4K0UA

Pilotin/secretin peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
VPANEQISQLASLVAASKYLRVQCERSDLPDDGTILKTAVNVAVQKGWDTGRYQSLPQLSENLYQGLLKDGTPKATQCSSFNRTMTPFLDAMRTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Lipoprotein OutS
publication title Anatomy of secretin binding to the Dickeya dadantii type II secretion system pilotin.
pubmed doi rcsb
source organism Dickeya dadantii
total genus 36
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4k0uA00
4K0UA 4A56A 3UTKA 3SOLA
chains in the Genus database with same CATH superfamily
1KNRA 4DR7T 2EHOA 5IYZE 5FXZA 3RYFE 4IDNA 1IJ6A 2X0LB 4GYSA 3G06A 5AQVB 3PUZF 2XZEA 4ZI2D 5LBQB 3SFDA 3OVUA 3H3MA 5H6QB 4H9OC 5L4EA 3QB5K 2C0SA 3MXZA 2MYSA 4WW0A 5LNKA 4JUYA 4X65T 3PUXF 1IBKT 5FY1A 4ZI7E 3KVAA 2X0HA 1U5PA 3UU8A 2VQET 2I6HA 3JAEA 3PURA 4ZHQE 1KF6A 1HS7A 4MLKA 1I94T 1LVFA 3RPUA 3V5SA 4DMWA 4YSYA 3ZT6A 1J1JA 2FJBA 3FBZA 2BG9E 2XSAA 4H9QC 5HXRA 2BBHA 2H89A 3AECA 3I9YA 3Q2MA 1XDOA 4IHJE 3TLWA 5DJQC 2M6IA 4KHZF 5C2TA 5CA0E 2P9BA 2M67A 4ISSA 2YK0A 4JYAT 4EIWA 5LOVE 2XQ4A 3BQLA 1E7PA 3UT5E 3EABA 2R6GF 3IF8B 3AA7B 2ZLYA 1WYBA 1N34T 2UUCT 3KINB 2LSGA 4ZI3C 3LK3B 1T7SA 5AQRB 3AB3B 3KFWX 5JDGA 1HNXT 2ZMAA 4OK0A 2W67A 4HWHA 4NUUA 4EEBA 2LHNA 4ERRA 2UU9T 5AQMB 4UVBB 4I50E 2WWUA 5J2TE 1VCSA 1M62A 1KFYA 4DR3T 3Q5DA 2K48A 4OFZA 4Q25A 2Z6EA 5AQHB 4U74A 5JH7E 1UX5A 3DTOA 2DCFA 3LFMA 3ZSTA 5JDMA 1XWMA 3AEDA 1KNZA 3AEAA 4QH1A 5LP6E 4HE8A 3UTKA 2XAJB 4TUYE 1XNQT 1MIVA 2FUPA 5FMNA 4F6RC 3I9WA 4U33A 4ZXLA 4U7IA 3ZT5A 1KK7A 3BQKA 4L0RA 4A98A 2BG9B 4AKRB 4HFHA 5M4YA 3LDQB 5HWXA 2FBWA 2V7IA 5AQQB 2BVMA 5H6RB 5LGUB 4PJMA 3RIAA 2KT9A 1ZP0A 5EK3A 2DHRA 1J5ET 4C91A 3P4QA 4LMKA 2VKDA 2VK9A 3ZMVB 4YLHA 3RX6A 4HTEA 3JCFA 3FXEB 4B3RT 1YQ3A 3F57A 3PE0A 3ESLA 3IBPA 4TWHA 4JI0T 2AE9A 3PUGA 3QB5A 1U4QA 3CQGB 1HFAA 2Y8DA 4IDPA 1B7TA 3HL6A 2IAKA 2PFVA 3TKLB 5LGNB 4IDZA 3ETVA 1MMDA 5CA1E 2PBIA 2IC9A 4JI5T 3EUHA 3RYCE 4B3ST 5JDFA 4O4JE 3ZN1B 3AEBA 2LSJA 2V6YB 4G2AA 2CA5A 3O1IA 2V8SV 1YKEB 3AE8A 4HFBA 1HG5A 2BG9A 1FMVA 4QH5A 4DV6T 3PUWF 2LJLA 2V1DB 2W63A 3KV9A 2BDEA 2FJEA 3ZJ2A 2KXPB 3AE5A 4ZZCA 4JLEA 2JQKA 3R84B 3UUMA 4DIDB 4IIJE 4X5TA 2G0UA 4JI8T 5L3EB 4EOZB 3X1DA 4JEUB 3P7IA 2XQ9A 2WCAA 1QSDA 2FJAA 3RQUA 4C90A 1QLBA 4MHCA 1XMQT 4HFCA 2E8IA 2MPKA 1UUSA 3P4RA 4AQFA 2CXLA 4CN1A 4LF9T 2LRKA 3VKHA 2VKOA 2X9XA 4TV8E 3OTOT 3VR9A 3UUBA 4AXPA 2YDRA 3PUAA 5ABFA 2E9XB 2XHEB 5AFUL 4I4TE 5LBMA 4X20E 3N9QA 5A1LA 1UCUA 5FVLA 3K3QC 4ILBA 3N5LA 3HKBE 4LF8T 3CX8B 5FVKA 5F3JA 2N9DA 3K3NA 4DMVA 5AQGB 1UURA 5ABEA 2HHHT 2Y6XA 3IEEA 1MMAA 3UFGA 4L5GA 3ONLC 3IA3A 5HEOA 5BR8T 2QA7A 1T8BA 5AQOB 5HCMA 2L9QA 3FZMB 2Y48B 2JQHA 1WRDA 5HYAA 5LHHB 4I55E 3ONXA 4HEAA 4MBQA 2K5BB 2E9XA 4PJNA 2LM9A 2XM1A 4PAGA 5L3DB 3AVSA 3AE7A 5CB4E 4LF4T 2YINA 3UQ4A 3FHNA 2DL1A 4CI1B 2YDQA 3K8PC 4U3CA 3LBXB 2XAQB 1UGOA 2XSBA 4JV5T 4U31A 2CBIA 2RPAA 5J2UE 4O2BE 2W4XA 4H9PC 2W2UA 3HKEE 2LRLA 4WNKA 2EHOC 2ODUA 3JAFA 2LSKA 3LJCA 2V7LA 5CGMA 5LA6E 4ADZA 2ODVA 2X0YA 3RH3A 4XZCA 2CHNA 2EHOB 3T1YT 3RRCA 2J4GA 3ZMSB 4YTPA 4X64T 4AKHA 2JMHA 3MZKB 3Q5WA 3KV4A 1OWAA 4NXNT 1BR4A 4QHOA 3AEEA 3FZHB 3T8OA 2J1DG 1UK5A 4HGAA 3LBXA 1FJGT 3MACA 2CCQA 2WY2A 3VR8A 4B3MT 2XASB 4UR9A 2WWVA 2CHOA 2WU5A 4PFPA 3U78A 3GMIA 2ACZA 5JVDE 3RLFF 3CX6B 2NW7A 2E5LT 3C64A 2XM2A 4LF7T 5BMVE 5KX5E 2A72A 4IGUA 3SS1A 3NKZA 2MTQA 1HX8A 3T1HT 3B57A 2WDRA 3N9MA 5E0OA 2VKJA 3I0OA 4PK5A 4JI4T 2VWAA 3N9LA 2K9AA 2NW9A 4GOUA 3AVRA 3A8YC 2CM0A 5FNVE 1YW0A 3V5UA 5JREA 2YDSA 3ZCIA 2HN1A 4CN6A 4ILCA 2BBJA 2C5JA 5AQKB 1S94A 2WBLA 2L8KA 4G63A 4O4LE 4AIUA 1LRZA 1Y64B 1OXZA 2X9WA 1D0YA 1HTJF 3L09A 3RGLA 3EI0A 2HPJA 3M3ZB 3BK9A 1YD8G 3FZKB 2IC6A 3I0QA 4QXHB 3RIUA 1WR6A 3RQWA 2QRXA 4TX5A 3L39A 4YHJA 4PK6A 2W62A 3PV0F 4P1NA 4H63V 5HWYA 2IMLA 3AEFA 4I43B 1G8XA 4Z91A 1R8IA 2WMNA 1GQEA 5KXJA 1HNWT 2JQQA 4LFCT 3L3PA 2LSYA 3SWHA 5HAXA 4ANJA 4GK5E 2QYWA 4KHPT 3KBUA 4TWFA 4IE4A 3N2OA 1OEDB 3C4XA 4YJ2E 2UXNB 3ANWB 1SA0E 2PTFA 5FY0A 4P09A 5LG4A 3RYHE 1N32T 3UU5A 4EV6A 3O1HA 3ZYMA 4HFEA 3RIFA 4DV5T 5FXWA 4IDOA 3U3IA 4JI1T 1SUMB 3P4SA 3P4WA 4ZI3D 5L3FB 4H9NC 1N36T 1BR1A 4NUVA 4X66T 3H37A 5AQNB 2RP4A 4DR4T 2VB6A 2BG9C 3AE4A 4OYJA 3OYXA 1HCIA 2XUEA 2LLYA 4U2YA 2VL0A 3LG7A 