3C98B

Revised structure of the munc18a-syntaxin1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
247
structure length
230
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 1
total genus 91
structure length 230
sequence length 247
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c98B00
4JEHB 5M4YA 1FEWA 2XHEB 3C98B 1S94A 4JEUB 1BR0A 1EZ3A 2DNXA 4TX5A 3LG7A 1G73A 1FIOA 5LG4A 1HS7A
chains in the Genus database with same CATH superfamily
3QC9A 4IDOA 5HEUA 2XAFB 1YKEB 5JH7E 1E7PA 1YW0A 2D2SA 2WAUA 3IBPA 1HCIA 3EDVA 5FY0A 4X1YE 3TLVA 5FVLA 3V5SA 1WR0A 4NUUA 4ISTA 4X20E 4JI5T 4YSXA 4LFAT 2QRXA 3BQIA 3C4WA 4KUMB 2E9XA 2UXNB 3KVBA 4ZXLA 3ZKRA 4QX7B 1M7KA 3ZMZB 2XQAA 3PU3A 3TLSA 2L9QA 4MBQA 4O8SA 4LF8T 5LNKA 2LHNA 4LFBT 2NW7A 3RLFF 4JI6T 2R6GF 1MIWA 4NPPA 1EZ3A 2E2AA 4DR7T 4CZZB 3CK6A 2X67A 4YSYA 3JC6C 2WMOA 3P4WA 4BAYB 2X9HA 2V7KA 3PUWF 5LB7B 3I0OA 5CFBA 5L47A 1W09A 2OV9A 3RIAA 5C2TA 2V7JA 4UEMA 5AQTB 2BS2A 3NRYA 4DR6T 3C50A 3RC3A 4LF4T 2OLTA 2SPCA 3VKGA 1OEDB 2MBGA 4IGUA 5LBQB 3SFDA 4PFOA 4AIUA 2ZM2A 2IMLA 3J9X1 3RPUA 4DR1T 5AQUB 4ZEYA 4HFVA 5L4HA 1XNRT 2UXCT 3F57A 1SE7A 2LSGA 2KZ7B 3Q5DA 4QX8B 4BJMA 4CQIA 3JADA 1Z0PA 3AA6B 4TN7B 4WW0A 3EAMA 4I55E 3DP7A 2ZM8A 4H9OC 2P9BA 3JAEA 3ZN0B 3HR0A 1BR4A 4HGAA 3FZFB 4AISA 3DJBA 4P09A 4UXNB 5L3CB 3O9XA 2N9DA 2J62A 3AE8A 5GONE 3RX6A 3ZJ1A 2V7MA 1D0ZA 3MKDA 3ZSTA 4GIWA 2CWYA 3C4ZA 2VKOA 2DWGA 2WDQA 5CB4E 4CI2B 1DU2A 1B7TA 2NW8A 2XPKA 3AE7A 3F31A 3K3NA 4HEAA 4TUYE 4HFHA 4PJLA 1MMNA 5H6QB 4JI8T 2XQ8A 5DQWA 1D0XA 1KK7A 5EK4A 3A7MA 1BR0A 1E2AA 4ZZBA 2V7IA 3ZC0A 3EUHA 4E7ZA 4TWHA 5J2TE 2C0SA 2E9XB 2NTXA 3E08A 1NENA 5AQHB 4DR3T 4B3RT 2V1DB 2DI4A 2LHRA 3B57A 4HE8A 2CLYC 1SUMB 3KVAA 4Z91A 3FHNA 4M1PA 4O4HE 2W4XA 4OFZA 3NBXX 4QXHB 5HEHA 2V26A 4HWCA 2YN6A 2M6IA 4LMKA 3CQXC 1LVFA 3TKLB 4JLEA 5FP3A 2ACXA 2UXDT 3I9WA 2LT3A 3UU3A 2H89A 1WYCA 1ZEEA 5JDMA 5LHHB 3ZCIA 4PNIA 5LA6E 3R6NA 2HN1A 2KINB 3ZJ2A 4LFCT 4L0RA 4YHJA 2W2UA 4IE6A 3TLWA 4ILCA 3UFEA 2Y6XA 1G73A 2V6YB 4CI1B 2VASA 3ONXA 4O2AE 1OEDC 5EZYE 1MMGA 2WCAA 2YDSA 2A9UA 3RI5A 2H7VC 4HTEA 4A56A 4PW8A 3CX7B 4U33A 3VKHA 1G8XA 2BKPA 2JJ9A 2CHOA 2CA5A 2X0HA 3NRXA 5BMVE 2A3DA 2D9DA 4IE7A 3FBZA 4YTNA 2X66A 3GA8A 5AQVB 3NZQA 2E9XC 4ADZA 4QH4A 3AA7B 3JAFA 1IJ6A 3A5XA 3P4SA 2XUEA 5AQMB 5LBMA 1HX1B 3AAAB 3AEGA 3O1IA 3ZCJA 4EOZB 4EYYR 4LMLA 3PTRB 1U5PA 5L2LA 4CI3B 3ABVA 5AQSB 3KBTA 2Q9QA 3AAIA 1WLXA 3C98B 3MXZA 1KFYA 3VHLA 4QH1A 2EHOB 4ZS3A 3ZYKA 4AI6A 1KF6A 5FL0A 5LHIB 1WRDA 2DHRA 3EABA 1ZOYA 2BKOA 3PUGA 2MOZA 3Q9DA 1OXZA 2KSRA 4IE0A 4ZI3C 4DV2T 3EDUA 4HFCA 2WZHA 5JDHA 4LF6T 4TWDA 1US7B 3KV5A 4AKIA 4XAXB 3QK6A 2LSIA 2WBLA 2WQYA 1HX8A 4QH5A 2I0MA 1D1CA 4XZCA 5J1GA 2J1DG 4OYKA 3ZYLA 1R8IA 5LJNA 4YJ2E 3AA1B 1AJ3A 3M3ZB 1SA0E 3N9PA 3IF8B 4UR9A 5FNVE 4COFA 1W9RA 4EAHA 2W00A 3OTOT 2JRKA 5AQKB 2N2NA 4QXCB 2VKHA 2L3LA 5FXZA 1KNRA 4ZHQE 5LG4A 1SHZC 3ETUA 3KFWX 3CX6B 3UTKA 3PV0F 3L3PA 3Q5WA 3PE0A 4IL4A 3ONLC 2VKJA 5ABFA 3I0QA 1V9DA 4DV0T 2W66A 3KBUA 3CPZA 3UU5A 4JEHB 4ZI2D 3RIFA 4J2CA 3RQUA 3X1DA 2E5VA 5L3DB 4MALA 3KV9A 3I9YA 2K5BB 3EHZA 3Q2MA 5HWXA 2IHR1 4FJOA 4N78D 3W15B 2W63A 3UU8A 3TLTA 4CXYA 2LOPA 2XZEA 4JI7T 5F5WA 3UULA 1XNQT 2UXBT 3CMLA 3CQCB 3K3QC 5F3JA 4BA9A 4UF0A 2MPKA 4IDQA 3NWIA 4AQFA 4UV8B 1KNPA 1BR2A 4PK5A 2XQ6A 3CVRA 5HXSA 3ETVA 1MMAA 2VQET 3A8YC 2GK9A 3ZT6A 4NXMT 4YFSA 4JI1T 5HXHA 2V5CA 2YU1A 2PBIA 2HH7A 3RHWA 4ZI3D 1VCSA 1VCTA 3PUSA 3O1HA 4HN9A 5A1LA 1QUUA 1T72A 2JQKA 2WZIA 5IWAT 1Y01A 2X9WA 2K48A 3H37A 3UFGA 3QB5K 4TNVA 4PJNA 3UU6A 4DIDB 4IREA 5FMNA 4EXTA 4TV8E 1JNRA 5EK2A 3ZLIA 3CWZB 4IDZA 1YKHB 1W0BA 2AE9A 3N2KE 3VR8A 2BG9A 3ZC1A 2WU2A 2E9XD 3T1YT 1XMQT 1HFAA 2IIUA 4MLKA 3RYFE 3LSVA 1N33T 2IDOB 3K3OA 4DVDA 5HXEA 4K0KT 2V8SV 2Y48B 3J7Yq 4ZI2C 5AQQB 2ODUA 5LG3A 2Q9QD 4H63V 1J5WA 2V5DA 4HWHA 2G0UA 1VOMA 2XQYA 2IUBA 2CMRA 4XBFB 4HFBA 5CJ5A 5ETWA 4IE5A 1XWMA 2CLYB 2YK0A 3CQGB 4KMCA 4DUZT 2CXFA 1MNDA 3G06A 2UU9T 1VRBA 2WU5A 3HL6A 4AQGA 3HA4A 5HXCA 2BG9C 2XY8B 2CBIA 4B3ST 3N9QA 4U7IA 1IBKT 4LF7T 4YY3T 1MIVA 4IHJE 3KINB 3VRAA 4DUYT 4G63A 3FZKB 5HYAA 3AA0B 1D0YA 3FBLA 4KP3C 3ZEFB 1XZYA 3P8CD 4QHOA 3PUXF 4TNWA 2FJDA 3NVOA 2X9XA 3H3AA 2XHEB 2CBJA 2XAQB 4GK5E 4H9NC 1OEDA 2E5LT 2ES0A 3RIUC 3AB3B 