3C98B

Revised structure of the munc18a-syntaxin1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
247
structure length
230
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-binding protein 1
publication title Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 91
structure length 230
sequence length 247
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c98B00
1BR0A 4JEUB 1S94A 1FIOA 1EZ3A 1FEWA 4JEHB 5LG4A 5M4YA 1HS7A 2XHEB 2DNXA 1G73A 4TX5A 3C98B 3LG7A
chains in the Genus database with same CATH superfamily
3ANWB 3CQCB 2UUBT 4X1KE 4IIJE 5JQGE 3F31A 4QH1A 3A5XA 2VKOA 2VL0A 2K5BB 1LKXA 1JNZA 1SUMB 4UXNB 2JIWA 4DO0A 2C5IT 1LVKA 4YHJA 3O9XA 2UXCT 4N78D 2RPAA 2Y8DA 5IYZE 3CK6A 1XMQT 4PJNA 4NUVA 3SOLA 3ZCIA 4LF9T 3KV9A 3CVRA 4QH4A 4UF0B 5AQPB 4UVBB 4IE0A 3LBXA 2FBWA 2KWIB 3UULA 2UXXB 2VASA 3JAEA 4MFRA 2VURA 2LHNA 3K3OA 2AXDS 2BKNA 4MBQA 4E7ZA 4C91A 2KSRA 3TKLB 4DUYT 4AQGA 4YHHT 2K24A 3CX6B 4DNDA 1J5ET 3O1IA 1YKEB 4JI4T 4X64T 2MPKA 4EAHA 2V6YB 4I55E 2XQ7A 3KV4A 5DQWA 3LDQB 4P0AA 4EV6A 1Z8UA 3CX7B 3KVAA 1DU2A 2CXLA 3HL6A 4PJMA 2JPFA 3BQKA 4ZEYA 2R6GF 4A98A 2XAQB 4H9RC 2WY2A 3OBVE 3GN5A 1J5WA 2G0UA 3VU7H 3O1JA 2JMKA 4CN1A 4ZS2A 2W62A 2WP9A 3LK3B 4TV9E 4QX8B 3FZLB 3AEAA 4IHJE 2ES0A 3D0TA 4UF0A 1IBKT 3H3AA 1BR2A 3BQLA 4HN9A 4TWHA 3EAMA 4DMWA 2HHHT 3KV6A 2DWGA 4OK0A 4HFVA 4B3RT 5ABGA 3U78A 5FY7A 4PAGA 1HCIA 3FXDB 4HWFA 4ZXLA 4C90A 4CI1B 3RKGA 1D1BA 4IDOA 2D0TA 2V5DA 1UUSA 2JQKA 3LG7A 4HFBA 4DUZT 5AQRB 4PNIA 2M6BA 2HH7A 2CLYC 5JH7E 3NVOA 3DJBA 2E9XC 2JJ9A 4TWFA 3AVSA 2CE7A 4F6RC 5LJMA 3ZYMA 1ZEEA 2IIUA 3PUVF 3LJCA 4U7YA 3P4SA 4KBMB 5L2LA 2ODVA 4TNWA 1BR0A 4EEDA 5FY0A 3AEDA 3F57A 4ZI2D 2DWKA 2ZM2A 2EHOC 4NIQA 4X62T 2NP9A 2XQ8A 4L5GA 1N32T 4H9NC 2XQAA 1YXRA 1I94T 3RF1A 3RLFF 2RA1A 2MOZA 4AKIA 3RYIE 2H7VC 3UUNA 4CN6A 3AA0B 1W0AA 3LSVA 4WNKA 2KMFA 3QB5A 4O2BE 4WZXA 5ABHA 1KFYA 2UUCT 5FNVE 1VCTA 4GKKT 2W61A 3KFWX 4TN7B 4JYAT 1OEDB 1S94A 5HAXA 3I0OA 4AKHA 1WCRA 5E0OA 2W63A 4MHCA 3KBUA 3I0QA 1G73A 3O1HA 5LBQB 4H63V 4BJNA 4CXWA 3EABA 1UX4A 3T1HT 3CX8B 5EZYE 4LF7T 1D0YA 5AQKB 3RGLA 4IL4A 2YOEA 3KVBA 4PK6A 2C5JA 1HX1B 3ESLA 2BVMA 1FJGT 3HI2A 2BDEA 3ZJ1A 5EK4A 5FXXA 3OJAA 2WSSV 3AB3B 3RHWA 3Q5EA 2K9AA 3ZJ2A 2JRKA 4J2CA 3AAAB 4DIDB 2VQFT 3VR8A 4JV5T 5LG4A 3AE2A 3N2OA 3IA3A 3AEGA 2BKOA 1MIWA 2X0YA 3HR0A 1KNRA 5LA6E 1UCUA 2PG8A 5JDHA 2Q9QB 2YDSA 3MXZA 1HX8A 4KUMB 3ZCJA 5AQNB 3GMIA 1FMWA 4GYRA 2V8SV 1UX5A 2YINA 4DMVA 4DBRA 3P8CD 2Z6EA 3AA1B 2E9XA 4ILUA 2FUPA 4AQYT 4ISTA 3J9X1 4B3ST 5FXZA 2MBGA 4OFZA 2W2UA 1YD8G 4DR2T 3AAEB 4CXYA 5AQMB 2OV9A 3OVUA 3N5LA 3Q2MA 4X1YE 3M3ZB 3T1YT 5L3FB 4H9QC 3B5MA 2EHOD 2IW5B 4DBQA 2FJEA 1M62A 5AQOB 2WDVA 2XTLA 2BG9C 1W9RA 3Q5DA 5L3CB 2KT9A 3NWIA 4X65T 4IE6A 4JI7T 5AQTB 1WFDA 3P4PA 5JR9B 2DHRA 2WCAA 3SFEA 4ZZCA 2M6IA 2XQ5A 4P0BA 3VKHA 3AECA 4JI5T 2HN1A 2XQ6A 2A3DA 4HFEA 3HKCE 3PUQA 2LSJA 5LNKA 2N2NA 5CJ5A 3FZMB 4OHFA 3X1DA 2X9YA 2Q9QA 3E0ZA 3AA7B 3L8RA 3ZMVB 5JDGA 1WYBA 4JI6T 3AE5A 5J1GA 2B76A 2XZEA 3RYFE 3JADA 4U3CA 5L3BB 2Y48B 4JI0T 5HEHA 4IT4A 4QX7B 4DV5T 3E22E 4LMJA 1HF8A 3RX6A 3VRBA 4A5XA 4A56A 3R84B 4ISSA 3PUYF 4X66T 2VK9A 1HG2A 4DR1T 1Y01A 1MMNA 4E7SA 2L8KA 2JQQA 5KXJA 4AXPA 5LHHB 3K3NA 5DJQC 5AQIB 2FJDA 3AA6B 1HS7A 4QKNA 2PBIA 2CCQA 2VKHA 5LXTE 5KDMC 1MNDA 3HKDE 3UQ7A 3ZSTA 2WAUA 1D1CA 5JRCB 4X1IE 4UIGA 2MAWA 4XZCA 2HPLA 3R6NA 4QXBB 3AXJB 4M1PA 3QOFA 2YU2A 4JEUB 1E7PA 3G06A 1HTJF 3FZKB 3TLUA 4ZI3C 4LF5T 1I6ZA 2WMOA 4PK5A 3NKZA 4L9IA 2W66A 4EYUA 1N34T 2NW9A 5FKYA 3JC6C 3V5UA 3C4XA 3K1SA 3I1AA 2MYSA 3EDVA 4IDPA 2KINB 5HEUA 4ADZA 5LGNB 4B6XA 2BG9A 2LSIA 5LG3A 5JDQA 2N9DA 3N2KE 2YN6A 4HTEA 4EIWA 2YDRA 3VR9A 4PFOA 1IZNB 2KXPB 3DTOA 5LMNT 2WDQA 5L4HA 3ANWA 2NTXA 2XSBA 4YTMA 4ERRA 2WS3A 3T8OA 3UU8A 2AE9A 5HXHA 2XHEB 3C50A 3RRWA 1EZ3A 5LHGB 2KZ7B 3RYCE 4EZHA 3UUMA 4UELA 5FP3A 4WBNE 3RIUA 2YDQA 1KK7A 3AXJA 3LK2B 5AQQB 3PUSA 4YTPA 2PFVA 4IGUA 4QWNB 1HNXT 1HR0T 5AQHB 3ETUA 4CXXA 2WWVA 3PUGA 1N36T 5AQSB 5ADXL 3FBLA 4H63H 2LRLA 1O3XA 4U2ZA 1GQEA 2JQHA 2NTYA 3C51A 4U31A 5TAOA 2OA5A 4LFCT 4AQFA 2X0HA 4U72A 2E5VA 4UV8B 1OEDC 4JI3T 4KMCA 4UVCB 4U2YA 3PUAA 1Z0PA 4X5TA 2VVSA 4LF6T 3C64A 2V6YA 1VOMA 3HA4A 2V7IA 2LOPA 2WU5A 4GK5E 1D0XA 3PURA 3SFDA 2E5LT 3OYZA 2C5KT 1E2AA 4KX6A 