4HN9A 4PNIA 1X79A 3H3AA 1G73A 1OEDA 2V5CA 4DV1T 3P4PA 3ANWA 4UEMA 4DR6T 1CHUA 3UFEA 3NWIA 2KINB 1WCRA 5IWAT 2YU1A 4UV9B 4WBNE 3A7MA 5AQIB 4JBWF 3KV5A 2CEAA 4YJ3E 2F4VT 3ZT7A 3E22E 5C3JA 4GKJT 4DUZT 4HWCA 2Q9QC 1H7CA 2H7VC 2XQ3A 4AQFC 5LG3A 4GYRA 4F8HA 3SRZA 5FL0A 4QXCB 3ZMZB 3AE9A 4HFIA 3UUXB 5J0ZA 1KEYA 3CK6A 4UVAB 2V7JA 5EK4A 2Q9QB 4NIQA 4TNVA 4UXNB 5LMNT 2WZHA 3UQ7A 1WFDA 4AQYT 5CFBA 3ZYLA 4UF0B 5AQPB 4DBRA 2CWYA 4YTMA 4QKNA 3QUJA 2MOZA 5ABFB 4IDQA 5JR9B 3L8RA 3UULA 3ABVA 4ISTA 3B13A 1XNRT 3C4ZA 2OLTA 3DJBA 1D0ZA 2JQ9A 3NBXX 4X1KE 4IE5A 5ADXL 4Z8XA 2CE7A 1MIYA 2XQ7A 3RRWA 3P8CD 4B3TT 3CX7B 2K24A 4HFDA 2L3LA 4CXWA 2DWKA 5LHGB 4PJJA 3P50A 3I1AA 4IT4A 1HR0T 4YT0A 2E9XC 2LHRA 2WS3A 2Q9QA 2LOSA 4LMLA 5EK2A 3A5XA 3TLUA 3ZEFB 2IW5B 4UF0A 4ZS2A 3ONJA 5JR9A 4QX7B 5FP3A 1ZEEA 3AE6A 2ZM2A 3JADA 1AJ3A 2VQFT 1D0XA 2C5KT 4LF6T 2BVLA 3LK2B 2YEVC 2X9HA 1M7KA 4AKLA 3OPCA 2V7KA 3PU8A 3O4XE 5FY7A 4K0KT 5HEGA 5LJMA 2N2NA 1NAFA 3FBLA 5CJ5A 1IJ5A 2HPLA 5JDHA 3J9X1 3AAEB 2AXDS 1D1CA 4XBFB 4NPPA 4KI0F 1US7B 2E5VA 3M65A 2VKHA 4TWDA 5KDMC 2IDOB 2JRKA 1O3XA 3UU4A 4CN4A 2DNXA 3ZMTB 3PUYF 5L2LA 2JMKA 3Q5EA 4DV7T 3VHLA 2CLYC 2CXDA 2WB5A 4FJOA 3NRXA 3JC6C 2E2AA 3J7Yq 2X67A 4IL4A 4DR1T 3HKDE 4NXMT 2KSRA 2CLYB 4KMCA 2LE8A 2XQYA 3VU7H 1NEKA 4ASKA 4OHFA 3KBTA 4JI2T 3QC9A 3OJAA 3N2KE 5L3GB 3ZKRA 2CPTA 2LOPA 3TLTA 4E7ZA 5FKYA 2XQ5A 2UXXB 4WBOA 5KMGP 1Z8UA 1IBLT 1QUUA 2W61A 3CMLA 3TLVA 2BS3A 5IUXA 1XMOT 2EHOD 3B5MA 4DV4T 4AI6A 1NWMX 1HG2A 2B76A 2CMRA 4WYVA 2YU2A 4ILAA 2FJDA 5LMUT 2BKPA 2V7MA 4CXXA 4AKGA 3AA0B 5JRCA 4YFSA 3ZYKA 4KP3C 4BJMA 4ZI2C 3PUVF 1FEWA 3RIUC 2CWOA 3PJAA 1YXRA 1IBMT 4N78D 4MFRA 4JEHB 2B1EA 1OEDE 4H63H 4QX8B 2W66A 3N2GE 2ACXA 2NTXA 3PUSA 5IHYA 3Q5XA 3ETUA 1FIOA 2KZ7B 1DU2A 5AQFB 3AAIA 5ETWA 1YQ4A 3C4WA 4IE6A 2X66A 2M6BA 1W9RA 3GA8A 3QOFA 2I59A 1VOMA 2V26A 1XZYA 3HA4A 1YKHB 2XPKA 3AEGA 1L0VA 2PG8A 2CXFA 3MJXA 3RI5A 2NOXA 2A2FX 4IL9A 4EZ4A 1IZNB 4OYKA 4O4IE 2XAGB 4P0AA 2WDVA 3FZFB 3NZQA 4GKKT 3C98B 3E0ZA 3ZC0A 4AQGA 1V9DA 2W00A 3UUNA 3CIRA 4UELA 3EDVA 3FB2A 4CI3B 5ABGA 5JDQA 2VVNA 4DV3T 5J1GA 2H7OA 3AA6B 5JTGA 5LHIB 2ZM8A 3CKDA 2IHR1 2MAWA 2N1GA 4ZS3A 2DI4A 2OV9A 1JNRA 4J2CA 5HEUA 1BR0A 1CUNA 3QK6A 4BJNA 4DV2T 1MIWA 2D2SA 3RYIE 5HCJA 3UU3A 1Z0PA 1OEDC 4JI6T 2VASA 2WZIA 2J62A 4CZZB 4EAHA 2LM2A 2VURA 4IREA 2C5IT 3OYZA 2WMOA 2XQ8A 1VCTA 2XAFB 3AAAB 3VRAA 5JDNA 1E2AA 2D0UA 4AISA 4CXYA 1JNZA 2LEHA 4GIWA 4X62T 3ZCJA 1MNDA 1E1HB 3FXDB 2BS2A 2GK9A 5HXCA 4X1IE 1MNEA 4O8SA 4QWNB 3N9PA 1FMWA 4KUMB 5FYMA 3F31A 5FL1A 4EGWA 2XJ7A 2D9DA 1ZOYA 2HH7A 2LKHA 5ABHA 2D0TA 3AE2A 2YN6A 3K1SA 4HKAA 3OKQA 2BKNA 2LT3A 3KDSE 1LKXA 4EB6E 4PJLA 4DVDA 3RF1A 5LB7B 4JI3T 4EYYR 2UUAT 3GN5B 4WZXA 3SOLA 1XDPA 3ZPOA 2ZM6T 2CRBA 2WP9A 4DV0T 1W0AA 3UU6A 2NTYA 2QGSA 3C50A 3PDYA 5LYJE 3RC3A 2J47A 1ZV4X 3ZSSA 2BZBA 3EVYA 2VVSA 1N33T 5JR9C 3S4UA 2WDQA 4OX9T 4CQIA 1NENA 5DQWA 4DR2T 2KWHA 3K3OA 1LVKA 2NR4A 3ZC1A 4HWIB 3RKOA 4PW8A 2NP9A 3ZN0B 1D1BA 4K0UA 4PFOA 5L47A 3D0TA 5AQTB 2X51A 4EZHA 2BKOA 2Q9QD 4UIGA 4KX6A 1EZ3A 2PJQA 3GN5A 4P0BA 2XTLA 1HNZT 4ZZBA 2LKGA 3DP7A 3MK7C 4V1Av 3ZMUB 2DWGA 4I0UA 2V5DA 2XAHB 1WR0A 4MALA 1HF8A 1SHZC 4CI2B 3PJAJ 4BA9A 4LFAT 2ZM0A 2I0MA 2W0GA 3NZPA 4DUYT 4A5XA 3F2EA 3E08A 2JIWA 2WAUA 2KNDA 2IIUA 3BQIA 2VL8A 3LK42 2XQAA 3HR0A 4M1PA 2V6YA 5AQUB 3KV6A 1UX4A 3VRBA 1J5WA 4EYUA 4U2ZA 5L3BB 2SPCA 3WAJA 3AE3A 3ZLIA 1ZKEA 3MA9A 5FXVA 2OA5A 2XQ6A 3CQXC 3GWHA 4LMJA 4HWFA 3N9NA 2E9XD 3EHZA 3RC8A 3AA1B 4DBQA 5GONE 1BR2A 2UXBT 3CVRA 5LJNA 4ZEYA 4YSZA 3OBVE 5HEJA 4X1YE 3WI3A 4YHHT 4B6XA 4HFVA 2H3RA 4LF5T 5JQGE 3ZJ1A 1ZHCA 4LFBT 5HEHA 1MMNA 2JPFA 3KVBA 1S35A 4YY3T 2IUBA 4IE7A 2HN2A 1D1AA 2K3WA 4EEDA 4H9RC 4DO0A 2X9YA 3N9OA 1W0BA 4ZOLE 3LSVA 2UXCT 5HXEA 2BS4A 2KMFA 1X9BA 5EZYE 2NW8A 2WU2A 3O9XA 2MBGA 2XY8B 3NVOA 4YTNA 2UUBT 5L4HA 3MKDA 3PTRB 2CBJA 4A97A 3WAKA 2ES0A 4YXDA 2A9UA 4Z90A 2KWIB 5HXHA 2YKSA 1T72A 2QVAA 2KLQA 3SFEA 2RA1A 2WM9A 3TLSA 4UVCB 5FXXA 4U7YA 4E7SA 2JJ9A 5JDLA 2WSSV 4HWDA 2NWBA 4COFA 4YSXA 2DLRA 4DNDA 4JI7T 3C51A 4TN7B 5AQJB 3RHWA 2UXDT 5DQVA 5JRCB 4XAXB 3EDUA 5TAOA 5LCYA 4QH4A 4UV8B 1WYCA 1SE7A 3W15B 3AXJB 4TNWA 3FZLB 3HKCE 3AE1A 1VRBA 5F8PA 4L9IA 2LSIA 4U72A 1KNPA 3JC6D 3PUQA 2D5UA 4H9SE 4O4HE 1Y01A 3CPZA 2WQYA 4FI5A 1HX1B 1I6ZA 5AQSB 3PU3A 5HXSA 5LXTE 4ILUA 4A56A 5L3CB 4TZ4C 3EAMA 3R6NA 2H88A 3NRYA 3RKGA 4TV9E 5AQLB 3CWZB 1T98A 3VKGA 5F5WA 3QNUA 1IAPA 1WLXA 3IHRA 4PK4A 1MMGA 3CQCB 4QXBB 4BAYB 4GK0E 3HI2A 4DR5T 4AKIA 3AXJA 2YOEA 3Q9DA 2V6XA 4KBMB 5DABA 3O1JA 4EXTA 2X68A 2A3DA 5C8YE 1W09A 4IE0A 5LGTB 4O2AE
