2LOPA

Backbone structure of human membrane protein tmem14a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 14A
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 29
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03647 Tmemb_14 Transmembrane proteins 14C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lopA00
2LOSA 2LOPA
chains in the Genus database with same CATH superfamily
2V7IA 5ADXL 1E1HB 1W09A 2LKHA 3FB2A 4ADZA 4COFA 5AQSB 3GN5B 2VK9A 2JQKA 2V5CA 5CFBA 2LKGA 2QYWA 3QOFA 1WR6A 3I0OA 3UTKA 3RGLA 2VQFT 4L5GA 2X0LB 1BR0A 3K3QC 3VR8A 2W0GA 4DBRA 3UU3A 2IMLA 4HFBA 3GA8A 2BBHA 3A5XA 2VQET 3SS1A 4H9PC 3BQKA 3MJXA 1T7SA 5EK4A 1T72A 2PJQA 2YKSA 3UFEA 1UUSA 3B57A 3RH3A 3A8YC 4H9NC 2X9XA 5ABFB 4PK4A 3C51A 4DV5T 3M3ZB 1VCSA 2HN1A 1KEYA 1HX1B 1CUNA 4WYVA 2N2NA 1GQEA 1BR1A 1V9DA 2KXPB 2VL8A 3L3PA 3O1HA 4DV0T 5IYZE 4PFOA 4QXBB 3ONXA 2A3DA 2VWAA 4MBQA 3AEGA 3AE7A 3ZT5A 2M67A 3V5SA 2MOZA 3RI5A 4UR9A 3GN5A 1XZYA 5LOVE 3AE6A 2Y8DA 4DUYT 4UVBB 1XMQT 2YINA 5JR9B 1M62A 5LMUT 5FKYA 4TNWA 2IUBA 5CB4E 3T1YT 3H3AA 1WCRA 3QNUA 3TLWA 2CA5A 4CI1B 3I9YA 3ANWA 3CPZA 3ZYLA 4O4JE 2XZEA 3RHWA 1QUUA 1EZ3A 2BVMA 3RF1A 2RPAA 4JBWF 3H37A 3ZN0B 5ABFA 2D0TA 1HNWT 2MPKA 3OVUA 4QX7B 3VKHA 1HG5A 3DJBA 4PK6A 4AKRB 4EOZB 1NEKA 1IJ5A 3HKCE 3RYHE 5AQFB 3AAIA 4AQYT 4AI6A 4PJMA 3EDVA 2XJ7A 2XQ9A 2WZIA 2VB6A 3E08A 3RYIE 4I4TE 2ZM0A 2K9AA 1LRZA 4DNDA 3RC3A 5LGNB 5LHIB 2YDQA 4ILAA 1HCIA 4U72A 4LF6T 3HR0A 3ESLA 2JIWA 2IC6A 2WDRA 4YLHA 2WSSV 5LXTE 2F4VT 2WY2A 3EAMA 5LBQB 4ASKA 3MKDA 4UV9B 2XAFB 1FMVA 4ZI7E 4IE7A 2C5JA 3N2OA 2D9DA 2HN2A 4JI4T 5F5WA 2XAGB 3UT5E 4I0UA 2KMFA 2L8KA 3LFMA 2IIUA 4DBQA 4YHJA 4F6RC 3O1JA 1ZEEA 4X20E 2UUCT 1OWAA 4ZI3C 1Z8UA 4IDZA 5FY1A 3NVOA 2L3LA 3TLTA 4OX9T 3PJAA 4N78D 5L3CB 1D1AA 4U31A 3AA6B 4LF4T 5TAOA 4HWFA 4WBNE 4UXNB 3PUGA 2KINB 1KF6A 4CI3B 3HL6A 1E7PA 3ONLC 3AVRA 2KSRA 1HX8A 5FY7A 3UUNA 5L4EA 2NTXA 3B5MA 2V6YB 2QRXA 5EK3A 4EIWA 2QA7A 5FL1A 3PDYA 3PU3A 1N34T 4LF5T 3ZJ2A 3P4PA 2LSIA 4U74A 1IZNB 3PUXF 5BR8T 5FXWA 4UIGA 2XQ7A 5LG3A 4U2YA 2W00A 2I6HA 3PUQA 1WYCA 4XZCA 5HXRA 5AQVB 4EAHA 3VR9A 2HPLA 2V7KA 4Q25A 4QH5A 3N9PA 2JMKA 2Z6EA 2CLYC 3LK2B 2NWBA 3UUMA 1HNZT 4EV6A 5JDHA 4CXYA 4G63A 3PU8A 3U78A 2BDEA 4EYUA 1WLXA 3W15B 5KXJA 2BG9E 2CBJA 4F8HA 1D1BA 3HI2A 1MMGA 4Z91A 2UXXB 2LRKA 3CQGB 1HS7A 3AA7B 4LF7T 5AQKB 4PK5A 3CVRA 4DV2T 3R6NA 3K1SA 2YN6A 3EI0A 2Y6XA 3LK42 5M4YA 3ZJ1A 3IBPA 3NRXA 5HCMA 3RQWA 3ETVA 4DMWA 5LGUB 4PFPA 3PUZF 2V6YA 3RIUA 5JTGA 4TUYE 4JI3T 4C91A 4TWDA 4O4LE 5FVKA 3MXZA 4U7IA 5LG4A 4GKKT 5AQIB 4P09A 3Q2MA 2VVSA 5IHYA 3Q5EA 5L47A 2V8SV 1AJ3A 4O2AE 2E9XC 5FY0A 3L39A 2J47A 4MHCA 4AISA 2V6XA 2CEAA 2WDVA 4CN6A 3I9WA 4IE6A 1IAPA 2LHRA 3TKLB 2A2FX 2UXNB 1MNEA 2CBIA 2MBGA 3CX8B 2W4XA 2X67A 1WR0A 5JVDE 5HXEA 2VKDA 2V1DB 4I43B 3CKDA 3J9X1 3H3MA 2B1EA 2XAQB 1E2AA 2A9UA 3RPUA 3X1DA 2LEHA 5LCYA 2LE8A 3KV6A 2J4GA 2FJAA 3FZLB 4H9QC 2YEVC 5C8YE 3PUYF 3M65A 4I50E 2ZMAA 1VCTA 1S35A 5ABHA 4G2AA 4ZOLE 3EVYA 2CCQA 3UUXB 1I6ZA 3ZMSB 1N32T 3TLUA 1YW0A 4AQFC 2PG8A 4DV1T 5CA1E 4QXCB 4PJLA 2VASA 5EK2A 3PUWF 3NRYA 4JI8T 1BR2A 2V26A 2XQAA 3FZMB 3RRCA 1WFDA 1Y01A 4AQGA 2WWUA 4O2BE 4KUMB 3ZMUB 2DNXA 5HYAA 3HA4A 5HWXA 2NW9A 4WNKA 2E9XB 4OFZA 5JDQA 2LRLA 4BJNA 4P0AA 1UK5A 2BVLA 5CJ5A 2K3WA 2FUPA 2NW7A 5IWAT 3PUSA 1LVKA 3N9OA 3TLVA 2H88A 3BQIA 4H9SE 4X64T 1HNXT 3ZMVB 4CQIA 3A7MA 3AVSA 4B3MT 5LNKA 3GWHA 4DV4T 4YJ3E 2ZM2A 4TWFA 5HCJA 4YSYA 1I94T 1G8XA 2D5UA 2W61A 2Q9QC 3CK6A 2XUEA 3O4XE 5JQGE 5LA6E 1ZKEA 3FBLA 4LFBT 1SE7A 4DVDA 2C0SA 3C98B 4JLEA 2NOXA 1ZHCA 3JC6D 1KK7A 2J1DG 4HN9A 2BBJA 3L8RA 1FMWA 4IE4A 3VU7H 4PNIA 3CWZB 1Z0PA 1N36T 2X66A 3AA1B 4IDNA 3KV9A 3P4RA 5IUXA 4QKNA 5HEGA 5AFUL 2DWGA 3ONJA 2H3RA 3IHRA 5GONE 2LHNA 2BS3A 3LJCA 3ZKRA 4DV7T 2HH7A 2E9XA 3ZT6A 4IHJE 5A1LA 5DABA 4QH1A 2H7OA 4EEDA 1OEDE 3AECA 4TNVA 4HFVA 2WZHA 1VOMA 4DR1T 2ODUA 4J2CA 2BKOA 2ES0A 1YD8G 4HFIA 2JQHA 1L0VA 3QB5K 4EGWA 4BAYB 5H6QB 4KI0F 3ZC1A 1FJGT 5AQMB 2YDRA 2ACXA 1X9BA 5FXXA 4HWCA 3P50A 4DIDB 5JREA 4GYSA 4UVAB 2IHR1 3AA0B 2K5BB 3JADA 3LSVA 4YTMA 1JNZA 4UF0B 4IGUA 4ZS3A 1XNRT 4DR5T 4ZEYA 4TV9E 2X68A 3Q5WA 2LSKA 4JI0T 1YKHB 2Q9QB 1Y64B 3F57A 1IBMT 2X0HA 1O3XA 4TX5A 2XSAA 2FJEA 4FI5A 3R84B 