 4AKIA 2E9XA 3O4XE 2KWHA 4OK0A 3DP7A 3RYCE 2VKJA 3LDQB 3WAJA 3OYXA 3UU5A 3RRCA 1T98A 4ISTA 5FMNA 4AQFC 4CXXA 3FXEB 4TNWA 2HN1A 4J2CA 4I50E 5IHYA 4EIWA 1N34T 1KNPA 2WWVA 1UX4A 3Q5EA 2BBJA 2F4VT 2NTYA 4UVBB 3I9WA 1UCUA 3T1HT 2YU1A 3FBLA 4X62T 1UURA 1XMOT 3ESLA 5LGTB 1D0XA 2Y48B 3RHWA 2FJEA 4UVCB 2KXPB 4JI2T 2RPAA 3AEGA 3ANWB 4YSYA 3UUBA 5L2LA 3MK7C 4ZI3D 3PUYF 4CI2B 5EK4A 1MMNA 2X9YA 5JR9A 1KNZA 3A7MA 2FJDA 2LOSA 3P4RA 3AE4A 4CXYA 2FJAA 4KHPT 4H9SE 2CXLA 4MLKA 4IDZA 1E1HB 3P7IA 4QXBB 4OYJA 3LBXB 4JLEA 4EXTA 2E5LT 3PU8A 3ZKRA 4LF4T 2C5IT 4IL9A 4IL4A 1WR0A 1W9RA 3AVSA 4OX9T 4AKHA 4U7IA 1YXRA 1D1BA 1LRZA 5FNVE 1YD8G 3ZMSB 4WBNE 5EK3A 2WZHA 2C5JA 3FB2A 2JQQA 3FZHB 1BR2A 3KV5A 3MJXA 3CX7B 1VOMA 2D2SA 2BG9B 2ODUA 4JEUB 4PJNA 3O1JA 2BG9A 5L4HA 3UU4A 2CWYA 3ZMZB 3AAEB 4HTEA 2I0MA 3U78A 4YFSA 1WCRA 5A1LA 3AE8A 2ZM2A 4EV6A 2YDRA 3UUNA 4CQIA 4C90A 4DNDA 2LRKA 3HKBE 3L3PA 3JC6D 5LGUB 3C98B 4DV5T 3PV0F 4AKRB 3LSVA 3ZCIA 4H9NC 2D5UA 2AE9A 2CHOA 2ES0A 4IDPA 4DUZT 2M6IA 5CB4E 4V1Av 1CUNA 2LKHA 1WYBA 2W66A 4XAXB 3RC3A 4EZ4A 5L3DB 4EEBA 2CPTA 1W0AA 2WDQA
chains in the Genus database with same CATH topology
5FY0A 3RX6A 5FY1A 3CMLA 1BR0A 3NZQA 2K5BB 1MMGA 1FEWA 3BK9A 4WNKA 3K3NA 4H9OC 2LSIA 4QXCB 4ZI7E 1MIVA 2PBIA 3CQCB 3DJBA 5LYJE 3ONXA 3KVBA 3ZYMA 5LXTE 5FXXA 4TV9E 3KBUA 5DJQC 2V7JA 4ZI2D 4AQFA 3EUHA 3K3QC 4QWNB 4X20E 3N9LA 3Q9DA 2CE7A 2LHNA 3ZMVB 4ANJA 4PJJA 4H63H 2KNDA 5L3GB 5FP3A 4ILUA 5JDQA 3N2GE 3ZYKA 5HXCA 3HR0A 3QK6A 2YEVC 3F57A 5AFUL 2DWKA 5KX5E 1YKEB 5H6RB 4PK5A 5A1LA 4Z8XA 2VKDA 2J1DG 4G63A 4KP3C 2RA1A 3GA8A 4X1YE 2M67A 1WRDA 1IAPA 4BJNA 3OJAA 5LHHB 4HE8A 2CWOA 5HAXA 4PAGA 2CEAA 2PG8A 4TN7B 1HTJF 2VB6A 2ZM8A 1IZNB 3IF8B 3BQLA 2JRKA 2KZ7B 4GOUA 3ZLIA 2EHOA 4XBFB 1LVKA 3LK2B 1FMVA 4X1IE 2DI4A 4ZI3C 3CWZB 3F2EA 4EB6E 5HWYA 2XAHB 4JEHB 4ZS2A 4DMVA 5M4YA 3MXZA 2H7OA 2DCFA 5HWXA 2DNXA 5F8PA 4EYUA 2DWGA 2NW9A 4DO0A 4XZCA 3CQGB 4UEMA 1HG5A 1OXZA 1ZHCA 4E7ZA 4EYYR 1IJ6A 2K9AA 3NBXX 3PE0A 1O3XA 1HF8A 2XAGB 2UXXB 4OFZA 1YW0A 2L9QA 2WWUA 2Y6XA 3CVRA 3GN5B 3HKDE 2BVLA 2X0LB 1ZKEA 5HXEA 2WMOA 4TUYE 3C4WA 3N2OA 5LG4A 1MMAA 4GK0E 2VWAA 4TV8E 4CI3B 1HFAA 1NAFA 5ADXL 2NW7A 4U74A 4AKLA 2DLRA 4ZHQE 2KT9A 1LKXA 2LHRA 3O1HA 4BAYB 2XQYA 3R84B 1KNZA 2Q9QB 3HA4A 4IE6A 3I9YA 2IC6A 2VASA 3ZC0A 2CM0A 2XAQB 2NW8A 3K8PC 4UF0A 2WMNA 3H37A 2BZBA 1QUUA 4CI1B 3CX8B 3N9PA 3UUMA 5ETWA 4QXHB 2IAKA 3DTOA 4AQGA 2LJLA 5LCYA 4FJOA 4YJ3E 1BR1A 2LE8A 4JUYA 3IEEA 3MZKB 3ZC1A 5LGNB 3RYFE 3AAAB 3KV9A 4KBMB 4MALA 2N2NA 4O4HE 3ZN1B 5JDGA 3VHLA 3I1AA 1HX8A 2JMKA 5L3CB 5JDMA 5LP6E 3GWHA 3MA9A 5LBQB 3VKGA 3AAIA 1G73A 4GYRA 2XTLA 3UT5E 1WR6A 3EVYA 2CMRA 2RP4A 2EHOC 3D0TA 5JR9B 3KFWX 3N9OA 1V9DA 4I4TE 5JH7E 3ETUA 2C5KT 3SS1A 2LT3A 3P8CD 2ZLYA 3LG7A 2LEHA 4UV9B 4OHFA 5JDFA 3RYIE 1HG2A 1WLXA 2NP9A 3AA0B 3PDYA 1MNDA 2JJ9A 3V5UA 3ZCJA 5BMVE 3HL6A 2B1EA 3V5SA 4B6XA 4DBQA 4TX5A 4CZZB 2H3RA 3PTRB 1BR4A 4ADZA 2X9WA 1AJ3A 4L0RA 2JMHA 4KMCA 2V7KA 3OKQA 4UXNB 1YKHB 5L3BB 4BA9A 4QX8B 2W63A 2WSSV 3CKDA 2V1DB 3PUGA 3W15B 5F3JA 4IIJE 4P09A 4PFPA 2OA5A 3AA7B 5GONE 3ZEFB 1SHZC 4GK5E 4UF0B 1ZV4X 3LK42 4E7SA 3HKCE 2WM9A 3E22E 3IBPA 3ZMTB 2Q9QA 4GIWA 3ZMUB 3Q5XA 4YJ2E 4MFRA 4PW8A 2WAUA 2XAFB 3LFMA 2XHEB 2NTXA 4PJMA 5J1GA 3LJCA 4UELA 2A2FX 3L09A 