3C98B

Revised structure of the munc18a-syntaxin1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
247
structure length
230
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-binding protein 1
publication title Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 91
structure length 230
sequence length 247
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c98B00
2DNXA 4JEUB 1S94A 3LG7A 1BR0A 2XHEB 1EZ3A 1FEWA 5LG4A 1FIOA 4TX5A 4JEHB 5M4YA 1HS7A 1G73A 3C98B
chains in the Genus database with same CATH superfamily
1WRDA 5HAXA 3FB2A 5FXWA 2L3LA 2NW8A 2LJLA 2BS4A 2X9XA 2MOZA 3QB5A 2CPTA 4UF0B 3CQGB 5DJQC 4UR9A 2RPAA 2XJ7A 1IBMT 5CGMA 4ZHQE 4B3MT 4LF6T 1MMAA 4B3TT 3ETVA 4QH1A 2XQ6A 4A56A 2FBWA 4DBQA 1OEDC 3KV4A 2NR4A 2XAJB 1LVKA 2JRKA 3N2KE 3O1JA 5LOVE 4UEMA 5AQJB 1SE7A 1XNQT 4I55E 1OEDA 4H9PC 4IDZA 3CPZA 3MJXA 2QYWA 4DNDA 3RC8A 2JMKA 5A1LA 4B3ST 4LF7T 4QXCB 3ZN1B 2V1DB 2AE9A 3UQ4A 4WYVA 1T72A 4X1YE 4DVDA 1VOMA 1YXRA 5AQGB 1W0BA 2BG9C 3ZYMA 3RRWA 4EB6E 1X9BA 4A98A 3IF8B 4NIQA 2IW5B 2V6XA 2WWVA 2CBJA 4JI8T 1Z0PA 4LFCT 4AISA 1FEWA 2BG9A 1XNRT 1M7KA 2RP4A 3DP7A 2D0UA 4HEAA 4PW8A 5JR9B 2LSJA 3H3MA 3NVOA 2CRBA 2CCQA 1YQ4A 3UUNA 2CM0A 3RIAA 3E08A 2CXFA 3E22E 3L3PA 4HFDA 1YQ3A 4AKLA 2C5IT 5L3BB 4O4IE 2MPKA 4WBNE 3UQ7A 3ANWA 2K3WA 4Z91A 2W67A 2ZMAA 4HE8A 2M6BA 3HKEE 2CLYB 2FJEA 4ERRA 1LKXA 3SFDA 2I59A 4EAHA 3N9LA 2YU2A 4DIDB 4JLEA 4HFHA 2LHNA 5AQQB 4CI1B 4KHPT 1EZ3A 3ZSTA 4U74A 4EEDA 4AKHA 3G06A 2W62A 4QX7B 4QWNB 5ABGA 5KXJA 3PUXF 4AI6A 4PFOA 2KWHA 4FI5A 5F5WA 1W09A 3ONXA 4IE5A 3CKDA 2KLQA 4ZZCA 4IIJE 1ZP0A 2E5LT 2X66A 3NZQA 1VCSA 4V1Av 3X1DA 4PAGA 3I9WA 3F31A 4C91A 4LF4T 4AKGA 3AXJA 4XZCA 4AXPA 2Q9QD 3PE0A 2Y48B 2XM2A 2F4VT 2D0TA 2E9XC 5L3CB 4JI0T 4OX9T 4KP3C 3TKLB 4HFCA 3RQUA 1M62A 3JCFA 3K8PC 1G8XA 4NUUA 4KUMB 5ABEA 5KDMC 1UX4A 3PUWF 1LVFA 2JQ9A 4DR7T 2CHOA 3VR9A 4OFZA 2D2SA 3ZLIA 3Q5DA 4YTNA 4B3RT 2XAFB 2LT3A 1UK5A 2H7VC 3EAMA 2UXCT 4EZ4A 4F8HA 3OYZA 2J47A 3UUXB 1GQEA 2LRKA 2WM9A 3I0QA 4DR5T 3ZCJA 3TLUA 1G73A 4X1KE 3PTRB 1ZKEA 3PUYF 1XDPA 4M1PA 2MTQA 2UUBT 4P0AA 1N34T 3I9YA 1SA0E 2WMOA 3AE1A 5HXSA 3MZKB 2XASB 4ZI3D 4WW0A 1WFDA 3O1IA 3RC3A 2J62A 3RPUA 3ONLC 4CXWA 3PUGA 2E9XD 4U2YA 2LE8A 1ZV4X 3W15B 5FVLA 3SFEA 3K3QC 2KMFA 4G2AA 5CJ5A 3K3OA 1HCIA 3IBPA 5JQGE 3C4WA 4YY3T 2PBIA 3QB5K 1KNZA 5AQHB 5FXXA 4COFA 5FXZA 5JRCB 2BZBA 5M4YA 4TN7B 2W0GA 3ZT5A 5HXHA 4TV9E 2A9UA 4JI3T 3CWZB 4F6RC 4DV0T 4X66T 5ABFA 2PJQA 5AQTB 5HXEA 2JQQA 2M67A 1JNZA 3OTOT 2E2AA 3PJAA 4EXTA 2EHOB 2VURA 4K0KT 1HNXT 5FY7A 3RIUA 3I1AA 3CVRA 4HTEA 1MMGA 3U3IA 1D0ZA 2BVLA 2XTLA 2H89A 5L3FB 2KZ7B 5JH7E 2NTYA 3T1YT 5LP6E 3ZJ1A 5FYMA 1V9DA 2WB5A 2R6GF 4IDPA 3FZLB 2CA5A 4KX6A 2LOPA 3N9PA 2V7IA 2D9DA 2XZEA 3RIFA 3TLSA 3RKOA 3A8YC 3ZMSB 3UTKA 3ZJ2A 3QUJA 3RKGA 3LJCA 2YDSA 2VKDA 2XSBA 3SWHA 3PU8A 1XMOT 2DLRA 1VCTA 4HFIA 4PK6A 3ZC0A 2QGSA 2CLYC 3O1HA 4LMKA 4HWHA 3DTOA 3AB3B 3ZPOA 3RYIE 1Z8UA 5JDGA 5DQWA 5AQLB 5JVDE 2MBGA 2XQ3A 3P4PA 3B13A 5LCYA 4GYSA 5HWXA 2VKOA 2VKHA 4TUYE 4O4LE 1H7CA 3HKCE 2DI4A 2XSAA 3AE4A 4JI4T 1MNDA 2YDRA 2V26A 3PJAJ 3PUSA 4ZI2C 2HH7A 4GOUA 2X68A 4TWFA 3EDVA 1HR0T 2CBIA 4I4TE 2DL1A 1J5WA 2LEHA 5ABHA 2ZM2A 2WZIA 3P50A 3ZMVB 5HEGA 3KV5A 3AEFA 2YEVC 2LSYA 4ILAA 4WNKA 3P4WA 5HXRA 3PDYA 2L8KA 2CHNA 1O3XA 1QUUA 5FNVE 2LM9A 3CQXC 4MFRA 1MMDA 4ZS3A 2VVSA 2Y6XA 2XQ7A 4EYYR 2JMHA 3O9XA 3V5UA 2ACZA 2NTXA 1XZYA 3P4RA 4IDNA 4ILUA 5DQVA 2G0UA 3MK7C 1QSDA 4YFSA 1T8BA 4NXMT 3WAKA 5LNKA 4TWDA 1WLXA 2UUCT 4X20E 4O4HE 3EI0A 2VQFT 3OJAA 3NRYA 4XBFB 1MIWA 2YKSA 2VL8A 4ANJA 4Q25A 2XPKA 2Z6EA 4UELA 4ZI2D 3L8RA 5L3GB 4KHZF 5L4HA 2DWKA 2BDEA 4UVBB 4IE7A 2V5CA 3RGLA 1WYCA 4N78D 4PJJA 5LXTE 4PJLA 5TAOA 3N2GE 2X9YA 4PJMA 4TX5A 3AE6A 3BQKA 1YKHB 1S94A 5LYJE 1UX5A 2LSGA 2IC6A 4NPPA 2VKJA 5LA6E 2I6HA 1FJGT 2P9BA 2Q9QC 4HWCA 1XMQT 2FUPA 3MACA 4LF5T 5FMNA 3OBVE 3N9OA 5KMGP 5BR8T 3B57A 5J2UE 5ADXL 3ZEFB 4YXDA 1N32T 4YJ3E 4YSXA 2Q9QA 2VK9A 3ETUA 2BS3A 5BMVE 1LRZA 4QXHB 1MMNA 1IBKT 3FZKB 3TLVA 2V7KA 4ZEYA 2NWBA 3O4XE 2FJBA 3F57A 2FJDA 3K3NA 1S35A 3AE2A 3UU6A 4P0BA 2WDQA 3HKDE 2YDQA 3CK6A 3ABVA 3VRAA 4DO0A 4U7IA 3F2EA 3OPCA 3TLWA 1U4QA 4OHFA 4DMVA 4DR4T 5LMNT 4LMLA 