4K0UA

Pilotin/secretin peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
VPANEQISQLASLVAASKYLRVQCERSDLPDDGTILKTAVNVAVQKGWDTGRYQSLPQLSENLYQGLLKDGTPKATQCSSFNRTMTPFLDAMRTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein OutS
publication title Anatomy of secretin binding to the Dickeya dadantii type II secretion system pilotin.
pubmed doi rcsb
source organism Dickeya dadantii
molecule tags Protein transport
total genus 36
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4k0uA00
4A56A 3SOLA 3UTKA 4K0UA
chains in the Genus database with same CATH superfamily
3AEGA 4PAGA 1D1BA 1HCIA 2K5BB 4WYVA 3FXDB 2YOEA 3U78A 3QK6A 3ABVA 4YJ3E 5JDGA 2LE8A 4ZI2C 4JEUB 4KI0F 3C4WA 2HHHT 2IMLA 3AA0B 3P4PA 1LKXA 2BBHA 3AAEB 3B13A 4JI0T 3RIFA 4PNIA 1XZYA 1U4QA 1H7CA 4PJLA 4TV9E 3MK7C 4YSZA 1IJ6A 5L3FB 2XM1A 3MACA 5L3DB 4LFBT 5AQRB 4A97A 3NKZA 5EK2A 1WCRA 5LJNA 5H6QB 1N36T 2XPKA 3LK3B 3EABA 3T1YT 3O1IA 2KZ7B 3RQUA 3NBXX 2W4XA 2WDVA 1B7TA 4QX8B 4I50E 5BR8T 5EZYE 2XAQB 1KEYA 5ABHA 3A7MA 2HN2A 5ABGA 2E2AA 3ZMTB 4YY3T 1WR0A 4WW0A 4FI5A 2E9XC 3CK6A 4YXDA 2BKOA 2WP9A 3OKQA 2MAWA 5AQGB 5EK4A 3RC3A 3ZLIA 2JIWA 4EB6E 3Q5EA 4YTNA 5LCYA 2VL0A 2ODUA 2BKNA 2XSAA 4WBNE 1VRBA 5AQLB 5JQGE 4I55E 5LXTE 3ZYLA 2UXDT 5LB7B 5J1GA 5AQUB 4Q25A 2NW8A 4JUYA 5F5WA 3EUHA 4JI3T 2DCFA 3T8OA 4ILCA 1SE7A 5HWXA 3P4WA 1YXRA 4A56A 2IAKA 4DV2T 3CQCB 2VKJA 5JDQA 1HNWT 3GMIA 3IA3A 5AQQB 3RQWA 2XQ5A 3UQ7A 4IE6A 2N1GA 2SPCA 4IE7A 3LSVA 2J62A 1VOMA 5CB4E 1UX4A 3VRAA 3AE2A 3FZHB 3A8YC 4IL9A 1VCSA 3ZSSA 2XQ8A 2V6YB 1IBMT 2V6YA 5LP6E 4YTMA 3PJAJ 4COFA 2W2UA 4U2ZA 3J7Yq 2DL1A 5EK3A 1FMVA 2VQET 1HR0T 4ZI3D 4MFRA 2LKGA 1EZ3A 5AQKB 3AEAA 3H3MA 3AE3A 2GK9A 1QUUA 1WR6A 4CI2B 1BR0A 2C5JA 3EI0A 3QNUA 1T8BA 2XQ4A 4H9PC 2UXCT 4IDOA 3QB5K 2A3DA 3FZLB 3ZJ1A 3PJAA 1SA0E 3KVAA 3FZMB 4JV5T 2WWUA 1L0VA 4KBMB 4DUZT 1NENA 4HFVA 1WFDA 2X68A 4ZEYA 5BMVE 3HKCE 2V5DA 2X0YA 2Q9QC 5FY0A 4DR5T 2KT9A 3ONXA 3AE7A 5L3CB 1Y64B 3F31A 4LMKA 4KHZF 2YEVC 5AQPB 3JADA 2QVAA 2CHOA 2IC9A 3KBUA 2XAGB 5KMGP 4HWIB 4QWNB 2IDOB 1YKEB 2YU2A 3HKEE 3VKGA 4K0UA 4NIQA 2BVLA 4E7SA 2JRKA 2IC6A 3AAAB 2XQAA 4H63H 4DVDA 5ETWA 5M4YA 2E5LT 4IE4A 3RI5A 2FBWA 2KXPB 4HTEA 4TNVA 4EAHA 4O4JE 4MALA 5JTGA 3DP7A 4O4IE 4U7YA 2C5IT 4IE0A 3UQ4A 3M3ZB 2X9YA 3GN5B 3GN5A 4B3MT 1DU2A 4X1YE 4U74A 3P4QA 5HCMA 2ODVA 4ZS3A 2WDRA 4QHOA 1S35A 1HF8A 4GIWA 3CIRA 2LM2A 5IYZE 1HS7A 3JAFA 4TN7B 5HXHA 3WAKA 2CMRA 4TWDA 2LRKA 2V7IA 2WY2A 4EZ4A 4XBFB 4ILAA 4LMLA 5CA0E 1T98A 1MNDA 2V26A 3NZQA 4IGUA 4O2BE 3AXJB 3AXJA 3QC9A 3PURA 2BG9C 3DJBA 3KDSE 2NTYA 1CHUA 5HYAA 4H9NC 2JMHA 4JEHB 5HAXA 4IDNA 2V7JA 2Q9QB 1Z8UA 2M6BA 2Q9QA 3CWZB 4LF9T 4LFAT 3AVRA 4IREA 5A1LA 4U33A 2CWOA 5L3GB 4UV8B 1HNZT 3N2KE 1XMQT 2K48A 2X0HA 5FY7A 3UU4A 2KMFA 2UXXB 1D1CA 4ZHQE 2I6HA 5LA6E 1OEDB 1OEDA 2BBJA 2WMOA 3NZPA 5HXEA 5JDNA 2X9XA 4HEAA 1D0YA 1IJ5A 2CE7A 3TLSA 3IHRA 4CXYA 1LRZA 2X0LB 3LK42 2ZM2A 2EHOD 3MXZA 1W9RA 3TLTA 3PUYF 1IBLT 1W0AA 2ZM8A 3PUVF 2WDQA 1BR2A 1ZKEA 2BS4A 5IWAT 4JI2T 3R6NA 3EDUA 3RYFE 4YJ2E 3I0QA 4DV6T 2F4VT 2MTQA 4X66T 5JDFA 5FXWA 3BQLA 3LDQB 3ZCJA 3AAIA 2KSRA 4HWDA 2LEHA 2CLYC 3K1SA 4OK0A 1E1HB 3FBZA 2Q9QD 3PUQA 4JI7T 3ZT7A 4IIJE 5LGNB 3ZMUB 4L5GA 3UT5E 3HA4A 3IEEA 4CI1B 4A5XA 1LVFA 2CRBA 2WBLA 3N9QA 3QUJA 4KMCA 4H9QC 3RYHE 4NPPA 5FVKA 3VRBA 3OYXA 1R8IA 5HEGA 1MIVA 4DO0A 2ZM6T 5LHHB 3RX6A 2PFVA 2W61A 4CXWA 2CBJA 4CZZB 4PK6A 5F3JA 3ZSTA 1N34T 5FP3A 3AEFA 2LSIA 3SS1A 4GKKT 4PK5A 4GYRA 3RIUA 1AJ3A 4X1KE 2DWKA 3ZMSB 4YHHT 1XMOT 3LBXB 1UURA 5C3JA 3LBXA 2QRXA 5JREA 4JBWF 4AI6A 1HG2A 5JR9C 2ZM0A 4EOZB 3OVUA 4DIDB 4OX9T 5FMNA 4GOUA 1US7B 3RRWA 1S94A 3SOLA 3RKGA 4HFDA 5CFBA 3KINB 2BS2A 4JI4T 5AFUL 4HWCA 3MA9A 4DV0T 2H3RA 3V5UA 3K8PC 4TX5A 3LK2B 2HPLA 3CX6B 1MNEA 3X1DA 2FJEA 4EEDA 2BZBA 2A9UA 4AQGA 3KV6A 3I9WA 3C4XA 4E7ZA 3Q9DA 4L9IA 2DNXA 3HKBE 2D5UA 3RLFF 3IBPA 3FBLA 2KLQA 2NP9A 2VQFT 2UXBT 3RGLA 3TLVA 2JPFA 2XJ7A 2L8KA 4NXNT 3AEBA 2FUPA 3AB3B 2MYSA 3KV5A 4IDPA 1N33T 4BJMA 2VVNA 3O4XE 4HKAA 2BS3A 3ONLC 4EYYR 1M62A 1WLXA 2DHRA 3UTKA 4UV9B 3F57A 2DLRA 1OXZA 1E7PA 3CKDA 5F8PA 2DI4A 4HFBA 5LBMA 2J4GA 4HFCA 2KNDA 4N78D 4IDQA 5LG3A 3PE0A 4ZOLE 1E2AA 4IT4A 2WU2A 5JRCB 5DABA 5JRCA 2J1DG 3QB5A 2JQHA 2AE9A 1JNRA 1J1JA 3C51A 4UELA 