2LOPA

Backbone structure of human membrane protein tmem14a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Transmembrane protein 14A
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03647 Tmemb_14 Transmembrane proteins 14C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lopA00
2LOPA 2LOSA
chains in the Genus database with same CATH superfamily
3B13A 5AQJB 3CMLA 2J47A 4PNIA 2DNXA 5F5WA 4EXTA 1OEDB 5JDFA 3IEEA 2JMKA 3NZPA 3RYIE 1DU2A 4FI5A 2D0TA 2WZHA 1N32T 3PV0F 3ZT5A 5LOVE 3EDUA 4ILUA 2KNDA 3P4QA 4UV9B 5JRCA 3M65A 2AXDS 4CXWA 4UVBB 2JJ9A 3ZMZB 3C4XA 5DQVA 2XM1A 2KT9A 1X79A 1XNQT 4QH4A 4DV3T 4PFPA 3V5UA 4U31A 1U4QA 3PUVF 3F31A 5AQUB 4HFBA 2IUBA 4IE0A 3CQCB 2M67A 5JR9C 3PUSA 5CGMA 4IDQA 5JDNA 4MFRA 3O1JA 2UXDT 3JAFA 2YN6A 3KINB 4JI8T 5FP3A 2J62A 4PJMA 3OYXA 2E9XB 2LHRA 4ISTA 3P4WA 4YSZA 3RRWA 1X9BA 3JC6D 2KLQA 2CBIA 4IDZA 3KV4A 5M4YA 5HEHA 1MMAA 1FIOA 1I94T 4MLKA 2N1GA 5IWAT 4A98A 4ZI3C 3AAAB 5HAXA 3C98B 3ZYLA 3EI0A 4WW0A 4FJOA 2VB6A 4P09A 4JYAT 4LMJA 3PUYF 4O4LE 2WZIA 3RIUA 4TX5A 2BBHA 5LMUT 4HE8A 2VKHA 3HKEE 3I0OA 2X9HA 1XWMA 3H3AA 5AQQB 4KUMB 2E8IA 4EOZB 3RX6A 4F8HA 2X66A 2DCFA 3A7MA 4DR1T 2X51A 1GQEA 2WDRA 5HEJA 1BR0A 3ANWB 1O3XA 3ZMUB 2BS2A 1L0VA 3HA4A 2QGSA 2XQ3A 2YDQA 5JRCB 1IBKT 1WLXA 4AKLA 5JR9A 2LSJA 2XQYA 3BK9A 3PURA 5L3CB 2LEHA 2WAUA 3E0ZA 2XAHB 5LGUB 4U7YA 2XAQB 3ONXA 4U33A 4U2ZA 2ZM2A 5JQGE 2Y48B 3KV5A 2L3LA 4DVDA 2ACXA 3RF1A 4HWHA 1LKXA 2CWOA 3SWHA 3T1YT 1HX1B 2IIUA 1U5PA 3V5SA 5FVLA 2JIWA 1B7TA 4ZI2D 3HR0A 2X9WA 1OWAA 4HFHA 3OVUA 1E2AA 2BS3A 2BG9A 4NUVA 4DR2T 2XQ6A 5KMGP 3AE1A 3QB5A 3BQLA 3C51A 4DMWA 5AQTB 2XPKA 4LF9T 3ZC1A 4GK0E 5HEOA 2CXDA 2CCQA 3UU5A 5L2LA 3KDSE 3RQWA 4NPPA 5L3DB 2UXBT 1MIWA 2C5KT 2Y6XA 4EIWA 5L3GB 1HR0T 3K1SA 4ZEYA 2W00A 2M6IA 3BQKA 5HWXA 2V7IA 2H88A 4DR4T 5AQRB 5C2TA 4NXNT 2K9AA 4KHPT 3GN5A 2CRBA 4ZOLE 3UU8A 2EHOD 3ESLA 1OEDC 4TUYE 3UT5E 3FZKB 3MZKB 4X20E 3H37A 4QWNB 3T1HT 2QVAA 2VQET 2WBLA 3UU6A 2J1DG 2CEAA 5ABHA 4ZZBA 4CN1A 3ZCJA 1YQ3A 5FXXA 1MMDA 2CXLA 1T72A 1N36T 3M3ZB 4ILCA 4XZCA 5LYJE 4DV4T 2P9BA 5FVKA 2EHOA 1ZV4X 5C3JA 4GIWA 3NWIA 3GMIA 2PG8A 4O4JE 1R8IA 5ABFA 3AEBA 3ETUA 1XZYA 1KEYA 3UQ7A 4ZS2A 2V8SV 3PU3A 4OFZA 1M7KA 3MXZA 3GA8A 3ZLIA 3UQ4A 5H6QB 3MK7C 3B57A 4HFEA 1SUMB 4OYKA 3RLFF 3ETVA 2E9XC 2BKOA 2Y8DA 3N5LA 2L8KA 1YQ4A 5FMNA 2LSIA 2BG9B 4P1NA 4DBQA 3QC9A 3A5XA 5JVDE 5LBQB 1T98A 4DR3T 4AQFA 2XTLA 3EVYA 3N2KE 5AQKB 4DUZT 2WCAA 2DWKA 4UVAB 3KBTA 2X0LB 4NUUA 3TLVA 4U7IA 2LKHA 3FBLA 3AXJA 4TNVA 5H6RB 3UUMA 1D0YA 2VURA 1J5WA 4BA9A 4JEHB 2WWUA 1UURA 3ZT6A 2W61A 5EK2A 5F3JA 2IC9A 5ABGA 2XY8B 4AQYT 2UU9T 2KMFA 4H9RC 1OXZA 3LDQB 3CX8B 2WDQA 1T8BA 2DHRA 5JH7E 3MA9A 3CQXC 2V7JA 4AQGA 4IGUA 3RYCE 3I0QA 4YJ3E 4TV9E 2YDRA 3EUHA 5EK3A 3AE3A 4DV0T 3IBPA 2EHOB 5AQNB 2E5LT 3PE0A 4GKJT 5LGTB 5J1GA 4H9NC 2AE9A 1ZP0A 5ABFB 3IHRA 2XSBA 4X65T 4LMLA 3QOFA 4DV7T 3I9WA 3F2EA 2PTFA 2RA1A 3ZJ2A 4PW8A 3ZYMA 3CWZB 3VRAA 1FJGT 3RYHE 2WP9A 3PUWF 4QHOA 3L39A 4YSYA 4DV5T 2HN1A 4N78D 2H3RA 3EDVA 4CI2B 3VKGA 2A9UA 1ZHCA 4ERRA 4U3CA 1KF6A 1HNZT 1UK5A 4LMKA 4YJ2E 3CPZA 3UUBA 4HWCA 2YINA 4ILBA 2I0MA 5J2UE 2JMHA 3JC6C 2A3DA 3AXJB 2V5DA 3RC3A 4CN4A 1Y01A 3RIUC 2XM2A 4LF4T 1UUSA 3RYFE 2JQKA 2K48A 2NTYA 3TKLB 3FXEB 3ANWA 3OYZA 2UUCT 1MIVA 5TAOA 2V7MA 3K3NA 2QA7A 3KV9A 2V6YA 4UR9A 4WZXA 3ZEFB 5DABA 4UXNB 3RPUA 1J1JA 1HG2A 3SFEA 3SFDA 4KX6A 3IF8B 4COFA 2W2UA 5LHGB 2LRKA 1VCTA 3J7Yq 3KV6A 3R6NA 3N9QA 2ZM6T 4DR6T 3RH3A 5AQOB 2YU1A 3C64A 1H7CA 2NW7A 5IYZE 4CQIA 3SRZA 3RQUA 2FJBA 5CFBA 3LK3B 2X9YA 2BBJA 2XQ8A 5HCMA 4Z90A 5CA1E 1D1AA 1HTJF 3L3PA 4ISSA 2MPKA 4DV2T 4IL9A 4JI5T 5FXVA 3T8OA 2UUAT 3N9LA 5LA6E 2X68A 2A2FX 1BR2A 2BG9C 2HN2A 3S4UA 1UX5A 5AQGB 5LCYA 4QH1A 4DIDB 3DJBA 5HWYA 1SA0E 3NZQA 5AQVB 5HEUA 3ZT7A 4AKHA 1WR6A 2VL0A 3OPCA 4O2BE 2MYSA 4KI0F 1VOMA 2NR4A 4ZI2C 3OTOT 2BZBA 2LHNA 4AKRB 2CXFA 3AEFA 2WMOA 3VRBA 3Q5EA 2XQ5A 4Q25A 5JREA 2D5UA 2NW9A 1N33T 3E22E 1SHZC 2X0HA 2I59A 3ZC0A 3SS1A 2VVNA 1OEDE 4A56A 2W4XA 2V6YB 1US7B 5FXZA 5L4EA 4NIQA 4GOUA 2LM2A 4CI3B 3NBXX 3ZMVB 3IA3A 2WS3A 3UFEA 4M1PA 2XJ7A 2EHOC 1FMWA 1KNPA 2H89A 3PJAJ 3ZSSA 3ZN1B 3AECA 4KP3C 3F57A 3Q2MA 1FEWA 1HG5A 1QSDA 3LK2B 2B76A 4H63H 5JDHA 2YK0A 4IREA 3VR8A 