2HH7A

Crystal structure of cu(i) bound csor from mycobacterium tuberculosis.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
85
structure length
85
Chain Sequence
b'ELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein CsoR
molecule tags Unknown function
source organism Mycobacterium tuberculosis
publication title CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator.
pubmed doi rcsb
total genus 34
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2hh7A00
5FMNA 4M1PA 2HH7A 4UIGA 5LCYA 5LBMA 3AAIA 4ADZA
chains in the Genus database with same CATH superfamily
2DLRA 4I0UA 3NZPA 1E7PA 2WCAA 5L4EA 1ZKEA 3EVYA 3LK2B 5AQNB 4H9SE 3CX7B 4O4IE 5FP3A 2A2FX 1XDPA 2BZBA 3WAKA 4UF0B 4EAHA 4X62T 5LB7B 1OXZA 3QOFA 3RIFA 1M62A 2V8SV 4K0UA 3UT5E 5LNKA 2XQYA 3O1JA 3RRCA 3N2OA 5E0OA 3KINB 3OKQA 1XDOA 3FZKB 4NUVA 1MIVA 2IW5B 3SFDA 2VKOA 1U5PA 3ZYMA 2LLYA 2C5KT 3CQGB 4UV9B 2HN1A 2GK9A 3P7IA 4CI1B 4I50E 3CK6A 3ZT7A 2P9BA 2EHOC 2D0TA 4FI5A 3VU7H 3ZT5A 1NEKA 2YU2A 2VL8A 4CQIA 2Y6XA 3AB3B 2WP9A 3Q5EA 3ZCIA 4MBQA 4K0KT 4ERRA 3N9PA 4GYSA 2PTFA 2WDVA 1XWMA 5LGTB 5FXVA 4HFCA 1S94A 4P09A 3KDSE 4HFIA 2W63A 1US7B 3ABVA 5BMVE 2V5DA 4LF8T 4JI7T 3PUGA 2XTLA 2LE8A 2V1DB 2RP4A 2WS3A 3D0TA 3RH3A 3CPZA 3RGLA 1S35A 2VURA 3GMIA 4DO0A 4DMWA 2VB6A 2QGSA 2W0GA 2E5VA 3BK9A 3LBXB 4IL9A 1WR6A 5ABGA 3RX6A 3SWHA 3LFMA 1HNWT 2C5IT 3C4XA 2OV9A 3Q9DA 2IHR1 2UUAT 4B3ST 3LBXA 2JQ9A 3R84B 4U2YA 5JDGA 3A7MA 5J0ZA 1SUMB 3RYIE 1X9BA 3MKDA 2L8KA 2MOZA 3AVSA 4PNIA 3UU6A 3ZYLA 2XJ7A 3Q5WA 1HX8A 3RHWA 3U78A 3CVRA 3FBZA 4TUYE 4NPPA 3SS1A 2RPAA 5L3FB 3I9WA 3NVOA 2D2SA 2BVMA 3AE8A 3I9YA 1N32T 5FKYA 3SOLA 3IHRA 4YJ3E 1N34T 2X9YA 1WLXA 3ANWA 2B76A 3UUNA 5H6RB 3ZSTA 5ABFB 5IHYA 2H7OA 4TWDA 5LBQB 4C91A 3NZQA 5HYAA 2KWHA 2JQQA 4XBFB 2QRXA 5FNVE 5LG3A 2E9XA 3K8PC 3AA0B 1YKEB 4U33A 2QA7A 5JDMA 5JDQA 4YFSA 1MIWA 3NRYA 1YXRA 2ODUA 1VCSA 3AA7B 5L2LA 4YSYA 2QVAA 5F3JA 4NUUA 3CQXC 4YLHA 5HCMA 3ZCJA 3IEEA 4FJOA 2VKHA 5CGMA 3LG7A 1HTJF 2UUCT 1HNXT 4TX5A 4EZ4A 4QKNA 3EABA 1BR2A 2E2AA 4H63V 4PW8A 4IE0A 3GN5A 4HKAA 5ETWA 5FY0A 5TAOA 3RKOA 5J2TE 4Z8XA 2VKJA 3L3PA 1YKHB 3PU8A 3P4WA 2NWBA 4X66T 4JV5T 3AE3A 2UXDT 2CA5A 4IDZA 2CWOA 4MALA 4P1NA 3S4UA 1N36T 2CWYA 3RIAA 1YQ4A 3Q2MA 1HX1B 1CUNA 3N9OA 2KWIB 3T1YT 2EHOD 2C5JA 2WZIA 3B57A 4ZZBA 5ABFA 4DR7T 3DP7A 4NXNT 4TNVA 3CMLA 5IWAT 3WAJA 2PFVA 4IGUA 4E7SA 3UFEA 4YHHT 2CXFA 1VRBA 4WBOA 4HN9A 5F5WA 1KFYA 5AQHB 1D0ZA 4A5XA 1YD8G 3ZT6A 2R6GF 2XQ9A 4H9PC 5JREA 1HNZT 4LF5T 2UXXB 2ACXA 1LVKA 4HGAA 1FMWA 2K3WA 2WWUA 4PK6A 3ZMUB 5CFBA 5HXEA 2J47A 5KDMC 3P4PA 2DWKA 4ILAA 5AQPB 2EHOA 2BG9C 3L8RA 4U31A 2YEVC 4HFEA 3H37A 4KBMB 5FL1A 2AXDS 3EI0A 5DQWA 2WDQA 4H9RC 3T1HT 3AA6B 2NR4A 2CBJA 5AQIB 4YSXA 4ZI7E 4LF7T 2BKPA 1BR0A 3C51A 5JTGA 1BR1A 1KNZA 3MZKB 3FZLB 3KV9A 1EZ3A 2IMLA 3GWHA 4U7YA 3UU5A 1ZV4X 4HWCA 4WYVA 2LT3A 3L09A 3AE1A 2PG8A 4EV6A 3DTOA 2X9HA 4B3RT 2Q9QC 5AQTB 3PUYF 2G0UA 4G63A 2OA5A 4YTPA 2XM2A 3O1IA 4AQFC 2V7JA 4IDPA 1D1BA 2FJBA 3N2KE 3T8OA 3ZC0A 2UXBT 3JADA 1G73A 2L3LA 4O4HE 3NKZA 1IJ5A 3KBTA 1HCIA 4ADZA 2I59A 4DUYT 3Q5XA 5L47A 3OBVE 4A98A 5LHIB 1IBLT 2H88A 3QK6A 1I6ZA 5JR9B 4EYUA 5LJNA 4LFAT 5LOVE 3FZFB 3CIRA 4DR3T 1X79A 2WQYA 4AQYT 2CMRA 3PE0A 1H7CA 3O4XE 2FUPA 3CKDA 4HFDA 4CI2B 4E7ZA 5L3GB 2IUBA 5FXZA 3RYCE 4AKGA 3UU3A 3TKLB 4H9OC 3TLWA 4GK0E 2LSGA 2YN6A 3NRXA 1FMVA 3ONXA 5J2UE 4TN7B 4X64T 2XM1A 3F31A 4ILCA 4ZI2C 3EUHA 2CRBA 1M7KA 3NBXX 2RA1A 4LFBT 5LYJE 2HPJA 3OTOT 4EEDA 5ADXL 1Y64B 1QUUA 4GIWA 2DI4A 4G2AA 5EK4A 3ONJA 3RC3A 3ZJ1A 3UTKA 2YDSA 1HG2A 1L0VA 2YDRA 4KI0F 3KV6A 3J7Yq 2BS4A 4I55E 1XNRT 2LSKA 2X67A 5JDHA 2XQ6A 3E0ZA 5AQGB 2K9AA 3AECA 2BKOA 1O3XA 4IDNA 2JMHA 3G06A 2Q9QA 2KZ7B 2NTYA 2Z6EA 4HWIB 4QHOA 2CLYB 2WY2A 4HE8A 4DBRA 3JAEA 3F2EA 4IE4A 5JDFA 3HR0A 3OYXA 4DUZT 2CEAA 5FY1A 4TZ4C 4Z90A 2MBGA 1QLBA 2SPCA 4B3TT 3L39A 1D1AA 2J62A 4UF0A 3PTRB 4F6RC 5ABHA 3BQIA 3KVBA 1OEDE 3IA3A 4YTNA 1WFDA 1SA0E 4HFVA 4DV1T 4U74A 3RI5A 2FJDA 4LFCT 5FY7A 3AE5A 3AXJB 2KXPB 2VQFT 1KF6A 4PK4A 3RYHE 3AAAB 4IHJE 4ZS3A 4DV5T 3QB5K 2HPLA 4ILUA 4OFZA 5F8PA 4JI4T 5LBMA 2CE7A 1YW0A 4QX8B 1IBKT 1T8BA 1IJ6A 2I0MA 2CCQA 2W66A 5L3CB 2X66A 4JEUB 5AQQB 1HG5A 2Q9QD 2V7IA 2M67A 1NENA 2BDEA 2LOPA 2HN2A 2N2NA 4IE7A 3RQUA 4LMLA 