5FVKA 2XM1A 2XQYA 3JAFA 3ZYLA 2IMLA 2C5KT 2EHOC 1HNZT 2X9HA 1B7TA 4U31A 4EGWA 2PG8A 2ZLYA 3JADA 2X0LB 1JNRA 4X62T 1HG2A 3IEEA 1FMWA 3JAEA 2EHOA 2LRLA 1BR4A 2X67A 2HN2A 3WI3A 3IHRA 4PNIA 2BKPA 4HWDA 4YSZA 4ZI7E 3NWIA 4ZI3C 1KFYA 4Z90A 5HEOA 2KINB 4QX8B 3ZSSA 4LMJA 3H3AA 2N2NA 4MHCA 3UU5A 3AE5A 2V7JA 2WDRA 2VB6A 2BBJA 3AA0B 2WS3A 4EV6A 3FXEB 3IA3A 3C50A 3BQIA 2LLYA 4AKIA 4H9QC 2VL0A 2E9XA 4GKKT 4CXYA 3T8OA 2JQHA 1ZOYA 3PUAA 3SOLA 1L0VA 1HX1B 3RQWA 3N2OA 2RA1A 4IREA 3Q5XA 2X51A 2YINA 4K0UA 3VKHA 2OLTA 3KFWX 5F8PA 4KBMB 2W61A 4JBWF 3T1HT 3EHZA 2EHOD 3UULA 5EK4A 5JTGA 5CB4E 5ETWA 4HFEA 3Q9DA 5HXCA 2UXXB 4G63A 4H9NC 3PV0F 5LHGB 2UUAT 2SPCA 3FBZA 1YD8G 4WZXA 3I0OA 4IDQA 1E2AA 4GIWA 4L9IA 5AQVB 4XAXB 4EYUA 4AIUA 5LJNA 2M6IA 4MLKA 4EIWA 2KXPB 4O4JE 3RLFF 4QH5A 2IC9A 5CA0E 1OWAA 3C98B 2DNXA 3J9X1 5IUXA 3CIRA 3JC6C 1QLBA 4CI3B 2ES0A 2V6YB 3LSVA 2B1EA 3BK9A 4HFBA 3FHNA 4OK0A 3UUMA 3CX8B 2BG9B 2UXDT 3N5LA 3UU8A 2X9WA 1HF8A 2IHR1 3LK3B 5AQKB 5FL1A 5HEJA 4UF0A 2X0HA 1BR0A 3LDQB 5HEUA 4DV4T 3ZN0B 2OV9A 1T7SA 3ANWB 2CEAA 3TLTA 4PK5A 5FY0A 1UGOA 3LBXB 2K9AA 2E5VA 4H9SE 2A3DA 1J1JA 2W00A 2ZM8A 2LM2A 2DCFA 3LFMA 4OYKA 2YN6A 3QC9A 5EK2A 4UXNB 3ONJA 3PUZF 3A7MA 3NRXA 4EOZB 3AVSA 2HHHT 2K5BB 2WZHA 2XAQB 1D0XA 3H37A 3NKZA 1D1BA 1MIVA 4P09A 2HPJA 5AQSB 3EABA 5L3EB 4Z8XA 1SHZC 5KX5E 3GA8A 2ODVA 4H9OC 2LHRA 3MKDA 2XQ9A 2CWOA 3UU4A 4CQIA 5L2LA 4ADZA 2WBLA 3AEAA 3E0ZA 2IDOB 4AQFC 3UT5E 2IAKA 3AXJB 1OXZA 2CMRA 4ILBA 4TV8E 3KBTA 2J4GA 3JC6D 4IL4A 2YU1A 3GN5B 4JUYA 5JDQA 4LFBT 5JR9C 3VU7H 2DHRA 2K24A 4PJNA 2MAWA 3AAIA 4IE4A 3FBLA 4AQFA 2N9DA 5HWYA 4TWHA 4IHJE 4ZZBA 4OYJA 1I94T 1IJ5A 3AVRA 4LF8T 4HFVA 5EK3A 5JR9A 3QOFA 3PURA 1D1CA 3KDSE 3UU3A 3ZT6A 2KNDA 5J2TE 2H7OA 1D0YA 2XUEA 4ZOLE 2NP9A 1IBLT 4U7YA 4YJ2E 5GONE 1SUMB 5LHHB 4DR3T 3FZFB 4DV2T 5HCMA 3MA9A 5AQMB 4BJNA 3AAEB 3UFEA 2JIWA 2D5UA 4JI7T 1Y01A 4O8SA 1E7PA 3C4ZA 2LSIA 4HKAA 4HWFA 5LGUB 2QVAA 5AQUB 2BS2A 2WCAA 2WAUA 3QNUA 2X0YA 2QA7A 3KV9A 2WU2A 1BR2A 3UUBA 1XDOA 1YW0A 2ODUA 4UVCB 4YLHA 3BQLA 2CWYA 2XQ8A 4BAYB 3R84B 3KV6A 3RYFE 4DV7T 3PU3A 4TNVA 3WAJA 3AEEA 2YK0A 3ZMZB 4QXBB 5JDMA 5IYZE 2DWGA 4E7ZA 1FIOA 4IDOA 2W2UA 2J1DG 3HKBE 2WY2A 2PFVA 3HA4A 3NBXX 3AA6B 5FL0A 5ABFB 3KINB 3M3ZB 2W63A 4AKRB 4UVAB 2BVMA 4MBQA 4DUYT 3PUVF 4IE0A 3A5XA 1KNPA 2NOXA 5HYAA 2WU5A 2XY8B 5AQPB 4U72A 4KMCA 4HWIB 4IE6A 3AEGA 4U3CA 5LBQB 3CMLA 2IUBA 1WCRA 1IJ6A 4ASKA 4DMWA 4EEBA 3ZC1A 1DU2A 4DBRA 5DABA 4DR1T 1HFAA 5LHIB 3S4UA 2GK9A 1AJ3A 3CX7B 3L09A 3GWHA 4TZ4C 4JI1T 2V8SV 3L39A 3P8CD 5H6RB 4JEUB 1W0AA 1J5ET 2E8IA 4GK0E 4U2ZA 3NZPA 4E7SA 3AE9A 4ILCA 5LBMA 2C0SA 2LKHA 2V6YA 3RYHE 4MALA 5C8YE 2C5JA 3RH3A 4BA9A 5AQIB 2WMNA 3ZYKA 5IHYA 3HL6A 4JI5T 5JDFA 5LG4A 3HI2A 4DV3T 3KVBA 1I6ZA 3P4QA 5JDLA 3MXZA 3P7IA 4X5TA 4HN9A 3OKQA 2WSSV 1WR0A 2BKNA 5JRCA 2XQAA 1KNRA 4I43B 3LBXA 1MNEA 4P1NA 3AEBA 1E1HB 1X79A 2I0MA 1BR1A 1HTJF 1UUSA 4YTMA 5J1GA 4YHHT 1KK7A 2A2FX 5F3JA 4GKJT 5C3JA 4JI2T 2K48A 4QKNA 1NENA 3EDUA 2BBHA 2HPLA 4TNWA 1U5PA 4DV1T 2WP9A 2NW7A 4X1IE 4ZXLA 3N9NA 3AAAB 5FP3A 2AXDS 2IIUA 2CXLA 1WR6A 3QK6A 5CA1E 4ZS2A 1MIYA 1XWMA 4CZZB 3P4SA 1CUNA 4DV5T 3GN5A 3FXDB 5AQNB 2VWAA 3PUQA 5CFBA 2UXNB 4UV8B 3N9QA 1HG5A 1US7B 5JDNA 2KT9A 2VASA 2LOSA 4I0UA 1VRBA 2QRXA 3AEDA 4YTPA 4GYRA 5AQRB 3RYCE 5L3DB 4H9RC 2LSKA 3ZKRA 2XQ5A 5JDHA 1D1AA 4UIGA 4EZHA 4IT4A 3ZT7A 2WWUA 1OEDB 3B5MA 2OA5A 5LMUT 2ZM6T 3ZMUB 4NUVA 3VHLA 1WYBA 1OEDE 3UFGA 1N33T 3CX6B 4UV9B 2WQYA 4HGAA 5HEHA 4GK5E 3Q5EA 3AECA 4YSYA 5J0ZA 1IAPA 2W66A 4NXNT 1NWMX 4JV5T 4JI6T 3LG7A 1N36T 5H6QB 5LJMA 2W4XA 3KVAA 4L5GA 3HR0A 4U33A 2B76A 3R6NA 3FZMB 1T98A 4DUZT 4PFPA 5IWAT 1ZHCA 4YHJA 2Y8DA 3C51A 5AQOB 1R8IA 2XAGB 2Q9QB 1YKEB 1FMVA 3M65A 2V5DA 4CXXA 4FJOA 2BG9E 4DR6T 2XQ4A 4LF9T 5EZYE 3C64A 5E0OA 4L0RA 3RRCA 4B6XA 4H63H 4A97A 4CN6A 2PTFA 3KBUA 4CI2B 1KF6A 2CXDA 3ZCIA 4DV6T 3EVYA 4WBOA 4IL9A 3OYXA 5FY1A 1Y64B 3K1SA 3RX6A 3CQCB 4X65T 1IZNB 3VR8A 3AE3A 3RIUC 3Q5WA 5AFUL 2UU9T 3RF1A 2YOEA 4A5XA 2N1GA 3Q2MA 5LG3A 1NAFA 3SRZA 5LB7B 3U78A 1HX8A 3V5SA 2BKOA 4BJMA 3VKGA 2UXBT 2NW9A 2ACXA 3OVUA 3DJBA 2H3RA 4H63V 4JYAT 3LK2B 1HS7A 1UURA 5FXVA 2CE7A 5C2TA 2MYSA 2V7MA 3AE8A 2KWIB 2A72A 4AQGA 1CHUA 2L9QA 3LK42 4ISTA 3ZMTB 3SS1A 2WDVA 5LGNB 4J2CA 3D0TA 2E9XB 4QHOA 4O2BE 1ZEEA 5AQFB 4CN4A 4O2AE 4QH4A 2VQET 5LGTB 5HCJA 4X64T 3GMIA 3AE7A 2FJAA 4IGUA 3N9MA 2KSRA 4JEHB 2ZM0A 2XAHB 3VRBA 1W9RA 4LFAT 2V7LA 2H88A 3FZHB 4YT0A 3C4XA 2XHEB 3AA1B 2VVNA 2JJ9A 5FKYA 5JREA 3AA7B 4PK4A 3ESLA 1HNWT 4DR2T 4C90A 3RI5A 1NEKA 5L4EA 5L47A 4I50E 4ISSA 3RHWA 2LKGA 1KEYA 3EUHA 2JPFA 4CN1A 1UCUA 4AQYT 3J7Yq 2HN1A 2JQKA 4KI0F