4AKRB 2LSYA 3C64A 1ZEEA 2LSGA 2Z6EA 3T8OA 3SOLA 3B13A 3N9QA 3QC9A 4O4LE 3K3OA 1HCIA 1FIOA 2MOZA 3IHRA 4O4IE 3UULA 4G2AA 3ZJ2A 4HN9A 4M1PA 4F6RC 4K0UA 3FHNA 3LBXA 4ZS3A 2V7LA 3PURA 5EZYE 4WBOA 2X67A 2SPCA 4PK6A 2PFVA 3EDUA 2V7MA 4UVAB 5DQVA 2CCQA 4PNIA 2Q9QC 3AA6B 4HEAA 3KBTA 3BQIA 1KK7A 4BJMA 3BQKA 1NWMX 5JR9C 2X9XA 3C51A 5HYAA 3AVRA 3H3AA 4H9QC 4YHJA 1H7CA 2CXFA 4ZI2C 1VRBA 3B57A 4N78D 2CLYC 2KMFA 3RRWA 4DBRA 3HKEE 2IW5B 3E0ZA 5JQGE 5LJMA 2YK0A 2VKOA 2E9XD 3PU3A 2MBGA 3ANWA 2KINB 4EAHA 3CQXC 4TZ4C 2W62A 3OBVE 4NUUA 4I55E 3C50A 3RKOA 3OYZA 2XUEA 1Z0PA 1IJ5A 4PJLA 4O8SA 4OYKA 1MNEA 5JDNA 4IE7A 5IYZE 2C0SA 3ZN0B 4YLHA 1D1CA 2YINA 5FXVA 2VKHA 5LNKA 3S4UA 5JRCA 3WI3A 2KWIB 2XASB 4GYSA 4P0BA 3NRYA 3A5XA 1HS7A 2UXNB 2WBLA 1US7B 2EHOB 2K24A 4L5GA 2QA7A 3AB3B 4O4JE 3C4XA 3O9XA 5FXWA 4I43B 2JPFA 4DMWA 2MYSA 4FI5A 2KLQA 4IGUA 4QKNA 5DQWA 3VKHA 1S94A 2L8KA 4HGAA 3N9NA 4EZHA 5J2TE 2I59A 3ZPOA 2VL8A 1G8XA 2A72A 2V7IA 3EDVA 1EZ3A 2A3DA 2X66A 5FYMA 5JREA 3MKDA 4MBQA 2HH7A 2LM9A 5L3EB 4AXPA 1MIWA 3KV4A 4WW0A 2YU2A 3KDSE 1WYCA 2HPJA 2G0UA 2H7VC 3N5LA 5LJNA 4ASKA 2D0TA 4ERRA 5LBMA 2ZM0A 1Y64B 2ODVA 5CA0E 4KUMB 3O1IA 2DHRA 4O2AE 3NZPA 3J9X1 5HXHA 3GMIA 3RYHE 2X68A 4HKAA 5TAOA 3QUJA 2LSKA 4CXWA 2P9BA 3J7Yq 3ZYLA 3ETVA 3PUQA 1U4QA 2X9HA 4P0AA 3UTKA 5FY7A 3UFEA 4X1KE 5FXZA 3E08A 4UIGA 5KMGP 2V26A 3CX6B 3I0OA 2VK9A 1SA0E 2Q9QD 4U72A 3TKLB 5HXSA 3RC8A 4MHCA 5L3FB 2NOXA 3F31A 3GN5A 1U5PA 2MTQA 4QX7B 3N9MA 2CA5A 1D0YA 2W0GA 1S35A 2GK9A 3N2KE 3RPUA 2QGSA 4A56A 1FMWA 4ISSA 3I0QA 1D0ZA 4IE5A 2HPLA 3WAKA 4O2BE 5JVDE 3C4ZA 5LHGB 1MMDA 2CXDA 2Y8DA 3MACA 3JC6C 4H63V 4QHOA 2X51A 3Q5WA 3KV6A 1UX5A 2E9XC 3KINB 4DVDA 2K48A 2ZMAA 3U3IA 3ZJ1A 5DABA 3HI2A 4C91A 2PJQA 5E0OA 1MIYA 5C8YE 5JDHA 2E9XB 3R6NA 4IE4A 4H9RC 4ZOLE 5J2UE 3AA1B 2IC9A 2XAJB 4AKGA 4HFVA 5CA1E 2E8IA 5LOVE 2LOPA 1D1AA 1B7TA 1QSDA 2BVMA 4UV8B 5LHIB 3VU7H 2L3LA 2BDEA 4IHJE 2N1GA 3SRZA 2CLYB 1OWAA 2ACXA 5H6QB 2W61A 4IE0A 3SWHA 3FXDB 3Q2MA 4NUVA 5JRCB 2EHOD 4PFOA 3NRXA 3CPZA 3M65A 5KDMC 3UUXB 4EOZB 4AI6A 3FBZA 5EK2A 1LVFA 2W00A 3KVAA 4H9PC 3PUAA 4PK4A 3PUSA 5JDLA 2N9DA 3RH3A 5HXRA 5LA6E 1X79A 2D0UA 3LK3B 4L9IA 2LSJA 2NWBA 4AKIA 2E9XA 3O4XE 2KWHA 4OK0A 3DP7A 3RYCE 2VKJA 3WAJA 3OYXA 3RRCA 1T98A 4ISTA 5FMNA 4AQFC 4CXXA 3FXEB 4J2CA 4I50E 5IHYA 4EIWA 1UX4A 2NTYA 4UVBB 3I9WA 1UCUA 2YU1A 3FBLA 3ESLA 5LGTB 1D0XA 2Y48B 4UVCB 2KXPB 3ANWB 5L2LA 3MK7C 4ZI3D 4CI2B 5EK4A 1MMNA 2X9YA 5JR9A 2LOSA 4CXYA 4H9SE 2CXLA 4MLKA 4IDZA 1E1HB 3P7IA 4QXBB 4OYJA 3LBXB 4JLEA 4EXTA 3PU8A 2C5IT 4AKHA 3AVSA 1D1BA 1LRZA 5FNVE 1YD8G 3ZMSB 4WBNE 5EK3A 3FB2A 2C5JA 3KV5A 2JQQA 3MJXA 1BR2A 3CX7B 1VOMA 2D2SA 2ODUA 4JEUB 4PJNA 3O1JA 2CWYA 3ZMZB 3AAEB 4HTEA 3U78A 4YFSA 2ZM2A 4CQIA 3UUNA 4C90A 4DNDA 3HKBE 3L3PA 3JC6D 5LGUB 3C98B 3ZCIA 4H9NC 2D5UA 2ES0A 5CB4E 4V1Av 1CUNA 4EZ4A 1WYBA 4XAXB 3RC3A 5L3DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOP A;  2LOS A; 
#chains in the Genus database with same CATH topology