2LKGA 4CXWA 4EYYR 5AFUL 1I94T 3PJAA 5LA6E 2UXNB 2YK0A 2JRKA 4OX9T 2H89A 1UUSA 2CHNA 4OYJA 2FJEA 1D0YA 3P4RA 4U7IA 2JQHA 3V5UA 2X68A 4QWNB 3X1DA 5IUXA 4JI3T 4GK5E 3FBLA 3AEGA 2WMOA 2XQ7A 4OHFA 2OLTA 3MK7C 5HEJA 3C64A 4EEBA 3PUVF 3B5MA 2XAQB 3AE7A 2NP9A 3AEFA 3UU8A 4GOUA 3VHLA 1LRZA 4LMKA 2VVSA 5JRCA 4YY3T 3I0QA 4ILBA 5HCJA 4WBNE 3PDYA 4X1KE 3RKGA 2D5UA 3AE4A 3HKDE 3K3OA 2W00A 4XAXB 5FXWA 4IIJE 2K24A 2BVLA 4DIDB 3ZEFB 2V5CA 3QB5A 4Q25A 4TWHA 1ZOYA 1HS7A 4YXDA 4LMJA 4GYRA 4GKJT 2X51A 1V9DA 1SE7A 2LHRA 4L0RA 4PFPA 3PV0F 4O4JE 3EAMA 2WU5A 3W15B 5GONE 2XUEA 4ZOLE 2LM2A 5AQJB 5AQRB 2BBJA 4O2BE 3UQ7A 3AXJA 3RF1A 4UELA 3HA4A 4B3MT 4M1PA 1FEWA 4U2ZA 2FJAA 4EGWA 2I6HA 1IAPA 4NIQA 1J1JA 4COFA 4DMVA 4DV2T 5EK3A 4WW0A 1ZHCA 3PU3A 2Y48B 2A72A 5CA1E 2DCFA 3FXEB 4U3CA 3K3NA 4CXYA 2WBLA 5H6QB 4BA9A 5BR8T 1AJ3A 3V5SA 4HWFA 5LGNB 2Y8DA 1R8IA 3AAEB 3U3IA 4ZXLA 5JDLA 2BG9E 1JNRA 2CXLA 2Q9QB 3BQKA 4TWFA 4TV8E 4UIGA 5LCYA 5HXHA 5KX5E 4LF9T 5LG4A 4AKHA 3HL6A 1OEDB 3QUJA 3PUSA 1DU2A 3K3QC 3CWZB 2LEHA 2XASB 2HH7A 2E5LT 4MFRA 2H7VC 3A5XA 1Y01A 1MMDA 3FHNA 2UU9T 5LMUT 2ACZA 2JPFA 3CX6B 1OEDA 2J1DG 2J4GA 3AA1B 2W62A 3JC6D 2E9XC 2XQ8A 3MJXA 4ZI3D 3O9XA 3HKBE 2JQKA 2CM0A 1B7TA 3PUXF 4A56A 5AQSB 4CI3B 4O4LE 5DABA 3ESLA 4YJ2E 1Z8UA 3Q5DA 5L3BB 3AE6A 5HAXA 3AEDA 3KBUA 2V26A 5JRCB 1HF8A 3IF8B 3ZSSA 1WYBA 4IL4A 5C3JA 1KEYA 3RIUC 2IC9A 4CXXA 3JAFA 5LJMA 4UVBB 3ZC1A 2LJLA 2V6XA 5L4HA 2KSRA 2YOEA 3FB2A 3ZYKA 4AQGA 4DR2T 3LK3B 4MHCA 3I1AA 5HXSA 3EDUA 2XHEB 3H3AA 3ETUA 5CB4E 2W61A 2WAUA 3N9MA 1KNPA 5AQLB 2PJQA 2YDQA 2IAKA 2MTQA 5L3EB 3N9NA 4PJNA 4AISA 4ANJA 4GKKT 3NWIA 2NW8A 4HFHA 2YINA 4JEHB 2AE9A 3PUWF 4L5GA 3M3ZB 5EZYE 5HEOA 4IDQA 2XSAA 4AIUA 4QXHB 4X1IE 3TLUA 5HWXA 2ZM0A 3O1HA 5JR9C 4P0AA 1N33T 2CBIA 3B13A 4X5TA 4X65T 2VVNA 1NWMX 3OJAA 3EHZA 2H3RA 3ZMSB 3P4QA 4CN1A 3ZN0B 2DNXA 2JIWA 4UEMA 5AQMB 2A9UA 4DR5T 3UQ4A 4LF6T 1UURA 2CPTA 2KNDA 1VCTA 4TV9E 1MNDA 4IT4A 4AQFA 5LHGB 4DR4T 3N9QA 4YHJA 2VK9A 3VRAA 5DJQC 1FJGT 2B1EA 1W0BA 2NOXA 4HWHA 4JI1T 5DQVA 4DV7T 4I43B 2XZEA 4JI5T 4ISSA 2BBHA 5HEHA 2A3DA 5AQKB 4EZHA 1IBMT 3BQLA 3QNUA 4JBWF 3RLFF 4J2CA 4X1YE 2PBIA 2ZLYA 1XMQT 2LRLA 4IE6A 4JI0T 5IYZE 3J9X1 3CQCB 3MXZA 1Z0PA 2EHOB 2UXCT 1ZEEA 5JQGE 1E2AA 2XY8B 4EXTA 4H9NC 2KT9A 3H3MA 2VL0A 4KP3C 3UU4A 1LKXA 2LRKA 2MAWA 1FIOA 4TNWA 5KXJA 4QXCB 4PFOA 4AXPA 3AEEA 2BS3A 1NAFA 2XQ4A 3C4WA 3SFEA 4KUMB 3AEBA 3SRZA 4YSZA 5C8YE 2NTXA 1HR0T 4KHPT 2JJ9A 4ZI3C 1BR4A 2DL1A 3PUAA 2ZM8A 4BJNA 4EOZB 4BAYB 2X0HA 3IBPA 4CN6A 4NXMT 2DWGA 3PUQA 1XZYA 1UGOA 4O2AE 3VKHA 3KFWX 2XQAA 2KLQA 1T98A 2ES0A 2N1GA 3VR9A 4JI8T 2V7LA 1G8XA 3KV4A 3ZMTB 3AAIA 2X9XA 2E9XB 2XQ3A 3E22E 3PJAJ 3F57A 1VOMA 2JMKA 4MLKA 3AEAA 1JNZA 2M6BA 3LSVA 3VRBA 5FMNA 3WI3A 2BKNA 3ZKRA 4EIWA 3ANWB 4F8HA 3TLSA 5JDNA 3OYZA 4I4TE 5CJ5A 1W9RA 5EK2A 3JCFA 1UK5A 1OEDC 2BS2A 5A1LA 3VR8A 2XAHB 4QH4A 1KK7A 2XAJB 3C50A 3JC6C 4JLEA 1WR0A 2KMFA 4PAGA 3RYFE 1J5ET 4KHZF 5JVDE 3ZPOA 1UX5A 3N2GE 4AI6A 1D1CA 3UUMA 2W67A 3OVUA 3OPCA 3HKEE 4ZI2D 4UVCB 5ABEA 4LF4T 4AKRB 1MMNA 5FYMA 5FVLA 5HWYA 5AQUB 3RC8A 2CLYC 4C90A 2WZHA 4IDOA 4DNDA 4ZEYA 3AVRA 5LMNT 2M6IA 1WYCA 2WSSV 2D9DA 3LK42 5LP6E 1CHUA 5C2TA 4BJMA 3VKGA 1SHZC 3MACA 4OK0A 4DV3T 3TLVA 1MMAA 4DV6T 2MYSA 1W09A 3LDQB 4DVDA 4JYAT 1QSDA 1J5WA 2IDOB 3KV5A 4PJMA 4IE5A 3ONLC 4HEAA 4UV8B 2UUBT 4H63H 5FVKA 5HEUA 3HI2A 1T72A 5FL0A 3ZN1B 1T7SA 4DR6T 4HWDA 2V6YA 3I0OA 5JR9A 2V7MA 3FZHB 2VKDA 2VASA 2X0LB 1E1HB 1WCRA 2IC6A 5HXCA 2F4VT 3QC9A 4DV0T 3RQWA 2BG9B 1W0AA 5L3DB 3RRWA 3AE9A 5AQOB 3P8CD 4ZHQE 4DR1T 2WB5A 2XAFB 1IZNB 3N5LA 3P4SA 2LHNA 4QXBB 4X20E 2WWVA 2ODVA 3GA8A 3UUBA 2D0UA 4DBQA 2IIUA 1WRDA 2CHOA 2NW7A 2WDRA 2L9QA 2XSBA 1XNQT 2X9WA 4YT0A 4U72A 3ZMZB 2HHHT 1XMOT 2YKSA 4HTEA 2BG9A 3CX8B 3PURA 3UUXB 4L9IA 2ZM2A 1HFAA 3N9LA 4UVAB 3RIUA 3K1SA 4PJLA 2CXDA 5HEGA 3P50A 2XQ5A 3C4ZA 2N9DA 4HFBA 5LGUB 1ZP0A 4ZS2A 3TLTA 2VQET 4YTMA 3ZJ2A 2V6YB 2WMNA 3KVAA 5LXTE 4KX6A 2K5BB 2LOSA 3FXDB 4O8SA 2W2UA 4P0BA 4ZZCA 3ETVA 4KMCA 3E08A 4QH1A 4AKIA 2DHRA 1LVFA 2WM9A 1MMGA 3DJBA 3ZMVB 4UXNB 5JH7E 2ZM6T 3RPUA 5AQFB 5KMGP 2MPKA 3PUZF 3FZMB 3EDVA 2X0YA 2ZMAA 3C98B 2KINB 3A8YC 2XAGB 4QH5A 5FXXA 1KNRA 2W4XA 5HXRA 3R6NA 4EB6E 3HKCE 4B6XA 4JI6T 1UX4A 2QYWA 4N78D 4XZCA 2LSJA 4UR9A 4Z91A 5CA0E 4JUYA 2C0SA 4IREA 4A97A 4OYKA 3GN5B 2NW9A 2YU1A 3AE2A 4PK5A 2XPKA 4H9QC 5AQVB 1MNEA 3LJCA 4WZXA 5M4YA 5J1GA 1U4QA 2LSYA 3MA9A 4CN4A 4DV4T 2LSIA 1MIYA 4AKLA 3M65A 3UULA 4PJJA 4QX7B 3UFGA 2WU2A 2E9XD 4V1Av 1OWAA 1YQ3A 1D0XA 4CZZB 1GQEA 4ISTA 2V7KA 4WNKA 5LHHB 2K48A 1UCUA 4JI2T 2LKHA 3ZLIA 2LM9A 2FBWA 2VWAA 4ASKA 2E8IA