chains in the Genus database with same CATH topology
1WRDA 3ZYKA 5IHYA 3HL6A 2EHOD 3U3IA 5JDFA 1D0ZA 5LG4A 3UULA 5EK4A 2BVLA 2XTLA 5CB4E 3HI2A 5ETWA 5L3FB 2KZ7B 3KVBA 5HAXA 5HXCA 3Q9DA 5JH7E 2UXXB 5JDLA 3FB2A 2NTYA 3MXZA 2L3LA 2NW8A 3P7IA 4G63A 4H9NC 4HN9A 5FXWA 2LJLA 2WSSV 3OKQA 5FYMA 3ZJ1A 5LP6E 5LHGB 1V9DA 2X9XA 5JRCA 2CA5A 2MOZA 4UF0B 3CQGB 2LOPA 5DJQC 3N9PA 2SPCA 4I43B 3LBXA 2V7IA 1MNEA 4ZHQE 3FBZA 1MMAA 1YD8G 3I0OA 3ETVA 4GIWA 3RKOA 4L9IA 4XAXB 4A56A 3ZMSB 4EYUA 1E1HB 3UTKA 1X79A 3ZJ2A 5LJNA 4DBQA 4MLKA 3QUJA 4EIWA 3KV4A 3LJCA 2KXPB 4O4JE 2XAJB 1LVKA 1BR1A 2VKDA 1HTJF 2IC9A 2JRKA 5CA0E 3N2KE 1OWAA 3C98B 3O1JA 2DNXA 5LOVE 4UEMA 5J1GA 3SWHA 3PU8A 3J9X1 2DLRA 1KK7A 2A2FX 5F3JA 3JC6C 4CI3B 2ES0A 4I55E 2B1EA 4PK6A 3BK9A 3ZC0A 2QGSA 3FHNA 4H9PC 4OK0A 2CLYC 2K48A 4QKNA 3UUMA 3CX8B 3O1HA 3EDUA 2HPLA 1U5PA 3N5LA 4IDZA 3CPZA 2X9WA 3MJXA 1HF8A 3DTOA 2NW7A 3AB3B 3ZPOA 3LK3B 4X1IE 3RYIE 4DNDA 3RC8A 2JMKA 5JDGA 5DQWA 5JVDE 5A1LA 2MBGA 3N9NA 4UF0A 1BR0A 3AAAB 3B13A 4QXCB 3ZN1B 5FP3A 5LCYA 3ZN0B 4GYSA 5HWXA 2VKOA 2VKHA 3ANWB 2CEAA 4TUYE 2V1DB 1WR6A 2CXLA 4O4LE 1H7CA 3HKCE 2DI4A 3QK6A 4ZS2A 5CA1E 4PK5A 1MIYA 4CZZB 1MNDA 5FY0A 1CUNA 2V26A 3GN5A 3LBXB 3PUSA 2K9AA 4ZI2C 4X1YE 2HH7A 4DVDA 1VOMA 3FXDB 2VWAA 3PUQA 4GOUA 2UXNB 4H9SE 4UV8B 3N9QA 2X68A 1HG5A 2A3DA 2W00A 1US7B 5JDNA 2ZM8A 3EDVA 2DCFA 4I4TE 3LFMA 2KT9A 2VASA 4OYKA 3ZYMA 2LOSA 1VRBA 3RRWA 4EB6E 3QC9A 5EK2A 4GYRA 3RYCE 4UXNB 5L3DB 4H9RC 2LSKA 2LEHA 3IF8B 2ZM2A 3NRXA 2IW5B 4EOZB 3AVSA 3ZMVB 2K5BB 1Z0PA 3KV5A 5JDHA 2YEVC 2LSYA 1D1AA 4UIGA 4EZHA 1FEWA 4WNKA 2XAQB 2WWUA 2RP4A 3DP7A 4HEAA 1D0XA 2D0UA 4PW8A 5HXRA 3H37A 5JR9B 3PDYA 1D1BA 1MIVA 2LSJA 2HPJA 4P09A 2OA5A 5L3EB 4Z8XA 2CCQA 3UUNA 2CM0A 2L8KA 1SHZC 5KX5E 3GA8A 2ODVA 3E08A 2CXFA 3ZMUB 4H9OC 3E22E 3L3PA 4AKLA 2LHRA 3MKDA 1O3XA 1QUUA 5FNVE 2C5IT 5L3BB 2CWOA 4O4IE 4CQIA 2LM9A 3CQXC 4MFRA 4NUVA 3VHLA 1WYBA 1MMDA 5L2LA 4WBNE 3ANWA 4ZS3A 2Y6XA 4ADZA 2WBLA 4EYYR 2JMHA 2ZMAA 3CX6B 4HE8A 4UV9B 4HGAA 3E0ZA 3HKEE 2CLYB 4GK5E 3O9XA 4AQFC 4ERRA 3UT5E 2IAKA 3V5UA 1OXZA 1LKXA 2CMRA 4TV8E 2NTXA 2I59A 3KBTA 1IAPA 4EAHA 3N9LA 4ILUA 3JC6D 2YU1A 2YU2A 3GN5B 4JUYA 5DQVA 5JDQA 1NWMX 2G0UA 3MK7C 5JR9C 3LG7A 3VU7H 1QSDA 2DHRA 4YFSA 4JLEA 5H6QB 3WAKA 2K24A 4PJNA 5LNKA 5LJMA 3KVAA 3AAIA 4IE4A 2LHNA 3FBLA 4CI1B 4L5GA 4AQFA 1EZ3A 2N9DA 5HWYA 4U74A 4IHJE 4AKHA 1WLXA 3HR0A 4OYJA 2W62A 1IJ5A 4X20E 4O4HE 4QX7B 3AVRA 4QWNB 3R6NA 4HFVA 5EK3A 5JR9A 4AI6A 1T98A 3OJAA 3NRYA 4PFOA 3PURA 4PFPA 2KWHA 4FI5A 1ZHCA 4XBFB 1MIWA 3ONXA 4YHJA 4IE5A 2Y8DA 1D1CA 3C51A 3KDSE 2VL8A 4ANJA 3CKDA 2KLQA 2XAGB 2KNDA 2Q9QB 5J2TE 1YKEB 4IIJE 2Z6EA 4UELA 1FMVA 3M65A 2H7OA 1D0YA 2XUEA 4ZI2D 2X66A 5L3GB 3NZQA 4ZOLE 4CXXA 4V1Av 2NP9A 4FJOA 4PAGA 4YJ2E 2DWKA 2BDEA 3I9WA 4IE7A 3F31A 4UVBB 5GONE 4C91A 1WYCA 4N78D 4PJJA 5EZYE 5LXTE 3C64A 4AKGA 5E0OA 4PJLA 5TAOA 5LHHB 4XZCA 4AXPA 2Q9QD 3N2GE 2X9YA 3PE0A 4L0RA 4PJMA 2Y48B 4TX5A 3RRCA 3MA9A 4B6XA 4H63H 4BJNA 3AAEB 3BQKA 1YKHB 1S94A 2D0TA 2E9XC 2D5UA 3UFEA 5L3CB 4O8SA 5LYJE 1UX5A 3KBUA 2LSGA 3C4ZA 2LSIA 2IC6A 4KP3C 4CI2B 2VKJA 5LA6E 2CXDA 3TKLB 3ZCIA 3EVYA 4HKAA 4WBOA 2P9BA 2Q9QC 5LGUB 3K8PC 3OYXA 3MACA 5FY1A 1Y64B 1G8XA 4NUUA 3RX6A 4KUMB 3CQCB 3OBVE 5FMNA 3N9OA 5KMGP 5KDMC 1UX4A 1LVFA 1IZNB 3B57A 2WAUA 5J2UE 5ADXL 3ZEFB 4OFZA 2QA7A 2D2SA 3ZLIA 4YJ3E 3Q5WA 5AFUL 2Q9QA 2VK9A 3KV9A 3ETUA 5BMVE 1LRZA 4QXHB 2XAFB 1BR2A 1MMNA 2LT3A 2N1GA 3Q2MA 2H7VC 2V7KA 1NAFA 3SRZA 1YW0A 3U78A 4EZ4A 2NWBA 2ODUA 1HX8A 3O4XE 3V5SA 4UVCB 4YLHA 3BQLA 2CWYA 4BJMA 3F57A 3VKGA 2NW9A 4BAYB 3K3NA 2ACXA 3OYZA 3R84B 3DJBA 1S35A 2H3RA 4H63V 4P0BA 3KV6A 3LK2B 1HS7A 3UUXB 3RYFE 3HKDE 2WM9A 5FXVA 2CE7A 3PU3A 3I0QA 4DO0A 3ZCJA 3F2EA 1G73A 1U4QA 2MYSA 