5LBQB 1NWMX 2XZEA 1HX1B 3HI2A 2ES0A 4JI8T 3F2EA 4DR3T 4YHJA 5L2LA 4UF0B 2P9BA 4UF0A 5L3BB 1BR1A 3T1HT 4ERRA 5JR9B 3CX7B 5JR9A 1MIYA 5DQVA 5LHIB 2UUCT 1XDPA 3M65A 2VKHA 4TNWA 1IZNB 1OEDE 2M6IA 2UXNB 3S4UA 3UFGA 2WZHA 1YQ3A 5LMUT 3J9X1 4I0UA 2KWIB 2LSGA 2YDRA 3VR9A 3ZYKA 1D1AA 1KF6A 2E9XB 2E9XA 5C2TA 4U72A 2LSYA 3OTOT 5LJMA 1M7KA 3RYIE 5LMNT 2XAHB 3UUNA 2PTFA 4PJJA 5AQTB 4ZI2D 2LRLA 4H9SE 4U2YA 1MMGA 3BK9A 3AEEA 4YT0A 5KDMC 1SUMB 3RH3A 3EVYA 2XY8B 3K3NA 4EZHA 1UCUA 4H9OC 3RHWA 2V7KA 3I0OA 3LFMA 2FJAA 4MLKA 5JVDE 3ZKRA 2H89A 3SRZA 3ZN0B 4IHJE 3ZN1B 2MOZA 3ZYMA 4UR9A 3VKHA 3O9XA 4QKNA 5LGTB 2I0MA 3VU7H 2RP4A 4OHFA 4ZS2A 2VKOA 2LT3A 3Q5WA 5JH7E 4QH1A 2UUBT 3I9YA 2IW5B 2LHNA 1FMWA 1MIWA 1ZOYA 2WU5A 5LGUB 2XHEB 4HFHA 3RF1A 2LOPA 3FXEB 4DV7T 1JNZA 3ZCIA 4MBQA 2E5VA 2E9XD 2CPTA 4AKIA 5GONE 3KVBA 2NW9A 4EV6A 4OYKA 5HEJA 2MBGA 2J47A 1LVKA 2W63A 3PUZF 1KFYA 5AQJB 4ASKA 2D0UA 2V1DB 3N5LA 5IHYA 4ADZA 2VL8A 4AISA 1KNPA 2I59A 4O4HE 4X1IE 2VB6A 2XM2A 2WMNA 3HL6A 2HPJA 4WNKA 4DR7T 2X51A 4B3RT 5HWYA 3O1HA 3MKDA 4DV5T 3AECA 3P4SA 1UGOA 2K3WA 4HWFA 4X20E 2WZIA 3PU8A 3B5MA 3VHLA 5L3EB 4GYSA 3L09A 2NOXA 5HXSA 3R84B 4AXPA 5H6RB 4DV1T 4IDZA 4PJMA 5FKYA 1UUSA 1HG5A 2H7OA 4U31A 2YKSA 4F6RC 2CM0A 2NR4A 3ZC1A 4ANJA 4LF5T 4XAXB 3N9LA 5E0OA 1QLBA 2WS3A 3PUXF 1W0BA 3CVRA 3RIAA 1G73A 4DR2T 4C90A 1VCTA 2YDQA 1I94T 1GQEA 2A72A 4X62T 2X9HA 2NTXA 3N9PA 5FY1A 2W67A 3A5XA 2R6GF 1ZP0A 4L0RA 5CJ5A 3N9MA 5AQSB 4ZXLA 2XAJB 4P0AA 1FIOA 4NUVA 3H3AA 5J2TE 2K24A 4HFIA 3NWIA 4TUYE 5JDLA 2H7VC 3WI3A 2LSJA 2D2SA 1HFAA 3K3QC 2PBIA 3PU3A 5AQMB 2HN1A 4MHCA 4AQFC 3D0TA 4EGWA 3N9NA 2YN6A 3JC6C 3OYZA 2LKHA 1J5ET 4OFZA 3TLWA 2ACXA 1Z0PA 5HXCA 5FXVA 4ZI3C 4H63V 5IUXA 4HE8A 4YLHA 1T72A 4KUMB 2Y8DA 3UU6A 3ZMVB 4ISTA 2BG9B 5HEHA 4TV8E 2XSBA 2BG9A 1HTJF 3CX8B 3NVOA 5FL0A 3VR8A 1O3XA 3SWHA 4P0BA 2X9WA 1NEKA 2CXFA 2WQYA 2CEAA 4K0KT 3UUXB 4UVAB 3QOFA 5AQFB 3RC8A 4AQYT 2KINB 4KX6A 3ZMZB 4LF7T 4GK0E 4EEBA 3FB2A 1XNRT 4JI1T 2B1EA 4PW8A 2Y6XA 4YTPA 4ZI7E 3SFEA 3PUAA 4JLEA 4UEMA 3KV9A 1MMNA 2HH7A 3FZKB 3UFEA 4EYUA 1N32T 4DNDA 2QYWA 2LJLA 4HFEA 3PTRB 4B3TT 4KP3C 4U3CA 2RPAA 2YINA 3ONJA 3CQGB 2VVSA 1XWMA 3PV0F 3IF8B 3EAMA 3PUWF 3UU8A 5C8YE 2BKPA 1I6ZA 3ETVA 4G2AA 1MMDA 2WSSV 3GWHA 3JAEA 2LHRA 4LMJA 4UIGA 3KBTA 3AE1A 3H37A 2QA7A 3W15B 4CXXA 3AA7B 4QX7B 4P1NA 2V7MA 4AQFA 3AE8A 3GA8A 3ETUA 1T7SA 3ZT5A 4F8HA 2D0TA 2JJ9A 3E08A 2CLYB 2C5KT 4X64T 2LM9A 2KWHA 4G63A 4LF6T 2JQQA 4QH5A 2YU1A 4B6XA 5L4HA 1YD8G 4XZCA 3C4ZA 3PUSA 2NWBA 2JQ9A 3V5SA 3AE5A 2XQ9A 4DR4T 4JI5T 1D0ZA 4AIUA 4HGAA 3Q5XA 4DBQA 1UX5A 1WYBA 2PJQA 2BDEA 1FEWA 5LNKA 1W09A 2H88A 2IIUA 1MMAA 2AXDS 2FJDA 2K9AA 5L4EA 2XASB 3C50A 4JI6T 5FYMA 2LSKA 4JYAT 1FJGT 4YSYA 2OV9A 2OA5A 2W66A 2RA1A 5AQNB 2V5CA 4LF8T 1KK7A 3UUBA 3BQIA 5LG4A 1D0XA 3JCFA 2D9DA 2CWYA 2L9QA 4CN1A 2L3LA 4EXTA 4YSXA 3LG7A 3UULA 5FNVE 4X5TA 3JC6D 4TWFA 2WB5A 4H9RC 4WBOA 1IBKT 1X79A 4CQIA 4QXCB 3P4RA 2CBIA 2EHOC 3KV4A 4NUUA 3BQKA 2FJBA 3ZJ2A 3CPZA 2IHR1 3AVSA 1XNQT 1G8XA 4ISSA 2XQ3A 3B57A 3Q2MA 4U7IA 4NXMT 3FZFB 2XQ6A 5KX5E 4DMVA 2YDSA 5ADXL 2VWAA 3N9OA 2X66A 3AE9A 2Y48B 5FL1A 1IAPA 5J0ZA 2XUEA 4QXBB 4PFOA 4AKLA 4I43B 3Q5DA 1YW0A 5LOVE 3ESLA 3O1JA 4ZZCA 2BG9E 1U5PA 3NRXA 5JDMA 5TAOA 4AKHA 4O2AE 2PG8A 3UUMA 3TLUA 3CQXC 5LYJE 5AQVB 3C64A 2CCQA 4C91A 2WAUA 4J2CA 1OEDC 4DR1T 3AA6B 4DUYT 2N2NA 3OBVE 4UVCB 4P09A 4PK4A 3AA1B 3L8RA 3UU3A 3RKOA 1XDOA 4I4TE 3OJAA 3C98B 4A98A 2JQKA 3RRCA 5KXJA 4DV4T 4GKJT 4HWHA 2E8IA 1Y01A 2B76A 4HN9A 5FXZA 4BJNA 4YFSA 4DV3T 3ZPOA 2G0UA 2XQ7A 1HNXT 2XAFB 2YK0A 5AQHB 3E0ZA 2W0GA 2EHOB 2VKDA 4OYJA 2EHOA 3LJCA 3OPCA 4Z91A 2XQYA 2LLYA 2CXDA 3FHNA 4ILBA 3ZEFB 2C0SA 3TKLB 3RYCE 1YQ4A 1ZEEA 4TZ4C 4LFCT 4DMWA 1ZHCA 4B3ST 2NW7A 3U3IA 2V6XA 3L3PA 4CI3B 1UK5A 1BR4A 3PUGA 2VK9A 2CHNA 1OWAA 4UXNB 3AE4A 5DJQC 4KHPT 4IL4A 2ZLYA 2WM9A 3PDYA 4GK5E 4CN4A 2LOSA 2W62A 5AQOB 4DBRA 2Z6EA 4PJNA 4AKGA 2N9DA 1YKHB 5HEOA 4BAYB 4QH4A 4IE5A 2W00A 3ZC0A 3HR0A 3N2GE 3MJXA 4TWHA 3P50A 5ABFB 3WAJA 5ABFA 2CA5A 5CA1E 4QXHB 4O8SA 2UU9T 3EDVA 3ZT6A 1KNRA 2WCAA 4Z8XA 5J2UE 4BA9A 1SHZC 1WYCA 4M1PA 3RIUC 1ZV4X 2A2FX 5HCJA 3AEDA 1J5WA 5LHGB 1CUNA 1HX8A 3AE6A 4Z90A 2X67A 3UU5A 4DR6T 2V7LA 5FXXA 3RPUA 3HKDE 2JMKA 3ANWB 4EIWA 3ANWA 4WZXA 3N2OA 2V8SV 3SFDA 1NAFA 3E22E 5DQWA 2MPKA 1X9BA 2OLTA 2ACZA 3MZKB 2VURA 4ILUA 5HEUA 2WWVA 4X65T 5L47A 5ABEA 3P8CD 3I1AA 2IUBA 4ZZBA 3K3OA 5FVLA 5JDHA 2M67A 2BVMA 5AQIB 4V1Av 3L39A 2VASA 1V9DA 4PFPA 4LF4T 4CN6A 2UUAT 2XTLA 4UVBB 2ZMAA 3NRYA 4O4LE 3CMLA 1WRDA 2DWGA 3P7IA 1QSDA 3DTOA 5HXRA 4AKRB 3EHZA 4FJOA 2QGSA 3KFWX 5CGMA 1KNZA 2CXLA 3G06A