chains in the Genus database with same CATH topology
3DJBA 4PAGA 1D0ZA 3NBXX 5L3DB 2EHOA 4X1KE 5IYZE 5FXZA 3RYFE 4IE5A 5ADXL 3AVSA 3FXDB 4Z8XA 5CB4E 1IJ6A 1MIYA 2CE7A 2X0LB 4GYSA 2YINA 3RRWA 3P8CD 4ZI2D 3FHNA 2GK9A 3CX7B 5HXCA 5LBQB 4X1IE 1MNEA 2K24A 4CI1B 4O8SA 4QWNB 3K8PC 2L3LA 5H6QB 4H9OC 4CXWA 3LBXB 3N9PA 2DWKA 2XAQB 1FMWA 2C0SA 3MXZA 2MYSA 5LHGB 4WW0A 5J2UE 4O2BE 5LNKA 4JUYA 4KUMB 4PJJA 4H9PC 3I1AA 5FYMA 3F31A 5FY1A 4ZI7E 2E9XC 3HKEE 3KVAA 2LHRA 2Q9QA 1U5PA 2LOSA 2HH7A 4WNKA 5EK2A 2EHOC 2ODUA 3A5XA 3PURA 2D0TA 3ZEFB 2IW5B 4UF0A 2LSKA 4ZHQE 1HS7A 4HKAA 3LJCA 2V7LA 3OKQA 4MLKA 4ZS2A 2LT3A 5LA6E 4ADZA 3KDSE 5JR9A 1LKXA 1LVFA 4QX7B 3RPUA 3V5SA 5FP3A 4DMWA 2ODVA 4EB6E 1ZEEA 3RH3A 4PJLA 4XZCA 2ZM2A 4DVDA 1AJ3A 2EHOB 3FBZA 5HXRA 3RRCA 4H9QC 1D0XA 2C5KT 4EYYR 3GN5B 3ZMSB 3I9YA 2BVLA 3SOLA 3Q2MA 3LK2B 3ZPOA 4IHJE 4AKHA 2YEVC 2X9HA 5DJQC 4AKLA 2JMHA 3MZKB 3Q5WA 2V7KA 3PU8A 3KV4A 2NTYA 2QGSA 1OWAA 3C50A 3O4XE 5FY7A 5CA0E 3PDYA 2P9BA 2M67A 5LYJE 1BR4A 4QHOA 3RC3A 4ISSA 2YK0A 1ZV4X 3T8OA 2J1DG 4EIWA 5LOVE 4HGAA 3LBXA 3BQLA 5LJMA 2N2NA 2BZBA 1NAFA 3EVYA 3UT5E 3FBLA 3MACA 3IF8B 2CCQA 3AA7B 5JR9C 2ZLYA 3S4UA 1IJ5A 2HPLA 1WYBA 4CQIA 5DQWA 2XASB 5JDHA 2KWHA 3J9X1 3K3OA 3KINB 1LVKA 3AAEB 1D1CA 2LSGA 4PFPA 3U78A 3ZC1A 4XBFB 3GMIA 4ZI3C 3LK3B 5JVDE 1US7B 3AB3B 3M65A 3RKOA 4PW8A 2NP9A 2NW7A 2VKHA 3CX6B 3KFWX 5JDGA 3ZN0B 1D1BA 4K0UA 4PFOA 3C64A 3D0TA 2X51A 2ZMAA 4OK0A 5KDMC 4EZHA 2Q9QD 2JRKA 4UIGA 5BMVE 1EZ3A 1O3XA 2PJQA 5KX5E 2DNXA 4NUUA 2LHNA 4ERRA 2A72A 3GN5A 4IGUA 3ZMTB 5L2LA 3SS1A 2JMKA 4P0BA 4UVBB 4I50E 2XTLA 2MTQA 1HX8A 3DP7A 3MK7C 4V1Av 3ZMUB 3VHLA 2DWGA 3B57A 2WWUA 2CLYC 5J2TE 3N9MA 5E0OA 2VKJA 2CXDA 2XAHB 3I0OA 4FJOA 4MALA 1HF8A 1SHZC 2K48A 3NRXA 4OFZA 4CI2B 4PK5A 2Z6EA 3JC6C 3J7Yq 2X67A 4U74A 5JH7E 1UX5A 3DTOA 2VWAA 4BA9A 3N9LA 2K9AA 3HKDE 2DCFA 2NW9A 4GOUA 2ZM0A 3LFMA 3AVRA 2W0GA 3NZPA 5JDMA 2CLYB 4KMCA 2LE8A 2CM0A 3F2EA 2XQYA 5FNVE 3E08A 3VU7H 1YW0A 1KNZA 3V5UA 4ASKA 5JREA 2WAUA 5LP6E 4OHFA 3KBTA 3ZCIA 2KNDA 3QC9A 4HE8A 3UTKA 3BQIA 2XAJB 3OJAA 2VL8A 4TUYE 2C5JA 3LK42 3HR0A 1MIVA 1S94A 3N2KE 2WBLA 4M1PA 5FMNA 4F6RC 3I9WA 2L8KA 4G63A 4O4LE 1LRZA 1Y64B 1KK7A 3KV6A 1UX4A 1OXZA 3BQKA 4L0RA 5L3GB 4EYUA 2X9WA 2LOPA 4E7ZA 4AKRB 5L3BB 1D0YA 1HTJF 3L09A 5M4YA 2UXXB 5HWXA 4WBOA 2HPJA 2V7IA 2SPCA 5KMGP 2BVMA 3BK9A 3WAJA 1YD8G 3ZLIA 1ZKEA 5H6RB 3MA9A 5LGUB 4PJMA 5FXVA 2IC6A 1QUUA 2OA5A 3CQXC 2KT9A 3I0QA 3GWHA 4QXHB 3N9NA 5EK3A 2E9XD 1WR6A 2W61A 2DHRA 3RC8A 3CMLA 3AA1B 4DBQA 4C91A 5GONE 1BR2A 2EHOD 2VK9A 2VKDA 3CVRA 4TX5A 4YLHA 3RX6A 3ZMVB 4HTEA 5LJNA 3FXEB 3OBVE 4YHJA 4PK6A 4AI6A 1NWMX 1HG2A 2W62A 3ESLA 3F57A 3IBPA 3PE0A 4X1YE 4H63V 3WI3A 2CMRA 3PUGA 5HWYA 4B6XA 4HFVA 4I43B 2YU2A 1U4QA 1G8XA 2H3RA 3CQGB 5JQGE 1HFAA 2Y8DA 1ZHCA 3ZJ1A 1B7TA 2WMNA 1MMNA 2JPFA 2IAKA 3HL6A 2PFVA 2V7MA 3TKLB 3KVBA 1S35A 2JQQA 5LGNB 4IDZA 4CXXA 3ETVA 1MMDA 4IE7A 2PBIA 5CA1E 2IC9A 1D1AA 4AKGA 4H9RC 3AA0B 3L3PA 2X9YA 3EUHA 3RYCE 4DO0A 2LSYA 3N9OA 3SWHA 4YFSA 4ZOLE 3ZYKA 5JDFA 4O4JE 4KP3C 3ZN1B 4BJMA 4ZI2C 2LSJA 4G2AA 5HXEA 2CA5A 5HAXA 2KMFA 4ANJA 5EZYE 1FEWA 3O1IA 4GK5E 2NW8A 3O9XA 1YKEB 3KBUA 2MBGA 2CWOA 4IE4A 3N2OA 4N78D 4MFRA 4JEHB 2B1EA 3MKDA 1HG5A 3C4XA 3PTRB 1FMVA 4YJ2E 2UXNB 3ANWB 4H63H 1SA0E 4QX8B 2ES0A 3WAKA 3N2GE 2LJLA 2ACXA 2V1DB 5FY0A 2NTXA 4P09A 5LG4A 2KWIB 3PUSA 5HXHA 3RYHE 2W63A 5IHYA 2KLQA 3O1HA 3KV9A 3ZYMA 2BDEA 2RA1A 3Q5XA 2WM9A 3ETUA 3ZJ2A 1FIOA 2KZ7B 5FXWA 2KXPB 4UVCB 5FXXA 4E7SA 3AAIA 3U3IA 5ETWA 2JJ9A 3C4WA 4JLEA 4ZI3D 5JDLA 5L3FB 4H9NC 2WSSV 4IE6A 2X66A 3R84B 1BR1A 4NUVA 2NWBA 3UUMA 3GA8A 2DLRA 4IIJE 4DNDA 3C51A 3H37A 2G0UA 2RP4A 2I59A 1VOMA 2V26A 4TN7B 3HA4A 5L3EB 4EOZB 2VB6A 4OYJA 4JEUB 3OYXA 1YKHB 5DQVA 5JRCB 3P7IA 4XAXB 3EDUA 2PG8A 1HCIA 2CXFA 2XUEA 5TAOA 1QSDA 5LCYA 3MJXA 4C90A 2NOXA 4MHCA 4UV8B 2A2FX 1WYCA 3LG7A 4HN9A 4PNIA 2E8IA 3W15B 1X79A 3H3AA 4EZ4A 1IZNB 4OYKA 4O4IE 