4OHFA 2V7MA 3WAJA 4DMVA 4X1KE 2YK0A 3PTRB 2KWIB 3ZMZB 1ZKEA 2A72A 4AQGA 2L9QA 2XQYA 4QXBB 3LK42 4ISTA 5JDMA 3ZMTB 4M1PA 2MTQA 3ZYLA 4P0AA 2C5KT 2EHOC 3SS1A 2X9HA 5IYZE 2DWGA 5LGNB 1B7TA 4E7ZA 4J2CA 3I9YA 1FIOA 1SA0E 2WMOA 2PG8A 5HXSA 2J1DG 3MZKB 2ZLYA 3HKBE 2XASB 3D0TA 2E9XB 2X0LB 4WW0A 4ZI3D 4QHOA 3O1IA 2PFVA 1HG2A 3HA4A 4O2BE 3NBXX 1ZEEA 3AA6B 1FMWA 3IEEA 2EHOA 1BR4A 2X67A 3RC3A 3WI3A 3IHRA 3KINB 4O2AE 2W63A 4PNIA 4AKRB 4UVAB 2BVMA 4MBQA 3RPUA 4IE0A 3A5XA 4CXWA 3PUGA 2E9XD 2NOXA 5HYAA 4ZI7E 5LGTB 2LE8A 4ZI3C 3GMIA 1ZV4X 4IGUA 3W15B 3N9MA 4U72A 4KMCA 4JEHB 2KINB 2ZM0A 2XAHB 4QX8B 4IE6A 3K3QC 3H3AA 5LBQB 2V7LA 3CMLA 2KMFA 4G2AA 3K3OA 1IJ6A 1HCIA 3IBPA 2N2NA 4ASKA 4DMWA 4MHCA 3ZC1A 5JQGE 3C4XA 2V7JA 3C4WA 2XHEB 4DBRA 2VB6A 2PBIA 3AA1B 2JJ9A 5DABA 1KNZA 3AA0B 5JREA 1HFAA 3AA7B 5FXXA 5LHIB 5FXZA 3FXEB 3S4UA 2GK9A 3C50A 2BZBA 4PK4A 5JRCB 1AJ3A 3CX7B 3L09A 3BQIA 5M4YA 3GWHA 4AKIA 4TN7B 2W0GA 5HXHA 4TV9E 4TZ4C 3ESLA 4H9QC 2E9XA 5H6RB 3P8CD 3CWZB 4C90A 4CXYA 4F6RC 3T8OA 4JEUB 3PUAA 3SOLA 2E8IA 4GK0E 2PJQA 4I50E 4ISSA 3NZPA 4E7SA 5HXEA 2JQQA 2M67A 3N2OA 2RA1A 3EUHA 4EXTA 2JPFA 3Q5XA 2EHOB 2X51A 2YINA 5LBMA 4K0UA 2C0SA 1UCUA 5FY7A 3RYHE 3VKHA 3J7Yq 3KFWX 4MALA 5C8YE 3I1AA 5F8PA 2C5JA 3RH3A 4BA9A 3CVRA 4HTEA 4KBMB 2WMNA 1MMGA 2W61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNX A;  4JEU B;  1S94 A;  3LG7 A;  1BR0 A;  2XHE B;  1EZ3 A;  1FEW A;  5LG4 A;  1FIO A;  4TX5 A;  4JEH B;  5M4Y A;  1HS7 A;  1G73 A;  3C98 B; 
#chains in the Genus database with same CATH topology
 1WRD A;  5HAX A;  3FB2 A;  5FXW A;  2L3L A;  2NW8 A;  2LJL A;  2BS4 A;  2X9X A;  2MOZ A;  3QB5 A;  2CPT A;  4UF0 B;  3CQG B;  5DJQ C;  4UR9 A;  2RPA A;  2XJ7 A;  1IBM T;  5CGM A;  4ZHQ E;  4B3M T;  4LF6 T;  1MMA A;  4B3T T;  3ETV A;  4QH1 A;  2XQ6 A;  4A56 A;  2FBW A;  4DBQ A;  1OED C;  3KV4 A;  2NR4 A;  2XAJ B;  1LVK A;  2JRK A;  3N2K E;  3O1J A;  5LOV E;  4UEM A;  5AQJ B;  1SE7 A;  1XNQ T;  4I55 E;  1OED A;  4H9P C;  4IDZ A;  3CPZ A;  3MJX A;  2QYW A;  4DND A;  3RC8 A;  2JMK A;  5A1L A;  4B3S T;  4LF7 T;  4QXC B;  3ZN1 B;  2V1D B;  2AE9 A;  3UQ4 A;  4WYV A;  1T72 A;  4X1Y E;  4DVD A;  1VOM A;  1YXR A;  5AQG B;  1W0B A;  2BG9 C;  3ZYM A;  3RRW A;  4EB6 E;  1X9B A;  4A98 A;  3IF8 B;  4NIQ A;  2IW5 B;  2V6X A;  2WWV A;  2CBJ A;  4JI8 T;  1Z0P A;  4LFC T;  4AIS A;  1FEW A;  2BG9 A;  1XNR T;  1M7K A;  2RP4 A;  3DP7 A;  2D0U A;  4HEA A;  4PW8 A;  5JR9 B;  2LSJ A;  3H3M A;  3NVO A;  2CRB A;  2CCQ A;  1YQ4 A;  3UUN A;  2CM0 A;  3RIA A;  3E08 A;  2CXF A;  3E22 E;  3L3P A;  4HFD A;  1YQ3 A;  4AKL A;  2C5I T;  5L3B B;  4O4I E;  2MPK A;  4WBN E;  3UQ7 A;  3ANW A;  2K3W A;  4Z91 A;  2W67 A;  2ZMA A;  4HE8 A;  2M6B A;  3HKE E;  2CLY B;  2FJE A;  4ERR A;  1LKX A;  3SFD A;  2I59 A;  4EAH A;  3N9L A;  2YU2 A;  4DID B;  4JLE A;  4HFH A;  2LHN A;  5AQQ B;  4CI1 B;  4KHP T;  1EZ3 A;  3ZST A;  4U74 A;  4EED A;  4AKH A;  3G06 A;  2W62 A;  4QX7 B;  4QWN B;  5ABG A;  5KXJ A;  3PUX F;  4AI6 A;  4PFO A;  2KWH A;  4FI5 A;  5F5W A;  1W09 A;  3ONX A;  4IE5 A;  3CKD A;  2KLQ A;  4ZZC A;  4IIJ E;  1ZP0 A;  2E5L T;  2X66 A;  3NZQ A;  1VCS A;  4V1A v;  3X1D A;  4PAG A;  3I9W A;  3F31 A;  4C91 A;  4LF4 T;  4AKG A;  3AXJ A;  4XZC A;  4AXP A;  2Q9Q D;  3PE0 A;  2Y48 B;  2XM2 A;  2F4V T;  2D0T A;  2E9X C;  5L3C B;  4JI0 T;  4OX9 T;  4KP3 C;  3TKL B;  4HFC A;  3RQU A;  1M62 A;  3JCF A;  3K8P C;  1G8X A;  4NUU A;  4KUM B;  5ABE A;  5KDM C;  1UX4 A;  3PUW F;  1LVF A;  2JQ9 A;  4DR7 T;  2CHO A;  3VR9 A;  4OFZ A;  2D2S A;  3ZLI A;  3Q5D A;  4YTN A;  4B3R T;  2XAF B;  2LT3 A;  1UK5 A;  2H7V C;  3EAM A;  2UXC T;  4EZ4 A;  4F8H A;  3OYZ A;  2J47 A;  3UUX B;  1GQE A;  2LRK A;  2WM9 A;  3I0Q A;  4DR5 T;  3ZCJ A;  3TLU A;  1G73 A;  4X1K E;  3PTR B;  1ZKE A;  3PUY F;  1XDP A;  4M1P A;  2MTQ A;  2UUB T;  4P0A A;  1N34 T;  3I9Y A;  1SA0 E;  2WMO A;  3AE1 A;  5HXS A;  3MZK B;  2XAS B;  4ZI3 D;  4WW0 A;  1WFD A;  3O1I A;  3RC3 A;  2J62 A;  3RPU A;  3ONL C;  4CXW A;  3PUG A;  2E9X D;  4U2Y A;  2LE8 A;  1ZV4 X;  3W15 B;  5FVL A;  3SFE A;  3K3Q C;  2KMF A;  4G2A A;  5CJ5 A;  3K3O A;  1HCI A;  3IBP