chains in the Genus database with same CATH topology
5HAXA 4PAGA 1MMGA 2V7JA 3BK9A 1D1BA 1HCIA 2K5BB 2Q9QB 5KDMC 2Q9QA 3FXDB 3RH3A 3EVYA 3U78A 3K3NA 4EZHA 3QK6A 3CWZB 4YJ3E 1D0ZA 1UCUA 4H9OC 4HGAA 2V7KA 5JDGA 3AVRA 3Q5XA 2LE8A 3I0OA 4ZI2C 3LFMA 4DBQA 1UX5A 4JEUB 3C4WA 1WYBA 5A1LA 2PJQA 4MLKA 5JVDE 2BDEA 2CWOA 5L3GB 1FEWA 4UV8B 3AA0B 5LNKA 3SRZA 3ZN0B 3N2KE 1LKXA 2K48A 4IHJE 5FY7A 3ZN1B 3AAEB 3B13A 2MOZA 2KMFA 1MMAA 3ZYMA 2UXXB 3VKHA 1D1CA 3O9XA 2K9AA 4QKNA 4PNIA 4ZHQE 2XASB 1U4QA 5LA6E 1H7CA 3C50A 4PJLA 5LGTB 5FYMA 4TV9E 2LSKA 3MK7C 2WMOA 3NZPA 1IJ6A 3VU7H 5HXEA 5JDNA 5L3FB 2X9XA 2RP4A 3MACA 4HEAA 4OHFA 5L3DB 4ZS2A 1D0YA 2VKOA 1IJ5A 2OA5A 2CE7A 2RA1A 2LT3A 3Q5WA 3IHRA 5JH7E 4CXYA 1LRZA 2X0LB 5EK2A 1KK7A 3I9YA 3LK42 2ZM2A 2EHOD 3BQIA 3MXZA 1D0XA 2IW5B 5LG4A 2LHNA 1FMWA 1MIWA 2CWYA 2L9QA 5LGUB 5LJNA 2XHEB 2L3LA 5H6QB 4EXTA 2LOPA 3FXEB 3LG7A 3UULA 2ZM8A 5FNVE 3LK3B 3JC6D 3ZCIA 4MBQA 1BR2A 2E9XD 2KZ7B 3O1IA 4AKIA 1ZKEA 5GONE 3NBXX 3KVBA 2NW9A 3R6NA 4H9RC 4WBOA 1X79A 4CQIA 3EDUA 4QXCB 3RYFE 4YJ2E 1B7TA 4QX8B 3I0QA 2EHOC 4I50E 4OYKA 2MTQA 5EZYE 5JDFA 2MBGA 5FXWA 3BQLA 3KV4A 4NUUA 2XAQB 3BQKA 1LVKA 2W63A 3ZJ2A 4ASKA 3CPZA 2D0UA 2V1DB 3N5LA 5IHYA 3AVSA 4ADZA 3ZMTB 1G8XA 3ZCJA 4ISSA 2VL8A 3AAIA 4WW0A 4FI5A 3B57A 3Q2MA 2I59A 2LEHA 2E9XC 2CLYC 4O4HE 4X1IE 4OK0A 1E1HB 3FBZA 2Q9QD 3OKQA 5EK4A 2VB6A 3PUQA 3RC3A 3ZLIA 2WMNA 3HL6A 5KX5E 4DMVA 2HPJA 4EB6E 4IIJE 4WNKA 5LGNB 2X51A 5HWYA 3O1HA 3ZMUB 4L5GA 3MKDA 3UT5E 5LCYA 5ADXL 2VWAA 2ODUA 3HA4A 3IEEA 4CI1B 4X20E 3N9OA 1VRBA 2X66A 4WBNE 5JQGE 1LVFA 2Y48B 4I55E 5LXTE 3PU8A 2WBLA 3N9QA 3VHLA 1IAPA 3ZYLA 2XUEA 4GYSA 5L3EB 3L09A 4QXBB 4PFOA 4AKLA 3QUJA 2NOXA 4I43B 4KMCA 4H9QC 3R84B 3RYHE 5J1GA 5HXSA 4AXPA 1YW0A 5LOVE 3ESLA 3OYXA 2NW8A 5H6RB 3O1JA 4JUYA 4IDZA 4PJMA 1HG5A 1MIVA 3EUHA 4DO0A 2H7OA 2DCFA 3T8OA 5LHHB 3RX6A 2PFVA 2W61A 4CXWA 4CZZB 4PK6A 5HWXA 5F3JA 4F6RC 1U5PA 3NRXA 4A56A 5JDMA 5TAOA 2CM0A 2IAKA 3CQCB 3ZC1A 2VKJA 4AKHA 4ANJA 4O2AE 5FP3A 2PG8A 5JDQA 2LSIA 3GMIA 3SS1A 3UUMA 4XAXB 3N9LA 5E0OA 4PK5A 3CQXC 4GYRA 5LYJE 1AJ3A 3C64A 2CCQA 4IE6A 4X1KE 2N1GA 2DWKA 4C91A 2SPCA 2WAUA 4IE7A 4J2CA 3AA6B 3CVRA 2N2NA 3ZMSB 1VOMA 1G73A 3OBVE 5CB4E 1UX4A 4C90A 4UVCB 4P09A 4PK4A 3AA1B 3LBXB 3LBXA 5JREA 4AI6A 2A72A 3RKOA 5LP6E 2X9HA 1HG2A 5JR9C 2NTXA 4I4TE 3N9PA 2ZM0A 3OJAA 3C98B 5FY1A 4EOZB 3A5XA 5FMNA 3RRCA 4L0RA 3N9MA 4GOUA 1US7B 3RRWA 2XAJB 3J7Yq 4P0AA 1S94A 3SOLA 1FIOA 5EK3A 2E8IA 4NUVA 3KINB 5HYAA 4HN9A 1FMVA 5FXZA 4BJNA 4YFSA 3H3AA 5AFUL 3MA9A 3ZPOA 2H3RA 2G0UA 5J2TE 4ZI3D 4MFRA 2K24A 1EZ3A 2XAFB 3V5UA 2YK0A 3K8PC 4TX5A 3LK2B 2HPLA 3E0ZA 4TUYE 3CX6B 5JDLA 2H7VC 2W0GA 1MNEA 3WI3A 2LSJA 2GK9A 2D2SA 1HFAA 1QUUA 2BZBA 2PBIA 3K3QC 3PU3A 1WR6A 2EHOB 2VKDA 4OYJA 4CI2B 4AQGA 4MHCA 1BR0A 2EHOA 3I9WA 2C5JA 3KV6A 3C4XA 3D0TA 3LJCA 4AQFC 4E7ZA 3N9NA 3Q9DA 4L9IA 3JC6C 3OYZA 2XQYA 3FHNA 2CXDA 2DNXA 3HKBE 3ZEFB 2D5UA 4H9PC 2C0SA 3IBPA 3RYCE 3TKLB 3FBLA 4OFZA 2ACXA 1ZEEA 1Z0PA 2KLQA 2A3DA 4TZ4C 5HXCA 2NP9A 4DMWA 5FXVA 4ZI3C 3ZJ1A 4H63V 1ZHCA 2NW7A 4HE8A 3U3IA 2JPFA 1SA0E 4YLHA 3KVAA 2L8KA 3L3PA 4CI3B 1BR4A 4KUMB 2Y8DA 3AB3B 3PUGA 2VK9A 2MYSA 2WWUA 3KV5A 1OWAA 4UXNB 3ZMVB 4ISTA 4KBMB 5DJQC 4TV8E 4BJMA 2ZLYA 1HTJF 2WM9A 3CX8B 3PDYA 4GK5E 3O4XE 4HKAA 2LOSA 2W62A 4HFVA 1O3XA 2X68A 3SWHA 4DBRA 2Z6EA 5BMVE 4PJNA 3HKCE 4P0BA 4EYYR 1WLXA 4AKGA 2X9WA 2N9DA 2DHRA 1YKHB 3UTKA 2Q9QC 5FY0A 4BAYB 2KT9A 2CXFA 2W00A 4IE5A 4UV9B 3F57A 2CEAA 3ZC0A 3ONXA 3UUXB 3HR0A 3N2GE 5L3CB 4UVAB 1Y64B 2DLRA 3F31A 3MJXA 2YEVC 1OXZA 3RC8A 2KINB 3CKDA 3ZMZB 5F8PA 2DI4A 5LBMA 3WAJA 4GK0E 2KNDA 4N78D 2CA5A 5CA1E 2IC9A 4QXHB 3KBUA 2XAGB 5KMGP 3FB2A 4O8SA 4QWNB 3PE0A 1YKEB 2YU2A 2B1EA 4ZOLE 3HKEE 3EDVA 2Y6XA 4K0UA 4PW8A 3VKGA 5JRCB 2BVLA 5DABA 4E7SA 2JRKA 4ZI7E 5JRCA 2J1DG 2IC6A 3AAAB 4H63H 4DVDA 4Z8XA 3C51A 3PUAA 5ETWA 5J2UE 4JLEA 4BA9A 5M4YA 1SHZC 1WYCA 4UEMA 3KV9A 4UELA 