4LF6T 1LVKA 4YFSA 4HFCA 3CIRA 4ASKA 5A1LA 3W15B 2NP9A 3AEAA 4JV5T 1KFYA 2WM9A 4K0KT 2WDVA 4C91A 4UV8B 2A72A 3RIAA 3KFWX 5F8PA 2Z6EA 1SE7A 4HWIB 1D0XA 3VR9A 2YDSA 2ACZA 4UIGA 3RHWA 5L3EB 2ZM0A 4LFCT 4AQFC 1BR1A 2WU2A 3AA1B 1HFAA 1QLBA 4OX9T 4X64T 3ZSTA 4OK0A 4EV6A 5FY1A 2NOXA 4H9OC 3AB3B 3ZN0B 3L8RA 2KWIB 1WCRA 4JI3T 3FB2A 3ONJA 1YXRA 1IBMT 4V1Av 4JI2T 3UTKA 3K3OA 5LHIB 2MOZA 2VWAA 1NEKA 3CK6A 1VCSA 2FJAA 2BVLA 4IDPA 3UFGA 4IT4A 2YEVC 5HCJA 2G0UA 3KVBA 3OJAA 4EEDA 4I43B 4YXDA 4YTMA 1Z8UA 3L09A 4HWFA 2OA5A 3AE6A 1G8XA 2KINB 3LJCA 5J2TE 4CZZB 4L0RA 4P0BA 2Q9QD 4YY3T 1YKHB 5EZYE 3TLUA 4H63V 1E1HB 4X1YE 4WNKA 5AQMB 3Q5WA 2N2NA 2B1EA 2XQAA 2XQ9A 2MAWA 1CHUA 3D0TA 5LG3A 5JDGA 3N9PA 5JDQA 5JTGA 2LJLA 2Q9QA 4O4IE 2C5IT 3BQIA 4HKAA 3O1HA 1WYBA 2LRLA 1HCIA 4YHHT 3CQGB 1NAFA 3I9YA 4UF0A 2XUEA 2CM0A 3Q9DA 2ZM8A 3AE7A 1WRDA 3U78A 1HNWT 1UCUA 2CBJA 4K0UA 4IDNA 2K5BB 1HS7A 3G06A 3CKDA 1XDOA 4B6XA 2LSKA 4AIUA 5JDLA 2XSAA 2VKJA 2LE8A 3P7IA 3TLTA 4EGWA 3PUZF 3JCFA 4YT0A 2D2SA 2WB5A 1QUUA 2VKDA 2V7KA 2IHR1 4QXHB 2FJDA 1ZEEA 2K3WA 5HXSA 3PU8A 3HKDE 1W09A 4AXPA 4XAXB 2CHOA 2XQ4A 4X5TA 1W9RA 1Z0PA 4GKKT 3LBXA 4PJNA 4TV8E 3WAKA 4DR7T 1LRZA 2CWYA 3Q5DA 2M6BA 2DL1A 3E08A 2W63A 5AQLB 1HF8A 4C90A 1KNZA 3FZLB 4ZXLA 3KVAA 3UU4A 3LFMA 2JQHA 4TN7B 4A5XA 3QK6A 3FBZA 4TWDA 5LMNT 4HEAA 2WMNA 5E0OA 5KDMC 3N9NA 2YU2A 3K8PC 2RP4A 2L9QA 1MMNA 3K3QC 2IMLA 3JAEA 2V26A 2HHHT 1MIYA 3UULA 4YTPA 3N9MA 2XHEB 4QXBB 2X0YA 2Q9QB 4OYJA 2LSGA 1XMOT 4HN9A 3EHZA 3RI5A 4DUYT 3FZHB 3O4XE 2YOEA 1IJ5A 3GWHA 4UF0B 4DBRA 2BG9E 1HNXT 5EK4A 2K24A 2QYWA 5DJQC 2BDEA 4AKIA 4YLHA 4WBNE 3UUXB 3P50A 3TLWA 4F6RC 1VRBA 4ZS3A 1YD8G 4PK4A 5ETWA 3P4PA 2XAJB 2E2AA 4PK6A 4MBQA 3AEDA 3DTOA 2WY2A 3N2OA 4X1KE 5FL1A 4E7ZA 3R84B 4JI7T 4G2AA 3NRXA 2DLRA 2LLYA 4G63A 1S94A 5AFUL 4IL4A 4QX7B 2X9XA 3FXDB 2XQ7A 2MTQA 4IE6A 5GONE 4TWHA 4Z91A 3LG7A 2HPJA 2JRKA 3LBXB 4L5GA 4JI4T 2DI4A 2FBWA 2UUBT 3J9X1 2WU5A 1V9DA 2V6XA 3AA7B 5LB7B 3O9XA 3CVRA 2KSRA 3AE8A 4GK5E 3AVSA 2LKGA 1ZKEA 4HFIA 3RIFA 3RKGA 2D0UA 1JNRA 4EZHA 4PJLA 3QUJA 4HGAA 3OKQA 1WR0A 4PFOA 2ODVA 2FUPA 4X66T 5ADXL 4I4TE 3HKBE 3X1DA 4HFDA 4IE4A 1WFDA 4X62T 4KMCA 2IDOB 3PJAA 4IDOA 1LVFA 2WQYA 1NWMX 3P8CD 2H7OA 2IAKA 3AA6B 4L9IA 2I6HA 4BJMA 1D1CA 2OV9A 3NRYA 3AEGA 2RPAA 4ZZCA 4I55E 4E7SA 5JDMA 4QH5A 2YKSA 4WBOA 5FY7A 3VU7H 2CLYC 5L3FB 3ZKRA 5J0ZA 4X1IE 3H3MA 4P0AA 1W0AA 2D9DA 2X67A 1BR4A 5LJNA 5AQIB 3ZPOA 2W62A 1HX8A 4ILAA 4JUYA 3SOLA 2N9DA 3P4RA 2C0SA 4A97A 2ZMAA 3RGLA 3CX6B 2VL8A 2CPTA 3UU3A 3AAEB 2XAGB 3VHLA 4IHJE 3LK42 4ZI3D 2QRXA 1M62A 3PUXF 1JNZA 4AKGA 4B3RT 3AE9A 4BJNA 2LT3A 5HYAA 3DP7A 2WSSV 1MMGA 4MHCA 3EAMA 1T7SA 4QXCB 3RRCA 1UGOA 3B5MA 4HTEA 2NTXA 1D1BA 5BMVE 5FY0A 3MACA 4MALA 4LF7T 3O1IA 4HWDA 4DV1T 1NENA 3HI2A 5ABEA 2Q9QC 5KX5E 3HL6A 4EZ4A 5FYMA 2WWVA 5LXTE 2JPFA 2MBGA 2JQ9A 1EZ3A 3P4SA 4OHFA 2CHNA 2NWBA 5HXEA 4B3TT 4DO0A 3ABVA 5L4HA 4CI1B 5FNVE 2CMRA 2XASB 4LFBT 5DQWA 4YTNA 4HFVA 2VK9A 4ZHQE 1ZOYA 3AVRA 4J2CA 4O2AE 2LOSA 2KXPB 3I1AA 5HXCA 2V1DB 5IHYA 2V7LA 2V5CA 4DNDA 3PUGA 3JADA 4O8SA 1MNDA 4NXMT 4B3MT 3RC8A 3FZFB 1J5ET 3C4WA 4JEUB 4EEBA 5FXWA 3C50A 4B3ST 3NKZA 3Q5XA 1Y64B 2KZ7B 2LSYA 4PAGA 5L47A 5CB4E 5JR9B 2E5VA 2KWHA 1XNRT 4YHJA 2VASA 4LF5T 1FMVA 4TNWA 3AA0B 2W0GA 3N9OA 5C8YE 4DV6T 1IJ6A 5L3BB 3ONLC 4ANJA 4WYVA 2PJQA 4CXXA 2JQQA 3HKCE 2C5JA 3AEEA 5HEGA 4H9QC 3ZMTB 4QX8B 3MKDA 1AJ3A 1I6ZA 2HH7A 3AE5A 2FJEA 1YW0A 3A8YC 5CJ5A 3FZMB 1KK7A 4JLEA 2F4VT 4JI0T 2W67A 4I50E 1XDPA 1D0ZA 4EB6E 5LP6E 2HPLA 4U74A 2UXNB 4AI6A 1E7PA 2CE7A 4TZ4C 4DR5T 5LJMA 1IAPA 2IW5B 2CLYB 5AQSB 3PUAA 1WYCA 2UXXB 4EYUA 3N2GE 2LOPA 2BVMA 3AE4A 4UELA 2DWGA 1N34T 2BKPA 4QKNA 2BKNA 5HXRA 4IE7A 5IUXA 4IE5A 3AE2A 2VQFT 2UXCT 3QB5K 4EYYR 2W66A 2OLTA 1OEDA 2ODUA 1IBLT 5AQHB 3AAIA 5AQFB 4XBFB 3RKOA 3GN5B 4CN6A 2GK9A 3QNUA 3ZYKA 4JI6T 3CX7B 4AISA 4JI1T 3WAJA 2PFVA 4U72A 3OBVE 2IC6A 4BAYB 2ZLYA 2E9XD 1G73A 1YKEB 2BS4A 1XMQT 5LBMA 3PDYA 3C4ZA 4KHZF 4KBMB 5LG4A 4LFAT 5FKYA 3ZJ1A 4YSXA 2PBIA 4H9SE 4LF8T 4EAHA 3PTRB 3FHNA 3ZCIA 4I0UA 4DMVA 2CA5A 3LSVA 1MNEA 4ZI7E 5CA0E 3KBUA 3PUQA 3U3IA 2VKOA 4CXYA 1CUNA 2E9XA 4UVCB 2ES0A 2XZEA 3EABA 4JBWF 5HXHA 4PJJA 3ZMSB 5LNKA 4ADZA 4GYRA 4Z8XA 4TWFA 4H9PC 2H7VC 3TLSA 5AQPB 1IZNB 1UX4A 3NVOA 2NW8A 4O4HE 5LHHB 4IIJE 2R6GF 4UEMA 2VVSA 5KXJA 5BR8T 3MJXA 2XAFB 1S35A 2J4GA 3VKHA 3WI3A 3UUNA 2SPCA 1KNRA 2LM9A 1W0BA 5LGNB 4PK5A 4U2YA 4GYSA 5FL0A