3ETVA 1CHUA 3CQXC 2A2FX 3AE6A 1SE7A 3B57A 4AKLA 2LT3A 4TUYE 2VKDA 1XZYA 2IAKA 1UURA 2V7JA 5LGTB 4JI8T 3UQ4A 4AI6A 2F4VT 3S4UA 4V1Av 2BS2A 4HWIB 4ZI3D 4YY3T 3C4ZA 5DQVA 4ASKA 2VKJA 3F2EA 2DLRA 1NAFA 1FIOA 5EK2A 2D9DA 5LB7B 1T8BA 4HEAA 5HXCA 4JUYA 3ZYLA 4BA9A 4PK4A 3JC6D 3C4WA 3N9QA 5L47A 3AE7A 3P4WA 2NW8A 2V7MA 3EUHA 1NWMX 3RQUA 4AIUA 2XAJB 5HXRA 2ACZA 2J1DG 4LMKA 3N9MA 2CRBA 2W00A 2Q9QC 2XPKA 4KI0F 5FL0A 1NEKA 2LJLA 3V5SA 4ILBA 4JEHB 2VVNA 3P4QA 4HGAA 4LFAT 5CGMA 5AQVB 3SS1A 2XQ3A 4AISA 5HWYA 2XSAA 2V7KA 3AE3A 3OTOT 4YSXA 3TLTA 5FL1A 3FB2A 2FJAA 4O4HE 2QYWA 3LK42 3CMLA 4HWHA 4OYJA 4Z91A 2M67A 4Z8XA 5FYMA 4GK0E 3AEBA 3PUZF 4WYVA 4DV0T 2V1DB 2PJQA 5HCJA 2V7LA 5ABFB 1MMDA 3ZSSA 2LHRA 1ZV4X 4A97A 4OX9T 3MJXA 2L9QA 3FHNA 3RIAA 4YJ2E 2LKGA 2W0GA 1JNRA 4HFDA 4UR9A 4F8HA 1XDOA 4IDZA 2IMLA 5JR9C 1J1JA 5H6RB 1OEDA 3WAJA 1BR4A 3VHLA 3RRCA 3ZT7A 4O8SA 5C3JA 2DL1A 5C8YE 2NOXA 1IJ5A 5FXVA 3A8YC 2HN2A 2E9XD 4DVDA 5CA1E 2UXBT 5AQJB 2FJBA 3UU5A 1XDPA 2WZHA 2LSKA 4EEBA 3PU8A 3UFGA 5HYAA 2DNXA 5AFUL 2LEHA 5HWXA 1LRZA 4DR6T 4JI2T 2BG9E 4K0UA 3KBTA 2H88A 2XQYA 4IE5A 3UUXB 2D5UA 3AE9A 1MIVA 4ZI7E 1IAPA 5LMUT 1HG5A 4DV1T 1HNZT 3P7IA 4LFBT 3ZMZB 3W15B 1R8IA 4U74A 2UXDT 4GYSA 4HFIA 5F3JA 5JDNA 5HXSA 1QSDA 2IDOB 2NWBA 1VRBA 2LRKA 3WI3A 4YTNA 3EVYA 3UUBA 2QA7A 2WQYA 2XM2A 4H9OC 2J47A 1M7KA 3L09A 3SWHA 4HWDA 2XASB 4LF8T 2X9HA 3RIUC 3GWHA 4CZZB 3LBXB 3MK7C 2BS4A 2Q9QD 4PW8A 3N2GE 3ZEFB 1XNRT 2XM1A 5L3DB 4YFSA 3ZYKA 4HE8A 5AQLB 3ONLC 2WB5A 1KNZA 5KX5E 2RP4A 5A1LA 3Q9DA 4PJJA 4COFA 4HFCA 2N1GA 2XAHB 2YK0A 2B1EA 4AKRB 4CI3B 2ZM6T 3RPUA 4TV8E 4EYYR 4ZZBA 4AQFC 3BQIA 4EGWA 3MKDA 4YSYA 4Q25A 2LKHA 1YQ3A 2IHR1 4DR5T 1SA0E 1X9BA 1MIYA 3AE1A 3PE0A 2W67A 1YQ4A 2V5CA 3IF8B 4YT0A 1WR0A 4UV9B 3GA8A 3ZC1A 3N9OA 3CKDA 3RI5A 1WR6A 5FY1A 2IUBA 3QUJA 3K3QC 4B3MT 3A7MA 1WRDA 2LM9A 3NZQA 4GIWA 3ZKRA 2L3LA 4ILAA 4AKGA 2KNDA 3GN5B 5FMNA 5JR9A 3OPCA 5FVLA 5HEJA 3N9PA 5IUXA 5DABA 4KP3C 3QK6A 4G63A 4U33A 4TWDA 2XJ7A 1IBMT 4ZI2C 2ZMAA 2KWHA 2V6XA 4FI5A 2VWAA 2A72A 5LBMA 3MZKB 2GK9A 3WAKA 3CQGB 5J2TE 2ZM0A 2CPTA 4LMLA 2LSGA 4Z90A 2CHNA 4WW0A 5CFBA 4WBOA 4P1NA 1VCSA 5BR8T 5L3GB 3AE4A 5ETWA 1KEYA 4BJMA 3PUWF 1MMGA 4ANJA 3PJAJ 3AEEA 3IHRA 2ACXA 2X9XA 4TNVA 1OXZA 4X20E 4TX5A 2Y6XA 3UT5E 4OYKA 3H3MA 2LLYA 2WWUA 2V26A 1WLXA 1S35A 1N33T 2I6HA 5LHIB 2BBJA 3VKGA 3I9YA 5HEOA 3CPZA 4IE4A 1T7SA 2H89A 3ONJA 2WU2A 5IWAT 5JRCA 3ZMTB 1SHZC 2E2AA 5KMGP 4JLEA 4BAYB 3ZT5A 4DR3T 3JAFA 5CB4E 3J7Yq 2ODUA 4QH5A 3CIRA 3FZHB 2BZBA 1AJ3A 1L0VA 4NXNT 3UU6A 3NBXX 3FBZA 5HXEA 1ZHCA 3EHZA 5LJNA 1NENA 3KDSE 3ZMUB 2BS3A 1U4QA 2VQET 4IREA 1OEDE 3QNUA 4YLHA 5JVDE 3UU3A 2J4GA 3EI0A 3UTKA 1US7B 2LOSA 3NRXA 5J0ZA 2UUAT 1UGOA 2XAFB 2KLQA 2ZM8A 3ZPOA 4O2AE 1X79A 2YKSA 3M65A 3ZC0A 3RH3A 5L4EA 1FMVA 2VL8A 4H9SE 2WBLA 2UXNB 5F5WA 3QC9A 4MLKA 2CA5A 2JMHA 2X51A 4DR7T 4EOZB 4TZ4C 4ZHQE 4DV4T 3ONXA 3B13A 4IL9A 1Y64B 5H6QB 1W0BA 3OKQA 5JDLA 4EZ4A 5CA0E 3O4XE 2D2SA 3FZFB 2DI4A 1XNQT 3N9LA 5LYJE 1D1AA 3Q5WA 4KHZF 1ZP0A 1MMAA 2CXFA 3UU4A 1U5PA 5M4YA 1E1HB 2CM0A 4K0KT 5EK3A 4O4LE 1XWMA 3TLSA 4CI2B 1T72A 3N9NA 4HFHA 3RC3A 4EB6E 2LSYA 2NW7A 1MNEA 4LF4T 1YW0A 3AVRA 2OLTA 1QUUA 5ABEA 4H9PC 4U7IA 2P9BA 4I43B 2K48A 4P09A 2CLYB 4IDQA 3ZLIA 4CN4A 2IC9A 2CBJA 2E9XB 4JBWF 3P4RA 1V9DA 2HPJA 3AAIA 2UU9T 2XUEA 3TLWA 5J2UE 2BVLA 3PUXF 3BK9A 4NXMT 1LVFA 5JTGA 3I9WA 1OWAA 4CQIA 2E8IA 2SPCA 3AE8A 3SRZA 3ZMSB 3E08A 4UEMA 2CHOA 2EHOB 4GKJT 2LE8A 3IBPA 3RC8A 4DV2T 4JI1T 2CWYA 1W09A 2QGSA 1HFAA 4O4JE 5C2TA 3PV0F 4IE7A 4O4IE 5AQUB 2XY8B 2C0SA 1G8XA 2WZIA 2BBHA 3K8PC 5LP6E 4EXTA 3OYXA 4YSZA 1QLBA 1ZKEA 3JCFA 2A9UA 2PTFA 2WMNA 3L3PA 1IJ6A 4QHOA 2CXDA 4GOUA 2LM2A 4YJ3E 5JREA 2X67A 2YU1A 3LFMA 3NRYA 5IHYA 3ZN1B 3PDYA 2DCFA 2JQ9A 4UVAB 5GONE 3H37A 3L39A 5HCMA 2MTQA 5HEGA 2QRXA 3PJAA 1HNWT 5AQFB 2WM9A 4PJLA 2BKPA 2XQ9A 3Q5XA 4FJOA 1B7TA 3UFEA 4ZOLE 3TLVA 4MALA 4L0RA 1T98A 2XQ4A 5JDFA 1WYCA 5LOVE 3PU3A 4HKAA 4IDNA 2W4XA 2CBIA 2X68A 1CUNA 2CMRA 4DV6T 1IBLT 3VRAA 4DV3T 3KINB 3RIFA 2EHOA 1UK5A 1BR1A 4NUUA 3RKOA 3NZPA 5L3EB 2I0MA 2NR4A 2WDRA 3ABVA 2I59A 5JDMA 3RQWA 1YKHB 3C98B 2X0LB 3AEFA 3HKEE 3PTRB 5BMVE 2CEAA 1FEWA 4YXDA 1KNPA 1H7CA 2XAGB 5ABFA 4ZS3A 4QXHB 2H3RA 3DP7A 4I50E 4DR4T 2YEVC 1ZOYA 2VB6A 1XMOT 4G2AA 3IEEA 5LGUB 4ILCA 5FXWA 4PFPA 2K3WA 4NPPA 4XBFB 3QB5K 4I0UA 2ZLYA 3U3IA 3MA9A 2X9WA 3HKBE 4HWCA 2X66A 3RYHE 2IC6A 5F8PA 1D0ZA 4DV7T 3CWZB 4I4TE 5FVKA 4QXCB 2H7OA 5AQGB 3ZN0B 2QVAA 5LCYA 3P50A 4XAXB 2D0UA 4B3TT 2BG9B 3FXEB 2J62A 3KV5A 3MACA 2CWOA 4KHPT 1KF6A 3EDUA 3ZT6A