chains in the Genus database with same CATH topology
2DLRA 3NZPA 1ZKEA 3EVYA 3LK2B 4H9SE 3CX7B 4O4IE 5FP3A 2A2FX 3WAKA 2BZBA 4UF0B 4EAHA 1OXZA 4K0UA 3UT5E 5LNKA 2XQYA 3O1JA 3RRCA 3N2OA 5E0OA 3KINB 3OKQA 2IW5B 4NUVA 1MIVA 2VKOA 1U5PA 3ZYMA 4UV9B 2C5KT 3CQGB 2GK9A 3P7IA 4CI1B 4I50E 2P9BA 2EHOC 2D0TA 4FI5A 3VU7H 2YU2A 2VL8A 4CQIA 2Y6XA 3AB3B 3ZCIA 4MBQA 4ERRA 3N9PA 4GYSA 5LGTB 5FXVA 4P09A 1S94A 3KDSE 2W63A 1US7B 5BMVE 3PUGA 2XTLA 2LE8A 2V1DB 2RP4A 3D0TA 3RH3A 4EYYR 3CPZA 3GMIA 1S35A 4DO0A 4DMWA 2VB6A 2QGSA 2W0GA 3BK9A 3LBXB 1WR6A 3RX6A 3SWHA 3LFMA 2C5IT 3C4XA 3Q9DA 3LBXA 3R84B 5JDGA 3RYIE 3MKDA 2L8KA 2MOZA 3AVSA 4PNIA 3ZYLA 3Q5WA 1HX8A 3U78A 3CVRA 3FBZA 4TUYE 3SS1A 5L3FB 3I9WA 2D2SA 2BVMA 3I9YA 3SOLA 3IHRA 4YJ3E 2X9YA 1WLXA 3ANWA 3UUNA 5H6RB 5IHYA 2H7OA 4C91A 5LBQB 5HYAA 3NZQA 4XBFB 2KWHA 2JQQA 5FNVE 2E9XA 3K8PC 3AA0B 1YKEB 2QA7A 5JDMA 5JDQA 4YFSA 1MIWA 3NRYA 5L2LA 2ODUA 3AA7B 5F3JA 4NUUA 3CQXC 4YLHA 3ZCJA 3IEEA 4FJOA 2VKHA 3LG7A 1HTJF 4TX5A 4EZ4A 4QKNA 1BR2A 4H63V 4PW8A 4IE0A 3GN5A 4HKAA 5ETWA 5FY0A 5TAOA 3RKOA 5J2TE 4Z8XA 2VKJA 3L3PA 1YKHB 3PU8A 2NWBA 2CA5A 4IDZA 2CWOA 4MALA 3S4UA 2CWYA 3Q2MA 3N9OA 1CUNA 2KWIB 2EHOD 2C5JA 3B57A 3DP7A 3CMLA 3WAJA 2PFVA 4IGUA 4E7SA 3UFEA 2CXFA 1VRBA 4WBOA 4HN9A 1D0ZA 1YD8G 4H9PC 5JREA 2UXXB 2ACXA 1LVKA 4HGAA 1FMWA 2WWUA 4PK6A 3ZMUB 5HXEA 5KDMC 2DWKA 2EHOA 2YEVC 3H37A 4KBMB 5DQWA 4H9RC 3AA6B 4ZI7E 1BR0A 3C51A 1KNZA 1BR1A 3MZKB 3KV9A 1EZ3A 3GWHA 1ZV4X 2LT3A 3L09A 2PG8A 3DTOA 2X9HA 2Q9QC 2G0UA 4G63A 2OA5A 3O1IA 4AQFC 2V7JA 1D1BA 3N2KE 3T8OA 3ZC0A 4O4HE 1G73A 2L3LA 4ADZA 1IJ5A 3KBTA 1HCIA 2I59A 3Q5XA 3OBVE 5LHIB 3QK6A 5JR9B 4EYUA 5LJNA 5LOVE 1X79A 2CMRA 3PE0A 1H7CA 3O4XE 3CKDA 4CI2B 4E7ZA 5L3GB 5FXZA 3RYCE 4AKGA 3TKLB 4H9OC 4GK0E 2LSGA 3NRXA 3ONXA 1FMVA 5J2UE 4TN7B 3F31A 4ZI2C 3EUHA 3NBXX 2RA1A 5LYJE 2HPJA 5ADXL 1Y64B 1QUUA 4GIWA 2DI4A 4G2AA 5EK4A 3RC3A 3ZJ1A 3UTKA 3J7Yq 1HG2A 3KV6A 4I55E 2LSKA 2X67A 5JDHA 3E0ZA 2K9AA 1O3XA 2JMHA 2Q9QA 2KZ7B 2NTYA 2Z6EA 4QHOA 2CLYB 4HE8A 4DBRA 3F2EA 4IE4A 5JDFA 3HR0A 3OYXA 2CEAA 5FY1A 4TZ4C 2MBGA 2SPCA 1D1AA 4UF0A 3PTRB 4F6RC 3BQIA 3KVBA 1SA0E 4HFVA 4U74A 5FY7A 2KXPB 3RYHE 3AAAB 4IHJE 4ZS3A 2HPLA 4ILUA 4OFZA 5F8PA 5LBMA 2CE7A 1YW0A 4QX8B 1IJ6A 5L3CB 2CCQA 2X66A 4JEUB 1HG5A 2Q9QD 2V7IA 2M67A 2BDEA 2LOPA 2N2NA 4IE7A 4CXWA 5AFUL 5LA6E 2UXNB 2YK0A 2JRKA 4OYJA 1D0YA 3V5UA 2X68A 4QWNB 4GK5E 3FBLA 2WMOA 4OHFA 3MK7C 3C64A 2XAQB 2NP9A 4GOUA 3VHLA 1LRZA 5JRCA 3I0QA 4WBNE 3PDYA 4X1KE 4ZI2D 2D5UA 3HKDE 3K3OA 2W00A 4XAXB 5FXWA 4IIJE 2K24A 2BVLA 3ZEFB 4GYRA 2X51A 1V9DA 2LHRA 4L0RA 4PFPA 4O4JE 3W15B 5GONE 2XUEA 4ZOLE 4O2BE 4UELA 3HA4A 4M1PA 1FEWA 1IAPA 4DMVA 5EK3A 4WW0A 1ZHCA 3PU3A 2Y48B 2A72A 5CA1E 2DCFA 3FXEB 3K3NA 4CXYA 2WBLA 5H6QB 4BA9A 1AJ3A 3V5SA 5LGNB 2Y8DA 3AAEB 3U3IA 5JDLA 2Q9QB 2CXLA 5KX5E 3BQKA 4UIGA 4TV8E 5LCYA 5HXHA 5LG4A 4AKHA 3HL6A 3QUJA 3PUSA 3K3QC 3CWZB 2LEHA 2XASB 2HH7A 4MFRA 2H7VC 3A5XA 1MMDA 3FHNA 2JPFA 3CX6B 2J1DG 3AA1B 2W62A 3JC6D 2E9XC 3MJXA 4ZI3D 3O9XA 3HKBE 4A56A 2CM0A 1B7TA 4YJ2E 4CI3B 5A1LA 5L3BB 4O4LE 5DABA 3ESLA 4P0AA 5HAXA 3KBUA 2V26A 5JRCB 1HF8A 3IF8B 1WYBA 2IC9A 4CXXA 5LJMA 4UVBB 3ZC1A 2LJLA 3ZYKA 3FB2A 4AQGA 3LK3B 4MHCA 3I1AA 5HXSA 3EDUA 2XHEB 3H3AA 3ETUA 5CB4E 2W61A 2WAUA 3N9MA 2PJQA 2IAKA 2MTQA 5L3EB 3N9NA 4PJNA 4ANJA 2NW8A 4JEHB 2YINA 4L5GA 5EZYE 1HS7A 5JR9C 4QXHB 4X1IE 5HWXA 2ZM0A 3O1HA 3B13A 3OJAA 1NWMX 2H3RA 3ZMSB 3ZN0B 2DNXA 4UEMA 2KNDA 4TV9E 4AQFA 1MNDA 5LHGB 3N9QA 4YHJA 2VK9A 5DJQC 2B1EA 2NOXA 5DQVA 4I43B 4ISSA 2A3DA 4EZHA 3BQLA 4J2CA 4X1YE 2PBIA 2ZLYA 4IE6A 5IYZE 3J9X1 3CQCB 3MXZA 1Z0PA 2EHOB 1ZEEA 5JQGE 4EXTA 4H9NC 2KT9A 4KP3C 1LKXA 1FIOA 4QXCB 4PFOA 4AXPA 3C4WA 1NAFA 5C8YE 3SRZA 4KUMB 2NTXA 2JJ9A 4ZI3C 1BR4A 3PUAA 2ZM8A 4BJNA 4EOZB 4BAYB 3IBPA 3VKHA 2DWGA 3PUQA 4O2AE 3KFWX 2KLQA 1T98A 2ES0A 2N1GA 2V7LA 1G8XA 3KV4A 3ZMTB 3AAIA 2X9XA 2E9XB 3E22E 4MLKA 3F57A 1VOMA 