3C98B

Revised structure of the munc18a-syntaxin1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
247
structure length
230
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 1
publication title Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide
pubmed doi rcsb
source organism Rattus norvegicus
total genus 91
structure length 230
sequence length 247
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c98B00
5LG4A 4JEHB 1FEWA 4TX5A 1HS7A 1G73A 1EZ3A 3LG7A 5M4YA 1BR0A 3C98B 1S94A 2XHEB 4JEUB 2DNXA 1FIOA
chains in the Genus database with same CATH superfamily
4UIGA 4ILCA 1JNRA 2E2AA 3RQWA 1QSDA 3HKBE 4DV7T 4YSZA 3RYCE 5LG3A 4EGWA 4EZHA 3MA9A 2Q9QC 3PTRB 4FI5A 2X9HA 4BJMA 3V5SA 4OYKA 3M3ZB 2X0YA 3C4ZA 2JPFA 3SOLA 4QHOA 4CXYA 3EDVA 2J47A 3TLWA 4TNVA 4U74A 5AQKB 4L5GA 4ZZBA 2LHNA 3FZLB 4ZOLE 2JQQA 3RYHE 2Y6XA 2KNDA 4DBQA 3NBXX 1MMDA 1OXZA 4HE8A 2W67A 4I43B 5LP6E 5AQVB 4OK0A 4QH1A 1N33T 4LMKA 2RPAA 2BKNA 3Q9DA 2B1EA 1OWAA 4TUYE 3B5MA 2V7MA 5FXVA 1ZHCA 4CN4A 5LGNB 4DR5T 3Q5DA 5JDQA 3ONJA 2EHOA 4EYUA 2J62A 5ABHA 3CQCB 4DR1T 2XQ6A 3FZHB 1HG2A 1FMVA 1X9BA 4Z90A 4G2AA 2CBJA 3LK42 3VKGA 2XAGB 2QGSA 1CUNA 4GKJT 4DVDA 3NKZA 3AA6B 3H3MA 4CN6A 5HEJA 2X67A 4JEUB 4QXCB 4IL9A 2IIUA 2WMOA 4YFSA 4XAXB 3O1JA 5L3CB 4IE7A 1NWMX 5H6RB 3QOFA 3UUBA 2YU2A 2XHEB 3L39A 2Z6EA 5A1LA 2L3LA 5AQOB 5JVDE 4AKRB 5JDMA 4UR9A 2FJDA 2MTQA 3KVBA 4ILBA 2WMNA 5HEOA 3B57A 4IHJE 2BS2A 2LRLA 3ZT5A 3C64A 3RF1A 2E5VA 3LSVA 2N9DA 1IBKT 3TLVA 4JLEA 3ETUA 2K9AA 3RKGA 4CI1B 5KX5E 2BG9A 5FY7A 4U72A 3U78A 3UUNA 2ZLYA 2X51A 3UFEA 3AXJB 4DIDB 2XQ4A 2W00A 3QB5A 3G06A 4O4JE 3VR9A 2LLYA 2X0LB 3AEFA 5ABGA 2UU9T 3PUQA 4HFBA 4MBQA 3SFEA 2XAQB 3ZMTB 3CVRA 4X5TA 2WSSV 4JI1T 3RI5A 4EV6A 4JI6T 4LFCT 5HXSA 4HWHA 2LKHA 2P9BA 5HXCA 4GKKT 3RRCA 4B3TT 5LGUB 2Q9QD 3N9OA 2WCAA 4EYYR 4YJ2E 3CX6B 1N32T 2V6YB 3ONXA 3ZJ2A 4CXWA 3AA7B 3UTKA 2CCQA 2NW8A 1OEDE 4QKNA 2YINA 1U5PA 3ZN1B 1E2AA 1IBMT 2WZHA 3UU3A 2WQYA 5FP3A 5AQUB 2VK9A 2CWOA 3GMIA 2XM2A 3VRBA 3P4RA 4Z91A 3AAEB 1WRDA 5LBMA 5C2TA 4LF5T 2OV9A 4HFDA 3RIFA 4H9RC 4HGAA 4AKLA 4EEBA 5L3GB 2UXNB 5HWYA 4WBNE 3VR8A 2Y8DA 1KFYA 1VCTA 2UUCT 2VURA 4JYAT 3PUWF 4YXDA 4I4TE 4HFCA 3S4UA 4IREA 5HCJA 1MNEA 4U31A 1IBLT 3K1SA 4KHZF 3ZKRA 4LMLA 2VQET 2CBIA 4BA9A 5F8PA 3UULA 4IDOA 5C8YE 2WS3A 2XQYA 5HYAA 2CE7A 3KDSE 2YN6A 2LOPA 1T72A 3K3QC 2ZM8A 3RYIE 3AA1B 3JC6C 1MIYA 3TLSA 3HA4A 1BR1A 2BKPA 5IWAT 5L47A 2KLQA 1VCSA 5DQVA 3HKCE 3KVAA 3P4PA 3T8OA 4EOZB 5F3JA 3F2EA 4P09A 2XUEA 3UFGA 1MIVA 1NENA 3VKHA 2LSKA 3MKDA 1MMAA 4O4LE 4U3CA 2W2UA 3Q2MA 2VVNA 4IDNA 4QXBB 3R84B 4EIWA 5L3EB 1SHZC 3PUZF 3JADA 5BMVE 4HFEA 5HXHA 2N2NA 2EHOB 2K3WA 4UF0A 4IE0A 3RIUC 2XQ7A 1Y64B 5JR9A 1T7SA 2CHNA 1KF6A 5J0ZA 3O9XA 2XQ8A 4WZXA 2JJ9A 1X79A 3DTOA 3T1HT 3IBPA 3MACA 3KFWX 4UELA 2D0TA 3H37A 4HTEA 2VWAA 5HXRA 2B76A 4X65T 2C5KT 3NVOA 1UURA 5ABFA 4JI5T 1VOMA 2NR4A 4PFOA 5LGTB 1D1CA 2BZBA 4PK6A 2LEHA 4ILUA 4CQIA 2DWGA 1J1JA 3BQLA 3ZYLA 3OPCA 4ZEYA 4U2ZA 3SS1A 1W09A 2YKSA 4ZI3C 2NP9A 1NAFA 1R8IA 1ZP0A 4DR4T 4IE4A 4DUYT 5JDNA 3DJBA 3N9QA 2LSYA 3Q5XA 3ZCIA 1LVFA 3ZSTA 3KBTA 1HS7A 3JCFA 2BG9B 3AEDA 3LFMA 3BQIA 2WAUA 3JAEA 2VL8A 1FIOA 3EUHA 4J2CA 3C50A 3V5UA 1I94T 2VB6A 3FHNA 2CHOA 1YQ3A 4ASKA 2QRXA 3J7Yq 3FBLA 2J4GA 4HEAA 5LCYA 3PUAA 1HCIA 3UUXB 2FJAA 1UX5A 2WU5A 2XQ9A 3FZFB 3R6NA 2V26A 1T8BA 4JUYA 5LB7B 1IAPA 2D5UA 3LG7A 3ETVA 4LF8T 3CX7B 3JC6D 4EB6E 5GONE 3AA0B 3EDUA 4OHFA 1YD8G 3AE6A 2XJ7A 4HFVA 4NIQA 2CXLA 1D1BA 2BG9E 5KMGP 3EHZA 4HWIB 2WDQA 1E1HB 2HPLA 4B3RT 2PFVA 1XZYA 3Q5EA 4GK5E 5AQFB 2JQ9A 4NPPA 2LRKA 4A97A 4YHHT 5EK4A 4TX5A 2WWUA 3I1AA 4YSXA 4KP3C 2EHOC 3OYZA 5AQTB 3EABA 3BQKA 4U33A 3EAMA 5L2LA 2JMKA 3FZKB 2WB5A 4EZ4A 2CA5A 5AQRB 1US7B 3PUYF 2YDSA 4X1KE 5CJ5A 2IC9A 4UVCB 4GYSA 3KV5A 1WYBA 2W0GA 3LDQB 5DABA 2HPJA 2YK0A 1WR0A 2D2SA 4G63A 2E9XC 3OYXA 4PK4A 3O4XE 5LBQB 5IYZE 1Z0PA 3ZT7A 2UXBT 3MXZA 1I6ZA 4GYRA 2E9XA 2KXPB 4TV9E 2XZEA 4AKGA 4DMWA 2UXCT 1YKHB 1BR0A 3ZC1A 5AFUL 3PU3A 1D0ZA 3I9YA 4DV6T 1KNZA 4M1PA 2LT3A 5FXZA 2JQHA 2X9WA 5FVLA 3Q5WA 4LF9T 2WDRA 3AEEA 1HX8A 4PAGA 1LKXA 2V7IA 4PFPA 2WWVA 3DP7A 2LSGA 4KUMB 5FKYA 2LSIA 3RIAA 3OVUA 4AQGA 4P0AA 1HF8A 2SPCA 5AQQB 3UU6A 4UVBB 2VL0A 4ISSA 2CWYA 3FZMB 2FUPA 4ZI3D 3F57A 4AI6A 2BG9C 2W62A 