chains in the Genus database with same CATH topology
3ANWB 2XAJB 3CQCB 2BZBA 3AAEB 4CXYA 1AJ3A 4X1KE 3N5LA 5HXRA 2J1DG 4IIJE 3NBXX 5JQGE 3F31A 3FBZA 3Q2MA 5HXEA 1ZHCA 3A5XA 4X1YE 2VKOA 3N9MA 5L3FB 4H9QC 2K5BB 5LJNA 1LKXA 2W00A 4UXNB 2Q9QC 2EHOD 3KDSE 2IW5B 4DO0A 2C5IT 4DBQA 1LVKA 4YHJA 3O9XA 2LJLA 3V5SA 4N78D 2Y8DA 5IYZE 3ZMUB 4JEHB 1U4QA 2XTLA 4PJNA 4HGAA 4NUVA 3SOLA 3ZCIA 4YLHA 3KV9A 5JVDE 3CVRA 4UF0B 5L3CB 2KT9A 4UVBB 4IE0A 3LBXA 3SS1A 3UTKA 1US7B 2LOSA 4IE6A 3NRXA 2KWIB 2XAFB 5HWYA 3UULA 2KLQA 2V7KA 2ZM8A 3ZPOA 2UXXB 2VASA 4MFRA 2DHRA 4O2AE 5JR9B 1X79A 2LHNA 3K3OA 3M65A 3ZC0A 4P0BA 3RH3A 3FB2A 3VKHA 1FMVA 2VL8A 4O4HE 4H9SE 3LK42 2WBLA 2UXNB 4MBQA 3QC9A 4MLKA 4E7ZA 2A3DA 4C91A 3CMLA 2CA5A 4OYJA 2JMHA 3HKCE 3PUQA 3TKLB 2LSJA 5LNKA 2M67A 4Z8XA 2N2NA 2X51A 4AQGA 2K24A 4OHFA 4GK0E 4TZ4C 5FYMA 4EOZB 4ZHQE 3CX6B 4DNDA 2V1DB 3ONXA 2PJQA 2X9YA 2Q9QA 3B13A 3E0ZA 3AA7B 2V7LA 3O1IA 1Y64B 5H6QB 1MMDA 1YKEB 3OKQA 5JDLA 4EAHA 3ZMVB 4EZ4A 5JDGA 5CA0E 1WYBA 2LHRA 1ZV4X 3O4XE 2D2SA 3MJXA 2L9QA 5J1GA 2DI4A 3RYFE 3FHNA 3N9LA 5LYJE 4YJ2E 4I55E 5L3BB 1D1AA 2W0GA 2Y48B 3Q5WA 3KV4A 5DQWA 4QX7B 3E22E 1MMAA 4IDZA 4P0AA 1HF8A 2CXFA 3RX6A 5JR9C 5H6RB 3CX7B 3WAJA 1BR4A 4A56A 1U5PA 3KVAA 3R84B 3VHLA 2CXLA 1E1HB 3HL6A 4PJMA 2CM0A 3RRCA 5M4YA 4ISSA 2JPFA 3BQKA 4O8SA 5EK3A 5C8YE 2NOXA 1IJ5A 5FXVA 2VK9A 1HG2A 2E9XD 4O4LE 4CI2B 2XAQB 4H9RC 3N9NA 1MMNA 4E7SA 2L8KA 3OBVE 4DVDA 2JQQA 3RC3A 5CA1E 4EB6E 2LSYA 2NW7A 3GN5A 2G0UA 4AXPA 1MNEA 5LHHB 1YW0A 2LSKA 3VU7H 3O1JA 2JMKA 3PU8A 5HYAA 2DNXA 3AVRA 4ZS2A 3K3NA 5DJQC 5AFUL 2W62A 1QUUA 2LEHA 3AA6B 3LK3B 4TV9E 1HS7A 5HWXA 4QKNA 4QX8B 2PBIA 4H9PC 1LRZA 2CCQA 2VKHA 4IHJE 2ES0A 2P9BA 5LXTE 4I43B 4K0UA 3D0TA 3KBTA 5KDMC 2K48A 4P09A 1MNDA 2CLYB 2XQYA 3HKDE 4IE5A 3ZLIA 2WAUA 1D1CA 5JRCB 3UUXB 4UF0A 2D5UA 2IC9A 1MIVA 4UIGA 4X1IE 2E9XB 4ZI7E 1V9DA 1IAPA 2HPJA 3AAIA 3H3AA 4XZCA 1BR2A 2HPLA 3BQLA 4HN9A 3R6NA 1HG5A 4QXBB 4DMWA 3P7IA 4M1PA 2YU2A 3KV6A 3ZMZB 2XUEA 3W15B 5J2UE 2DWGA 2BVLA 4JEUB 4U74A 3BK9A 1LVFA 4GYSA 3I9WA 4OK0A 5F3JA 1HTJF 1OWAA 4HFVA 5JDNA 4CQIA 2E8IA 2SPCA 5FY7A 3U78A 5HXSA 4PAGA 1HCIA 3FXDB 4ZI3C 1QSDA 3SRZA 2NWBA 1VRBA 3ZMSB 3E08A 4UEMA 3WI3A 4C90A 4CI1B 1D1BA 2EHOB 2D0TA 2WMOA 4PK5A 3LG7A 3EVYA 2LE8A 3IBPA 3RC8A 2QA7A 4L9IA 2CWYA 2QGSA 1HFAA 4H9OC 4O4JE 4EYUA 2NW9A 3L09A 3SWHA 3JC6C 4IE7A 3V5UA 4PNIA 2HH7A 3C4XA 2CLYC 4O4IE 5JH7E 2XASB 3I1AA 2X9HA 3DJBA 2C0SA 2E9XC 2JJ9A 2MYSA 1G8XA 3EDVA 3AVSA 2KINB 3K8PC 2CE7A 3GWHA 4F6RC 5LJMA 4CZZB 3LBXB 3MK7C 3ZYMA 2Q9QD 5LP6E 1ZEEA 3N2GE 4PW8A 4EXTA 3ZEFB 3LJCA 4KBMB 3OYXA 1ZKEA 5L2LA 4ADZA 2ODVA 5L3DB 4YFSA 5LGNB 3ZYKA 4B6XA 4HE8A 2LSIA 2WMNA 3L3PA 1BR0A 1IJ6A 4QHOA 2CXDA 5JDQA 5FY0A 3F57A 4GOUA 4YJ3E 2N9DA 3N2KE 4ZI2D 5JREA 2DWKA 2ZM2A 4HTEA 2X67A 1KNZA 2EHOC 4EIWA 5KX5E 2YU1A 3LFMA 3NRYA 5IHYA 2RP4A 2NP9A 4L5GA 3ZN1B 4PFOA 1IZNB 2KXPB 3DTOA 5A1LA 4H9NC 3PDYA 3ANWA 2NTXA 3Q9DA 4PJJA 2DCFA 4UVAB 4ERRA 5GONE 3T8OA 2N1GA 2XAHB 2YK0A 2B1EA 2RA1A 4AKRB 2MOZA 3H37A 4CI3B 3RPUA 2MTQA 5HXHA 2XHEB 4TV8E 4EYYR 3C50A 4AKIA 3RRWA 4AQFC 3RYIE 3BQIA 2H7VC 3MKDA 3UUNA 1EZ3A 5LHGB 2KZ7B 3AA0B 3RYCE 2WM9A 4WNKA 4EZHA 1SA0E 2KMFA 3UUMA 4PJLA 4UELA 4O2BE 1MIYA 5FP3A 3PE0A 3Q5XA 4WBNE 4FJOA 5FNVE 1B7TA 3UFEA 1KK7A 3IF8B 4ZOLE 2W61A 3KFWX 3LK2B 4MALA 4L0RA 4TN7B 1T98A 5JDFA 1WYCA 4UV9B 3PUSA 5LOVE 1S94A 3PU3A 4HKAA 5HAXA 2PFVA 4IGUA 4QWNB 3I0OA 3GA8A 4AKHA 3ZC1A 3N9OA 3CKDA 3ETUA 1WR6A 5E0OA 2W63A 4CXXA 4MHCA 2X68A 3KBUA 5FY1A 3I0QA 3QUJA 1G73A 1CUNA 3K3QC 2CMRA 1WRDA 3PUGA 2LM9A 3KINB 3NZQA 4GIWA 3O1HA 5ADXL 2EHOA 2L3LA 4AKGA 2KNDA 3GN5B 5FMNA 5JR9A 5LBQB 4H63V 4BJNA 1BR1A 4NUUA 3FBLA 4CXWA 4H63H 3RKOA 3NZPA 5L3EB 1O3XA 1UX4A 3N9PA 3CX8B 5DABA 4KP3C 5EZYE 2I59A 5JDMA 3QK6A 1D0YA 4G63A 2NTYA 3C51A 1YKHB 5TAOA 3C98B 4ZI2C 2ZMAA 2OA5A 2X0LB 3KVBA 4AQFA 2KWHA 4PK6A 3HKEE 3PTRB 4FI5A 2VWAA 4U72A 2A72A 5LBMA 5BMVE 3MZKB 2C5JA 2CEAA 1FEWA 2GK9A 3WAKA 4UV8B 1H7CA 3CQGB 2XAGB 4ZS3A 