2JMKA 3WI3A 5FMNA 4EIWA 3ANWB 5JDNA 3OYZA 4I4TE 5EK2A 2XAHB 1KK7A 2XAJB 3C50A 3JC6C 4JLEA 4PAGA 2KMFA 3RYFE 5JVDE 3ZPOA 1UX5A 3N2GE 4AI6A 1D1CA 3UUMA 3HKEE 4UVCB 4AKRB 1MMNA 5FYMA 5HWYA 3RC8A 2CLYC 4C90A 4DNDA 3AVRA 1WYCA 2WSSV 3LK42 5LP6E 3VKGA 4BJMA 1SHZC 3MACA 4OK0A 1MMAA 2MYSA 4DVDA 1QSDA 3KV5A 4PJMA 4IE5A 4HEAA 4UV8B 4H63H 3HI2A 3ZN1B 3I0OA 5JR9A 2V7MA 2VKDA 2VASA 2X0LB 1E1HB 2IC6A 5HXCA 3QC9A 5L3DB 3RRWA 3P8CD 4ZHQE 3N5LA 2XAFB 1IZNB 4QXBB 2LHNA 4DBQA 4X20E 2ODVA 3GA8A 2D0UA 2NW7A 1WRDA 2L9QA 2X9WA 4U72A 3ZMZB 4HTEA 3CX8B 3PURA 3UUXB 4L9IA 2ZM2A 1HFAA 3N9LA 4UVAB 4PJLA 2CXDA 3C4ZA 2N9DA 5LGUB 4ZS2A 3ZJ2A 2WMNA 3KVAA 5LXTE 2K5BB 2LOSA 3FXDB 4O8SA 4P0BA 3ETVA 4KMCA 3E08A 4AKIA 2DHRA 1LVFA 2WM9A 1MMGA 3DJBA 3ZMVB 4UXNB 5JH7E 3RPUA 5KMGP 3EDVA 3C98B 2ZMAA 2KINB 2XAGB 5FXXA 3R6NA 4EB6E 5HXRA 3HKCE 4B6XA 1UX4A 4N78D 4XZCA 2LSJA 5CA0E 4JUYA 2C0SA 4OYKA 3GN5B 2NW9A 2YU1A 4PK5A 4H9QC 1MNEA 3LJCA 5M4YA 5J1GA 1U4QA 2LSYA 3MA9A 2LSIA 1MIYA 4AKLA 3M65A 3UULA 4PJJA 4QX7B 2E9XD 4V1Av 1OWAA 1D0XA 4CZZB 4ISTA 4WNKA 2V7KA 5LHHB 2K48A 1UCUA 3ZLIA 2LM9A 4PK4A 2VWAA 4ASKA 2E8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FMN A;  4M1P A;  2HH7 A;  4UIG A;  5LCY A;  5LBM A;  3AAI A;  4ADZ A; 
#chains in the Genus database with same CATH topology
 2DLR A;  4I0U A;  3NZP A;  1E7P A;  2WCA A;  5L4E A;  1ZKE A;  3EVY A;  3LK2 B;  5AQN B;  4H9S E;  3CX7 B;  4O4I E;  5FP3 A;  2A2F X;  1XDP A;  2BZB A;  3WAK A;  4UF0 B;  4EAH A;  4X62 T;  5LB7 B;  1OXZ A;  3QOF A;  3RIF A;  1M62 A;  2V8S V;  4K0U A;  3UT5 E;  5LNK A;  2XQY A;  3O1J A;  3RRC A;  3N2O A;  5E0O A;  3KIN B;  3OKQ A;  1XDO A;  3FZK B;  4NUV A;  1MIV A;  2IW5 B;  3SFD A;  2VKO A;  1U5P A;  3ZYM A;  2LLY A;  2C5K T;  3CQG B;  4UV9 B;  2HN1 A;  2GK9 A;  3P7I A;  4CI1 B;  4I50 E;  3CK6 A;  3ZT7 A;  2P9B A;  2EHO C;  2D0T A;  4FI5 A;  3VU7 H;  3ZT5 A;  1NEK A;  2YU2 A;  2VL8 A;  4CQI A;  2Y6X A;  3AB3 B;  2WP9 A;  3Q5E A;  3ZCI A;  4MBQ A;  4K0K T;  4ERR A;  3N9P A;  4GYS A;  2PTF A;  2WDV A;  1XWM A;  5LGT B;  5FXV A;  4HFC A;  1S94 A;  4P09 A;  3KDS E;  4HFI A;  2W63 A;  1US7 B;  3ABV A;  5BMV E;  2V5D A;  4LF8 T;  4JI7 T;  3PUG A;  2XTL A;  2LE8 A;  2V1D B;  2RP4 A;  2WS3 A;  3D0T A;  3RH3 A;  3CPZ A;  3RGL A;  1S35 A;  2VUR A;  3GMI A;  4DO0 A;  4DMW A;  2VB6 A;  2QGS A;  2W0G A;  2E5V A;  3BK9 A;  3LBX B;  4IL9 A;  1WR6 A;  5ABG A;  3RX6 A;  3SWH A;  3LFM A;  1HNW T;  2C5I T;  3C4X A;  2OV9 A;  3Q9D A;  2IHR 1;  2UUA T;  4B3S T;  3LBX A;  2JQ9 A;  3R84 B;  4U2Y A;  5JDG A;  3A7M A;  5J0Z A;  1SUM B;  3RYI E;  1X9B A;  3MKD A;  2L8K A;  2MOZ A;  3AVS A;  4PNI A;  3UU6 A;  3ZYL A;  2XJ7 A;  3Q5W A;  1HX8 A;  3RHW A;  3U78 A;  3CVR A;  3FBZ A;  4TUY E;  4NPP A;  3SS1 A;  2RPA A;  5L3F B;  3I9W A;  3NVO A;  2D2S A;  2BVM A;  3AE8 A;  3I9Y A;  1N32 T;  5FKY A;  3SOL A;  3IHR A;  4YJ3 E;  1N34 T;  2X9Y A;  1WLX A;  3ANW A;  2B76 A;  3UUN A;  5H6R B;  3ZST A;  5ABF B;  5IHY A;  2H7O A;  4TWD A;  5LBQ B;  4C91 A;  3NZQ A;  5HYA A;  2KWH A;  2JQQ A;  4XBF B;  2QRX A;  5FNV E;  5LG3 A;  2E9X A;  3K8P C;  3AA0 B;  1YKE B;  4U33 A;  2QA7 A;  5JDM A;  5JDQ A;  4YFS A;  1MIW A;  3NRY A;  1YXR A;  2ODU A;  1VCS A;  3AA7 B;  5L2L A;  4YSY A;  2QVA A;  5F3J A;  4NUU A;  3CQX C;  4YLH A;  5HCM A;  3ZCJ A;  3IEE A;  4FJO A;  2VKH A;  5CGM A;  3LG7 A;  1HTJ F;  2UUC T;  1HNX T;  4TX5 A;  4EZ4 A;  4QKN A;  3EAB A;  1BR2 A;  2E2A A;  4H63 V;  4PW8 A;  4IE0 A;  3GN5 A;  4HKA A;  5ETW A;  5FY0 A;  5TAO A;  3RKO A;  5J2T E;  4Z8X A;  2VKJ A;  3L3P A;  1YKH B;  3PU8 A;  3P4W A;  2NWB A;  4X66 T;  4JV5 T;  3AE3 A;  2UXD T;  2CA5 A;  4IDZ A;  2CWO A;  4MAL A;  4P1N A;  3S4U A;  1N36 T;  2CWY A;  3RIA A;  1YQ4 A;  3Q2M A;  1HX1 B;  1CUN A;  3N9O A;  2KWI B;  3T1Y T;  2EHO D;  2C5J A;  2WZI A;  3B57 A;  4ZZB A;  5ABF A;  4DR7 T;  3DP7 A;  4NXN T;  4TNV A;  3CML A;  5IWA T;  3WAJ A;  2PFV A;  4IGU A;  4E7S A;  3UFE A;  4YHH T;  2CXF A;  1VRB A;  4WBO A;  4HN9 A;  5F5W A;  1KFY A;  5AQH B;  1D0Z A;  4A5X A;  1YD8 G;  3ZT6 A;  2R6G F;  2XQ9 A;  4H9P C;  5JRE A;  1HNZ T;  4LF5 T;  2UXX B;  2ACX A;  1LVK A;  4HGA A;  1FMW A;  2K3W A;  2WWU A;  4PK6 A;  3ZMU B;  5CFB