chains in the Genus database with same CATH topology
1D0YA 3B13A 4X1IE 4P0AA 3CMLA 4V1Av 3UTKA 4PNIA 4BA9A 3K3OA 5LHIB 2DNXA 4EXTA 4JEHB 5JDFA 2X67A 2WWUA 1BR4A 2MOZA 2JMKA 3IEEA 5LJNA 2VWAA 3NZPA 3RYIE 4FI5A 3ZPOA 2W62A 1HX8A 2D0TA 2W61A 5EK2A 5LOVE 2BVLA 3EDUA 4JUYA 5F3JA 4ILUA 2KNDA 2IC9A 2YEVC 4UV9B 5JRCA 2G0UA 3M65A 3SOLA 4CXWA 2KMFA 2N9DA 3KVBA 4H9RC 1OXZA 3CX8B 3OJAA 2C0SA 4I43B 4UVBB 2JJ9A 3ZMZB 2ZMAA 3C4XA 5DQVA 3L09A 2DHRA 2KT9A 1X79A 5JH7E 3CX6B 2VL8A 3MA9A 3CQXC 2OA5A 2V7JA 1G8XA 4PFPA 3V5UA 4AQGA 2KINB 4IGUA 3RYCE 3I0QA 3LJCA 4YJ3E 5J2TE 1U4QA 3F31A 4TV9E 4CZZB 3EUHA 3AAEB 4L0RA 5EK3A 2XAGB 4IE0A 3IBPA 4P0BA 2EHOB 3CQCB 2M67A 2Q9QD 3PUSA 5JR9C 3PE0A 3VHLA 5LGTB 5J1GA 4IHJE 3LK42 1YKHB 4H9NC 5JDNA 4ZI3D 5EZYE 4MFRA 4H63V 3IHRA 1E1HB 3O1JA 4WNKA 4X1YE 3Q5WA 3I9WA 3F2EA 4AKGA 2N2NA 4BJNA 2LT3A 5HYAA 2B1EA 2RA1A 3ZJ2A 4PW8A 3KINB 3DP7A 2WSSV 1MMGA 4MHCA 3ZYMA 3D0TA 5FP3A 3CWZB 4PJMA 4QXCB 3RRCA 3OYXA 2E9XB 2LHRA 4ISTA 3RYHE 5JDGA 4HTEA 2NTXA 1D1BA 3N9PA 5BMVE 3RRWA 5FY0A 3JC6D 2KLQA 5JDQA 2LJLA 4QHOA 3MACA 2Q9QA 4MALA 4IDZA 2C5IT 4O4IE 3BQIA 3KV4A 4HKAA 3O1IA 5M4YA 3O1HA 4N78D 1WYBA 2H3RA 1HCIA 1MMAA 3CQGB 1NAFA 3I9YA 3HI2A 1FIOA 4UF0A 2Q9QC 2XUEA 4MLKA 3HL6A 5KX5E 2CM0A 3Q9DA 4EZ4A 2ZM8A 5FYMA 5LXTE 1WRDA 3U78A 2N1GA 4ZI3C 3AAAB 3EDVA 2JPFA 2MBGA 1EZ3A 4OHFA 1UCUA 5HAXA 2NWBA 4CI2B 5HXEA 3C98B 4K0UA 3VKGA 2K5BB 3ZYLA 1HS7A 1ZHCA 4ERRA 4WW0A 3CKDA 4FJOA 4DO0A 2VB6A 4P09A 4B6XA 2LSKA 5JDLA 2VKJA 2LE8A 4O4LE 3P7IA 4YJ2E 5FNVE 4CI1B 2CMRA 2XASB 3CPZA 5DQWA 4HFVA 2VK9A 2D2SA 2YINA 4ZHQE 4TX5A 1QUUA 2VKDA 2V7KA 2VKHA 3AVRA 4HE8A 5J2UE 4J2CA 3HKEE 4O2AE 2JMHA 3I0OA 3JC6C 2A3DA 2LOSA 2X9HA 3H3AA 2KXPB 3I1AA 3RC3A 5HXCA 2V1DB 2E8IA 4KUMB 4QXHB 5IHYA 2V7LA 4EOZB 3RYFE 3RX6A 1ZEEA 4DNDA 2K48A 2NTYA 3PU8A 5HXSA 2X66A 3TKLB 2DCFA 3FXEB 3PUGA 3ANWA 3HKDE 2X51A 4AXPA 3OYZA 1MIVA 4XAXB 5TAOA 4O8SA 1Z0PA 1MNDA 2V7MA 1BR0A 3K3NA 2QA7A 1O3XA 3ANWB 3ZMUB 3KV9A 3ZEFB 3LBXA 4PJNA 3HA4A 2QGSA 4TV8E 3WAKA 5DABA 4UXNB 3RC8A 1LRZA 3C4WA 5JRCB 3RPUA 1WLXA 4AKLA 4JEUB 2CWYA 1HG2A 5FXWA 3C50A 3E08A 5JR9A 3IF8B 3Q5XA 2LSJA 2XQYA 1Y64B 2W63A 3BK9A 3PURA 5LHGB 2KZ7B 1HF8A 4C90A 5L3CB 1KNZA 2LEHA 3J7Yq 3KVAA 2WAUA 2LSYA 3KV6A 3LFMA 4PAGA 3R6NA 5CB4E 5JR9B 3N9QA 3E0ZA 2XAHB 4TN7B 5LGUB 2XAQB 3ONXA 3RH3A 3QK6A 3FBZA 2KWHA 2YU1A 2ZM2A 4YHJA 2VASA 3C64A 1H7CA 5JQGE 1FMVA 4HEAA 2WMNA 3AA0B 2Y48B 5E0OA 2W0GA 3KV5A 3N9OA 2L3LA 3N9NA 2YU2A 5KDMC 5C8YE 2NW7A 4DVDA 2ACXA 3K8PC 1LKXA 5IYZE 1IJ6A 2CWOA 3SWHA 5L3BB 4CQIA 2RP4A 1U5PA 2L9QA 4ANJA 3SRZA 3V5SA 2PJQA 4CXXA 1MMNA 1B7TA 2JQQA 4ZI2D 3K3QC 3HKCE 2C5JA 3HR0A 2V26A 2X9WA 1MIYA 4H9QC 3UULA 3LK3B 3N9MA 3ZMTB 2X9YA 2XHEB 4QX8B 5CA1E 3MKDA 1OWAA 1AJ3A 1D1AA 1HTJF 4QXBB 3L3PA 4ISSA 2HH7A 4NUVA 2Q9QB 5FXVA 4OYJA 5KMGP 3T8OA 2LSGA 3N9LA 5LA6E 4HN9A 1YW0A 1KK7A 2X68A 2A2FX 1BR2A 4JLEA 3BQLA 3O4XE 1IJ5A 3GWHA 4UF0B 3S4UA 1UX5A 4DBRA 3C51A 5EK4A 2K24A 4I50E 5LCYA 4DMWA 3DJBA 5HWYA 1SA0E 1D0ZA 3NZQA 3ZC1A 4EB6E 4GK0E 5DJQC 5LP6E 4AKHA 2HPLA 4U74A 2UXNB 2CXDA 4AI6A 1WR6A 2BDEA 2CE7A 4TZ4C 4AKIA 2CCQA 5LJMA 4O2BE 4YLHA 4WBNE 1IAPA 2MYSA 2IW5B 2CLYB 3UUXB 3PUAA 1VOMA 4F6RC 1VRBA 5L2LA 4ZS3A 1WYCA 3KDSE 5L3DB 4ZI2C 1MIWA 2BZBA 2C5KT 2UXXB 2Y6XA 1YD8G 4EYUA 4PK4A 2LHNA 4AKRB 2CXFA 5ETWA 3N2GE 2LOPA 4EIWA 2BVMA 4UELA 5L3GB 2DWGA 2XAJB 4QKNA 2W00A 5HXRA 3BQKA 2WMOA 5HWXA 2V7IA 4IE7A 4IE5A 4PK6A 4MBQA 5JREA 2D5UA 3DTOA 2NW9A 4EYYR 3N2OA 4X1KE 3E22E 2K9AA 4E7ZA 1SHZC 3GN5A 3R84B 2ODUA 4G2AA 2I59A 3NRXA 4ZOLE 2DLRA 4G63A 2EHOD 1S94A 3ZC0A 5AFUL 3AAIA 4QX7B 3SS1A 3ESLA 4XBFB 3RKOA 2X9XA 3FXDB 3GN5B 4TUYE 4A56A 2GK9A 3UT5E 2MTQA 4IE6A 3MZKB 3ZYKA 5GONE 3CX7B 3LG7A 4X20E 2HPJA 2JRKA 3H37A 3LBXB 4QWNB 1US7B 4L5GA 5FXZA 2WBLA 2DI4A 2J1DG 3WAJA 3J9X1 2PFVA 2CEAA 4U72A 1V9DA 3OBVE 2IC6A 4BAYB 3ZCJA 2ZLYA 5FXXA 1MMDA 4GOUA 3AA7B 2CXLA 3O9XA 2E9XD 4CI3B 1G73A 4XZCA 1YKEB 3NBXX 3CVRA 3ZMVB 5LYJE 5LBMA 3PDYA 3C4ZA 2P9BA 4KBMB 4GK5E 2EHOA 3UFEA 4M1PA 3AVSA 1ZV4X 5LG4A 1ZKEA 4GIWA 