5HEHA 4K0KT 2V8SV 1IJ6A 3CKDA 2KINB 1HTJF 2IDOB 1AJ3A 4UF0B 2H7OA 3KINB 3C51A 3CQGB 3FXDB 4X20E 4C91A 4QX7B 2YDQA 3CIRA 3I0OA 2I6HA 5AQGB 3P50A 5L3BB 5JR9B 4HWFA 3AE9A 2KSRA 3AE3A 2X0HA 3GWHA 2H88A 5JTGA 4AKHA 3AVRA 4EAHA 2G0UA 1KNRA 4MFRA 3SRZA 2X9YA 3K3OA 5LJNA 3PUVF 4V1Av 4TWDA 1J5ET 3A8YC 1ZOYA 3P4QA 3J9X1 1HNZT 2MBGA 2CXDA 3CMLA 4ISTA 4X1IE 3E0ZA 3QK6A 4ERRA 3TKLB 4PJJA 5ABFB 1XNRT 3GA8A 1XDOA 5L4EA 2LM9A 4UV9B 2K48A 2L8KA 5HEUA 2H7VC 3N9LA 2DWKA 3AB3B 4E7SA 3AECA 4IDZA 3C4XA 2BKOA 2XM1A 3M65A 4AQYT 2DL1A 4YHJA 4IL4A 2DI4A 3ZSSA 4PJLA 2R6GF 2PG8A 1KNPA 4WW0A 3IEEA 2VASA 4YLHA 2KWIB 2UUBT 2XASB 3KBUA 4ZS2A 4L9IA 2YEVC 5FMNA 4EXTA 2IUBA 5M4YA 3A7MA 2J1DG 3O1IA 2X68A 4YTMA 1H7CA 3H3AA 3KV9A 3N9PA 4QH5A 3HI2A 3UQ4A 1DU2A 3ZC0A 5CA1E 3W15B 2EHOD 2I0MA 2IMLA 4I0UA 4UVAB 2XY8B 4UEMA 3EI0A 4HN9A 4NXMT 4ZS3A 5J2UE 2M6BA 2DLRA 5ETWA 2M6IA 3LK3B 3N2GE 4AKIA 2XAFB 5CFBA 4DR7T 1G73A 2E8IA 3AE5A 3P4SA 5KDMC 2XQ3A 1HNXT 2N1GA 3PE0A 4CN1A 1LVKA 3AE1A 1WFDA 3K8PC 3PURA 4BJNA 4ILAA 4DUZT 5KXJA 4IE6A 3T1YT 2DCFA 3UU8A 3HL6A 2WDVA 3N5LA 4LF7T 5ADXL 2WM9A 5JDFA 4AISA 4OYJA 2HN1A 1V9DA 4TWHA 3VU7H 5IHYA 3P7IA 1XMOT 2KMFA 3CK6A 3PJAA 4KHPT 3HKDE 5LG4A 2XAJB 4N78D 2IW5B 1M62A 2PTFA 3PJAJ 1XMQT 5AQHB 4ZI7E 3AVSA 5FVKA 3WAJA 4IT4A 2NOXA 4Q25A 5HXEA 1MMNA 1YXRA 5EZYE 2ODUA 4JI0T 4GIWA 4DV3T 4H63H 3AE7A 3RKOA 2JIWA 3CPZA 3ESLA 4KX6A 5AQSB 2XQ5A 5FXWA 5JR9C 2ZMAA 5AQNB 5EK3A 3NZPA 3CQXC 3AAIA 1E7PA 4B3MT 4O2BE 4O2AE 3GN5A 3QC9A 2FBWA 1OEDA 2XTLA 3BK9A 5LMUT 4DR3T 3TLTA 1UX4A 3LBXB 4PJMA 2NWBA 2E9XB 3WI3A 2IC6A 2X66A 3ZN0B 4X66T 4QXHB 3UQ7A 3ZYKA 5FXXA 5HEGA 1MMGA 4JI8T 3K3NA 4L0RA 2NW9A 3ZLIA 5JH7E 1SA0E 5LA6E 1WCRA 1FMWA 2LJLA 2NTXA 4B6XA 3EVYA 3RC8A 4PJNA 4QWNB 5IUXA 3RHWA 3ABVA 4TWFA 3P4WA 3ONLC 4TV8E 4F8HA 2RP4A 3FXEB 4DO0A 3O1HA 2VQFT 3ZEFB 3OJAA 3QNUA 1FEWA 3N9MA 2WZIA 3AE2A 3N2KE 2QVAA 5F5WA 2YOEA 3FBZA 4QH4A 4X62T 1T98A 4KI0F 3MJXA 5JRCA 1WLXA 3RLFF 5HAXA 5ABEA 3AAAB 2BBJA 4UV8B 2C5IT 3L8RA 3MZKB 4DV4T 1UCUA 3MK7C 4ZXLA 2UUAT 3RC3A 4CI3B 4HFIA 1LRZA 2WBLA 2YU1A 4LFAT 2F4VT 2DNXA 3L3PA 3ZCJA 4H9QC 4A5XA 2I59A 2M67A 4QX8B 4OFZA 4XZCA 1UK5A 3RRWA 2MYSA 4GK0E 3UUMA 3C98B 4A56A 2XPKA 2MOZA 3ZPOA 2Q9QA 2HH7A 3N9NA 5LMNT 4WBOA 4IDQA 2L9QA 1GQEA 2UXDT 3UU4A 2A72A 3WAKA 3JAFA 3HR0A 2AE9A 1HR0T 4UXNB 4DMVA 3AE8A 3RGLA 2CM0A 1YQ4A 2QA7A 5J2TE 3UU5A 3P8CD 3U3IA 2JMHA 3ZMVB 5DJQC 1XNQT 2LE8A 5C3JA 5FL1A 2JQKA 4NUUA 2BVMA 2MPKA 4F6RC 1W9RA 1W0AA 5AQIB 2CMRA 4DR6T 2VKHA 4JEHB 2LSJA 3ZT6A 1VRBA 4PNIA 4YY3T 4PW8A 5FNVE 4DR2T 1XDPA 1QUUA 2A9UA 5AQPB 4KMCA 3KV4A 2VKOA 3LBXA 4DBRA 5LJMA 4IGUA 5EK2A 1CHUA 3TLUA 4KBMB 2VVSA 4U7IA 4B3ST 3PV0F 4LF6T 3ANWA 1D0XA 4EEDA 3PUXF 3RYFE 1IZNB 2H3RA 4BAYB 5LYJE 4DV5T 3OKQA 2NTYA 2ZM0A 5FY1A 5LHHB 4Z8XA 1XWMA 1BR4A 2W4XA 4CI2B 4DNDA 4ZI2C 2W66A 4O4HE 3CX8B 2IHR1 2WP9A 4GOUA 2CPTA 2V6XA 4IIJE 4U7YA 4DV1T 2CXFA 4K0UA 4H9OC 2WU2A 1UUSA 3NRXA 3RPUA 3C4WA 1Y01A 2BDEA 4C90A 5BR8T 4H9NC 4YTNA 4HKAA 2E5LT 2OA5A 2PBIA 3IF8B 4AQFC 1ZKEA 3SFDA 2X9XA 5FL0A 4JI7T 3LK2B 3PUSA 3NRYA 4AQFA 3NWIA 4AIUA 3AEGA 4ZHQE 3PUGA 3AE4A 3GN5B 4IDPA 5TAOA 5FY0A 1OEDB 1W0BA 2Y48B 4O4IE 2D9DA 3CWZB 2CEAA 1KEYA 1MNDA 4YSYA 3AEBA 3OBVE 5L3DB 1MIWA 2CRBA 2JRKA 4MLKA 2RA1A 5CGMA 2V1DB 5JREA 2WY2A 2CLYB 1ZEEA 4JV5T 2H89A 2LOSA 4AXPA 3RX6A 4CZZB 1UGOA 2NW7A 3I0QA 2VKJA 2LHRA 4H63V 5DQWA 3ZMSB 2V5DA 2GK9A 3B13A 4ADZA 1EZ3A 5L4HA 4XBFB 5AQJB 1WYCA 1Z8UA 1JNZA 1L0VA 3ZMZB 2HHHT 4HFHA 3N2OA 2FJEA 1YKEB 2QYWA 2V7KA 4LFBT 1D1AA 5AQLB 3RQUA 1M7KA 5JRCB 1SUMB 4JI4T 2LKGA 4ZZCA 4LMJA 3E08A 2W63A 4HWDA 2FJBA 3RH3A 4OX9T 3L09A 4WNKA 1ZV4X 2OLTA 4MHCA 3I9WA 4COFA 2W61A 5CA0E 4X64T 2E9XD 2A3DA 2ES0A 5HWXA 5H6QB 4YTPA 1HG5A 4U2YA 3ZYMA 1BR2A 3UT5E 3VHLA 2XSBA 4IE5A 3E22E 2V5CA 4JI2T 5CB4E 4YJ3E 2ZM6T 2Q9QB 2IAKA 3F31A 4DV2T 3HKEE 4JBWF 5JDHA 1YW0A 2BBHA 4NUVA 4ZI2D 1S35A 2XAHB 1FJGT 4TN7B 2KWHA 1KK7A 5FYMA 3QUJA 4WYVA 4CXXA 1S94A 2K5BB 4I55E 2UXXB 2DHRA 1OEDC 3PDYA 4PK5A 4ANJA 1O3XA 4LF4T 1IJ5A 1QLBA 3AXJA 2BS4A 5LXTE 4HWCA 5LHGB 2PJQA 3AEAA 4TNWA 2VKDA 1N36T 2ZM2A 1B7TA 2KT9A 3FB2A 2ODVA 2XSAA 3RIUA 3D0TA 3NZQA 4O8SA 3IHRA 4P0BA 2ACZA 1HX1B 2HN2A 5LHIB 3OTOT 2YDRA 2CLYC 3ANWB 4P1NA 4I50E 4FJOA 1D0YA 2C0SA 1G8XA 1WR6A 2ACXA 2AXDS 5JQGE 2MAWA 4E7ZA 2LM2A 4MALA 1NEKA 3IA3A 2D0UA 5LNKA 5JDLA 3X1DA 2V6YA 3PU8A 5LOVE 3SWHA 2XQAA 5J1GA 3A5XA 3ZJ1A 4X1YE 2K24A 2KZ7B 3QB5K 4TZ4C 5L3FB 4JI3T 5E0OA 1J5WA 1U4QA 3LJCA 2A2FX 3VRAA 4A98A 4H9PC 4YT0A 1HNWT 2V7JA 4DV0T 5AQMB 2BVLA 3ZMUB 5HCMA 1SE7A 2V7LA 4H9SE 3KV6A 4NXNT 2C5JA 2BS3A 1N34T 5JDGA 1HFAA