3RX6A 3AXJB 3L09A 3AEBA 3SFDA 4CN4A 2X9HA 1U4QA 4IT4A 5JR9A 4JEHB 4ZZCA 5LP6E 2LOPA 1MIYA 1IJ6A 4YTPA 2K24A 2W2UA 2B76A 4H63V 5HEOA 4JI5T 2WWVA 2KWHA 3RQUA 2WU5A 1UCUA 1QLBA 1XDPA 3PUAA 3PTRB 4KX6A 4KHPT 2J62A 3JAEA 4TN7B 4WZXA 3B13A 2XQ5A 3QK6A 2WQYA 1HTJF 5J2UE 4NUUA 1KNPA 1KFYA 2N9DA 4TV8E 4A56A 2JRKA 3FHNA 4XAXB 2BKNA 4ILBA 2HPJA 4HEAA 2XM2A 2FJBA 5LBMA 3P4WA 4A5XA 4UF0A 4H63H 1ZV4X 3JAFA 3ZT7A 5FMNA 3IF8B 4IDPA 2WCAA 3AE3A 5KX5E 1MMDA 3KFWX 2BS2A 3S4UA 1XMOT 3VRBA 2Q9QA 3N2GE 2CRBA 3LG7A 3NKZA 4GOUA 4CZZB 2W63A 4NPPA 3O9XA 3AXJA 4JYAT 3WAJA 4EXTA 2WU2A 3ZYKA 2EHOC 4B3RT 5AQQB 3ZSSA 4JEUB 2XQYA 2IDOB 1UX5A 2VVNA 2XAJB 3AE4A 4H9RC 4QH4A 1D0XA 4HFHA 4YSZA 5HEHA 1T98A 2YOEA 2OA5A 3C4WA 4MFRA 1U5PA 4LF9T 2V7LA 2C5IT 5LHGB 5LJNA 3RIAA 5AQOB 3ZEFB 2VKOA 4AXPA 3P4SA 2M6IA 2OLTA 1HF8A 5AQTB 2ZM8A 4HWDA 4FJOA 1N33T 3ZCJA 3DP7A 4AKLA 3E0ZA 4NUVA 4LMKA 4ANJA 3AEEA 4HFEA 2CMRA 5FXZA 2V5DA 4JI1T 2XPKA 5H6RB 4MLKA 2W67A 3CX7B 3SOLA 1UGOA 2DCFA 5AQRB 4HWHA 4OHFA 4DR6T 2LSGA 4AIUA 3EABA 4DO0A 2FJDA 2XQ6A 3LK3B 4OK0A 1QSDA 4AKGA 2HHHT 5EZYE 3NZPA 4JV5T 5KDMC 4HGAA 4ZI2C 2SPCA 2KWIB 4TZ4C 3RYFE 3AEFA 3C64A 4GYRA 2VKJA 2XTLA 4X5TA 2YK0A 5HEUA 2I59A 3WI3A 2EHOB 2X9YA 3E22E 4WW0A 2LLYA 3LBXB 5JDFA 2CWOA 4B3ST 2JMHA 3UU5A 1KNRA 4ZI3D 2VKHA 5AQLB 1CHUA 3N9MA 4JUYA 4K0KT 2CLYB 3N9LA 1US7B 3PV0F 3UFGA 1YXRA 5L3GB 4B6XA 2Y48B 3FZKB 3K8PC 3AE5A 1H7CA 2AXDS 3G06A 4A97A 1JNRA 4XBFB 5DQWA 3N5LA 2LSYA 1ZP0A 4YTNA 3IEEA 1MNDA 2BZBA 5LHHB 2MTQA 2XASB 2BG9C 3SRZA 2VL0A 5ABEA 1UURA 1X79A 3VHLA 3EHZA 5F3JA 2ODVA 4A98A 2NR4A 2CM0A 5CA0E 4I55E 3V5UA 4JI6T 1ZOYA 4YFSA 4IL4A 3J7Yq 3BQLA 1W0BA 4PW8A 4E7ZA 5J0ZA 2NP9A 3KDSE 2QVAA 3JCFA 2VURA 1D1CA 4PJJA 3C4XA 2XQ8A 3C4ZA 4HE8A 4V1Av 4IREA 3FZFB 2ACZA 3MA9A 3RC8A 3OYXA 4HWIB 3OPCA 3AAEB 2EHOA 4JI2T 3LBXA 1OXZA 2MAWA 2DI4A 2KNDA 4DV3T 3PE0A 2K48A 1BR4A 5DJQC 4GIWA 3OYZA 2KZ7B 5FYMA 5BMVE 1HR0T 1XDOA 4IIJE 4GKJT 4ZHQE 5AQGB 1MIVA 4EZHA 4ISSA 3OKQA 2JJ9A 4OYJA 4DV6T 2YU1A 3ANWB 3GMIA 2LJLA 5LMNT 4JI7T 4X1YE 3VRAA 1SHZC 3UQ7A 4EB6E 1J5ET 3P7IA 3NWIA 4QX8B 2E5LT 2BS4A 3OTOT 4LF8T 2E2AA 3KBUA 4DR2T 3EDUA 1J5WA 2XY8B 2G0UA 2W66A 2LM2A 3QC9A 4X1IE 2GK9A 4Z8XA 1WRDA 1T8BA 4X62T 3MZKB 4ZI2D 2JPFA 2BG9B 1LKXA 5ABGA 2E9XD 1FIOA 2PTFA 3Q5XA 2WM9A 3PUVF 5J1GA 4YSXA 5FP3A 5HAXA 3MK7C 1MMAA 3KV4A 3N2KE 3CQXC 3N9NA 4UV8B 1S94A 4UVCB 2CHNA 2BKPA 2CE7A 5JDGA 4X66T 3HKBE 4ERRA 2X0YA 3AAAB 2V7MA 2DWKA 4AKIA 4K0UA 1YQ4A 3VKGA 3CIRA 4UELA 1NWMX 4PAGA 4KBMB 2CHOA 3PURA 4ZXLA 3RIFA 1SA0E 1MMNA 1R8IA 4YT0A 2CWYA 3F31A 3UULA 2WDQA 2PBIA 2YDSA 1UX4A 3QB5A 2OV9A 3RIUC 3K3NA 4AKHA 3KV5A 1NAFA 5FVLA 5E0OA 4LMJA 4YHHT 5JRCB 3AE2A 5AQNB 4O8SA 4O4HE 5HXHA 5C3JA 4U3CA 2BG9A 3AEAA 1M7KA 5L2LA 4ZZBA 2R6GF 2H7VC 4U2ZA 2WBLA 3C50A 3CQCB 3RKGA 4NXNT 4CN1A 4AQFA 2XQ3A 3UUBA 2NW8A 3NZQA 4ISTA 1IBKT 2RA1A 2WMNA 3SWHA 2IC9A 3UQ4A 5C2TA 5JDMA 3RKOA 2XHEB 3O1IA 1WYBA 4X1KE 5JH7E 3ZMTB 3KVBA 3N9QA 4U7YA 3KVAA 3ZMZB 3FBZA 3RRWA 5HXSA 5LJMA 3ABVA 4L9IA 4L0RA 3ZSTA 4B3TT 2D2SA 4LFAT 1MIWA 5L3DB 3Q9DA 2V7JA 2CXLA 5L3FB 2D0UA 3RYCE 3ZYMA 4X65T 2Q9QD 5HWYA 2CPTA 3WAKA 1IBLT 4CXWA 2H89A 5JDLA 3AB3B 2P9BA 1G73A 1OEDC 1J1JA 2XQ4A 4P1NA 1XNQT 5JRCA 5AQJB 3CMLA 1HG2A 2IW5B 3AEDA 3IA3A 2WMOA 2LT3A 1SUMB 4LFCT 4DMVA 4UEMA 4BJMA 5HXCA 2WAUA 5AQPB 1W9RA 2M6BA 4ILUA 5L3BB 2AE9A 2UUAT 2NTYA 3FZHB 3AE8A 4LMLA 4EYYR 4KHZF 3AE1A 5HEJA 4E7SA 3UU4A 3ZCIA 1D0YA 2WS3A 1W0AA 2XM1A 2XAHB 4IE5A 3T1HT 2UXDT 2A72A 3HKEE 5L4HA 2ZM6T 2PFVA 2UUBT 3NBXX 2E8IA 4M1PA 5DQVA 2X51A 2X9WA 5ETWA 5AQUB 4MALA 5LYJE 1HFAA 2ZLYA 4CI2B 3U3IA 4C90A 5AQHB 2YU2A 5L3EB 4EEBA 2N1GA 3TLSA 5FNVE 4HKAA 4ILCA 4HTEA 5FL0A 3ETUA 1YKEB 3OJAA 2W62A 4HFDA 3ZLIA 5LGTB 3KBTA 3QUJA 2RP4A 1YQ3A 3K3OA 2DHRA 3RLFF 3FXDB 3I1AA 2JQQA 4CXXA 4NXMT 5F8PA 2UXCT 3P4QA 2DLRA 5KMGP 4YY3T 1FEWA 2UXBT 4KP3C 1OEDB 4P0BA 1D0ZA 4ZS2A 4IL9A 3JC6C 4DUZT 2LM9A 4HFCA 5J2TE 1B7TA 4IE0A 2C5KT 3Q5DA 4EZ4A 4O4IE 2IAKA 2LSJA 4PJNA 4TWHA 4YXDA 2JQ9A 4Z90A 3I0QA 2E5VA 1NENA 3PJAJ 3EUHA 3F2EA 4QWNB 2I0MA 2FBWA 3FXEB 4KMCA 4OYKA 3ZN1B 3UU8A 3ZC0A 1DU2A 1XWMA 5CGMA 4IDQA 1LVFA 2WB5A 4YJ2E 2CXFA 3CX6B 2DL1A 3UU6A 4DR7T 2WP9A 5FXVA 2CXDA 3AE9A 3D0TA 2LOSA 4GK5E 3MACA 3HKDE 3SFEA 4NIQA 3KINB 4U33A 5JDNA 1KNZA 4H9OC 3OBVE 3T8OA 2KT9A 2L9QA 4IDOA 2KLQA 4BA9A 1VRBA 4DR3T 2QGSA 4GK0E 3P8CD 3BK9A 4DR4T 4QXHB 4WBOA 4QHOA 1OEDA 2XSBA 2EHOD 2UU9T 3DTOA 2MYSA 5LB7B 5JR9C 3ZPOA 3LDQB