A;  5JQG E;  3C4W A;  4YY3 T;  2PBI A;  3QB5 K;  1KNZ A;  5AQH B;  5FXX A;  4COF A;  5FXZ A;  5JRC B;  2BZB A;  5M4Y A;  4TN7 B;  2W0G A;  3ZT5 A;  5HXH A;  4TV9 E;  2A9U A;  4JI3 T;  3CWZ B;  4F6R C;  4DV0 T;  4X66 T;  5ABF A;  2PJQ A;  5AQT B;  5HXE A;  2JQQ A;  2M67 A;  1JNZ A;  3OTO T;  2E2A A;  3PJA A;  4EXT A;  2EHO B;  2VUR A;  4K0K T;  1HNX T;  5FY7 A;  3RIU A;  3I1A A;  3CVR A;  4HTE A;  1MMG A;  3U3I A;  1D0Z A;  2BVL A;  2XTL A;  2H89 A;  5L3F B;  2KZ7 B;  5JH7 E;  2NTY A;  3T1Y T;  5LP6 E;  3ZJ1 A;  5FYM A;  1V9D A;  2WB5 A;  2R6G F;  4IDP A;  3FZL B;  2CA5 A;  4KX6 A;  2LOP A;  3N9P A;  2V7I A;  2D9D A;  2XZE A;  3RIF A;  3TLS A;  3RKO A;  3A8Y C;  3ZMS B;  3UTK A;  3ZJ2 A;  3QUJ A;  3RKG A;  3LJC A;  2YDS A;  2VKD A;  2XSB A;  3SWH A;  3PU8 A;  1XMO T;  2DLR A;  1VCT A;  4HFI A;  4PK6 A;  3ZC0 A;  2QGS A;  2CLY C;  3O1H A;  4LMK A;  4HWH A;  3DTO A;  3AB3 B;  3ZPO A;  3RYI E;  1Z8U A;  5JDG A;  5DQW A;  5AQL B;  5JVD E;  2MBG A;  2XQ3 A;  3P4P A;  3B13 A;  5LCY A;  4GYS A;  5HWX A;  2VKO A;  2VKH A;  4TUY E;  4O4L E;  1H7C A;  3HKC E;  2DI4 A;  2XSA A;  3AE4 A;  4JI4 T;  1MND A;  2YDR A;  2V26 A;  3PJA J;  3PUS A;  4ZI2 C;  2HH7 A;  4GOU A;  2X68 A;  4TWF A;  3EDV A;  1HR0 T;  2CBI A;  4I4T E;  2DL1 A;  1J5W A;  2LEH A;  5ABH A;  2ZM2 A;  2WZI A;  3P50 A;  3ZMV B;  5HEG A;  3KV5 A;  3AEF A;  2YEV C;  2LSY A;  4ILA A;  4WNK A;  3P4W A;  5HXR A;  3PDY A;  2L8K A;  2CHN A;  1O3X A;  1QUU A;  5FNV E;  2LM9 A;  3CQX C;  4MFR A;  1MMD A;  4ZS3 A;  2VVS A;  2Y6X A;  2XQ7 A;  4EYY R;  2JMH A;  3O9X A;  3V5U A;  2ACZ A;  2NTX A;  1XZY A;  3P4R A;  4IDN A;  4ILU A;  5DQV A;  2G0U A;  3MK7 C;  1QSD A;  4YFS A;  1T8B A;  4NXM T;  3WAK A;  5LNK A;  4TWD A;  1WLX A;  2UUC T;  4X20 E;  4O4H E;  3EI0 A;  2VQF T;  3OJA A;  3NRY A;  4XBF B;  1MIW A;  2YKS A;  2VL8 A;  4ANJ A;  4Q25 A;  2XPK A;  2Z6E A;  4UEL A;  4ZI2 D;  3L8R A;  5L3G B;  4KHZ F;  5L4H A;  2DWK A;  2BDE A;  4UVB B;  4IE7 A;  2V5C A;  3RGL A;  1WYC A;  4N78 D;  4PJJ A;  5LXT E;  4PJL A;  5TAO A;  3N2G E;  2X9Y A;  4PJM A;  4TX5 A;  3AE6 A;  3BQK A;  1YKH B;  1S94 A;  5LYJ E;  1UX5 A;  2LSG A;  2IC6 A;  4NPP A;  2VKJ A;  5LA6 E;  2I6H A;  1FJG T;  2P9B A;  2Q9Q C;  4HWC A;  1XMQ T;  2FUP A;  3MAC A;  4LF5 T;  5FMN A;  3OBV E;  3N9O A;  5KMG P;  5BR8 T;  3B57 A;  5J2U E;  5ADX L;  3ZEF B;  4YXD A;  1N32 T;  4YJ3 E;  4YSX A;  2Q9Q A;  2VK9 A;  3ETU A;  2BS3 A;  5BMV E;  1LRZ A;  4QXH B;  1MMN A;  1IBK T;  3FZK B;  3TLV A;  2V7K A;  4ZEY A;  2NWB A;  3O4X E;  2FJB A;  3F57 A;  2FJD A;  3K3N A;  1S35 A;  3AE2 A;  3UU6 A;  4P0B A;  2WDQ A;  3HKD E;  2YDQ A;  3CK6 A;  3ABV A;  3VRA A;  4DO0 A;  4U7I A;  3F2E A;  3OPC A;  3TLW A;  1U4Q A;  4OHF A;  4DMV A;  4DR4 T;  5LMN T;  4LML A;  5FVK A;  2XM1 A;  2XQY A;  3JAF A;  3ZYL A;  2IML A;  2C5K T;  2EHO C;  1HNZ T;  2X9H A;  1B7T A;  4U31 A;  4EGW A;  2PG8 A;  2ZLY A;  3JAD A;  2X0L B;  1JNR A;  4X62 T;  1HG2 A;  3IEE A;  1FMW A;  3JAE A;  2EHO A;  2LRL A;  1BR4 A;  2X67 A;  2HN2 A;  3WI3 A;  3IHR A;  4PNI A;  2BKP A;  4HWD A;  4YSZ A;  4ZI7 E;  3NWI A;  4ZI3 C;  1KFY A;  4Z90 A;  5HEO A;  2KIN B;  4QX8 B;  3ZSS A;  4LMJ A;  3H3A A;  2N2N A;  4MHC A;  3UU5 A;  3AE5 A;  2V7J A;  2WDR A;  2VB6 A;  2BBJ A;  3AA0 B;  2WS3 A;  4EV6 A;  3FXE B;  3IA3 A;  3C50 A;  3BQI A;  2LLY A;  4AKI A;  4H9Q C;  2VL0 A;  2E9X A;  4GKK T;  4CXY A;  3T8O A;  2JQH A;  1ZOY A;  3PUA A;  3SOL A;  1L0V A;  1HX1 B;  3RQW A;  3N2O A;  2RA1 A;  4IRE A;  3Q5X A;  2X51 A;  2YIN A;  4K0U A;  3VKH A;  2OLT A;  3KFW X;  5F8P A;  4KBM B;  2W61 A;  4JBW F;  3T1H T;  3EHZ A;  2EHO D;  3UUL A;  5EK4 A;  5JTG A;  5CB4 E;  5ETW A;  4HFE A;  3Q9D A;  5HXC A;  2UXX B;  4G63 A;  4H9N C;  3PV0 F;  5LHG B;  2UUA T;  2SPC A;  3FBZ A;  1YD8 G;  4WZX A;  3I0O A;  4IDQ A;  1E2A A;  4GIW A;  4L9I A;  5AQV B;  4XAX B;  4EYU A;  4AIU A;  5LJN A;  2M6I A;  4MLK A;  4EIW A;  2KXP B;  4O4J E;  3RLF F;  4QH5 A;  2IC9 A;  5CA0 E;  1OWA A;  3C98 B;  2DNX A;  3J9X 1;  5IUX A;  3CIR A;  3JC6 C;  1QLB A;  4CI3 B;  2ES0 A;  2V6Y B;  3LSV A;  2B1E A;  3BK9 A;  4HFB A;  