3HKCE 4AQFA 2CXLA 1VRBA 2XAGB 4P0AA 5F8PA 3NZQA 1G73A 4L9IA 3VKHA 2VKOA 2LSIA 2X9XA 4TV8E 4U72A 3C98B 3E0ZA 3JC6D 3PUQA 4AXPA 3ZC0A 2D5UA 3ANWA 4UEMA 4AQGA 1V9DA 2W00A 4H9SE 3PUAA 3UUNA 4UELA 2E9XB 4O4HE 3EDVA 2XHEB 3UFEA 3FB2A 4CI3B 5AFUL 5JRCA 5JDQA 4I4TE 2KINB 3CPZA 5J1GA 5LBMA 2H7OA 3AA6B 2YU1A 5LHIB 2ZM8A 4UV9B 4FI5A 3N9QA 4X20E 5A1LA 3CKDA 1UCUA 4WBNE 2N1GA 4ZS3A 2DI4A 3KV5A 2CEAA 3PU3A 4YJ3E 5HXSA 5LXTE 4J2CA 4ILUA 4A56A 3E22E 3K3QC 5L3CB 3N5LA 3HKBE 4TZ4C 1BR0A 1CUNA 3QK6A 3CX8B 3R6NA 4BJNA 2Q9QC 1MIWA 2D2SA 5F3JA 1H7CA 2N9DA 3K3NA 3RYIE 2H7VC 3NRYA 4AQFC 4DMVA 4GYRA 4TV9E 3CWZB 1T98A 2Y6XA 3IEEA 3SRZA 3VKGA 4QXCB 1MMAA 1Z0PA 3ZMZB 4L5GA 3UUXB 1IAPA 2VASA 4UVAB 2V7JA 5EK4A 1WLXA 3IHRA 2QA7A 4CZZB 4PK4A 2Q9QB 4EAHA 1MMGA 3CQCB 4QXBB 4UXNB 4BAYB 4GK0E 2C5IT 3HI2A 3OYZA 4AKIA 3Q9DA 3ZYLA 2WMOA 2L9QA 4KBMB 4UF0B 2Y48B 4DBRA 2CWYA 1WRDA 5HYAA 5LHHB 2XAFB 3AAAB 4I55E 4QKNA 5JDNA 3QUJA 2MOZA 5JR9B 5DABA 3ONXA 3O1JA 3UULA 4EXTA 4HEAA 4MBQA 2K5BB 2X68A 2D0UA 2A3DA 4ISTA 4CXYA 2E9XA 5C8YE 4PJNA 2LEHA 4GIWA 3B13A 4IE0A 3ZCJA 3C4ZA 5LGTB 1MNDA 2LM9A 4O2AE 1E1HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0U A;  4A56 A;  3UTK A;  3SOL A; 
#chains in the Genus database with same CATH topology
 1KNR A;  4DR7 T;  2EHO A;  5IYZ E;  5FXZ A;  3RYF E;  4IDN A;  1IJ6 A;  2X0L B;  4GYS A;  3G06 A;  5AQV B;  3PUZ F;  2XZE A;  4ZI2 D;  5LBQ B;  3SFD A;  3OVU A;  3H3M A;  5H6Q B;  4H9O C;  5L4E A;  3QB5 K;  2C0S A;  3MXZ A;  2MYS A;  4WW0 A;  5LNK A;  4JUY A;  4X65 T;  3PUX F;  1IBK T;  5FY1 A;  4ZI7 E;  3KVA A;  2X0H A;  1U5P A;  3UU8 A;  2VQE T;  2I6H A;  3JAE A;  3PUR A;  4ZHQ E;  1KF6 A;  1HS7 A;  4MLK A;  1I94 T;  1LVF A;  3RPU A;  3V5S A;  4DMW A;  4YSY A;  3ZT6 A;  1J1J A;  2FJB A;  3FBZ A;  2BG9 E;  2XSA A;  4H9Q C;  5HXR A;  2BBH A;  2H89 A;  3AEC A;  3I9Y A;  3Q2M A;  1XDO A;  4IHJ E;  3TLW A;  5DJQ C;  2M6I A;  4KHZ F;  5C2T A;  5CA0 E;  2P9B A;  2M67 A;  4ISS A;  2YK0 A;  4JYA T;  4EIW A;  5LOV E;  2XQ4 A;  3BQL A;  1E7P A;  3UT5 E;  3EAB A;  2R6G F;  3IF8 B;  3AA7 B;  2ZLY A;  1WYB A;  1N34 T;  2UUC T;  3KIN B;  2LSG A;  4ZI3 C;  3LK3 B;  1T7S A;  5AQR B;  3AB3 B;  3KFW X;  5JDG A;  1HNX T;  2ZMA A;  4OK0 A;  2W67 A;  4HWH A;  4NUU A;  4EEB A;  2LHN A;  4ERR A;  2UU9 T;  5AQM B;  4UVB B;  4I50 E;  2WWU A;  5J2T E;  1VCS A;  1M62 A;  1KFY A;  4DR3 T;  3Q5D A;  2K48 A;  4OFZ A;  4Q25 A;  2Z6E A;  5AQH B;  4U74 A;  5JH7 E;  1UX5 A;  3DTO A;  2DCF A;  3LFM A;  3ZST A;  5JDM A;  1XWM A;  3AED A;  1KNZ A;  3AEA A;  4QH1 A;  5LP6 E;  4HE8 A;  3UTK A;  2XAJ B;  4TUY E;  1XNQ T;  1MIV A;  2FUP A;  5FMN A;  4F6R C;  3I9W A;  4U33 A;  4ZXL A;  4U7I A;  3ZT5 A;  1KK7 A;  3BQK A;  4L0R A;  4A98 A;  2BG9 B;  4AKR B;  4HFH A;  5M4Y A;  3LDQ B;  5HWX A;  2FBW A;  2V7I A;  5AQQ B;  2BVM A;  5H6R B;  5LGU B;  4PJM A;  3RIA A;  2KT9 A;  1ZP0 A;  5EK3 A;  2DHR A;  1J5E T;  4C91 A;  3P4Q A;  4LMK A;  2VKD A;  2VK9 A;  3ZMV B;  4YLH A;  3RX6 A;  4HTE A;  3JCF A;  3FXE B;  4B3R T;  1YQ3 A;  3F57 A;  3PE0 A;  3ESL A;  3IBP A;  4TWH A;  4JI0 T;  2AE9 A;  3PUG A;  3QB5 A;  1U4Q A;  3CQG B;  1HFA A;  2Y8D A;  4IDP A;  1B7T A;  3HL6 A;  2IAK A;  2PFV A;  3TKL B;  5LGN B;  4IDZ A;  3ETV A;  1MMD A;  5CA1 E;  2PBI A;  2IC9 A;  4JI5 T;  3EUH A;  3RYC E;  4B3S T;  5JDF A;  4O4J E;  3ZN1 B;  3AEB A;  2LSJ A;  2V6Y B;  4G2A A;  2CA5 A;  3O1I A;  2V8S V;  1YKE B;  3AE8 A;  4HFB A;  1HG5 A;  2BG9 A;  1FMV A;  4QH5 A;  4DV6 T;  3PUW F;  2LJL A;  2V1D B;  2W63 A;  3KV9 A;  2BDE A;  2FJE A;  3ZJ2 A;  2KXP B;  3AE5 A;  4ZZC A;  4JLE A;  2JQK A;  3R84 B;  3UUM A;  4DID B;  4IIJ E;  4X5T A;  2G0U A;  4JI8 T;  5L3E B;  4EOZ B;  3X1D A;  4JEU B;  3P7I A;  2XQ9 A;  2WCA A;  1QSD A;  2FJA A;  3RQU A;  4C90 A;  1QLB A;  4MHC A;  1XMQ T;  4HFC A;  2E8I A;  2MPK A;  1UUS A;  3P4R A;  4AQF A;  2CXL A;  4CN1 A;  4LF9 T;  2LRK A;  3VKH A;  2VKO A;  2X9X A;  4TV8 E;  3OTO T;  3VR9 A;  3UUB A;  4AXP A;  2YDR A;  3PUA A;  5ABF A;  2E9X B;  2XHE B;  5AFU L;  4I4T E;  5LBM A;  4X20 E;  3N9Q A;  5A1L A;  1UCU A;  5FVL A;  3K3Q C;  4ILB A;  3N5L A;  3HKB E;  4LF8 T;  3CX8 B;  5FVK A;  5F3J A;  2N9D A;  3K3N A;  4DMV A;  