4UELA 4O4IE 2XQ3A 2WMNA 3K8PC 4OYJA 2BVMA 4A5XA 3AECA 5LCYA 1XMOT 4KBMB 5EK3A 3UQ7A 3PUZF 2B1EA 2NP9A 1UGOA 2HPLA 3AE9A 3BQLA 3N2GE 1UX5A 3LBXA 5JDQA 4AKGA 5HCJA 4GKJT 5J2UE 4KI0F 1E1HB 2Y8DA 4AQYT 2BS4A 3PDYA 4DR4T 1IBMT 4K0UA 2LOSA 2X9YA 2RA1A 3N9MA 3AE6A 1HF8A 1LRZA 1UUSA 4YTMA 5E0OA 5TAOA 2NW9A 3RQWA 4DR2T 5FXVA 3AE3A 2EHOC 3F2EA 5H6RB 2VVSA 4WNKA 1HG5A 4DMVA 2CHNA 2X0YA 3QUJA 2IAKA 4H9RC 5IYZE 3C51A 1OWAA 4EYUA 5LYJE 3PJAA 2LJLA 3AXJA 3HKEE 4DBRA 2MAWA 4QXBB 3RYHE 3RC8A 4A98A 3VR9A 4DR5T 2YEVC 2WDVA 3FXEB 4B6XA 4UF0B 1KNZA 3ZT5A 2M67A 2XSBA 4Z90A 3KV6A 5FL1A 4H9QC 3PJAJ 5LHGB 2W61A 4ERRA 4ILBA 3Q5XA 4LF9T 4JEUB 3JC6D 2WSSV 2UUCT 2WS3A 2C5KT 4L9IA 1M62A 3M65A 5JDFA 5LMNT 3RRCA 2VURA 2I6HA 2N1GA 1LKXA 2EHOA 3CIRA 1O3XA 1D1BA 3ZMTB 1S94A 4BJNA 5KXJA 4DV6T 5JRCA 3HKBE 2CXDA 3H3MA 5AQNB 2AXDS 2CEAA 2KMFA 2VL8A 3OVUA 4CN4A 3AEBA 4DV5T 3ZN1B 3QNUA 1T7SA 3O1JA 4X66T 5C3JA 4OX9T 3V5UA 2X51A 2XQ7A 1X9BA 1CUNA 1FJGT 3ZT7A 1NWMX 4ASKA 3S4UA 2BBHA 3NZPA 3WAJA 1HNZT 3LJCA 4LF5T 4JI3T 1QLBA 3ONJA 3K1SA 2CM0A 3ZMSB 5L3FB 2NR4A 5JR9A 4DV4T 1N32T 1HNXT 2XTLA 4NXNT 2KNDA 5FVKA 2FUPA 4ANJA 4U74A 3T1HT 3FZLB 1T8BA 2F4VT 4CXXA 2W62A 5JTGA 2E8IA 3AAEB 4F6RC 4JYAT 5JQGE 2C5JA 4AKHA 2XM1A 2H3RA 3CKDA 2ACZA 4I50E 3SS1A 2PJQA 1D1AA 2DWKA 4Z8XA 4ZI7E 2LEHA 5LXTE 5ABFB 4DV7T 3KDSE 4WZXA 3GWHA 4YSZA 4CN1A 3OKQA 1ZHCA 2IW5B 4DBQA 1MIYA 3AE4A 2YDQA 3UU4A 1YQ3A 5CA1E 3VU7H 3HKCE 5FY7A 1MNEA 5AQLB 5LMUT 2NWBA 5L3EB 1WCRA 3ANWA 2LSYA 2JMKA 5DJQC 2NOXA 2J47A 1IJ5A 3HI2A 1MMDA 3P4PA 2KT9A 5HXRA 1WFDA 3ANWB 1UURA 4P1NA 1IAPA 1NEKA 3ESLA 2CRBA 3LK2B 2A2FX 2IC9A 2QA7A 2YKSA 3AXJB 2KLQA 3PU8A 4HFDA 3QOFA 3BQKA 3IA3A 4OK0A 3DTOA 3FZHB 4TZ4C 2X68A 2C5IT 5L3BB 3L09A 3UUNA 2L8KA 4H9PC 3EVYA 3E22E 4U7YA 4AQFC 2D0TA 4FI5A 4NUVA 4ILAA 3RYIE 2QVAA 4C91A 5FY1A 3LFMA 3U3IA 3GMIA 4EZHA 3EI0A 5AQPB 3P4RA 4KHZF 2XJ7A 3R84B 5JR9C 2FJAA 3LBXB 4ZOLE 1J5ET 3IHRA 3N9OA 2JQ9A 2A72A 2YU2A 2VL0A 1T98A 1IBLT 2DCFA 2WP9A 3MZKB 5ABHA 2EHOD 1BR1A 4G2AA 3SOLA 2XQ4A 4HFIA 2LLYA 4I4TE 4B3TT 2LRLA 2LRKA 4YHHT 2PTFA 2VWAA 3IEEA 5BR8T 4WBOA 4GK0E 3CX8B 5LOVE 1LVKA 5AQFB 5LGNB 3PUYF 1N36T 3MACA 4PJJA 4U72A 1HTJF 2JMHA 2CCQA 3RKGA 3JCFA 3RYCE 3SWHA 5HEOA 4DMWA 2J4GA 5IHYA 2FJBA 4IE4A 3N2OA 1I94T 2PFVA 2OA5A 1QSDA 4EB6E 4UV9B 2ZM0A 5LGUB 1UCUA 2JQQA 4I43B 3OYXA 2XAHB 3AE1A 2LM2A 2W0GA 2LSKA 3AEAA 2K3WA 3RH3A 4YTPA 2YOEA 5ADXL 5IUXA 5JDLA 4JV5T 2W67A 5L4EA 2H7OA 4GOUA 5KDMC 2BZBA 5KX5E 4X65T 1I6ZA 2ZMAA 1FMWA 4NIQA 3OPCA 3LK42 3AE5A 1OEDE 4H63H 3TLUA 5JDGA 4U31A 2VQFT 1N34T 2HPJA 2CXLA 4MFRA 4AKRB 4X1IE 4DV3T 4KHPT 3ZPOA 3C4XA 4HWFA 2YINA 3L39A 3LG7A 3FXDB 1IZNB 3AEFA 3LK3B 4ISSA 4PK4A 2CE7A 2D0UA 2FBWA 5FXXA 4TWFA 2HN2A 2DL1A 2IC6A 3Q5EA 5FKYA 4IDNA 4X1KE 5AQJB 4JI4T 2WWUA 2DNXA 1KEYA 2B76A 5AQOB 4GKKT 4HWIB 4TV9E 2KWIB 2LSJA 4A97A 1HS7A 2V7LA 5AFUL 2JQHA 4GYSA 4IIJE 3L8RA 5AQRB 5ABEA 1GQEA 1WR6A 1UK5A 2XQ9A 3B5MA 4EGWA 4B3MT 4U2ZA 3O4XE 4DO0A 2BDEA 2VK9A 2XAJB 1Y64B 2LM9A 1X79A 2XQ5A 2Q9QC 4O4JE 5DQVA 5JDNA 4PK6A 4YT0A 4DNDA 2CPTA 4WYVA 4UVAB 5LJMA 1WYBA 2VKDA 3SFEA 4F8HA 3N9LA 1Z8UA 1H7CA 2ZM6T 4WBNE 2H88A 1HR0T 5ABGA 2VB6A 2K9AA 3PURA 1HNWT 3MJXA 3AE2A 3ZYMA 2XM2A 2BG9B 2RP4A 5M4YA 3WI3A 2YDRA 4DV1T 1JNZA 2FJEA 3VRBA 2BKNA 4UIGA 3I1AA 3OYZA 4P0BA 3UUBA 4YXDA 2BBJA 1XDOA 1ZV4X 2K24A 3AVSA 4KX6A 3RGLA 1NAFA 4IT4A 5KMGP 3RF1A 4JI0T 4QWNB 2KWHA 4H9SE 4U3CA 1ZP0A 2I59A 4C90A 3UUMA 3U78A 5HAXA 3PUAA 5CGMA 5JREA 3AVRA 1XDPA 3UUXB 3LDQB 3ZSSA 5HCMA 3KV4A 3PUQA 3RIUA 4U2YA 2ODVA 4E7SA 5C8YE 1FIOA 2NTYA 2D5UA 2MTQA 5F8PA 5HEJA 1ZKEA 3PUVF 4UVCB 5JR9B 4X64T 1YQ4A 2RPAA 3B13A 3ZMUB 3MK7C 3UT5E 3NKZA 5AQIB 1UX4A 2XAGB 3D0TA 3P50A 4V1Av 5FYMA 4Q25A 4I0UA 4L5GA 3ZMVB 3C64A 4CXWA 2PG8A 5FXWA 4JI2T 3UQ4A 4EEDA 2XSAA 2WB5A 4EIWA 5CA0E 1L0VA 2XASB 1FEWA 2LKHA 3E0ZA 2Q9QB 3SRZA 5JRCB 4O4LE 2WWVA 3GN5B 2V6XA 3FB2A 1CHUA 4AKLA 4ZZCA 2KXPB 4PJMA 5HWYA 4AXPA 2UUAT 5L3GB 3AEEA 4PAGA 3RRWA 2BVLA 4X62T 4YJ3E 5LP6E 3MA9A 3FZMB 3QB5A 4UVBB 4YLHA 4MHCA 5JVDE 2JPFA 4JUYA 4CN6A 4ZS2A 1FMVA 5J0ZA 2UUBT 5DABA 2BS3A 1YD8G 3RKOA 2Z6EA 2DLRA 4HFEA 3WAKA 5LGTB 2M6BA 2CWOA 1J1JA 2WY2A 2LE8A 2MYSA 3OJAA 4EZ4A 4X5TA 1YXRA 3P7IA 4EEBA 3P4QA 3OBVE 5AQGB 2HHHT 1HG2A 4PFPA 2QYWA 3T8OA 3HKDE 5HEGA 1U4QA 2WDRA 2V6YA 4IL9A 3GN5A 4TX5A 1S35A 2ZLYA 4QKNA 2X0LB 4P0AA 4EV6A 4OHFA 3N9NA 4O2BE 2UXXB 2BG9E 2LKGA 4JBWF 3N5LA 4LMJA 4GYRA 3BK9A 2JIWA 2QGSA 2WM9A 2VVNA 3AEDA 4IDPA 1W0AA 4HWDA 4ILUA 4HKAA
