2HH7A

Crystal structure of cu(i) bound csor from mycobacterium tuberculosis.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
85
structure length
85
Chain Sequence
ELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Hypothetical protein CsoR
total genus 34
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2hh7A00
4M1PA 4UIGA 5LCYA 4ADZA 2HH7A 3AAIA 5LBMA 5FMNA
chains in the Genus database with same CATH superfamily
5HCMA 5CFBA 2ZM6T 3AE5A 3IEEA 1D1BA 3BQKA 4UEMA 5LOVE 3UUMA 2XM2A 3TKLB 4JEUB 2EHOA 4TZ4C 3J7Yq 3FBLA 3AA1B 4TV8E 2KLQA 3UUNA 3AA7B 3EABA 4FI5A 4Z8XA 5CA0E 4IHJE 4DR5T 4QH4A 2V5CA 5AQPB 4ERRA 1UX4A 3ZKRA 5FL1A 2W00A 1HNXT 2CBJA 4B6XA 3H37A 1HNZT 1HG2A 2XPKA 4LF7T 4GK5E 2BS2A 2LRKA 4QX8B 2WS3A 3T8OA 5JRCB 2JQKA 3A8YC 3AA0B 3ANWA 5EK4A 3QOFA 1UURA 2CWOA 2ZLYA 1FMWA 5LA6E 4K0UA 3RYFE 4C91A 3CVRA 2Q9QB 2X68A 5TAOA 1WRDA 1IJ5A 2K9AA 2L3LA 3FZKB 1FMVA 5JDQA 2CLYC 3ETUA 4DV3T 4ZZCA 2XM1A 4HFDA 3ZCIA 4EGWA 4JI2T 2V7LA 2ZM0A 2CXLA 1MIVA 3AEFA 3FB2A 3PDYA 3QB5A 4TWHA 3AE1A 5H6QB 3IHRA 4EB6E 3OBVE 3ZC1A 1MIYA 5L3BB 3PUXF 2X0YA 5HEOA 3KBTA 2YKSA 5IWAT 2A3DA 2W62A 1HCIA 4YXDA 5HEHA 2WY2A 4O4JE 2QGSA 2JQHA 5AQJB 2PBIA 3LG7A 3UU8A 1T7SA 5LBMA 2Q9QC 4IDOA 1MMAA 4QKNA 2KNDA 2N2NA 1SUMB 2L9QA 2OLTA 5HCJA 3RX6A 2OV9A 5HEJA 2V5DA 2LE8A 2J62A 2RA1A 4AISA 4B3TT 3O1JA 4G2AA 4L0RA 3CKDA 4A5XA 4X64T 5FXXA 4OHFA 4GYRA 4BAYB 4YTMA 5ETWA 4PK5A 4KUMB 4U31A 4I50E 5AQHB 4IDNA 3CX7B 2FJDA 2UUAT 1HFAA 1D1AA 2D2SA 2AE9A 2ACZA 2X9HA 3ETVA 4U72A 4U2ZA 5A1LA 4X66T 1VOMA 4DUZT 2BZBA 2I59A 4IL9A 2KSRA 3K3OA 3VR8A 3ZMZB 3TLTA 4AIUA 2R6GF 2PG8A 3F2EA 2CE7A 5LB7B 1FJGT 5M4YA 4YT0A 5JDGA 1S94A 2CXFA 3N2GE 3AEGA 4CN4A 3N9LA 3B5MA 5JR9B 2CBIA 4E7SA 4EOZB 5KDMC 4DV1T 4OFZA 3RRWA 2LHRA 3HKBE 3PU8A 3K1SA 4QHOA 1E7PA 2ODUA 2WM9A 2EHOD 2VKJA 2VL8A 4O4IE 3DP7A 4DV2T 2XQ5A 2LSGA 5ABGA 1IBLT 4GKKT 2VKDA 3UULA 5JDFA 4ILCA 1H7CA 2VASA 3LK2B 4L9IA 2XAHB 2I0MA 5HYAA 2QYWA 2BS3A 2V6XA 4IE6A 4YSZA 4ZS2A 4CI3B 5EK3A 3E22E 1FEWA 5F3JA 4CXYA 2W2UA 2WB5A 3MZKB 5LNKA 2NR4A 1LVKA 1W09A 5FMNA 2RPAA 4QXHB 3L8RA 5CGMA 4YY3T 1HX1B 2C5JA 2M67A 2FUPA 3OTOT 3AECA 3N2OA 4QWNB 3VHLA 3JC6D 3UQ7A 1KF6A 5LG3A 1NWMX 1UGOA 5IHYA 3LBXA 3IF8B 1WYBA 3WAKA 4AQYT 5ABFB 1ZHCA 3LJCA 2C5KT 2C5IT 1Z8UA 4A97A 2WCAA 1QLBA 2XAQB 3BK9A 5J1GA 1XMOT 4P0AA 2UXBT 2X51A 3VKGA 4CN6A 3Q5EA 5LGUB 5AQKB 4MLKA 2XQAA 5HWYA 4DR1T 2IC6A 3KV6A 4TWFA 2VVNA 4WZXA 4JI8T 4XZCA 1NEKA 3SFDA 1HG5A 3LBXB 2DI4A 1YKEB 2IC9A 4HFIA 1XDOA 5ABFA 4U74A 1I6ZA 4LFBT 3ABVA 2HPLA 4U2YA 3KVAA 2Q9QD 2MAWA 4EAHA 2PJQA 4NXNT 2YU1A 2XQ7A 2J47A 3UU3A 3OYZA 2N9DA 1Y64B 4U7IA 4DVDA 3I9YA 5FYMA 3N9NA 4DR7T 3MK7C 4ZOLE 3HL6A 3RC3A 1NAFA 2QRXA 3ONLC 3QNUA 5FVKA 3QC9A 3C4XA 2CPTA 2WDVA 1R8IA 5FP3A 3RIFA 4BJMA 3NZPA 2MTQA 4DO0A 1YD8G 2ZM2A 2BDEA 2XAFB 2GK9A 1E2AA 3AEDA 3F57A 4DBQA 2BBHA 3QK6A 3HKDE 2BG9E 2E9XA 4CXWA 4HEAA 4DIDB 5AFUL 5JREA 3AEEA 3CPZA 2CCQA 2WMOA 3AAIA 2FJBA 3MKDA 4HFCA 2DNXA 2XQ9A 4KMCA 1Y01A 4HGAA 4DMVA 5JDNA 2K5BB 2NW7A 2Z6EA 2RP4A 4TV9E 1MIWA 1CUNA 2A9UA 3EDVA 3NWIA 3O1HA 2JQ9A 2MBGA 3FHNA 3R84B 3P4WA 5AQUB 2BVMA 3N9QA 4UF0B 1VCTA 3UFGA 1HTJF 2DWGA 4ZHQE 2X9YA 3V5SA 5LG4A 4QXCB 2UU9T 4JI1T 4XBFB 3W15B 2JIWA 3AE2A 4P1NA 4DBRA 3GN5A 4HTEA 3RHWA 2V6YA 2VK9A 4JI3T 4DV4T 4ASKA 4I4TE 1MMDA 4AKGA 4O4LE 3KBUA 4ISTA 4ILUA 3KV5A 3ZMTB 3OVUA 4WBNE 5L4EA 1X9BA 2NTXA 4LF4T 2CMRA 3H3MA 4X62T 2ODVA 2WDQA 3MACA 3Q5DA 3C98B 3ZT5A 4DV5T 4EZHA 4ADZA 3P4SA 3RKOA 4H9SE 3EUHA 5FY7A 3KINB 4LF6T 3VKHA 2XQ4A 3AE4A 2LEHA 2W63A 3RYHE 3PE0A 2VKHA 4COFA 1LRZA 4CI2B 3JC6C 2DHRA 4JI4T 4KHPT 2CA5A 2X0HA 3B13A 1SHZC 5L3EB 2CRBA 5L2LA 1IBMT 1US7B 5HXHA 3E08A 3AVSA 3ZT6A 5LGTB 2UXCT 4YTNA 1D0YA 1J5WA 2L8KA 2YN6A 3L3PA 3AE3A 5AQGB 4UV9B 3TLUA 5L3GB 1LVFA 1CHUA 1YKHB 4ZI2D 1BR4A 1W0BA 2X9XA 4WYVA 3UUXB 1DU2A 3ZMUB 1KNRA 3FZMB 2E9XB 3N9OA 5LP6E 1YQ3A 2KWHA 3AAEB 1LKXA 2V26A 3KDSE 4IT4A 2WWUA 4P0BA 5HXCA 3SOLA 3T1HT 2LM9A 3RYIE 2VKOA 3EHZA 4DR4T 3ANWB 2XAGB 2UUBT 3Q9DA 3RLFF 3GMIA 2WAUA 3RGLA 1HS7A 3C64A 3RQWA 4PJMA 5CJ5A 4AI6A 2W4XA 2NOXA 3VU7H 1G73A 3N9PA 1YQ4A 3M3ZB 4HFBA 4A56A 4LF5T 1XMQT 4KX6A 5C3JA 1VCSA 3AA6B 3DTOA 3NVOA 1L0VA 5BR8T 3RI5A 4DV7T 4OX9T 3P4PA 2VL0A 2H3RA 5EK2A 2EHOB 