3FHN A;  4OK0 A;  3UUM A;  3CX8 B;  2BG9 B;  2UXD T;  3N5L A;  3UU8 A;  2X9W A;  1HF8 A;  2IHR 1;  3LK3 B;  5AQK B;  5FL1 A;  5HEJ A;  4UF0 A;  2X0H A;  1BR0 A;  3LDQ B;  5HEU A;  4DV4 T;  3ZN0 B;  2OV9 A;  1T7S A;  3ANW B;  2CEA A;  3TLT A;  4PK5 A;  5FY0 A;  1UGO A;  3LBX B;  2K9A A;  2E5V A;  4H9S E;  2A3D A;  1J1J A;  2W00 A;  2ZM8 A;  2LM2 A;  2DCF A;  3LFM A;  4OYK A;  2YN6 A;  3QC9 A;  5EK2 A;  4UXN B;  3ONJ A;  3PUZ F;  3A7M A;  3NRX A;  4EOZ B;  3AVS A;  2HHH T;  2K5B B;  2WZH A;  2XAQ B;  1D0X A;  3H37 A;  3NKZ A;  1D1B A;  1MIV A;  4P09 A;  2HPJ A;  5AQS B;  3EAB A;  5L3E B;  4Z8X A;  1SHZ C;  5KX5 E;  3GA8 A;  2ODV A;  4H9O C;  2LHR A;  3MKD A;  2XQ9 A;  2CWO A;  3UU4 A;  4CQI A;  5L2L A;  4ADZ A;  2WBL A;  3AEA A;  3E0Z A;  2IDO B;  4AQF C;  3UT5 E;  2IAK A;  3AXJ B;  1OXZ A;  2CMR A;  4ILB A;  4TV8 E;  3KBT A;  2J4G A;  3JC6 D;  4IL4 A;  2YU1 A;  3GN5 B;  4JUY A;  5JDQ A;  4LFB T;  5JR9 C;  3VU7 H;  2DHR A;  2K24 A;  4PJN A;  2MAW A;  3AAI A;  4IE4 A;  3FBL A;  4AQF A;  2N9D A;  5HWY A;  4TWH A;  4IHJ E;  4ZZB A;  4OYJ A;  1I94 T;  1IJ5 A;  3AVR A;  4LF8 T;  4HFV A;  5EK3 A;  5JR9 A;  3QOF A;  3PUR A;  1D1C A;  3KDS E;  3UU3 A;  3ZT6 A;  2KND A;  5J2T E;  2H7O A;  1D0Y A;  2XUE A;  4ZOL E;  2NP9 A;  1IBL T;  4U7Y A;  4YJ2 E;  5GON E;  1SUM B;  5LHH B;  4DR3 T;  3FZF B;  4DV2 T;  5HCM A;  3MA9 A;  5AQM B;  4BJN A;  3AAE B;  3UFE A;  2JIW A;  2D5U A;  4JI7 T;  1Y01 A;  4O8S A;  1E7P A;  3C4Z A;  2LSI A;  4HKA A;  4HWF A;  5LGU B;  2QVA A;  5AQU B;  2BS2 A;  2WCA A;  2WAU A;  3QNU A;  2X0Y A;  2QA7 A;  3KV9 A;  2WU2 A;  1BR2 A;  3UUB A;  1XDO A;  1YW0 A;  2ODU A;  4UVC B;  4YLH A;  3BQL A;  2CWY A;  2XQ8 A;  4BAY B;  3R84 B;  3KV6 A;  3RYF E;  4DV7 T;  3PU3 A;  4TNV A;  3WAJ A;  3AEE A;  2YK0 A;  3ZMZ B;  4QXB B;  5JDM A;  5IYZ E;  2DWG A;  4E7Z A;  1FIO A;  4IDO A;  2W2U A;  2J1D G;  3HKB E;  2WY2 A;  2PFV A;  3HA4 A;  3NBX X;  3AA6 B;  5FL0 A;  5ABF B;  3KIN B;  3M3Z B;  2W63 A;  4AKR B;  4UVA B;  2BVM A;  4MBQ A;  4DUY T;  3PUV F;  4IE0 A;  3A5X A;  1KNP A;  2NOX A;  5HYA A;  2WU5 A;  2XY8 B;  5AQP B;  4U72 A;  4KMC A;  4HWI B;  4IE6 A;  3AEG A;  4U3C A;  5LBQ B;  3CML A;  2IUB A;  1WCR A;  1IJ6 A;  4ASK A;  4DMW A;  4EEB A;  3ZC1 A;  1DU2 A;  4DBR A;  5DAB A;  4DR1 T;  1HFA A;  5LHI B;  3S4U A;  2GK9 A;  1AJ3 A;  3CX7 B;  3L09 A;  3GWH A;  4TZ4 C;  4JI1 T;  2V8S V;  3L39 A;  3P8C D;  5H6R B;  4JEU B;  1W0A A;  1J5E T;  2E8I A;  4GK0 E;  4U2Z A;  3NZP A;  4E7S A;  3AE9 A;  4ILC A;  5LBM A;  2C0S A;  2LKH A;  2V6Y A;  3RYH E;  4MAL A;  5C8Y E;  2C5J A;  3RH3 A;  4BA9 A;  5AQI B;  2WMN A;  3ZYK A;  5IHY A;  3HL6 A;  4JI5 T;  5JDF A;  5LG4 A;  3HI2 A;  4DV3 T;  3KVB A;  1I6Z A;  3P4Q A;  5JDL A;  3MXZ A;  3P7I A;  4X5T A;  4HN9 A;  3OKQ A;  2WSS V;  1WR0 A;  2BKN A;  5JRC A;  2XQA A;  1KNR A;  4I43 B;  3LBX A;  1MNE A;  4P1N A;  3AEB A;  1E1H B;  1X79 A;  2I0M A;  1BR1 A;  1HTJ F;  1UUS A;  4YTM A;  5J1G A;  4YHH T;  1KK7 A;  2A2F X;  5F3J A;  4GKJ T;  5C3J A;  4JI2 T;  2K48 A;  4QKN A;  1NEN A;  3EDU A;  2BBH A;  2HPL A;  4TNW A;  1U5P A;  4DV1 T;  2WP9 A;  2NW7 A;  4X1I E;  4ZXL A;  3N9N A;  3AAA B;  5FP3 A;  2AXD S;  2IIU A;  2CXL A;  1WR6 A;  3QK6 A;  5CA1 E;  4ZS2 A;  1MIY A;  1XWM A;  4CZZ B;  3P4S A;  1CUN A;  4DV5 T;  3GN5 A;  3FXD B;  5AQN B;  2VWA A;  3PUQ A;  5CFB A;  2UXN B;  4UV8 B;  3N9Q A;  1HG5 A;  1US7 B;  5JDN A;  2KT9 A;  2VAS A;  2LOS A;  4I0U A;  1VRB A;  2QRX A;  3AED A;  4YTP A;  4GYR A;  5AQR B;  3RYC E;  5L3D B;  4H9R C;  2LSK A;  3ZKR A;  2XQ5 A;  5JDH A;  1D1A A;  4UIG A;  4EZH A;  4IT4 A;  3ZT7 A;  2WWU A;  1OED B;  3B5M A;  2OA5 A;  5LMU T;  2ZM6 T;  3ZMU B;  4NUV A;  3VHL A;  1WYB A;  1OED E;  3UFG A;  1N33 T;  3CX6 B;  4UV9 B;  2WQY A;  4HGA A;  5HEH A;  4GK5 E;  3Q5E A;  3AEC A;  4YSY A;  5J0Z A;  1IAP A;  2W66 A;  4NXN T;  1NWM X;  4JV5 T;  4JI6 T;  3LG7 A;  1N36 T;  5H6Q B;  5LJM A;  2W4X A;  3KVA A;  4L5G A;  3HR0 A;  4U33 A;  2B76 A;  3R6N A;  3FZM B;  1T98 A;  4DUZ T;  4PFP A;  5IWA T;  1ZHC A;  4YHJ A;  2Y8D A;  3C51 A;  5AQO B;  1R8I A;  2XAG B;  2Q9Q B;  