5AQG B;  1UUR A;  5ABE A;  2HHH T;  2Y6X A;  3IEE A;  1MMA A;  3UFG A;  4L5G A;  3ONL C;  3IA3 A;  5HEO A;  5BR8 T;  2QA7 A;  1T8B A;  5AQO B;  5HCM A;  2L9Q A;  3FZM B;  2Y48 B;  2JQH A;  1WRD A;  5HYA A;  5LHH B;  4I55 E;  3ONX A;  4HEA A;  4MBQ A;  2K5B B;  2E9X A;  4PJN A;  2LM9 A;  2XM1 A;  4PAG A;  5L3D B;  3AVS A;  3AE7 A;  5CB4 E;  4LF4 T;  2YIN A;  3UQ4 A;  3FHN A;  2DL1 A;  4CI1 B;  2YDQ A;  3K8P C;  4U3C A;  3LBX B;  2XAQ B;  1UGO A;  2XSB A;  4JV5 T;  4U31 A;  2CBI A;  2RPA A;  5J2U E;  4O2B E;  2W4X A;  4H9P C;  2W2U A;  3HKE E;  2LRL A;  4WNK A;  2EHO C;  2ODU A;  3JAF A;  2LSK A;  3LJC A;  2V7L A;  5CGM A;  5LA6 E;  4ADZ A;  2ODV A;  2X0Y A;  3RH3 A;  4XZC A;  2CHN A;  2EHO B;  3T1Y T;  3RRC A;  2J4G A;  3ZMS B;  4YTP A;  4X64 T;  4AKH A;  2JMH A;  3MZK B;  3Q5W A;  3KV4 A;  1OWA A;  4NXN T;  1BR4 A;  4QHO A;  3AEE A;  3FZH B;  3T8O A;  2J1D G;  1UK5 A;  4HGA A;  3LBX A;  1FJG T;  3MAC A;  2CCQ A;  2WY2 A;  3VR8 A;  4B3M T;  2XAS B;  4UR9 A;  2WWV A;  2CHO A;  2WU5 A;  4PFP A;  3U78 A;  3GMI A;  2ACZ A;  5JVD E;  3RLF F;  3CX6 B;  2NW7 A;  2E5L T;  3C64 A;  2XM2 A;  4LF7 T;  5BMV E;  5KX5 E;  2A72 A;  4IGU A;  3SS1 A;  3NKZ A;  2MTQ A;  1HX8 A;  3T1H T;  3B57 A;  2WDR A;  3N9M A;  5E0O A;  2VKJ A;  3I0O A;  4PK5 A;  4JI4 T;  2VWA A;  3N9L A;  2K9A A;  2NW9 A;  4GOU A;  3AVR A;  3A8Y C;  2CM0 A;  5FNV E;  1YW0 A;  3V5U A;  5JRE A;  2YDS A;  3ZCI A;  2HN1 A;  4CN6 A;  4ILC A;  2BBJ A;  2C5J A;  5AQK B;  1S94 A;  2WBL A;  2L8K A;  4G63 A;  4O4L E;  4AIU A;  1LRZ A;  1Y64 B;  1OXZ A;  2X9W A;  1D0Y A;  1HTJ F;  3L09 A;  3RGL A;  3EI0 A;  2HPJ A;  3M3Z B;  3BK9 A;  1YD8 G;  3FZK B;  2IC6 A;  3I0Q A;  4QXH B;  3RIU A;  1WR6 A;  3RQW A;  2QRX A;  4TX5 A;  3L39 A;  4YHJ A;  4PK6 A;  2W62 A;  3PV0 F;  4P1N A;  4H63 V;  5HWY A;  2IML A;  3AEF A;  4I43 B;  1G8X A;  4Z91 A;  1R8I A;  2WMN A;  1GQE A;  5KXJ A;  1HNW T;  2JQQ A;  4LFC T;  3L3P A;  2LSY A;  3SWH A;  5HAX A;  4ANJ A;  4GK5 E;  2QYW A;  4KHP T;  3KBU A;  4TWF A;  4IE4 A;  3N2O A;  1OED B;  3C4X A;  4YJ2 E;  2UXN B;  3ANW B;  1SA0 E;  2PTF A;  5FY0 A;  4P09 A;  5LG4 A;  3RYH E;  1N32 T;  3UU5 A;  4EV6 A;  3O1H A;  3ZYM A;  4HFE A;  3RIF A;  4DV5 T;  5FXW A;  4IDO A;  3U3I A;  4JI1 T;  1SUM B;  3P4S A;  3P4W A;  4ZI3 D;  5L3F B;  4H9N C;  1N36 T;  1BR1 A;  4NUV A;  4X66 T;  3H37 A;  5AQN B;  2RP4 A;  4DR4 T;  2VB6 A;  2BG9 C;  3AE4 A;  4OYJ A;  3OYX A;  1HCI A;  2XUE A;  2LLY A;  4U2Y A;  2VL0 A;  3LG7 A;  4HN9 A;  4PNI A;  1X79 A;  3H3A A;  1G73 A;  1OED A;  2V5C A;  4DV1 T;  3P4P A;  3ANW A;  4UEM A;  4DR6 T;  1CHU A;  3UFE A;  3NWI A;  2KIN B;  1WCR A;  5IWA T;  2YU1 A;  4UV9 B;  4WBN E;  3A7M A;  5AQI B;  4JBW F;  3KV5 A;  2CEA A;  4YJ3 E;  2F4V T;  3ZT7 A;  3E22 E;  5C3J A;  4GKJ T;  4DUZ T;  4HWC A;  2Q9Q C;  1H7C A;  2H7V C;  2XQ3 A;  4AQF C;  5LG3 A;  4GYR A;  4F8H A;  3SRZ A;  5FL0 A;  4QXC B;  3ZMZ B;  3AE9 A;  4HFI A;  3UUX B;  5J0Z A;  1KEY A;  3CK6 A;  4UVA B;  2V7J A;  5EK4 A;  2Q9Q B;  4NIQ A;  4TNV A;  4UXN B;  5LMN T;  2WZH A;  3UQ7 A;  1WFD A;  4AQY T;  5CFB A;  3ZYL A;  4UF0 B;  5AQP B;  4DBR A;  2CWY A;  4YTM A;  4QKN A;  3QUJ A;  2MOZ A;  5ABF B;  4IDQ A;  5JR9 B;  3L8R A;  3UUL A;  3ABV A;  4IST A;  3B13 A;  1XNR T;  3C4Z A;  2OLT A;  3DJB A;  1D0Z A;  2JQ9 A;  3NBX X;  4X1K E;  4IE5 A;  5ADX L;  4Z8X A;  2CE7 A;  1MIY A;  2XQ7 A;  3RRW A;  3P8C D;  4B3T T;  3CX7 B;  2K24 A;  4HFD A;  2L3L A;  4CXW A;  2DWK A;  5LHG B;  4PJJ A;  3P50 A;  3I1A A;  4IT4 A;  1HR0 T;  4YT0 A;  2E9X C;  2LHR A;  2WS3 A;  2Q9Q A;  2LOS A;  4LML A;  5EK2 A;  3A5X A;  3TLU A;  3ZEF B;  2IW5 B;  4UF0 A;  4ZS2 A;  3ONJ A;  5JR9 A;  4QX7 B;  5FP3 A;  1ZEE A;  3AE6 A;  2ZM2 A;  3JAD A;  1AJ3 A;  2VQF T;  1D0X A;  2C5K T;  4LF6 T;  2BVL A;  3LK2 B;  2YEV C;  2X9H A;  1M7K A;  4AKL A;  3OPC A;  2V7K A;  3PU8 A;  3O4X E;  5FY7 A;  4K0K T;  5HEG A;  5LJM A;  2N2N A;  1NAF A;  3FBL A;  5CJ5 A;  1IJ5 A;  2HPL A;  5JDH A;  3J9X 1;  3AAE B;  2AXD S;  1D1C A;  4XBF B;  4NPP A;  4KI0 F;  1US7 B;  2E5V A;  3M65 A;  2VKH A;  4TWD A;  5KDM C;  2IDO B;  2JRK A;  1O3X A;  3UU4 A;  4CN4 A;  2DNX A;  3ZMT B;  3PUY F;  5L2L A;  2JMK