1MMNA 4M1PA 5LBQB 1NWMX 4IE4A 1ZV4X 2A2FX 2HH7A 3UFEA 2KXPB 5LHGB 4EYUA 1CUNA 4DNDA 1HX8A 4HTEA 2LJLA 3HI2A 2ES0A 2X67A 3PTRB 4EAHA 2V7LA 4MALA 3F2EA 4O4JE 4YHJA 4KP3C 5FXXA 5L2LA 3DP7A 4UF0B 3RPUA 2P9BA 3HKDE 4UF0A 2JMKA 2YINA 3ANWB 4O4IE 4EIWA 2C5IT 5L3BB 3ANWA 1BR1A 4IE0A 3CQGB 3N2OA 4ERRA 5JR9B 3CX7B 5JR9A 1NAFA 2X9YA 3E22E 3GN5B 3IF8B 5DQWA 1MIYA 3GN5A 5C8YE 5DQVA 5LHIB 3M65A 4X1YE 3ETVA 4G2AA 1MMDA 2VKHA 1IZNB 4U74A 3MZKB 2WSSV 3GWHA 2ODVA 4ILUA 4ZS3A 3P8CD 2UXNB 4QHOA 1S35A 3I1AA 3S4UA 1HF8A 2LHRA 3K3OA 4UIGA 3KBTA 5JDHA 3J9X1 2KWIB 2M67A 2BVMA 3H37A 2QA7A 3W15B 4CXXA 3AA7B 4GIWA 4V1Av 2LSGA 2VASA 4QX7B 1V9DA 5IYZE 1HS7A 3ZYKA 2V7MA 4AQFA 4PFPA 1D1AA 3GA8A 3ETUA 4TN7B 2XTLA 4UVBB 2D0TA 2JJ9A 3E08A 2E9XB 2CLYB 2C5KT 2LM9A 2E9XA 2KWHA 4G63A 5HXHA 3WAKA 2CMRA 2ZMAA 3NRYA 4O4LE 3CMLA 2JQQA 1WRDA 2DWGA 4U72A 2V7IA 4EZ4A 4XBFB 2LSYA 5LJMA 3P7IA 1QSDA 3DTOA 5HXRA 5CA0E 3RYIE 1T98A 2XAHB 3UUNA 1MNDA 2V26A 2YU1A 3NZQA 4IGUA 4AKRB 4FJOA 4O2BE 4B6XA 2QGSA 3KFWX 4PJJA 3QC9A 1KNZA 2CXLA 1YD8G 3PURA 4XZCA 4ZI2D 3C4ZA 3PUSA 2NWBA 3DJBA 4H9SE 3KDSE 2NTYA 3V5SA 4H9NC 2JMHA 4JEHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A56 A;  3SOL A;  3UTK A;  4K0U A; 
#chains in the Genus database with same CATH topology
 3AEG A;  4PAG A;  1D1B A;  1HCI A;  2K5B B;  4WYV A;  3FXD B;  2YOE A;  3U78 A;  3QK6 A;  3ABV A;  4YJ3 E;  5JDG A;  2LE8 A;  4ZI2 C;  4JEU B;  4KI0 F;  3C4W A;  2HHH T;  2IML A;  3AA0 B;  3P4P A;  1LKX A;  2BBH A;  3AAE B;  3B13 A;  4JI0 T;  3RIF A;  4PNI A;  1XZY A;  1U4Q A;  1H7C A;  4PJL A;  4TV9 E;  3MK7 C;  4YSZ A;  1IJ6 A;  5L3F B;  2XM1 A;  3MAC A;  5L3D B;  4LFB T;  5AQR B;  4A97 A;  3NKZ A;  5EK2 A;  1WCR A;  5LJN A;  5H6Q B;  1N36 T;  2XPK A;  3LK3 B;  3EAB A;  3T1Y T;  3O1I A;  2KZ7 B;  3RQU A;  3NBX X;  2W4X A;  2WDV A;  1B7T A;  4QX8 B;  4I50 E;  5BR8 T;  5EZY E;  2XAQ B;  1KEY A;  5ABH A;  3A7M A;  2HN2 A;  5ABG A;  2E2A A;  3ZMT B;  4YY3 T;  1WR0 A;  4WW0 A;  4FI5 A;  2E9X C;  3CK6 A;  4YXD A;  2BKO A;  2WP9 A;  3OKQ A;  2MAW A;  5AQG B;  5EK4 A;  3RC3 A;  3ZLI A;  2JIW A;  4EB6 E;  3Q5E A;  4YTN A;  5LCY A;  2VL0 A;  2ODU A;  2BKN A;  2XSA A;  4WBN E;  1VRB A;  5AQL B;  5JQG E;  4I55 E;  5LXT E;  3ZYL A;  2UXD T;  5LB7 B;  5J1G A;  5AQU B;  4Q25 A;  2NW8 A;  4JUY A;  5F5W A;  3EUH A;  4JI3 T;  2DCF A;  3T8O A;  4ILC A;  1SE7 A;  5HWX A;  3P4W A;  1YXR A;  4A56 A;  2IAK A;  4DV2 T;  3CQC B;  2VKJ A;  5JDQ A;  1HNW T;  3GMI A;  3IA3 A;  5AQQ B;  3RQW A;  2XQ5 A;  3UQ7 A;  4IE6 A;  2N1G A;  2SPC A;  4IE7 A;  3LSV A;  2J62 A;  1VOM A;  5CB4 E;  1UX4 A;  3VRA A;  3AE2 A;  3FZH B;  3A8Y C;  4IL9 A;  1VCS A;  3ZSS A;  2XQ8 A;  2V6Y B;  1IBM T;  2V6Y A;  5LP6 E;  4YTM A;  3PJA J;  4COF A;  2W2U A;  4U2Z A;  3J7Y q;  2DL1 A;  5EK3 A;  1FMV A;  2VQE T;  1HR0 T;  4ZI3 D;  4MFR A;  2LKG A;  1EZ3 A;  5AQK B;  3AEA A;  3H3M A;  3AE3 A;  2GK9 A;  1QUU A;  1WR6 A;  4CI2 B;  1BR0 A;  2C5J A;  3EI0 A;  3QNU A;  1T8B A;  2XQ4 A;  4H9P C;  2UXC T;  4IDO A;  3QB5 K;  2A3D A;  3FZL B;  3ZJ1 A;  3PJA A;  1SA0 E;  3KVA A;  3FZM B;  4JV5 T;  2WWU A;  1L0V A;  4KBM B;  4DUZ T;  1NEN A;  4HFV A;  1WFD A;  2X68 A;  4ZEY A;  5BMV E;  3HKC E;  2V5D A;  2X0Y A;  2Q9Q C;  5FY0 A;  4DR5 T;  2KT9 A;  3ONX A;  3AE7 A;  5L3C B;  1Y64 B;  3F31 A;  4LMK A;  4KHZ F;  2YEV C;  5AQP B;  3JAD A;  2QVA A;  2CHO A;  2IC9 A;  3KBU A;  2XAG B;  5KMG P;  4HWI B;  4QWN B;  2IDO B;  1YKE B;  2YU2 A;  3HKE E;  3VKG A;  4K0U A;  4NIQ A;  2BVL A;  4E7S A;  2JRK A;  2IC6 A;  3AAA B;  2XQA A;  4H63 H;  4DVD A;  5ETW A;  5M4Y A;  2E5L T;  4IE4 A;  3RI5 A;  2FBW A;  2KXP B;  4HTE A;  4TNV A;  4EAH A;  4O4J E;  4MAL A;  5JTG A;  3DP7 A;  4O4I E;  4U7Y A;  2C5I T;  4IE0 A;  3UQ4 A;  3M3Z B;  2X9Y A;  3GN5 B;  3GN5 A;  4B3M T;  1DU2 A;  4X1Y E;  4U74 A;  3P4Q A;  5HCM A;  2ODV A;  4ZS3 A;  2WDR A;  4QHO A;  1S35 A;  1HF8 A;  4GIW A;  3CIR A;  2LM2 A;  5IYZ E;  1HS7 A;  3JAF A;  4TN7 B;  5HXH A;  3WAK A;  2CMR A;  4TWD A;  2LRK A;  2V7I A;  2WY2 A;  4EZ4 A;  4XBF B;  4ILA A;  4LML A;  5CA0 E;  1T98 A;  1MND A;  2V26 A;  3NZQ A;  4IGU A;  4O2B E;  3AXJ B;  3AXJ A;  3QC9 A;  3PUR A;  2BG9 C;  3DJB A;  3KDS E;  