A;  5HXE A;  2J47 A;  5KDM C;  3P4P A;  2DWK A;  4ILA A;  5AQP B;  2EHO A;  2BG9 C;  3L8R A;  4U31 A;  2YEV C;  4HFE A;  3H37 A;  4KBM B;  5FL1 A;  2AXD S;  3EI0 A;  5DQW A;  2WDQ A;  4H9R C;  3T1H T;  3AA6 B;  2NR4 A;  2CBJ A;  5AQI B;  4YSX A;  4ZI7 E;  4LF7 T;  2BKP A;  1BR0 A;  3C51 A;  5JTG A;  1BR1 A;  1KNZ A;  3MZK B;  3FZL B;  3KV9 A;  1EZ3 A;  2IML A;  3GWH A;  4U7Y A;  3UU5 A;  1ZV4 X;  4HWC A;  4WYV A;  2LT3 A;  3L09 A;  3AE1 A;  2PG8 A;  4EV6 A;  3DTO A;  2X9H A;  4B3R T;  2Q9Q C;  5AQT B;  3PUY F;  2G0U A;  4G63 A;  2OA5 A;  4YTP A;  2XM2 A;  3O1I A;  4AQF C;  2V7J A;  4IDP A;  1D1B A;  2FJB A;  3N2K E;  3T8O A;  3ZC0 A;  2UXB T;  3JAD A;  1G73 A;  2L3L A;  4O4H E;  3NKZ A;  1IJ5 A;  3KBT A;  1HCI A;  4ADZ A;  2I59 A;  4DUY T;  3Q5X A;  5L47 A;  3OBV E;  4A98 A;  5LHI B;  1IBL T;  2H88 A;  3QK6 A;  1I6Z A;  5JR9 B;  4EYU A;  5LJN A;  4LFA T;  5LOV E;  3FZF B;  3CIR A;  4DR3 T;  1X79 A;  2WQY A;  4AQY T;  2CMR A;  3PE0 A;  1H7C A;  3O4X E;  2FUP A;  3CKD A;  4HFD A;  4CI2 B;  4E7Z A;  5L3G B;  2IUB A;  5FXZ A;  3RYC E;  4AKG A;  3UU3 A;  3TKL B;  4H9O C;  3TLW A;  4GK0 E;  2LSG A;  2YN6 A;  3NRX A;  1FMV A;  3ONX A;  5J2U E;  4TN7 B;  4X64 T;  2XM1 A;  3F31 A;  4ILC A;  4ZI2 C;  3EUH A;  2CRB A;  1M7K A;  3NBX X;  2RA1 A;  4LFB T;  5LYJ E;  2HPJ A;  3OTO T;  4EED A;  5ADX L;  1Y64 B;  1QUU A;  4GIW A;  2DI4 A;  4G2A A;  5EK4 A;  3ONJ A;  3RC3 A;  3ZJ1 A;  3UTK A;  2YDS A;  1HG2 A;  1L0V A;  2YDR A;  4KI0 F;  3KV6 A;  3J7Y q;  2BS4 A;  4I55 E;  1XNR T;  2LSK A;  2X67 A;  5JDH A;  2XQ6 A;  3E0Z A;  5AQG B;  2K9A A;  3AEC A;  2BKO A;  1O3X A;  4IDN A;  2JMH A;  3G06 A;  2Q9Q A;  2KZ7 B;  2NTY A;  2Z6E A;  4HWI B;  4QHO A;  2CLY B;  2WY2 A;  4HE8 A;  4DBR A;  3JAE A;  3F2E A;  4IE4 A;  5JDF A;  3HR0 A;  3OYX A;  4DUZ T;  2CEA A;  5FY1 A;  4TZ4 C;  4Z90 A;  2MBG A;  1QLB A;  2SPC A;  4B3T T;  3L39 A;  1D1A A;  2J62 A;  4UF0 A;  3PTR B;  4F6R C;  5ABH A;  3BQI A;  3KVB A;  1OED E;  3IA3 A;  4YTN A;  1WFD A;  1SA0 E;  4HFV A;  4DV1 T;  4U74 A;  3RI5 A;  2FJD A;  4LFC T;  5FY7 A;  3AE5 A;  3AXJ B;  2KXP B;  2VQF T;  1KF6 A;  4PK4 A;  3RYH E;  3AAA B;  4IHJ E;  4ZS3 A;  4DV5 T;  3QB5 K;  2HPL A;  4ILU A;  4OFZ A;  5F8P A;  4JI4 T;  5LBM A;  2CE7 A;  1YW0 A;  4QX8 B;  1IBK T;  1T8B A;  1IJ6 A;  2I0M A;  2CCQ A;  2W66 A;  5L3C B;  2X66 A;  4JEU B;  5AQQ B;  1HG5 A;  2Q9Q D;  2V7I A;  2M67 A;  1NEN A;  2BDE A;  2LOP A;  2HN2 A;  2N2N A;  4IE7 A;  3RQU A;  4LML A;  2LKG A;  4CXW A;  4EYY R;  5AFU L;  1I94 T;  3PJA A;  5LA6 E;  2UXN B;  2YK0 A;  2JRK A;  4OX9 T;  2H89 A;  1UUS A;  2CHN A;  4OYJ A;  2FJE A;  1D0Y A;  3P4R A;  4U7I A;  2JQH A;  3V5U A;  2X68 A;  4QWN B;  3X1D A;  5IUX A;  4JI3 T;  4GK5 E;  3FBL A;  3AEG A;  2WMO A;  2XQ7 A;  4OHF A;  2OLT A;  3MK7 C;  5HEJ A;  3C64 A;  4EEB A;  3PUV F;  3B5M A;  2XAQ B;  3AE7 A;  2NP9 A;  3AEF A;  3UU8 A;  4GOU A;  3VHL A;  1LRZ A;  4LMK A;  2VVS A;  5JRC A;  4YY3 T;  3I0Q A;  4ILB A;  5HCJ A;  4WBN E;  3PDY A;  4X1K E;  3RKG A;  2D5U A;  3AE4 A;  3HKD E;  3K3O A;  2W00 A;  4XAX B;  5FXW A;  4IIJ E;  2K24 A;  2BVL A;  4DID B;  3ZEF B;  2V5C A;  3QB5 A;  4Q25 A;  4TWH A;  1ZOY A;  1HS7 A;  4YXD A;  4LMJ A;  4GYR A;  4GKJ T;  2X51 A;  1V9D A;  1SE7 A;  2LHR A;  4L0R A;  4PFP A;  3PV0 F;  4O4J E;  3EAM A;  2WU5 A;  3W15 B;  5GON E;  2XUE A;  4ZOL E;  2LM2 A;  5AQJ B;  5AQR B;  2BBJ A;  4O2B E;  3UQ7 A;  3AXJ A;  3RF1 A;  4UEL A;  3HA4 A;  4B3M T;  4M1P A;  1FEW A;  4U2Z A;  2FJA A;  4EGW A;  2I6H A;  1IAP A;  4NIQ A;  1J1J A;  4COF A;  4DMV A;  4DV2 T;  5EK3 A;  4WW0 A;  1ZHC A;  3PU3 A;  2Y48 B;  2A72 A;  5CA1 E;  2DCF A;  3FXE B;  4U3C A;  3K3N A;  4CXY A;  2WBL A;  5H6Q B;  4BA9 A;  5BR8 T;  1AJ3 A;  3V5S A;  4HWF A;  5LGN B;  2Y8D A;  1R8I A;  3AAE B;  3U3I A;  4ZXL A;  5JDL A;  2BG9 E;  1JNR A;  2CXL A;  2Q9Q B;  3BQK A;  4TWF A;  4TV8 E;  4UIG A;  5LCY A;  5HXH A;  5KX5 E;  4LF9 T;  5LG4 A;  4AKH A;  3HL6 A;  1OED B;  3QUJ A;  3PUS A;  1DU2 A;  3K3Q C;  3CWZ B;  2LEH A;  2XAS B;  2HH7 A;  2E5L T;  4MFR A;  2H7V C;  3A5X A;  1Y01 A;  1MMD A;  3FHN A;  2UU9 T;  5LMU T;  2ACZ A;  2JPF A;  3CX6 B;  1OED A;  2J1D G;  2J4G A;  3AA1 