chains in the Genus database with same CATH topology
3QC9A 2XAFB 1YKEB 5JH7E 2D2SA 1YW0A 2WAUA 3IBPA 1HCIA 3EDVA 5FY0A 4X1YE 3V5SA 4NUUA 4ISTA 4X20E 3BQIA 3C4WA 4KUMB 2E9XA 2UXNB 3KVBA 4QX7B 3ZMZB 3PU3A 2L9QA 4MBQA 4O8SA 5LNKA 2LHNA 2NW7A 1MIWA 1EZ3A 4CZZB 2X67A 3JC6C 2WMOA 4BAYB 2X9HA 2V7KA 3I0OA 2V7JA 3NRYA 3C50A 3RC3A 2SPCA 3VKGA 2MBGA 4IGUA 5LBQB 4PFOA 2ZM2A 3J9X1 3RPUA 4HFVA 3F57A 2LSGA 2KZ7B 4QX8B 4BJMA 4CQIA 4TN7B 1Z0PA 3AA6B 4WW0A 4I55E 3DP7A 2ZM8A 4H9OC 2P9BA 3ZN0B 3HR0A 1BR4A 4HGAA 3DJBA 4P09A 4UXNB 5L3CB 3O9XA 2N9DA 5GONE 3RX6A 3ZJ1A 2V7MA 1D0ZA 3MKDA 4GIWA 2CWYA 3C4ZA 2VKOA 2DWGA 5CB4E 1B7TA 2NW8A 3K3NA 3F31A 4HEAA 4TUYE 4PJLA 1MMNA 5DQWA 1D0XA 1KK7A 5EK4A 1BR0A 2V7IA 3ZC0A 3EUHA 4E7ZA 5J2TE 2C0SA 2E9XB 2NTXA 3E08A 2V1DB 2DI4A 3B57A 2LHRA 4HE8A 2CLYC 3KVAA 5H6QB 3ZLIA 3FHNA 4M1PA 4O4HE 4OFZA 4QXHB 3NBXX 4AKGA 2V26A 3CQXC 1LVFA 3TKLB 4JLEA 5FP3A 2ACXA 3I9WA 2LT3A 5LHHB 1WYCA 1ZEEA 5JDMA 3ZCIA 4PNIA 5LA6E 3R6NA 3ZJ2A 2KINB 4L0RA 4YHJA 4IE6A 3UFEA 2Y6XA 1G73A 4CI1B 2VASA 3ONXA 4O2AE 1MMGA 4A56A 2H7VC 4HTEA 4PW8A 3CX7B 3VKHA 1G8XA 2JJ9A 2CA5A 3NRXA 5BMVE 2A3DA 4IE7A 3FBZA 2X66A 3GA8A 4ADZA 3NZQA 2E9XC 3AA7B 1IJ6A 3A5XA 5LBMA 2XUEA 3AAAB 3O1IA 4EOZB 3ZCJA 4EYYR 3PTRB 1U5PA 5L2LA 4CI3B 3KBTA 2Q9QA 3AAIA 1WLXA 3C98B 3MXZA 3VHLA 5CA1E 4AI6A 2EHOB 4ZS3A 3ZYKA 1WRDA 2DHRA 4CI2B 4IE0A 3PUGA 2MOZA 3Q9DA 1OXZA 4ZI3C 3EDUA 5JDHA 4AKIA 1US7B 3KV5A 4XAXB 3QK6A 2WBLA 2LSIA 1HX8A 3ZYLA 1D1CA 4XZCA 5J1GA 2J1DG 4OYKA 5LJNA 4YJ2E 3AA1B 3N9PA 1SA0E 4EAHA 3IF8B 5FNVE 2W00A 2JRKA 2N2NA 4QXCB 2VKHA 2L3LA 5FXZA 4ZHQE 5LG4A 1SHZC 3ETUA 3KFWX 3CX6B 3UTKA 3L3PA 3Q5WA 3PE0A 2VKJA 3I0QA 1V9DA 3KBUA 3CPZA 4JEHB 4ZI2D 4J2CA 5L3DB 4MALA 3KV9A 3I9YA 2K5BB 3Q2MA 5HWXA 4FJOA 4N78D 3W15B 2W63A 4CXYA 2LOPA 3UULA 3CMLA 3CQCB 3K3QC 5F3JA 4BA9A 4UF0A 4AQFA 4UV8B 1BR2A 4PK5A 3CVRA 5HXSA 3ETVA 1MMAA 2GK9A 5HXHA 2YU1A 2PBIA 2HH7A 4ZI3D 3PUSA 3O1HA 4HN9A 5A1LA 1QUUA 2X9WA 2K48A 3H37A 4PJNA 4EXTA 5FMNA 4TV8E 5EK2A 3CWZB 4IDZA 1YKHB 3N2KE 3ZC1A 2E9XD 1HFAA 4MLKA 3RYFE 3K3OA 4DVDA 5HXEA 2Y48B 3J7Yq 4ZI2C 2ODUA 2Q9QD 4H63V 2G0UA 1VOMA 2XQYA 2CMRA 4XBFB 5ETWA 4IE5A 2YK0A 2CLYB 3CQGB 4KMCA 2CXFA 1MNDA 1VRBA 4AQGA 3HL6A 3HA4A 5HXCA 3N9QA 1MIVA 4IHJE 3KINB 4G63A 5HYAA 3AA0B 1D0YA 3FBLA 4KP3C 3ZEFB 3P8CD 4QHOA 2X9XA 3H3AA 2XHEB 2XAQB 4GK5E 4H9NC 2ES0A 3AB3B 4UELA 4O4IE 3K8PC 2WMNA 4OYJA 2BVMA 5LCYA 4KBMB 5EK3A 2B1EA 2NP9A 2HPLA 3BQLA 5JDQA 3N2GE 1UX5A 3LBXA 5J2UE 1E1HB 2Y8DA 3PDYA 4K0UA 2LOSA 2X9YA 2RA1A 3N9MA 5E0OA 1HF8A 1LRZA 5TAOA 2NW9A 1AJ3A 5FXVA 3F2EA 2EHOC 5H6RB 4DMVA 5LHIB 4WNKA 1HG5A 3QUJA 2IAKA 4H9RC 5IYZE 3C51A 1OWAA 4EYUA 5LYJE 2LJLA 3HKEE 4DBRA 4QXBB 3RYHE 3RC8A 2YEVC 3FXEB 4B6XA 4UF0B 1KNZA 2M67A 3KV6A 4H9QC 5LHGB 2W61A 4ERRA 3Q5XA 4JEUB 3JC6D 2WSSV 2C5KT 4L9IA 3M65A 5JDFA 3RRCA 2N1GA 1LKXA 2EHOA 4BJNA 1O3XA 1D1BA 3ZMTB 1S94A 5JRCA 3HKBE 2CXDA 2CEAA 2KMFA 2VL8A 3ZN1B 3O1JA 3V5UA 2X51A 1CUNA 1NWMX 4ASKA 3S4UA 3WAJA 3LJCA 2CM0A 3ZMSB 5L3FB 5JR9A 2XTLA 2KNDA 4ANJA 4U74A 4CXXA 2W62A 2E8IA 3AAEB 4F6RC 5JQGE 2C5JA 4AKHA 4I50E 2H3RA 3CKDA 3SS1A 2PJQA 1D1AA 2DWKA 4Z8XA 4ZI7E 2LEHA 5LXTE 3KDSE 3GWHA 3OKQA 1ZHCA 2IW5B 4DBQA 1MIYA 3VU7H 3HKCE 5FY7A 1MNEA 2NWBA 5L3EB 3ANWA 2LSYA 2JMKA 5DJQC 2NOXA 1IJ5A 3HI2A 1MMDA 2KT9A 5HXRA 3ANWB 1IAPA 3ESLA 3NZPA 3LK2B 2A2FX 2IC9A 2QA7A 5EZYE 2KLQA 3PU8A 4OK0A 3BQKA 3DTOA 4TZ4C 5L3BB 2X68A 2C5IT 3L09A 3UUNA 2L8KA 4H9PC 3EVYA 3E22E 4AQFC 2D0TA 4FI5A 4NUVA 4C91A 3RYIE 5FY1A 3LFMA 3U3IA 3GMIA 4EZHA 3R84B 5JR9C 3LBXB 4ZOLE 3IHRA 3N9OA 2A72A 2YU2A 1T98A 2DCFA 3MZKB 2EHOD 1BR1A 4G2AA 3SOLA 4I4TE 2VWAA 3IEEA 4WBOA 4GK0E 3CX8B 5LOVE 1LVKA 5LGNB 3MACA 4PJJA 4U72A 1HTJF 2JMHA 2CCQA 3RYCE 3SWHA 4DMWA 5IHYA 4IE4A 3N2OA 2PFVA 2OA5A 1QSDA 4EB6E 4UV9B 2ZM0A 5LGUB 1UCUA 2JQQA 4I43B 3OYXA 2XAHB 3RH3A 2W0GA 2LSKA 5JDLA 5ADXL 2H7OA 4GOUA 5KDMC 2BZBA 5KX5E 2ZMAA 1FMWA 3LK42 4H63H 5JDGA 2HPJA 2CXLA 4MFRA 4AKRB 4X1IE 3ZPOA 3C4XA 2YINA 3LK3B 3LG7A 3FXDB 1IZNB 4ISSA 4PK4A 4UEMA 2CE7A 