 5FY0 A;  3RX6 A;  5FY1 A;  2WY2 A;  3CML A;  5CFB A;  3NZQ A;  1BR0 A;  2K5B B;  1MMG A;  5ABF A;  1FEW A;  3BK9 A;  5HEO A;  3CK6 A;  4WNK A;  2E2A A;  3K3N A;  4LMJ A;  5AQP B;  1T7S A;  4YTM A;  3QNU A;  4H9O C;  2YDQ A;  5AQQ B;  1HNW T;  2V6Y A;  5J0Z A;  2MPK A;  2LSI A;  2VL0 A;  4QXC B;  4HFB A;  3OVU A;  4ZI7 E;  4LFA T;  4ZEY A;  5ABE A;  1MIV A;  2PBI A;  3CQC B;  3DJB A;  4HFC A;  5LYJ E;  3ONX A;  2V8S V;  3KVB A;  3ZYM A;  4GKK T;  5JTG A;  5LXT E;  4WYV A;  5FXX A;  2BKN A;  4TV9 E;  2X0H A;  3KBU A;  3EI0 A;  2V7J A;  5DJQ C;  3PUW F;  4ZI2 D;  4AQF A;  3EUH A;  3K3Q C;  2XQ5 A;  4QWN B;  2QRX A;  4X20 E;  2IUB A;  3AEB A;  3N9L A;  3ONJ A;  4ILA A;  3Q9D A;  4U2Z A;  2CE7 A;  2IHR 1;  2LHN A;  3ZMV B;  4ANJ A;  4PJJ A;  4YTN A;  4H63 H;  5AQF B;  4AIS A;  5LMU T;  2KND A;  4LML A;  3QB5 A;  5FP3 A;  4ILU A;  5JDQ A;  3N2G E;  5L3G B;  4DV3 T;  3ZYK A;  5HXC A;  3HR0 A;  3QK6 A;  2YEV C;  4ILB A;  3F57 A;  5AFU L;  2DWK A;  1X9B A;  4HFH A;  4NPP A;  1KNR A;  4U33 A;  4LF8 T;  5KX5 E;  1YKE B;  5H6R B;  5CJ5 A;  4LMK A;  2LKG A;  4PK5 A;  4I0U A;  2VKD A;  4Z8X A;  2J1D G;  4G63 A;  2FUP A;  2RA1 A;  2WZI A;  3GA8 A;  2BKP A;  4KP3 C;  4X1Y E;  5F5W A;  2YKS A;  3EHZ A;  4DV6 T;  2M67 A;  1WRD A;  1IAP A;  5HEH A;  4BJN A;  3OJA A;  4QH4 A;  5LHH B;  4HE8 A;  2CWO A;  3VR8 A;  5HAX A;  2H89 A;  3P4W A;  4PAG A;  5FKY A;  4YHH T;  2CEA A;  2PG8 A;  2QYW A;  4TN7 B;  1HTJ F;  2VB6 A;  2YDS A;  1IZN B;  1T72 A;  2ZM8 A;  3IF8 B;  3BQL A;  1XDP A;  2JRK A;  2KZ7 B;  5LMN T;  4GOU A;  2JIW A;  2EHO A;  3ZLI A;  1LVK A;  3LK2 B;  1FMV A;  4X1I E;  4XBF B;  2DI4 A;  4WZX A;  3CWZ B;  4ZI3 C;  3F2E A;  3RIU A;  4EB6 E;  1XMQ T;  5HWY A;  1J5W A;  2XAH B;  4JEH B;  4YSX A;  2E5V A;  4ZS2 A;  4DMV A;  2PTF A;  3MXZ A;  5M4Y A;  2V5D A;  2H7O A;  5LG3 A;  5IUX A;  2DCF A;  1UUS A;  3L39 A;  2UUA T;  5HWX A;  2DNX A;  5F8P A;  4EYU A;  2DWG A;  2NW9 A;  4DO0 A;  4XZC A;  3CQG B;  4UEM A;  1HG5 A;  3SFE A;  1OXZ A;  1ZHC A;  4E7Z A;  4EYY R;  1XNQ T;  1IJ6 A;  2K9A A;  3H3M A;  3NBX X;  3PE0 A;  1O3X A;  1HF8 A;  4DV1 T;  1OED A;  2XAG B;  2UXX B;  2XZE A;  4OFZ A;  2M6B A;  1YW0 A;  2L9Q A;  2WWU A;  2Y6X A;  3AE3 A;  2IDO B;  3CVR A;  2BVL A;  2X0L B;  1ZKE A;  3GN5 B;  3HKD E;  2WMO A;  4TUY E;  5AQM B;  5HXE A;  3C4W A;  4JI3 T;  3N2O A;  3JAF A;  5LG4 A;  1MMA A;  1XZY A;  2VWA A;  4GK0 E;  2D9D A;  1J1J A;  1HFA A;  1NAF A;  2W2U A;  1CHU A;  4TV8 E;  4NIQ A;  4CI3 B;  5ADX L;  2NW7 A;  4JV5 T;  4U74 A;  4AKL A;  2DLR A;  4ZHQ E;  3B5M A;  2KT9 A;  4KHZ F;  1ZOY A;  1LKX A;  2LHR A;  3O1H A;  4BAY B;  2XQY A;  3AE9 A;  4U7Y A;  2Q9Q B;  3AEC A;  3R84 B;  4LF6 T;  5AQT B;  2LLY A;  3HA4 A;  4IE6 A;  3I9Y A;  5AQL B;  2V6X A;  2IC6 A;  2VAS A;  4LF9 T;  1FJG T;  3JAD A;  2UXB T;  4YT0 A;  4DR5 T;  2CM0 A;  3ZC0 A;  2XAQ B;  2NW8 A;  3JCF A;  3K8P C;  4UF0 A;  2WMN A;  4DV0 T;  3H37 A;  2BZB A;  1QUU A;  4X66 T;  2WS3 A;  4CI1 B;  3EAM A;  1GQE A;  3CX8 B;  3N9P A;  3UUM A;  5ETW A;  1HNX T;  4B3T T;  4QXH B;  2IAK A;  3DTO A;  4AQG A;  2LJL A;  5LCY A;  4FJO A;  4YJ3 E;  2OLT A;  3A8Y C;  1BR1 A;  2LE8 A;  3QB5 K;  4JUY A;  3UU3 A;  3IEE A;  3MZK B;  3ZC1 A;  5LGN B;  2WU5 A;  3RYF E;  3AAA B;  3KV9 A;  5LB7 B;  5CA0 E;  4YTP A;  1N33 T;  4KBM B;  4MAL A;  2N2N A;  3RQU A;  4O4H E;  2OV9 A;  3ZN1 B;  5JDG A;  3VHL A;  3I1A A;  1HX8 A;  1KEY A;  2JMK A;  5JDM A;  3QOF A;  3GWH A;  5L3C B;  3ONL C;  2J47 A;  5HEJ A;  2ZM6 T;  