2BKPA 2ZMAA 3L39A 2ES0A 5FL0A 3UT5E 4DR6T 4ZS3A 1MMGA 2X67A 4CZZB 2IAKA 3KFWX 2WZHA 3NKZA 3PUGA 2XQ6A 2XZEA 3VR9A 1GQEA 3ZPOA 2WMNA 5LXTE 3ONXA 2VVSA 3SWHA 2CHNA 4GK0E 3J9X1 4EXTA 2LSIA 4IE4A 5L3DB 1ZKEA 5KXJA 2LOPA 3FXDB 3T1YT 2SPCA 3OKQA 3AEBA 1WR6A 2LT3A 3CWZB 2V8SV 5JR9C 2WP9A 3HKEE 2V7MA 4P09A 2V6YB 1G8XA 3GN5B 2JQQA 4AXPA 1YW0A 2VQFT 1UCUA 2WU5A 4MFRA 3SS1A 3WI3A 1KFYA 2FJAA 3KVBA 4JEHB 4TNVA 3AXJB 4UR9A 1B7TA 2LSJA 4PFPA 2BS4A 2LSKA 1WCRA 4TNWA 4LF8T 4AQFC 4H63V 4CN1A 3IBPA 4IDQA 2NP9A 3ZJ1A 1OWAA 4UVCB 2A72A 3OJAA 3PV0F 3RKGA 1ZP0A 5AQOB 1UUSA 4H9RC 3PURA 5AQVB 3P8CD 1JNZA 4EIWA 5LHHB 2LHNA 3C51A 3LDQB 3JAFA 3OPCA 1WFDA 4HKAA 2ZM8A 3NBXX 4HWDA 2UXNB 3ZSTA 1XNQT 1D0ZA 2FJEA 2KINB 2XY8B 5AQNB 2IUBA 2X0LB 5HXRA 2YU2A 2UUCT 3H3AA 3FXEB 4PJLA 4X20E 4JI5T 1JNRA 2J4GA 3FZHB 4QH5A 4I0UA 1N32T 1WR0A 3I0QA 3N2KE 4O4HE 5FVLA 4UELA 2NW9A 1ZOYA 1OEDB 3C50A 5JVDE 4HWCA 2JPFA 3JAEA 2VWAA 3JCFA 3A5XA 3HI2A 2CHOA 4N78D 4WNKA 3ZT7A 1OEDE 3PUSA 2E9XC 4HWIB 4KI0F 4MBQA 5FXVA 3B57A 4LF9T 2LSYA 3C4WA 3NRXA 1N34T 2HH7A 3MXZA 4JV5T 1AJ3A 1O3XA 4JYAT 3LK42 2XASB 4WW0A 3CQGB 4AQFA 5J2TE 2W67A 3ONJA 5AQTB 3ZCJA 1ZV4X 3V5UA 2BKNA 4HN9A 3RIUA 5J2UE 2DL1A 4ZEYA 1S35A 2XHEB 4OYJA 2IIUA 5AQRB 4ZI7E 2LKGA 3QUJA 1W0AA 2H7VC 2YK0A 3IA3A 4HE8A 5LYJE 2CWYA 4H9OC 1HR0T 4IDPA 2WDRA 4MALA 4YFSA 3Q5WA 4EYYR 3RRCA 4ZI3D 5LJNA 2F4VT 1N36T 3ZYLA 3CIRA 1T72A 3R6NA 2B76A 3BQIA 1QUUA 4PAGA 5CA1E 5HWXA 2JMHA 3UQ4A 3ZMVB 2ACXA 5L3CB 1UX5A 2BG9A 3PUAA 4QH1A 3CX8B 4H9PC 3C4ZA 1X79A 5F5WA 3EDUA 2CM0A 2XQYA 3GA8A 3P4QA 4O2AE 4U7YA 2YOEA 5JQGE 2UXXB 2W61A 3ESLA 2K48A 5CB4E 3SFEA 2KT9A 2OA5A 2V7KA 3AE9A 3FZFB 1U4QA 4PW8A 4QX7B 2LM2A 1V9DA 3AE8A 4LFAT 1OEDA 4HFVA 3TLSA 3NZQA 4LMKA 3UU4A 4X1KE 2XAJB 5LCYA 4EEBA 5L47A 2XSBA 4X65T 5C2TA 2XQ3A 2W0GA 1E1HB 4JI7T 2IMLA 4IGUA 3HKCE 4LFCT 4LMLA 2YINA 2JRKA 1KK7A 4H63H 2NTYA 3RIUC 2WZIA 1M7KA 2WBLA 2HN2A 3LFMA 4PFOA 2LKHA 5DJQC 1T8BA 2BKOA 1OEDC 2DCFA 3FZLB 4DV6T 3JADA 1KNPA 3CQXC 2M6IA 4EEDA 4AKHA 4ISSA 4TX5A 4B3MT 1QSDA 3G06A 4O2BE 4U3CA 2JMKA 3CQCB 1KEYA 3ZN1B 2JJ9A 2V1DB 4IE5A 3AE7A 3ZYMA 1IBKT 4U33A 3I9WA 3UU6A 3RPUA 4CQIA 3K3NA 3TLVA 2BG9C 3AXJA 4ILAA 2WQYA 5F8PA 5H6RB 4ZI2C 3K3QC 2D0UA 1BR2A 4GOUA 2Y8DA 3OYXA 2A2FX 1WLXA 2WSSV 2CLYB 4I55E 4X1YE 4YJ3E 5HEGA 3EI0A 3VRBA 4JI0T 5LMUT 4YSYA 3DJBA 2W66A 4H9NC 4WBOA 4HWHA 5LJMA 4DUYT 1N33T 5DABA 1T98A 2XUEA 3PJAA 1HF8A 3QB5K 4PJJA 4BJNA 4PK6A 4Z91A 3PJAJ 4YTPA 3X1DA 2PFVA 2H89A 5LHGB 3PU3A 1ZEEA 5AQIB 5JR9A 4UIGA 1Z0PA 4NPPA 3ZMSB 3AB3B 5HXSA 1IZNB 2IDOB 2KZ7B 3CX6B 3U3IA 4PJNA 5BMVE 4JLEA 2FBWA 4HFHA 3FBZA 5IUXA 4KHZF 3ZC0A 2VB6A 2YEVC 4IE0A 4M1PA 5LBQB 5L3FB 3ZLIA 4OK0A 2BBJA 3P50A 3N9MA 1XZYA 4CXXA 4X1IE 3UUBA 4CI1B 4ANJA 4JBWF 4K0KT 3WAJA 2V7IA 5JTGA 4AKIA 2P9BA 3LK3B 2QA7A 5J0ZA 3S4UA 4B3RT 4TUYE 3LSVA 5JDHA 4NUVA 4TN7B 2D5UA 2LRLA 2H88A 4HWFA 2UXDT 2Q9QA 5JRCA 2YDSA 5C8YE 5ABHA 1M62A 5JDMA 1XDPA 5AQFB 3HR0A 1J1JA 3D0TA 2NWBA 2V7JA 2WU2A 4LMJA 5E0OA 2B1EA 3ZEFB 2YDRA 1W9RA 3EVYA 1VRBA 3RIAA 4KBMB 3TLWA 4JI6T 1OXZA 2Y48B 3K8PC 1BR1A 4AKRB 4BA9A 1BR0A 2LJLA 4HFEA 4A98A 3PUQA 4DV0T 2E8IA 5HXEA 2IW5B 5HEUA 3UTKA 3AE6A 3L09A 2E2AA 4IE7A 2EHOC 2XQ8A 3AVRA 3MJXA 4JUYA 4QXBB 3PUWF 3NRYA 2BG9B 4AQGA 2KMFA 2K24A 2PTFA 1IAPA 2LOSA 4XAXB 1J5ET 3O1IA 2HHHT 4B3ST 3KV9A 4OYKA 4YSXA 2DWKA 3RQUA 4Q25A 3VRAA 1WYCA 2WWVA 1IJ6A 1SE7A 1UK5A 4V1Av 4I43B 5FXWA 2HPJA 2J1DG 3RYCE 4DR2T 4E7ZA 2I6HA 4MHCA 3MA9A 2MOZA 5FXZA 5DQWA 4IIJE 1XWMA 5FNVE 1I94T 5ADXL 5JDLA 5JH7E 1HNWT 3HA4A 4J2CA 5AQMB 3KV4A 4UVBB 3PTRB 2HN1A 3O4XE 3ZN0B 5DQVA 4UV8B 1MMNA 4NXMT 5FY0A 4EV6A 4H9QC 1FIOA 4F6RC 3A7MA 5FKYA 2E9XD 2CEAA 4EYUA 4EZ4A 3E0ZA 4UF0A 4UVAB 1MNDA 2M6BA 3I1AA 3RH3A 3SRZA 5AQLB 3AEAA 4DNDA 4IREA 5AQQB 5KX5E 3Q5XA 2XTLA 2VURA 2Y6XA 2MPKA 3CK6A 4IDZA 4L5GA 5GONE 3UU5A 5LHIB 3CMLA 5LMNT 3AAAB 3N5LA 4GYSA 3M65A 4PNIA 3ZJ2A 3ZYKA 4C90A 2CXDA 2D0TA 4DMWA 4GKJT 1NENA 5IYZE 2C0SA 4TWDA 3UFEA 3F31A 4G63A 1EZ3A 1YXRA 3RF1A 2D9DA 4FJOA 5FY1A 4ILBA 2XSAA 2H7OA 4X5TA 3P4RA 1U5PA 2X9WA 4KP3C 2E5VA 2IHR1 1MNEA 3Q2MA 4UXNB 4ZI3C 4O8SA 5KMGP 4YJ2E 1XNRT 4AKLA 2AXDS 2LLYA 2BVLA 2G0UA 4DR3T 2K3WA 3BQLA 3PUYF 2MYSA 4F8HA 3RC8A 2QVAA 2X66A 2YDQA 4NUUA 3I0OA 3PUZF 4PK4A 3O9XA 1KNZA 5AQSB 3PUVF 3ZSSA 4Z90A 4GIWA 2NW8A 5EZYE 2KWIB 4ZXLA 4YHHT 3P7IA 1D0XA 4ZZBA 2E5LT 3GWHA 2KXPB 1D1CA 1HX8A 1SA0E 2XJ7A 5HAXA 3EAMA 5L4HA 4NIQA 5ABEA 4IL4A 4YLHA 5LGNB 3U78A 2VQET 2DLRA 2N1GA 4YHJA