2D0UA 5FXXA 2IC6A 4X1KE 2WWUA 2DNXA 4TV9E 2KWIB 2LSJA 1HS7A 2V7LA 5AFUL 5LJMA 4GYSA 4IIJE 1WR6A 3O4XE 4DO0A 2BDEA 2VK9A 2XAJB 1Y64B 2LM9A 1X79A 4O4JE 2Q9QC 5DQVA 5JDNA 4PK6A 4DNDA 4UVAB 1WYBA 2VKDA 3N9LA 1H7CA 4WBNE 2VB6A 2K9AA 3PURA 3MJXA 3ZYMA 2RP4A 5M4YA 3WI3A 4UIGA 3I1AA 3OYZA 4P0BA 1ZV4X 2K24A 3AVSA 5KMGP 1NAFA 4QWNB 2KWHA 4H9SE 4C90A 2I59A 3UUMA 3U78A 5HAXA 3PUAA 5JREA 3AVRA 3UUXB 3KV4A 3PUQA 2ODVA 4E7SA 5C8YE 1FIOA 2NTYA 2D5UA 2MTQA 5F8PA 1ZKEA 5JR9B 4UVCB 3B13A 3ZMUB 3MK7C 3UT5E 1UX4A 2XAGB 3D0TA 4V1Av 5FYMA 4L5GA 3ZMVB 3C64A 4CXWA 2PG8A 5FXWA 4EIWA 5CA0E 2XASB 1FEWA 3E0ZA 2Q9QB 3SRZA 5JRCB 4O4LE 3GN5B 3FB2A 4AKLA 2KXPB 4PJMA 5HWYA 4AXPA 5L3GB 4PAGA 3RRWA 2BVLA 4YJ3E 5LP6E 3MA9A 4UVBB 4YLHA 4MHCA 5JVDE 2JPFA 4JUYA 4ZS2A 1FMVA 5DABA 1YD8G 3RKOA 2Z6EA 2DLRA 3WAKA 5LGTB 2CWOA 2LE8A 2MYSA 3OJAA 4EZ4A 3P7IA 3OBVE 1HG2A 4PFPA 3T8OA 3HKDE 1U4QA 3GN5A 4TX5A 1S35A 2ZLYA 4QKNA 2X0LB 4P0AA 4OHFA 3N9NA 4O2BE 2UXXB 3N5LA 4GYRA 3BK9A 2QGSA 2WM9A 4YFSA 4ILUA 4HKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEH B;  5M4Y A;  1FEW A;  2XHE B;  3C98 B;  1S94 A;  4JEU B;  1BR0 A;  1EZ3 A;  2DNX A;  4TX5 A;  3LG7 A;  1G73 A;  1FIO A;  5LG4 A;  1HS7 A; 
#chains in the Genus database with same CATH topology
 3QC9 A;  4IDO A;  5HEU A;  2XAF B;  1YKE B;  5JH7 E;  1E7P A;  1YW0 A;  2D2S A;  2WAU A;  3IBP A;  1HCI A;  3EDV A;  5FY0 A;  4X1Y E;  3TLV A;  5FVL A;  3V5S A;  1WR0 A;  4NUU A;  4IST A;  4X20 E;  4JI5 T;  4YSX A;  4LFA T;  2QRX A;  3BQI A;  3C4W A;  4KUM B;  2E9X A;  2UXN B;  3KVB A;  4ZXL A;  3ZKR A;  4QX7 B;  1M7K A;  3ZMZ B;  2XQA A;  3PU3 A;  3TLS A;  2L9Q A;  4MBQ A;  4O8S A;  4LF8 T;  5LNK A;  2LHN A;  4LFB T;  2NW7 A;  3RLF F;  4JI6 T;  2R6G F;  1MIW A;  4NPP A;  1EZ3 A;  2E2A A;  4DR7 T;  4CZZ B;  3CK6 A;  2X67 A;  4YSY A;  3JC6 C;  2WMO A;  3P4W A;  4BAY B;  2X9H A;  2V7K A;  3PUW F;  5LB7 B;  3I0O A;  5CFB A;  5L47 A;  1W09 A;  2OV9 A;  3RIA A;  5C2T A;  2V7J A;  4UEM A;  5AQT B;  2BS2 A;  3NRY A;  4DR6 T;  3C50 A;  3RC3 A;  4LF4 T;  2OLT A;  2SPC A;  3VKG A;  1OED B;  2MBG A;  4IGU A;  5LBQ B;  3SFD A;  4PFO A;  4AIU A;  2ZM2 A;  2IML A;  3J9X 1;  3RPU A;  4DR1 T;  5AQU B;  4ZEY A;  4HFV A;  5L4H A;  1XNR T;  2UXC T;  3F57 A;  1SE7 A;  2LSG A;  2KZ7 B;  3Q5D A;  4QX8 B;  4BJM A;  4CQI A;  3JAD A;  1Z0P A;  3AA6 B;  4TN7 B;  4WW0 A;  3EAM A;  4I55 E;  3DP7 A;  2ZM8 A;  4H9O C;  2P9B A;  3JAE A;  3ZN0 B;  3HR0 A;  1BR4 A;  4HGA A;  3FZF B;  4AIS A;  3DJB A;  4P09 A;  4UXN B;  5L3C B;  3O9X A;  2N9D A;  2J62 A;  3AE8 A;  5GON E;  3RX6 A;  3ZJ1 A;  2V7M A;  1D0Z A;  3MKD A;  3ZST A;  4GIW A;  2CWY A;  3C4Z A;  2VKO A;  2DWG A;  2WDQ A;  5CB4 E;  4CI2 B;  1DU2 A;  1B7T A;  2NW8 A;  2XPK A;  3AE7 A;  3F31 A;  3K3N A;  4HEA A;  4TUY E;  4HFH A;  4PJL A;  1MMN A;  5H6Q B;  4JI8 T;  2XQ8 A;  5DQW A;  1D0X A;  1KK7 A;  5EK4 A;  3A7M A;  1BR0 A;  1E2A A;  4ZZB A;  2V7I A;  3ZC0 A;  3EUH A;  4E7Z A;  4TWH A;  5J2T E;  2C0S A;  2E9X B;  2NTX A;  3E08 A;  1NEN A;  5AQH B;  4DR3 T;  4B3R T;  2V1D B;  2DI4 A;  2LHR A;  3B57 A;  4HE8 A;  2CLY C;  1SUM B;  3KVA A;  4Z91 A;  3FHN A;  4M1P A;  4O4H E;  2W4X A;  4OFZ A;  3NBX X;  4QXH B;  5HEH A;  2V26 A;  4HWC A;  2YN6 A;  2M6I A;  4LMK A;  3CQX C;  1LVF A;  3TKL B;  4JLE A;  5FP3 A;  2ACX A;  2UXD T;  3I9W A;  2LT3 A;  3UU3 A;  2H89 A;  1WYC A;  1ZEE A;  5JDM A;  5LHH B;  3ZCI A;  4PNI A;  5LA6 E;  3R6N A;  2HN1 A;  2KIN B;  3ZJ2 A;  4LFC T;  4L0R A;  4YHJ A;  2W2U A;  4IE6 A;  3TLW A;  4ILC A;  3UFE A;  2Y6X A;  1G73 A;  2V6Y B;  4CI1 B;  2VAS A;  3ONX A;  4O2A E;  1OED C;  5EZY E;  1MMG A;  2WCA A;  2YDS A;  2A9U A;  3RI5 A;  2H7V C;  4HTE A;  4A56 A;  4PW8 A;  3CX7 B;  4U33 A;  3VKH A;  1G8X A;  2BKP A;  2JJ9 A;  2CHO A;  2CA5 A;  2X0H A;  3NRX A;  5BMV E;  2A3D A;  2D9D A;  4IE7 A;  3FBZ A;  4YTN A;  2X66 A;  3GA8 A;  5AQV B;  3NZQ A;  2E9X C;  4ADZ A;  4QH4 A;  3AA7 B;  3JAF A;  1IJ6 A;  3A5X A;  3P4S A;  2XUE A;  5AQM B;  5LBM A;  1HX1 B;  3AAA B;  3AEG A;  3O1I A;  3ZCJ A;  4EOZ B;  4EYY R;  4LML A;  3PTR B;  1U5P A;  5L2L A;  4CI3 B;  3ABV A;  5AQS B;  3KBT A;  2Q9Q A;  3AAI A;  1WLX A;  3C98 B;  3MXZ A;  1KFY A;  3VHL A;  