3GMIA 2PG8A 3ZJ1A 2D0UA 2PBIA 4O4JE 2EHOC 1FMWA 3ETUA 4H9SE 4EZHA 4PJLA 4EAHA 3PTRB 3QUJA 4HGAA 3FHNA 3ZCIA 4DMVA 3OKQA 2CA5A 4ZS2A 4PFOA 1MNEA 2ODVA 4ZI7E 3PU3A 4OFZA 5CA0E 3KBUA 3PUQA 3ZN1B 3U3IA 4KP3C 3F57A 3MXZA 3Q2MA 2VKOA 3GA8A 1FEWA 4CXYA 1CUNA 1HG5A 3ZLIA 1QSDA 2E9XA 3LK2B 3MK7C 3B57A 4H63H 4UVCB 5H6QB 5ADXL 5JDHA 2YK0A 2ES0A 4I4TE 3HKBE 4IE4A 4OYKA 1LVKA 4YFSA 5HXHA 3ETVA 4ASKA 5A1LA 4PJJA 2E9XC 3W15B 2NP9A 3ZMSB 5LNKA 2Y8DA 3N5LA 2L8KA 5FMNA 2LSIA 2WM9A 4GYRA 4KMCA 4Z8XA 4ADZA 4DBQA 4H9PC 3QC9A 4C91A 2H7VC 3A5XA 2A72A 4UV8B 5JVDE 3KFWX 5LBQB 1T98A 5F8PA 1IZNB 1UX4A 2Z6EA 1LVFA 2XTLA 3EVYA 4AQFA 1D0XA 1NWMX 2NW8A 3N2KE 4O4HE 3P8CD 4UIGA 5L3EB 2ZM0A 2H7OA 2IAKA 3AA6B 4IIJE 5LHHB 4L9IA 1BR1A 4UEMA 4AQFC 4BJMA 3AA1B 1D1CA 1HFAA 2DWKA 3NRYA 3MJXA 4UVAB 2XAFB 1S35A 3KBTA 2X0LB 3WI3A 4I55E 3VKHA 4E7SA 5JDMA 4NUUA 4OK0A 4WBOA 5FY7A 3UUNA 2SPCA 3VU7H 3FBLA 5FY1A 2LM9A 2NOXA 5LGNB 4PK5A 2CLYC 4H9OC 3AB3B 3ZN0B 2KWIB 4GYSA 5L3FB 5H6RB 3FB2A 3UUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOP A;  2LOS A; 
#chains in the Genus database with same CATH topology
 3B13 A;  5AQJ B;  3CML A;  2J47 A;  4PNI A;  2DNX A;  5F5W A;  4EXT A;  1OED B;  5JDF A;  3IEE A;  2JMK A;  3NZP A;  3RYI E;  1DU2 A;  4FI5 A;  2D0T A;  2WZH A;  1N32 T;  3PV0 F;  3ZT5 A;  5LOV E;  3EDU A;  4ILU A;  2KND A;  3P4Q A;  4UV9 B;  5JRC A;  3M65 A;  2AXD S;  4CXW A;  4UVB B;  2JJ9 A;  3ZMZ B;  3C4X A;  5DQV A;  2XM1 A;  2KT9 A;  1X79 A;  1XNQ T;  4QH4 A;  4DV3 T;  4PFP A;  3V5U A;  4U31 A;  1U4Q A;  3PUV F;  3F31 A;  5AQU B;  4HFB A;  2IUB A;  4IE0 A;  3CQC B;  2M67 A;  5JR9 C;  3PUS A;  5CGM A;  4IDQ A;  5JDN A;  4MFR A;  3O1J A;  2UXD T;  3JAF A;  2YN6 A;  3KIN B;  4JI8 T;  5FP3 A;  2J62 A;  4PJM A;  3OYX A;  2E9X B;  2LHR A;  4IST A;  3P4W A;  4YSZ A;  3RRW A;  1X9B A;  3JC6 D;  2KLQ A;  2CBI A;  4IDZ A;  3KV4 A;  5M4Y A;  5HEH A;  1MMA A;  1FIO A;  1I94 T;  4MLK A;  2N1G A;  5IWA T;  4A98 A;  4ZI3 C;  3AAA B;  5HAX A;  3C98 B;  3ZYL A;  3EI0 A;  4WW0 A;  4FJO A;  2VB6 A;  4P09 A;  4JYA T;  4LMJ A;  3PUY F;  4O4L E;  2WZI A;  3RIU A;  4TX5 A;  2BBH A;  5LMU T;  4HE8 A;  2VKH A;  3HKE E;  3I0O A;  2X9H A;  1XWM A;  3H3A A;  5AQQ B;  4KUM B;  2E8I A;  4EOZ B;  3RX6 A;  4F8H A;  2X66 A;  2DCF A;  3A7M A;  4DR1 T;  2X51 A;  1GQE A;  2WDR A;  5HEJ A;  1BR0 A;  3ANW B;  1O3X A;  3ZMU B;  2BS2 A;  1L0V A;  3HA4 A;  2QGS A;  2XQ3 A;  2YDQ A;  5JRC B;  1IBK T;  1WLX A;  4AKL A;  5JR9 A;  2LSJ A;  2XQY A;  3BK9 A;  3PUR A;  5L3C B;  2LEH A;  2WAU A;  3E0Z A;  2XAH B;  5LGU B;  4U7Y A;  2XAQ B;  3ONX A;  4U33 A;  4U2Z A;  2ZM2 A;  5JQG E;  2Y48 B;  3KV5 A;  2L3L A;  4DVD A;  2ACX A;  3RF1 A;  4HWH A;  1LKX A;  2CWO A;  3SWH A;  3T1Y T;  1HX1 B;  2IIU A;  1U5P A;  3V5S A;  5FVL A;  2JIW A;  1B7T A;  4ZI2 D;  3HR0 A;  2X9W A;  1OWA A;  4HFH A;  3OVU A;  1E2A A;  2BS3 A;  2BG9 A;  4NUV A;  4DR2 T;  2XQ6 A;  5KMG P;  3AE1 A;  3QB5 A;  3BQL A;  3C51 A;  4DMW A;  5AQT B;  2XPK A;  4LF9 T;  3ZC1 A;  4GK0 E;  5HEO A;  2CXD A;  2CCQ A;  3UU5 A;  5L2L A;  3KDS E;  3RQW A;  4NPP A;  5L3D B;  2UXB T;  1MIW A;  2C5K T;  2Y6X A;  4EIW A;  5L3G B;  1HR0 T;  3K1S A;  4ZEY A;  2W00 A;  2M6I A;  3BQK A;  5HWX A;  2V7I A;  2H88 A;  4DR4 T;  5AQR B;  5C2T A;  4NXN T;  2K9A A;  4KHP T;  3GN5 A;  2CRB A;  4ZOL E;  3UU8 A;  2EHO D;  3ESL A;  1OED C;  4TUY E;  3UT5 E;  3FZK B;  3MZK B;  4X20 E;  3H37 A;  4QWN B;  3T1H T;  2QVA A;  2VQE T;  2WBL A;  3UU6 A;  2J1D G;  2CEA A;  5ABH A;  4ZZB A;  4CN1 A;  3ZCJ A;  1YQ3 A;  5FXX A;  1MMD A;  2CXL A;  1T72 A;  1N36 T;  3M3Z B;  4ILC A;  4XZC A;  5LYJ E;  4DV4 T;  2P9B A;  5FVK A;  2EHO A;  1ZV4 X;  5C3J A;  4GIW A;  3NWI A;  3GMI A;  2PG8 A;  4O4J E;  1R8I A;  5ABF A;  3AEB A;  3ETU A;  1XZY A;  1KEY A;  3UQ7 A;  4ZS2 A;  2V8S V;  3PU3 A;  4OFZ A;  1M7K A;  3MXZ A;  3GA8 A;  3ZLI A;  3UQ4 A;  5H6Q B;  3MK7 C;  3B57 A;  4HFE A;  1SUM B;  4OYK A;  3RLF F;  3ETV A;  2E9X C;  2BKO A;  2Y8D A;  3N5L A;  2L8K A;  1YQ4 A;  5FMN A;  2LSI A;  2BG9 B;  4P1N A;  4DBQ A;  3QC9 A;  3A5X A;  5JVD E;  5LBQ B;  1T98 A;  4DR3 T;  4AQF A;  2XTL A;  3EVY A;  3N2K E;  5AQK B;  