chains in the Genus database with same CATH topology
2V7IA 5ADXL 2N9DA 1E1HB 4TV8E 4A56A 2JRKA 3FHNA 3ETVA 4XAXB 4DMWA 3FB2A 4PFPA 5LGUB 2CE7A 4ADZA 5JDGA 3HKBE 2HPJA 4HEAA 4ERRA 4TUYE 5LBMA 4C91A 3GN5B 2VK9A 4UF0A 3AAAB 4O4LE 4H63H 2V7MA 1ZV4X 2DWKA 4AKIA 4K0UA 3VKGA 4UELA 3MXZA 1WR6A 1NWMX 3I0OA 5FMNA 3UTKA 3IF8B 4PAGA 5LG4A 4KBMB 4L5GA 4P09A 2X0LB 1MMDA 5KX5E 3KFWX 1BR0A 3K3QC 2W0GA 3PURA 3Q2MA 5IHYA 3S4UA 4DBRA 2Q9QA 1SA0E 3N2GE 1AJ3A 3LG7A 1MMNA 4O2AE 2CWYA 3F31A 4GOUA 2E9XC 5FY0A 4CZZB 2W63A 3GA8A 3UULA 3A5XA 3ZPOA 4MHCA 3O9XA 3SS1A 4H9PC 2PBIA 3WAJA 2CEAA 4EXTA 3BQKA 3I9WA 4IE6A 1IAPA 1UX4A 2LHRA 3ZYKA 3K3NA 3MJXA 4AKHA 2EHOC 3KV5A 3TKLB 2A2FX 4JEUB 2XQYA 1NAFA 2UXNB 5E0OA 1MNEA 5EK4A 2PJQA 3UFEA 5JRCB 3B57A 2MBGA 1UX5A 3CX8B 4O8SA 2XAJB 4O4HE 3RH3A 5HXHA 4H9NC 2X9XA 5L2LA 2X67A 2H7VC 4H9RC 2WBLA 4PK4A 5JVDE 5HXEA 1D0XA 2VKDA 2V1DB 3C51A 3C50A 1T98A 4I43B 3CKDA 3CQCB 3J9X1 2OA5A 4AQFA 3C4WA 4MFRA 1U5PA 2B1EA 2XAQB 2V7LA 2NW8A 2C5IT 5LHGB 1CUNA 3RPUA 2N2NA 3NZQA 4ISTA 5LJNA 2LEHA 1BR1A 5LCYA 2LE8A 2RA1A 2WMNA 3KV6A 3ZEFB 3SWHA 2VKOA 1V9DA 2IC9A 4AXPA 5JDMA 3RKOA 2KXPB 2VL8A 2XHEB 3O1IA 1WYBA 3L3PA 3O1HA 5IYZE 1HF8A 4PFOA 4X1KE 2ZM8A 5JH7E 4QXBB 3ONXA 2A3DA 4H9QC 3ZMTB 2VWAA 3KVBA 3N9QA 2YEVC 3KVAA 4MBQA 3ZMZB 5C8YE 4FJOA 3M65A 4I50E 3ZCJA 3DP7A 3FBZA 2ZMAA 2M67A 1S35A 3E0ZA 4NUVA 3V5SA 4AKLA 2MOZA 3RRWA 5HXSA 4ANJA 5LJMA 3GN5A 4G2AA 4ZOLE 4L9IA 3EVYA 2CCQA 4L0RA 3UUXB 2CMRA 5FXZA 2D2SA 3ZMSB 5H6RB 5LOVE 2Y8DA 1YW0A 4MLKA 4UVBB 2YINA 5JR9B 3CX7B 3SOLA 2DCFA 4AQFC 2PG8A 4OHFA 1MIWA 5L3DB 3Q9DA 2V7JA 2CXLA 5CB4E 5L3FB 2D0UA 3H3AA 3RYCE 5CA1E 3ZYMA 4QXCB 2LSGA 4PJLA 2VASA 5EK2A 4DO0A 3NRYA 2Q9QD 2CA5A 3LK3B 5HWYA 3WAKA 1BR2A 2V26A 4OK0A 1QSDA 3I9YA 4CI1B 4AKGA 3ANWA 4CXWA 3CPZA 3ZYLA 3RRCA 5JDLA 4O4JE 5EZYE 3AB3B 1QUUA 3NZPA 5KDMC 4AQGA 4HGAA 2P9BA 2WWUA 4O2BE 4ZI2C 4KUMB 1G73A 3ZMUB 2SPCA 1EZ3A 2DNXA 2KWIB 2BVMA 5HYAA 3HA4A 4TZ4C 5HWXA 5JRCA 2NW9A 4WNKA 3RYFE 3CMLA 1HG2A 2E9XB 3C64A 4OFZA 5JDQA 3H37A 2IW5B 4GYRA 3ZN0B 4BJNA 4P0AA 2BVLA 2VKJA 2LT3A 2NW7A 2WMOA 2D0TA 2XTLA 3PUSA 4DMVA 2YK0A 4UEMA 1LVKA 5HXCA 4BJMA 2WAUA 3N9OA 2I59A 4QX7B 3VKHA 1HG5A 3DJBA 4PK6A 2EHOB 2X9YA 3E22E 3WI3A 4AKRB 4WW0A 3BQIA 4ILUA 4EOZB 4H9SE 1IJ5A 3HKCE 5L3BB 3LBXB 3RYHE 5JDFA 2CWOA 3ZMVB 3AAIA 4CQIA 3AVSA 2JMHA 4AI6A 4PJMA 5LNKA 2NTYA 3EDVA 3GWHA 4YJ3E 4ZI3D 2VKHA 2ZM2A 4EYYR 2VB6A 1G8XA 3E08A 3N9MA 3RYIE 4I4TE 2D5UA 2ZM0A 4JUYA 2K9AA 2CLYB 3N9LA 1LRZA 4DNDA 1US7B 4E7SA 2W61A 3RC3A 5LGNB 3ZCIA 1D0YA 5LHIB 2Q9QC 1HCIA 2XUEA 4U72A 2XAHB 3O4XE 4IE5A 5JQGE 3HR0A 5L3GB 4B6XA 3ESLA 5LA6E 4YLHA 2IC6A 2Y48B 1ZKEA 3FBLA 2A72A 2WSSV 3K8PC 5LXTE 3HKEE 4DVDA 1H7CA 2C0SA 3C98B 4JLEA 2NOXA 1ZHCA 5LBQB 4ASKA 2PFVA 3MKDA 4UV9B 2XAFB 3JC6D 3NBXX 1KK7A 1FMVA 4ZI7E 2E8IA 2J1DG 4XBFB 4HN9A 4IE7A 4M1PA 5DQVA 5DQWA 2X51A 3N5LA 2X9WA 5ETWA 4MALA 2C5JA 2LSYA 5LYJE 1FMWA 3IEEA 3N2OA 1MNDA 1HFAA 2BZBA 2ZLYA 4IE4A 4CI2B 3U3IA 3VU7H 5LHHB 4C90A 2MTQA 4PNIA 2YU2A 2XASB 3CWZB 5L3EB 3SRZA 1Z0PA 2X66A 2N1GA 5FNVE 2XAGB 4HKAA 3UT5E 3AA1B 3KV9A 1X79A 3VHLA 4HTEA 2KMFA 5F3JA 2ODVA 3ETUA 2CM0A 5CA0E 1YKEB 4I55E 3V5UA 3OJAA 4QKNA 2L8KA 3LFMA 2W62A 4DBQA 3ZLIA 4YFSA 4YHJA 4F6RC 3O1JA 1ZEEA 3BQLA 3J7Yq 4X20E 5AFUL 1OWAA 4ZI3C 4IDZA 5FY1A 2DWGA 2L3LA 5LGTB 3KBTA 4PW8A 2H3RA 3IHRA 3QUJA 4E7ZA 2NP9A 2RP4A 2LHNA 5GONE 3KDSE 3LJCA 3K3OA 2HH7A 2E9XA 1D1CA 2DHRA 4PJJA 3C4XA 3C4ZA 4HE8A 3FXDB 3I1AA 2JQQA 4IHJE 4CXXA 4V1Av 4N78D 5F8PA 3MA9A 5A1LA 3RC8A 5DABA 3OYXA 5L3CB 4UVCB 1D1AA 3AA6B 2DLRA 2H7OA 5KMGP 3AAEB 5TAOA 2EHOA 4WBNE 1FEWA 4HFVA 1VOMA 4UXNB 3PUGA 4KP3C 2ODUA 3LBXA 1OXZA 4P0BA 2KINB 4J2CA 1D0ZA 2ES0A 4ZS2A 1YD8G 4CI3B 3HL6A 3JC6C 2DI4A 2LM9A 2KNDA 3AVRA 3PE0A 5H6QB 4BAYB 1HX8A 3ZC1A 1B7TA 4IE0A 5J2TE 2K48A 2C5KT 5FY7A 1BR4A 3UUNA 5DJQC 2ACXA 5FXXA 4EZ4A 4O4IE 4GIWA 2IAKA 3OYZA 2KZ7B 5FYMA 2LSJA 4PJNA 5BMVE 2NTXA 5JREA 4GYSA 5EK3A 4EIWA 4UVAB 2QA7A 3I0QA 3PDYA 4IIJE 3PU3A 3EUHA 3F2EA 4QWNB 3AA0B 2K5BB 