4QH1 A;  2EHO B;  4ZS3 A;  3ZYK A;  4AI6 A;  1KF6 A;  5FL0 A;  5LHI B;  1WRD A;  2DHR A;  3EAB A;  1ZOY A;  2BKO A;  3PUG A;  2MOZ A;  3Q9D A;  1OXZ A;  2KSR A;  4IE0 A;  4ZI3 C;  4DV2 T;  3EDU A;  4HFC A;  2WZH A;  5JDH A;  4LF6 T;  4TWD A;  1US7 B;  3KV5 A;  4AKI A;  4XAX B;  3QK6 A;  2LSI A;  2WBL A;  2WQY A;  1HX8 A;  4QH5 A;  2I0M A;  1D1C A;  4XZC A;  5J1G A;  2J1D G;  4OYK A;  3ZYL A;  1R8I A;  5LJN A;  4YJ2 E;  3AA1 B;  1AJ3 A;  3M3Z B;  1SA0 E;  3N9P A;  3IF8 B;  4UR9 A;  5FNV E;  4COF A;  1W9R A;  4EAH A;  2W00 A;  3OTO T;  2JRK A;  5AQK B;  2N2N A;  4QXC B;  2VKH A;  2L3L A;  5FXZ A;  1KNR A;  4ZHQ E;  5LG4 A;  1SHZ C;  3ETU A;  3KFW X;  3CX6 B;  3UTK A;  3PV0 F;  3L3P A;  3Q5W A;  3PE0 A;  4IL4 A;  3ONL C;  2VKJ A;  5ABF A;  3I0Q A;  1V9D A;  4DV0 T;  2W66 A;  3KBU A;  3CPZ A;  3UU5 A;  4JEH B;  4ZI2 D;  3RIF A;  4J2C A;  3RQU A;  3X1D A;  2E5V A;  5L3D B;  4MAL A;  3KV9 A;  3I9Y A;  2K5B B;  3EHZ A;  3Q2M A;  5HWX A;  2IHR 1;  4FJO A;  4N78 D;  3W15 B;  2W63 A;  3UU8 A;  3TLT A;  4CXY A;  2LOP A;  2XZE A;  4JI7 T;  5F5W A;  3UUL A;  1XNQ T;  2UXB T;  3CML A;  3CQC B;  3K3Q C;  5F3J A;  4BA9 A;  4UF0 A;  2MPK A;  4IDQ A;  3NWI A;  4AQF A;  4UV8 B;  1KNP A;  1BR2 A;  4PK5 A;  2XQ6 A;  3CVR A;  5HXS A;  3ETV A;  1MMA A;  2VQE T;  3A8Y C;  2GK9 A;  3ZT6 A;  4NXM T;  4YFS A;  4JI1 T;  5HXH A;  2V5C A;  2YU1 A;  2PBI A;  2HH7 A;  3RHW A;  4ZI3 D;  1VCS A;  1VCT A;  3PUS A;  3O1H A;  4HN9 A;  5A1L A;  1QUU A;  1T72 A;  2JQK A;  2WZI A;  5IWA T;  1Y01 A;  2X9W A;  2K48 A;  3H37 A;  3UFG A;  3QB5 K;  4TNV A;  4PJN A;  3UU6 A;  4DID B;  4IRE A;  5FMN A;  4EXT A;  4TV8 E;  1JNR A;  5EK2 A;  3ZLI A;  3CWZ B;  4IDZ A;  1YKH B;  1W0B A;  2AE9 A;  3N2K E;  3VR8 A;  2BG9 A;  3ZC1 A;  2WU2 A;  2E9X D;  3T1Y T;  1XMQ T;  1HFA A;  2IIU A;  4MLK A;  3RYF E;  3LSV A;  1N33 T;  2IDO B;  3K3O A;  4DVD A;  5HXE A;  4K0K T;  2V8S V;  2Y48 B;  3J7Y q;  4ZI2 C;  5AQQ B;  2ODU A;  5LG3 A;  2Q9Q D;  4H63 V;  1J5W A;  2V5D A;  4HWH A;  2G0U A;  1VOM A;  2XQY A;  2IUB A;  2CMR A;  4XBF B;  4HFB A;  5CJ5 A;  5ETW A;  4IE5 A;  1XWM A;  2CLY B;  2YK0 A;  3CQG B;  4KMC A;  4DUZ T;  2CXF A;  1MND A;  3G06 A;  2UU9 T;  1VRB A;  2WU5 A;  3HL6 A;  4AQG A;  3HA4 A;  5HXC A;  2BG9 C;  2XY8 B;  2CBI A;  4B3S T;  3N9Q A;  4U7I A;  1IBK T;  4LF7 T;  4YY3 T;  1MIV A;  4IHJ E;  3KIN B;  3VRA A;  4DUY T;  4G63 A;  3FZK B;  5HYA A;  3AA0 B;  1D0Y A;  3FBL A;  4KP3 C;  3ZEF B;  1XZY A;  3P8C D;  4QHO A;  3PUX F;  4TNW A;  2FJD A;  3NVO A;  2X9X A;  3H3A A;  2XHE B;  2CBJ A;  2XAQ B;  4GK5 E;  4H9N C;  1OED A;  2E5L T;  2ES0 A;  3RIU C;  3AB3 B;  4UEL A;  4O4I E;  2XQ3 A;  2WMN A;  3K8P C;  4OYJ A;  2BVM A;  4A5X A;  3AEC A;  5LCY A;  1XMO T;  4KBM B;  5EK3 A;  3UQ7 A;  3PUZ F;  2B1E A;  2NP9 A;  1UGO A;  2HPL A;  3AE9 A;  3BQL A;  3N2G E;  1UX5 A;  3LBX A;  5JDQ A;  4AKG A;  5HCJ A;  4GKJ T;  5J2U E;  4KI0 F;  1E1H B;  2Y8D A;  4AQY T;  2BS4 A;  3PDY A;  4DR4 T;  1IBM T;  4K0U A;  2LOS A;  2X9Y A;  2RA1 A;  3N9M A;  3AE6 A;  1HF8 A;  1LRZ A;  1UUS A;  4YTM A;  5E0O A;  5TAO A;  2NW9 A;  3RQW A;  4DR2 T;  5FXV A;  3AE3 A;  2EHO C;  3F2E A;  5H6R B;  2VVS A;  4WNK A;  1HG5 A;  4DMV A;  2CHN A;  2X0Y A;  3QUJ A;  2IAK A;  4H9R C;  5IYZ E;  3C51 A;  1OWA A;  4EYU A;  5LYJ E;  3PJA A;  2LJL A;  3AXJ A;  3HKE E;  4DBR A;  2MAW A;  4QXB B;  3RYH E;  3RC8 A;  4A98 A;  3VR9 A;  4DR5 T;  2YEV C;  2WDV A;  3FXE B;  4B6X A;  4UF0 B;  1KNZ A;  3ZT5 A;  2M67 A;  2XSB A;  4Z90 A;  3KV6 A;  5FL1 A;  4H9Q C;  3PJA J;  5LHG B;  2W61 A;  4ERR A;  4ILB A;  3Q5X A;  4LF9 T;  4JEU B;  3JC6 D;  2WSS V;  2UUC T;  2WS3 A;  2C5K T;  4L9I A;  1M62 A;  3M65 A;  5JDF A;  5LMN T;  3RRC A;  2VUR A;  2I6H A;  2N1G A;  1LKX A;  2EHO A;  3CIR A;  1O3X A;  1D1B A;  3ZMT B;  1S94 A;  4BJN A;  5KXJ A;  4DV6 T;  5JRC A;  3HKB E;  2CXD A;  3H3M A;  5AQN B;  2AXD S;  2CEA A;  2KMF A;  2VL8 A;  3OVU A;  4CN4 A;  3AEB A;  4DV5 T;  3ZN1 B;  3QNU A;  1T7S A;  3O1J A;  4X66 T;  5C3J A;  4OX9 T;  3V5U A;  2X51 A;  2XQ7 A;  1X9B A;  1CUN A;  1FJG T;  3ZT7 A;  1NWM X;  4ASK A;  3S4U A;  2BBH A;  3NZP A;  3WAJ A;  1HNZ T;  3LJC A;  4LF5 T;  4JI3 T;  