2NTY A;  1CHU A;  5HYA A;  4H9N C;  2JMH A;  4JEH B;  5HAX A;  4IDN A;  2V7J A;  2Q9Q B;  1Z8U A;  2M6B A;  2Q9Q A;  3CWZ B;  4LF9 T;  4LFA T;  3AVR A;  4IRE A;  5A1L A;  4U33 A;  2CWO A;  5L3G B;  4UV8 B;  1HNZ T;  3N2K E;  1XMQ T;  2K48 A;  2X0H A;  5FY7 A;  3UU4 A;  2KMF A;  2UXX B;  1D1C A;  4ZHQ E;  2I6H A;  5LA6 E;  1OED B;  1OED A;  2BBJ A;  2WMO A;  3NZP A;  5HXE A;  5JDN A;  2X9X A;  4HEA A;  1D0Y A;  1IJ5 A;  2CE7 A;  3TLS A;  3IHR A;  4CXY A;  1LRZ A;  2X0L B;  3LK4 2;  2ZM2 A;  2EHO D;  3MXZ A;  1W9R A;  3TLT A;  3PUY F;  1IBL T;  1W0A A;  2ZM8 A;  3PUV F;  2WDQ A;  1BR2 A;  1ZKE A;  2BS4 A;  5IWA T;  4JI2 T;  3R6N A;  3EDU A;  3RYF E;  4YJ2 E;  3I0Q A;  4DV6 T;  2F4V T;  2MTQ A;  4X66 T;  5JDF A;  5FXW A;  3BQL A;  3LDQ B;  3ZCJ A;  3AAI A;  2KSR A;  4HWD A;  2LEH A;  2CLY C;  3K1S A;  4OK0 A;  1E1H B;  3FBZ A;  2Q9Q D;  3PUQ A;  4JI7 T;  3ZT7 A;  4IIJ E;  5LGN B;  3ZMU B;  4L5G A;  3UT5 E;  3HA4 A;  3IEE A;  4CI1 B;  4A5X A;  1LVF A;  2CRB A;  2WBL A;  3N9Q A;  3QUJ A;  4KMC A;  4H9Q C;  3RYH E;  4NPP A;  5FVK A;  3VRB A;  3OYX A;  1R8I A;  5HEG A;  1MIV A;  4DO0 A;  2ZM6 T;  5LHH B;  3RX6 A;  2PFV A;  2W61 A;  4CXW A;  2CBJ A;  4CZZ B;  4PK6 A;  5F3J A;  3ZST A;  1N34 T;  5FP3 A;  3AEF A;  2LSI A;  3SS1 A;  4GKK T;  4PK5 A;  4GYR A;  3RIU A;  1AJ3 A;  4X1K E;  2DWK A;  3ZMS B;  4YHH T;  1XMO T;  3LBX B;  1UUR A;  5C3J A;  3LBX A;  2QRX A;  5JRE A;  4JBW F;  4AI6 A;  1HG2 A;  5JR9 C;  2ZM0 A;  4EOZ B;  3OVU A;  4DID B;  4OX9 T;  5FMN A;  4GOU A;  1US7 B;  3RRW A;  1S94 A;  3SOL A;  3RKG A;  4HFD A;  5CFB A;  3KIN B;  2BS2 A;  4JI4 T;  5AFU L;  4HWC A;  3MA9 A;  4DV0 T;  2H3R A;  3V5U A;  3K8P C;  4TX5 A;  3LK2 B;  2HPL A;  3CX6 B;  1MNE A;  3X1D A;  2FJE A;  4EED A;  2BZB A;  2A9U A;  4AQG A;  3KV6 A;  3I9W A;  3C4X A;  4E7Z A;  3Q9D A;  4L9I A;  2DNX A;  3HKB E;  2D5U A;  3RLF F;  3IBP A;  3FBL A;  2KLQ A;  2NP9 A;  2VQF T;  2UXB T;  3RGL A;  3TLV A;  2JPF A;  2XJ7 A;  2L8K A;  4NXN T;  3AEB A;  2FUP A;  3AB3 B;  2MYS A;  3KV5 A;  4IDP A;  1N33 T;  4BJM A;  2VVN A;  3O4X E;  4HKA A;  2BS3 A;  3ONL C;  4EYY R;  1M62 A;  1WLX A;  2DHR A;  3UTK A;  4UV9 B;  3F57 A;  2DLR A;  1OXZ A;  1E7P A;  3CKD A;  5F8P A;  2DI4 A;  4HFB A;  5LBM A;  2J4G A;  4HFC A;  2KND A;  4N78 D;  4IDQ A;  5LG3 A;  3PE0 A;  4ZOL E;  1E2A A;  4IT4 A;  2WU2 A;  5JRC B;  5DAB A;  5JRC A;  2J1D G;  3QB5 A;  2JQH A;  2AE9 A;  1JNR A;  1J1J A;  3C51 A;  4UEL A;  5LBQ B;  1NWM X;  2XZE A;  1HX1 B;  3HI2 A;  2ES0 A;  4JI8 T;  3F2E A;  4DR3 T;  4YHJ A;  5L2L A;  4UF0 B;  2P9B A;  4UF0 A;  5L3B B;  1BR1 A;  3T1H T;  4ERR A;  5JR9 B;  3CX7 B;  5JR9 A;  1MIY A;  5DQV A;  5LHI B;  2UUC T;  1XDP A;  3M65 A;  2VKH A;  4TNW A;  1IZN B;  1OED E;  2M6I A;  2UXN B;  3S4U A;  3UFG A;  2WZH A;  1YQ3 A;  5LMU T;  3J9X 1;  4I0U A;  2KWI B;  2LSG A;  2YDR A;  3VR9 A;  3ZYK A;  1D1A A;  1KF6 A;  2E9X B;  2E9X A;  5C2T A;  4U72 A;  2LSY A;  3OTO T;  5LJM A;  1M7K A;  3RYI E;  5LMN T;  2XAH B;  3UUN A;  2PTF A;  4PJJ A;  5AQT B;  4ZI2 D;  2LRL A;  4H9S E;  4U2Y A;  1MMG A;  3BK9 A;  3AEE A;  4YT0 A;  5KDM C;  1SUM B;  3RH3 A;  3EVY A;  2XY8 B;  3K3N A;  4EZH A;  1UCU A;  4H9O C;  3RHW A;  2V7K A;  3I0O A;  3LFM A;  2FJA A;  4MLK A;  5JVD E;  3ZKR A;  2H89 A;  3SRZ A;  3ZN0 B;  4IHJ E;  3ZN1 B;  2MOZ A;  3ZYM A;  4UR9 A;  3VKH A;  3O9X A;  4QKN A;  5LGT B;  2I0M A;  3VU7 H;  2RP4 A;  4OHF A;  4ZS2 A;  2VKO A;  2LT3 A;  3Q5W A;  5JH7 E;  4QH1 A;  2UUB T;  3I9Y A;  2IW5 B;  2LHN A;  1FMW A;  1MIW A;  1ZOY A;  2WU5 A;  5LGU B;  2XHE B;  4HFH A;  3RF1 A;  2LOP A;  3FXE B;  4DV7 T;  1JNZ A;  3ZCI A;  4MBQ A;  2E5V A;  2E9X D;  2CPT A;  4AKI A;  5GON E;  3KVB A;  2NW9 A;  4EV6 A;  4OYK A;  5HEJ A;  2MBG A;  2J47 A;  1LVK A;  2W63 A;  3PUZ F;  1KFY A;  5AQJ B;  4ASK A;  2D0U A;  2V1D B;  3N5L A;  5IHY A;  4ADZ A;  2VL8 A;  4AIS A;  1KNP A;  2I59 A;  4O4H E;  4X1I E;  2VB6 A;  2XM2 A;  2WMN A;  3HL6 A;  2HPJ A;  4WNK A;  4DR7 T;  2X51 A;  4B3R T;  5HWY A;  3O1H A;  3MKD A;  4DV5 T;  3AEC A;  3P4S A;  1UGO A;  2K3W A;  4HWF A;  4X20 E;  2WZI A;  3PU8 A;  3B5M A;  3VHL A;  5L3E B;  4GYS A;  3L09 A;  2NOX A;  5HXS A;  3R84 