5J2TE 4QXHB 2ZM0A 3ESLA 2H3RA 3DP7A 4KMCA 4I50E 4UVCB 2BVMA 3PUAA 2YEVC 1Z0PA 2VB6A 3HI2A 3C64A 2BDEA 2LSGA 3ZJ1A 5EK4A 5FXXA 4WW0A 1VOMA 3OJAA 3HA4A 2WSSV 2V7IA 4G2AA 3IEEA 4WBOA 2LOPA 5LGUB 4GK5E 1D0XA 3AB3B 3PURA 5FXWA 4PFPA 5L3GB 3OYZA 5ETWA 2C5KT 2K9AA 3ZJ2A 4BJMA 2JRKA 3ETVA 4J2CA 3AAAB 4XBFB 3CQXC 2ZLYA 3U3IA 1MMGA 3MA9A 4ANJA 2A2FX 2X9WA 3B57A 3HKBE 4AKLA 3IHRA 2ACXA 2X9XA 2LT3A 1OXZA 2VKDA 2X66A 4TUYE 5LG4A 3RYHE 3N2OA 2IAKA 4X20E 4TX5A 2Y6XA 2V7JA 2IC6A 3UT5E 5LGTB 4OYKA 1MIWA 4AI6A 3HR0A 5F8PA 3S4UA 2WWUA 2V26A 4V1Av 1D0ZA 5LA6E 1UCUA 2PG8A 4ZI3D 5JDHA 3C4ZA 5DQVA 3CWZB 4ASKA 1WLXA 1S35A 2Q9QB 2VKJA 3F2EA 2DLRA 3MXZA 4I4TE 1HX8A 1NAFA 1FIOA 5LHIB 4KUMB 3ZCJA 4QXCB 5EK2A 2H7OA 3VKGA 3I9YA 3CPZA 3ZN0B 4IE4A 4HEAA 3GMIA 5HXCA 4JUYA 5LCYA 3ZYLA 4BA9A 1FMWA 4GYRA 4PK4A 1UX5A 4XAXB 2D0UA 2YINA 4DMVA 4DBRA 3P8CD 3JC6D 3C4WA 3FXEB 3N9QA 5JRCA 2Z6EA 3AA1B 3ZMTB 1SHZC 2E9XA 3KV5A 3MACA 2CWOA 2NW8A 4ILUA 2V7MA 5KMGP 4JLEA 4ISTA 3J9X1 4BAYB 3EUHA 5FXZA 2MBGA 1NWMX 3EDUA 4OFZA 1YD8G 5CB4E 3J7Yq 2ODUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR0 A;  4JEU B;  1S94 A;  1FIO A;  1EZ3 A;  1FEW A;  4JEH B;  5LG4 A;  5M4Y A;  1HS7 A;  2XHE B;  2DNX A;  1G73 A;  4TX5 A;  3C98 B;  3LG7 A; 
#chains in the Genus database with same CATH topology
 3ANW B;  3CQC B;  2UUB T;  4X1K E;  4IIJ E;  5JQG E;  3F31 A;  4QH1 A;  3A5X A;  2VKO A;  2VL0 A;  2K5B B;  1LKX A;  1JNZ A;  1SUM B;  4UXN B;  2JIW A;  4DO0 A;  2C5I T;  1LVK A;  4YHJ A;  3O9X A;  2UXC T;  4N78 D;  2RPA A;  2Y8D A;  5IYZ E;  3CK6 A;  1XMQ T;  4PJN A;  4NUV A;  3SOL A;  3ZCI A;  4LF9 T;  3KV9 A;  3CVR A;  4QH4 A;  4UF0 B;  5AQP B;  4UVB B;  4IE0 A;  3LBX A;  2FBW A;  2KWI B;  3UUL A;  2UXX B;  2VAS A;  3JAE A;  4MFR A;  2VUR A;  2LHN A;  3K3O A;  2AXD S;  2BKN A;  4MBQ A;  4E7Z A;  4C91 A;  2KSR A;  3TKL B;  4DUY T;  4AQG A;  4YHH T;  2K24 A;  3CX6 B;  4DND A;  1J5E T;  3O1I A;  1YKE B;  4JI4 T;  4X64 T;  2MPK A;  4EAH A;  2V6Y B;  4I55 E;  2XQ7 A;  3KV4 A;  5DQW A;  3LDQ B;  4P0A A;  4EV6 A;  1Z8U A;  3CX7 B;  3KVA A;  1DU2 A;  2CXL A;  3HL6 A;  4PJM A;  2JPF A;  3BQK A;  4ZEY A;  2R6G F;  4A98 A;  2XAQ B;  4H9R C;  2WY2 A;  3OBV E;  3GN5 A;  1J5W A;  2G0U A;  3VU7 H;  3O1J A;  2JMK A;  4CN1 A;  4ZS2 A;  2W62 A;  2WP9 A;  3LK3 B;  4TV9 E;  4QX8 B;  3FZL B;  3AEA A;  4IHJ E;  2ES0 A;  3D0T A;  4UF0 A;  1IBK T;  3H3A A;  1BR2 A;  3BQL A;  4HN9 A;  4TWH A;  3EAM A;  4DMW A;  2HHH T;  3KV6 A;  2DWG A;  4OK0 A;  4HFV A;  4B3R T;  5ABG A;  3U78 A;  5FY7 A;  4PAG A;  1HCI A;  3FXD B;  4HWF A;  4ZXL A;  4C90 A;  4CI1 B;  3RKG A;  1D1B A;  4IDO A;  2D0T A;  2V5D A;  1UUS A;  2JQK A;  3LG7 A;  4HFB A;  4DUZ T;  5AQR B;  4PNI A;  2M6B A;  2HH7 A;  2CLY C;  5JH7 E;  3NVO A;  3DJB A;  2E9X C;  2JJ9 A;  4TWF A;  3AVS A;  2CE7 A;  4F6R C;  5LJM A;  3ZYM A;  1ZEE A;  2IIU A;  3PUV F;  3LJC A;  4U7Y A;  3P4S A;  4KBM B;  5L2L A;  2ODV A;  4TNW A;  1BR0 A;  4EED A;  5FY0 A;  3AED A;  3F57 A;  4ZI2 D;  2DWK A;  2ZM2 A;  2EHO C;  4NIQ A;  4X62 T;  2NP9 A;  2XQ8 A;  4L5G A;  1N32 T;  4H9N C;  2XQA A;  1YXR A;  1I94 T;  3RF1 A;  3RLF F;  2RA1 A;  2MOZ A;  4AKI A;  3RYI E;  2H7V C;  3UUN A;  4CN6 A;  3AA0 B;  1W0A A;  3LSV A;  4WNK A;  2KMF A;  3QB5 A;  4O2B E;  4WZX A;  5ABH A;  1KFY A;  2UUC T;  5FNV E;  1VCT A;  4GKK T;  2W61 A;  3KFW X;  4TN7 B;  4JYA T;  1OED B;  1S94 A;  5HAX A;  3I0O A;  4AKH A;  1WCR A;  5E0O A;  2W63 A;  4MHC A;  3KBU A;  3I0Q A;  1G73 A;  3O1H A;  5LBQ B;  4H63 V;  4BJN A;  4CXW A;  3EAB A;  1UX4 A;  3T1H T;  3CX8 B;  5EZY E;  4LF7 T;  1D0Y A;  5AQK B;  3RGL A;  4IL4 A;  2YOE A;  3KVB A;  4PK6 A;  2C5J A;  1HX1 B;  3ESL A;  2BVM A;  1FJG T;  3HI2 A;  2BDE A;  3ZJ1 A;  5EK4 A;  5FXX A;  3OJA A;  2WSS V;  3AB3 B;  3RHW A;  3Q5E A;  2K9A A;  3ZJ2 A;  2JRK A;  4J2C A;  3AAA B;  4DID B;  2VQF T;  3VR8 A;  4JV5 T;  5LG4 A;  3AE2 A;  3N2O A;  3IA3 A;  3AEG A;  2BKO A;  1MIW A;  2X0Y A;  3HR0 A;  1KNR A;  5LA6 E;  1UCU A;  2PG8 A;  5JDH A;  2Q9Q B;  2YDS A;  3MXZ A;  1HX8 A;  4KUM B;  3ZCJ A;  5AQN B;  3GMI A;  1FMW A;  4GYR A;  2V8S V;  1UX5 A;  2YIN A;  4DMV A;  4DBR A;  3P8C D;  2Z6E A;  3AA1 B;  2E9X A;  4ILU A;  2FUP