4DUZ T;  2WCA A;  2DWK A;  4UVA B;  3KBT A;  2X0L B;  4NUU A;  3TLV A;  4U7I A;  2LKH A;  3FBL A;  3AXJ A;  4TNV A;  5H6R B;  3UUM A;  1D0Y A;  2VUR A;  1J5W A;  4BA9 A;  4JEH B;  2WWU A;  1UUR A;  3ZT6 A;  2W61 A;  5EK2 A;  5F3J A;  2IC9 A;  5ABG A;  2XY8 B;  4AQY T;  2UU9 T;  2KMF A;  4H9R C;  1OXZ A;  3LDQ B;  3CX8 B;  2WDQ A;  1T8B A;  2DHR A;  5JH7 E;  3MA9 A;  3CQX C;  2V7J A;  4AQG A;  4IGU A;  3RYC E;  3I0Q A;  4YJ3 E;  4TV9 E;  2YDR A;  3EUH A;  5EK3 A;  3AE3 A;  4DV0 T;  3IBP A;  2EHO B;  5AQN B;  2E5L T;  3PE0 A;  4GKJ T;  5LGT B;  5J1G A;  4H9N C;  2AE9 A;  1ZP0 A;  5ABF B;  3IHR A;  2XSB A;  4X65 T;  4LML A;  3QOF A;  4DV7 T;  3I9W A;  3F2E A;  2PTF A;  2RA1 A;  3ZJ2 A;  4PW8 A;  3ZYM A;  3CWZ B;  3VRA A;  1FJG T;  3RYH E;  2WP9 A;  3PUW F;  4QHO A;  3L39 A;  4YSY A;  4DV5 T;  2HN1 A;  4N78 D;  2H3R A;  3EDV A;  4CI2 B;  3VKG A;  2A9U A;  1ZHC A;  4ERR A;  4U3C A;  1KF6 A;  1HNZ T;  1UK5 A;  4LMK A;  4YJ2 E;  3CPZ A;  3UUB A;  4HWC A;  2YIN A;  4ILB A;  2I0M A;  5J2U E;  2JMH A;  3JC6 C;  2A3D A;  3AXJ B;  2V5D A;  3RC3 A;  4CN4 A;  1Y01 A;  3RIU C;  2XM2 A;  4LF4 T;  1UUS A;  3RYF E;  2JQK A;  2K48 A;  2NTY A;  3TKL B;  3FXE B;  3ANW A;  3OYZ A;  2UUC T;  1MIV A;  5TAO A;  2V7M A;  3K3N A;  2QA7 A;  3KV9 A;  2V6Y A;  4UR9 A;  4WZX A;  3ZEF B;  5DAB A;  4UXN B;  3RPU A;  1J1J A;  1HG2 A;  3SFE A;  3SFD A;  4KX6 A;  3IF8 B;  4COF A;  2W2U A;  5LHG B;  2LRK A;  1VCT A;  3J7Y q;  3KV6 A;  3R6N A;  3N9Q A;  2ZM6 T;  4DR6 T;  3RH3 A;  5AQO B;  2YU1 A;  3C64 A;  1H7C A;  2NW7 A;  5IYZ E;  4CQI A;  3SRZ A;  3RQU A;  2FJB A;  5CFB A;  3LK3 B;  2X9Y A;  2BBJ A;  2XQ8 A;  5HCM A;  4Z90 A;  5CA1 E;  1D1A A;  1HTJ F;  3L3P A;  4ISS A;  2MPK A;  4DV2 T;  4IL9 A;  4JI5 T;  5FXV A;  3T8O A;  2UUA T;  3N9L A;  5LA6 E;  2X68 A;  2A2F X;  1BR2 A;  2BG9 C;  2HN2 A;  3S4U A;  1UX5 A;  5AQG B;  5LCY A;  4QH1 A;  4DID B;  3DJB A;  5HWY A;  1SA0 E;  3NZQ A;  5AQV B;  5HEU A;  3ZT7 A;  4AKH A;  1WR6 A;  2VL0 A;  3OPC A;  4O2B E;  2MYS A;  4KI0 F;  1VOM A;  2NR4 A;  4ZI2 C;  3OTO T;  2BZB A;  2LHN A;  4AKR B;  2CXF A;  3AEF A;  2WMO A;  3VRB A;  3Q5E A;  2XQ5 A;  4Q25 A;  5JRE A;  2D5U A;  2NW9 A;  1N33 T;  3E22 E;  1SHZ C;  2X0H A;  2I59 A;  3ZC0 A;  3SS1 A;  2VVN A;  1OED E;  4A56 A;  2W4X A;  2V6Y B;  1US7 B;  5FXZ A;  5L4E A;  4NIQ A;  4GOU A;  2LM2 A;  4CI3 B;  3NBX X;  3ZMV B;  3IA3 A;  2WS3 A;  3UFE A;  4M1P A;  2XJ7 A;  2EHO C;  1FMW A;  1KNP A;  2H89 A;  3PJA J;  3ZSS A;  3ZN1 B;  3AEC A;  4KP3 C;  3F57 A;  3Q2M A;  1FEW A;  1HG5 A;  1QSD A;  3LK2 B;  2B76 A;  4H63 H;  5JDH A;  2YK0 A;  4IRE A;  3VR8 A;  4LF6 T;  1LVK A;  4YFS A;  4HFC A;  3CIR A;  4ASK A;  5A1L A;  3W15 B;  2NP9 A;  3AEA A;  4JV5 T;  1KFY A;  2WM9 A;  4K0K T;  2WDV A;  4C91 A;  4UV8 B;  2A72 A;  3RIA A;  3KFW X;  5F8P A;  2Z6E A;  1SE7 A;  4HWI B;  1D0X A;  3VR9 A;  2YDS A;  2ACZ A;  4UIG A;  3RHW A;  5L3E B;  2ZM0 A;  4LFC T;  4AQF C;  1BR1 A;  2WU2 A;  3AA1 B;  1HFA A;  1QLB A;  4OX9 T;  4X64 T;  3ZST A;  4OK0 A;  4EV6 A;  5FY1 A;  2NOX A;  4H9O C;  3AB3 B;  3ZN0 B;  3L8R A;  2KWI B;  1WCR A;  4JI3 T;  3FB2 A;  3ONJ A;  1YXR A;  1IBM T;  4V1A v;  4JI2 T;  3UTK A;  3K3O A;  5LHI B;  2MOZ A;  2VWA A;  1NEK A;  3CK6 A;  1VCS A;  2FJA A;  2BVL A;  4IDP A;  3UFG A;  4IT4 A;  2YEV C;  5HCJ A;  2G0U A;  3KVB A;  3OJA A;  4EED A;  4I43 B;  4YXD A;  4YTM A;  1Z8U A;  3L09 A;  4HWF A;  2OA5 A;  3AE6 A;  1G8X A;  2KIN B;  3LJC A;  5J2T E;  4CZZ B;  4L0R A;  4P0B A;  2Q9Q D;  4YY3 T;  1YKH B;  5EZY E;  3TLU A;  4H63 V;  1E1H B;  4X1Y E;  4WNK A;  5AQM B;  3Q5W A;  2N2N A;  2B1E A;  2XQA A;  2XQ9 A;  2MAW A;  1CHU A;  3D0T A;  5LG3 A;  5JDG A;  3N9P A;  5JDQ A;  5JTG A;  2LJL A;  2Q9Q A;  4O4I E;  2C5I T;  3BQI A;  4HKA A;  3O1H A;  1WYB A;  2LRL A;  1HCI A;  4YHH T;  3CQG B;  1NAF A;  3I9Y A;  4UF0 A;  2XUE A;  2CM0 A;  3Q9D A;  2ZM8 A;  3AE7 A;  1WRD A;  3U78 A;  1HNW T;  1UCU A;  2CBJ A;  4K0U A;  4IDN A;  2K5B B;  1HS7 A;  3G06 A;  3CKD A;  1XDO A;  4B6X A;  2LSK A;  4AIU A;  5JDL A;  2XSA A;  2VKJ A;  2LE8 A;  3P7I A;  3TLT A;  4EGW A;  3PUZ F;  3JCF A;  4YT0 A;  2D2S A;  2WB5 A;  