B;  4AXP A;  5H6R B;  4DV1 T;  4IDZ A;  4PJM A;  5FKY A;  1UUS A;  1HG5 A;  2H7O A;  4U31 A;  2YKS A;  4F6R C;  2CM0 A;  2NR4 A;  3ZC1 A;  4ANJ A;  4LF5 T;  4XAX B;  3N9L A;  5E0O A;  1QLB A;  2WS3 A;  3PUX F;  1W0B A;  3CVR A;  3RIA A;  1G73 A;  4DR2 T;  4C90 A;  1VCT A;  2YDQ A;  1I94 T;  1GQE A;  2A72 A;  4X62 T;  2X9H A;  2NTX A;  3N9P A;  5FY1 A;  2W67 A;  3A5X A;  2R6G F;  1ZP0 A;  4L0R A;  5CJ5 A;  3N9M A;  5AQS B;  4ZXL A;  2XAJ B;  4P0A A;  1FIO A;  4NUV A;  3H3A A;  5J2T E;  2K24 A;  4HFI A;  3NWI A;  4TUY E;  5JDL A;  2H7V C;  3WI3 A;  2LSJ A;  2D2S A;  1HFA A;  3K3Q C;  2PBI A;  3PU3 A;  5AQM B;  2HN1 A;  4MHC A;  4AQF C;  3D0T A;  4EGW A;  3N9N A;  2YN6 A;  3JC6 C;  3OYZ A;  2LKH A;  1J5E T;  4OFZ A;  3TLW A;  2ACX A;  1Z0P A;  5HXC A;  5FXV A;  4ZI3 C;  4H63 V;  5IUX A;  4HE8 A;  4YLH A;  1T72 A;  4KUM B;  2Y8D A;  3UU6 A;  3ZMV B;  4IST A;  2BG9 B;  5HEH A;  4TV8 E;  2XSB A;  2BG9 A;  1HTJ F;  3CX8 B;  3NVO A;  5FL0 A;  3VR8 A;  1O3X A;  3SWH A;  4P0B A;  2X9W A;  1NEK A;  2CXF A;  2WQY A;  2CEA A;  4K0K T;  3UUX B;  4UVA B;  3QOF A;  5AQF B;  3RC8 A;  4AQY T;  2KIN B;  4KX6 A;  3ZMZ B;  4LF7 T;  4GK0 E;  4EEB A;  3FB2 A;  1XNR T;  4JI1 T;  2B1E A;  4PW8 A;  2Y6X A;  4YTP A;  4ZI7 E;  3SFE A;  3PUA A;  4JLE A;  4UEM A;  3KV9 A;  1MMN A;  2HH7 A;  3FZK B;  3UFE A;  4EYU A;  1N32 T;  4DND A;  2QYW A;  2LJL A;  4HFE A;  3PTR B;  4B3T T;  4KP3 C;  4U3C A;  2RPA A;  2YIN A;  3ONJ A;  3CQG B;  2VVS A;  1XWM A;  3PV0 F;  3IF8 B;  3EAM A;  3PUW F;  3UU8 A;  5C8Y E;  2BKP A;  1I6Z A;  3ETV A;  4G2A A;  1MMD A;  2WSS V;  3GWH A;  3JAE A;  2LHR A;  4LMJ A;  4UIG A;  3KBT A;  3AE1 A;  3H37 A;  2QA7 A;  3W15 B;  4CXX A;  3AA7 B;  4QX7 B;  4P1N A;  2V7M A;  4AQF A;  3AE8 A;  3GA8 A;  3ETU A;  1T7S A;  3ZT5 A;  4F8H A;  2D0T A;  2JJ9 A;  3E08 A;  2CLY B;  2C5K T;  4X64 T;  2LM9 A;  2KWH A;  4G63 A;  4LF6 T;  2JQQ A;  4QH5 A;  2YU1 A;  4B6X A;  5L4H A;  1YD8 G;  4XZC A;  3C4Z A;  3PUS A;  2NWB A;  2JQ9 A;  3V5S A;  3AE5 A;  2XQ9 A;  4DR4 T;  4JI5 T;  1D0Z A;  4AIU A;  4HGA A;  3Q5X A;  4DBQ A;  1UX5 A;  1WYB A;  2PJQ A;  2BDE A;  1FEW A;  5LNK A;  1W09 A;  2H88 A;  2IIU A;  1MMA A;  2AXD S;  2FJD A;  2K9A A;  5L4E A;  2XAS B;  3C50 A;  4JI6 T;  5FYM A;  2LSK A;  4JYA T;  1FJG T;  4YSY A;  2OV9 A;  2OA5 A;  2W66 A;  2RA1 A;  5AQN B;  2V5C A;  4LF8 T;  1KK7 A;  3UUB A;  3BQI A;  5LG4 A;  1D0X A;  3JCF A;  2D9D A;  2CWY A;  2L9Q A;  4CN1 A;  2L3L A;  4EXT A;  4YSX A;  3LG7 A;  3UUL A;  5FNV E;  4X5T A;  3JC6 D;  4TWF A;  2WB5 A;  4H9R C;  4WBO A;  1IBK T;  1X79 A;  4CQI A;  4QXC B;  3P4R A;  2CBI A;  2EHO C;  3KV4 A;  4NUU A;  3BQK A;  2FJB A;  3ZJ2 A;  3CPZ A;  2IHR 1;  3AVS A;  1XNQ T;  1G8X A;  4ISS A;  2XQ3 A;  3B57 A;  3Q2M A;  4U7I A;  4NXM T;  3FZF B;  2XQ6 A;  5KX5 E;  4DMV A;  2YDS A;  5ADX L;  2VWA A;  3N9O A;  2X66 A;  3AE9 A;  2Y48 B;  5FL1 A;  1IAP A;  5J0Z A;  2XUE A;  4QXB B;  4PFO A;  4AKL A;  4I43 B;  3Q5D A;  1YW0 A;  5LOV E;  3ESL A;  3O1J A;  4ZZC A;  2BG9 E;  1U5P A;  3NRX A;  5JDM A;  5TAO A;  4AKH A;  4O2A E;  2PG8 A;  3UUM A;  3TLU A;  3CQX C;  5LYJ E;  5AQV B;  3C64 A;  2CCQ A;  4C91 A;  2WAU A;  4J2C A;  1OED C;  4DR1 T;  3AA6 B;  4DUY T;  2N2N A;  3OBV E;  4UVC B;  4P09 A;  4PK4 A;  3AA1 B;  3L8R A;  3UU3 A;  3RKO A;  1XDO A;  4I4T E;  3OJA A;  3C98 B;  4A98 A;  2JQK A;  3RRC A;  5KXJ A;  4DV4 T;  4GKJ T;  4HWH A;  2E8I A;  1Y01 A;  2B76 A;  4HN9 A;  5FXZ A;  4BJN A;  4YFS A;  4DV3 T;  3ZPO A;  2G0U A;  2XQ7 A;  1HNX T;  2XAF B;  2YK0 A;  5AQH B;  3E0Z A;  2W0G A;  2EHO B;  2VKD A;  4OYJ A;  2EHO A;  3LJC A;  3OPC A;  4Z91 A;  2XQY A;  2LLY A;  2CXD A;  3FHN A;  4ILB A;  3ZEF B;  2C0S A;  3TKL B;  3RYC E;  1YQ4 A;  1ZEE A;  4TZ4 C;  4LFC T;  4DMW A;  1ZHC A;  4B3S T;  2NW7 A;  3U3I A;  2V6X A;  3L3P A;  4CI3 B;  1UK5 A;  1BR4 A;  3PUG A;  2VK9 A;  2CHN A;  1OWA A;  4UXN B;  3AE4 A;  5DJQ C;  4KHP T;  4IL4 A;  2ZLY A;  2WM9 A;  3PDY A;  4GK5 E;  4CN4 A;  2LOS A;  2W62 A;  5AQO B;  4DBR A;  2Z6E A;  4PJN A;  4AKG A;  2N9D A;  1YKH B;  5HEO A;  4BAY B;  4QH4 A;  4IE5 A;  2W00 A;  3ZC0 A;  3HR0 A;  3N2G E;  3MJX A;  4TWH A;  3P50 A;  5ABF B;  3WAJ A;  