3MA9 A;  3AXJ A;  5LBQ B;  4EED A;  4ZZB A;  4Z90 A;  3TLU A;  3VKG A;  3AAI A;  4DV7 T;  1G73 A;  4GYR A;  4A97 A;  1HNZ T;  2IIU A;  2XTL A;  3UT5 E;  1WR6 A;  5AQH B;  4DR3 T;  3EVY A;  2CMR A;  2RP4 A;  3FZL B;  2EHO C;  3D0T A;  5JR9 B;  3KFW X;  3AEA A;  5HCJ A;  4JI0 T;  3N9O A;  1V9D A;  4I4T E;  4UR9 A;  5JH7 E;  3ETU A;  2C5K T;  2CHN A;  2XY8 B;  4JBW F;  3SS1 A;  4TNV A;  2LT3 A;  3P8C D;  4HFD A;  2ZLY A;  3LG7 A;  2LEH A;  4UV9 B;  4OHF A;  3EAB A;  2BS4 A;  4AIU A;  5JDF A;  3UU8 A;  3RYI E;  1HG2 A;  3AE6 A;  1WLX A;  3FZM B;  1W09 A;  2NP9 A;  3AA0 B;  1OED E;  3PDY A;  4CN6 A;  4LFC T;  1MND A;  2JJ9 A;  1YQ4 A;  3CIR A;  3V5U A;  3ZCJ A;  3T1Y T;  4DR4 T;  5BMV E;  3HL6 A;  3UQ4 A;  3AE5 A;  2B1E A;  1J5E T;  5C2T A;  3V5S A;  4B6X A;  5FVL A;  4DBQ A;  4ZZC A;  4LFB T;  4TX5 A;  5FL0 A;  3P4P A;  4CZZ B;  2H3R A;  3PTR B;  5AQK B;  1BR4 A;  4ADZ A;  2X9W A;  1AJ3 A;  1E2A A;  2XQ6 A;  4L0R A;  1KF6 A;  2QVA A;  2JMH A;  2WDV A;  4KMC A;  2V7K A;  3OKQ A;  4UXN B;  1YKH B;  3TLV A;  2WB5 A;  4QH5 A;  5L3B B;  4IDQ A;  4ZXL A;  4BA9 A;  4QX8 B;  1N36 T;  1JNR A;  1UK5 A;  2W63 A;  4AI6 A;  2WSS V;  3CKD A;  2V1D B;  3PUG A;  3W15 B;  5F3J A;  5AQV B;  4IIJ E;  4P09 A;  4PFP A;  2OA5 A;  3AA7 B;  1SE7 A;  5GON E;  3ZEF B;  1SHZ C;  4GK5 E;  4UF0 B;  1ZV4 X;  2XPK A;  4CN4 A;  4DR7 T;  3LK4 2;  5CGM A;  2VVN A;  4E7S A;  3RIA A;  5AQR B;  3HKC E;  1VCT A;  4AQY T;  2UXC T;  3VRA A;  2WDR A;  2V6Y B;  2WP9 A;  3TLS A;  4JI7 T;  2WM9 A;  3E22 E;  3IBP A;  3ZMT B;  2Q9Q A;  4GIW A;  3ZMU B;  3Q5X A;  4KX6 A;  3ZT6 A;  4YJ2 E;  4MFR A;  3K1S A;  3UFG A;  2XQ7 A;  2WAU A;  2XAF B;  3AEE A;  3LFM A;  3AXJ B;  4PW8 A;  3VRB A;  2XHE B;  1IBL T;  2NTX A;  4PJM A;  5J1G A;  3LJC A;  4UEL A;  2A2F X;  1OED C;  3L09 A;  2LSY A;  3FZK B;  5AQU B;  3RGL A;  3AEF A;  1ZEE A;  2BBH A;  2LSG A;  2Z6E A;  3C64 A;  1E7P A;  3SOL A;  3T8O A;  3VKH A;  3B13 A;  3N9Q A;  3QC9 A;  3L8R A;  4HWC A;  4O4L E;  4X65 T;  5C3J A;  3PJA A;  2MAW A;  1HCI A;  1FIO A;  2LRL A;  2MOZ A;  3IHR A;  3K3O A;  4G2A A;  4O4I E;  2XQ4 A;  3UUL A;  4HN9 A;  3ZJ2 A;  4M1P A;  4F6R C;  1IBK T;  4HWH A;  4HWI B;  2AXD S;  4YY3 T;  4JI5 T;  4K0U A;  3FHN A;  3LBX A;  2W67 A;  2V7L A;  1VCS A;  3PUR A;  4ZS3 A;  5AQN B;  1XDO A;  4WBO A;  5EZY E;  2X67 A;  1N32 T;  2SPC A;  4PK6 A;  2PFV A;  3AE2 A;  2V7M A;  2BG9 E;  3EDU A;  4HWD A;  4UVA B;  5DQV A;  2UU9 T;  2CCQ A;  4PNI A;  4K0K T;  5LP6 E;  2BS3 A;  2Q9Q C;  1IBM T;  2CBI A;  4LF7 T;  3AA6 B;  4HEA A;  3RI5 A;  2CRB A;  2ACZ A;  3BQI A;  3KBT A;  3TLW A;  1KK7 A;  2NR4 A;  4BJM A;  5IWA T;  3BQK A;  1NWM X;  2YN6 A;  1W0B A;  2X9X A;  3C51 A;  5JR9 C;  2JQ9 A;  1ZP0 A;  3AVR A;  5HYA A;  3H3A A;  2JQK A;  2YOE A;  4H9Q C;  4YHJ A;  5L4E A;  4JI6 T;  1H7C A;  2CXF A;  2XM2 A;  4YSZ A;  4ZI2 C;  1VRB A;  3B57 A;  4N78 D;  2CLY C;  2KMF A;  1T8B A;  3RRW A;  4DBR A;  3HKE E;  3UQ7 A;  2J62 A;  3E0Z A;  3NWI A;  2IW5 B;  4EGW A;  5JQG E;  5LJM A;  5FL1 A;  4DUY T;  2YK0 A;  2VKO A;  2E9X D;  3PU3 A;  2MBG A;  3ANW A;  3ABV A;  2KIN B;  4ILC A;  4EAH A;  3CQX C;  4TZ4 C;  2W62 A;  3OBV E;  3PUV F;  4NUU A;  4I55 E;  2WCA A;  3C50 A;  4TWH