B;  2W62 A;  3JC6 D;  2E9X C;  2XQ8 A;  3MJX A;  4ZI3 D;  3O9X A;  3HKB E;  2JQK A;  2CM0 A;  1B7T A;  3PUX F;  4A56 A;  5AQS B;  4CI3 B;  4O4L E;  5DAB A;  3ESL A;  4YJ2 E;  1Z8U A;  3Q5D A;  5L3B B;  3AE6 A;  5HAX A;  3AED A;  3KBU A;  2V26 A;  5JRC B;  1HF8 A;  3IF8 B;  3ZSS A;  1WYB A;  4IL4 A;  5C3J A;  1KEY A;  3RIU C;  2IC9 A;  4CXX A;  3JAF A;  5LJM A;  4UVB B;  3ZC1 A;  2LJL A;  2V6X A;  5L4H A;  2KSR A;  2YOE A;  3FB2 A;  3ZYK A;  4AQG A;  4DR2 T;  3LK3 B;  4MHC A;  3I1A A;  5HXS A;  3EDU A;  2XHE B;  3H3A A;  3ETU A;  5CB4 E;  2W61 A;  2WAU A;  3N9M A;  1KNP A;  5AQL B;  2PJQ A;  2YDQ A;  2IAK A;  2MTQ A;  5L3E B;  3N9N A;  4PJN A;  4AIS A;  4ANJ A;  4GKK T;  3NWI A;  2NW8 A;  4HFH A;  2YIN A;  4JEH B;  2AE9 A;  3PUW F;  4L5G A;  3M3Z B;  5EZY E;  5HEO A;  4IDQ A;  2XSA A;  4AIU A;  4QXH B;  4X1I E;  3TLU A;  5HWX A;  2ZM0 A;  3O1H A;  5JR9 C;  4P0A A;  1N33 T;  2CBI A;  3B13 A;  4X5T A;  4X65 T;  2VVN A;  1NWM X;  3OJA A;  3EHZ A;  2H3R A;  3ZMS B;  3P4Q A;  4CN1 A;  3ZN0 B;  2DNX A;  2JIW A;  4UEM A;  5AQM B;  2A9U A;  4DR5 T;  3UQ4 A;  4LF6 T;  1UUR A;  2CPT A;  2KND A;  1VCT A;  4TV9 E;  1MND A;  4IT4 A;  4AQF A;  5LHG B;  4DR4 T;  3N9Q A;  4YHJ A;  2VK9 A;  3VRA A;  5DJQ C;  1FJG T;  2B1E A;  1W0B A;  2NOX A;  4HWH A;  4JI1 T;  5DQV A;  4DV7 T;  4I43 B;  2XZE A;  4JI5 T;  4ISS A;  2BBH A;  5HEH A;  2A3D A;  5AQK B;  4EZH A;  1IBM T;  3BQL A;  3QNU A;  4JBW F;  3RLF F;  4J2C A;  4X1Y E;  2PBI A;  2ZLY A;  1XMQ T;  2LRL A;  4IE6 A;  4JI0 T;  5IYZ E;  3J9X 1;  3CQC B;  3MXZ A;  1Z0P A;  2EHO B;  2UXC T;  1ZEE A;  5JQG E;  1E2A A;  2XY8 B;  4EXT A;  4H9N C;  2KT9 A;  3H3M A;  2VL0 A;  4KP3 C;  3UU4 A;  1LKX A;  2LRK A;  2MAW A;  1FIO A;  4TNW A;  5KXJ A;  4QXC B;  4PFO A;  4AXP A;  3AEE A;  2BS3 A;  1NAF A;  2XQ4 A;  3C4W A;  3SFE A;  4KUM B;  3AEB A;  3SRZ A;  4YSZ A;  5C8Y E;  2NTX A;  1HR0 T;  4KHP T;  2JJ9 A;  4ZI3 C;  1BR4 A;  2DL1 A;  3PUA A;  2ZM8 A;  4BJN A;  4EOZ B;  4BAY B;  2X0H A;  3IBP A;  4CN6 A;  4NXM T;  2DWG A;  3PUQ A;  1XZY A;  1UGO A;  4O2A E;  3VKH A;  3KFW X;  2XQA A;  2KLQ A;  1T98 A;  2ES0 A;  2N1G A;  3VR9 A;  4JI8 T;  2V7L A;  1G8X A;  3KV4 A;  3ZMT B;  3AAI A;  2X9X A;  2E9X B;  2XQ3 A;  3E22 E;  3PJA J;  3F57 A;  1VOM A;  2JMK A;  4MLK A;  3AEA A;  1JNZ A;  2M6B A;  3LSV A;  3VRB A;  5FMN A;  3WI3 A;  2BKN A;  3ZKR A;  4EIW A;  3ANW B;  4F8H A;  3TLS A;  5JDN A;  3OYZ A;  4I4T E;  5CJ5 A;  1W9R A;  5EK2 A;  3JCF A;  1UK5 A;  1OED C;  2BS2 A;  5A1L A;  3VR8 A;  2XAH B;  4QH4 A;  1KK7 A;  2XAJ B;  3C50 A;  3JC6 C;  4JLE A;  1WR0 A;  2KMF A;  4PAG A;  3RYF E;  1J5E T;  4KHZ F;  5JVD E;  3ZPO A;  1UX5 A;  3N2G E;  4AI6 A;  1D1C A;  3UUM A;  2W67 A;  3OVU A;  3OPC A;  3HKE E;  4ZI2 D;  4UVC B;  5ABE A;  4LF4 T;  4AKR B;  1MMN A;  5FYM A;  5FVL A;  5HWY A;  5AQU B;  3RC8 A;  2CLY C;  4C90 A;  2WZH A;  4IDO A;  4DND A;  4ZEY A;  3AVR A;  5LMN T;  2M6I A;  1WYC A;  2WSS V;  2D9D A;  3LK4 2;  5LP6 E;  1CHU A;  5C2T A;  4BJM A;  3VKG A;  1SHZ C;  3MAC A;  4OK0 A;  4DV3 T;  3TLV A;  1MMA A;  4DV6 T;  2MYS A;  1W09 A;  3LDQ B;  4DVD A;  4JYA T;  1QSD A;  1J5W A;  2IDO B;  3KV5 A;  4PJM A;  4IE5 A;  3ONL C;  4HEA A;  4UV8 B;  2UUB T;  4H63 H;  5FVK A;  5HEU A;  3HI2 A;  1T72 A;  5FL0 A;  3ZN1 B;  1T7S A;  4DR6 T;  4HWD A;  2V6Y A;  3I0O A;  5JR9 A;  2V7M A;  3FZH B;  2VKD A;  2VAS A;  2X0L B;  1E1H B;  1WCR A;  2IC6 A;  5HXC A;  2F4V T;  3QC9 A;  4DV0 T;  3RQW A;  2BG9 B;  1W0A A;  5L3D B;  3RRW A;  3AE9 A;  5AQO B;  3P8C D;  4ZHQ E;  4DR1 T;  2WB5 A;  2XAF B;  1IZN B;  3N5L A;  3P4S A;  2LHN A;  4QXB B;  4X20 E;  2WWV A;  2ODV A;  3GA8 A;  3UUB A;  2D0U A;  4DBQ A;  2IIU A;  1WRD A;  2CHO A;  2NW7 A;  2WDR A;  2L9Q A;  2XSB A;  1XNQ T;  2X9W A;  4YT0 A;  4U72 A;  3ZMZ B;  2HHH T;  1XMO T;  2YKS A;  4HTE A;  2BG9 A;  3CX8 B;  3PUR A;  3UUX B;  4L9I A;  2ZM2 A;  1HFA A;  3N9L A;  4UVA B;  3RIU A;  3K1S A;  4PJL A;  2CXD A;  5HEG A;  3P50 A;  2XQ5 A;  3C4Z A;  2N9D A;  4HFB A;  5LGU B;  1ZP0 A;  4ZS2 A;  3TLT A;  2VQE T;  4YTM A;  3ZJ2 A;  2V6Y B;  2WMN A;  3KVA A;  5LXT E;  4KX6 A;  2K5B B;  2LOS A;  3FXD B;  4O8S A;  2W2U A;  4P0B A;  4ZZC A;  3ETV