chains in the Genus database with same CATH topology
4UIGA 3ANWA 3M65A 1D0XA 3RYFE 4YHJA 1IZNB 2H3RA 1QSDA 4BAYB 3HKBE 2DI4A 4PJLA 5BMVE 5LYJE 3OKQA 2NTYA 2PG8A 2ZM0A 5HXHA 5FY1A 4WW0A 3IEEA 3RYCE 5LHHB 2VASA 2N2NA 2EHOB 4Z8XA 4YLHA 2KWIB 4UF0A 1BR4A 4IE0A 2XASB 3KBUA 4ZS2A 4L9IA 2YEVC 5FMNA 4CI2B 3MA9A 4DNDA 4EXTA 4EZHA 2Q9QC 4ZI2C 1Y64B 3PTRB 4FI5A 2X9HA 4O4HE 5JR9A 5M4YA 2J1DG 3O1IA 2X68A 4BJMA 3CX8B 3V5SA 1H7CA 3O9XA 4OYKA 3H3AA 3C4ZA 3KV9A 3N9PA 4GOUA 2JJ9A 2JPFA 3HI2A 3SOLA 4IIJE 4QHOA 4CXYA 3ZC0A 2CXFA 1X79A 5CA1E 3W15B 3DTOA 3EDVA 2EHOD 3IBPA 4K0UA 4H9OC 3MACA 3NRXA 3RPUA 4U74A 3KFWX 3C4WA 4L5GA 4UEMA 4UVAB 4UELA 2D0TA 2LHNA 2BDEA 3H37A 4HTEA 4C90A 4HN9A 4ZOLE 4H9NC 4HKAA 2JQQA 2VWAA 5HXRA 2OA5A 2PBIA 3RYHE 4ZS3A 3IF8B 2Y6XA 2KNDA 4AQFC 1ZKEA 5J2UE 4DBQA 3NBXX 2X9XA 2C5KT 2DLRA 5ETWA 3LK3B 1MMDA 3N2GE 3LK2B 3PUSA 3NRYA 4AQFA 4AKIA 1OXZA 1VOMA 2XAFB 4PFOA 5LGTB 4HE8A 4ZHQE 1G73A 2E8IA 3PUGA 1D1CA 2BZBA 4I43B 3GN5B 5TAOA 4PK6A 5KDMC 5LP6E 2LEHA 4ILUA 2N1GA 3PE0A 5FY0A 4CQIA 4OK0A 2DWGA 1LVKA 2Y48B 3K8PC 3PURA 4O4IE 3BQLA 4BJNA 3Q9DA 2B1EA 3ZYLA 3CWZB 1OWAA 2CEAA 4TUYE 4IE6A 2V7MA 5FXVA 3SS1A 1ZHCA 5LGNB 1MNDA 3OBVE 5JDQA 4ZI3C 2DCFA 2NP9A 1NAFA 5L3DB 1MIWA 3HL6A 2EHOA 3N5LA 2JRKA 5ADXL 4IE4A 5JDNA 4EYUA 3DJBA 2WM9A 4MLKA 3N9QA 2LSYA 2RA1A 5JDFA 2V1DB 3CQCB 3Q5XA 4OYJA 5JREA 3ZCIA 1V9DA 1HG2A 3VU7H 5IHYA 3P7IA 1LVFA 1FMVA 2CLYB 3KBTA 1HS7A 2KMFA 1ZEEA 3HKDE 2LOSA 5LG4A 2XAJB 4N78D 2IW5B 4G2AA 4AXPA 3LFMA 3LK42 3BQIA 3RX6A 2WAUA 3VKGA 4CZZB 2VL8A 2XAGB 2NW7A 2QGSA 1FIOA 1CUNA 4ZI7E 3AVSA 3I0QA 2VKJA 4DVDA 3WAJA 2NOXA 3EUHA 4J2CA 3C50A 3V5UA 2VB6A 3AA6B 3FHNA 5HXEA 2LHRA 4H63V 5DQWA 4ASKA 1MMNA 3J7Yq 5EZYE 3ZMSB 2X67A 2ODUA 4JEUB 2GK9A 3B13A 3FBLA 4QXCB 4GIWA 4H63H 1EZ3A 4ADZA 3RKOA 4HEAA 3CPZA 2WMOA 3ESLA 4XAXB 4YFSA 5LCYA 3O1JA 3PUAA 1HCIA 4IE7A 5L3CB 1NWMX 3UUXB 5JR9C 5FXWA 2ZMAA 4XBFB 1WYCA 5EK3A 5H6RB 1UX5A 3R6NA 3NZPA 3CQXC 3AAIA 2YU2A 2XHEB 4O2BE 2Z6EA 3ZMZB 4O2AE 2L3LA 2V26A 5A1LA 3GN5A 3QC9A 4JUYA 1IAPA 2D5UA 2XTLA 3BK9A 5JVDE 4AKRB 5JDMA 3N2OA 1YKEB 2MTQA 3LG7A 3ETVA 2V7KA 3CX7B 1UX4A 3JC6D 3KVBA 3LBXB 4PJMA 1D1AA 4EB6E 2NWBA 5GONE 3AA0B 2E9XB 3EDUA 4OHFA 3WI3A 1YD8G 2WMNA 2IC6A 2X66A 5JRCB 3ZN0B 4HFVA 3B57A 4IHJE 2CXLA 1D1BA 4QXHB 3E08A 2W63A 3C64A 5KMGP 3ZYKA 2N9DA 5FXXA 1E1HB 3RH3A 4JLEA 1MMGA 3ETUA 3L09A 2K9AA 3K3NA 4WNKA 4L0RA 1ZV4X 2HPLA 4MHCA 3I9WA 2W61A 2PFVA 2NW9A 3ZLIA 4CI1B 5JH7E 1SA0E 4GK5E 5CA0E 5KX5E 2E9XD 2A3DA 2ES0A 5LA6E 5FY7A 4U72A 3U78A 3UUNA 2ZLYA 1FMWA 5HWXA 2X51A 2LJLA 2NTXA 5H6QB 1HG5A 3UFEA 4B6XA 5EK4A 3ZYMA 1BR2A 2W00A 3EVYA 3UT5E 3RC8A 4PJNA 4TX5A 4IE5A 3VHLA 3E22E 2WWUA 4QWNB 3I1AA 4O4JE 4KP3C 2EHOC 3OYZA 2X0LB 5CB4E 4YJ3E 4IDZA 3BQKA 2Q9QB 2IAKA 5L2LA 2JMKA 3PUQA 4MBQA 4TV8E 2XAQB 3ZMTB 3CVRA 4EZ4A 2CA5A 2WSSV 3F31A 1US7B 4X1KE 3HKEE 2RP4A 3FXEB 4DO0A 2IC9A 4UVCB 3O1HA 4GYSA 5HXSA 5HXCA 2P9BA 3KV5A 1WYBA 2W0GA 3ZEFB 5DABA 5JDHA 3OJAA 1YW0A 3RRCA 2HPJA 2YK0A 1FEWA 3N9MA 2D2SA 4G63A 3N2KE 2E9XC 3OYXA 2Q9QD 3N9OA 1S35A 3FBZA 4NUVA 4PK4A 4ZI2D 5LGUB 3O4XE 5LBQB 5IYZE 1Z0PA 1T98A 2XAHB 3MXZA 4TN7B 4EYYR 4GYRA 4YJ2E 2E9XA 3MJXA 3CX6B 2KXPB 2KWHA 4TV9E 5JRCA 4AKGA 3ONXA 3ZJ2A 4DMWA 1KK7A 1WLXA 4CXWA 1YKHB 5HAXA 3AA7B 5FYMA 3UTKA 2CCQA 3QUJA 3AAAB 2NW8A 4UV8B 2C5IT 1BR0A 3MZKB 3ZC1A 5AFUL 1UCUA 3MK7C 3PU3A 1D0ZA 3I9YA 4QKNA 4CXXA 3RC3A 2YINA 1S94A 2K5BB 4I55E 1U5PA 4CI3B 1LRZA 2UXXB 2WBLA 2DHRA 3ZN1B 2YU1A 2DNXA 3PDYA 3L3PA 1KNZA 4PK5A 4ANJA 5FP3A 4M1PA 2VK9A 1O3XA 2LT3A 2CWOA 3GMIA 5FXZA 3ZCJA 2X9WA 3AAEB 4H9QC 1IJ5A 1WRDA 5LBMA 3Q5WA 2I59A 2M67A 4QX8B 5LXTE 1HX8A 4H9RC 5LHGB 4OFZA 4XZCA 4PAGA 2PJQA 4HGAA 1LKXA 4AKLA 2VKDA 3RRWA 2V7IA 2MYSA 4GK0E 4PFPA 2ZM2A 3DP7A 1B7TA 3UUMA 2LSGA 5L3GB 2KT9A 3FB2A 2UXNB 2ODVA 3C98B 4KUMB 4A56A 2LSIA 2MOZA 3D0TA 3NZQA 3ZPOA 2Q9QA 2HH7A 3N9NA 4O8SA 5HWYA 3IHRA 4WBNE 4WBOA 2Y8DA 4P0BA 4AQGA 2L9QA 4P0AA 5LHIB 1HF8A 