A;  3RKO A;  1QLB A;  3OYZ A;  4NXN T;  2XUE A;  4DR6 T;  1Z0P A;  1IJ5 A;  4PJL A;  4O8S A;  3ZT5 A;  2XJ7 A;  3P50 A;  4OYK A;  1MNE A;  5JDN A;  4IE7 A;  5IYZ E;  2C0S A;  3ZN0 B;  5ABH A;  4YLH A;  1D1C A;  2YIN A;  5FXV A;  3OTO T;  2VKH A;  5LNK A;  1L0V A;  3S4U A;  5JRC A;  3WI3 A;  2KWI B;  2XAS B;  4GYS A;  2VVS A;  4P0B A;  3NRY A;  3A5X A;  1HS7 A;  2UXN B;  2WBL A;  1US7 B;  5AQI B;  2EHO B;  5HCM A;  1R8I A;  2VQE T;  2K24 A;  4L5G A;  2QA7 A;  3AB3 B;  3NVO A;  4O4J E;  3RIU C;  5HEU A;  3C4X A;  3O9X A;  5FXW A;  4I43 B;  2JPF A;  4DMW A;  2MYS A;  4FI5 A;  2H88 A;  2KLQ A;  1NEN A;  2FJB A;  3PJA J;  4IGU A;  4QKN A;  1S94 A;  2L8K A;  5DQW A;  3ZSS A;  4HGA A;  3N9N A;  4EZH A;  5J2T E;  4IRE A;  2I59 A;  3ZPO A;  2XQA A;  2VL8 A;  1G8X A;  2A72 A;  2V7I A;  3EDV A;  1EZ3 A;  2A3D A;  2X66 A;  4U3C A;  5FYM A;  2XSB A;  3MKD A;  3AE7 A;  4MBQ A;  5JRE A;  4DID B;  2B76 A;  2UUC T;  5BR8 T;  2HH7 A;  2LM9 A;  2BS2 A;  2X0Y A;  4X5T A;  4AXP A;  1MIW A;  3KV4 A;  4WW0 A;  5L3E B;  3VR9 A;  4HWF A;  2VQF T;  2YU2 A;  3KDS E;  1WYC A;  2HPJ A;  2XQ3 A;  2G0U A;  2H7V C;  3IA3 A;  3N5L A;  5LJN A;  2WQY A;  4ASK A;  2D0T A;  2XSA A;  5LBM A;  2ZM0 A;  1Y64 B;  2ODV A;  4COF A;  4KUM B;  3O1I A;  4ERR A;  5HEG A;  2BG9 C;  1HR0 T;  4B3M T;  4DR1 T;  2DHR A;  4JI1 T;  4O2A E;  3NZP A;  3ZT7 A;  2UUB T;  1I6Z A;  2BKO A;  4P1N A;  5AQS B;  3AE1 A;  3J9X 1;  5HXH A;  2XM1 A;  3GMI A;  3RYH E;  3G06 A;  3UU6 A;  2JQH A;  2X68 A;  4HKA A;  5TAO A;  3QUJ A;  2LSK A;  3JAE A;  3PUZ F;  3P4S A;  4HFI A;  4KI0 F;  2P9B A;  4CXW A;  1KFY A;  3J7Y q;  4B3S T;  2DL1 A;  3ZYL A;  3ETV A;  3PUQ A;  3X1D A;  1U4Q A;  2X9H A;  4P0A A;  3UTK A;  5FY7 A;  3UFE A;  4X1K E;  3TLT A;  3RQW A;  5FXZ A;  4IT4 A;  5ABF B;  1Z8U A;  3E08 A;  4UIG A;  1I94 T;  5KMG P;  4JYA T;  5ABG A;  1SUM B;  2IML A;  2V26 A;  2WU2 A;  3CX6 B;  3I0O A;  3RKG A;  2VK9 A;  1SA0 E;  2Q9Q D;  4U72 A;  3TKL B;  5HXS A;  4JI8 T;  3RC8 A;  4MHC A;  4DV4 T;  5L3F B;  2NOX A;  4LF5 T;  3F31 A;  1U5P A;  2MTQ A;  3GN5 A;  3M3Z B;  3N9M A;  4QX7 B;  4CN1 A;  2CA5 A;  1D0Y A;  1OED B;  2W0G A;  4F8H A;  1S35 A;  2GK9 A;  3N2K E;  3RPU A;  2QGS A;  4A56 A;  1FMW A;  4GKJ T;  4ISS A;  1Y01 A;  2K3W A;  3I0Q A;  1D0Z A;  4IE5 A;  2HPL A;  2R6G F;  1NEK A;  3WAK A;  4A98 A;  4O2B E;  5JVD E;  3C4Z A;  4IDN A;  4YXD A;  5LHG B;  1MMD A;  2CXD A;  2KSR A;  2Y8D A;  3JC6 C;  3MAC A;  4H63 V;  2X51 A;  4QHO A;  3Q5W A;  2VUR A;  4U31 A;  3KV6 A;  1XNR T;  2W4X A;  2HHH T;  4X64 T;  1UX5 A;  2E9X C;  3KIN B;  4DVD A;  2K48 A;  2ZMA A;  3U3I A;  3ZJ1 A;  5DAB A;  3HI2 A;  1HX1 B;  2XQ9 A;  2PJQ A;  4C91 A;  2FBW A;  5E0O A;  1MIY A;  4TWF A;  5C8Y E;  5FVK A;  5JDH A;  2E9X B;  3R6N A;  4IE4 A;  4H9R C;  4ZOL E;  5KXJ A;  5J2U E;  4NXM T;  1DU2 A;  3AA1 B;  2IC9 A;  2XAJ B;  4AKG A;  4HFV A;  5CA1 E;  5AQG B;  2E8I A;  2UXD T;  3RLF F;  4DR2 T;  5LOV E;  2LOP A;  1D1A A;  1B7T A;  2V5C A;  4IDO A;  3AED A;  1QSD A;  4TWD A;  5AQJ B;  2BVM A;  4UV8 B;  4A5X A;  5LHI B;  1UGO A;  2XQ8 A;  3VU7 H;  5L47 A;  4QH1 A;  5AQO B;  2L3L A;  2BDE A;  4DV2 T;  4IHJ E;  2LM2 A;  2N1G A;  3SRZ A;  2CLY B;  1OWA A;  1JNZ A;  2ACX