1QLB A;  3ONJ A;  3K1S A;  2CM0 A;  3ZMS B;  5L3F B;  2NR4 A;  5JR9 A;  4DV4 T;  1N32 T;  1HNX T;  2XTL A;  4NXN T;  2KND A;  5FVK A;  2FUP A;  4ANJ A;  4U74 A;  3T1H T;  3FZL B;  1T8B A;  2F4V T;  4CXX A;  2W62 A;  5JTG A;  2E8I A;  3AAE B;  4F6R C;  4JYA T;  5JQG E;  2C5J A;  4AKH A;  2XM1 A;  2H3R A;  3CKD A;  2ACZ A;  4I50 E;  3SS1 A;  2PJQ A;  1D1A A;  2DWK A;  4Z8X A;  4ZI7 E;  2LEH A;  5LXT E;  5ABF B;  4DV7 T;  3KDS E;  4WZX A;  3GWH A;  4YSZ A;  4CN1 A;  3OKQ A;  1ZHC A;  2IW5 B;  4DBQ A;  1MIY A;  3AE4 A;  2YDQ A;  3UU4 A;  1YQ3 A;  5CA1 E;  3VU7 H;  3HKC E;  5FY7 A;  1MNE A;  5AQL B;  5LMU T;  2NWB A;  5L3E B;  1WCR A;  3ANW A;  2LSY A;  2JMK A;  5DJQ C;  2NOX A;  2J47 A;  1IJ5 A;  3HI2 A;  1MMD A;  3P4P A;  2KT9 A;  5HXR A;  1WFD A;  3ANW B;  1UUR A;  4P1N A;  1IAP A;  1NEK A;  3ESL A;  2CRB A;  3LK2 B;  2A2F X;  2IC9 A;  2QA7 A;  2YKS A;  3AXJ B;  2KLQ A;  3PU8 A;  4HFD A;  3QOF A;  3BQK A;  3IA3 A;  4OK0 A;  3DTO A;  3FZH B;  4TZ4 C;  2X68 A;  2C5I T;  5L3B B;  3L09 A;  3UUN A;  2L8K A;  4H9P C;  3EVY A;  3E22 E;  4U7Y A;  4AQF C;  2D0T A;  4FI5 A;  4NUV A;  4ILA A;  3RYI E;  2QVA A;  4C91 A;  5FY1 A;  3LFM A;  3U3I A;  3GMI A;  4EZH A;  3EI0 A;  5AQP B;  3P4R A;  4KHZ F;  2XJ7 A;  3R84 B;  5JR9 C;  2FJA A;  3LBX B;  4ZOL E;  1J5E T;  3IHR A;  3N9O A;  2JQ9 A;  2A72 A;  2YU2 A;  2VL0 A;  1T98 A;  1IBL T;  2DCF A;  2WP9 A;  3MZK B;  5ABH A;  2EHO D;  1BR1 A;  4G2A A;  3SOL A;  2XQ4 A;  4HFI A;  2LLY A;  4I4T E;  4B3T T;  2LRL A;  2LRK A;  4YHH T;  2PTF A;  2VWA A;  3IEE A;  5BR8 T;  4WBO A;  4GK0 E;  3CX8 B;  5LOV E;  1LVK A;  5AQF B;  5LGN B;  3PUY F;  1N36 T;  3MAC A;  4PJJ A;  4U72 A;  1HTJ F;  2JMH A;  2CCQ A;  3RKG A;  3JCF A;  3RYC E;  3SWH A;  5HEO A;  4DMW A;  2J4G A;  5IHY A;  2FJB A;  4IE4 A;  3N2O A;  1I94 T;  2PFV A;  2OA5 A;  1QSD A;  4EB6 E;  4UV9 B;  2ZM0 A;  5LGU B;  1UCU A;  2JQQ A;  4I43 B;  3OYX A;  2XAH B;  3AE1 A;  2LM2 A;  2W0G A;  2LSK A;  3AEA A;  2K3W A;  3RH3 A;  4YTP A;  2YOE A;  5ADX L;  5IUX A;  5JDL A;  4JV5 T;  2W67 A;  5L4E A;  2H7O A;  4GOU A;  5KDM C;  2BZB A;  5KX5 E;  4X65 T;  1I6Z A;  2ZMA A;  1FMW A;  4NIQ A;  3OPC A;  3LK4 2;  3AE5 A;  1OED E;  4H63 H;  3TLU A;  5JDG A;  4U31 A;  2VQF T;  1N34 T;  2HPJ A;  2CXL A;  4MFR A;  4AKR B;  4X1I E;  4DV3 T;  4KHP T;  3ZPO A;  3C4X A;  4HWF A;  2YIN A;  3L39 A;  3LG7 A;  3FXD B;  1IZN B;  3AEF A;  3LK3 B;  4ISS A;  4PK4 A;  2CE7 A;  2D0U A;  2FBW A;  5FXX A;  4TWF A;  2HN2 A;  2DL1 A;  2IC6 A;  3Q5E A;  5FKY A;  4IDN A;  4X1K E;  5AQJ B;  4JI4 T;  2WWU A;  2DNX A;  1KEY A;  2B76 A;  5AQO B;  4GKK T;  4HWI B;  4TV9 E;  2KWI B;  2LSJ A;  4A97 A;  1HS7 A;  2V7L A;  5AFU L;  2JQH A;  4GYS A;  4IIJ E;  3L8R A;  5AQR B;  5ABE A;  1GQE A;  1WR6 A;  1UK5 A;  2XQ9 A;  3B5M A;  4EGW A;  4B3M T;  4U2Z A;  3O4X E;  4DO0 A;  2BDE A;  2VK9 A;  2XAJ B;  1Y64 B;  2LM9 A;  1X79 A;  2XQ5 A;  2Q9Q C;  4O4J E;  5DQV A;  5JDN A;  4PK6 A;  4YT0 A;  4DND A;  2CPT A;  4WYV A;  4UVA B;  5LJM A;  1WYB A;  2VKD A;  3SFE A;  4F8H A;  3N9L A;  1Z8U A;  1H7C A;  2ZM6 T;  4WBN E;  2H88 A;  1HR0 T;  5ABG A;  2VB6 A;  2K9A A;  3PUR A;  1HNW T;  3MJX A;  3AE2 A;  3ZYM A;  2XM2 A;  2BG9 B;  2RP4 A;  5M4Y A;  3WI3 A;  2YDR A;  4DV1 T;  1JNZ A;  2FJE A;  3VRB A;  2BKN A;  4UIG A;  3I1A A;  3OYZ A;  4P0B A;  3UUB A;  4YXD A;  2BBJ A;  1XDO A;  1ZV4 X;  2K24 A;  3AVS A;  4KX6 A;  3RGL A;  1NAF A;  4IT4 A;  5KMG P;  3RF1 A;  4JI0 T;  4QWN B;  2KWH A;  4H9S E;  4U3C A;  1ZP0 A;  2I59 A;  4C90 A;  3UUM A;  3U78 A;  5HAX A;  3PUA A;  5CGM A;  5JRE A;  3AVR A;  1XDP A;  3UUX B;  3LDQ B;  3ZSS A;  5HCM A;  3KV4 A;  3PUQ A;  3RIU A;  4U2Y A;  2ODV A;  4E7S A;  5C8Y E;  1FIO A;  2NTY A;  2D5U A;  2MTQ A;  5F8P A;  5HEJ A;  1ZKE A;  3PUV F;  4UVC B;  5JR9 B;  4X64 T;  1YQ4 A;  2RPA A;  3B13 A;  3ZMU B;  3MK7 C;  3UT5 E;  3NKZ A;  5AQI B;  1UX4 A;  2XAG B;  3D0T A;  3P50 A;  4V1A v;  5FYM A;  4Q25 A;  4I0U A;  4L5G A;  3ZMV B;  3C64 A;  4CXW A;  2PG8 A;  5FXW A;  4JI2 T;  3UQ4 A;  4EED A;  2XSA A;  2WB5 A;  4EIW A;  5CA0 E;  1L0V A;  2XAS B;  1FEW A;  2LKH A;  3E0Z A;  2Q9Q B;  3SRZ A;  5JRC B;  4O4L E;  2WWV A;  3GN5 B;  