2SPCA 4UVBB 2CLYC 4I4TE 4ISSA 2CWYA 3ANWB 2A72A 3S4UA 4I50E 3F57A 4ZI3D 4FJOA 4AI6A 1D0YA 2W62A 2C0SA 3WAKA 1MNEA 3HR0A 1G8XA 1IJ6A 4UXNB 1WR6A 2ACXA 3CKDA 2KINB 5JQGE 4DMVA 4E7ZA 1HTJF 2CM0A 4MALA 2QA7A 5J2TE 4BA9A 2D0UA 3P8CD 5F8PA 3U3IA 2JMHA 4UF0B 1AJ3A 2H7OA 3KINB 3C51A 5DJQC 3UULA 3ZMVB 5C8YE 5LNKA 2XQYA 3CQGB 3FXDB 5HYAA 4X20E 2CE7A 3KDSE 4C91A 2LE8A 4QX7B 5JDLA 2LOPA 3K3QC 3I0OA 2ZM8A 3RYIE 3PU8A 5L3BB 5LOVE 3AA1B 3JC6C 3SWHA 5JR9B 5J1GA 1MIYA 3A5XA 3ZJ1A 4X1YE 3GWHA 2K24A 2KZ7B 3HA4A 1BR1A 4NUUA 4AKHA 2BVMA 4F6RC 3AVRA 4TZ4C 4EAHA 5L3FB 2G0UA 5E0OA 2CMRA 2KLQA 2VKHA 5DQVA 3HKCE 3KVAA 1U4QA 4JEHB 4MFRA 2LSJA 2X9YA 3LJCA 3SRZA 1VRBA 4PNIA 3T8OA 3K3OA 4EOZB 2A2FX 5LJNA 5F3JA 3F2EA 4P09A 4V1Av 2XUEA 4PW8A 5FNVE 1MIVA 4H9PC 3J9X1 1QUUA 2MBGA 3VKHA 2LSKA 2CXDA 3MKDA 4KMCA 3KV4A 3CMLA 4ISTA 2VKOA 2V7JA 4X1IE 3E0ZA 1MMAA 3LBXA 3QK6A 4DBRA 5LJMA 4ERRA 4IGUA 3TKLB 4O4LE 4PJJA 5EK2A 2BVLA 3ZMUB 3GA8A 2LM9A 4UV9B 3Q2MA 2K48A 2L8KA 4QXBB 2V7LA 4H9SE 3KV6A 2C5JA 2H7VC 4KBMB 3R84B 4EIWA 3N9LA 5L3EB 2DWKA 3AB3B 4E7SA 1SHZC 5JDGA 1HFAA 3C4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG4 A;  4JEH B;  1FEW A;  4TX5 A;  1HS7 A;  1G73 A;  1EZ3 A;  3LG7 A;  5M4Y A;  1BR0 A;  3C98 B;  1S94 A;  2XHE B;  4JEU B;  2DNX A;  1FIO A; 
#chains in the Genus database with same CATH topology
 4UIG A;  4ILC A;  1JNR A;  2E2A A;  3RQW A;  1QSD A;  3HKB E;  4DV7 T;  4YSZ A;  3RYC E;  5LG3 A;  4EGW A;  4EZH A;  3MA9 A;  2Q9Q C;  3PTR B;  4FI5 A;  2X9H A;  4BJM A;  3V5S A;  4OYK A;  3M3Z B;  2X0Y A;  3C4Z A;  2JPF A;  3SOL A;  4QHO A;  4CXY A;  3EDV A;  2J47 A;  3TLW A;  4TNV A;  4U74 A;  5AQK B;  4L5G A;  4ZZB A;  2LHN A;  3FZL B;  4ZOL E;  2JQQ A;  3RYH E;  2Y6X A;  2KND A;  4DBQ A;  3NBX X;  1MMD A;  1OXZ A;  4HE8 A;  2W67 A;  4I43 B;  5LP6 E;  5AQV B;  4OK0 A;  4QH1 A;  1N33 T;  4LMK A;  2RPA A;  2BKN A;  3Q9D A;  2B1E A;  1OWA A;  4TUY E;  3B5M A;  2V7M A;  5FXV A;  1ZHC A;  4CN4 A;  5LGN B;  4DR5 T;  3Q5D A;  5JDQ A;  3ONJ A;  2EHO A;  4EYU A;  2J62 A;  5ABH A;  3CQC B;  4DR1 T;  2XQ6 A;  3FZH B;  1HG2 A;  1FMV A;  1X9B A;  4Z90 A;  4G2A A;  2CBJ A;  3LK4 2;  3VKG A;  2XAG B;  2QGS A;  1CUN A;  4GKJ T;  4DVD A;  3NKZ A;  3AA6 B;  3H3M A;  4CN6 A;  5HEJ A;  2X67 A;  4JEU B;  4QXC B;  4IL9 A;  2IIU A;  2WMO A;  4YFS A;  4XAX B;  3O1J A;  5L3C B;  4IE7 A;  1NWM X;  5H6R B;  3QOF A;  3UUB A;  2YU2 A;  2XHE B;  3L39 A;  2Z6E A;  5A1L A;  2L3L A;  5AQO B;  5JVD E;  4AKR B;  5JDM A;  4UR9 A;  2FJD A;  2MTQ A;  3KVB A;  4ILB A;  2WMN A;  5HEO A;  3B57 A;  4IHJ E;  2BS2 A;  2LRL A;  3ZT5 A;  3C64 A;  3RF1 A;  2E5V A;  3LSV A;  2N9D A;  1IBK T;  3TLV A;  4JLE A;  3ETU A;  2K9A A;  3RKG A;  4CI1 B;  5KX5 E;  2BG9 A;  5FY7 A;  4U72 A;  3U78 A;  3UUN A;  2ZLY A;  2X51 A;  3UFE A;  3AXJ B;  4DID B;  2XQ4 A;  2W00 A;  3QB5 A;  3G06 A;  4O4J E;  3VR9 A;  2LLY A;  2X0L B;  3AEF A;  5ABG A;  2UU9 T;  3PUQ A;  4HFB A;  4MBQ A;  3SFE A;  2XAQ B;  3ZMT B;  3CVR A;  4X5T A;  2WSS V;  4JI1 T;  3RI5 A;  4EV6 A;  4JI6 T;  4LFC T;  5HXS A;  4HWH A;  2LKH A;  2P9B A;  5HXC A;  4GKK T;  3RRC A;  4B3T T;  5LGU B;  2Q9Q D;  3N9O A;  2WCA A;  4EYY R;  4YJ2 E;  3CX6 B;  1N32 T;  2V6Y B;  3ONX A;  3ZJ2 A;  4CXW A;  3AA7 B;  3UTK A;  2CCQ A;  2NW8 A;  1OED E;  4QKN A;  2YIN A;  1U5P A;  3ZN1 B;  1E2A A;  1IBM T;  2WZH A;  3UU3 A;  2WQY A;  5FP3 A;  5AQU B;  2VK9 A;  2CWO A;  3GMI A;  2XM2 A;  3VRB A;  3P4R A;  4Z91 A;  3AAE B;  1WRD A;  5LBM A;  5C2T A;  4LF5 T;  2OV9 A;  4HFD A;  3RIF A;  4H9R C;  4HGA A;  4AKL A;  4EEB A;  5L3G B;  2UXN B;  5HWY A;  4WBN E;  3VR8 A;  2Y8D A;  1KFY A;  1VCT A;  2UUC T;  2VUR A;  4JYA T;  3PUW F;  4YXD A;  4I4T E;  4HFC A;  3S4U A;  4IRE A;  5HCJ A;  1MNE A;  4U31 A;  1IBL T;  3K1S A;  4KHZ F;  3ZKR A;  4LML A;  2VQE T;  2CBI A;  4BA9 A;  5F8P A;  3UUL A;  4IDO A;  5C8Y E;  2WS3 A;  2XQY A;  5HYA A;  2CE7 A;  3KDS E;  2YN6 A;  2LOP A;  1T72 A;  3K3Q C;  2ZM8 A;  3RYI E;  3AA1 B;  3JC6 C;  1MIY A;  3TLS A;  3HA4 A;  1BR1 A;  2BKP A;  5IWA T;  5L47 A;  2KLQ A;  1VCS A;  5DQV A;  3HKC E;  3KVA A;  3P4P A;  3T8O A;  4EOZ B;  5F3J A;  3F2E A;  4P09 A;  2XUE A;  3UFG A;  1MIV A;  1NEN A;  3VKH A;  2LSK A;  