5ABF A;  2CA5 A;  5CA1 E;  4QXH B;  4O8S A;  2UU9 T;  3EDV A;  3ZT6 A;  1KNR A;  2WCA A;  4Z8X A;  5J2U E;  4BA9 A;  1SHZ C;  1WYC A;  4M1P A;  3RIU C;  1ZV4 X;  2A2F X;  5HCJ A;  3AED A;  1J5W A;  5LHG B;  1CUN A;  1HX8 A;  3AE6 A;  4Z90 A;  2X67 A;  3UU5 A;  4DR6 T;  2V7L A;  5FXX A;  3RPU A;  3HKD E;  2JMK A;  3ANW B;  4EIW A;  3ANW A;  4WZX A;  3N2O A;  2V8S V;  3SFD A;  1NAF A;  3E22 E;  5DQW A;  2MPK A;  1X9B A;  2OLT A;  2ACZ A;  3MZK B;  2VUR A;  4ILU A;  5HEU A;  2WWV A;  4X65 T;  5L47 A;  5ABE A;  3P8C D;  3I1A A;  2IUB A;  4ZZB A;  3K3O A;  5FVL A;  5JDH A;  2M67 A;  2BVM A;  5AQI B;  4V1A v;  3L39 A;  2VAS A;  1V9D A;  4PFP A;  4LF4 T;  4CN6 A;  2UUA T;  2XTL A;  4UVB B;  2ZMA A;  3NRY A;  4O4L E;  3CML A;  1WRD A;  2DWG A;  3P7I A;  1QSD A;  3DTO A;  5HXR A;  4AKR B;  3EHZ A;  4FJO A;  2QGS A;  3KFW X;  5CGM A;  1KNZ A;  2CXL A;  3G06 A; 
#chains in the Genus database with same CATH homology
 5HAX A;  4PAG A;  1MMG A;  2V7J A;  3BK9 A;  1D1B A;  1HCI A;  2K5B B;  2Q9Q B;  5KDM C;  2Q9Q A;  3FXD B;  3RH3 A;  3EVY A;  3U78 A;  3K3N A;  4EZH A;  3QK6 A;  3CWZ B;  4YJ3 E;  1D0Z A;  1UCU A;  4H9O C;  4HGA A;  2V7K A;  5JDG A;  3AVR A;  3Q5X A;  2LE8 A;  3I0O A;  4ZI2 C;  3LFM A;  4DBQ A;  1UX5 A;  4JEU B;  3C4W A;  1WYB A;  5A1L A;  2PJQ A;  4MLK A;  5JVD E;  2BDE A;  2CWO A;  5L3G B;  1FEW A;  4UV8 B;  3AA0 B;  5LNK A;  3SRZ A;  3ZN0 B;  3N2K E;  1LKX A;  2K48 A;  4IHJ E;  5FY7 A;  3ZN1 B;  3AAE B;  3B13 A;  2MOZ A;  2KMF A;  1MMA A;  3ZYM A;  2UXX B;  3VKH A;  1D1C A;  3O9X A;  2K9A A;  4QKN A;  4PNI A;  4ZHQ E;  2XAS B;  1U4Q A;  5LA6 E;  1H7C A;  3C50 A;  4PJL A;  5LGT B;  5FYM A;  4TV9 E;  2LSK A;  3MK7 C;  2WMO A;  3NZP A;  1IJ6 A;  3VU7 H;  5HXE A;  5JDN A;  5L3F B;  2X9X A;  2RP4 A;  3MAC A;  4HEA A;  4OHF A;  5L3D B;  4ZS2 A;  1D0Y A;  2VKO A;  1IJ5 A;  2OA5 A;  2CE7 A;  2RA1 A;  2LT3 A;  3Q5W A;  3IHR A;  5JH7 E;  4CXY A;  1LRZ A;  2X0L B;  5EK2 A;  1KK7 A;  3I9Y A;  3LK4 2;  2ZM2 A;  2EHO D;  3BQI A;  3MXZ A;  1D0X A;  2IW5 B;  5LG4 A;  2LHN A;  1FMW A;  1MIW A;  2CWY A;  2L9Q A;  5LGU B;  5LJN A;  2XHE B;  2L3L A;  5H6Q B;  4EXT A;  2LOP A;  3FXE B;  3LG7 A;  3UUL A;  2ZM8 A;  5FNV E;  3LK3 B;  3JC6 D;  3ZCI A;  4MBQ A;  1BR2 A;  2E9X D;  2KZ7 B;  3O1I A;  4AKI A;  1ZKE A;  5GON E;  3NBX X;  3KVB A;  2NW9 A;  3R6N A;  4H9R C;  4WBO A;  1X79 A;  4CQI A;  3EDU A;  4QXC B;  3RYF E;  4YJ2 E;  1B7T A;  4QX8 B;  3I0Q A;  2EHO C;  4I50 E;  4OYK A;  2MTQ A;  5EZY E;  5JDF A;  2MBG A;  5FXW A;  3BQL A;  3KV4 A;  4NUU A;  2XAQ B;  3BQK A;  1LVK A;  2W63 A;  3ZJ2 A;  4ASK A;  3CPZ A;  2D0U A;  2V1D B;  3N5L A;  5IHY A;  3AVS A;  4ADZ A;  3ZMT B;  1G8X A;  3ZCJ A;  4ISS A;  2VL8 A;  3AAI A;  4WW0 A;  4FI5 A;  3B57 A;  3Q2M A;  2I59 A;  2LEH A;  2E9X C;  2CLY C;  4O4H E;  4X1I E;  4OK0 A;  1E1H B;  3FBZ A;  2Q9Q D;  3OKQ A;  5EK4 A;  2VB6 A;  3PUQ A;  3RC3 A;  3ZLI A;  2WMN A;  3HL6 A;  5KX5 E;  4DMV A;  2HPJ A;  4EB6 E;  4IIJ E;  4WNK A;  5LGN B;  2X51 A;  5HWY A;  3O1H A;  3ZMU B;  4L5G A;  3MKD A;  3UT5 E;  5LCY A;  5ADX L;  2VWA A;  2ODU A;  3HA4 A;  3IEE A;  4CI1 B;  4X20 E;  3N9O A;  1VRB A;  2X66 A;  4WBN E;  5JQG E;  1LVF A;  2Y48 B;  4I55 E;  5LXT E;  3PU8 A;  2WBL A;  3N9Q A;  3VHL A;  1IAP A;  3ZYL A;  2XUE A;  4GYS A;  5L3E B;  3L09 A;  4QXB B;  4PFO A;  4AKL A;  3QUJ A;  2NOX A;  4I43 B;  4KMC A;  4H9Q C;  3R84 B;  3RYH E;  5J1G A;  5HXS A;  4AXP A;  1YW0 A;  5LOV E;  3ESL A;  3OYX A;  2NW8 A;  5H6R B;  3O1J A;  4JUY A;  4IDZ A;  4PJM A;  1HG5 A;  1MIV A;  3EUH A;  4DO0 A;  2H7O A;  2DCF A;  3T8O A;  5LHH B;  3RX6 A;  2PFV A;  2W61 A;  4CXW A;  4CZZ B;  4PK6 A;  5HWX A;  5F3J A;  4F6R C;  1U5P A;  3NRX A;  4A56 A;  5JDM A;  5TAO A;  2CM0 A;  2IAK A;  3CQC B;  3ZC1 A;  2VKJ A;  4AKH A;  4ANJ A;  4O2A E;  5FP3 A;  2PG8 A;  5JDQ A;  2LSI A;  3GMI A;  3SS1 A;  3UUM A;  4XAX B;  3N9L A;  5E0O A;  4PK5 A;  3CQX C;  4GYR A;  5LYJ E;  1AJ3 A;  3C64 A;  2CCQ A;  4IE6 A;  4X1K E;  2N1G A;  2DWK A;  4C91 A;  2SPC A;  2WAU A;  4IE7 A;  4J2C A;  3AA6 B;  3CVR A;  2N2N A;  3ZMS B;  1VOM A;  1G73 A;  3OBV E;  5CB4 E;  1UX4 A;  4C90 A;  4UVC B;  4P09 A;  4PK4 A;  