1QUU A;  2VKD A;  2V7K A;  2IHR 1;  4QXH B;  2FJD A;  1ZEE A;  2K3W A;  5HXS A;  3PU8 A;  3HKD E;  1W09 A;  4AXP A;  4XAX B;  2CHO A;  2XQ4 A;  4X5T A;  1W9R A;  1Z0P A;  4GKK T;  3LBX A;  4PJN A;  4TV8 E;  3WAK A;  4DR7 T;  1LRZ A;  2CWY A;  3Q5D A;  2M6B A;  2DL1 A;  3E08 A;  2W63 A;  5AQL B;  1HF8 A;  4C90 A;  1KNZ A;  3FZL B;  4ZXL A;  3KVA A;  3UU4 A;  3LFM A;  2JQH A;  4TN7 B;  4A5X A;  3QK6 A;  3FBZ A;  4TWD A;  5LMN T;  4HEA A;  2WMN A;  5E0O A;  5KDM C;  3N9N A;  2YU2 A;  3K8P C;  2RP4 A;  2L9Q A;  1MMN A;  3K3Q C;  2IML A;  3JAE A;  2V26 A;  2HHH T;  1MIY A;  3UUL A;  4YTP A;  3N9M A;  2XHE B;  4QXB B;  2X0Y A;  2Q9Q B;  4OYJ A;  2LSG A;  1XMO T;  4HN9 A;  3EHZ A;  3RI5 A;  4DUY T;  3FZH B;  3O4X E;  2YOE A;  1IJ5 A;  3GWH A;  4UF0 B;  4DBR A;  2BG9 E;  1HNX T;  5EK4 A;  2K24 A;  2QYW A;  5DJQ C;  2BDE A;  4AKI A;  4YLH A;  4WBN E;  3UUX B;  3P50 A;  3TLW A;  4F6R C;  1VRB A;  4ZS3 A;  1YD8 G;  4PK4 A;  5ETW A;  3P4P A;  2XAJ B;  2E2A A;  4PK6 A;  4MBQ A;  3AED A;  3DTO A;  2WY2 A;  3N2O A;  4X1K E;  5FL1 A;  4E7Z A;  3R84 B;  4JI7 T;  4G2A A;  3NRX A;  2DLR A;  2LLY A;  4G63 A;  1S94 A;  5AFU L;  4IL4 A;  4QX7 B;  2X9X A;  3FXD B;  2XQ7 A;  2MTQ A;  4IE6 A;  5GON E;  4TWH A;  4Z91 A;  3LG7 A;  2HPJ A;  2JRK A;  3LBX B;  4L5G A;  4JI4 T;  2DI4 A;  2FBW A;  2UUB T;  3J9X 1;  2WU5 A;  1V9D A;  2V6X A;  3AA7 B;  5LB7 B;  3O9X A;  3CVR A;  2KSR A;  3AE8 A;  4GK5 E;  3AVS A;  2LKG A;  1ZKE A;  4HFI A;  3RIF A;  3RKG A;  2D0U A;  1JNR A;  4EZH A;  4PJL A;  3QUJ A;  4HGA A;  3OKQ A;  1WR0 A;  4PFO A;  2ODV A;  2FUP A;  4X66 T;  5ADX L;  4I4T E;  3HKB E;  3X1D A;  4HFD A;  4IE4 A;  1WFD A;  4X62 T;  4KMC A;  2IDO B;  3PJA A;  4IDO A;  1LVF A;  2WQY A;  1NWM X;  3P8C D;  2H7O A;  2IAK A;  3AA6 B;  4L9I A;  2I6H A;  4BJM A;  1D1C A;  2OV9 A;  3NRY A;  3AEG A;  2RPA A;  4ZZC A;  4I55 E;  4E7S A;  5JDM A;  4QH5 A;  2YKS A;  4WBO A;  5FY7 A;  3VU7 H;  2CLY C;  5L3F B;  3ZKR A;  5J0Z A;  4X1I E;  3H3M A;  4P0A A;  1W0A A;  2D9D A;  2X67 A;  1BR4 A;  5LJN A;  5AQI B;  3ZPO A;  2W62 A;  1HX8 A;  4ILA A;  4JUY A;  3SOL A;  2N9D A;  3P4R A;  2C0S A;  4A97 A;  2ZMA A;  3RGL A;  3CX6 B;  2VL8 A;  2CPT A;  3UU3 A;  3AAE B;  2XAG B;  3VHL A;  4IHJ E;  3LK4 2;  4ZI3 D;  2QRX A;  1M62 A;  3PUX F;  1JNZ A;  4AKG A;  4B3R T;  3AE9 A;  4BJN A;  2LT3 A;  5HYA A;  3DP7 A;  2WSS V;  1MMG A;  4MHC A;  3EAM A;  1T7S A;  4QXC B;  3RRC A;  1UGO A;  3B5M A;  4HTE A;  2NTX A;  1D1B A;  5BMV E;  5FY0 A;  3MAC A;  4MAL A;  4LF7 T;  3O1I A;  4HWD A;  4DV1 T;  1NEN A;  3HI2 A;  5ABE A;  2Q9Q C;  5KX5 E;  3HL6 A;  4EZ4 A;  5FYM A;  2WWV A;  5LXT E;  2JPF A;  2MBG A;  2JQ9 A;  1EZ3 A;  3P4S A;  4OHF A;  2CHN A;  2NWB A;  5HXE A;  4B3T T;  4DO0 A;  3ABV A;  5L4H A;  4CI1 B;  5FNV E;  2CMR A;  2XAS B;  4LFB T;  5DQW A;  4YTN A;  4HFV A;  2VK9 A;  4ZHQ E;  1ZOY A;  3AVR A;  4J2C A;  4O2A E;  2LOS A;  2KXP B;  3I1A A;  5HXC A;  2V1D B;  5IHY A;  2V7L A;  2V5C A;  4DND A;  3PUG A;  3JAD A;  4O8S A;  1MND A;  4NXM T;  4B3M T;  3RC8 A;  3FZF B;  1J5E T;  3C4W A;  4JEU B;  4EEB A;  5FXW A;  3C50 A;  4B3S T;  3NKZ A;  3Q5X A;  1Y64 B;  2KZ7 B;  2LSY A;  4PAG A;  5L47 A;  5CB4 E;  5JR9 B;  2E5V A;  2KWH A;  1XNR T;  4YHJ A;  2VAS A;  4LF5 T;  1FMV A;  4TNW A;  3AA0 B;  2W0G A;  3N9O A;  5C8Y E;  4DV6 T;  1IJ6 A;  5L3B B;  3ONL C;  4ANJ A;  4WYV A;  2PJQ A;  4CXX A;  2JQQ A;  3HKC E;  2C5J A;  3AEE A;  5HEG A;  4H9Q C;  3ZMT B;  4QX8 B;  3MKD A;  1AJ3 A;  1I6Z A;  2HH7 A;  3AE5 A;  2FJE A;  1YW0 A;  3A8Y C;  5CJ5 A;  3FZM B;  1KK7 A;  4JLE A;  2F4V T;  4JI0 T;  2W67 A;  4I50 E;  1XDP A;  1D0Z A;  4EB6 E;  5LP6 E;  2HPL A;  4U74 A;  2UXN B;  4AI6 A;  1E7P A;  2CE7 A;  4TZ4 C;  4DR5 T;  5LJM A;  1IAP A;  2IW5 B;  2CLY B;  5AQS B;  3PUA A;  1WYC A;  2UXX B;  4EYU A;  3N2G E;  2LOP A;  2BVM A;  3AE4 A;  4UEL A;  2DWG A;  1N34 T;  2BKP A;  4QKN A;  2BKN A;  5HXR A;  4IE7 A;  5IUX A;  4IE5 A;  3AE2 A;  2VQF T;  2UXC T;  3QB5 K;  4EYY R;  2W66 A;  2OLT A;  1OED A;  2ODU A;  1IBL T;  5AQH B;  3AAI A;  5AQF B;  4XBF B;  3RKO A;  3GN5 B;  4CN6 A;  2GK9 A;  3QNU A;  3ZYK A;  4JI6 T;  3CX7 B;  4AIS