3MKD A;  1MMA A;  4O4L E;  4U3C A;  2W2U A;  3Q2M A;  2VVN A;  4IDN A;  4QXB B;  3R84 B;  4EIW A;  5L3E B;  1SHZ C;  3PUZ F;  3JAD A;  5BMV E;  4HFE A;  5HXH A;  2N2N A;  2EHO B;  2K3W A;  4UF0 A;  4IE0 A;  3RIU C;  2XQ7 A;  1Y64 B;  5JR9 A;  1T7S A;  2CHN A;  1KF6 A;  5J0Z A;  3O9X A;  2XQ8 A;  4WZX A;  2JJ9 A;  1X79 A;  3DTO A;  3T1H T;  3IBP A;  3MAC A;  3KFW X;  4UEL A;  2D0T A;  3H37 A;  4HTE A;  2VWA A;  5HXR A;  2B76 A;  4X65 T;  2C5K T;  3NVO A;  1UUR A;  5ABF A;  4JI5 T;  1VOM A;  2NR4 A;  4PFO A;  5LGT B;  1D1C A;  2BZB A;  4PK6 A;  2LEH A;  4ILU A;  4CQI A;  2DWG A;  1J1J A;  3BQL A;  3ZYL A;  3OPC A;  4ZEY A;  4U2Z A;  3SS1 A;  1W09 A;  2YKS A;  4ZI3 C;  2NP9 A;  1NAF A;  1R8I A;  1ZP0 A;  4DR4 T;  4IE4 A;  4DUY T;  5JDN A;  3DJB A;  3N9Q A;  2LSY A;  3Q5X A;  3ZCI A;  1LVF A;  3ZST A;  3KBT A;  1HS7 A;  3JCF A;  2BG9 B;  3AED A;  3LFM A;  3BQI A;  2WAU A;  3JAE A;  2VL8 A;  1FIO A;  3EUH A;  4J2C A;  3C50 A;  3V5U A;  1I94 T;  2VB6 A;  3FHN A;  2CHO A;  1YQ3 A;  4ASK A;  2QRX A;  3J7Y q;  3FBL A;  2J4G A;  4HEA A;  5LCY A;  3PUA A;  1HCI A;  3UUX B;  2FJA A;  1UX5 A;  2WU5 A;  2XQ9 A;  3FZF B;  3R6N A;  2V26 A;  1T8B A;  4JUY A;  5LB7 B;  1IAP A;  2D5U A;  3LG7 A;  3ETV A;  4LF8 T;  3CX7 B;  3JC6 D;  4EB6 E;  5GON E;  3AA0 B;  3EDU A;  4OHF A;  1YD8 G;  3AE6 A;  2XJ7 A;  4HFV A;  4NIQ A;  2CXL A;  1D1B A;  2BG9 E;  5KMG P;  3EHZ A;  4HWI B;  2WDQ A;  1E1H B;  2HPL A;  4B3R T;  2PFV A;  1XZY A;  3Q5E A;  4GK5 E;  5AQF B;  2JQ9 A;  4NPP A;  2LRK A;  4A97 A;  4YHH T;  5EK4 A;  4TX5 A;  2WWU A;  3I1A A;  4YSX A;  4KP3 C;  2EHO C;  3OYZ A;  5AQT B;  3EAB A;  3BQK A;  4U33 A;  3EAM A;  5L2L A;  2JMK A;  3FZK B;  2WB5 A;  4EZ4 A;  2CA5 A;  5AQR B;  1US7 B;  3PUY F;  2YDS A;  4X1K E;  5CJ5 A;  2IC9 A;  4UVC B;  4GYS A;  3KV5 A;  1WYB A;  2W0G A;  3LDQ B;  5DAB A;  2HPJ A;  2YK0 A;  1WR0 A;  2D2S A;  4G63 A;  2E9X C;  3OYX A;  4PK4 A;  3O4X E;  5LBQ B;  5IYZ E;  1Z0P A;  3ZT7 A;  2UXB T;  3MXZ A;  1I6Z A;  4GYR A;  2E9X A;  2KXP B;  4TV9 E;  2XZE A;  4AKG A;  4DMW A;  2UXC T;  1YKH B;  1BR0 A;  3ZC1 A;  5AFU L;  3PU3 A;  1D0Z A;  3I9Y A;  4DV6 T;  1KNZ A;  4M1P A;  2LT3 A;  5FXZ A;  2JQH A;  2X9W A;  5FVL A;  3Q5W A;  4LF9 T;  2WDR A;  3AEE A;  1HX8 A;  4PAG A;  1LKX A;  2V7I A;  4PFP A;  2WWV A;  3DP7 A;  2LSG A;  4KUM B;  5FKY A;  2LSI A;  3RIA A;  3OVU A;  4AQG A;  4P0A A;  1HF8 A;  2SPC A;  5AQQ B;  3UU6 A;  4UVB B;  2VL0 A;  4ISS A;  2CWY A;  3FZM B;  2FUP A;  4ZI3 D;  3F57 A;  4AI6 A;  2BG9 C;  2W62 A;  5HEH A;  4K0K T;  2V8S V;  1IJ6 A;  3CKD A;  2KIN B;  1HTJ F;  2IDO B;  1AJ3 A;  4UF0 B;  2H7O A;  3KIN B;  3C51 A;  3CQG B;  3FXD B;  4X20 E;  4C91 A;  4QX7 B;  2YDQ A;  3CIR A;  3I0O A;  2I6H A;  5AQG B;  3P50 A;  5L3B B;  5JR9 B;  4HWF A;  3AE9 A;  2KSR A;  3AE3 A;  2X0H A;  3GWH A;  2H88 A;  5JTG A;  4AKH A;  3AVR A;  4EAH A;  2G0U A;  1KNR A;  4MFR A;  3SRZ A;  2X9Y A;  3K3O A;  5LJN A;  3PUV F;  4V1A v;  4TWD A;  1J5E T;  3A8Y C;  1ZOY A;  3P4Q A;  3J9X 1;  1HNZ T;  2MBG A;  2CXD A;  3CML A;  4IST A;  4X1I E;  3E0Z A;  3QK6 A;  4ERR A;  3TKL B;  4PJJ A;  5ABF B;  1XNR T;  3GA8 A;  1XDO A;  5L4E A;  2LM9 A;  4UV9 B;  2K48 A;  2L8K A;  5HEU A;  2H7V C;  3N9L A;  2DWK A;  3AB3 B;  4E7S A;  3AEC A;  4IDZ A;  3C4X A;  2BKO A;  2XM1 A;  3M65 A;  4AQY T;  2DL1 A;  4YHJ A;  4IL4 A;  2DI4 A;  3ZSS A;  4PJL A;  2R6G F;  2PG8 A;  1KNP A;  4WW0 A;  3IEE A;  2VAS A;  4YLH A;  2KWI B;  2UUB T;  2XAS B;  3KBU A;  4ZS2 A;  4L9I A;  2YEV C;  5FMN A;  4EXT A;  2IUB A;  5M4Y A;  3A7M A;  2J1D G;  3O1I A;  2X68 A;  4YTM A;  1H7C A;  3H3A A;  3KV9 A;  3N9P A;  4QH5 A;  3HI2 A;  3UQ4 A;  1DU2 A;  3ZC0 A;  5CA1 E;  3W15 B;  2EHO D;  2I0M A;  2IML A;  4I0U A;  4UVA B;  2XY8 B;  4UEM A;  3EI0 A;  4HN9 A;  4NXM T;  4ZS3 A;  5J2U E;  2M6B A;  2DLR A;  5ETW A;  2M6I A;  3LK3 B;  3N2G E;  4AKI A;  2XAF B;  5CFB A;  4DR7 T;  1G73 A;  2E8I A;  3AE5 A;  3P4S A;  5KDM C;  2XQ3 A;  1HNX T;  2N1G A;  3PE0 A;  4CN1 A;  1LVK A;  3AE1 A;  1WFD A;  3K8P C;  3PUR A;  4BJN A;  4ILA A;  4DUZ T;  5KXJ A;  4IE6 A;  3T1Y T;  2DCF A;  3UU8 A;  3HL6 A;  2WDV A;  3N5L A;  4LF7 T;  5ADX L;  2WM9 A;  5JDF A;  4AIS A;  