A;  5H6Q B;  2W61 A;  4IE0 A;  3SWH A;  3FXD B;  3Q2M A;  4B3R T;  1WFD A;  2J4G A;  4NUV A;  3OPC A;  5JRC B;  3RF1 A;  2EHO D;  2HN2 A;  4PFO A;  3NRX A;  3CPZ A;  3M65 A;  5KDM C;  3PUX F;  4HFE A;  3RIF A;  3FBZ A;  3UUX B;  4EOZ B;  5EK2 A;  1LVF A;  2W00 A;  3KVA A;  3FZF B;  4H9P C;  3NKZ A;  3PUA A;  4PK4 A;  3P4Q A;  3PUS A;  5JDL A;  2N9D A;  4Z91 A;  5HXR A;  3RH3 A;  5LA6 E;  4JI4 T;  1M62 A;  1X79 A;  2D0U A;  2I6H A;  3LK3 B;  3Q5D A;  4Q25 A;  4L9I A;  2LSJ A;  3SFD A;  2A9U A;  2CBJ A;  1XWM A;  2NWB A;  4U2Y A;  1M7K A;  3ZST A;  1YQ3 A;  4AKI A;  2E9X A;  3O4X E;  2KWH A;  4OK0 A;  3DP7 A;  3RYC E;  2VKJ A;  3LDQ B;  3WAJ A;  3OYX A;  3UU5 A;  3RRC A;  1T98 A;  4IST A;  5FMN A;  4AQF C;  4CXX A;  3FXE B;  4TNW A;  2HN1 A;  4J2C A;  4I50 E;  5IHY A;  4EIW A;  1N34 T;  1KNP A;  2WWV A;  1UX4 A;  3Q5E A;  2BBJ A;  2F4V T;  2NTY A;  4UVB B;  3I9W A;  1UCU A;  3T1H T;  2YU1 A;  3FBL A;  4X62 T;  1UUR A;  1XMO T;  3ESL A;  5LGT B;  1D0X A;  2Y48 B;  3RHW A;  2FJE A;  4UVC B;  2KXP B;  4JI2 T;  2RPA A;  3AEG A;  3ANW B;  4YSY A;  3UUB A;  5L2L A;  3MK7 C;  4ZI3 D;  3PUY F;  4CI2 B;  5EK4 A;  1MMN A;  2X9Y A;  5JR9 A;  1KNZ A;  3A7M A;  2FJD A;  2LOS A;  3P4R A;  3AE4 A;  4CXY A;  2FJA A;  4KHP T;  4H9S E;  2CXL A;  4MLK A;  4IDZ A;  1E1H B;  3P7I A;  4QXB B;  4OYJ A;  3LBX B;  4JLE A;  4EXT A;  2E5L T;  3PU8 A;  3ZKR A;  4LF4 T;  2C5I T;  4IL9 A;  4IL4 A;  1WR0 A;  1W9R A;  3AVS A;  4OX9 T;  4AKH A;  4U7I A;  1YXR A;  1D1B A;  1LRZ A;  5FNV E;  1YD8 G;  3ZMS B;  4WBN E;  5EK3 A;  2WZH A;  2C5J A;  3FB2 A;  2JQQ A;  3FZH B;  1BR2 A;  3KV5 A;  3MJX A;  3CX7 B;  1VOM A;  2D2S A;  2BG9 B;  2ODU A;  4JEU B;  4PJN A;  3O1J A;  2BG9 A;  5L4H A;  3UU4 A;  2CWY A;  3ZMZ B;  3AAE B;  4HTE A;  2I0M A;  3U78 A;  4YFS A;  1WCR A;  5A1L A;  3AE8 A;  2ZM2 A;  4EV6 A;  2YDR A;  3UUN A;  4CQI A;  4C90 A;  4DND A;  2LRK A;  3HKB E;  3L3P A;  3JC6 D;  5LGU B;  3C98 B;  4DV5 T;  3PV0 F;  4AKR B;  3LSV A;  3ZCI A;  4H9N C;  2D5U A;  2AE9 A;  2CHO A;  2ES0 A;  4IDP A;  4DUZ T;  2M6I A;  5CB4 E;  4V1A v;  1CUN A;  2LKH A;  1WYB A;  2W66 A;  4XAX B;  3RC3 A;  4EZ4 A;  5L3D B;  4EEB A;  2CPT A;  1W0A A;  2WDQ A; 
#chains in the Genus database with same CATH homology
 5FY0 A;  3RX6 A;  5FY1 A;  3CML A;  1BR0 A;  3NZQ A;  2K5B B;  1MMG A;  1FEW A;  3BK9 A;  4WNK A;  3K3N A;  4H9O C;  2LSI A;  4QXC B;  4ZI7 E;  1MIV A;  2PBI A;  3CQC B;  3DJB A;  5LYJ E;  3ONX A;  3KVB A;  3ZYM A;  5LXT E;  5FXX A;  4TV9 E;  3KBU A;  5DJQ C;  2V7J A;  4ZI2 D;  4AQF A;  3EUH A;  3K3Q C;  4QWN B;  4X20 E;  3N9L A;  3Q9D A;  2CE7 A;  2LHN A;  3ZMV B;  4ANJ A;  4PJJ A;  4H63 H;  2KND A;  5L3G B;  5FP3 A;  4ILU A;  5JDQ A;  3N2G E;  3ZYK A;  5HXC A;  3HR0 A;  3QK6 A;  2YEV C;  3F57 A;  5AFU L;  2DWK A;  5KX5 E;  1YKE B;  5H6R B;  4PK5 A;  5A1L A;  4Z8X A;  2VKD A;  2J1D G;  4G63 A;  4KP3 C;  2RA1 A;  3GA8 A;  4X1Y E;  2M67 A;  1WRD A;  1IAP A;  4BJN A;  3OJA A;  5LHH B;  4HE8 A;  2CWO A;  5HAX A;  4PAG A;  2CEA A;  2PG8 A;  4TN7 B;  1HTJ F;  2VB6 A;  2ZM8 A;  1IZN B;  3IF8 B;  3BQL A;  2JRK A;  2KZ7 B;  4GOU A;  3ZLI A;  2EHO A;  4XBF B;  1LVK A;  3LK2 B;  1FMV A;  4X1I E;  2DI4 A;  4ZI3 C;  3CWZ B;  