chains in the Genus database with same CATH topology
3IEEA 1D1BA 3BQKA 4UEMA 5LOVE 3UUMA 3J7Yq 3TKLB 4JEUB 2EHOA 4TZ4C 3FBLA 3AA1B 4TV8E 2KLQA 3UUNA 3AA7B 4FI5A 4Z8XA 5CA0E 4IHJE 4ERRA 1UX4A 2W00A 4B6XA 3H37A 1HG2A 4GK5E 3T8OA 4QX8B 5JRCB 3AA0B 3ANWA 5EK4A 2CWOA 2ZLYA 1FMWA 5LA6E 4K0UA 3RYFE 4C91A 3CVRA 2Q9QB 2X68A 5TAOA 1WRDA 1IJ5A 2K9AA 2L3LA 5JDQA 1FMVA 2CLYC 3ETUA 3ZCIA 2V7LA 2ZM0A 2CXLA 3FB2A 1MIVA 5H6QB 3PDYA 4EB6E 3IHRA 5L3BB 3OBVE 3ZC1A 1MIYA 3KBTA 2A3DA 2W62A 1HCIA 4O4JE 2QGSA 2PBIA 3LG7A 5LBMA 2Q9QC 4QKNA 1MMAA 2KNDA 2N2NA 2L9QA 3RX6A 2LE8A 2RA1A 3O1JA 4G2AA 4L0RA 3CKDA 5FXXA 4OHFA 4GYRA 4BAYB 5ETWA 4PK5A 4KUMB 4I50E 3CX7B 1HFAA 1D1AA 2D2SA 3ETVA 5A1LA 2X9HA 4U72A 1VOMA 2BZBA 2I59A 3K3OA 3ZMZB 2PG8A 3F2EA 2CE7A 5M4YA 5JDGA 1S94A 2CXFA 3N2GE 3N9LA 4E7SA 5KDMC 4EOZB 4OFZA 3RRWA 2LHRA 3HKBE 3PU8A 4QHOA 2ODUA 2WM9A 2EHOD 2VKJA 2VL8A 4O4IE 3DP7A 2LSGA 2VKDA 3UULA 5JDFA 1H7CA 2VASA 3LK2B 4L9IA 2XAHB 5HYAA 4IE6A 4ZS2A 4CI3B 5EK3A 3E22E 1FEWA 5F3JA 4CXYA 3MZKB 5LNKA 1LVKA 5FMNA 4QXHB 2C5JA 2M67A 3N2OA 4QWNB 3VHLA 3JC6D 1NWMX 5IHYA 3LBXA 3IF8B 1WYBA 3WAKA 1ZHCA 3LJCA 2C5KT 2C5IT 4AKHA 4P0AA 2XAQB 3BK9A 5J1GA 3VKGA 2X51A 5LGUB 4MLKA 5HWYA 2IC6A 3KV6A 4XZCA 1HG5A 3LBXB 2DI4A 1YKEB 2IC9A 4U74A 2HPLA 3KVAA 2Q9QD 4EAHA 2PJQA 2YU1A 3OYZA 2N9DA 1Y64B 4DVDA 3I9YA 5FYMA 3N9NA 3MK7C 4ZOLE 3HL6A 3RC3A 1NAFA 3QC9A 3C4XA 4BJMA 1HS7A 5FP3A 3NZPA 2MTQA 4DO0A 1YD8G 2ZM2A 2BDEA 2XAFB 2GK9A 4DBQA 3F57A 3QK6A 3HKDE 2E9XA 4CXWA 4HEAA 5AFUL 5JREA 3CPZA 2CCQA 2WMOA 3AAIA 4KMCA 3MKDA 3UTKA 2DNXA 4DMVA 5JDNA 4HGAA 2K5BB 2NW7A 2Z6EA 2RP4A 4TV9E 1MIWA 1CUNA 3EDVA 3O1HA 2MBGA 3FHNA 3R84B 2BVMA 3N9QA 4UF0B 1HTJF 2DWGA 4ZHQE 2X9YA 3V5SA 5LG4A 4QXCB 4XBFB 3W15B 4DBRA 3GN5A 4HTEA 2VK9A 4AKGA 4ASKA 4I4TE 1MMDA 4O4LE 3KBUA 4ISTA 4ILUA 3KV5A 3ZMTB 4WBNE 2NTXA 2CMRA 2ODVA 3MACA 3C98B 4EZHA 4ADZA 3RKOA 4H9SE 3EUHA 5FY7A 3KINB 3VKHA 2LEHA 2W63A 3RYHE 3PE0A 2VKHA 1LRZA 4CI2B 3JC6C 2DHRA 2CA5A 3B13A 5L2LA 1SHZC 5L3EB 1US7B 5HXHA 3E08A 3AVSA 5LGTB 1D0YA 2L8KA 3L3PA 5L3GB 4UV9B 1LVFA 1YKHB 4ZI2D 1BR4A 2X9XA 3UUXB 3ZMUB 3N9OA 2E9XB 5LP6E 3AAEB 2KWHA 1LKXA 2V26A 3KDSE 4P0BA 2WWUA 5HXCA 3SOLA 2LM9A 3RYIE 2VKOA 3ANWB 2XAGB 3Q9DA 3GMIA 2WAUA 3C64A 4PJMA 4AI6A 2NOXA 3VU7H 1G73A 3N9PA 4A56A 3AA6B 3DTOA 2H3RA 5EK2A 2EHOB 2ZMAA 3UT5E 2ES0A 4ZS3A 1MMGA 2X67A 4CZZB 2IAKA 3KFWX 5HXSA 3PUGA 5JR9B 3ZPOA 2WMNA 5LXTE 3ONXA 3SWHA 4GK0E 3J9X1 4EXTA 2LSIA 4IE4A 5L3DB 1ZKEA 2LOPA 3FXDB 2SPCA 3OKQA 1WR6A 2LT3A 3CWZB 5JR9C 3HKEE 2V7MA 4P09A 1G8XA 3GN5B 2JQQA 4AXPA 1YW0A 1UCUA 4MFRA 3SS1A 3WI3A 3KVBA 4JEHB 1B7TA 2LSJA 4PFPA 4AQFC 2LSKA 4H63V 3IBPA 3ZJ1A 2NP9A 1OWAA 4UVCB 2A72A 3OJAA 4H9RC 3PURA 3P8CD 4EIWA 5LHHB 2LHNA 3C51A 4HKAA 2ZM8A 3NBXX 2UXNB 1D0ZA 5HXRA 2KINB 2X0LB 2YU2A 3H3AA 3FXEB 4PJLA 4X20E 3I0QA 3N2KE 4O4HE 4UELA 2NW9A 3C50A 5JVDE 2JPFA 2VWAA 3A5XA 3HI2A 4N78D 4WNKA 4MBQA 3PUSA 2E9XC 5FXVA 3B57A 2LSYA 3C4WA 3NRXA 2HH7A 3MXZA 1AJ3A 1O3XA 3LK42 2XASB 4WW0A 3CQGB 4AQFA 5J2TE 1ZV4X 3V5UA 4HN9A 5J2UE 1S35A 2XHEB 4OYJA 4ZI7E 3QUJA 5LYJE 2H7VC 2YK0A 4HE8A 2CWYA 4H9OC 4MALA 4YFSA 4EYYR 3Q5WA 4ZI3D 3RRCA 5LJNA 3ZYLA 3R6NA 4PAGA 3BQIA 1QUUA 5CA1E 5HWXA 2JMHA 3ZMVB 2ACXA 5L3CB 1UX5A 3PUAA 3CX8B 4H9PC 3C4ZA 1X79A 3EDUA 2CM0A 2XQYA 3GA8A 4O2AE 5JQGE 2UXXB 2W61A 3ESLA 2K48A 5CB4E 2KT9A 2OA5A 2V7KA 4PW8A 4QX7B 1U4QA 1V9DA 4HFVA 3NZQA 4X1KE 2XAJB 5LCYA 2W0GA 1E1HB 4IGUA 3HKCE 2YINA 2JRKA 1KK7A 4H63H 2NTYA 2WBLA 3LFMA 4PFOA 5DJQC 2DCFA 3CQXC 4ISSA 4TX5A 1QSDA 4O2BE 2JMKA 3CQCB 3ZN1B 3ZYMA 2JJ9A 2V1DB 4IE5A 3I9WA 3RPUA 4CQIA 3K3NA 5F8PA 5H6RB 4ZI2C 3K3QC 2D0UA 1BR2A 4GOUA 2Y8DA 3OYXA 2A2FX 1WLXA 2WSSV 2CLYB 4I55E 4X1YE 4YJ3E 3DJBA 4H9NC 4WBOA 5LJMA 5DABA 1T98A 2XUEA 1HF8A 4PJJA 4BJNA 4PK6A 2PFVA 5LHGB 3PU3A 1ZEEA 5JR9A 4UIGA 1Z0PA 3ZMSB 3AB3B 1IZNB 2KZ7B 3CX6B 5BMVE 3U3IA 4PJNA 4JLEA 3FBZA 3ZC0A 2VB6A 2YEVC 4IE0A 4M1PA 5LBQB 5L3FB 3ZLIA 4OK0A 4CXXA 3RC8A 3N9MA 4CI1B 4X1IE 4ANJA 3WAJA 2V7IA 4AKIA 2P9BA 3LK3B 2QA7A 