A;  4KMC A;  3E08 A;  4QH1 A;  4AKI A;  2DHR A;  1LVF A;  2WM9 A;  1MMG A;  3DJB A;  3ZMV B;  4UXN B;  5JH7 E;  2ZM6 T;  3RPU A;  5AQF B;  5KMG P;  2MPK A;  3PUZ F;  3FZM B;  3EDV A;  2X0Y A;  2ZMA A;  3C98 B;  2KIN B;  3A8Y C;  2XAG B;  4QH5 A;  5FXX A;  1KNR A;  2W4X A;  5HXR A;  3R6N A;  4EB6 E;  3HKC E;  4B6X A;  4JI6 T;  1UX4 A;  2QYW A;  4N78 D;  4XZC A;  2LSJ A;  4UR9 A;  4Z91 A;  5CA0 E;  4JUY A;  2C0S A;  4IRE A;  4A97 A;  4OYK A;  3GN5 B;  2NW9 A;  2YU1 A;  3AE2 A;  4PK5 A;  2XPK A;  4H9Q C;  5AQV B;  1MNE A;  3LJC A;  4WZX A;  5M4Y A;  5J1G A;  1U4Q A;  2LSY A;  3MA9 A;  4CN4 A;  4DV4 T;  2LSI A;  1MIY A;  4AKL A;  3M65 A;  3UUL A;  4PJJ A;  4QX7 B;  3UFG A;  2WU2 A;  2E9X D;  4V1A v;  1OWA A;  1YQ3 A;  1D0X A;  4CZZ B;  1GQE A;  4IST A;  2V7K A;  4WNK A;  5LHH B;  2K48 A;  1UCU A;  4JI2 T;  2LKH A;  3ZLI A;  2LM9 A;  2FBW A;  2VWA A;  4ASK A;  2E8I A; 
#chains in the Genus database with same CATH homology
 2DLR A;  3NZP A;  1ZKE A;  3EVY A;  3LK2 B;  4H9S E;  3CX7 B;  4O4I E;  5FP3 A;  2A2F X;  3WAK A;  2BZB A;  4UF0 B;  4EAH A;  1OXZ A;  4K0U A;  3UT5 E;  5LNK A;  2XQY A;  3O1J A;  3RRC A;  3N2O A;  5E0O A;  3KIN B;  3OKQ A;  2IW5 B;  4NUV A;  1MIV A;  2VKO A;  1U5P A;  3ZYM A;  4UV9 B;  2C5K T;  3CQG B;  2GK9 A;  3P7I A;  4CI1 B;  4I50 E;  2P9B A;  2EHO C;  2D0T A;  4FI5 A;  3VU7 H;  2YU2 A;  2VL8 A;  4CQI A;  2Y6X A;  3AB3 B;  3ZCI A;  4MBQ A;  4ERR A;  3N9P A;  4GYS A;  5LGT B;  5FXV A;  4P09 A;  1S94 A;  3KDS E;  2W63 A;  1US7 B;  5BMV E;  3PUG A;  2XTL A;  2LE8 A;  2V1D B;  2RP4 A;  3D0T A;  3RH3 A;  4EYY R;  3CPZ A;  3GMI A;  1S35 A;  4DO0 A;  4DMW A;  2VB6 A;  2QGS A;  2W0G A;  3BK9 A;  3LBX B;  1WR6 A;  3RX6 A;  3SWH A;  3LFM A;  2C5I T;  3C4X A;  3Q9D A;  3LBX A;  3R84 B;  5JDG A;  3RYI E;  3MKD A;  2L8K A;  2MOZ A;  3AVS A;  4PNI A;  3ZYL A;  3Q5W A;  1HX8 A;  3U78 A;  3CVR A;  3FBZ A;  4TUY E;  3SS1 A;  5L3F B;  3I9W A;  2D2S A;  2BVM A;  3I9Y A;  3SOL A;  3IHR A;  4YJ3 E;  2X9Y A;  1WLX A;  3ANW A;  3UUN A;  5H6R B;  5IHY A;  2H7O A;  4C91 A;  5LBQ B;  5HYA A;  3NZQ A;  4XBF B;  2KWH A;  2JQQ A;  5FNV E;  2E9X A;  3K8P C;  3AA0 B;  1YKE B;  2QA7 A;  5JDM A;  5JDQ A;  4YFS A;  1MIW A;  3NRY A;  5L2L A;  2ODU A;  3AA7 B;  5F3J A;  4NUU A;  3CQX C;  4YLH A;  3ZCJ A;  3IEE A;  4FJO A;  2VKH A;  3LG7 A;  1HTJ F;  4TX5 A;  4EZ4 A;  4QKN A;  1BR2 A;  4H63 V;  4PW8 A;  4IE0 A;  3GN5 A;  4HKA A;  5ETW A;  5FY0 A;  5TAO A;  3RKO A;  5J2T E;  4Z8X A;  2VKJ A;  3L3P A;  1YKH B;  3PU8 A;  2NWB A;  2CA5 A;  4IDZ A;  2CWO A;  4MAL A;  3S4U A;  2CWY A;  3Q2M A;  3N9O A;  1CUN A;  2KWI B;  2EHO D;  2C5J A;  3B57 A;  3DP7 A;  3CML A;  3WAJ A;  2PFV A;  4IGU A;  4E7S A;  3UFE A;  2CXF A;  1VRB A;  4WBO A;  4HN9 A;  1D0Z A;  1YD8 G;  4H9P C;  5JRE A;  2UXX B;  2ACX A;  1LVK A;  4HGA A;  1FMW A;  2WWU A;  4PK6 A;  3ZMU B;  5HXE A;  5KDM C;  2DWK A;  2EHO A;  2YEV C;  3H37 A;  4KBM B;  5DQW A;  4H9R C;  3AA6 B;  4ZI7 E;  1BR0 A;  3C51 A;  1KNZ A;  1BR1 A;  3MZK B;  3KV9 A;  1EZ3 A;  3GWH A;  1ZV4 X;  2LT3 A;  3L09 A;  2PG8 A;  3DTO A;  2X9H A;  2Q9Q C;  2G0U A;  4G63 A;  2OA5 A;  3O1I A;  4AQF C;  2V7J A;  1D1B A;  3N2K E;  3T8O A;  3ZC0 A;  4O4H E;  1G73 A;  2L3L A;  4ADZ A;  1IJ5 A;  3KBT A;  1HCI A;  2I59 A;  3Q5X A;  3OBV E;  5LHI B;  3QK6 A;  5JR9 B;  4EYU A;  5LJN A;  5LOV E;  1X79 A;  2CMR A;  3PE0 A;  1H7C A;  3O4X E;  3CKD A;  4CI2 B;  4E7Z A;  5L3G B;  5FXZ A;  3RYC E;  4AKG A;  3TKL B;  4H9O C;  4GK0 E;  2LSG A;  3NRX A;  3ONX A;  1FMV A;  5J2U E;  4TN7 B;  3F31 A;  4ZI2 C;  3EUH A;  3NBX X;  2RA1 A;  5LYJ E;  2HPJ A;  5ADX L;  1Y64 B;  1QUU A;  4GIW A;  2DI4 A;  4G2A A;  5EK4 A;  3RC3 A;  3ZJ1 A;  3UTK A;  3J7Y q;  1HG2 A;  3KV6 A;  4I55 E;  2LSK A;  2X67 A;  5JDH A;  3E0Z A;  2K9A A;  1O3X A;  2JMH A;  2Q9Q A;  2KZ7 B;  2NTY A;  2Z6E A;  4QHO A;  2CLY B;  4HE8 A;  4DBR A;  3F2E A;  4IE4 A;  5JDF A;  3HR0 A;  3OYX A;  2CEA A;  5FY1 A;  4TZ4 C;  2MBG A;  2SPC A;  1D1A A;  4UF0 A;  3PTR B;  4F6R C;  3BQI A;  3KVB A;  1SA0 E;  4HFV A;  4U74 A;  5FY7 A;  2KXP B;  3RYH E;  3AAA B;  4IHJ E;  4ZS3 A;  2HPL A;  4ILU A;  4OFZ A;  5F8P A;  5LBM A;  2CE7 A;  1YW0 A;  4QX8 