A;  3Q5E A;  4DV7 T;  3VHL A;  2CLY C;  2CXD A;  2WB5 A;  4FJO A;  3NRX A;  3JC6 C;  2E2A A;  3J7Y q;  2X67 A;  4IL4 A;  4DR1 T;  3HKD E;  4NXM T;  2KSR A;  2CLY B;  4KMC A;  2LE8 A;  2XQY A;  3VU7 H;  1NEK A;  4ASK A;  4OHF A;  3KBT A;  4JI2 T;  3QC9 A;  3OJA A;  3N2K E;  5L3G B;  3ZKR A;  2CPT A;  2LOP A;  3TLT A;  4E7Z A;  5FKY A;  2XQ5 A;  2UXX B;  4WBO A;  5KMG P;  1Z8U A;  1IBL T;  1QUU A;  2W61 A;  3CML A;  3TLV A;  2BS3 A;  5IUX A;  1XMO T;  2EHO D;  3B5M A;  4DV4 T;  4AI6 A;  1NWM X;  1HG2 A;  2B76 A;  2CMR A;  4WYV A;  2YU2 A;  4ILA A;  2FJD A;  5LMU T;  2BKP A;  2V7M A;  4CXX A;  4AKG A;  3AA0 B;  5JRC A;  4YFS A;  3ZYK A;  4KP3 C;  4BJM A;  4ZI2 C;  3PUV F;  1FEW A;  3RIU C;  2CWO A;  3PJA A;  1YXR A;  1IBM T;  4N78 D;  4MFR A;  4JEH B;  2B1E A;  1OED E;  4H63 H;  4QX8 B;  2W66 A;  3N2G E;  2ACX A;  2NTX A;  3PUS A;  5IHY A;  3Q5X A;  3ETU A;  1FIO A;  2KZ7 B;  1DU2 A;  5AQF B;  3AAI A;  5ETW A;  1YQ4 A;  3C4W A;  4IE6 A;  2X66 A;  2M6B A;  1W9R A;  3GA8 A;  3QOF A;  2I59 A;  1VOM A;  2V26 A;  1XZY A;  3HA4 A;  1YKH B;  2XPK A;  3AEG A;  1L0V A;  2PG8 A;  2CXF A;  3MJX A;  3RI5 A;  2NOX A;  2A2F X;  4IL9 A;  4EZ4 A;  1IZN B;  4OYK A;  4O4I E;  2XAG B;  4P0A A;  2WDV A;  3FZF B;  3NZQ A;  4GKK T;  3C98 B;  3E0Z A;  3ZC0 A;  4AQG A;  1V9D A;  2W00 A;  3UUN A;  3CIR A;  4UEL A;  3EDV A;  3FB2 A;  4CI3 B;  5ABG A;  5JDQ A;  2VVN A;  4DV3 T;  5J1G A;  2H7O A;  3AA6 B;  5JTG A;  5LHI B;  2ZM8 A;  3CKD A;  2IHR 1;  2MAW A;  2N1G A;  4ZS3 A;  2DI4 A;  2OV9 A;  1JNR A;  4J2C A;  5HEU A;  1BR0 A;  1CUN A;  3QK6 A;  4BJN A;  4DV2 T;  1MIW A;  2D2S A;  3RYI E;  5HCJ A;  3UU3 A;  1Z0P A;  1OED C;  4JI6 T;  2VAS A;  2WZI A;  2J62 A;  4CZZ B;  4EAH A;  2LM2 A;  2VUR A;  4IRE A;  2C5I T;  3OYZ A;  2WMO A;  2XQ8 A;  1VCT A;  2XAF B;  3AAA B;  3VRA A;  5JDN A;  1E2A A;  2D0U A;  4AIS A;  4CXY A;  1JNZ A;  2LEH A;  4GIW A;  4X62 T;  3ZCJ A;  1MND A;  1E1H B;  3FXD B;  2BS2 A;  2GK9 A;  5HXC A;  4X1I E;  1MNE A;  4O8S A;  4QWN B;  3N9P A;  1FMW A;  4KUM B;  5FYM A;  3F31 A;  5FL1 A;  4EGW A;  2XJ7 A;  2D9D A;  1ZOY A;  2HH7 A;  2LKH A;  5ABH A;  2D0T A;  3AE2 A;  2YN6 A;  3K1S A;  4HKA A;  3OKQ A;  2BKN A;  2LT3 A;  3KDS E;  1LKX A;  4EB6 E;  4PJL A;  4DVD A;  3RF1 A;  5LB7 B;  4JI3 T;  4EYY R;  2UUA T;  3GN5 B;  4WZX A;  3SOL A;  1XDP A;  3ZPO A;  2ZM6 T;  2CRB A;  2WP9 A;  4DV0 T;  1W0A A;  3UU6 A;  2NTY A;  2QGS A;  3C50 A;  3PDY A;  5LYJ E;  3RC3 A;  2J47 A;  1ZV4 X;  3ZSS A;  2BZB A;  3EVY A;  2VVS A;  1N33 T;  5JR9 C;  3S4U A;  2WDQ A;  4OX9 T;  4CQI A;  1NEN A;  5DQW A;  4DR2 T;  2KWH A;  3K3O A;  1LVK A;  2NR4 A;  3ZC1 A;  4HWI B;  3RKO A;  4PW8 A;  2NP9 A;  3ZN0 B;  1D1B A;  4K0U A;  4PFO A;  5L47 A;  3D0T A;  5AQT B;  2X51 A;  4EZH A;  2BKO A;  2Q9Q D;  4UIG A;  4KX6 A;  1EZ3 A;  2PJQ A;  3GN5 A;  4P0B A;  2XTL A;  1HNZ T;  4ZZB A;  2LKG A;  3DP7 A;  3MK7 C;  4V1A v;  3ZMU B;  2DWG A;  4I0U A;  2V5D A;  2XAH B;  1WR0 A;  4MAL A;  1HF8 A;  1SHZ C;  4CI2 B;  3PJA J;  4BA9 A;  4LFA T;  2ZM0 A;  2I0M A;  2W0G A;  3NZP A;  4DUY T;  4A5X A;  3F2E A;  3E08 A;  2JIW A;  2WAU A;  2KND A;  2IIU A;  3BQI A;  2VL8 A;  3LK4 2;  2XQA A;  3HR0 A;  4M1P A;  2V6Y A;  5AQU B;  3KV6 A;  1UX4 A;  3VRB A;  1J5W A;  4EYU A;  4U2Z A;  5L3B B;  2SPC A;  3WAJ A;  3AE3 A;  3ZLI A;  1ZKE A;  3MA9 A;  5FXV A;  2OA5 A;  2XQ6 A;  3CQX C;  3GWH A;  4LMJ A;  4HWF A;  3N9N A;  2E9X D;  3EHZ A;  3RC8 A;  3AA1 B;  4DBQ A;  5GON E;  1BR2 A;  2UXB T;  3CVR A;  5LJN A;  4ZEY A;  4YSZ A;  3OBV E;  5HEJ A;  4X1Y E;  3WI3 A;  4YHH T;  4B6X A;  4HFV A;  2H3R A;  4LF5 T;  5JQG E;  3ZJ1 A;  1ZHC A;  4LFB T;  5HEH A;  1MMN A;  2JPF A;  3KVB A;  1S35 A;  4YY3 T;  2IUB A;  4IE7 A;  2HN2 A;  1D1A A;  2K3W A;  4EED A;  4H9R C;  4DO0 A;  2X9Y A;  3N9O A;  1W0B A;  4ZOL E;  3LSV A;  2UXC T;  5HXE A;  2BS4 A;  2KMF A;  1X9B A;  5EZY E;  2NW8 A;  2WU2 A;  3O9X A;  2MBG A;  2XY8 B;  3NVO A;  4YTN A;  2UUB T;  5L4H A;  3MKD A;  3PTR B;  2CBJ A;  4A97 A;  3WAK A;  2ES0 A;  4YXD A;  2A9U A;  4Z90 A;  2KWI B;  5HXH A;  2YKS A;  1T72 A;  2QVA A;  2KLQ A;  3SFE A;  2RA1 A;  2WM9 A;  3TLS A;  4UVC B;  5FXX A;  4U7Y A;  4E7S