1YKE B;  1FMV A;  3M65 A;  2V5D A;  4CXX A;  4FJO A;  2BG9 E;  4DR6 T;  2XQ4 A;  4LF9 T;  5EZY E;  3C64 A;  5E0O A;  4L0R A;  3RRC A;  4B6X A;  4H63 H;  4A97 A;  4CN6 A;  2PTF A;  3KBU A;  4CI2 B;  1KF6 A;  2CXD A;  3ZCI A;  4DV6 T;  3EVY A;  4WBO A;  4IL9 A;  3OYX A;  5FY1 A;  1Y64 B;  3K1S A;  3RX6 A;  3CQC B;  4X65 T;  1IZN B;  3VR8 A;  3AE3 A;  3RIU C;  3Q5W A;  5AFU L;  2UU9 T;  3RF1 A;  2YOE A;  4A5X A;  2N1G A;  3Q2M A;  5LG3 A;  1NAF A;  3SRZ A;  5LB7 B;  3U78 A;  1HX8 A;  3V5S A;  2BKO A;  4BJM A;  3VKG A;  2UXB T;  2NW9 A;  2ACX A;  3OVU A;  3DJB A;  2H3R A;  4H63 V;  4JYA T;  3LK2 B;  1HS7 A;  1UUR A;  5FXV A;  2CE7 A;  5C2T A;  2MYS A;  2V7M A;  3AE8 A;  2KWI B;  2A72 A;  4AQG A;  1CHU A;  2L9Q A;  3LK4 2;  4IST A;  3ZMT B;  3SS1 A;  2WDV A;  5LGN B;  4J2C A;  3D0T A;  2E9X B;  4QHO A;  4O2B E;  1ZEE A;  5AQF B;  4CN4 A;  4O2A E;  4QH4 A;  2VQE T;  5LGT B;  5HCJ A;  4X64 T;  3GMI A;  3AE7 A;  2FJA A;  4IGU A;  3N9M A;  2KSR A;  4JEH B;  2ZM0 A;  2XAH B;  3VRB A;  1W9R A;  4LFA T;  2V7L A;  2H88 A;  3FZH B;  4YT0 A;  3C4X A;  2XHE B;  3AA1 B;  2VVN A;  2JJ9 A;  5FKY A;  5JRE A;  3AA7 B;  4PK4 A;  3ESL A;  1HNW T;  4DR2 T;  4C90 A;  3RI5 A;  1NEK A;  5L4E A;  5L47 A;  4I50 E;  4ISS A;  3RHW A;  2LKG A;  1KEY A;  3EUH A;  2JPF A;  4CN1 A;  1UCU A;  4AQY T;  3J7Y q;  2HN1 A;  2JQK A;  4KI0 F; 
#chains in the Genus database with same CATH homology
 1WRD A;  3ZYK A;  5IHY A;  3HL6 A;  2EHO D;  3U3I A;  5JDF A;  1D0Z A;  5LG4 A;  3UUL A;  5EK4 A;  2BVL A;  2XTL A;  5CB4 E;  3HI2 A;  5ETW A;  5L3F B;  2KZ7 B;  3KVB A;  5HAX A;  5HXC A;  3Q9D A;  5JH7 E;  2UXX B;  5JDL A;  3FB2 A;  2NTY A;  3MXZ A;  2L3L A;  2NW8 A;  3P7I A;  4G63 A;  4H9N C;  4HN9 A;  5FXW A;  2LJL A;  2WSS V;  3OKQ A;  5FYM A;  3ZJ1 A;  5LP6 E;  5LHG B;  1V9D A;  2X9X A;  5JRC A;  2CA5 A;  2MOZ A;  4UF0 B;  3CQG B;  2LOP A;  5DJQ C;  3N9P A;  2SPC A;  4I43 B;  3LBX A;  2V7I A;  1MNE A;  4ZHQ E;  3FBZ A;  1MMA A;  1YD8 G;  3I0O A;  3ETV A;  4GIW A;  3RKO A;  4L9I A;  4XAX B;  4A56 A;  3ZMS B;  4EYU A;  1E1H B;  3UTK A;  1X79 A;  3ZJ2 A;  5LJN A;  4DBQ A;  4MLK A;  3QUJ A;  4EIW A;  3KV4 A;  3LJC A;  2KXP B;  4O4J E;  2XAJ B;  1LVK A;  1BR1 A;  2VKD A;  1HTJ F;  2IC9 A;  2JRK A;  5CA0 E;  3N2K E;  1OWA A;  3C98 B;  3O1J A;  2DNX A;  5LOV E;  4UEM A;  5J1G A;  3SWH A;  3PU8 A;  3J9X 1;  2DLR A;  1KK7 A;  2A2F X;  5F3J A;  3JC6 C;  4CI3 B;  2ES0 A;  4I55 E;  2B1E A;  4PK6 A;  3BK9 A;  3ZC0 A;  2QGS A;  3FHN A;  4H9P C;  4OK0 A;  2CLY C;  2K48 A;  4QKN A;  3UUM A;  3CX8 B;  3O1H A;  3EDU A;  2HPL A;  1U5P A;  3N5L A;  4IDZ A;  3CPZ A;  2X9W A;  3MJX A;  1HF8 A;  3DTO A;  2NW7 A;  3AB3 B;  3ZPO A;  3LK3 B;  4X1I E;  3RYI E;  4DND A;  3RC8 A;  2JMK A;  5JDG A;  5DQW A;  5JVD E;  5A1L A;  2MBG A;  3N9N A;  4UF0 A;  1BR0 A;  3AAA B;  3B13 A;  4QXC B;  3ZN1 B;  5FP3 A;  5LCY A;  3ZN0 B;  4GYS A;  5HWX A;  2VKO A;  2VKH A;  3ANW B;  2CEA A;  4TUY E;  2V1D B;  1WR6 A;  2CXL A;  4O4L E;  1H7C A;  3HKC E;  2DI4 A;  3QK6 A;  4ZS2 A;  5CA1 E;  4PK5 A;  1MIY A;  4CZZ B;  1MND A;  5FY0 A;  1CUN A;  2V26 A;  3GN5 A;  3LBX B;  3PUS A;  2K9A A;  4ZI2 C;  4X1Y E;  2HH7 A;  4DVD A;  1VOM A;  3FXD B;  2VWA A;  3PUQ A;  4GOU A;  2UXN B;  4H9S E;  4UV8 B;  3N9Q A;  2X68 A;  1HG5 A;  2A3D A;  2W00 A;  1US7 B;  5JDN A;  2ZM8 A;  3EDV A;  2DCF A;  4I4T E;  3LFM A;  2KT9 A;  2VAS A;  4OYK A;  3ZYM A;  2LOS A;  1VRB A;  3RRW A;  4EB6 E;  3QC9 A;  5EK2 A;  4GYR A;  3RYC E;  4UXN B;  5L3D B;  4H9R C;  2LSK A;  2LEH A;  3IF8 B;  2ZM2 A;  3NRX A;  2IW5 B;  4EOZ B;  3AVS A;  3ZMV B;  2K5B B;  1Z0P A;  3KV5 A;  5JDH A;  2YEV C;  2LSY A;  1D1A A;  4UIG A;  4EZH A;  1FEW A;  4WNK A;  2XAQ B;  2WWU A;  2RP4 A;  3DP7 A;  4HEA A;  1D0X A;  2D0U A;  4PW8 A;  5HXR A;  3H37 A;  5JR9 B;  3PDY A;  1D1B A;  1MIV A;  2LSJ A;  2HPJ A;  4P09 A;  2OA5 A;  5L3E B;  4Z8X A;  2CCQ A;  3UUN A;  2CM0 A;  2L8K A;  1SHZ C;  5KX5 E;  3GA8 A;  2ODV A;  3E08 A;  2CXF A;  3ZMU B;  4H9O C;  3E22 E;  3L3P A;  4AKL A;  2LHR A;  3MKD A;  1O3X A;  1QUU A;  5FNV E;  2C5I T;  5L3B B;  2CWO A;  4O4I