3S4UA 4TUYE 5JDHA 4NUVA 4TN7B 2D5UA 5JRCA 2Q9QA 5C8YE 5JDMA 3HR0A 3D0TA 2NWBA 2V7JA 5E0OA 3ZEFB 2B1EA 3EVYA 1VRBA 4KBMB 1OXZA 2Y48B 3K8PC 1BR1A 4AKRB 4BA9A 1BR0A 2LJLA 3PUQA 2E8IA 5HXEA 2IW5B 3L09A 4QXBB 4IE7A 2EHOC 3AVRA 3MJXA 4JUYA 4AQGA 3NRYA 2KMFA 2K24A 1IAPA 2LOSA 4XAXB 3O1IA 3KV9A 4OYKA 2DWKA 1WYCA 1IJ6A 4V1Av 4I43B 3RYCE 5FXWA 2HPJA 2J1DG 4E7ZA 4MHCA 3MA9A 2MOZA 5FXZA 5DQWA 4IIJE 5FNVE 5ADXL 5JDLA 5JH7E 3HA4A 4J2CA 3KV4A 4UVBB 3PTRB 3O4XE 3ZN0B 5DQVA 4UV8B 1MMNA 5FY0A 4H9QC 1FIOA 4F6RC 2E9XD 2CEAA 4EYUA 4EZ4A 3E0ZA 4UF0A 4UVAB 1MNDA 3I1AA 3RH3A 3SRZA 4DNDA 5KX5E 3Q5XA 2XTLA 4L5GA 2Y6XA 4IDZA 5GONE 5LHIB 3CMLA 3AAAB 3N5LA 4GYSA 3M65A 4PNIA 3ZJ2A 3ZYKA 4C90A 2CXDA 2D0TA 4DMWA 5IYZE 3UFEA 2C0SA 3ZCJA 3F31A 4G63A 1EZ3A 4FJOA 5FY1A 2H7OA 1U5PA 2X9WA 4KP3C 3Q2MA 4UXNB 1MNEA 4ZI3C 4O8SA 5KMGP 4YJ2E 4AKLA 2BVLA 2G0UA 3BQLA 2MYSA 2X66A 1KNZA 4NUUA 3I0OA 4PK4A 3O9XA 4GIWA 2NW8A 5EZYE 2KWIB 3P7IA 1D0XA 3GWHA 2KXPB 1D1CA 1HX8A 1SA0E 5HAXA 5LGNB 4YLHA 3U78A 2DLRA 2N1GA 4YHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M1P A;  4UIG A;  5LCY A;  4ADZ A;  2HH7 A;  3AAI A;  5LBM A;  5FMN A; 
#chains in the Genus database with same CATH topology
 5HCM A;  5CFB A;  2ZM6 T;  3AE5 A;  3IEE A;  1D1B A;  3BQK A;  4UEM A;  5LOV E;  3UUM A;  2XM2 A;  3TKL B;  4JEU B;  2EHO A;  4TZ4 C;  3J7Y q;  3FBL A;  3AA1 B;  4TV8 E;  2KLQ A;  3UUN A;  3AA7 B;  3EAB A;  4FI5 A;  4Z8X A;  5CA0 E;  4IHJ E;  4DR5 T;  4QH4 A;  2V5C A;  5AQP B;  4ERR A;  1UX4 A;  3ZKR A;  5FL1 A;  2W00 A;  1HNX T;  2CBJ A;  4B6X A;  3H37 A;  1HNZ T;  1HG2 A;  2XPK A;  4LF7 T;  4GK5 E;  2BS2 A;  2LRK A;  4QX8 B;  2WS3 A;  3T8O A;  5JRC B;  2JQK A;  3A8Y C;  3AA0 B;  3ANW A;  5EK4 A;  3QOF A;  1UUR A;  2CWO A;  2ZLY A;  1FMW A;  5LA6 E;  4K0U A;  3RYF E;  4C91 A;  3CVR A;  2Q9Q B;  2X68 A;  5TAO A;  1WRD A;  1IJ5 A;  2K9A A;  2L3L A;  3FZK B;  1FMV A;  5JDQ A;  2CLY C;  3ETU A;  4DV3 T;  4ZZC A;  2XM1 A;  4HFD A;  3ZCI A;  4EGW A;  4JI2 T;  2V7L A;  2ZM0 A;  2CXL A;  1MIV A;  3AEF A;  3FB2 A;  3PDY A;  3QB5 A;  4TWH A;  3AE1 A;  5H6Q B;  3IHR A;  4EB6 E;  3OBV E;  3ZC1 A;  1MIY A;  5L3B B;  3PUX F;  2X0Y A;  5HEO A;  3KBT A;  2YKS A;  5IWA T;  2A3D A;  2W62 A;  1HCI A;  4YXD A;  5HEH A;  2WY2 A;  4O4J E;  2QGS A;  2JQH A;  5AQJ B;  2PBI A;  3LG7 A;  3UU8 A;  1T7S A;  5LBM A;  2Q9Q C;  4IDO A;  1MMA A;  4QKN A;  2KND A;  2N2N A;  1SUM B;  2L9Q A;  2OLT A;  5HCJ A;  3RX6 A;  2OV9 A;  5HEJ A;  2V5D A;  2LE8 A;  2J62 A;  2RA1 A;  4AIS A;  4B3T T;  3O1J A;  4G2A A;  4L0R A;  3CKD A;  4A5X A;  4X64 T;  5FXX A;  4OHF A;  4GYR A;  4BAY B;  4YTM A;  5ETW A;  4PK5 A;  4KUM B;  4U31 A;  4I50 E;  5AQH B;  4IDN A;  3CX7 B;  2FJD A;  2UUA T;  1HFA A;  1D1A A;  2D2S A;  2AE9 A;  2ACZ A;  2X9H A;  3ETV A;  4U72 A;  4U2Z A;  5A1L A;  4X66 T;  1VOM A;  4DUZ T;  2BZB A;  2I59 A;  4IL9 A;  2KSR A;  3K3O A;  3VR8 A;  3ZMZ B;  3TLT A;  4AIU A;  2R6G F;  2PG8 A;  3F2E A;  2CE7 A;  5LB7 B;  1FJG T;  5M4Y A;  4YT0 A;  5JDG A;  1S94 A;  2CXF A;  3N2G E;  3AEG A;  4CN4 A;  3N9L A;  3B5M A;  5JR9 B;  2CBI A;  4E7S A;  4EOZ B;  5KDM C;  4DV1 T;  4OFZ A;  3RRW A;  2LHR A;  3HKB E;  3PU8 A;  3K1S A;  4QHO A;  1E7P A;  2ODU A;  2WM9 A;  2EHO D;  2VKJ A;  2VL8 A;  4O4I E;  3DP7 A;  4DV2 T;  2XQ5 A;  2LSG A;  5ABG A;  1IBL T;  4GKK T;  2VKD A;  3UUL A;  5JDF A;  4ILC A;  1H7C A;  2VAS A;  3LK2 B;  4L9I A;  2XAH B;  2I0M A;  5HYA A;  2QYW A;  2BS3 A;  2V6X A;  4IE6 A;  4YSZ A;  4ZS2 A;  4CI3 B;  5EK3 A;  3E22 E;  1FEW A;  5F3J A;  4CXY A;  2W2U A;  2WB5 A;  3MZK B;  5LNK A;  2NR4 A;  1LVK A;  1W09 A;  5FMN A;  2RPA A;  4QXH B;  3L8R A;  5CGM A;  4YY3 T;  1HX1 B;  2C5J A;  2M67 A;  2FUP A;  3OTO T;  3AEC A;  3N2O A;  4QWN B;  3VHL A;  3JC6 D;  3UQ7 A;  1KF6 A;  5LG3 A;  1NWM X;  1UGO A;  5IHY A;  3LBX A;  3IF8 B;  1WYB A;  3WAK A;  4AQY T;  5ABF B;  1ZHC A;  3LJC A;  2C5K T;  2C5I T;  1Z8U A;  4A97 A;  2WCA A;  1QLB A;  2XAQ B;  3BK9 A;  5J1G A;  1XMO T;  4P0A A;  2UXB T;  2X51 A;  3VKG A;  4CN6 A;  3Q5E A;  5LGU B;  5AQK B;  4MLK A;  2XQA A;  5HWY A;  4DR1 T;  2IC6 A;  3KV6 A;  4TWF A;  2VVN A;  4WZX A;  4JI8 T;  4XZC A;  1NEK A;  3SFD A;  