A;  2JJ9 A;  5JDL A;  2WSS V;  4HWD A;  2NWB A;  4COF A;  4YSX A;  2DLR A;  4DND A;  4JI7 T;  3C51 A;  4TN7 B;  5AQJ B;  3RHW A;  2UXD T;  5DQV A;  5JRC B;  4XAX B;  3EDU A;  5TAO A;  5LCY A;  4QH4 A;  4UV8 B;  1WYC A;  1SE7 A;  3W15 B;  3AXJ B;  4TNW A;  3FZL B;  3HKC E;  3AE1 A;  1VRB A;  5F8P A;  4L9I A;  2LSI A;  4U72 A;  1KNP A;  3JC6 D;  3PUQ A;  2D5U A;  4H9S E;  4O4H E;  1Y01 A;  3CPZ A;  2WQY A;  4FI5 A;  1HX1 B;  1I6Z A;  5AQS B;  3PU3 A;  5HXS A;  5LXT E;  4ILU A;  4A56 A;  5L3C B;  4TZ4 C;  3EAM A;  3R6N A;  2H88 A;  3NRY A;  3RKG A;  4TV9 E;  5AQL B;  3CWZ B;  1T98 A;  3VKG A;  5F5W A;  3QNU A;  1IAP A;  1WLX A;  3IHR A;  4PK4 A;  1MMG A;  3CQC B;  4QXB B;  4BAY B;  4GK0 E;  3HI2 A;  4DR5 T;  4AKI A;  3AXJ A;  2YOE A;  3Q9D A;  2V6X A;  4KBM B;  5DAB A;  3O1J A;  4EXT A;  2X68 A;  2A3D A;  5C8Y E;  1W09 A;  4IE0 A;  5LGT B;  4O2A E; 
#chains in the Genus database with same CATH homology
 3DJB A;  4PAG A;  1D0Z A;  3NBX X;  5L3D B;  2EHO A;  4X1K E;  5IYZ E;  5FXZ A;  3RYF E;  4IE5 A;  5ADX L;  3AVS A;  3FXD B;  4Z8X A;  5CB4 E;  1IJ6 A;  1MIY A;  2CE7 A;  2X0L B;  4GYS A;  2YIN A;  3RRW A;  3P8C D;  4ZI2 D;  3FHN A;  2GK9 A;  3CX7 B;  5HXC A;  5LBQ B;  4X1I E;  1MNE A;  2K24 A;  4CI1 B;  4O8S A;  4QWN B;  3K8P C;  2L3L A;  5H6Q B;  4H9O C;  4CXW A;  3LBX B;  3N9P A;  2DWK A;  2XAQ B;  1FMW A;  2C0S A;  3MXZ A;  2MYS A;  5LHG B;  4WW0 A;  5J2U E;  4O2B E;  5LNK A;  4JUY A;  4KUM B;  4PJJ A;  4H9P C;  3I1A A;  5FYM A;  3F31 A;  5FY1 A;  4ZI7 E;  2E9X C;  3HKE E;  3KVA A;  2LHR A;  2Q9Q A;  1U5P A;  2LOS A;  2HH7 A;  4WNK A;  5EK2 A;  2EHO C;  2ODU A;  3A5X A;  3PUR A;  2D0T A;  3ZEF B;  2IW5 B;  4UF0 A;  2LSK A;  4ZHQ E;  1HS7 A;  4HKA A;  3LJC A;  2V7L A;  3OKQ A;  4MLK A;  4ZS2 A;  2LT3 A;  5LA6 E;  4ADZ A;  3KDS E;  5JR9 A;  1LKX A;  1LVF A;  4QX7 B;  3RPU A;  3V5S A;  5FP3 A;  4DMW A;  2ODV A;  4EB6 E;  1ZEE A;  3RH3 A;  4PJL A;  4XZC A;  2ZM2 A;  4DVD A;  1AJ3 A;  2EHO B;  3FBZ A;  5HXR A;  3RRC A;  4H9Q C;  1D0X A;  2C5K T;  4EYY R;  3GN5 B;  3ZMS B;  3I9Y A;  2BVL A;  3SOL A;  3Q2M A;  3LK2 B;  3ZPO A;  4IHJ E;  4AKH A;  2YEV C;  2X9H A;  5DJQ C;  4AKL A;  2JMH A;  3MZK B;  3Q5W A;  2V7K A;  3PU8 A;  3KV4 A;  2NTY A;  2QGS A;  1OWA A;  3C50 A;  3O4X E;  5FY7 A;  5CA0 E;  3PDY A;  2P9B A;  2M67 A;  5LYJ E;  1BR4 A;  4QHO A;  3RC3 A;  4ISS A;  2YK0 A;  1ZV4 X;  3T8O A;  2J1D G;  4EIW A;  5LOV E;  4HGA A;  3LBX A;  3BQL A;  5LJM A;  2N2N A;  2BZB A;  1NAF A;  3EVY A;  3UT5 E;  3FBL A;  3MAC A;  3IF8 B;  2CCQ A;  3AA7 B;  5JR9 C;  2ZLY A;  3S4U A;  1IJ5 A;  2HPL A;  1WYB A;  4CQI A;  5DQW A;  2XAS B;  5JDH A;  2KWH A;  3J9X 1;  3K3O A;  3KIN B;  1LVK A;  3AAE B;  1D1C A;  2LSG A;  4PFP A;  3U78 A;  3ZC1 A;  4XBF B;  3GMI A;  4ZI3 C;  3LK3 B;  5JVD E;  1US7 B;  3AB3 B;  3M65 A;  3RKO A;  4PW8 A;  2NP9 A;  2NW7 A;  2VKH A;  3CX6 B;  3KFW X;  5JDG A;  3ZN0 B;  1D1B A;  4K0U A;  4PFO A;  3C64 A;  3D0T A;  2X51 A;  2ZMA A;  4OK0 A;  5KDM C;  4EZH A;  2Q9Q D;  2JRK A;  4UIG A;  5BMV E;  1EZ3 A;  1O3X A;  2PJQ A;  5KX5 E;  2DNX A;  4NUU A;  2LHN A;  4ERR A;  2A72 A;  3GN5 A;  4IGU A;  3ZMT B;  5L2L A;  3SS1 A;  2JMK A;  4P0B A;  4UVB B;  4I50 E;  2XTL A;  2MTQ A;  1HX8 A;  3DP7 A;  3MK7 C;  4V1A v;  3ZMU B;  3VHL A;  2DWG A;  3B57 A;  2WWU A;  2CLY C;  5J2T E;  3N9M A;  5E0O A;  2VKJ A;  2CXD A;  2XAH B;  3I0O A;  4FJO A;  4MAL A;  1HF8 A;  1SHZ C;  2K48 A;  3NRX A;  4OFZ A;  4CI2 B;  4PK5 A;  2Z6E A;  3JC6 C;  3J7Y q;  2X67 A;  4U74 A;  5JH7 E;  1UX5 A;  3DTO A;  2VWA A;  4BA9 A;  3N9L A;  2K9A A;  3HKD E;  2DCF A;  2NW9 A;  4GOU A;  2ZM0 A;  3LFM A;  3AVR A;  2W0G A;  3NZP A;  5JDM A;  2CLY B;  4KMC A;  2LE8 A;  2CM0 A;  3F2E A;  2XQY A;  5FNV E;  3E08 A;  3VU7 H;  1YW0 A;  1KNZ A;  3V5U A;  4ASK A;  5JRE A;  2WAU A;  5LP6 E;  4OHF A;  3KBT A;  3ZCI A;  2KND A;  3QC9 A;  4HE8 A;  3UTK A;  3BQI A;  2XAJ B;  3OJA A;  2VL8 A;  4TUY E;  2C5J A;  3LK4 2;  3HR0 A;  1MIV A;  1S94 A;  3N2K E;  2WBL A;  4M1P A;  5FMN A;  4F6R C;  3I9W A;  2L8K A;  4G63 A;  4O4L E;  1LRZ A;  1Y64 B;  1KK7 A;  3KV6 A;  1UX4 A;  1OXZ A;  3BQK A;  4L0R A;  5L3G B;  4EYU A;  2X9W A;  2LOP