4ZHQE 3ZJ2A 1MIVA 2LSIA 4UF0B 4EZHA 4IGUA 4ISSA 4ZS3A 4U74A 1IZNB 3OKQA 2JJ9A 3FXEB 4KMCA 4OYKA 3ZN1B 5FXWA 4UIGA 4OYJA 2YU1A 3ANWB 3GMIA 2LJLA 4TV9E 3ZC0A 2X68A 2W00A 4X1YE 3PUQA 3Q5WA 2LSKA 1SHZC 1WYCA 4XZCA 1YKHB 1LVFA 3P7IA 5HXRA 4EB6E 4YJ2E 2CXFA 4QX8B 2Q9QB 1Y64B 3F57A 3CX6B 4EAHA 1O3XA 4TX5A 4FI5A 2HPLA 2V7KA 3R84B 3RX6A 3KBUA 5FXVA 2CXDA 3D0TA 3L09A 3N9PA 2JMKA 3EDUA 2Z6EA 2CLYC 2LOSA 4GK5E 2X9HA 3MACA 1U4QA 3LK2B 2NWBA 4JEHB 5JR9A 3UUMA 5LP6E 5JDHA 2G0UA 2LOPA 1MIYA 1IJ6A 4G63A 4CXYA 3PU8A 3U78A 2BDEA 3HKDE 4EYUA 1WLXA 3W15B 3QC9A 4X1IE 2K24A 3KINB 2GK9A 4Z8XA 1WRDA 5JDNA 3MZKB 4ZI2D 1KNZA 1D1BA 3HI2A 2JPFA 4H9OC 3OBVE 4H63V 1MMGA 3T8OA 2UXXB 2KWHA 2KT9A 1UCUA 1LKXA 2L9QA 2KLQA 2E9XD 3PUAA 1FIOA 3PTRB 1VRBA 4BA9A 2QGSA 3CQGB 4GK0E 1HS7A 3AA7B 3P8CD 3BK9A 3Q5XA 4PK5A 4TN7B 3CVRA 2WM9A 5J1GA 4QXHB 3B13A 4WBOA 5FP3A 4QHOA 5HAXA 3QK6A 3R6NA 3MK7C 2EHOD 1HTJF 1MMAA 5J2UE 3KV4A 3N2KE 3CQXC 3DTOA 3N9NA 4UV8B 2Y6XA 3LK42 5M4YA 2MYSA 3ZJ1A 3IBPA 5JR9C 1S94A 3NRXA 4NUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOS A;  2LOP A; 
#chains in the Genus database with same CATH topology
 2V7I A;  5ADX L;  1E1H B;  1W09 A;  2LKH A;  3FB2 A;  4ADZ A;  4COF A;  5AQS B;  3GN5 B;  2VK9 A;  2JQK A;  2V5C A;  5CFB A;  2LKG A;  2QYW A;  3QOF A;  1WR6 A;  3I0O A;  3UTK A;  3RGL A;  2VQF T;  4L5G A;  2X0L B;  1BR0 A;  3K3Q C;  3VR8 A;  2W0G A;  4DBR A;  3UU3 A;  2IML A;  4HFB A;  3GA8 A;  2BBH A;  3A5X A;  2VQE T;  3SS1 A;  4H9P C;  3BQK A;  3MJX A;  1T7S A;  5EK4 A;  1T72 A;  2PJQ A;  2YKS A;  3UFE A;  1UUS A;  3B57 A;  3RH3 A;  3A8Y C;  4H9N C;  2X9X A;  5ABF B;  4PK4 A;  3C51 A;  4DV5 T;  3M3Z B;  1VCS A;  2HN1 A;  1KEY A;  1HX1 B;  1CUN A;  4WYV A;  2N2N A;  1GQE A;  1BR1 A;  1V9D A;  2KXP B;  2VL8 A;  3L3P A;  3O1H A;  4DV0 T;  5IYZ E;  4PFO A;  4QXB B;  3ONX A;  2A3D A;  2VWA A;  4MBQ A;  3AEG A;  3AE7 A;  3ZT5 A;  2M67 A;  3V5S A;  2MOZ A;  3RI5 A;  4UR9 A;  3GN5 A;  1XZY A;  5LOV E;  3AE6 A;  2Y8D A;  4DUY T;  4UVB B;  1XMQ T;  2YIN A;  5JR9 B;  1M62 A;  5LMU T;  5FKY A;  4TNW A;  2IUB A;  5CB4 E;  3T1Y T;  3H3A A;  1WCR A;  3QNU A;  3TLW A;  2CA5 A;  4CI1 B;  3I9Y A;  3ANW A;  3CPZ A;  3ZYL A;  4O4J E;  2XZE A;  3RHW A;  1QUU A;  1EZ3 A;  2BVM A;  3RF1 A;  2RPA A;  4JBW F;  3H37 A;  3ZN0 B;  5ABF A;  2D0T A;  1HNW T;  2MPK A;  3OVU A;  4QX7 B;  3VKH A;  1HG5 A;  3DJB A;  4PK6 A;  4AKR B;  4EOZ B;  1NEK A;  1IJ5 A;  3HKC E;  3RYH E;  5AQF B;  3AAI A;  4AQY T;  4AI6 A;  4PJM A;  3EDV A;  2XJ7 A;  2XQ9 A;  2WZI A;  2VB6 A;  3E08 A;  3RYI E;  4I4T E;  2ZM0 A;  2K9A A;  1LRZ A;  4DND A;  3RC3 A;  5LGN B;  5LHI B;  2YDQ A;  4ILA A;  1HCI A;  4U72 A;  4LF6 T;  3HR0 A;  3ESL A;  2JIW A;  2IC6 A;  2WDR A;  4YLH A;  2WSS V;  5LXT E;  2F4V T;  2WY2 A;  3EAM A;  5LBQ B;  4ASK A;  3MKD A;  4UV9 B;  2XAF B;  1FMV A;  4ZI7 E;  4IE7 A;  2C5J A;  3N2O A;  2D9D A;  2HN2 A;  4JI4 T;  5F5W A;  2XAG B;  3UT5 E;  4I0U A;  2KMF A;  2L8K A;  3LFM A;  2IIU A;  4DBQ A;  4YHJ A;  4F6R C;  3O1J A;  1ZEE A;  4X20 E;  2UUC T;  1OWA A;  4ZI3 C;  1Z8U A;  4IDZ A;  5FY1 A;  3NVO A;  2L3L A;  3TLT A;  4OX9 T;  3PJA A;  4N78 D;  5L3C B;  1D1A A;  4U31 A;  3AA6 B;  4LF4 T;  5TAO A;  4HWF A;  4WBN E;  4UXN B;  3PUG A;  2KIN B;  1KF6 A;  4CI3 B;  3HL6 A;  1E7P A;  3ONL C;  3AVR A;  2KSR A;  1HX8 A;  5FY7 A;  3UUN A;  5L4E A;  2NTX A;  3B5M A;  2V6Y B;  2QRX A;  5EK3 A;  4EIW A;  2QA7 A;  5FL1 A;  3PDY A;  3PU3 A;  1N34 T;  4LF5 T;  3ZJ2 A;  3P4P A;  2LSI A;  4U74 A;  1IZN B;  3PUX F;  5BR8 T;  5FXW A;  4UIG A;  2XQ7 A;  5LG3 A;  4U2Y A;  2W00 A;  2I6H A;  3PUQ A;  1WYC A;  4XZC A;  5HXR A;  5AQV B;  4EAH A;  3VR9 A;  2HPL A;  2V7K A;  4Q25 A;  4QH5 A;  3N9P A;  2JMK A;  2Z6E A;  2CLY C;  3LK2 B;  2NWB A;  3UUM A;  1HNZ T;  4EV6 A;  5JDH A;  4CXY A;  4G63 A;  3PU8 A;  3U78 A;  2BDE A;  4EYU A;  1WLX A;  3W15 B;  5KXJ A;  2BG9 E;  2CBJ A;  4F8H A;  1D1B A;  3HI2 A;  1MMG A;  4Z91 A;  2UXX B;  2LRK A;  3CQG B;  1HS7 A;  3AA7 B;  4LF7 T;  5AQK B;  4PK5 A;  3CVR A;  4DV2 T;  3R6N A;  3K1S A;  2YN6 A;  3EI0 A;  2Y6X A;  3LK4 2;  5M4Y A;  3ZJ1 A;  3IBP A;  3NRX A;  5HCM A;  3RQW A;  3ETV A;  