A;  4JI1 T;  3WAJ A;  2PFV A;  4U72 A;  3OBV E;  2IC6 A;  4BAY B;  2ZLY A;  2E9X D;  1G73 A;  1YKE B;  2BS4 A;  1XMQ T;  5LBM A;  3PDY A;  3C4Z A;  4KHZ F;  4KBM B;  5LG4 A;  4LFA T;  5FKY A;  3ZJ1 A;  4YSX A;  2PBI A;  4H9S E;  4LF8 T;  4EAH A;  3PTR B;  3FHN A;  3ZCI A;  4I0U A;  4DMV A;  2CA5 A;  3LSV A;  1MNE A;  4ZI7 E;  5CA0 E;  3KBU A;  3PUQ A;  3U3I A;  2VKO A;  4CXY A;  1CUN A;  2E9X A;  4UVC B;  2ES0 A;  2XZE A;  3EAB A;  4JBW F;  5HXH A;  4PJJ A;  3ZMS B;  5LNK A;  4ADZ A;  4GYR A;  4Z8X A;  4TWF A;  4H9P C;  2H7V C;  3TLS A;  5AQP B;  1IZN B;  1UX4 A;  3NVO A;  2NW8 A;  4O4H E;  5LHH B;  4IIJ E;  2R6G F;  4UEM A;  2VVS A;  5KXJ A;  5BR8 T;  3MJX A;  2XAF B;  1S35 A;  2J4G A;  3VKH A;  3WI3 A;  3UUN A;  2SPC A;  1KNR A;  2LM9 A;  1W0B A;  5LGN B;  4PK5 A;  4U2Y A;  4GYS A;  5FL0 A; 
#chains in the Genus database with same CATH homology
 1D0Y A;  3B13 A;  4X1I E;  4P0A A;  3CML A;  4V1A v;  3UTK A;  4PNI A;  4BA9 A;  3K3O A;  5LHI B;  2DNX A;  4EXT A;  4JEH B;  5JDF A;  2X67 A;  2WWU A;  1BR4 A;  2MOZ A;  2JMK A;  3IEE A;  5LJN A;  2VWA A;  3NZP A;  3RYI E;  4FI5 A;  3ZPO A;  2W62 A;  1HX8 A;  2D0T A;  2W61 A;  5EK2 A;  5LOV E;  2BVL A;  3EDU A;  4JUY A;  5F3J A;  4ILU A;  2KND A;  2IC9 A;  2YEV C;  4UV9 B;  5JRC A;  2G0U A;  3M65 A;  3SOL A;  4CXW A;  2KMF A;  2N9D A;  3KVB A;  4H9R C;  1OXZ A;  3CX8 B;  3OJA A;  2C0S A;  4I43 B;  4UVB B;  2JJ9 A;  3ZMZ B;  2ZMA A;  3C4X A;  5DQV A;  3L09 A;  2DHR A;  2KT9 A;  1X79 A;  5JH7 E;  3CX6 B;  2VL8 A;  3MA9 A;  3CQX C;  2OA5 A;  2V7J A;  1G8X A;  4PFP A;  3V5U A;  4AQG A;  2KIN B;  4IGU A;  3RYC E;  3I0Q A;  3LJC A;  4YJ3 E;  5J2T E;  1U4Q A;  3F31 A;  4TV9 E;  4CZZ B;  3EUH A;  3AAE B;  4L0R A;  5EK3 A;  2XAG B;  4IE0 A;  3IBP A;  4P0B A;  2EHO B;  3CQC B;  2M67 A;  2Q9Q D;  3PUS A;  5JR9 C;  3PE0 A;  3VHL A;  5LGT B;  5J1G A;  4IHJ E;  3LK4 2;  1YKH B;  4H9N C;  5JDN A;  4ZI3 D;  5EZY E;  4MFR A;  4H63 V;  3IHR A;  1E1H B;  3O1J A;  4WNK A;  4X1Y E;  3Q5W A;  3I9W A;  3F2E A;  4AKG A;  2N2N A;  4BJN A;  2LT3 A;  5HYA A;  2B1E A;  2RA1 A;  3ZJ2 A;  4PW8 A;  3KIN B;  3DP7 A;  2WSS V;  1MMG A;  4MHC A;  3ZYM A;  3D0T A;  5FP3 A;  3CWZ B;  4PJM A;  4QXC B;  3RRC A;  3OYX A;  2E9X B;  2LHR A;  4IST A;  3RYH E;  5JDG A;  4HTE A;  2NTX A;  1D1B A;  3N9P A;  5BMV E;  3RRW A;  5FY0 A;  3JC6 D;  2KLQ A;  5JDQ A;  2LJL A;  4QHO A;  3MAC A;  2Q9Q A;  4MAL A;  4IDZ A;  2C5I T;  4O4I E;  3BQI A;  3KV4 A;  4HKA A;  3O1I A;  5M4Y A;  3O1H A;  4N78 D;  1WYB A;  2H3R A;  1HCI A;  1MMA A;  3CQG B;  1NAF A;  3I9Y A;  3HI2 A;  1FIO A;  4UF0 A;  2Q9Q C;  2XUE A;  4MLK A;  3HL6 A;  5KX5 E;  2CM0 A;  3Q9D A;  4EZ4 A;  2ZM8 A;  5FYM A;  5LXT E;  1WRD A;  3U78 A;  2N1G A;  4ZI3 C;  3AAA B;  3EDV A;  2JPF A;  2MBG A;  1EZ3 A;  4OHF A;  1UCU A;  5HAX A;  2NWB A;  4CI2 B;  5HXE A;  3C98 B;  4K0U A;  3VKG A;  2K5B B;  3ZYL A;  1HS7 A;  1ZHC A;  4ERR A;  4WW0 A;  3CKD A;  4FJO A;  4DO0 A;  2VB6 A;  4P09 A;  4B6X A;  2LSK A;  5JDL A;  2VKJ A;  2LE8 A;  4O4L E;  3P7I A;  4YJ2 E;  5FNV E;  4CI1 B;  2CMR A;  2XAS B;  3CPZ A;  5DQW A;  4HFV A;  2VK9 A;  2D2S A;  2YIN A;  4ZHQ E;  4TX5 A;  1QUU A;  2VKD A;  2V7K A;  2VKH A;  3AVR A;  4HE8 A;  5J2U E;  4J2C A;  3HKE E;  4O2A E;  2JMH A;  3I0O A;  3JC6 C;  2A3D A;  2LOS A;  2X9H A;  3H3A A;  2KXP B;  3I1A A;  3RC3 A;  5HXC A;  2V1D B;  2E8I A;  4KUM B;  4QXH B;  5IHY A;  2V7L A;  4EOZ B;  3RYF E;  3RX6 A;  1ZEE A;  4DND A;  2K48 A;  2NTY A;  3PU8 A;  5HXS A;  2X66 A;  3TKL B;  2DCF A;  3FXE B;  3PUG A;  3ANW A;  3HKD E;  2X51 A;  4AXP A;  3OYZ A;  1MIV A;  4XAX B;  5TAO A;  4O8S A;  1Z0P A;  1MND A;  2V7M A;  1BR0 A;  3K3N A;  2QA7 A;  1O3X A;  3ANW B;  3ZMU B;  3KV9 A;  3ZEF B;  3LBX A;  4PJN A;  3HA4 A;  2QGS A;  4TV8 E;  3WAK A;  5DAB A;  4UXN B;  3RC8 A;  1LRZ A;  3C4W A;  5JRC B;  3RPU A;  1WLX A;  4AKL A;  4JEU B;  2CWY A;  1HG2 A;  5FXW A;  3C50 A;  3E08 A;  5JR9 A;  3IF8 B;  3Q5X A;  2LSJ A;  2XQY A;  1Y64 B;  2W63 A;  3BK9 A;  3PUR A;  5LHG B;  2KZ7 B;  1HF8 A;  4C90 A;  5L3C B;  1KNZ A;  2LEH A;  3J7Y q;  3KVA A;  2WAU A;  2LSY A;  3KV6 A;  3LFM A;  4PAG A;  3R6N