A;  4E7Z A;  4AKR B;  5L3B B;  1D0Y A;  1HTJ F;  3L09 A;  5M4Y A;  2UXX B;  5HWX A;  4WBO A;  2HPJ A;  2V7I A;  2SPC A;  5KMG P;  2BVM A;  3BK9 A;  3WAJ A;  1YD8 G;  3ZLI A;  1ZKE A;  5H6R B;  3MA9 A;  5LGU B;  4PJM A;  5FXV A;  2IC6 A;  1QUU A;  2OA5 A;  3CQX C;  2KT9 A;  3I0Q A;  3GWH A;  4QXH B;  3N9N A;  5EK3 A;  2E9X D;  1WR6 A;  2W61 A;  2DHR A;  3RC8 A;  3CML A;  3AA1 B;  4DBQ A;  4C91 A;  5GON E;  1BR2 A;  2EHO D;  2VK9 A;  2VKD A;  3CVR A;  4TX5 A;  4YLH A;  3RX6 A;  3ZMV B;  4HTE A;  5LJN A;  3FXE B;  3OBV E;  4YHJ A;  4PK6 A;  4AI6 A;  1NWM X;  1HG2 A;  2W62 A;  3ESL A;  3F57 A;  3IBP A;  3PE0 A;  4X1Y E;  4H63 V;  3WI3 A;  2CMR A;  3PUG A;  5HWY A;  4B6X A;  4HFV A;  4I43 B;  2YU2 A;  1U4Q A;  1G8X A;  2H3R A;  3CQG B;  5JQG E;  1HFA A;  2Y8D A;  1ZHC A;  3ZJ1 A;  1B7T A;  2WMN A;  1MMN A;  2JPF A;  2IAK A;  3HL6 A;  2PFV A;  2V7M A;  3TKL B;  3KVB A;  1S35 A;  2JQQ A;  5LGN B;  4IDZ A;  4CXX A;  3ETV A;  1MMD A;  4IE7 A;  2PBI A;  5CA1 E;  2IC9 A;  1D1A A;  4AKG A;  4H9R C;  3AA0 B;  3L3P A;  2X9Y A;  3EUH A;  3RYC E;  4DO0 A;  2LSY A;  3N9O A;  3SWH A;  4YFS A;  4ZOL E;  3ZYK A;  5JDF A;  4O4J E;  4KP3 C;  3ZN1 B;  4BJM A;  4ZI2 C;  2LSJ A;  4G2A A;  5HXE A;  2CA5 A;  5HAX A;  2KMF A;  4ANJ A;  5EZY E;  1FEW A;  3O1I A;  4GK5 E;  2NW8 A;  3O9X A;  1YKE B;  3KBU A;  2MBG A;  2CWO A;  4IE4 A;  3N2O A;  4N78 D;  4MFR A;  4JEH B;  2B1E A;  3MKD A;  1HG5 A;  3C4X A;  3PTR B;  1FMV A;  4YJ2 E;  2UXN B;  3ANW B;  4H63 H;  1SA0 E;  4QX8 B;  2ES0 A;  3WAK A;  3N2G E;  2LJL A;  2ACX A;  2V1D B;  5FY0 A;  2NTX A;  4P09 A;  5LG4 A;  2KWI B;  3PUS A;  5HXH A;  3RYH E;  2W63 A;  5IHY A;  2KLQ A;  3O1H A;  3KV9 A;  3ZYM A;  2BDE A;  2RA1 A;  3Q5X A;  2WM9 A;  3ETU A;  3ZJ2 A;  1FIO A;  2KZ7 B;  5FXW A;  2KXP B;  4UVC B;  5FXX A;  4E7S A;  3AAI A;  3U3I A;  5ETW A;  2JJ9 A;  3C4W A;  4JLE A;  4ZI3 D;  5JDL A;  5L3F B;  4H9N C;  2WSS V;  4IE6 A;  2X66 A;  3R84 B;  1BR1 A;  4NUV A;  2NWB A;  3UUM A;  3GA8 A;  2DLR A;  4IIJ E;  4DND A;  3C51 A;  3H37 A;  2G0U A;  2RP4 A;  2I59 A;  1VOM A;  2V26 A;  4TN7 B;  3HA4 A;  5L3E B;  4EOZ B;  2VB6 A;  4OYJ A;  4JEU B;  3OYX A;  1YKH B;  5DQV A;  5JRC B;  3P7I A;  4XAX B;  3EDU A;  2PG8 A;  1HCI A;  2CXF A;  2XUE A;  5TAO A;  1QSD A;  5LCY A;  3MJX A;  4C90 A;  2NOX A;  4MHC A;  4UV8 B;  2A2F X;  1WYC A;  3LG7 A;  4HN9 A;  4PNI A;  2E8I A;  3W15 B;  1X79 A;  3H3A A;  4EZ4 A;  1IZN B;  4OYK A;  4O4I E;  3HKC E;  4AQF A;  2CXL A;  1VRB A;  2XAG B;  4P0A A;  5F8P A;  3NZQ A;  1G73 A;  4L9I A;  3VKH A;  2VKO A;  2LSI A;  2X9X A;  4TV8 E;  4U72 A;  3C98 B;  3E0Z A;  3JC6 D;  3PUQ A;  4AXP A;  3ZC0 A;  2D5U A;  3ANW A;  4UEM A;  4AQG A;  1V9D A;  2W00 A;  4H9S E;  3PUA A;  3UUN A;  4UEL A;  2E9X B;  4O4H E;  3EDV A;  2XHE B;  3UFE A;  3FB2 A;  4CI3 B;  5AFU L;  5JRC A;  5JDQ A;  4I4T E;  2KIN B;  3CPZ A;  5J1G A;  5LBM A;  2H7O A;  3AA6 B;  2YU1 A;  5LHI B;  2ZM8 A;  4UV9 B;  4FI5 A;  3N9Q A;  4X20 E;  5A1L A;  3CKD A;  1UCU A;  4WBN E;  2N1G A;  4ZS3 A;  2DI4 A;  3KV5 A;  2CEA A;  3PU3 A;  4YJ3 E;  5HXS A;  5LXT E;  4J2C A;  4ILU A;  4A56 A;  3E22 E;  3K3Q C;  5L3C B;  3N5L A;  3HKB E;  4TZ4 C;  1BR0 A;  1CUN A;  3QK6 A;  3CX8 B;  3R6N A;  4BJN A;  2Q9Q C;  1MIW A;  2D2S A;  5F3J A;  1H7C A;  2N9D A;  3K3N A;  3RYI E;  2H7V C;  3NRY A;  4AQF C;  4DMV A;  4GYR A;  4TV9 E;  3CWZ B;  1T98 A;  2Y6X A;  3IEE A;  3SRZ A;  3VKG A;  4QXC B;  1MMA A;  1Z0P A;  3ZMZ B;  4L5G A;  3UUX B;  1IAP A;  2VAS A;  4UVA B;  2V7J A;  5EK4 A;  1WLX A;  3IHR A;  2QA7 A;  4CZZ B;  4PK4 A;  2Q9Q B;  4EAH A;  1MMG A;  3CQC B;  4QXB B;  4UXN B;  4BAY B;  4GK0 E;  2C5I T;  3HI2 A;  3OYZ A;  4AKI A;  3Q9D A;  3ZYL A;  2WMO A;  2L9Q A;  4KBM B;  4UF0 B;  2Y48 B;  4DBR A;  2CWY A;  1WRD A;  5HYA A;  5LHH B;  2XAF B;  3AAA B;  4I55 E;  4QKN A;  5JDN A;  3QUJ A;  2MOZ A;  5JR9 B;  5DAB A;  3ONX A;  3O1J A;  3UUL A;  4EXT A;  4HEA A;  4MBQ A;  2K5B B;  2X68 A;  2D0U A;  2A3D A;  4IST A;  4CXY A;  2E9X A;  5C8Y E;  4PJN A;  2LEH A;  4GIW A;  3B13 A;  4IE0 A;  3ZCJ A;  3C4Z A;  5LGT B;  1MND A;  2LM9 A;  4O2A E;  1E1H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...