A;  4AQY T;  4IST A;  3J9X 1;  4B3S T;  5FXZ A;  2MBG A;  4OFZ A;  2W2U A;  1YD8 G;  4DR2 T;  3AAE B;  4CXY A;  5AQM B;  2OV9 A;  3OVU A;  3N5L A;  3Q2M A;  4X1Y E;  3M3Z B;  3T1Y T;  5L3F B;  4H9Q C;  3B5M A;  2EHO D;  2IW5 B;  4DBQ A;  2FJE A;  1M62 A;  5AQO B;  2WDV A;  2XTL A;  2BG9 C;  1W9R A;  3Q5D A;  5L3C B;  2KT9 A;  3NWI A;  4X65 T;  4IE6 A;  4JI7 T;  5AQT B;  1WFD A;  3P4P A;  5JR9 B;  2DHR A;  2WCA A;  3SFE A;  4ZZC A;  2M6I A;  2XQ5 A;  4P0B A;  3VKH A;  3AEC A;  4JI5 T;  2HN1 A;  2XQ6 A;  2A3D A;  4HFE A;  3HKC E;  3PUQ A;  2LSJ A;  5LNK A;  2N2N A;  5CJ5 A;  3FZM B;  4OHF A;  3X1D A;  2X9Y A;  2Q9Q A;  3E0Z A;  3AA7 B;  3L8R A;  3ZMV B;  5JDG A;  1WYB A;  4JI6 T;  3AE5 A;  5J1G A;  2B76 A;  2XZE A;  3RYF E;  3JAD A;  4U3C A;  5L3B B;  2Y48 B;  4JI0 T;  5HEH A;  4IT4 A;  4QX7 B;  4DV5 T;  3E22 E;  4LMJ A;  1HF8 A;  3RX6 A;  3VRB A;  4A5X A;  4A56 A;  3R84 B;  4ISS A;  3PUY F;  4X66 T;  2VK9 A;  1HG2 A;  4DR1 T;  1Y01 A;  1MMN A;  4E7S A;  2L8K A;  2JQQ A;  5KXJ A;  4AXP A;  5LHH B;  3K3N A;  5DJQ C;  5AQI B;  2FJD A;  3AA6 B;  1HS7 A;  4QKN A;  2PBI A;  2CCQ A;  2VKH A;  5LXT E;  5KDM C;  1MND A;  3HKD E;  3UQ7 A;  3ZST A;  2WAU A;  1D1C A;  5JRC B;  4X1I E;  4UIG A;  2MAW A;  4XZC A;  2HPL A;  3R6N A;  4QXB B;  3AXJ B;  4M1P A;  3QOF A;  2YU2 A;  4JEU B;  1E7P A;  3G06 A;  1HTJ F;  3FZK B;  3TLU A;  4ZI3 C;  4LF5 T;  1I6Z A;  2WMO A;  4PK5 A;  3NKZ A;  4L9I A;  2W66 A;  4EYU A;  1N34 T;  2NW9 A;  5FKY A;  3JC6 C;  3V5U A;  3C4X A;  3K1S A;  3I1A A;  2MYS A;  3EDV A;  4IDP A;  2KIN B;  5HEU A;  4ADZ A;  5LGN B;  4B6X A;  2BG9 A;  2LSI A;  5LG3 A;  5JDQ A;  2N9D A;  3N2K E;  2YN6 A;  4HTE A;  4EIW A;  2YDR A;  3VR9 A;  4PFO A;  1IZN B;  2KXP B;  3DTO A;  5LMN T;  2WDQ A;  5L4H A;  3ANW A;  2NTX A;  2XSB A;  4YTM A;  4ERR A;  2WS3 A;  3T8O A;  3UU8 A;  2AE9 A;  5HXH A;  2XHE B;  3C50 A;  3RRW A;  1EZ3 A;  5LHG B;  2KZ7 B;  3RYC E;  4EZH A;  3UUM A;  4UEL A;  5FP3 A;  4WBN E;  3RIU A;  2YDQ A;  1KK7 A;  3AXJ A;  3LK2 B;  5AQQ B;  3PUS A;  4YTP A;  2PFV A;  4IGU A;  4QWN B;  1HNX T;  1HR0 T;  5AQH B;  3ETU A;  4CXX A;  2WWV A;  3PUG A;  1N36 T;  5AQS B;  5ADX L;  3FBL A;  4H63 H;  2LRL A;  1O3X A;  4U2Z A;  1GQE A;  2JQH A;  2NTY A;  3C51 A;  4U31 A;  5TAO A;  2OA5 A;  4LFC T;  4AQF A;  2X0H A;  4U72 A;  2E5V A;  4UV8 B;  1OED C;  4JI3 T;  4KMC A;  4UVC B;  4U2Y A;  3PUA A;  1Z0P A;  4X5T A;  2VVS A;  4LF6 T;  3C64 A;  2V6Y A;  1VOM A;  3HA4 A;  2V7I A;  2LOP A;  2WU5 A;  4GK5 E;  1D0X A;  3PUR A;  3SFD A;  2E5L T;  3OYZ A;  2C5K T;  1E2A A;  4KX6 A;  3ETV A;  1CHU A;  3CQX C;  2A2F X;  3AE6 A;  1SE7 A;  3B57 A;  4AKL A;  2LT3 A;  4TUY E;  2VKD A;  1XZY A;  2IAK A;  1UUR A;  2V7J A;  5LGT B;  4JI8 T;  3UQ4 A;  4AI6 A;  2F4V T;  3S4U A;  4V1A v;  2BS2 A;  4HWI B;  4ZI3 D;  4YY3 T;  3C4Z A;  5DQV A;  4ASK A;  2VKJ A;  3F2E A;  2DLR A;  1NAF A;  1FIO A;  5EK2 A;  2D9D A;  5LB7 B;  1T8B A;  4HEA A;  5HXC A;  4JUY A;  3ZYL A;  4BA9 A;  4PK4 A;  3JC6 D;  3C4W A;  3N9Q A;  5L47 A;  3AE7 A;  3P4W A;  2NW8 A;  2V7M A;  3EUH A;  1NWM X;  3RQU A;  4AIU A;  2XAJ B;  5HXR A;  2ACZ A;  2J1D G;  4LMK A;  3N9M A;  2CRB A;  2W00 A;  2Q9Q C;  2XPK A;  4KI0 F;  5FL0 A;  1NEK A;  2LJL A;  3V5S A;  4ILB A;  4JEH B;  2VVN A;  3P4Q A;  4HGA A;  4LFA T;  5CGM A;  5AQV B;  3SS1 A;  2XQ3 A;  4AIS A;  5HWY A;  2XSA A;  2V7K A;  3AE3 A;  3OTO T;  4YSX A;  3TLT A;  5FL1 A;  3FB2 A;  2FJA A;  4O4H E;  2QYW A;  3LK4 2;  3CML A;  4HWH A;  4OYJ A;  4Z91 A;  2M67 A;  4Z8X A;  5FYM A;  4GK0 E;  3AEB A;  3PUZ F;  4WYV A;  4DV0 T;  2V1D B;  2PJQ A;  5HCJ A;  2V7L A;  5ABF B;  1MMD A;  3ZSS A;  2LHR A;  1ZV4 X;  4A97 A;  4OX9 T;  3MJX A;  2L9Q A;  3FHN A;  3RIA A;  4YJ2 E;  2LKG A;  2W0G A;  1JNR A;  4HFD A;  4UR9 A;  4F8H A;  1XDO A;  4IDZ A;  2IML A;  5JR9 C;  1J1J A;  5H6R B;  1OED A;  3WAJ A;  1BR4 A;  3VHL A;  3RRC A;  3ZT7 A;  4O8S A;  5C3J A;  2DL1 A;  5C8Y E;  2NOX A;  1IJ5 A;  5FXV A;  3A8Y C;  2HN2 A;  2E9X D;  4DVD A;  5CA1 E;  2UXB T;  5AQJ B;  2FJB A;  3UU5 A;  1XDP A;  2WZH A;  2LSK A;  4EEB A;  3PU8 A;  3UFG A;  5HYA A;  2DNX A;  5AFU L;  2LEH A;  5HWX A;  1LRZ A;  4DR6 T;  4JI2 T;  2BG9 E;  