3F2E A;  4EB6 E;  5HWY A;  2XAH B;  4JEH B;  4ZS2 A;  4DMV A;  5M4Y A;  3MXZ A;  2H7O A;  2DCF A;  5HWX A;  2DNX A;  5F8P A;  4EYU A;  2DWG A;  2NW9 A;  4DO0 A;  4XZC A;  3CQG B;  4UEM A;  1HG5 A;  1OXZ A;  1ZHC A;  4E7Z A;  4EYY R;  1IJ6 A;  2K9A A;  3NBX X;  3PE0 A;  1O3X A;  1HF8 A;  2XAG B;  2UXX B;  4OFZ A;  1YW0 A;  2L9Q A;  2WWU A;  2Y6X A;  3CVR A;  3GN5 B;  3HKD E;  2BVL A;  2X0L B;  1ZKE A;  5HXE A;  2WMO A;  4TUY E;  3C4W A;  3N2O A;  5LG4 A;  1MMA A;  4GK0 E;  2VWA A;  4TV8 E;  4CI3 B;  1HFA A;  1NAF A;  5ADX L;  2NW7 A;  4U74 A;  4AKL A;  2DLR A;  4ZHQ E;  2KT9 A;  1LKX A;  2LHR A;  3O1H A;  4BAY B;  2XQY A;  3R84 B;  1KNZ A;  2Q9Q B;  3HA4 A;  4IE6 A;  3I9Y A;  2IC6 A;  2VAS A;  3ZC0 A;  2CM0 A;  2XAQ B;  2NW8 A;  3K8P C;  4UF0 A;  2WMN A;  3H37 A;  2BZB A;  1QUU A;  4CI1 B;  3CX8 B;  3N9P A;  3UUM A;  5ETW A;  4QXH B;  2IAK A;  3DTO A;  4AQG A;  2LJL A;  5LCY A;  4FJO A;  4YJ3 E;  1BR1 A;  2LE8 A;  4JUY A;  3IEE A;  3MZK B;  3ZC1 A;  5LGN B;  3RYF E;  3AAA B;  3KV9 A;  4KBM B;  4MAL A;  2N2N A;  4O4H E;  3ZN1 B;  5JDG A;  3VHL A;  3I1A A;  1HX8 A;  2JMK A;  5L3C B;  5JDM A;  5LP6 E;  3GWH A;  3MA9 A;  5LBQ B;  3VKG A;  3AAI A;  1G73 A;  4GYR A;  2XTL A;  3UT5 E;  1WR6 A;  3EVY A;  2CMR A;  2RP4 A;  2EHO C;  3D0T A;  5JR9 B;  3KFW X;  3N9O A;  1V9D A;  4I4T E;  5JH7 E;  3ETU A;  2C5K T;  3SS1 A;  2LT3 A;  3P8C D;  2ZLY A;  3LG7 A;  2LEH A;  4UV9 B;  4OHF A;  5JDF A;  3RYI E;  1HG2 A;  1WLX A;  2NP9 A;  3AA0 B;  3PDY A;  1MND A;  2JJ9 A;  3V5U A;  3ZCJ A;  5BMV E;  3HL6 A;  2B1E A;  3V5S A;  4B6X A;  4DBQ A;  4TX5 A;  4CZZ B;  2H3R A;  3PTR B;  1BR4 A;  4ADZ A;  2X9W A;  1AJ3 A;  4L0R A;  2JMH A;  4KMC A;  2V7K A;  3OKQ A;  4UXN B;  1YKH B;  5L3B B;  4BA9 A;  4QX8 B;  2W63 A;  2WSS V;  3CKD A;  2V1D B;  3PUG A;  3W15 B;  5F3J A;  4IIJ E;  4P09 A;  4PFP A;  2OA5 A;  3AA7 B;  5GON E;  3ZEF B;  1SHZ C;  4GK5 E;  4UF0 B;  1ZV4 X;  3LK4 2;  4E7S A;  3HKC E;  2WM9 A;  3E22 E;  3IBP A;  3ZMT B;  2Q9Q A;  4GIW A;  3ZMU B;  3Q5X A;  4YJ2 E;  4MFR A;  4PW8 A;  2WAU A;  2XAF B;  3LFM A;  2XHE B;  2NTX A;  4PJM A;  5J1G A;  3LJC A;  4UEL A;  2A2F X;  3L09 A;  4AKR B;  2LSY A;  3C64 A;  1ZEE A;  2LSG A;  2Z6E A;  3T8O A;  3SOL A;  3B13 A;  3N9Q A;  3QC9 A;  4O4L E;  3K3O A;  1HCI A;  1FIO A;  2MOZ A;  3IHR A;  4O4I E;  3UUL A;  4G2A A;  3ZJ2 A;  4HN9 A;  4M1P A;  4F6R C;  4K0U A;  3FHN A;  3LBX A;  4ZS3 A;  2V7L A;  3PUR A;  5EZY E;  4WBO A;  2X67 A;  2SPC A;  4PK6 A;  2PFV A;  3EDU A;  2V7M A;  4UVA B;  5DQV A;  2CCQ A;  4PNI A;  2Q9Q C;  3AA6 B;  4HEA A;  3KBT A;  3BQI A;  1KK7 A;  4BJM A;  3BQK A;  1NWM X;  5JR9 C;  2X9X A;  3C51 A;  5HYA A;  3AVR A;  3H3A A;  4H9Q C;  4YHJ A;  1H7C A;  2CXF A;  4ZI2 C;  1VRB A;  3B57 A;  4N78 D;  2CLY C;  2KMF A;  3RRW A;  4DBR A;  3HKE E;  2IW5 B;  3E0Z A;  5JQG E;  5LJM A;  2YK0 A;  2VKO A;  2E9X D;  3PU3 A;  2MBG A;  3ANW A;  2KIN B;  4EAH A;  3CQX C;  4TZ4 C;  2W62 A;  3OBV E;  4NUU A;  4I55 E;  3C50 A;  3RKO A;  3OYZ A;  2XUE A;  1Z0P A;  1IJ5 A;  4PJL A;  4O8S A;  4OYK A;  1MNE A;  5JDN A;  4IE7 A;  5IYZ E;  2C0S A;  3ZN0 B;  4YLH A;  1D1C A;  2YIN A;  5FXV A;  2VKH A;  5LNK A;  3S4U A;  5JRC A;  3WI3 A;  2KWI B;  2XAS B;  