3AA1 B;  3LBX B;  3LBX A;  5JRE A;  4AI6 A;  2A72 A;  3RKO A;  5LP6 E;  2X9H A;  1HG2 A;  5JR9 C;  2NTX A;  4I4T E;  3N9P A;  2ZM0 A;  3OJA A;  3C98 B;  5FY1 A;  4EOZ B;  3A5X A;  5FMN A;  3RRC A;  4L0R A;  3N9M A;  4GOU A;  1US7 B;  3RRW A;  2XAJ B;  3J7Y q;  4P0A A;  1S94 A;  3SOL A;  1FIO A;  5EK3 A;  2E8I A;  4NUV A;  3KIN B;  5HYA A;  4HN9 A;  1FMV A;  5FXZ A;  4BJN A;  4YFS A;  3H3A A;  5AFU L;  3MA9 A;  3ZPO A;  2H3R A;  2G0U A;  5J2T E;  4ZI3 D;  4MFR A;  2K24 A;  1EZ3 A;  2XAF B;  3V5U A;  2YK0 A;  3K8P C;  4TX5 A;  3LK2 B;  2HPL A;  3E0Z A;  4TUY E;  3CX6 B;  5JDL A;  2H7V C;  2W0G A;  1MNE A;  3WI3 A;  2LSJ A;  2GK9 A;  2D2S A;  1HFA A;  1QUU A;  2BZB A;  2PBI A;  3K3Q C;  3PU3 A;  1WR6 A;  2EHO B;  2VKD A;  4OYJ A;  4CI2 B;  4AQG A;  4MHC A;  1BR0 A;  2EHO A;  3I9W A;  2C5J A;  3KV6 A;  3C4X A;  3D0T A;  3LJC A;  4AQF C;  4E7Z A;  3N9N A;  3Q9D A;  4L9I A;  3JC6 C;  3OYZ A;  2XQY A;  3FHN A;  2CXD A;  2DNX A;  3HKB E;  3ZEF B;  2D5U A;  4H9P C;  2C0S A;  3IBP A;  3RYC E;  3TKL B;  3FBL A;  4OFZ A;  2ACX A;  1ZEE A;  1Z0P A;  2KLQ A;  2A3D A;  4TZ4 C;  5HXC A;  2NP9 A;  4DMW A;  5FXV A;  4ZI3 C;  3ZJ1 A;  4H63 V;  1ZHC A;  2NW7 A;  4HE8 A;  3U3I A;  2JPF A;  1SA0 E;  4YLH A;  3KVA A;  2L8K A;  3L3P A;  4CI3 B;  1BR4 A;  4KUM B;  2Y8D A;  3AB3 B;  3PUG A;  2VK9 A;  2MYS A;  2WWU A;  3KV5 A;  1OWA A;  4UXN B;  3ZMV B;  4IST A;  4KBM B;  5DJQ C;  4TV8 E;  4BJM A;  2ZLY A;  1HTJ F;  2WM9 A;  3CX8 B;  3PDY A;  4GK5 E;  3O4X E;  4HKA A;  2LOS A;  2W62 A;  4HFV A;  1O3X A;  2X68 A;  3SWH A;  4DBR A;  2Z6E A;  5BMV E;  4PJN A;  3HKC E;  4P0B A;  4EYY R;  1WLX A;  4AKG A;  2X9W A;  2N9D A;  2DHR A;  1YKH B;  3UTK A;  2Q9Q C;  5FY0 A;  4BAY B;  2KT9 A;  2CXF A;  2W00 A;  4IE5 A;  4UV9 B;  3F57 A;  2CEA A;  3ZC0 A;  3ONX A;  3UUX B;  3HR0 A;  3N2G E;  5L3C B;  4UVA B;  1Y64 B;  2DLR A;  3F31 A;  3MJX A;  2YEV C;  1OXZ A;  3RC8 A;  2KIN B;  3CKD A;  3ZMZ B;  5F8P A;  2DI4 A;  5LBM A;  3WAJ A;  4GK0 E;  2KND A;  4N78 D;  2CA5 A;  5CA1 E;  2IC9 A;  4QXH B;  3KBU A;  2XAG B;  5KMG P;  3FB2 A;  4O8S A;  4QWN B;  3PE0 A;  1YKE B;  2YU2 A;  2B1E A;  4ZOL E;  3HKE E;  3EDV A;  2Y6X A;  4K0U A;  4PW8 A;  3VKG A;  5JRC B;  2BVL A;  5DAB A;  4E7S A;  2JRK A;  4ZI7 E;  5JRC A;  2J1D G;  2IC6 A;  3AAA B;  4H63 H;  4DVD A;  4Z8X A;  3C51 A;  3PUA A;  5ETW A;  5J2U E;  4JLE A;  4BA9 A;  5M4Y A;  1SHZ C;  1WYC A;  4UEM A;  3KV9 A;  4UEL A;  1MMN A;  4M1P A;  5LBQ B;  1NWM X;  4IE4 A;  1ZV4 X;  2A2F X;  2HH7 A;  3UFE A;  2KXP B;  5LHG B;  4EYU A;  1CUN A;  4DND A;  1HX8 A;  4HTE A;  2LJL A;  3HI2 A;  2ES0 A;  2X67 A;  3PTR B;  4EAH A;  2V7L A;  4MAL A;  3F2E A;  4O4J E;  4YHJ A;  4KP3 C;  5FXX A;  5L2L A;  3DP7 A;  4UF0 B;  3RPU A;  2P9B A;  3HKD E;  4UF0 A;  2JMK A;  2YIN A;  3ANW B;  4O4I E;  4EIW A;  2C5I T;  5L3B B;  3ANW A;  1BR1 A;  4IE0 A;  3CQG B;  3N2O A;  4ERR A;  5JR9 B;  3CX7 B;  5JR9 A;  1NAF A;  2X9Y A;  3E22 E;  3GN5 B;  3IF8 B;  5DQW A;  1MIY A;  3GN5 A;  5C8Y E;  5DQV A;  5LHI B;  3M65 A;  4X1Y E;  3ETV A;  4G2A A;  1MMD A;  2VKH A;  1IZN B;  4U74 A;  3MZK B;  2WSS V;  3GWH A;  2ODV A;  4ILU A;  4ZS3 A;  3P8C D;  2UXN B;  4QHO A;  1S35 A;  3I1A A;  3S4U A;  1HF8 A;  2LHR A;  3K3O A;  4UIG A;  3KBT A;  5JDH A;  3J9X 1;  2KWI B;  2M67 A;  2BVM A;  3H37 A;  2QA7 A;  3W15 B;  4CXX A;  3AA7 B;  4GIW A;  4V1A v;  2LSG A;  2VAS A;  4QX7 B;  1V9D A;  5IYZ E;  1HS7 A;  3ZYK A;  2V7M A;  4AQF A;  4PFP A;  1D1A A;  3GA8 A;  3ETU A;  4TN7 B;  2XTL A;  4UVB B;  2D0T A;  2JJ9 A;  3E08 A;  2E9X B;  2CLY B;  2C5K T;  2LM9 A;  2E9X A;  2KWH A;  4G63 A;  5HXH A;  3WAK A;  2CMR A;  2ZMA A;  3NRY A;  4O4L E;  3CML A;  2JQQ A;  1WRD A;  2DWG A;  4U72 A;  2V7I A;  4EZ4 A;  4XBF B;  2LSY A;  5LJM A;  3P7I A;  1QSD A;  3DTO A;  5HXR A;  5CA0 E;  3RYI E;  1T98 A;  2XAH B;  3UUN A;  1MND A;  2V26 A;  2YU1 A;  3NZQ A;  4IGU A;  4AKR B;  4FJO A;  4O2B E;  4B6X A;  2QGS A;  3KFW X;  4PJJ A;  3QC9 A;  1KNZ A;  2CXL A;  1YD8 G;  3PUR A;  4XZC A;  4ZI2 D;  3C4Z A;  3PUS A;  2NWB A;  3DJB A;  4H9S E;  3KDS E;  2NTY A;  3V5S A;  4H9N C;  2JMH A;  4JEH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...