2V6X A;  3FB2 A;  1CHU A;  4AKL A;  4ZZC A;  2KXP B;  4PJM A;  5HWY A;  4AXP A;  2UUA T;  5L3G B;  3AEE A;  4PAG A;  3RRW A;  2BVL A;  4X62 T;  4YJ3 E;  5LP6 E;  3MA9 A;  3FZM B;  3QB5 A;  4UVB B;  4YLH A;  4MHC A;  5JVD E;  2JPF A;  4JUY A;  4CN6 A;  4ZS2 A;  1FMV A;  5J0Z A;  2UUB T;  5DAB A;  2BS3 A;  1YD8 G;  3RKO A;  2Z6E A;  2DLR A;  4HFE A;  3WAK A;  5LGT B;  2M6B A;  2CWO A;  1J1J A;  2WY2 A;  2LE8 A;  2MYS A;  3OJA A;  4EZ4 A;  4X5T A;  1YXR A;  3P7I A;  4EEB A;  3P4Q A;  3OBV E;  5AQG B;  2HHH T;  1HG2 A;  4PFP A;  2QYW A;  3T8O A;  3HKD E;  5HEG A;  1U4Q A;  2WDR A;  2V6Y A;  4IL9 A;  3GN5 A;  4TX5 A;  1S35 A;  2ZLY A;  4QKN A;  2X0L B;  4P0A A;  4EV6 A;  4OHF A;  3N9N A;  4O2B E;  2UXX B;  2BG9 E;  2LKG A;  4JBW F;  3N5L A;  4LMJ A;  4GYR A;  3BK9 A;  2JIW A;  2QGS A;  2WM9 A;  2VVN A;  3AED A;  4IDP A;  1W0A A;  4HWD A;  4ILU A;  4HKA A; 
#chains in the Genus database with same CATH homology
 3QC9 A;  2XAF B;  1YKE B;  5JH7 E;  2D2S A;  1YW0 A;  2WAU A;  3IBP A;  1HCI A;  3EDV A;  5FY0 A;  4X1Y E;  3V5S A;  4NUU A;  4IST A;  4X20 E;  3BQI A;  3C4W A;  4KUM B;  2E9X A;  2UXN B;  3KVB A;  4QX7 B;  3ZMZ B;  3PU3 A;  2L9Q A;  4MBQ A;  4O8S A;  5LNK A;  2LHN A;  2NW7 A;  1MIW A;  1EZ3 A;  4CZZ B;  2X67 A;  3JC6 C;  2WMO A;  4BAY B;  2X9H A;  2V7K A;  3I0O A;  2V7J A;  3NRY A;  3C50 A;  3RC3 A;  2SPC A;  3VKG A;  2MBG A;  4IGU A;  5LBQ B;  4PFO A;  2ZM2 A;  3J9X 1;  3RPU A;  4HFV A;  3F57 A;  2LSG A;  2KZ7 B;  4QX8 B;  4BJM A;  4CQI A;  4TN7 B;  1Z0P A;  3AA6 B;  4WW0 A;  4I55 E;  3DP7 A;  2ZM8 A;  4H9O C;  2P9B A;  3ZN0 B;  3HR0 A;  1BR4 A;  4HGA A;  3DJB A;  4P09 A;  4UXN B;  5L3C B;  3O9X A;  2N9D A;  5GON E;  3RX6 A;  3ZJ1 A;  2V7M A;  1D0Z A;  3MKD A;  4GIW A;  2CWY A;  3C4Z A;  2VKO A;  2DWG A;  5CB4 E;  1B7T A;  2NW8 A;  3K3N A;  3F31 A;  4HEA A;  4TUY E;  4PJL A;  1MMN A;  5DQW A;  1D0X A;  1KK7 A;  5EK4 A;  1BR0 A;  2V7I A;  3ZC0 A;  3EUH A;  4E7Z A;  5J2T E;  2C0S A;  2E9X B;  2NTX A;  3E08 A;  2V1D B;  2DI4 A;  3B57 A;  2LHR A;  4HE8 A;  2CLY C;  3KVA A;  5H6Q B;  3ZLI A;  3FHN A;  4M1P A;  4O4H E;  4OFZ A;  4QXH B;  3NBX X;  4AKG A;  2V26 A;  3CQX C;  1LVF A;  3TKL B;  4JLE A;  5FP3 A;  2ACX A;  3I9W A;  2LT3 A;  5LHH B;  1WYC A;  1ZEE A;  5JDM A;  3ZCI A;  4PNI A;  5LA6 E;  3R6N A;  3ZJ2 A;  2KIN B;  4L0R A;  4YHJ A;  4IE6 A;  3UFE A;  2Y6X A;  1G73 A;  4CI1 B;  2VAS A;  3ONX A;  4O2A E;  1MMG A;  4A56 A;  2H7V C;  4HTE A;  4PW8 A;  3CX7 B;  3VKH A;  1G8X A;  2JJ9 A;  2CA5 A;  3NRX A;  5BMV E;  2A3D A;  4IE7 A;  3FBZ A;  2X66 A;  3GA8 A;  4ADZ A;  3NZQ A;  2E9X C;  3AA7 B;  1IJ6 A;  3A5X A;  5LBM A;  2XUE A;  3AAA B;  3O1I A;  4EOZ B;  3ZCJ A;  4EYY R;  3PTR B;  1U5P A;  5L2L A;  4CI3 B;  3KBT A;  2Q9Q A;  3AAI A;  1WLX A;  3C98 B;  3MXZ A;  3VHL A;  5CA1 E;  4AI6 A;  2EHO B;  4ZS3 A;  3ZYK A;  1WRD A;  2DHR A;  4CI2 B;  4IE0 A;  3PUG A;  2MOZ A;  3Q9D A;  1OXZ A;  4ZI3 C;  3EDU A;  5JDH A;  4AKI A;  1US7 B;  3KV5 A;  4XAX B;  3QK6 A;  2WBL A;  2LSI A;  1HX8 A;  3ZYL A;  1D1C A;  4XZC A;  5J1G A;  2J1D G;  4OYK A;  5LJN A;  4YJ2 E;  3AA1 B;  3N9P A;  1SA0 E;  4EAH A;  3IF8 B;  5FNV E;  2W00 A;  2JRK A;  2N2N A;  4QXC B;  2VKH A;  2L3L A;  5FXZ A;  4ZHQ E;  5LG4 A;  1SHZ C;  3ETU A;  3KFW X;  3CX6 B;  3UTK A;  3L3P A;  3Q5W A;  3PE0 A;  2VKJ A;  3I0Q A;  1V9D A;  3KBU A;  3CPZ A;  4JEH B;  4ZI2 D;  4J2C A;  5L3D B;  4MAL A;  3KV9 A;  3I9Y A;  2K5B B;  3Q2M A;  5HWX A;  4FJO A;  4N78 D;  3W15 B;  2W63 A;  4CXY A;  2LOP A;  3UUL A;  3CML A;  3CQC B;  3K3Q C;  5F3J A;  4BA9 A;  4UF0 A;  4AQF A;  4UV8 B;  1BR2 A;  4PK5 A;  3CVR A;  5HXS A;  3ETV A;  1MMA A;  2GK9 A;  5HXH A;  2YU1 A;  2PBI A;  2HH7 A;  4ZI3 D;  3PUS A;  3O1H A;  4HN9 A;  5A1L A;  1QUU A;  2X9W A;  2K48 A;  3H37 A;  4PJN A;  4EXT A;  5FMN A;  4TV8 E;  5EK2 A;  3CWZ B;  4IDZ A;  1YKH B;  3N2K E;  3ZC1 A;  2E9X D;  1HFA A;  4MLK A;  3RYF E;  3K3O A;  4DVD A;  5HXE A;  2Y48 B;  3J7Y q;  4ZI2 C;  2ODU A;  2Q9Q D;  4H63 V;  2G0U A;  1VOM A;  2XQY A;  2CMR A;  4XBF B;  5ETW A;  4IE5 A;  2YK0 A;  2CLY B;  3CQG B;  4KMC A;  2CXF A;  1MND A;  1VRB A;  4AQG A;  3HL6 A;  3HA4 A;  5HXC A;  3N9Q A;  1MIV