4DMW A;  5LGU B;  4PFP A;  3PUZ F;  2V6Y A;  3RIU A;  5JTG A;  4TUY E;  4JI3 T;  4C91 A;  4TWD A;  4O4L E;  5FVK A;  3MXZ A;  4U7I A;  5LG4 A;  4GKK T;  5AQI B;  4P09 A;  3Q2M A;  2VVS A;  5IHY A;  3Q5E A;  5L47 A;  2V8S V;  1AJ3 A;  4O2A E;  2E9X C;  5FY0 A;  3L39 A;  2J47 A;  4MHC A;  4AIS A;  2V6X A;  2CEA A;  2WDV A;  4CN6 A;  3I9W A;  4IE6 A;  1IAP A;  2LHR A;  3TKL B;  2A2F X;  2UXN B;  1MNE A;  2CBI A;  2MBG A;  3CX8 B;  2W4X A;  2X67 A;  1WR0 A;  5JVD E;  5HXE A;  2VKD A;  2V1D B;  4I43 B;  3CKD A;  3J9X 1;  3H3M A;  2B1E A;  2XAQ B;  1E2A A;  2A9U A;  3RPU A;  3X1D A;  2LEH A;  5LCY A;  2LE8 A;  3KV6 A;  2J4G A;  2FJA A;  3FZL B;  4H9Q C;  2YEV C;  5C8Y E;  3PUY F;  3M65 A;  4I50 E;  2ZMA A;  1VCT A;  1S35 A;  5ABH A;  4G2A A;  4ZOL E;  3EVY A;  2CCQ A;  3UUX B;  1I6Z A;  3ZMS B;  1N32 T;  3TLU A;  1YW0 A;  4AQF C;  2PG8 A;  4DV1 T;  5CA1 E;  4QXC B;  4PJL A;  2VAS A;  5EK2 A;  3PUW F;  3NRY A;  4JI8 T;  1BR2 A;  2V26 A;  2XQA A;  3FZM B;  3RRC A;  1WFD A;  1Y01 A;  4AQG A;  2WWU A;  4O2B E;  4KUM B;  3ZMU B;  2DNX A;  5HYA A;  3HA4 A;  5HWX A;  2NW9 A;  4WNK A;  2E9X B;  4OFZ A;  5JDQ A;  2LRL A;  4BJN A;  4P0A A;  1UK5 A;  2BVL A;  5CJ5 A;  2K3W A;  2FUP A;  2NW7 A;  5IWA T;  3PUS A;  1LVK A;  3N9O A;  3TLV A;  2H88 A;  3BQI A;  4H9S E;  4X64 T;  1HNX T;  3ZMV B;  4CQI A;  3A7M A;  3AVS A;  4B3M T;  5LNK A;  3GWH A;  4DV4 T;  4YJ3 E;  2ZM2 A;  4TWF A;  5HCJ A;  4YSY A;  1I94 T;  1G8X A;  2D5U A;  2W61 A;  2Q9Q C;  3CK6 A;  2XUE A;  3O4X E;  5JQG E;  5LA6 E;  1ZKE A;  3FBL A;  4LFB T;  1SE7 A;  4DVD A;  2C0S A;  3C98 B;  4JLE A;  2NOX A;  1ZHC A;  3JC6 D;  1KK7 A;  2J1D G;  4HN9 A;  2BBJ A;  3L8R A;  1FMW A;  4IE4 A;  3VU7 H;  4PNI A;  3CWZ B;  1Z0P A;  1N36 T;  2X66 A;  3AA1 B;  4IDN A;  3KV9 A;  3P4R A;  5IUX A;  4QKN A;  5HEG A;  5AFU L;  2DWG A;  3ONJ A;  2H3R A;  3IHR A;  5GON E;  2LHN A;  2BS3 A;  3LJC A;  3ZKR A;  4DV7 T;  2HH7 A;  2E9X A;  3ZT6 A;  4IHJ E;  5A1L A;  5DAB A;  4QH1 A;  2H7O A;  4EED A;  1OED E;  3AEC A;  4TNV A;  4HFV A;  2WZH A;  1VOM A;  4DR1 T;  2ODU A;  4J2C A;  2BKO A;  2ES0 A;  1YD8 G;  4HFI A;  2JQH A;  1L0V A;  3QB5 K;  4EGW A;  4BAY B;  5H6Q B;  4KI0 F;  3ZC1 A;  1FJG T;  5AQM B;  2YDR A;  2ACX A;  1X9B A;  5FXX A;  4HWC A;  3P50 A;  4DID B;  5JRE A;  4GYS A;  4UVA B;  2IHR 1;  3AA0 B;  2K5B B;  3JAD A;  3LSV A;  4YTM A;  1JNZ A;  4UF0 B;  4IGU A;  4ZS3 A;  1XNR T;  4DR5 T;  4ZEY A;  4TV9 E;  2X68 A;  3Q5W A;  2LSK A;  4JI0 T;  1YKH B;  2Q9Q B;  1Y64 B;  3F57 A;  1IBM T;  2X0H A;  1O3X A;  4TX5 A;  2XSA A;  2FJE A;  4FI5 A;  3R84 B;  3RX6 A;  3AXJ B;  3L09 A;  3AEB A;  3SFD A;  4CN4 A;  2X9H A;  1U4Q A;  4IT4 A;  5JR9 A;  4JEH B;  4ZZC A;  5LP6 E;  2LOP A;  1MIY A;  1IJ6 A;  4YTP A;  2K24 A;  2W2U A;  2B76 A;  4H63 V;  5HEO A;  4JI5 T;  2WWV A;  2KWH A;  3RQU A;  2WU5 A;  1UCU A;  1QLB A;  1XDP A;  3PUA A;  3PTR B;  4KX6 A;  4KHP T;  2J62 A;  3JAE A;  4TN7 B;  4WZX A;  3B13 A;  2XQ5 A;  3QK6 A;  2WQY A;  1HTJ F;  5J2U E;  4NUU A;  1KNP A;  1KFY A;  2N9D A;  4TV8 E;  4A56 A;  2JRK A;  3FHN A;  4XAX B;  2BKN A;  4ILB A;  2HPJ A;  4HEA A;  2XM2 A;  2FJB A;  5LBM A;  3P4W A;  4A5X A;  4UF0 A;  4H63 H;  1ZV4 X;  3JAF A;  3ZT7 A;  5FMN A;  3IF8 B;  4IDP A;  2WCA A;  3AE3 A;  5KX5 E;  1MMD A;  3KFW X;  2BS2 A;  3S4U A;  1XMO T;  3VRB A;  2Q9Q A;  3N2G E;  2CRB A;  3LG7 A;  3NKZ A;  4GOU A;  4CZZ B;  2W63 A;  4NPP A;  3O9X A;  3AXJ A;  4JYA T;  3WAJ A;  4EXT A;  2WU2 A;  3ZYK A;  2EHO C;  4B3R T;  5AQQ B;  3ZSS A;  4JEU B;  2XQY A;  2IDO B;  1UX5 A;  2VVN A;  2XAJ B;  3AE4 A;  4H9R C;  4QH4 A;  1D0X A;  4HFH A;  4YSZ A;  5HEH A;  1T98 A;  2YOE A;  2OA5 A;  3C4W A;  4MFR A;  1U5P A;  4LF9 T;  2V7L A;  2C5I T;  5LHG B;  5LJN A;  3RIA A;  5AQO B;  3ZEF B;  2VKO A;  4AXP A;  3P4S A;  2M6I A;  2OLT A;  1HF8 A;  5AQT B;  2ZM8 A;  4HWD A;  4FJO A;  1N33 T;  3ZCJ A;  3DP7 A;  4AKL A;  3E0Z A;  4NUV A;  4LMK A;  4ANJ A;  3AEE A;  4HFE A;  2CMR A;  5FXZ A;  2V5D A;  4JI1 T;  2XPK A;  5H6R B;  4MLK A;  2W67 A;  3CX7 B;  3SOL A;  1UGO A;  2DCF A;  5AQR B;  4HWH A;  4OHF A;  4DR6 T;  2LSG A;  4AIU A;  3EAB A;  4DO0 A;  2FJD