4OYJ A;  2HN1 A;  1V9D A;  4TWH A;  3VU7 H;  5IHY A;  3P7I A;  1XMO T;  2KMF A;  3CK6 A;  3PJA A;  4KHP T;  3HKD E;  5LG4 A;  2XAJ B;  4N78 D;  2IW5 B;  1M62 A;  2PTF A;  3PJA J;  1XMQ T;  5AQH B;  4ZI7 E;  3AVS A;  5FVK A;  3WAJ A;  4IT4 A;  2NOX A;  4Q25 A;  5HXE A;  1MMN A;  1YXR A;  5EZY E;  2ODU A;  4JI0 T;  4GIW A;  4DV3 T;  4H63 H;  3AE7 A;  3RKO A;  2JIW A;  3CPZ A;  3ESL A;  4KX6 A;  5AQS B;  2XQ5 A;  5FXW A;  5JR9 C;  2ZMA A;  5AQN B;  5EK3 A;  3NZP A;  3CQX C;  3AAI A;  1E7P A;  4B3M T;  4O2B E;  4O2A E;  3GN5 A;  3QC9 A;  2FBW A;  1OED A;  2XTL A;  3BK9 A;  5LMU T;  4DR3 T;  3TLT A;  1UX4 A;  3LBX B;  4PJM A;  2NWB A;  2E9X B;  3WI3 A;  2IC6 A;  2X66 A;  3ZN0 B;  4X66 T;  4QXH B;  3UQ7 A;  3ZYK A;  5FXX A;  5HEG A;  1MMG A;  4JI8 T;  3K3N A;  4L0R A;  2NW9 A;  3ZLI A;  5JH7 E;  1SA0 E;  5LA6 E;  1WCR A;  1FMW A;  2LJL A;  2NTX A;  4B6X A;  3EVY A;  3RC8 A;  4PJN A;  4QWN B;  5IUX A;  3RHW A;  3ABV A;  4TWF A;  3P4W A;  3ONL C;  4TV8 E;  4F8H A;  2RP4 A;  3FXE B;  4DO0 A;  3O1H A;  2VQF T;  3ZEF B;  3OJA A;  3QNU A;  1FEW A;  3N9M A;  2WZI A;  3AE2 A;  3N2K E;  2QVA A;  5F5W A;  2YOE A;  3FBZ A;  4QH4 A;  4X62 T;  1T98 A;  4KI0 F;  3MJX A;  5JRC A;  1WLX A;  3RLF F;  5HAX A;  5ABE A;  3AAA B;  2BBJ A;  4UV8 B;  2C5I T;  3L8R A;  3MZK B;  4DV4 T;  1UCU A;  3MK7 C;  4ZXL A;  2UUA T;  3RC3 A;  4CI3 B;  4HFI A;  1LRZ A;  2WBL A;  2YU1 A;  4LFA T;  2F4V T;  2DNX A;  3L3P A;  3ZCJ A;  4H9Q C;  4A5X A;  2I59 A;  2M67 A;  4QX8 B;  4OFZ A;  4XZC A;  1UK5 A;  3RRW A;  2MYS A;  4GK0 E;  3UUM A;  3C98 B;  4A56 A;  2XPK A;  2MOZ A;  3ZPO A;  2Q9Q A;  2HH7 A;  3N9N A;  5LMN T;  4WBO A;  4IDQ A;  2L9Q A;  1GQE A;  2UXD T;  3UU4 A;  2A72 A;  3WAK A;  3JAF A;  3HR0 A;  2AE9 A;  1HR0 T;  4UXN B;  4DMV A;  3AE8 A;  3RGL A;  2CM0 A;  1YQ4 A;  2QA7 A;  5J2T E;  3UU5 A;  3P8C D;  3U3I A;  2JMH A;  3ZMV B;  5DJQ C;  1XNQ T;  2LE8 A;  5C3J A;  5FL1 A;  2JQK A;  4NUU A;  2BVM A;  2MPK A;  4F6R C;  1W9R A;  1W0A A;  5AQI B;  2CMR A;  4DR6 T;  2VKH A;  4JEH B;  2LSJ A;  3ZT6 A;  1VRB A;  4PNI A;  4YY3 T;  4PW8 A;  5FNV E;  4DR2 T;  1XDP A;  1QUU A;  2A9U A;  5AQP B;  4KMC A;  3KV4 A;  2VKO A;  3LBX A;  4DBR A;  5LJM A;  4IGU A;  5EK2 A;  1CHU A;  3TLU A;  4KBM B;  2VVS A;  4U7I A;  4B3S T;  3PV0 F;  4LF6 T;  3ANW A;  1D0X A;  4EED A;  3PUX F;  3RYF E;  1IZN B;  2H3R A;  4BAY B;  5LYJ E;  4DV5 T;  3OKQ A;  2NTY A;  2ZM0 A;  5FY1 A;  5LHH B;  4Z8X A;  1XWM A;  1BR4 A;  2W4X A;  4CI2 B;  4DND A;  4ZI2 C;  2W66 A;  4O4H E;  3CX8 B;  2IHR 1;  2WP9 A;  4GOU A;  2CPT A;  2V6X A;  4IIJ E;  4U7Y A;  4DV1 T;  2CXF A;  4K0U A;  4H9O C;  2WU2 A;  1UUS A;  3NRX A;  3RPU A;  3C4W A;  1Y01 A;  2BDE A;  4C90 A;  5BR8 T;  4H9N C;  4YTN A;  4HKA A;  2E5L T;  2OA5 A;  2PBI A;  3IF8 B;  4AQF C;  1ZKE A;  3SFD A;  2X9X A;  5FL0 A;  4JI7 T;  3LK2 B;  3PUS A;  3NRY A;  4AQF A;  3NWI A;  4AIU A;  3AEG A;  4ZHQ E;  3PUG A;  3AE4 A;  3GN5 B;  4IDP A;  5TAO A;  5FY0 A;  1OED B;  1W0B A;  2Y48 B;  4O4I E;  2D9D A;  3CWZ B;  2CEA A;  1KEY A;  1MND A;  4YSY A;  3AEB A;  3OBV E;  5L3D B;  1MIW A;  2CRB A;  2JRK A;  4MLK A;  2RA1 A;  5CGM A;  2V1D B;  5JRE A;  2WY2 A;  2CLY B;  1ZEE A;  4JV5 T;  2H89 A;  2LOS A;  4AXP A;  3RX6 A;  4CZZ B;  1UGO A;  2NW7 A;  3I0Q A;  2VKJ A;  2LHR A;  4H63 V;  5DQW A;  3ZMS B;  2V5D A;  2GK9 A;  3B13 A;  4ADZ A;  1EZ3 A;  5L4H A;  4XBF B;  5AQJ B;  1WYC A;  1Z8U A;  1JNZ A;  1L0V A;  3ZMZ B;  2HHH T;  4HFH A;  3N2O A;  2FJE A;  1YKE B;  2QYW A;  2V7K A;  4LFB T;  1D1A A;  5AQL B;  3RQU A;  1M7K A;  5JRC B;  1SUM B;  4JI4 T;  2LKG A;  4ZZC A;  4LMJ A;  3E08 A;  2W63 A;  4HWD A;  2FJB A;  3RH3 A;  4OX9 T;  3L09 A;  4WNK A;  1ZV4 X;  2OLT A;  4MHC A;  3I9W A;  4COF A;  2W61 A;  5CA0 E;  4X64 T;  2E9X D;  2A3D A;  2ES0 A;  5HWX A;  5H6Q B;  4YTP A;  1HG5 A;  4U2Y A;  3ZYM A;  1BR2 A;  3UT5 E;  3VHL A;  2XSB A;  4IE5 A;  3E22 E;  2V5C A;  4JI2 T;  5CB4 E;  4YJ3 E;  2ZM6 T;  2Q9Q B;  2IAK A;  3F31 A;  4DV2 T;  3HKE E;  4JBW F;  5JDH A;  1YW0 A;  2BBH A;  4NUV A;  4ZI2 D;  1S35 A;  2XAH B;  1FJG T;  4TN7 B;  2KWH A;  1KK7 A;  5FYM A;  3QUJ A;  4WYV A;  4CXX A;  1S94 A;  2K5B B;  4I55 E;  2UXX B;  2DHR A;  