A;  4IHJ E;  3KIN B;  4G63 A;  5HYA A;  3AA0 B;  1D0Y A;  3FBL A;  4KP3 C;  3ZEF B;  3P8C D;  4QHO A;  2X9X A;  3H3A A;  2XHE B;  2XAQ B;  4GK5 E;  4H9N C;  2ES0 A;  3AB3 B;  4UEL A;  4O4I E;  3K8P C;  2WMN A;  4OYJ A;  2BVM A;  5LCY A;  4KBM B;  5EK3 A;  2B1E A;  2NP9 A;  2HPL A;  3BQL A;  5JDQ A;  3N2G E;  1UX5 A;  3LBX A;  5J2U E;  1E1H B;  2Y8D A;  3PDY A;  4K0U A;  2LOS A;  2X9Y A;  2RA1 A;  3N9M A;  5E0O A;  1HF8 A;  1LRZ A;  5TAO A;  2NW9 A;  1AJ3 A;  5FXV A;  3F2E A;  2EHO C;  5H6R B;  4DMV A;  5LHI B;  4WNK A;  1HG5 A;  3QUJ A;  2IAK A;  4H9R C;  5IYZ E;  3C51 A;  1OWA A;  4EYU A;  5LYJ E;  2LJL A;  3HKE E;  4DBR A;  4QXB B;  3RYH E;  3RC8 A;  2YEV C;  3FXE B;  4B6X A;  4UF0 B;  1KNZ A;  2M67 A;  3KV6 A;  4H9Q C;  5LHG B;  2W61 A;  4ERR A;  3Q5X A;  4JEU B;  3JC6 D;  2WSS V;  2C5K T;  4L9I A;  3M65 A;  5JDF A;  3RRC A;  2N1G A;  1LKX A;  2EHO A;  4BJN A;  1O3X A;  1D1B A;  3ZMT B;  1S94 A;  5JRC A;  3HKB E;  2CXD A;  2CEA A;  2KMF A;  2VL8 A;  3ZN1 B;  3O1J A;  3V5U A;  2X51 A;  1CUN A;  1NWM X;  4ASK A;  3S4U A;  3WAJ A;  3LJC A;  2CM0 A;  3ZMS B;  5L3F B;  5JR9 A;  2XTL A;  2KND A;  4ANJ A;  4U74 A;  4CXX A;  2W62 A;  2E8I A;  3AAE B;  4F6R C;  5JQG E;  2C5J A;  4AKH A;  4I50 E;  2H3R A;  3CKD A;  3SS1 A;  2PJQ A;  1D1A A;  2DWK A;  4Z8X A;  4ZI7 E;  2LEH A;  5LXT E;  3KDS E;  3GWH A;  3OKQ A;  1ZHC A;  2IW5 B;  4DBQ A;  1MIY A;  3VU7 H;  3HKC E;  5FY7 A;  1MNE A;  2NWB A;  5L3E B;  3ANW A;  2LSY A;  2JMK A;  5DJQ C;  2NOX A;  1IJ5 A;  3HI2 A;  1MMD A;  2KT9 A;  5HXR A;  3ANW B;  1IAP A;  3ESL A;  3NZP A;  3LK2 B;  2A2F X;  2IC9 A;  2QA7 A;  5EZY E;  2KLQ A;  3PU8 A;  4OK0 A;  3BQK A;  3DTO A;  4TZ4 C;  5L3B B;  2X68 A;  2C5I T;  3L09 A;  3UUN A;  2L8K A;  4H9P C;  3EVY A;  3E22 E;  4AQF C;  2D0T A;  4FI5 A;  4NUV A;  4C91 A;  3RYI E;  5FY1 A;  3LFM A;  3U3I A;  3GMI A;  4EZH A;  3R84 B;  5JR9 C;  3LBX B;  4ZOL E;  3IHR A;  3N9O A;  2A72 A;  2YU2 A;  1T98 A;  2DCF A;  3MZK B;  2EHO D;  1BR1 A;  4G2A A;  3SOL A;  4I4T E;  2VWA A;  3IEE A;  4WBO A;  4GK0 E;  3CX8 B;  5LOV E;  1LVK A;  5LGN B;  3MAC A;  4PJJ A;  4U72 A;  1HTJ F;  2JMH A;  2CCQ A;  3RYC E;  3SWH A;  4DMW A;  5IHY A;  4IE4 A;  3N2O A;  2PFV A;  2OA5 A;  1QSD A;  4EB6 E;  4UV9 B;  2ZM0 A;  5LGU B;  1UCU A;  2JQQ A;  4I43 B;  3OYX A;  2XAH B;  3RH3 A;  2W0G A;  2LSK A;  5JDL A;  5ADX L;  2H7O A;  4GOU A;  5KDM C;  2BZB A;  5KX5 E;  2ZMA A;  1FMW A;  3LK4 2;  4H63 H;  5JDG A;  2HPJ A;  2CXL A;  4MFR A;  4AKR B;  4X1I E;  3ZPO A;  3C4X A;  2YIN A;  3LK3 B;  3LG7 A;  3FXD B;  1IZN B;  4ISS A;  4PK4 A;  4UEM A;  2CE7 A;  2D0U A;  5FXX A;  2IC6 A;  4X1K E;  2WWU A;  2DNX A;  4TV9 E;  2KWI B;  2LSJ A;  1HS7 A;  2V7L A;  5AFU L;  5LJM A;  4GYS A;  4IIJ E;  1WR6 A;  3O4X E;  4DO0 A;  2BDE A;  2VK9 A;  2XAJ B;  1Y64 B;  2LM9 A;  1X79 A;  4O4J E;  2Q9Q C;  5DQV A;  5JDN A;  4PK6 A;  4DND A;  4UVA B;  1WYB A;  2VKD A;  3N9L A;  1H7C A;  4WBN E;  2VB6 A;  2K9A A;  3PUR A;  3MJX A;  3ZYM A;  2RP4 A;  5M4Y A;  3WI3 A;  4UIG A;  3I1A A;  3OYZ A;  4P0B A;  1ZV4 X;  2K24 A;  3AVS A;  5KMG P;  1NAF A;  4QWN B;  2KWH A;  4H9S E;  4C90 A;  2I59 A;  3UUM A;  3U78 A;  5HAX A;  3PUA A;  5JRE A;  3AVR A;  3UUX B;  3KV4 A;  3PUQ A;  2ODV A;  4E7S A;  5C8Y E;  1FIO A;  2NTY A;  2D5U A;  2MTQ A;  5F8P A;  1ZKE A;  5JR9 B;  4UVC B;  3B13 A;  3ZMU B;  3MK7 C;  3UT5 E;  1UX4 A;  2XAG B;  3D0T A;  4V1A v;  5FYM A;  4L5G A;  3ZMV B;  3C64 A;  4CXW A;  2PG8 A;  5FXW A;  4EIW A;  5CA0 E;  2XAS B;  1FEW A;  3E0Z A;  2Q9Q B;  3SRZ A;  5JRC B;  4O4L E;  3GN5 B;  3FB2 A;  4AKL A;  2KXP B;  4PJM A;  5HWY A;  4AXP A;  5L3G B;  4PAG A;  3RRW A;  2BVL A;  4YJ3 E;  5LP6 E;  3MA9 A;  4UVB B;  4YLH A;  4MHC A;  5JVD E;  2JPF A;  4JUY A;  4ZS2 A;  1FMV A;  5DAB A;  1YD8 G;  3RKO A;  2Z6E A;  2DLR A;  3WAK A;  5LGT B;  2CWO A;  2LE8 A;  2MYS A;  3OJA A;  4EZ4 A;  3P7I A;  3OBV E;  1HG2 A;  4PFP A;  3T8O A;  3HKD E;  1U4Q A;  3GN5 A;  4TX5 A;  1S35 A;  2ZLY A;  4QKN A;  2X0L B;  4P0A A;  4OHF A;  3N9N A;  4O2B E;  2UXX B;  3N5L A;  4GYR A;  3BK9 A;  2QGS A;  2WM9 A;  4YFS A;  4ILU A;  4HKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...