1HG5 A;  3LBX B;  2DI4 A;  1YKE B;  2IC9 A;  4HFI A;  1XDO A;  5ABF A;  4U74 A;  1I6Z A;  4LFB T;  3ABV A;  2HPL A;  4U2Y A;  3KVA A;  2Q9Q D;  2MAW A;  4EAH A;  2PJQ A;  4NXN T;  2YU1 A;  2XQ7 A;  2J47 A;  3UU3 A;  3OYZ A;  2N9D A;  1Y64 B;  4U7I A;  4DVD A;  3I9Y A;  5FYM A;  3N9N A;  4DR7 T;  3MK7 C;  4ZOL E;  3HL6 A;  3RC3 A;  1NAF A;  2QRX A;  3ONL C;  3QNU A;  5FVK A;  3QC9 A;  3C4X A;  2CPT A;  2WDV A;  1R8I A;  5FP3 A;  3RIF A;  4BJM A;  3NZP A;  2MTQ A;  4DO0 A;  1YD8 G;  2ZM2 A;  2BDE A;  2XAF B;  2GK9 A;  1E2A A;  3AED A;  3F57 A;  4DBQ A;  2BBH A;  3QK6 A;  3HKD E;  2BG9 E;  2E9X A;  4CXW A;  4HEA A;  4DID B;  5AFU L;  5JRE A;  3AEE A;  3CPZ A;  2CCQ A;  2WMO A;  3AAI A;  2FJB A;  3MKD A;  4HFC A;  2DNX A;  2XQ9 A;  4KMC A;  1Y01 A;  4HGA A;  4DMV A;  5JDN A;  2K5B B;  2NW7 A;  2Z6E A;  2RP4 A;  4TV9 E;  1MIW A;  1CUN A;  2A9U A;  3EDV A;  3NWI A;  3O1H A;  2JQ9 A;  2MBG A;  3FHN A;  3R84 B;  3P4W A;  5AQU B;  2BVM A;  3N9Q A;  4UF0 B;  1VCT A;  3UFG A;  1HTJ F;  2DWG A;  4ZHQ E;  2X9Y A;  3V5S A;  5LG4 A;  4QXC B;  2UU9 T;  4JI1 T;  4XBF B;  3W15 B;  2JIW A;  3AE2 A;  4P1N A;  4DBR A;  3GN5 A;  4HTE A;  3RHW A;  2V6Y A;  2VK9 A;  4JI3 T;  4DV4 T;  4ASK A;  4I4T E;  1MMD A;  4AKG A;  4O4L E;  3KBU A;  4IST A;  4ILU A;  3KV5 A;  3ZMT B;  3OVU A;  4WBN E;  5L4E A;  1X9B A;  2NTX A;  4LF4 T;  2CMR A;  3H3M A;  4X62 T;  2ODV A;  2WDQ A;  3MAC A;  3Q5D A;  3C98 B;  3ZT5 A;  4DV5 T;  4EZH A;  4ADZ A;  3P4S A;  3RKO A;  4H9S E;  3EUH A;  5FY7 A;  3KIN B;  4LF6 T;  3VKH A;  2XQ4 A;  3AE4 A;  2LEH A;  2W63 A;  3RYH E;  3PE0 A;  2VKH A;  4COF A;  1LRZ A;  4CI2 B;  3JC6 C;  2DHR A;  4JI4 T;  4KHP T;  2CA5 A;  2X0H A;  3B13 A;  1SHZ C;  5L3E B;  2CRB A;  5L2L A;  1IBM T;  1US7 B;  5HXH A;  3E08 A;  3AVS A;  3ZT6 A;  5LGT B;  2UXC T;  4YTN A;  1D0Y A;  1J5W A;  2L8K A;  2YN6 A;  3L3P A;  3AE3 A;  5AQG B;  4UV9 B;  3TLU A;  5L3G B;  1LVF A;  1CHU A;  1YKH B;  4ZI2 D;  1BR4 A;  1W0B A;  2X9X A;  4WYV A;  3UUX B;  1DU2 A;  3ZMU B;  1KNR A;  3FZM B;  2E9X B;  3N9O A;  5LP6 E;  1YQ3 A;  2KWH A;  3AAE B;  1LKX A;  2V26 A;  3KDS E;  4IT4 A;  2WWU A;  4P0B A;  5HXC A;  3SOL A;  3T1H T;  2LM9 A;  3RYI E;  2VKO A;  3EHZ A;  4DR4 T;  3ANW B;  2XAG B;  2UUB T;  3Q9D A;  3RLF F;  3GMI A;  2WAU A;  3RGL A;  1HS7 A;  3C64 A;  3RQW A;  4PJM A;  5CJ5 A;  4AI6 A;  2W4X A;  2NOX A;  3VU7 H;  1G73 A;  3N9P A;  1YQ4 A;  3M3Z B;  4HFB A;  4A56 A;  4LF5 T;  1XMQ T;  4KX6 A;  5C3J A;  1VCS A;  3AA6 B;  3DTO A;  3NVO A;  1L0V A;  5BR8 T;  3RI5 A;  4DV7 T;  4OX9 T;  3P4P A;  2VL0 A;  2H3R A;  5EK2 A;  2EHO B;  2BKP A;  2ZMA A;  3L39 A;  2ES0 A;  5FL0 A;  3UT5 E;  4DR6 T;  4ZS3 A;  1MMG A;  2X67 A;  4CZZ B;  2IAK A;  3KFW X;  2WZH A;  3NKZ A;  3PUG A;  2XQ6 A;  2XZE A;  3VR9 A;  1GQE A;  3ZPO A;  2WMN A;  5LXT E;  3ONX A;  2VVS A;  3SWH A;  2CHN A;  4GK0 E;  3J9X 1;  4EXT A;  2LSI A;  4IE4 A;  5L3D B;  1ZKE A;  5KXJ A;  2LOP A;  3FXD B;  3T1Y T;  2SPC A;  3OKQ A;  3AEB A;  1WR6 A;  2LT3 A;  3CWZ B;  2V8S V;  5JR9 C;  2WP9 A;  3HKE E;  2V7M A;  4P09 A;  2V6Y B;  1G8X A;  3GN5 B;  2JQQ A;  4AXP A;  1YW0 A;  2VQF T;  1UCU A;  2WU5 A;  4MFR A;  3SS1 A;  3WI3 A;  1KFY A;  2FJA A;  3KVB A;  4JEH B;  4TNV A;  3AXJ B;  4UR9 A;  1B7T A;  2LSJ A;  4PFP A;  2BS4 A;  2LSK A;  1WCR A;  4TNW A;  4LF8 T;  4AQF C;  4H63 V;  4CN1 A;  3IBP A;  4IDQ A;  2NP9 A;  3ZJ1 A;  1OWA A;  4UVC B;  2A72 A;  3OJA A;  3PV0 F;  3RKG A;  1ZP0 A;  5AQO B;  1UUS A;  4H9R C;  3PUR A;  5AQV B;  3P8C D;  1JNZ A;  4EIW A;  5LHH B;  2LHN A;  3C51 A;  3LDQ B;  3JAF A;  3OPC A;  1WFD A;  4HKA A;  2ZM8 A;  3NBX X;  4HWD A;  2UXN B;  3ZST A;  1XNQ T;  1D0Z A;  2FJE A;  2KIN B;  2XY8 B;  5AQN B;  2IUB A;  2X0L B;  5HXR A;  2YU2 A;  2UUC T;  3H3A A;  3FXE B;  4PJL A;  4X20 E;  4JI5 T;  1JNR A;  2J4G A;  3FZH B;  4QH5 A;  4I0U A;  1N32 T;  1WR0 A;  3I0Q A;  3N2K E;  4O4H E;  5FVL A;  4UEL A;  2NW9 A;  1ZOY A;  1OED B;  3C50 A;  5JVD E;  4HWC A;  2JPF A;  3JAE A;  2VWA A;  3JCF A;  3A5X A;  3HI2 A;  2CHO A;  4N78 D;  4WNK A;  3ZT7 A;  1OED E;  3PUS A;  2E9X C;  4HWI B;  4KI0 F;  4MBQ A;  5FXV A;  3B57 A;  4LF9 T;  2LSY A;  3C4W A;  