A;  2XQ6 A;  3LK3 B;  4OK0 A;  1QSD A;  4AKG A;  2HHH T;  5EZY E;  3NZP A;  4JV5 T;  5KDM C;  4HGA A;  4ZI2 C;  2SPC A;  2KWI B;  4TZ4 C;  3RYF E;  3AEF A;  3C64 A;  4GYR A;  2VKJ A;  2XTL A;  4X5T A;  2YK0 A;  5HEU A;  2I59 A;  3WI3 A;  2EHO B;  2X9Y A;  3E22 E;  4WW0 A;  2LLY A;  3LBX B;  5JDF A;  2CWO A;  4B3S T;  2JMH A;  3UU5 A;  1KNR A;  4ZI3 D;  2VKH A;  5AQL B;  1CHU A;  3N9M A;  4JUY A;  4K0K T;  2CLY B;  3N9L A;  1US7 B;  3PV0 F;  3UFG A;  1YXR A;  5L3G B;  4B6X A;  2Y48 B;  3FZK B;  3K8P C;  3AE5 A;  1H7C A;  2AXD S;  3G06 A;  4A97 A;  1JNR A;  4XBF B;  5DQW A;  3N5L A;  2LSY A;  1ZP0 A;  4YTN A;  3IEE A;  1MND A;  2BZB A;  5LHH B;  2MTQ A;  2XAS B;  2BG9 C;  3SRZ A;  2VL0 A;  5ABE A;  1UUR A;  1X79 A;  3VHL A;  3EHZ A;  5F3J A;  2ODV A;  4A98 A;  2NR4 A;  2CM0 A;  5CA0 E;  4I55 E;  3V5U A;  4JI6 T;  1ZOY A;  4YFS A;  4IL4 A;  3J7Y q;  3BQL A;  1W0B A;  4PW8 A;  4E7Z A;  5J0Z A;  2NP9 A;  3KDS E;  2QVA A;  3JCF A;  2VUR A;  1D1C A;  4PJJ A;  3C4X A;  2XQ8 A;  3C4Z A;  4HE8 A;  4V1A v;  4IRE A;  3FZF B;  2ACZ A;  3MA9 A;  3RC8 A;  3OYX A;  4HWI B;  3OPC A;  3AAE B;  2EHO A;  4JI2 T;  3LBX A;  1OXZ A;  2MAW A;  2DI4 A;  2KND A;  4DV3 T;  3PE0 A;  2K48 A;  1BR4 A;  5DJQ C;  4GIW A;  3OYZ A;  2KZ7 B;  5FYM A;  5BMV E;  1HR0 T;  1XDO A;  4IIJ E;  4GKJ T;  4ZHQ E;  5AQG B;  1MIV A;  4EZH A;  4ISS A;  3OKQ A;  2JJ9 A;  4OYJ A;  4DV6 T;  2YU1 A;  3ANW B;  3GMI A;  2LJL A;  5LMN T;  4JI7 T;  4X1Y E;  3VRA A;  1SHZ C;  3UQ7 A;  4EB6 E;  1J5E T;  3P7I A;  3NWI A;  4QX8 B;  2E5L T;  2BS4 A;  3OTO T;  4LF8 T;  2E2A A;  3KBU A;  4DR2 T;  3EDU A;  1J5W A;  2XY8 B;  2G0U A;  2W66 A;  2LM2 A;  3QC9 A;  4X1I E;  2GK9 A;  4Z8X A;  1WRD A;  1T8B A;  4X62 T;  3MZK B;  4ZI2 D;  2JPF A;  2BG9 B;  1LKX A;  5ABG A;  2E9X D;  1FIO A;  2PTF A;  3Q5X A;  2WM9 A;  3PUV F;  5J1G A;  4YSX A;  5FP3 A;  5HAX A;  3MK7 C;  1MMA A;  3KV4 A;  3N2K E;  3CQX C;  3N9N A;  4UV8 B;  1S94 A;  4UVC B;  2CHN A;  2BKP A;  2CE7 A;  5JDG A;  4X66 T;  3HKB E;  4ERR A;  2X0Y A;  3AAA B;  2V7M A;  2DWK A;  4AKI A;  4K0U A;  1YQ4 A;  3VKG A;  3CIR A;  4UEL A;  1NWM X;  4PAG A;  4KBM B;  2CHO A;  3PUR A;  4ZXL A;  3RIF A;  1SA0 E;  1MMN A;  1R8I A;  4YT0 A;  2CWY A;  3F31 A;  3UUL A;  2WDQ A;  2PBI A;  2YDS A;  1UX4 A;  3QB5 A;  2OV9 A;  3RIU C;  3K3N A;  4AKH A;  3KV5 A;  1NAF A;  5FVL A;  5E0O A;  4LMJ A;  4YHH T;  5JRC B;  3AE2 A;  5AQN B;  4O8S A;  4O4H E;  5HXH A;  5C3J A;  4U3C A;  2BG9 A;  3AEA A;  1M7K A;  5L2L A;  4ZZB A;  2R6G F;  2H7V C;  4U2Z A;  2WBL A;  3C50 A;  3CQC B;  3RKG A;  4NXN T;  4CN1 A;  4AQF A;  2XQ3 A;  3UUB A;  2NW8 A;  3NZQ A;  4IST A;  1IBK T;  2RA1 A;  2WMN A;  3SWH A;  2IC9 A;  3UQ4 A;  5C2T A;  5JDM A;  3RKO A;  2XHE B;  3O1I A;  1WYB A;  4X1K E;  5JH7 E;  3ZMT B;  3KVB A;  3N9Q A;  4U7Y A;  3KVA A;  3ZMZ B;  3FBZ A;  3RRW A;  5HXS A;  5LJM A;  3ABV A;  4L9I A;  4L0R A;  3ZST A;  4B3T T;  2D2S A;  4LFA T;  1MIW A;  5L3D B;  3Q9D A;  2V7J A;  2CXL A;  5L3F B;  2D0U A;  3RYC E;  3ZYM A;  4X65 T;  2Q9Q D;  5HWY A;  2CPT A;  3WAK A;  1IBL T;  4CXW A;  2H89 A;  5JDL A;  3AB3 B;  2P9B A;  1G73 A;  1OED C;  1J1J A;  2XQ4 A;  4P1N A;  1XNQ T;  5JRC A;  5AQJ B;  3CML A;  1HG2 A;  2IW5 B;  3AED A;  3IA3 A;  2WMO A;  2LT3 A;  1SUM B;  4LFC T;  4DMV A;  4UEM A;  4BJM A;  5HXC A;  2WAU A;  5AQP B;  1W9R A;  2M6B A;  4ILU A;  5L3B B;  2AE9 A;  2UUA T;  2NTY A;  3FZH B;  3AE8 A;  4LML A;  4EYY R;  4KHZ F;  3AE1 A;  5HEJ A;  4E7S A;  3UU4 A;  3ZCI A;  1D0Y A;  2WS3 A;  1W0A A;  2XM1 A;  2XAH B;  4IE5 A;  3T1H T;  2UXD T;  2A72 A;  3HKE E;  5L4H A;  2ZM6 T;  2PFV A;  2UUB T;  3NBX X;  2E8I A;  4M1P A;  5DQV A;  2X51 A;  2X9W A;  5ETW A;  5AQU B;  4MAL A;  5LYJ E;  1HFA A;  2ZLY A;  4CI2 B;  3U3I A;  4C90 A;  5AQH B;  2YU2 A;  5L3E B;  4EEB A;  2N1G A;  3TLS A;  5FNV E;  4HKA A;  4ILC A;  4HTE A;  5FL0 A;  3ETU A;  1YKE B;  3OJA A;  2W62 A;  4HFD A;  3ZLI A;  5LGT B;  3KBT A;  3QUJ A;  2RP4 A;  1YQ3 A;  3K3O A;  2DHR A;  3RLF F;  3FXD B;  3I1A A;  2JQQ A;  4CXX A;  4NXM T;  5F8P A;  2UXC T;  3P4Q A;  2DLR A;  5KMG P;  4YY3 T;  1FEW A;  2UXB T;  4KP3 C;  1OED B;  4P0B A;  1D0Z