4K0U A;  3KBT A;  2H88 A;  2XQY A;  4IE5 A;  3UUX B;  2D5U A;  3AE9 A;  1MIV A;  4ZI7 E;  1IAP A;  5LMU T;  1HG5 A;  4DV1 T;  1HNZ T;  3P7I A;  4LFB T;  3ZMZ B;  3W15 B;  1R8I A;  4U74 A;  2UXD T;  4GYS A;  4HFI A;  5F3J A;  5JDN A;  5HXS A;  1QSD A;  2IDO B;  2NWB A;  1VRB A;  2LRK A;  3WI3 A;  4YTN A;  3EVY A;  3UUB A;  2QA7 A;  2WQY A;  2XM2 A;  4H9O C;  2J47 A;  1M7K A;  3L09 A;  3SWH A;  4HWD A;  2XAS B;  4LF8 T;  2X9H A;  3RIU C;  3GWH A;  4CZZ B;  3LBX B;  3MK7 C;  2BS4 A;  2Q9Q D;  4PW8 A;  3N2G E;  3ZEF B;  1XNR T;  2XM1 A;  5L3D B;  4YFS A;  3ZYK A;  4HE8 A;  5AQL B;  3ONL C;  2WB5 A;  1KNZ A;  5KX5 E;  2RP4 A;  5A1L A;  3Q9D A;  4PJJ A;  4COF A;  4HFC A;  2N1G A;  2XAH B;  2YK0 A;  2B1E A;  4AKR B;  4CI3 B;  2ZM6 T;  3RPU A;  4TV8 E;  4EYY R;  4ZZB A;  4AQF C;  3BQI A;  4EGW A;  3MKD A;  4YSY A;  4Q25 A;  2LKH A;  1YQ3 A;  2IHR 1;  4DR5 T;  1SA0 E;  1X9B A;  1MIY A;  3AE1 A;  3PE0 A;  2W67 A;  1YQ4 A;  2V5C A;  3IF8 B;  4YT0 A;  1WR0 A;  4UV9 B;  3GA8 A;  3ZC1 A;  3N9O A;  3CKD A;  3RI5 A;  1WR6 A;  5FY1 A;  2IUB A;  3QUJ A;  3K3Q C;  4B3M T;  3A7M A;  1WRD A;  2LM9 A;  3NZQ A;  4GIW A;  3ZKR A;  2L3L A;  4ILA A;  4AKG A;  2KND A;  3GN5 B;  5FMN A;  5JR9 A;  3OPC A;  5FVL A;  5HEJ A;  3N9P A;  5IUX A;  5DAB A;  4KP3 C;  3QK6 A;  4G63 A;  4U33 A;  4TWD A;  2XJ7 A;  1IBM T;  4ZI2 C;  2ZMA A;  2KWH A;  2V6X A;  4FI5 A;  2VWA A;  2A72 A;  5LBM A;  3MZK B;  2GK9 A;  3WAK A;  3CQG B;  5J2T E;  2ZM0 A;  2CPT A;  4LML A;  2LSG A;  4Z90 A;  2CHN A;  4WW0 A;  5CFB A;  4WBO A;  4P1N A;  1VCS A;  5BR8 T;  5L3G B;  3AE4 A;  5ETW A;  1KEY A;  4BJM A;  3PUW F;  1MMG A;  4ANJ A;  3PJA J;  3AEE A;  3IHR A;  2ACX A;  2X9X A;  4TNV A;  1OXZ A;  4X20 E;  4TX5 A;  2Y6X A;  3UT5 E;  4OYK A;  3H3M A;  2LLY A;  2WWU A;  2V26 A;  1WLX A;  1S35 A;  1N33 T;  2I6H A;  5LHI B;  2BBJ A;  3VKG A;  3I9Y A;  5HEO A;  3CPZ A;  4IE4 A;  1T7S A;  2H89 A;  3ONJ A;  2WU2 A;  5IWA T;  5JRC A;  3ZMT B;  1SHZ C;  2E2A A;  5KMG P;  4JLE A;  4BAY B;  3ZT5 A;  4DR3 T;  3JAF A;  5CB4 E;  3J7Y q;  2ODU A;  4QH5 A;  3CIR A;  3FZH B;  2BZB A;  1AJ3 A;  1L0V A;  4NXN T;  3UU6 A;  3NBX X;  3FBZ A;  5HXE A;  1ZHC A;  3EHZ A;  5LJN A;  1NEN A;  3KDS E;  3ZMU B;  2BS3 A;  1U4Q A;  2VQE T;  4IRE A;  1OED E;  3QNU A;  4YLH A;  5JVD E;  3UU3 A;  2J4G A;  3EI0 A;  3UTK A;  1US7 B;  2LOS A;  3NRX A;  5J0Z A;  2UUA T;  1UGO A;  2XAF B;  2KLQ A;  2ZM8 A;  3ZPO A;  4O2A E;  1X79 A;  2YKS A;  3M65 A;  3ZC0 A;  3RH3 A;  5L4E A;  1FMV A;  2VL8 A;  4H9S E;  2WBL A;  2UXN B;  5F5W A;  3QC9 A;  4MLK A;  2CA5 A;  2JMH A;  2X51 A;  4DR7 T;  4EOZ B;  4TZ4 C;  4ZHQ E;  4DV4 T;  3ONX A;  3B13 A;  4IL9 A;  1Y64 B;  5H6Q B;  1W0B A;  3OKQ A;  5JDL A;  4EZ4 A;  5CA0 E;  3O4X E;  2D2S A;  3FZF B;  2DI4 A;  1XNQ T;  3N9L A;  5LYJ E;  1D1A A;  3Q5W A;  4KHZ F;  1ZP0 A;  1MMA A;  2CXF A;  3UU4 A;  1U5P A;  5M4Y A;  1E1H B;  2CM0 A;  4K0K T;  5EK3 A;  4O4L E;  1XWM A;  3TLS A;  4CI2 B;  1T72 A;  3N9N A;  4HFH A;  3RC3 A;  4EB6 E;  2LSY A;  2NW7 A;  1MNE A;  4LF4 T;  1YW0 A;  3AVR A;  2OLT A;  1QUU A;  5ABE A;  4H9P C;  4U7I A;  2P9B A;  4I43 B;  2K48 A;  4P09 A;  2CLY B;  4IDQ A;  3ZLI A;  4CN4 A;  2IC9 A;  2CBJ A;  2E9X B;  4JBW F;  3P4R A;  1V9D A;  2HPJ A;  3AAI A;  2UU9 T;  2XUE A;  3TLW A;  5J2U E;  2BVL A;  3PUX F;  3BK9 A;  4NXM T;  1LVF A;  5JTG A;  3I9W A;  1OWA A;  4CQI A;  2E8I A;  2SPC A;  3AE8 A;  3SRZ A;  3ZMS B;  3E08 A;  4UEM A;  2CHO A;  2EHO B;  4GKJ T;  2LE8 A;  3IBP A;  3RC8 A;  4DV2 T;  4JI1 T;  2CWY A;  1W09 A;  2QGS A;  1HFA A;  4O4J E;  5C2T A;  3PV0 F;  4IE7 A;  4O4I E;  5AQU B;  2XY8 B;  2C0S A;  1G8X A;  2WZI A;  2BBH A;  3K8P C;  5LP6 E;  4EXT A;  3OYX A;  4YSZ A;  1QLB A;  1ZKE A;  3JCF A;  2A9U A;  2PTF A;  2WMN A;  3L3P A;  1IJ6 A;  4QHO A;  2CXD A;  4GOU A;  2LM2 A;  4YJ3 E;  5JRE A;  2X67 A;  2YU1 A;  3LFM A;  3NRY A;  5IHY A;  3ZN1 B;  3PDY A;  2DCF A;  2JQ9 A;  4UVA B;  5GON E;  3H37 A;  3L39 A;  5HCM A;  2MTQ A;  5HEG A;  2QRX A;  3PJA A;  1HNW T;  5AQF B;  2WM9 A;  4PJL A;  2BKP A;  2XQ9 A;  3Q5X A;  4FJO A;  1B7T A;  3UFE A;  4ZOL E;  3TLV A;  4MAL A;  4L0R A;  1T98 A;  2XQ4 A;  5JDF A;  1WYC A;  5LOV E;  