B;  1IJ6 A;  5L3C B;  2CCQ A;  2X66 A;  4JEU B;  1HG5 A;  2Q9Q D;  2V7I A;  2M67 A;  2BDE A;  2LOP A;  2N2N A;  4IE7 A;  4CXW A;  5AFU L;  5LA6 E;  2UXN B;  2YK0 A;  2JRK A;  4OYJ A;  1D0Y A;  3V5U A;  2X68 A;  4QWN B;  4GK5 E;  3FBL A;  2WMO A;  4OHF A;  3MK7 C;  3C64 A;  2XAQ B;  2NP9 A;  4GOU A;  3VHL A;  1LRZ A;  5JRC A;  3I0Q A;  4WBN E;  3PDY A;  4X1K E;  4ZI2 D;  2D5U A;  3HKD E;  3K3O A;  2W00 A;  4XAX B;  5FXW A;  4IIJ E;  2K24 A;  2BVL A;  3ZEF B;  4GYR A;  2X51 A;  1V9D A;  2LHR A;  4L0R A;  4PFP A;  4O4J E;  3W15 B;  5GON E;  2XUE A;  4ZOL E;  4O2B E;  4UEL A;  3HA4 A;  4M1P A;  1FEW A;  1IAP A;  4DMV A;  5EK3 A;  4WW0 A;  1ZHC A;  3PU3 A;  2Y48 B;  2A72 A;  5CA1 E;  2DCF A;  3FXE B;  3K3N A;  4CXY A;  2WBL A;  5H6Q B;  4BA9 A;  1AJ3 A;  3V5S A;  5LGN B;  2Y8D A;  3AAE B;  3U3I A;  5JDL A;  2Q9Q B;  2CXL A;  5KX5 E;  3BQK A;  4UIG A;  4TV8 E;  5LCY A;  5HXH A;  5LG4 A;  4AKH A;  3HL6 A;  3QUJ A;  3PUS A;  3K3Q C;  3CWZ B;  2LEH A;  2XAS B;  2HH7 A;  4MFR A;  2H7V C;  3A5X A;  1MMD A;  3FHN A;  2JPF A;  3CX6 B;  2J1D G;  3AA1 B;  2W62 A;  3JC6 D;  2E9X C;  3MJX A;  4ZI3 D;  3O9X A;  3HKB E;  4A56 A;  2CM0 A;  1B7T A;  4YJ2 E;  4CI3 B;  5A1L A;  5L3B B;  4O4L E;  5DAB A;  3ESL A;  4P0A A;  5HAX A;  3KBU A;  2V26 A;  5JRC B;  1HF8 A;  3IF8 B;  1WYB A;  2IC9 A;  4CXX A;  5LJM A;  4UVB B;  3ZC1 A;  2LJL A;  3ZYK A;  3FB2 A;  4AQG A;  3LK3 B;  4MHC A;  3I1A A;  5HXS A;  3EDU A;  2XHE B;  3H3A A;  3ETU A;  5CB4 E;  2W61 A;  2WAU A;  3N9M A;  2PJQ A;  2IAK A;  2MTQ A;  5L3E B;  3N9N A;  4PJN A;  4ANJ A;  2NW8 A;  4JEH B;  2YIN A;  4L5G A;  5EZY E;  1HS7 A;  5JR9 C;  4QXH B;  4X1I E;  5HWX A;  2ZM0 A;  3O1H A;  3B13 A;  3OJA A;  1NWM X;  2H3R A;  3ZMS B;  3ZN0 B;  2DNX A;  4UEM A;  2KND A;  4TV9 E;  4AQF A;  1MND A;  5LHG B;  3N9Q A;  4YHJ A;  2VK9 A;  5DJQ C;  2B1E A;  2NOX A;  5DQV A;  4I43 B;  4ISS A;  2A3D A;  4EZH A;  3BQL A;  4J2C A;  4X1Y E;  2PBI A;  2ZLY A;  4IE6 A;  5IYZ E;  3J9X 1;  3CQC B;  3MXZ A;  1Z0P A;  2EHO B;  1ZEE A;  5JQG E;  4EXT A;  4H9N C;  2KT9 A;  4KP3 C;  1LKX A;  1FIO A;  4QXC B;  4PFO A;  4AXP A;  3C4W A;  1NAF A;  5C8Y E;  3SRZ A;  4KUM B;  2NTX A;  2JJ9 A;  4ZI3 C;  1BR4 A;  3PUA A;  2ZM8 A;  4BJN A;  4EOZ B;  4BAY B;  3IBP A;  3VKH A;  2DWG A;  3PUQ A;  4O2A E;  3KFW X;  2KLQ A;  1T98 A;  2ES0 A;  2N1G A;  2V7L A;  1G8X A;  3KV4 A;  3ZMT B;  3AAI A;  2X9X A;  2E9X B;  3E22 E;  4MLK A;  3F57 A;  1VOM A;  2JMK A;  3WI3 A;  5FMN A;  4EIW A;  3ANW B;  5JDN A;  3OYZ A;  4I4T E;  5EK2 A;  2XAH B;  1KK7 A;  2XAJ B;  3C50 A;  3JC6 C;  4JLE A;  4PAG A;  2KMF A;  3RYF E;  5JVD E;  3ZPO A;  1UX5 A;  3N2G E;  4AI6 A;  1D1C A;  3UUM A;  3HKE E;  4UVC B;  4AKR B;  1MMN A;  5FYM A;  5HWY A;  3RC8 A;  2CLY C;  4C90 A;  4DND A;  3AVR A;  1WYC A;  2WSS V;  3LK4 2;  5LP6 E;  3VKG A;  4BJM A;  1SHZ C;  3MAC A;  4OK0 A;  1MMA A;  2MYS A;  4DVD A;  1QSD A;  3KV5 A;  4PJM A;  4IE5 A;  4HEA A;  4UV8 B;  4H63 H;  3HI2 A;  3ZN1 B;  3I0O A;  5JR9 A;  2V7M A;  2VKD A;  2VAS A;  2X0L B;  1E1H B;  2IC6 A;  5HXC A;  3QC9 A;  5L3D B;  3RRW A;  3P8C D;  4ZHQ E;  3N5L A;  2XAF B;  1IZN B;  4QXB B;  2LHN A;  4DBQ A;  4X20 E;  2ODV A;  3GA8 A;  2D0U A;  2NW7 A;  1WRD A;  2L9Q A;  2X9W A;  4U72 A;  3ZMZ B;  4HTE A;  3CX8 B;  3PUR A;  3UUX B;  4L9I A;  2ZM2 A;  1HFA A;  3N9L A;  4UVA B;  4PJL A;  2CXD A;  3C4Z A;  2N9D A;  5LGU B;  4ZS2 A;  3ZJ2 A;  2WMN A;  3KVA A;  5LXT E;  2K5B B;  2LOS A;  3FXD B;  4O8S A;  4P0B A;  3ETV A;  4KMC A;  3E08 A;  4AKI A;  2DHR A;  1LVF A;  2WM9 A;  1MMG A;  3DJB A;  3ZMV B;  4UXN B;  5JH7 E;  3RPU A;  5KMG P;  3EDV A;  3C98 B;  2ZMA A;  2KIN B;  2XAG B;  5FXX A;  3R6N A;  4EB6 E;  5HXR A;  3HKC E;  4B6X A;  1UX4 A;  4N78 D;  4XZC A;  2LSJ A;  5CA0 E;  4JUY A;  2C0S A;  4OYK A;  3GN5 B;  2NW9 A;  2YU1 A;  4PK5 A;  4H9Q C;  1MNE A;  3LJC A;  5M4Y A;  5J1G A;  1U4Q A;  2LSY A;  3MA9 A;  2LSI A;  1MIY A;  4AKL A;  3M65 A;  3UUL A;  4PJJ A;  4QX7 B;  2E9X D;  4V1A v;  1OWA A;  1D0X A;  4CZZ B;  4IST A;  4WNK A;  2V7K A;  5LHH B;  2K48 A;  1UCU A;  3ZLI A;  2LM9 A;  4PK4 A;  2VWA A;  4ASK A;  2E8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...