3NRX A;  1N34 T;  2HH7 A;  3MXZ A;  4JV5 T;  1AJ3 A;  1O3X A;  4JYA T;  3LK4 2;  2XAS B;  4WW0 A;  3CQG B;  4AQF A;  5J2T E;  2W67 A;  3ONJ A;  5AQT B;  3ZCJ A;  1ZV4 X;  3V5U A;  2BKN A;  4HN9 A;  3RIU A;  5J2U E;  2DL1 A;  4ZEY A;  1S35 A;  2XHE B;  4OYJ A;  2IIU A;  5AQR B;  4ZI7 E;  2LKG A;  3QUJ A;  1W0A A;  2H7V C;  2YK0 A;  3IA3 A;  4HE8 A;  5LYJ E;  2CWY A;  4H9O C;  1HR0 T;  4IDP A;  2WDR A;  4MAL A;  4YFS A;  3Q5W A;  4EYY R;  3RRC A;  4ZI3 D;  5LJN A;  2F4V T;  1N36 T;  3ZYL A;  3CIR A;  1T72 A;  3R6N A;  2B76 A;  3BQI A;  1QUU A;  4PAG A;  5CA1 E;  5HWX A;  2JMH A;  3UQ4 A;  3ZMV B;  2ACX A;  5L3C B;  1UX5 A;  2BG9 A;  3PUA A;  4QH1 A;  3CX8 B;  4H9P C;  3C4Z A;  1X79 A;  5F5W A;  3EDU A;  2CM0 A;  2XQY A;  3GA8 A;  3P4Q A;  4O2A E;  4U7Y A;  2YOE A;  5JQG E;  2UXX B;  2W61 A;  3ESL A;  2K48 A;  5CB4 E;  3SFE A;  2KT9 A;  2OA5 A;  2V7K A;  3AE9 A;  3FZF B;  1U4Q A;  4PW8 A;  4QX7 B;  2LM2 A;  1V9D A;  3AE8 A;  4LFA T;  1OED A;  4HFV A;  3TLS A;  3NZQ A;  4LMK A;  3UU4 A;  4X1K E;  2XAJ B;  5LCY A;  4EEB A;  5L47 A;  2XSB A;  4X65 T;  5C2T A;  2XQ3 A;  2W0G A;  1E1H B;  4JI7 T;  2IML A;  4IGU A;  3HKC E;  4LFC T;  4LML A;  2YIN A;  2JRK A;  1KK7 A;  4H63 H;  2NTY A;  3RIU C;  2WZI A;  1M7K A;  2WBL A;  2HN2 A;  3LFM A;  4PFO A;  2LKH A;  5DJQ C;  1T8B A;  2BKO A;  1OED C;  2DCF A;  3FZL B;  4DV6 T;  3JAD A;  1KNP A;  3CQX C;  2M6I A;  4EED A;  4AKH A;  4ISS A;  4TX5 A;  4B3M T;  1QSD A;  3G06 A;  4O2B E;  4U3C A;  2JMK A;  3CQC B;  1KEY A;  3ZN1 B;  2JJ9 A;  2V1D B;  4IE5 A;  3AE7 A;  3ZYM A;  1IBK T;  4U33 A;  3I9W A;  3UU6 A;  3RPU A;  4CQI A;  3K3N A;  3TLV A;  2BG9 C;  3AXJ A;  4ILA A;  2WQY A;  5F8P A;  5H6R B;  4ZI2 C;  3K3Q C;  2D0U A;  1BR2 A;  4GOU A;  2Y8D A;  3OYX A;  2A2F X;  1WLX A;  2WSS V;  2CLY B;  4I55 E;  4X1Y E;  4YJ3 E;  5HEG A;  3EI0 A;  3VRB A;  4JI0 T;  5LMU T;  4YSY A;  3DJB A;  2W66 A;  4H9N C;  4WBO A;  4HWH A;  5LJM A;  4DUY T;  1N33 T;  5DAB A;  1T98 A;  2XUE A;  3PJA A;  1HF8 A;  3QB5 K;  4PJJ A;  4BJN A;  4PK6 A;  4Z91 A;  3PJA J;  4YTP A;  3X1D A;  2PFV A;  2H89 A;  5LHG B;  3PU3 A;  1ZEE A;  5AQI B;  5JR9 A;  4UIG A;  1Z0P A;  4NPP A;  3ZMS B;  3AB3 B;  5HXS A;  1IZN B;  2IDO B;  2KZ7 B;  3CX6 B;  3U3I A;  4PJN A;  5BMV E;  4JLE A;  2FBW A;  4HFH A;  3FBZ A;  5IUX A;  4KHZ F;  3ZC0 A;  2VB6 A;  2YEV C;  4IE0 A;  4M1P A;  5LBQ B;  5L3F B;  3ZLI A;  4OK0 A;  2BBJ A;  3P50 A;  3N9M A;  1XZY A;  4CXX A;  4X1I E;  3UUB A;  4CI1 B;  4ANJ A;  4JBW F;  4K0K T;  3WAJ A;  2V7I A;  5JTG A;  4AKI A;  2P9B A;  3LK3 B;  2QA7 A;  5J0Z A;  3S4U A;  4B3R T;  4TUY E;  3LSV A;  5JDH A;  4NUV A;  4TN7 B;  2D5U A;  2LRL A;  2H88 A;  4HWF A;  2UXD T;  2Q9Q A;  5JRC A;  2YDS A;  5C8Y E;  5ABH A;  1M62 A;  5JDM A;  1XDP A;  5AQF B;  3HR0 A;  1J1J A;  3D0T A;  2NWB A;  2V7J A;  2WU2 A;  4LMJ A;  5E0O A;  2B1E A;  3ZEF B;  2YDR A;  1W9R A;  3EVY A;  1VRB A;  3RIA A;  4KBM B;  3TLW A;  4JI6 T;  1OXZ A;  2Y48 B;  3K8P C;  1BR1 A;  4AKR B;  4BA9 A;  1BR0 A;  2LJL A;  4HFE A;  4A98 A;  3PUQ A;  4DV0 T;  2E8I A;  5HXE A;  2IW5 B;  5HEU A;  3UTK A;  3AE6 A;  3L09 A;  2E2A A;  4IE7 A;  2EHO C;  2XQ8 A;  3AVR A;  3MJX A;  4JUY A;  4QXB B;  3PUW F;  3NRY A;  2BG9 B;  4AQG A;  2KMF A;  2K24 A;  2PTF A;  1IAP A;  2LOS A;  4XAX B;  1J5E T;  3O1I A;  2HHH T;  4B3S T;  3KV9 A;  4OYK A;  4YSX A;  2DWK A;  3RQU A;  4Q25 A;  3VRA A;  1WYC A;  2WWV A;  1IJ6 A;  1SE7 A;  1UK5 A;  4V1A v;  4I43 B;  5FXW A;  2HPJ A;  2J1D G;  3RYC E;  4DR2 T;  4E7Z A;  2I6H A;  4MHC A;  3MA9 A;  2MOZ A;  5FXZ A;  5DQW A;  4IIJ E;  1XWM A;  5FNV E;  1I94 T;  5ADX L;  5JDL A;  5JH7 E;  1HNW T;  3HA4 A;  4J2C A;  5AQM B;  3KV4 A;  4UVB B;  3PTR B;  2HN1 A;  3O4X E;  3ZN0 B;  5DQV A;  4UV8 B;  1MMN A;  4NXM T;  5FY0 A;  4EV6 A;  4H9Q C;  1FIO A;  4F6R C;  3A7M A;  5FKY A;  2E9X D;  2CEA A;  4EYU A;  4EZ4 A;  3E0Z A;  4UF0 A;  4UVA B;  1MND A;  2M6B A;  3I1A A;  3RH3 A;  3SRZ A;  5AQL B;  3AEA A;  4DND A;  4IRE A;  5AQQ B;  5KX5 E;  3Q5X A;  2XTL A;  2VUR A;  2Y6X A;  2MPK A;  3CK6 A;  4IDZ A;  4L5G A;  5GON E;  3UU5 A;  5LHI B;  3CML A;  5LMN T;  3AAA B;  3N5L A;  4GYS A;  3M65 A;  