4GYS A;  4P0B A;  3NRY A;  3A5X A;  1HS7 A;  2UXN B;  2WBL A;  1US7 B;  2EHO B;  2K24 A;  4L5G A;  2QA7 A;  3AB3 B;  4O4J E;  3C4X A;  3O9X A;  5FXW A;  4I43 B;  2JPF A;  4DMW A;  2MYS A;  4FI5 A;  2KLQ A;  4IGU A;  4QKN A;  5DQW A;  3VKH A;  1S94 A;  2L8K A;  4HGA A;  3N9N A;  4EZH A;  5J2T E;  2I59 A;  3ZPO A;  2VL8 A;  1G8X A;  2A72 A;  2V7I A;  3EDV A;  1EZ3 A;  2A3D A;  2X66 A;  5FYM A;  5JRE A;  3MKD A;  4MBQ A;  2HH7 A;  2LM9 A;  5L3E B;  4AXP A;  1MIW A;  3KV4 A;  4WW0 A;  2YU2 A;  3KDS E;  1WYC A;  2HPJ A;  2G0U A;  2H7V C;  3N5L A;  5LJN A;  4ASK A;  2D0T A;  4ERR A;  5LBM A;  2ZM0 A;  1Y64 B;  2ODV A;  5CA0 E;  4KUM B;  3O1I A;  2DHR A;  4O2A E;  3NZP A;  3J9X 1;  5HXH A;  3GMI A;  3RYH E;  2X68 A;  4HKA A;  5TAO A;  3QUJ A;  2LSK A;  4CXW A;  2P9B A;  3J7Y q;  3ZYL A;  3ETV A;  3PUQ A;  1U4Q A;  2X9H A;  4P0A A;  3UTK A;  5FY7 A;  3UFE A;  4X1K E;  5FXZ A;  3E08 A;  4UIG A;  5KMG P;  2V26 A;  3CX6 B;  3I0O A;  2VK9 A;  1SA0 E;  2Q9Q D;  4U72 A;  3TKL B;  5HXS A;  3RC8 A;  4MHC A;  5L3F B;  2NOX A;  3F31 A;  3GN5 A;  1U5P A;  2MTQ A;  4QX7 B;  3N9M A;  2CA5 A;  1D0Y A;  2W0G A;  1S35 A;  2GK9 A;  3N2K E;  3RPU A;  2QGS A;  4A56 A;  1FMW A;  4ISS A;  3I0Q A;  1D0Z A;  4IE5 A;  2HPL A;  3WAK A;  4O2B E;  5JVD E;  3C4Z A;  5LHG B;  1MMD A;  2CXD A;  2Y8D A;  3MAC A;  3JC6 C;  4H63 V;  4QHO A;  2X51 A;  3Q5W A;  3KV6 A;  1UX5 A;  2E9X C;  3KIN B;  4DVD A;  2K48 A;  2ZMA A;  3U3I A;  3ZJ1 A;  5DAB A;  3HI2 A;  4C91 A;  2PJQ A;  5E0O A;  1MIY A;  5C8Y E;  5JDH A;  2E9X B;  3R6N A;  4IE4 A;  4H9R C;  4ZOL E;  5J2U E;  3AA1 B;  2IC9 A;  2XAJ B;  4AKG A;  4HFV A;  5CA1 E;  2E8I A;  5LOV E;  2LOP A;  1D1A A;  1B7T A;  1QSD A;  2BVM A;  4UV8 B;  5LHI B;  3VU7 H;  2L3L A;  2BDE A;  4IHJ E;  2N1G A;  3SRZ A;  2CLY B;  1OWA A;  2ACX A;  5H6Q B;  2W61 A;  4IE0 A;  3SWH A;  3FXD B;  3Q2M A;  4NUV A;  5JRC B;  2EHO D;  4PFO A;  3NRX A;  3CPZ A;  3M65 A;  5KDM C;  3UUX B;  4EOZ B;  4AI6 A;  3FBZ A;  5EK2 A;  1LVF A;  2W00 A;  3KVA A;  4H9P C;  3PUA A;  4PK4 A;  3PUS A;  5JDL A;  2N9D A;  3RH3 A;  5HXR A;  5LA6 E;  1X79 A;  2D0U A;  3LK3 B;  4L9I A;  2LSJ A;  2NWB A;  4AKI A;  2E9X A;  3O4X E;  2KWH A;  4OK0 A;  3DP7 A;  3RYC E;  2VKJ A;  3WAJ A;  3OYX A;  3RRC A;  1T98 A;  4IST A;  5FMN A;  4AQF C;  4CXX A;  3FXE B;  4J2C A;  4I50 E;  5IHY A;  4EIW A;  1UX4 A;  2NTY A;  4UVB B;  3I9W A;  1UCU A;  2YU1 A;  3FBL A;  3ESL A;  5LGT B;  1D0X A;  2Y48 B;  4UVC B;  2KXP B;  3ANW B;  5L2L A;  3MK7 C;  4ZI3 D;  4CI2 B;  5EK4 A;  1MMN A;  2X9Y A;  5JR9 A;  2LOS A;  4CXY A;  4H9S E;  2CXL A;  4MLK A;  4IDZ A;  1E1H B;  3P7I A;  4QXB B;  4OYJ A;  3LBX B;  4JLE A;  4EXT A;  3PU8 A;  2C5I T;  4AKH A;  3AVS A;  1D1B A;  1LRZ A;  5FNV E;  1YD8 G;  3ZMS B;  4WBN E;  5EK3 A;  3FB2 A;  2C5J A;  3KV5 A;  2JQQ A;  3MJX A;  1BR2 A;  3CX7 B;  1VOM A;  2D2S A;  2ODU A;  4JEU B;  4PJN A;  3O1J A;  2CWY A;  3ZMZ B;  3AAE B;  4HTE A;  3U78 A;  4YFS A;  2ZM2 A;  4CQI A;  3UUN A;  4C90 A;  4DND A;  3HKB E;  3L3P A;  3JC6 D;  5LGU B;  3C98 B;  3ZCI A;  4H9N C;  2D5U A;  2ES0 A;  5CB4 E;  4V1A v;  1CUN A;  4EZ4 A;  1WYB A;  4XAX B;  3RC3 A;  5L3D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...