3PU3 A;  4HKA A;  4IDN A;  2W4X A;  2CBI A;  2X68 A;  1CUN A;  2CMR A;  4DV6 T;  1IBL T;  3VRA A;  4DV3 T;  3KIN B;  3RIF A;  2EHO A;  1UK5 A;  1BR1 A;  4NUU A;  3RKO A;  3NZP A;  5L3E B;  2I0M A;  2NR4 A;  2WDR A;  3ABV A;  2I59 A;  5JDM A;  3RQW A;  1YKH B;  3C98 B;  2X0L B;  3AEF A;  3HKE E;  3PTR B;  5BMV E;  2CEA A;  1FEW A;  4YXD A;  1KNP A;  1H7C A;  2XAG B;  5ABF A;  4ZS3 A;  4QXH B;  2H3R A;  3DP7 A;  4I50 E;  4DR4 T;  2YEV C;  1ZOY A;  2VB6 A;  1XMO T;  4G2A A;  3IEE A;  5LGU B;  4ILC A;  5FXW A;  4PFP A;  2K3W A;  4NPP A;  4XBF B;  3QB5 K;  4I0U A;  2ZLY A;  3U3I A;  3MA9 A;  2X9W A;  3HKB E;  4HWC A;  2X66 A;  3RYH E;  2IC6 A;  5F8P A;  1D0Z A;  4DV7 T;  3CWZ B;  4I4T E;  5FVK A;  4QXC B;  2H7O A;  5AQG B;  3ZN0 B;  2QVA A;  5LCY A;  3P50 A;  4XAX B;  2D0U A;  4B3T T;  2BG9 B;  3FXE B;  2J62 A;  3KV5 A;  3MAC A;  2CWO A;  4KHP T;  1KF6 A;  3EDU A;  3ZT6 A; 
#chains in the Genus database with same CATH homology
 3ANW B;  2XAJ B;  3CQC B;  2BZB A;  3AAE B;  4CXY A;  1AJ3 A;  4X1K E;  3N5L A;  5HXR A;  2J1D G;  4IIJ E;  3NBX X;  5JQG E;  3F31 A;  3FBZ A;  3Q2M A;  5HXE A;  1ZHC A;  3A5X A;  4X1Y E;  2VKO A;  3N9M A;  5L3F B;  4H9Q C;  2K5B B;  5LJN A;  1LKX A;  2W00 A;  4UXN B;  2Q9Q C;  2EHO D;  3KDS E;  2IW5 B;  4DO0 A;  2C5I T;  4DBQ A;  1LVK A;  4YHJ A;  3O9X A;  2LJL A;  3V5S A;  4N78 D;  2Y8D A;  5IYZ E;  3ZMU B;  4JEH B;  1U4Q A;  2XTL A;  4PJN A;  4HGA A;  4NUV A;  3SOL A;  3ZCI A;  4YLH A;  3KV9 A;  5JVD E;  3CVR A;  4UF0 B;  5L3C B;  2KT9 A;  4UVB B;  4IE0 A;  3LBX A;  3SS1 A;  3UTK A;  1US7 B;  2LOS A;  4IE6 A;  3NRX A;  2KWI B;  2XAF B;  5HWY A;  3UUL A;  2KLQ A;  2V7K A;  2ZM8 A;  3ZPO A;  2UXX B;  2VAS A;  4MFR A;  2DHR A;  4O2A E;  5JR9 B;  1X79 A;  2LHN A;  3K3O A;  3M65 A;  3ZC0 A;  4P0B A;  3RH3 A;  3FB2 A;  3VKH A;  1FMV A;  2VL8 A;  4O4H E;  4H9S E;  3LK4 2;  2WBL A;  2UXN B;  4MBQ A;  3QC9 A;  4MLK A;  4E7Z A;  2A3D A;  4C91 A;  3CML A;  2CA5 A;  4OYJ A;  2JMH A;  3HKC E;  3PUQ A;  3TKL B;  2LSJ A;  5LNK A;  2M67 A;  4Z8X A;  2N2N A;  2X51 A;  4AQG A;  2K24 A;  4OHF A;  4GK0 E;  4TZ4 C;  5FYM A;  4EOZ B;  4ZHQ E;  3CX6 B;  4DND A;  2V1D B;  3ONX A;  2PJQ A;  2X9Y A;  2Q9Q A;  3B13 A;  3E0Z A;  3AA7 B;  2V7L A;  3O1I A;  1Y64 B;  5H6Q B;  1MMD A;  1YKE B;  3OKQ A;  5JDL A;  4EAH A;  3ZMV B;  4EZ4 A;  5JDG A;  5CA0 E;  1WYB A;  2LHR A;  1ZV4 X;  3O4X E;  2D2S A;  3MJX A;  2L9Q A;  5J1G A;  2DI4 A;  3RYF E;  3FHN A;  3N9L A;  5LYJ E;  4YJ2 E;  4I55 E;  5L3B B;  1D1A A;  2W0G A;  2Y48 B;  3Q5W A;  3KV4 A;  5DQW A;  4QX7 B;  3E22 E;  1MMA A;  4IDZ A;  4P0A A;  1HF8 A;  2CXF A;  3RX6 A;  5JR9 C;  5H6R B;  3CX7 B;  3WAJ A;  1BR4 A;  4A56 A;  1U5P A;  3KVA A;  3R84 B;  3VHL A;  2CXL A;  1E1H B;  3HL6 A;  4PJM A;  2CM0 A;  3RRC A;  5M4Y A;  4ISS A;  2JPF A;  3BQK A;  4O8S A;  5EK3 A;  5C8Y E;  2NOX A;  1IJ5 A;  5FXV A;  2VK9 A;  1HG2 A;  2E9X D;  4O4L E;  4CI2 B;  2XAQ B;  4H9R C;  3N9N A;  1MMN A;  4E7S A;  2L8K A;  3OBV E;  4DVD A;  2JQQ A;  3RC3 A;  5CA1 E;  4EB6 E;  2LSY A;  2NW7 A;  3GN5 A;  2G0U A;  4AXP A;  1MNE A;  5LHH B;  1YW0 A;  2LSK A;  3VU7 H;  3O1J A;  2JMK A;  3PU8 A;  5HYA A;  2DNX A;  3AVR A;  4ZS2 A;  3K3N A;  5DJQ C;  5AFU L;  2W62 A;  1QUU A;  2LEH A;  3AA6 B;  3LK3 B;  4TV9 E;  1HS7 A;  5HWX A;  4QKN A;  4QX8 B;  2PBI A;  4H9P C;  1LRZ A;  2CCQ A;  2VKH A;  4IHJ E;  2ES0 A;  2P9B A;  5LXT E;  4I43 B;  4K0U A;  3D0T A;  3KBT A;  5KDM C;  2K48 A;  4P09 A;  1MND A;  2CLY B;  2XQY A;  3HKD E;  4IE5 A;  3ZLI A;  2WAU A;  1D1C A;  5JRC B;  3UUX B;  4UF0 A;  2D5U A;  2IC9 A;  1MIV A;  4UIG A;  4X1I E;  2E9X B;  4ZI7 E;  1V9D A;  1IAP A;  2HPJ A;  3AAI A;  3H3A A;  4XZC A;  1BR2 A;  2HPL A;  3BQL A;  4HN9 A;  3R6N A;  1HG5 A;  4QXB B;  4DMW A;  3P7I A;  4M1P A;  2YU2 A;  3KV6 A;  3ZMZ B;  2XUE A;  3W15 B;  5J2U E;  2DWG A;  2BVL A;  4JEU B;  4U74 A;  3BK9 A;  1LVF A;  4GYS A;  3I9W A;  4OK0 A;  5F3J A;  1HTJ F;  1OWA A;  4HFV A;  5JDN A;  4CQI A;  2E8I A;  2SPC A;  5FY7 A;  3U78 A;  5HXS A;  4PAG A;  1HCI A;  3FXD B;  4ZI3 C;  1QSD A;  3SRZ A;  2NWB A;  1VRB A;  3ZMS B;  3E08 A;  4UEM A;  3WI3 A;  4C90 A;  4CI1 B;  1D1B A;  2EHO B;  2D0T A;  2WMO