4PNI A;  3ZJ2 A;  3ZYK A;  4C90 A;  2CXD A;  2D0T A;  4DMW A;  4GKJ T;  1NEN A;  5IYZ E;  2C0S A;  4TWD A;  3UFE A;  3F31 A;  4G63 A;  1EZ3 A;  1YXR A;  3RF1 A;  2D9D A;  4FJO A;  5FY1 A;  4ILB A;  2XSA A;  2H7O A;  4X5T A;  3P4R A;  1U5P A;  2X9W A;  4KP3 C;  2E5V A;  2IHR 1;  1MNE A;  3Q2M A;  4UXN B;  4ZI3 C;  4O8S A;  5KMG P;  4YJ2 E;  1XNR T;  4AKL A;  2AXD S;  2LLY A;  2BVL A;  2G0U A;  4DR3 T;  2K3W A;  3BQL A;  3PUY F;  2MYS A;  4F8H A;  3RC8 A;  2QVA A;  2X66 A;  2YDQ A;  4NUU A;  3I0O A;  3PUZ F;  4PK4 A;  3O9X A;  1KNZ A;  5AQS B;  3PUV F;  3ZSS A;  4Z90 A;  4GIW A;  2NW8 A;  5EZY E;  2KWI B;  4ZXL A;  4YHH T;  3P7I A;  1D0X A;  4ZZB A;  2E5L T;  3GWH A;  2KXP B;  1D1C A;  1HX8 A;  1SA0 E;  2XJ7 A;  5HAX A;  3EAM A;  5L4H A;  4NIQ A;  5ABE A;  4IL4 A;  4YLH A;  5LGN B;  3U78 A;  2VQE T;  2DLR A;  2N1G A;  4YHJ A; 
#chains in the Genus database with same CATH homology
 3IEE A;  1D1B A;  3BQK A;  4UEM A;  5LOV E;  3UUM A;  3J7Y q;  3TKL B;  4JEU B;  2EHO A;  4TZ4 C;  3FBL A;  3AA1 B;  4TV8 E;  2KLQ A;  3UUN A;  3AA7 B;  4FI5 A;  4Z8X A;  5CA0 E;  4IHJ E;  4ERR A;  1UX4 A;  2W00 A;  4B6X A;  3H37 A;  1HG2 A;  4GK5 E;  3T8O A;  4QX8 B;  5JRC B;  3AA0 B;  3ANW A;  5EK4 A;  2CWO A;  2ZLY A;  1FMW A;  5LA6 E;  4K0U A;  3RYF E;  4C91 A;  3CVR A;  2Q9Q B;  2X68 A;  5TAO A;  1WRD A;  1IJ5 A;  2K9A A;  2L3L A;  5JDQ A;  1FMV A;  2CLY C;  3ETU A;  3ZCI A;  2V7L A;  2ZM0 A;  2CXL A;  3FB2 A;  1MIV A;  5H6Q B;  3PDY A;  4EB6 E;  3IHR A;  5L3B B;  3OBV E;  3ZC1 A;  1MIY A;  3KBT A;  2A3D A;  2W62 A;  1HCI A;  4O4J E;  2QGS A;  2PBI A;  3LG7 A;  5LBM A;  2Q9Q C;  4QKN A;  1MMA A;  2KND A;  2N2N A;  2L9Q A;  3RX6 A;  2LE8 A;  2RA1 A;  3O1J A;  4G2A A;  4L0R A;  3CKD A;  5FXX A;  4OHF A;  4GYR A;  4BAY B;  5ETW A;  4PK5 A;  4KUM B;  4I50 E;  3CX7 B;  1HFA A;  1D1A A;  2D2S A;  3ETV A;  5A1L A;  2X9H A;  4U72 A;  1VOM A;  2BZB A;  2I59 A;  3K3O A;  3ZMZ B;  2PG8 A;  3F2E A;  2CE7 A;  5M4Y A;  5JDG A;  1S94 A;  2CXF A;  3N2G E;  3N9L A;  4E7S A;  5KDM C;  4EOZ B;  4OFZ A;  3RRW A;  2LHR A;  3HKB E;  3PU8 A;  4QHO A;  2ODU A;  2WM9 A;  2EHO D;  2VKJ A;  2VL8 A;  4O4I E;  3DP7 A;  2LSG A;  2VKD A;  3UUL A;  5JDF A;  1H7C A;  2VAS A;  3LK2 B;  4L9I A;  2XAH B;  5HYA A;  4IE6 A;  4ZS2 A;  4CI3 B;  5EK3 A;  3E22 E;  1FEW A;  5F3J A;  4CXY A;  3MZK B;  5LNK A;  1LVK A;  5FMN A;  4QXH B;  2C5J A;  2M67 A;  3N2O A;  4QWN B;  3VHL A;  3JC6 D;  1NWM X;  5IHY A;  3LBX A;  3IF8 B;  1WYB A;  3WAK A;  1ZHC A;  3LJC A;  2C5K T;  2C5I T;  4AKH A;  4P0A A;  2XAQ B;  3BK9 A;  5J1G A;  3VKG A;  2X51 A;  5LGU B;  4MLK A;  5HWY A;  2IC6 A;  3KV6 A;  4XZC A;  1HG5 A;  3LBX B;  2DI4 A;  1YKE B;  2IC9 A;  4U74 A;  2HPL A;  3KVA A;  2Q9Q D;  4EAH A;  2PJQ A;  2YU1 A;  3OYZ A;  2N9D A;  1Y64 B;  4DVD A;  3I9Y A;  5FYM A;  3N9N A;  3MK7 C;  4ZOL E;  3HL6 A;  3RC3 A;  1NAF A;  3QC9 A;  3C4X A;  4BJM A;  1HS7 A;  5FP3 A;  3NZP A;  2MTQ A;  4DO0 A;  1YD8 G;  2ZM2 A;  2BDE A;  2XAF B;  2GK9 A;  4DBQ A;  3F57 A;  3QK6 A;  3HKD E;  2E9X A;  4CXW A;  4HEA A;  5AFU L;  5JRE A;  3CPZ A;  2CCQ A;  2WMO A;  3AAI A;  4KMC A;  3MKD A;  3UTK A;  2DNX A;  4DMV A;  5JDN A;  4HGA A;  2K5B B;  2NW7 A;  2Z6E A;  2RP4 A;  4TV9 E;  1MIW A;  1CUN A;  3EDV A;  3O1H A;  2MBG A;  3FHN A;  3R84 B;  2BVM A;  3N9Q A;  4UF0 B;  1HTJ F;  2DWG A;  4ZHQ E;  2X9Y A;  3V5S A;  5LG4 A;  4QXC B;  4XBF B;  3W15 B;  4DBR A;  3GN5 A;  4HTE A;  2VK9 A;  4AKG A;  4ASK A;  4I4T E;  1MMD A;  4O4L E;  3KBU A;  4IST A;  4ILU A;  3KV5 A;  3ZMT B;  4WBN E;  2NTX A;  2CMR A;  2ODV A;  3MAC A;  3C98 B;  4EZH A;  4ADZ A;  3RKO A;  4H9S E;  3EUH A;  5FY7 A;  3KIN B;  3VKH A;  2LEH A;  2W63 A;  3RYH E;  3PE0 A;  2VKH A;  1LRZ A;  4CI2 B;  3JC6 C;  2DHR A;  2CA5 A;  3B13 A;  5L2L A;  1SHZ C;  5L3E B;  1US7 B;  5HXH A;  3E08 A;  3AVS A;  5LGT B;  1D0Y A;  2L8K A;  3L3P A;  5L3G B;  4UV9 B;  1LVF A;  1YKH B;  4ZI2 D;  1BR4 A;  2X9X A;  3UUX B;  3ZMU B;  3N9O A;  2E9X B;  5LP6 E;  3AAE B;  2KWH A;  1LKX A;  2V26 A;  3KDS E;  4P0B A;  2WWU A;  5HXC A;  3SOL A;  2LM9 A;  3RYI E;  2VKO A;  3ANW B;  2XAG B;  3Q9D A;  3GMI A;  2WAU A;  3C64 A;  4PJM