A;  4ZS2 A;  4IL9 A;  3JC6 C;  4DUZ T;  2LM9 A;  4HFC A;  5J2T E;  1B7T A;  4IE0 A;  2C5K T;  3Q5D A;  4EZ4 A;  4O4I E;  2IAK A;  2LSJ A;  4PJN A;  4TWH A;  4YXD A;  2JQ9 A;  4Z90 A;  3I0Q A;  2E5V A;  1NEN A;  3PJA J;  3EUH A;  3F2E A;  4QWN B;  2I0M A;  2FBW A;  3FXE B;  4KMC A;  4OYK A;  3ZN1 B;  3UU8 A;  3ZC0 A;  1DU2 A;  1XWM A;  5CGM A;  4IDQ A;  1LVF A;  2WB5 A;  4YJ2 E;  2CXF A;  3CX6 B;  2DL1 A;  3UU6 A;  4DR7 T;  2WP9 A;  5FXV A;  2CXD A;  3AE9 A;  3D0T A;  2LOS A;  4GK5 E;  3MAC A;  3HKD E;  3SFE A;  4NIQ A;  3KIN B;  4U33 A;  5JDN A;  1KNZ A;  4H9O C;  3OBV E;  3T8O A;  2KT9 A;  2L9Q A;  4IDO A;  2KLQ A;  4BA9 A;  1VRB A;  4DR3 T;  2QGS A;  4GK0 E;  3P8C D;  3BK9 A;  4DR4 T;  4QXH B;  4WBO A;  4QHO A;  1OED A;  2XSB A;  2EHO D;  2UU9 T;  3DTO A;  2MYS A;  5LB7 B;  5JR9 C;  3ZPO A;  3LDQ B; 
#chains in the Genus database with same CATH homology
 2V7I A;  5ADX L;  2N9D A;  1E1H B;  4TV8 E;  4A56 A;  2JRK A;  3FHN A;  3ETV A;  4XAX B;  4DMW A;  3FB2 A;  4PFP A;  5LGU B;  2CE7 A;  4ADZ A;  5JDG A;  3HKB E;  2HPJ A;  4HEA A;  4ERR A;  4TUY E;  5LBM A;  4C91 A;  3GN5 B;  2VK9 A;  4UF0 A;  3AAA B;  4O4L E;  4H63 H;  2V7M A;  1ZV4 X;  2DWK A;  4AKI A;  4K0U A;  3VKG A;  4UEL A;  3MXZ A;  1WR6 A;  1NWM X;  3I0O A;  5FMN A;  3UTK A;  3IF8 B;  4PAG A;  5LG4 A;  4KBM B;  4L5G A;  4P09 A;  2X0L B;  1MMD A;  5KX5 E;  3KFW X;  1BR0 A;  3K3Q C;  2W0G A;  3PUR A;  3Q2M A;  5IHY A;  3S4U A;  4DBR A;  2Q9Q A;  1SA0 E;  3N2G E;  1AJ3 A;  3LG7 A;  1MMN A;  4O2A E;  2CWY A;  3F31 A;  4GOU A;  2E9X C;  5FY0 A;  4CZZ B;  2W63 A;  3GA8 A;  3UUL A;  3A5X A;  3ZPO A;  4MHC A;  3O9X A;  3SS1 A;  4H9P C;  2PBI A;  3WAJ A;  2CEA A;  4EXT A;  3BQK A;  3I9W A;  4IE6 A;  1IAP A;  1UX4 A;  2LHR A;  3ZYK A;  3K3N A;  3MJX A;  4AKH A;  2EHO C;  3KV5 A;  3TKL B;  2A2F X;  4JEU B;  2XQY A;  1NAF A;  2UXN B;  5E0O A;  1MNE A;  5EK4 A;  2PJQ A;  3UFE A;  5JRC B;  3B57 A;  2MBG A;  1UX5 A;  3CX8 B;  4O8S A;  2XAJ B;  4O4H E;  3RH3 A;  5HXH A;  4H9N C;  2X9X A;  5L2L A;  2X67 A;  2H7V C;  4H9R C;  2WBL A;  4PK4 A;  5JVD E;  5HXE A;  1D0X A;  2VKD A;  2V1D B;  3C51 A;  3C50 A;  1T98 A;  4I43 B;  3CKD A;  3CQC B;  3J9X 1;  2OA5 A;  4AQF A;  3C4W A;  4MFR A;  1U5P A;  2B1E A;  2XAQ B;  2V7L A;  2NW8 A;  2C5I T;  5LHG B;  1CUN A;  3RPU A;  2N2N A;  3NZQ A;  4IST A;  5LJN A;  2LEH A;  1BR1 A;  5LCY A;  2LE8 A;  2RA1 A;  2WMN A;  3KV6 A;  3ZEF B;  3SWH A;  2VKO A;  1V9D A;  2IC9 A;  4AXP A;  5JDM A;  3RKO A;  2KXP B;  2VL8 A;  2XHE B;  3O1I A;  1WYB A;  3L3P A;  3O1H A;  5IYZ E;  1HF8 A;  4PFO A;  4X1K E;  2ZM8 A;  5JH7 E;  4QXB B;  3ONX A;  2A3D A;  4H9Q C;  3ZMT B;  2VWA A;  3KVB A;  3N9Q A;  2YEV C;  3KVA A;  4MBQ A;  3ZMZ B;  5C8Y E;  4FJO A;  3M65 A;  4I50 E;  3ZCJ A;  3DP7 A;  3FBZ A;  2ZMA A;  2M67 A;  1S35 A;  3E0Z A;  4NUV A;  3V5S A;  4AKL A;  2MOZ A;  3RRW A;  5HXS A;  4ANJ A;  5LJM A;  3GN5 A;  4G2A A;  4ZOL E;  4L9I A;  3EVY A;  2CCQ A;  4L0R A;  3UUX B;  2CMR A;  5FXZ A;  2D2S A;  3ZMS B;  5H6R B;  5LOV E;  2Y8D A;  1YW0 A;  4MLK A;  4UVB B;  2YIN A;  5JR9 B;  3CX7 B;  3SOL A;  2DCF A;  4AQF C;  2PG8 A;  4OHF A;  1MIW A;  5L3D B;  3Q9D A;  2V7J A;  2CXL A;  5CB4 E;  5L3F B;  2D0U A;  3H3A A;  3RYC E;  5CA1 E;  3ZYM A;  4QXC B;  2LSG A;  4PJL A;  2VAS A;  5EK2 A;  4DO0 A;  3NRY A;  2Q9Q D;  2CA5 A;  3LK3 B;  5HWY A;  3WAK A;  1BR2 A;  2V26 A;  4OK0 A;  1QSD A;  3I9Y A;  4CI1 B;  4AKG A;  3ANW A;  4CXW A;  3CPZ A;  3ZYL A;  3RRC A;  5JDL A;  4O4J E;  5EZY E;  3AB3 B;  1QUU A;  3NZP A;  5KDM C;  4AQG A;  4HGA A;  2P9B A;  2WWU A;  4O2B E;  4ZI2 C;  4KUM B;  1G73 A;  3ZMU B;  2SPC A;  1EZ3 A;  2DNX A;  2KWI B;  2BVM A;  5HYA A;  3HA4 A;  4TZ4 C;  5HWX A;  5JRC A;  2NW9 A;  4WNK A;  3RYF E;  3CML A;  1HG2 A;  2E9X B;  3C64 A;  4OFZ A;  5JDQ A;  3H37 A;  2IW5 B;  4GYR A;  3ZN0 B;  4BJN A;  4P0A A;  2BVL A;  2VKJ A;  2LT3 A;  2NW7 A;  2WMO A;  2D0T A;  2XTL A;  3PUS A;  4DMV A;  2YK0 A;  4UEM A;  1LVK A;  5HXC A;  4BJM A;  2WAU A;  3N9O A;  2I59 A;  4QX7 B;  3VKH A;  1HG5 A;  3DJB A;  4PK6 A;  2EHO B;  2X9Y A;  3E22 E;  3WI3 A;  4AKR B;  4WW0 A;  3BQI A;  4ILU A;  4EOZ B;  