A;  4PK5 A;  3LG7 A;  3EVY A;  2LE8 A;  3IBP A;  3RC8 A;  2QA7 A;  4L9I A;  2CWY A;  2QGS A;  1HFA A;  4H9O C;  4O4J E;  4EYU A;  2NW9 A;  3L09 A;  3SWH A;  3JC6 C;  4IE7 A;  3V5U A;  4PNI A;  2HH7 A;  3C4X A;  2CLY C;  4O4I E;  5JH7 E;  2XAS B;  3I1A A;  2X9H A;  3DJB A;  2C0S A;  2E9X C;  2JJ9 A;  2MYS A;  1G8X A;  3EDV A;  3AVS A;  2KIN B;  3K8P C;  2CE7 A;  3GWH A;  4F6R C;  5LJM A;  4CZZ B;  3LBX B;  3MK7 C;  3ZYM A;  2Q9Q D;  5LP6 E;  1ZEE A;  3N2G E;  4PW8 A;  4EXT A;  3ZEF B;  3LJC A;  4KBM B;  3OYX A;  1ZKE A;  5L2L A;  4ADZ A;  2ODV A;  5L3D B;  4YFS A;  5LGN B;  3ZYK A;  4B6X A;  4HE8 A;  2LSI A;  2WMN A;  3L3P A;  1BR0 A;  1IJ6 A;  4QHO A;  2CXD A;  5JDQ A;  5FY0 A;  3F57 A;  4GOU A;  4YJ3 E;  2N9D A;  3N2K E;  4ZI2 D;  5JRE A;  2DWK A;  2ZM2 A;  4HTE A;  2X67 A;  1KNZ A;  2EHO C;  4EIW A;  5KX5 E;  2YU1 A;  3LFM A;  3NRY A;  5IHY A;  2RP4 A;  2NP9 A;  4L5G A;  3ZN1 B;  4PFO A;  1IZN B;  2KXP B;  3DTO A;  5A1L A;  4H9N C;  3PDY A;  3ANW A;  2NTX A;  3Q9D A;  4PJJ A;  2DCF A;  4UVA B;  4ERR A;  5GON E;  3T8O A;  2N1G A;  2XAH B;  2YK0 A;  2B1E A;  2RA1 A;  4AKR B;  2MOZ A;  3H37 A;  4CI3 B;  3RPU A;  2MTQ A;  5HXH A;  2XHE B;  4TV8 E;  4EYY R;  3C50 A;  4AKI A;  3RRW A;  4AQF C;  3RYI E;  3BQI A;  2H7V C;  3MKD A;  3UUN A;  1EZ3 A;  5LHG B;  2KZ7 B;  3AA0 B;  3RYC E;  2WM9 A;  4WNK A;  4EZH A;  1SA0 E;  2KMF A;  3UUM A;  4PJL A;  4UEL A;  4O2B E;  1MIY A;  5FP3 A;  3PE0 A;  3Q5X A;  4WBN E;  4FJO A;  5FNV E;  1B7T A;  3UFE A;  1KK7 A;  3IF8 B;  4ZOL E;  2W61 A;  3KFW X;  3LK2 B;  4MAL A;  4L0R A;  4TN7 B;  1T98 A;  5JDF A;  1WYC A;  4UV9 B;  3PUS A;  5LOV E;  1S94 A;  3PU3 A;  4HKA A;  5HAX A;  2PFV A;  4IGU A;  4QWN B;  3I0O A;  3GA8 A;  4AKH A;  3ZC1 A;  3N9O A;  3CKD A;  3ETU A;  1WR6 A;  5E0O A;  2W63 A;  4CXX A;  4MHC A;  2X68 A;  3KBU A;  5FY1 A;  3I0Q A;  3QUJ A;  1G73 A;  1CUN A;  3K3Q C;  2CMR A;  1WRD A;  3PUG A;  2LM9 A;  3KIN B;  3NZQ A;  4GIW A;  3O1H A;  5ADX L;  2EHO A;  2L3L A;  4AKG A;  2KND A;  3GN5 B;  5FMN A;  5JR9 A;  5LBQ B;  4H63 V;  4BJN A;  1BR1 A;  4NUU A;  3FBL A;  4CXW A;  4H63 H;  3RKO A;  3NZP A;  5L3E B;  1O3X A;  1UX4 A;  3N9P A;  3CX8 B;  5DAB A;  4KP3 C;  5EZY E;  2I59 A;  5JDM A;  3QK6 A;  1D0Y A;  4G63 A;  2NTY A;  3C51 A;  1YKH B;  5TAO A;  3C98 B;  4ZI2 C;  2ZMA A;  2OA5 A;  2X0L B;  3KVB A;  4AQF A;  2KWH A;  4PK6 A;  3HKE E;  3PTR B;  4FI5 A;  2VWA A;  4U72 A;  2A72 A;  5LBM A;  5BMV E;  3MZK B;  2C5J A;  2CEA A;  1FEW A;  2GK9 A;  3WAK A;  4UV8 B;  1H7C A;  3CQG B;  2XAG B;  4ZS3 A;  5J2T E;  4QXH B;  2ZM0 A;  3ESL A;  2H3R A;  3DP7 A;  4KMC A;  4I50 E;  4UVC B;  2BVM A;  3PUA A;  2YEV C;  1Z0P A;  2VB6 A;  3HI2 A;  3C64 A;  2BDE A;  2LSG A;  3ZJ1 A;  5EK4 A;  5FXX A;  4WW0 A;  1VOM A;  3OJA A;  3HA4 A;  2WSS V;  2V7I A;  4G2A A;  3IEE A;  4WBO A;  2LOP A;  5LGU B;  4GK5 E;  1D0X A;  3AB3 B;  3PUR A;  5FXW A;  4PFP A;  5L3G B;  3OYZ A;  5ETW A;  2C5K T;  2K9A A;  3ZJ2 A;  4BJM A;  2JRK A;  3ETV A;  4J2C A;  3AAA B;  4XBF B;  3CQX C;  2ZLY A;  3U3I A;  1MMG A;  3MA9 A;  4ANJ A;  2A2F X;  2X9W A;  3B57 A;  3HKB E;  4AKL A;  3IHR A;  2ACX A;  2X9X A;  2LT3 A;  1OXZ A;  2VKD A;  2X66 A;  4TUY E;  5LG4 A;  3RYH E;  3N2O A;  2IAK A;  4X20 E;  4TX5 A;  2Y6X A;  2V7J A;  2IC6 A;  3UT5 E;  5LGT B;  4OYK A;  1MIW A;  4AI6 A;  3HR0 A;  5F8P A;  3S4U A;  2WWU A;  2V26 A;  4V1A v;  1D0Z A;  5LA6 E;  1UCU A;  2PG8 A;  4ZI3 D;  5JDH A;  3C4Z A;  5DQV A;  3CWZ B;  4ASK A;  1WLX A;  1S35 A;  2Q9Q B;  2VKJ A;  3F2E A;  2DLR A;  3MXZ A;  4I4T E;  1HX8 A;  1NAF A;  1FIO A;  5LHI B;  4KUM B;  3ZCJ A;  4QXC B;  5EK2 A;  2H7O A;  3VKG A;  3I9Y A;  3CPZ A;  3ZN0 B;  4IE4 A;  4HEA A;  3GMI A;  5HXC A;  4JUY A;  5LCY A;  3ZYL A;  4BA9 A;  1FMW A;  4GYR A;  4PK4 A;  1UX5 A;  4XAX B;  2D0U A;  2YIN A;  4DMV A;  4DBR A;  3P8C D;  3JC6 D;  3C4W A;  3FXE B;  3N9Q A;  5JRC A;  2Z6E A;  3AA1 B;  3ZMT B;  1SHZ C;  2E9X A;  3KV5 A;  3MAC A;  2CWO A;  2NW8 A;  4ILU A;  2V7M A;  5KMG P;  4JLE A;  4IST A;  3J9X 1;  4BAY B;  3EUH A;  5FXZ A;  2MBG A;  1NWM X;  3EDU A;  4OFZ A;  1YD8 G;  5CB4 E;  3J7Y q;  2ODU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...