A;  4AI6 A;  2NOX A;  3VU7 H;  1G73 A;  3N9P A;  4A56 A;  3AA6 B;  3DTO A;  2H3R A;  5EK2 A;  2EHO B;  2ZMA A;  3UT5 E;  2ES0 A;  4ZS3 A;  1MMG A;  2X67 A;  4CZZ B;  2IAK A;  3KFW X;  5HXS A;  3PUG A;  5JR9 B;  3ZPO A;  2WMN A;  5LXT E;  3ONX A;  3SWH A;  4GK0 E;  3J9X 1;  4EXT A;  2LSI A;  4IE4 A;  5L3D B;  1ZKE A;  2LOP A;  3FXD B;  2SPC A;  3OKQ A;  1WR6 A;  2LT3 A;  3CWZ B;  5JR9 C;  3HKE E;  2V7M A;  4P09 A;  1G8X A;  3GN5 B;  2JQQ A;  4AXP A;  1YW0 A;  1UCU A;  4MFR A;  3SS1 A;  3WI3 A;  3KVB A;  4JEH B;  1B7T A;  2LSJ A;  4PFP A;  4AQF C;  2LSK A;  4H63 V;  3IBP A;  3ZJ1 A;  2NP9 A;  1OWA A;  4UVC B;  2A72 A;  3OJA A;  4H9R C;  3PUR A;  3P8C D;  4EIW A;  5LHH B;  2LHN A;  3C51 A;  4HKA A;  2ZM8 A;  3NBX X;  2UXN B;  1D0Z A;  5HXR A;  2KIN B;  2X0L B;  2YU2 A;  3H3A A;  3FXE B;  4PJL A;  4X20 E;  3I0Q A;  3N2K E;  4O4H E;  4UEL A;  2NW9 A;  3C50 A;  5JVD E;  2JPF A;  2VWA A;  3A5X A;  3HI2 A;  4N78 D;  4WNK A;  4MBQ A;  3PUS A;  2E9X C;  5FXV A;  3B57 A;  2LSY A;  3C4W A;  3NRX A;  2HH7 A;  3MXZ A;  1AJ3 A;  1O3X A;  3LK4 2;  2XAS B;  4WW0 A;  3CQG B;  4AQF A;  5J2T E;  1ZV4 X;  3V5U A;  4HN9 A;  5J2U E;  1S35 A;  2XHE B;  4OYJ A;  4ZI7 E;  3QUJ A;  5LYJ E;  2H7V C;  2YK0 A;  4HE8 A;  2CWY A;  4H9O C;  4MAL A;  4YFS A;  4EYY R;  3Q5W A;  4ZI3 D;  3RRC A;  5LJN A;  3ZYL A;  3R6N A;  4PAG A;  3BQI A;  1QUU A;  5CA1 E;  5HWX A;  2JMH A;  3ZMV B;  2ACX A;  5L3C B;  1UX5 A;  3PUA A;  3CX8 B;  4H9P C;  3C4Z A;  1X79 A;  3EDU A;  2CM0 A;  2XQY A;  3GA8 A;  4O2A E;  5JQG E;  2UXX B;  2W61 A;  3ESL A;  2K48 A;  5CB4 E;  2KT9 A;  2OA5 A;  2V7K A;  4PW8 A;  4QX7 B;  1U4Q A;  1V9D A;  4HFV A;  3NZQ A;  4X1K E;  2XAJ B;  5LCY A;  2W0G A;  1E1H B;  4IGU A;  3HKC E;  2YIN A;  2JRK A;  1KK7 A;  4H63 H;  2NTY A;  2WBL A;  3LFM A;  4PFO A;  5DJQ C;  2DCF A;  3CQX C;  4ISS A;  4TX5 A;  1QSD A;  4O2B E;  2JMK A;  3CQC B;  3ZN1 B;  3ZYM A;  2JJ9 A;  2V1D B;  4IE5 A;  3I9W A;  3RPU A;  4CQI A;  3K3N A;  5F8P A;  5H6R B;  4ZI2 C;  3K3Q C;  2D0U A;  1BR2 A;  4GOU A;  2Y8D A;  3OYX A;  2A2F X;  1WLX A;  2WSS V;  2CLY B;  4I55 E;  4X1Y E;  4YJ3 E;  3DJB A;  4H9N C;  4WBO A;  5LJM A;  5DAB A;  1T98 A;  2XUE A;  1HF8 A;  4PJJ A;  4BJN A;  4PK6 A;  2PFV A;  5LHG B;  3PU3 A;  1ZEE A;  5JR9 A;  4UIG A;  1Z0P A;  3ZMS B;  3AB3 B;  1IZN B;  2KZ7 B;  3CX6 B;  5BMV E;  3U3I A;  4PJN A;  4JLE A;  3FBZ A;  3ZC0 A;  2VB6 A;  2YEV C;  4IE0 A;  4M1P A;  5LBQ B;  5L3F B;  3ZLI A;  4OK0 A;  4CXX A;  3RC8 A;  3N9M A;  4CI1 B;  4X1I E;  4ANJ A;  3WAJ A;  2V7I A;  4AKI A;  2P9B A;  3LK3 B;  2QA7 A;  3S4U A;  4TUY E;  5JDH A;  4NUV A;  4TN7 B;  2D5U A;  5JRC A;  2Q9Q A;  5C8Y E;  5JDM A;  3HR0 A;  3D0T A;  2NWB A;  2V7J A;  5E0O A;  3ZEF B;  2B1E A;  3EVY A;  1VRB A;  4KBM B;  1OXZ A;  2Y48 B;  3K8P C;  1BR1 A;  4AKR B;  4BA9 A;  1BR0 A;  2LJL A;  3PUQ A;  2E8I A;  5HXE A;  2IW5 B;  3L09 A;  4QXB B;  4IE7 A;  2EHO C;  3AVR A;  3MJX A;  4JUY A;  4AQG A;  3NRY A;  2KMF A;  2K24 A;  1IAP A;  2LOS A;  4XAX B;  3O1I A;  3KV9 A;  4OYK A;  2DWK A;  1WYC A;  1IJ6 A;  4V1A v;  4I43 B;  3RYC E;  5FXW A;  2HPJ A;  2J1D G;  4E7Z A;  4MHC A;  3MA9 A;  2MOZ A;  5FXZ A;  5DQW A;  4IIJ E;  5FNV E;  5ADX L;  5JDL A;  5JH7 E;  3HA4 A;  4J2C A;  3KV4 A;  4UVB B;  3PTR B;  3O4X E;  3ZN0 B;  5DQV A;  4UV8 B;  1MMN A;  5FY0 A;  4H9Q C;  1FIO A;  4F6R C;  2E9X D;  2CEA A;  4EYU A;  4EZ4 A;  3E0Z A;  4UF0 A;  4UVA B;  1MND A;  3I1A A;  3RH3 A;  3SRZ A;  4DND A;  5KX5 E;  3Q5X A;  2XTL A;  4L5G A;  2Y6X A;  4IDZ A;  5GON E;  5LHI B;  3CML A;  3AAA B;  3N5L A;  4GYS A;  3M65 A;  4PNI A;  3ZJ2 A;  3ZYK A;  4C90 A;  2CXD A;  2D0T A;  4DMW A;  5IYZ E;  3UFE A;  2C0S A;  3ZCJ A;  3F31 A;  4G63 A;  1EZ3 A;  4FJO A;  5FY1 A;  2H7O A;  1U5P A;  2X9W A;  4KP3 C;  3Q2M A;  4UXN B;  1MNE A;  4ZI3 C;  4O8S A;  5KMG P;  4YJ2 E;  4AKL A;  2BVL A;  2G0U A;  3BQL A;  2MYS A;  2X66 A;  1KNZ A;  4NUU A;  3I0O A;  4PK4 A;  3O9X A;  4GIW A;  2NW8 A;  5EZY E;  2KWI B;  3P7I A;  1D0X A;  3GWH A;  2KXP B;  1D1C A;  1HX8 A;  1SA0 E;  5HAX A;  5LGN B;  4YLH A;  3U78 A;  2DLR A;  2N1G A;  4YHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...