4H9S E;  1IJ5 A;  3HKC E;  5L3B B;  3LBX B;  3RYH E;  5JDF A;  2CWO A;  3ZMV B;  3AAI A;  4CQI A;  3AVS A;  2JMH A;  4AI6 A;  4PJM A;  5LNK A;  2NTY A;  3EDV A;  3GWH A;  4YJ3 E;  4ZI3 D;  2VKH A;  2ZM2 A;  4EYY R;  2VB6 A;  1G8X A;  3E08 A;  3N9M A;  3RYI E;  4I4T E;  2D5U A;  2ZM0 A;  4JUY A;  2K9A A;  2CLY B;  3N9L A;  1LRZ A;  4DND A;  1US7 B;  4E7S A;  2W61 A;  3RC3 A;  5LGN B;  3ZCI A;  1D0Y A;  5LHI B;  2Q9Q C;  1HCI A;  2XUE A;  4U72 A;  2XAH B;  3O4X E;  4IE5 A;  5JQG E;  3HR0 A;  5L3G B;  4B6X A;  3ESL A;  5LA6 E;  4YLH A;  2IC6 A;  2Y48 B;  1ZKE A;  3FBL A;  2A72 A;  2WSS V;  3K8P C;  5LXT E;  3HKE E;  4DVD A;  1H7C A;  2C0S A;  3C98 B;  4JLE A;  2NOX A;  1ZHC A;  5LBQ B;  4ASK A;  2PFV A;  3MKD A;  4UV9 B;  2XAF B;  3JC6 D;  3NBX X;  1KK7 A;  1FMV A;  4ZI7 E;  2E8I A;  2J1D G;  4XBF B;  4HN9 A;  4IE7 A;  4M1P A;  5DQV A;  5DQW A;  2X51 A;  3N5L A;  2X9W A;  5ETW A;  4MAL A;  2C5J A;  2LSY A;  5LYJ E;  1FMW A;  3IEE A;  3N2O A;  1MND A;  1HFA A;  2BZB A;  2ZLY A;  4IE4 A;  4CI2 B;  3U3I A;  3VU7 H;  5LHH B;  4C90 A;  2MTQ A;  4PNI A;  2YU2 A;  2XAS B;  3CWZ B;  5L3E B;  3SRZ A;  1Z0P A;  2X66 A;  2N1G A;  5FNV E;  2XAG B;  4HKA A;  3UT5 E;  3AA1 B;  3KV9 A;  1X79 A;  3VHL A;  4HTE A;  2KMF A;  5F3J A;  2ODV A;  3ETU A;  2CM0 A;  5CA0 E;  1YKE B;  4I55 E;  3V5U A;  3OJA A;  4QKN A;  2L8K A;  3LFM A;  2W62 A;  4DBQ A;  3ZLI A;  4YFS A;  4YHJ A;  4F6R C;  3O1J A;  1ZEE A;  3BQL A;  3J7Y q;  4X20 E;  5AFU L;  1OWA A;  4ZI3 C;  4IDZ A;  5FY1 A;  2DWG A;  2L3L A;  5LGT B;  3KBT A;  4PW8 A;  2H3R A;  3IHR A;  3QUJ A;  4E7Z A;  2NP9 A;  2RP4 A;  2LHN A;  5GON E;  3KDS E;  3LJC A;  3K3O A;  2HH7 A;  2E9X A;  1D1C A;  2DHR A;  4PJJ A;  3C4X A;  3C4Z A;  4HE8 A;  3FXD B;  3I1A A;  2JQQ A;  4IHJ E;  4CXX A;  4V1A v;  4N78 D;  5F8P A;  3MA9 A;  5A1L A;  3RC8 A;  5DAB A;  3OYX A;  5L3C B;  4UVC B;  1D1A A;  3AA6 B;  2DLR A;  2H7O A;  5KMG P;  3AAE B;  5TAO A;  2EHO A;  4WBN E;  1FEW A;  4HFV A;  1VOM A;  4UXN B;  3PUG A;  4KP3 C;  2ODU A;  3LBX A;  1OXZ A;  4P0B A;  2KIN B;  4J2C A;  1D0Z A;  2ES0 A;  4ZS2 A;  1YD8 G;  4CI3 B;  3HL6 A;  3JC6 C;  2DI4 A;  2LM9 A;  2KND A;  3AVR A;  3PE0 A;  5H6Q B;  4BAY B;  1HX8 A;  3ZC1 A;  1B7T A;  4IE0 A;  5J2T E;  2K48 A;  2C5K T;  5FY7 A;  1BR4 A;  3UUN A;  5DJQ C;  2ACX A;  5FXX A;  4EZ4 A;  4O4I E;  4GIW A;  2IAK A;  3OYZ A;  2KZ7 B;  5FYM A;  2LSJ A;  4PJN A;  5BMV E;  2NTX A;  5JRE A;  4GYS A;  5EK3 A;  4EIW A;  4UVA B;  2QA7 A;  3I0Q A;  3PDY A;  4IIJ E;  3PU3 A;  3EUH A;  3F2E A;  4QWN B;  3AA0 B;  2K5B B;  4ZHQ E;  3ZJ2 A;  1MIV A;  2LSI A;  4UF0 B;  4EZH A;  4IGU A;  4ISS A;  4ZS3 A;  4U74 A;  1IZN B;  3OKQ A;  2JJ9 A;  3FXE B;  4KMC A;  4OYK A;  3ZN1 B;  5FXW A;  4UIG A;  4OYJ A;  2YU1 A;  3ANW B;  3GMI A;  2LJL A;  4TV9 E;  3ZC0 A;  2X68 A;  2W00 A;  4X1Y E;  3PUQ A;  3Q5W A;  2LSK A;  1SHZ C;  1WYC A;  4XZC A;  1YKH B;  1LVF A;  3P7I A;  5HXR A;  4EB6 E;  4YJ2 E;  2CXF A;  4QX8 B;  2Q9Q B;  1Y64 B;  3F57 A;  3CX6 B;  4EAH A;  1O3X A;  4TX5 A;  4FI5 A;  2HPL A;  2V7K A;  3R84 B;  3RX6 A;  3KBU A;  5FXV A;  2CXD A;  3D0T A;  3L09 A;  3N9P A;  2JMK A;  3EDU A;  2Z6E A;  2CLY C;  2LOS A;  4GK5 E;  2X9H A;  3MAC A;  1U4Q A;  3LK2 B;  2NWB A;  4JEH B;  5JR9 A;  3UUM A;  5LP6 E;  5JDH A;  2G0U A;  2LOP A;  1MIY A;  1IJ6 A;  4G63 A;  4CXY A;  3PU8 A;  3U78 A;  2BDE A;  3HKD E;  4EYU A;  1WLX A;  3W15 B;  3QC9 A;  4X1I E;  2K24 A;  3KIN B;  2GK9 A;  4Z8X A;  1WRD A;  5JDN A;  3MZK B;  4ZI2 D;  1KNZ A;  1D1B A;  3HI2 A;  2JPF A;  4H9O C;  3OBV E;  4H63 V;  1MMG A;  3T8O A;  2UXX B;  2KWH A;  2KT9 A;  1UCU A;  1LKX A;  2L9Q A;  2KLQ A;  2E9X D;  3PUA A;  1FIO A;  3PTR B;  1VRB A;  4BA9 A;  2QGS A;  3CQG B;  4GK0 E;  1HS7 A;  3AA7 B;  3P8C D;  3BK9 A;  3Q5X A;  4PK5 A;  4TN7 B;  3CVR A;  2WM9 A;  5J1G A;  4QXH B;  3B13 A;  4WBO A;  5FP3 A;  4QHO A;  5HAX A;  3QK6 A;  3R6N A;  3MK7 C;  2EHO D;  1HTJ F;  1MMA A;  5J2U E;  3KV4 A;  3N2K E;  3CQX C;  3DTO A;  3N9N A;  4UV8 B;  2Y6X A;  3LK4 2;  5M4Y A;  2MYS A;  3ZJ1 A;  3IBP A;  5JR9 C;  1S94 A;  3NRX A;  4NUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...