1OED C;  3PDY A;  4PK5 A;  4ANJ A;  1O3X A;  4LF4 T;  1IJ5 A;  1QLB A;  3AXJ A;  2BS4 A;  5LXT E;  4HWC A;  5LHG B;  2PJQ A;  3AEA A;  4TNW A;  2VKD A;  1N36 T;  2ZM2 A;  1B7T A;  2KT9 A;  3FB2 A;  2ODV A;  2XSA A;  3RIU A;  3D0T A;  3NZQ A;  4O8S A;  3IHR A;  4P0B A;  2ACZ A;  1HX1 B;  2HN2 A;  5LHI B;  3OTO T;  2YDR A;  2CLY C;  3ANW B;  4P1N A;  4I50 E;  4FJO A;  1D0Y A;  2C0S A;  1G8X A;  1WR6 A;  2ACX A;  2AXD S;  5JQG E;  2MAW A;  4E7Z A;  2LM2 A;  4MAL A;  1NEK A;  3IA3 A;  2D0U A;  5LNK A;  5JDL A;  3X1D A;  2V6Y A;  3PU8 A;  5LOV E;  3SWH A;  2XQA A;  5J1G A;  3A5X A;  3ZJ1 A;  4X1Y E;  2K24 A;  2KZ7 B;  3QB5 K;  4TZ4 C;  5L3F B;  4JI3 T;  5E0O A;  1J5W A;  1U4Q A;  3LJC A;  2A2F X;  3VRA A;  4A98 A;  4H9P C;  4YT0 A;  1HNW T;  2V7J A;  4DV0 T;  5AQM B;  2BVL A;  3ZMU B;  5HCM A;  1SE7 A;  2V7L A;  4H9S E;  3KV6 A;  4NXN T;  2C5J A;  2BS3 A;  1N34 T;  5JDG A;  1HFA A; 
#chains in the Genus database with same CATH homology
 4UIG A;  3ANW A;  3M65 A;  1D0X A;  3RYF E;  4YHJ A;  1IZN B;  2H3R A;  1QSD A;  4BAY B;  3HKB E;  2DI4 A;  4PJL A;  5BMV E;  5LYJ E;  3OKQ A;  2NTY A;  2PG8 A;  2ZM0 A;  5HXH A;  5FY1 A;  4WW0 A;  3IEE A;  3RYC E;  5LHH B;  2VAS A;  2N2N A;  2EHO B;  4Z8X A;  4YLH A;  2KWI B;  4UF0 A;  1BR4 A;  4IE0 A;  2XAS B;  3KBU A;  4ZS2 A;  4L9I A;  2YEV C;  5FMN A;  4CI2 B;  3MA9 A;  4DND A;  4EXT A;  4EZH A;  2Q9Q C;  4ZI2 C;  1Y64 B;  3PTR B;  4FI5 A;  2X9H A;  4O4H E;  5JR9 A;  5M4Y A;  2J1D G;  3O1I A;  2X68 A;  4BJM A;  3CX8 B;  3V5S A;  1H7C A;  3O9X A;  4OYK A;  3H3A A;  3C4Z A;  3KV9 A;  3N9P A;  4GOU A;  2JJ9 A;  2JPF A;  3HI2 A;  3SOL A;  4IIJ E;  4QHO A;  4CXY A;  3ZC0 A;  2CXF A;  1X79 A;  5CA1 E;  3W15 B;  3DTO A;  3EDV A;  2EHO D;  3IBP A;  4K0U A;  4H9O C;  3MAC A;  3NRX A;  3RPU A;  4U74 A;  3KFW X;  3C4W A;  4L5G A;  4UEM A;  4UVA B;  4UEL A;  2D0T A;  2LHN A;  2BDE A;  3H37 A;  4HTE A;  4C90 A;  4HN9 A;  4ZOL E;  4H9N C;  4HKA A;  2JQQ A;  2VWA A;  5HXR A;  2OA5 A;  2PBI A;  3RYH E;  4ZS3 A;  3IF8 B;  2Y6X A;  2KND A;  4AQF C;  1ZKE A;  5J2U E;  4DBQ A;  3NBX X;  2X9X A;  2C5K T;  2DLR A;  5ETW A;  3LK3 B;  1MMD A;  3N2G E;  3LK2 B;  3PUS A;  3NRY A;  4AQF A;  4AKI A;  1OXZ A;  1VOM A;  2XAF B;  4PFO A;  5LGT B;  4HE8 A;  4ZHQ E;  1G73 A;  2E8I A;  3PUG A;  1D1C A;  2BZB A;  4I43 B;  3GN5 B;  5TAO A;  4PK6 A;  5KDM C;  5LP6 E;  2LEH A;  4ILU A;  2N1G A;  3PE0 A;  5FY0 A;  4CQI A;  4OK0 A;  2DWG A;  1LVK A;  2Y48 B;  3K8P C;  3PUR A;  4O4I E;  3BQL A;  4BJN A;  3Q9D A;  2B1E A;  3ZYL A;  3CWZ B;  1OWA A;  2CEA A;  4TUY E;  4IE6 A;  2V7M A;  5FXV A;  3SS1 A;  1ZHC A;  5LGN B;  1MND A;  3OBV E;  5JDQ A;  4ZI3 C;  2DCF A;  2NP9 A;  1NAF A;  5L3D B;  1MIW A;  3HL6 A;  2EHO A;  3N5L A;  2JRK A;  5ADX L;  4IE4 A;  5JDN A;  4EYU A;  3DJB A;  2WM9 A;  4MLK A;  3N9Q A;  2LSY A;  2RA1 A;  5JDF A;  2V1D B;  3CQC B;  3Q5X A;  4OYJ A;  5JRE A;  3ZCI A;  1V9D A;  1HG2 A;  3VU7 H;  5IHY A;  3P7I A;  1LVF A;  1FMV A;  2CLY B;  3KBT A;  1HS7 A;  2KMF A;  1ZEE A;  3HKD E;  2LOS A;  5LG4 A;  2XAJ B;  4N78 D;  2IW5 B;  4G2A A;  4AXP A;  3LFM A;  3LK4 2;  3BQI A;  3RX6 A;  2WAU A;  3VKG A;  4CZZ B;  2VL8 A;  2XAG B;  2NW7 A;  2QGS A;  1FIO A;  1CUN A;  4ZI7 E;  3AVS A;  3I0Q A;  2VKJ A;  4DVD A;  3WAJ A;  2NOX A;  3EUH A;  4J2C A;  3C50 A;  3V5U A;  2VB6 A;  3AA6 B;  3FHN A;  5HXE A;  2LHR A;  4H63 V;  5DQW A;  4ASK A;  1MMN A;  3J7Y q;  5EZY E;  3ZMS B;  2X67 A;  2ODU A;  4JEU B;  2GK9 A;  3B13 A;  3FBL A;  4QXC B;  4GIW A;  4H63 H;  1EZ3 A;  4ADZ A;  3RKO A;  4HEA A;  3CPZ A;  2WMO A;  3ESL A;  4XAX B;  4YFS A;  5LCY A;  3O1J A;  3PUA A;  1HCI A;  4IE7 A;  5L3C B;  1NWM X;  3UUX B;  5JR9 C;  5FXW A;  2ZMA A;  4XBF B;  1WYC A;  5EK3 A;  5H6R B;  1UX5 A;  3R6N A;  3NZP A;  3CQX C;  3AAI A;  2YU2 A;  2XHE B;  4O2B E;  2Z6E A;  3ZMZ B;  4O2A E;  2L3L A;  2V26 A;  5A1L A;  3GN5 A;  3QC9 A;  4JUY A;  1IAP A;  2D5U A;  2XTL A;  3BK9 A;  5JVD E;  4AKR B;  5JDM A;  3N2O A;  1YKE B;  2MTQ A;  3LG7 A;  3ETV A;  2V7K A;  3CX7 B;  1UX4 A;  3JC6 D;  3KVB A;  3LBX B;  4PJM A;  1D1A A;  4EB6 E;  2NWB A;  5GON E;  3AA0 B;  2E9X B;  3EDU A;  4OHF A;  3WI3 A;  1YD8 G;  2WMN A;  2IC6 