A;  5CB4 E;  5JR9 B;  3N9Q A;  3E0Z A;  2XAH B;  4TN7 B;  5LGU B;  2XAQ B;  3ONX A;  3RH3 A;  3QK6 A;  3FBZ A;  2KWH A;  2YU1 A;  2ZM2 A;  4YHJ A;  2VAS A;  3C64 A;  1H7C A;  5JQG E;  1FMV A;  4HEA A;  2WMN A;  3AA0 B;  2Y48 B;  5E0O A;  2W0G A;  3KV5 A;  3N9O A;  2L3L A;  3N9N A;  2YU2 A;  5KDM C;  5C8Y E;  2NW7 A;  4DVD A;  2ACX A;  3K8P C;  1LKX A;  5IYZ E;  1IJ6 A;  2CWO A;  3SWH A;  5L3B B;  4CQI A;  2RP4 A;  1U5P A;  2L9Q A;  4ANJ A;  3SRZ A;  3V5S A;  2PJQ A;  4CXX A;  1MMN A;  1B7T A;  2JQQ A;  4ZI2 D;  3K3Q C;  3HKC E;  2C5J A;  3HR0 A;  2V26 A;  2X9W A;  1MIY A;  4H9Q C;  3UUL A;  3LK3 B;  3N9M A;  3ZMT B;  2X9Y A;  2XHE B;  4QX8 B;  5CA1 E;  3MKD A;  1OWA A;  1AJ3 A;  1D1A A;  1HTJ F;  4QXB B;  3L3P A;  4ISS A;  2HH7 A;  4NUV A;  2Q9Q B;  5FXV A;  4OYJ A;  5KMG P;  3T8O A;  2LSG A;  3N9L A;  5LA6 E;  4HN9 A;  1YW0 A;  1KK7 A;  2X68 A;  2A2F X;  1BR2 A;  4JLE A;  3BQL A;  3O4X E;  1IJ5 A;  3GWH A;  4UF0 B;  3S4U A;  1UX5 A;  4DBR A;  3C51 A;  5EK4 A;  2K24 A;  4I50 E;  5LCY A;  4DMW A;  3DJB A;  5HWY A;  1SA0 E;  1D0Z A;  3NZQ A;  3ZC1 A;  4EB6 E;  4GK0 E;  5DJQ C;  5LP6 E;  4AKH A;  2HPL A;  4U74 A;  2UXN B;  2CXD A;  4AI6 A;  1WR6 A;  2BDE A;  2CE7 A;  4TZ4 C;  4AKI A;  2CCQ A;  5LJM A;  4O2B E;  4YLH A;  4WBN E;  1IAP A;  2MYS A;  2IW5 B;  2CLY B;  3UUX B;  3PUA A;  1VOM A;  4F6R C;  1VRB A;  5L2L A;  4ZS3 A;  1WYC A;  3KDS E;  5L3D B;  4ZI2 C;  1MIW A;  2BZB A;  2C5K T;  2UXX B;  2Y6X A;  1YD8 G;  4EYU A;  4PK4 A;  2LHN A;  4AKR B;  2CXF A;  5ETW A;  3N2G E;  2LOP A;  4EIW A;  2BVM A;  4UEL A;  5L3G B;  2DWG A;  2XAJ B;  4QKN A;  2W00 A;  5HXR A;  3BQK A;  2WMO A;  5HWX A;  2V7I A;  4IE7 A;  4IE5 A;  4PK6 A;  4MBQ A;  5JRE A;  2D5U A;  3DTO A;  2NW9 A;  4EYY R;  3N2O A;  4X1K E;  3E22 E;  2K9A A;  4E7Z A;  1SHZ C;  3GN5 A;  3R84 B;  2ODU A;  4G2A A;  2I59 A;  3NRX A;  4ZOL E;  2DLR A;  4G63 A;  2EHO D;  1S94 A;  3ZC0 A;  5AFU L;  3AAI A;  4QX7 B;  3SS1 A;  3ESL A;  4XBF B;  3RKO A;  2X9X A;  3FXD B;  3GN5 B;  4TUY E;  4A56 A;  2GK9 A;  3UT5 E;  2MTQ A;  4IE6 A;  3MZK B;  3ZYK A;  5GON E;  3CX7 B;  3LG7 A;  4X20 E;  2HPJ A;  2JRK A;  3H37 A;  3LBX B;  4QWN B;  1US7 B;  4L5G A;  5FXZ A;  2WBL A;  2DI4 A;  2J1D G;  3WAJ A;  3J9X 1;  2PFV A;  2CEA A;  4U72 A;  1V9D A;  3OBV E;  2IC6 A;  4BAY B;  3ZCJ A;  2ZLY A;  5FXX A;  1MMD A;  4GOU A;  3AA7 B;  2CXL A;  3O9X A;  2E9X D;  4CI3 B;  1G73 A;  4XZC A;  1YKE B;  3NBX X;  3CVR A;  3ZMV B;  5LYJ E;  5LBM A;  3PDY A;  3C4Z A;  2P9B A;  4KBM B;  4GK5 E;  2EHO A;  3UFE A;  4M1P A;  3AVS A;  1ZV4 X;  5LG4 A;  1ZKE A;  4GIW A;  3GMI A;  2PG8 A;  3ZJ1 A;  2D0U A;  2PBI A;  4O4J E;  2EHO C;  1FMW A;  3ETU A;  4H9S E;  4EZH A;  4PJL A;  4EAH A;  3PTR B;  3QUJ A;  4HGA A;  3FHN A;  3ZCI A;  4DMV A;  3OKQ A;  2CA5 A;  4ZS2 A;  4PFO A;  1MNE A;  2ODV A;  4ZI7 E;  3PU3 A;  4OFZ A;  5CA0 E;  3KBU A;  3PUQ A;  3ZN1 B;  3U3I A;  4KP3 C;  3F57 A;  3MXZ A;  3Q2M A;  2VKO A;  3GA8 A;  1FEW A;  4CXY A;  1CUN A;  1HG5 A;  3ZLI A;  1QSD A;  2E9X A;  3LK2 B;  3MK7 C;  3B57 A;  4H63 H;  4UVC B;  5H6Q B;  5ADX L;  5JDH A;  2YK0 A;  2ES0 A;  4I4T E;  3HKB E;  4IE4 A;  4OYK A;  1LVK A;  4YFS A;  5HXH A;  3ETV A;  4ASK A;  5A1L A;  4PJJ A;  2E9X C;  3W15 B;  2NP9 A;  3ZMS B;  5LNK A;  2Y8D A;  3N5L A;  2L8K A;  5FMN A;  2LSI A;  2WM9 A;  4GYR A;  4KMC A;  4Z8X A;  4ADZ A;  4DBQ A;  4H9P C;  3QC9 A;  4C91 A;  2H7V C;  3A5X A;  2A72 A;  4UV8 B;  5JVD E;  3KFW X;  5LBQ B;  1T98 A;  5F8P A;  1IZN B;  1UX4 A;  2Z6E A;  1LVF A;  2XTL A;  3EVY A;  4AQF A;  1D0X A;  1NWM X;  2NW8 A;  3N2K E;  4O4H E;  3P8C D;  4UIG A;  5L3E B;  2ZM0 A;  2H7O A;  2IAK A;  3AA6 B;  4IIJ E;  5LHH B;  4L9I A;  1BR1 A;  4UEM A;  4AQF C;  4BJM A;  3AA1 B;  1D1C A;  1HFA A;  2DWK A;  3NRY A;  3MJX A;  4UVA B;  2XAF B;  1S35 A;  3KBT A;  2X0L B;  3WI3 A;  4I55 E;  3VKH A;  4E7S A;  5JDM A;  4NUU A;  4OK0 A;  4WBO A;  5FY7 A;  3UUN A;  2SPC A;  3VU7 H;  3FBL A;  5FY1 A;  2LM9 A;  2NOX A;  5LGN B;  4PK5 A;  2CLY C;  4H9O C;  3AB3 B;  3ZN0 B;  2KWI B;  4GYS A;  5L3F B;  5H6R B;  3FB2 A;  3UUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...