A;  2X66 A;  5JRC B;  3ZN0 B;  4HFV A;  3B57 A;  4IHJ E;  2CXL A;  1D1B A;  4QXH B;  3E08 A;  2W63 A;  3C64 A;  5KMG P;  3ZYK A;  2N9D A;  5FXX A;  1E1H B;  3RH3 A;  4JLE A;  1MMG A;  3ETU A;  3L09 A;  2K9A A;  3K3N A;  4WNK A;  4L0R A;  1ZV4 X;  2HPL A;  4MHC A;  3I9W A;  2W61 A;  2PFV A;  2NW9 A;  3ZLI A;  4CI1 B;  5JH7 E;  1SA0 E;  4GK5 E;  5CA0 E;  5KX5 E;  2E9X D;  2A3D A;  2ES0 A;  5LA6 E;  5FY7 A;  4U72 A;  3U78 A;  3UUN A;  2ZLY A;  1FMW A;  5HWX A;  2X51 A;  2LJL A;  2NTX A;  5H6Q B;  1HG5 A;  3UFE A;  4B6X A;  5EK4 A;  3ZYM A;  1BR2 A;  2W00 A;  3EVY A;  3UT5 E;  3RC8 A;  4PJN A;  4TX5 A;  4IE5 A;  3VHL A;  3E22 E;  2WWU A;  4QWN B;  3I1A A;  4O4J E;  4KP3 C;  2EHO C;  3OYZ A;  2X0L B;  5CB4 E;  4YJ3 E;  4IDZ A;  3BQK A;  2Q9Q B;  2IAK A;  5L2L A;  2JMK A;  3PUQ A;  4MBQ A;  4TV8 E;  2XAQ B;  3ZMT B;  3CVR A;  4EZ4 A;  2CA5 A;  2WSS V;  3F31 A;  1US7 B;  4X1K E;  3HKE E;  2RP4 A;  3FXE B;  4DO0 A;  2IC9 A;  4UVC B;  3O1H A;  4GYS A;  5HXS A;  5HXC A;  2P9B A;  3KV5 A;  1WYB A;  2W0G A;  3ZEF B;  5DAB A;  5JDH A;  3OJA A;  1YW0 A;  3RRC A;  2HPJ A;  2YK0 A;  1FEW A;  3N9M A;  2D2S A;  4G63 A;  3N2K E;  2E9X C;  3OYX A;  2Q9Q D;  3N9O A;  1S35 A;  3FBZ A;  4NUV A;  4PK4 A;  4ZI2 D;  5LGU B;  3O4X E;  5LBQ B;  5IYZ E;  1Z0P A;  1T98 A;  2XAH B;  3MXZ A;  4TN7 B;  4EYY R;  4GYR A;  4YJ2 E;  2E9X A;  3MJX A;  3CX6 B;  2KXP B;  2KWH A;  4TV9 E;  5JRC A;  4AKG A;  3ONX A;  3ZJ2 A;  4DMW A;  1KK7 A;  1WLX A;  4CXW A;  1YKH B;  5HAX A;  3AA7 B;  5FYM A;  3UTK A;  2CCQ A;  3QUJ A;  3AAA B;  2NW8 A;  4UV8 B;  2C5I T;  1BR0 A;  3MZK B;  3ZC1 A;  5AFU L;  1UCU A;  3MK7 C;  3PU3 A;  1D0Z A;  3I9Y A;  4QKN A;  4CXX A;  3RC3 A;  2YIN A;  1S94 A;  2K5B B;  4I55 E;  1U5P A;  4CI3 B;  1LRZ A;  2UXX B;  2WBL A;  2DHR A;  3ZN1 B;  2YU1 A;  2DNX A;  3PDY A;  3L3P A;  1KNZ A;  4PK5 A;  4ANJ A;  5FP3 A;  4M1P A;  2VK9 A;  1O3X A;  2LT3 A;  2CWO A;  3GMI A;  5FXZ A;  3ZCJ A;  2X9W A;  3AAE B;  4H9Q C;  1IJ5 A;  1WRD A;  5LBM A;  3Q5W A;  2I59 A;  2M67 A;  4QX8 B;  5LXT E;  1HX8 A;  4H9R C;  5LHG B;  4OFZ A;  4XZC A;  4PAG A;  2PJQ A;  4HGA A;  1LKX A;  4AKL A;  2VKD A;  3RRW A;  2V7I A;  2MYS A;  4GK0 E;  4PFP A;  2ZM2 A;  3DP7 A;  1B7T A;  3UUM A;  2LSG A;  5L3G B;  2KT9 A;  3FB2 A;  2UXN B;  2ODV A;  3C98 B;  4KUM B;  4A56 A;  2LSI A;  2MOZ A;  3D0T A;  3NZQ A;  3ZPO A;  2Q9Q A;  2HH7 A;  3N9N A;  4O8S A;  5HWY A;  3IHR A;  4WBN E;  4WBO A;  2Y8D A;  4P0B A;  4AQG A;  2L9Q A;  4P0A A;  5LHI B;  1HF8 A;  2SPC A;  4UVB B;  2CLY C;  4I4T E;  4ISS A;  2CWY A;  3ANW B;  2A72 A;  3S4U A;  4I50 E;  3F57 A;  4ZI3 D;  4FJO A;  4AI6 A;  1D0Y A;  2W62 A;  2C0S A;  3WAK A;  1MNE A;  3HR0 A;  1G8X A;  1IJ6 A;  4UXN B;  1WR6 A;  2ACX A;  3CKD A;  2KIN B;  5JQG E;  4DMV A;  4E7Z A;  1HTJ F;  2CM0 A;  4MAL A;  2QA7 A;  5J2T E;  4BA9 A;  2D0U A;  3P8C D;  5F8P A;  3U3I A;  2JMH A;  4UF0 B;  1AJ3 A;  2H7O A;  3KIN B;  3C51 A;  5DJQ C;  3UUL A;  3ZMV B;  5C8Y E;  5LNK A;  2XQY A;  3CQG B;  3FXD B;  5HYA A;  4X20 E;  2CE7 A;  3KDS E;  4C91 A;  2LE8 A;  4QX7 B;  5JDL A;  2LOP A;  3K3Q C;  3I0O A;  2ZM8 A;  3RYI E;  3PU8 A;  5L3B B;  5LOV E;  3AA1 B;  3JC6 C;  3SWH A;  5JR9 B;  5J1G A;  1MIY A;  3A5X A;  3ZJ1 A;  4X1Y E;  3GWH A;  2K24 A;  2KZ7 B;  3HA4 A;  1BR1 A;  4NUU A;  4AKH A;  2BVM A;  4F6R C;  3AVR A;  4TZ4 C;  4EAH A;  5L3F B;  2G0U A;  5E0O A;  2CMR A;  2KLQ A;  2VKH A;  5DQV A;  3HKC E;  3KVA A;  1U4Q A;  4JEH B;  4MFR A;  2LSJ A;  2X9Y A;  3LJC A;  3SRZ A;  1VRB A;  4PNI A;  3T8O A;  3K3O A;  4EOZ B;  2A2F X;  5LJN A;  5F3J A;  3F2E A;  4P09 A;  4V1A v;  2XUE A;  4PW8 A;  5FNV E;  1MIV A;  4H9P C;  3J9X 1;  1QUU A;  2MBG A;  3VKH A;  2LSK A;  2CXD A;  3MKD A;  4KMC A;  3KV4 A;  3CML A;  4IST A;  2VKO A;  2V7J A;  4X1I E;  3E0Z A;  1MMA A;  3LBX A;  3QK6 A;  4DBR A;  5LJM A;  4ERR A;  4IGU A;  3TKL B;  4O4L E;  4PJJ A;  5EK2 A;  2BVL A;  3ZMU B;  3GA8 A;  2LM9 A;  4UV9 B;  3Q2M A;  2K48 A;  2L8K A;  4QXB B;  2V7L A;  4H9S E;  3KV6 A;  2C5J A;  2H7V C;  4KBM B;  3R84 B;  4EIW A;  3N9L A;  5L3E B;  2DWK A;  3AB3 B;  4E7S A;  1SHZ C;  5JDG A;  1HFA A;  3C4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...