E;  4CQI A;  2LM9 A;  3CQX C;  4MFR A;  4NUV A;  3VHL A;  1WYB A;  1MMD A;  5L2L A;  4WBN E;  3ANW A;  4ZS3 A;  2Y6X A;  4ADZ A;  2WBL A;  4EYY R;  2JMH A;  2ZMA A;  3CX6 B;  4HE8 A;  4UV9 B;  4HGA A;  3E0Z A;  3HKE E;  2CLY B;  4GK5 E;  3O9X A;  4AQF C;  4ERR A;  3UT5 E;  2IAK A;  3V5U A;  1OXZ A;  1LKX A;  2CMR A;  4TV8 E;  2NTX A;  2I59 A;  3KBT A;  1IAP A;  4EAH A;  3N9L A;  4ILU A;  3JC6 D;  2YU1 A;  2YU2 A;  3GN5 B;  4JUY A;  5DQV A;  5JDQ A;  1NWM X;  2G0U A;  3MK7 C;  5JR9 C;  3LG7 A;  3VU7 H;  1QSD A;  2DHR A;  4YFS A;  4JLE A;  5H6Q B;  3WAK A;  2K24 A;  4PJN A;  5LNK A;  5LJM A;  3KVA A;  3AAI A;  4IE4 A;  2LHN A;  3FBL A;  4CI1 B;  4L5G A;  4AQF A;  1EZ3 A;  2N9D A;  5HWY A;  4U74 A;  4IHJ E;  4AKH A;  1WLX A;  3HR0 A;  4OYJ A;  2W62 A;  1IJ5 A;  4X20 E;  4O4H E;  4QX7 B;  3AVR A;  4QWN B;  3R6N A;  4HFV A;  5EK3 A;  5JR9 A;  4AI6 A;  1T98 A;  3OJA A;  3NRY A;  4PFO A;  3PUR A;  4PFP A;  2KWH A;  4FI5 A;  1ZHC A;  4XBF B;  1MIW A;  3ONX A;  4YHJ A;  4IE5 A;  2Y8D A;  1D1C A;  3C51 A;  3KDS E;  2VL8 A;  4ANJ A;  3CKD A;  2KLQ A;  2XAG B;  2KND A;  2Q9Q B;  5J2T E;  1YKE B;  4IIJ E;  2Z6E A;  4UEL A;  1FMV A;  3M65 A;  2H7O A;  1D0Y A;  2XUE A;  4ZI2 D;  2X66 A;  5L3G B;  3NZQ A;  4ZOL E;  4CXX A;  4V1A v;  2NP9 A;  4FJO A;  4PAG A;  4YJ2 E;  2DWK A;  2BDE A;  3I9W A;  4IE7 A;  3F31 A;  4UVB B;  5GON E;  4C91 A;  1WYC A;  4N78 D;  4PJJ A;  5EZY E;  5LXT E;  3C64 A;  4AKG A;  5E0O A;  4PJL A;  5TAO A;  5LHH B;  4XZC A;  4AXP A;  2Q9Q D;  3N2G E;  2X9Y A;  3PE0 A;  4L0R A;  4PJM A;  2Y48 B;  4TX5 A;  3RRC A;  3MA9 A;  4B6X A;  4H63 H;  4BJN A;  3AAE B;  3BQK A;  1YKH B;  1S94 A;  2D0T A;  2E9X C;  2D5U A;  3UFE A;  5L3C B;  4O8S A;  5LYJ E;  1UX5 A;  3KBU A;  2LSG A;  3C4Z A;  2LSI A;  2IC6 A;  4KP3 C;  4CI2 B;  2VKJ A;  5LA6 E;  2CXD A;  3TKL B;  3ZCI A;  3EVY A;  4HKA A;  4WBO A;  2P9B A;  2Q9Q C;  5LGU B;  3K8P C;  3OYX A;  3MAC A;  5FY1 A;  1Y64 B;  1G8X A;  4NUU A;  3RX6 A;  4KUM B;  3CQC B;  3OBV E;  5FMN A;  3N9O A;  5KMG P;  5KDM C;  1UX4 A;  1LVF A;  1IZN B;  3B57 A;  2WAU A;  5J2U E;  5ADX L;  3ZEF B;  4OFZ A;  2QA7 A;  2D2S A;  3ZLI A;  4YJ3 E;  3Q5W A;  5AFU L;  2Q9Q A;  2VK9 A;  3KV9 A;  3ETU A;  5BMV E;  1LRZ A;  4QXH B;  2XAF B;  1BR2 A;  1MMN A;  2LT3 A;  2N1G A;  3Q2M A;  2H7V C;  2V7K A;  1NAF A;  3SRZ A;  1YW0 A;  3U78 A;  4EZ4 A;  2NWB A;  2ODU A;  1HX8 A;  3O4X E;  3V5S A;  4UVC B;  4YLH A;  3BQL A;  2CWY A;  4BJM A;  3F57 A;  3VKG A;  2NW9 A;  4BAY B;  3K3N A;  2ACX A;  3OYZ A;  3R84 B;  3DJB A;  1S35 A;  2H3R A;  4H63 V;  4P0B A;  3KV6 A;  3LK2 B;  1HS7 A;  3UUX B;  3RYF E;  3HKD E;  2WM9 A;  5FXV A;  2CE7 A;  3PU3 A;  3I0Q A;  4DO0 A;  3ZCJ A;  3F2E A;  1G73 A;  1U4Q A;  2MYS A;  4OHF A;  2V7M A;  3WAJ A;  4DMV A;  4X1K E;  2YK0 A;  3PTR B;  2KWI B;  3ZMZ B;  1ZKE A;  2A72 A;  4AQG A;  2L9Q A;  2XQY A;  4QXB B;  3LK4 2;  4IST A;  5JDM A;  3ZMT B;  4M1P A;  2MTQ A;  3ZYL A;  4P0A A;  2C5K T;  2EHO C;  3SS1 A;  2X9H A;  5IYZ E;  2DWG A;  5LGN B;  1B7T A;  4E7Z A;  4J2C A;  3I9Y A;  1FIO A;  1SA0 E;  2WMO A;  2PG8 A;  5HXS A;  2J1D G;  3MZK B;  2ZLY A;  3HKB E;  2XAS B;  3D0T A;  2E9X B;  2X0L B;  4WW0 A;  4ZI3 D;  4QHO A;  3O1I A;  2PFV A;  1HG2 A;  3HA4 A;  4O2B E;  3NBX X;  1ZEE A;  3AA6 B;  1FMW A;  3IEE A;  2EHO A;  1BR4 A;  2X67 A;  3RC3 A;  3WI3 A;  3IHR A;  3KIN B;  4O2A E;  2W63 A;  4PNI A;  4AKR B;  4UVA B;  2BVM A;  4MBQ A;  3RPU A;  4IE0 A;  3A5X A;  4CXW A;  3PUG A;  2E9X D;  2NOX A;  5HYA A;  4ZI7 E;  5LGT B;  2LE8 A;  4ZI3 C;  3GMI A;  1ZV4 X;  4IGU A;  3W15 B;  3N9M A;  4U72 A;  4KMC A;  4JEH B;  2KIN B;  2ZM0 A;  2XAH B;  4QX8 B;  4IE6 A;  3K3Q C;  3H3A A;  5LBQ B;  2V7L A;  3CML A;  2KMF A;  4G2A A;  3K3O A;  1IJ6 A;  1HCI A;  3IBP A;  2N2N A;  4ASK A;  4DMW A;  4MHC A;  3ZC1 A;  5JQG E;  3C4X A;  2V7J A;  3C4W A;  2XHE B;  4DBR A;  2VB6 A;  2PBI A;  3AA1 B;  2JJ9 A;  5DAB A;  1KNZ A;  3AA0 B;  5JRE A;  1HFA A;  3AA7 B;  5FXX A;  5LHI B;  5FXZ A;  3FXE B;  3S4U A;  2GK9 A;  3C50 A;  2BZB A;  4PK4 A;  5JRC B;  1AJ3 A;  3CX7 B;  3L09 A;  3BQI A;  5M4Y A;  3GWH A;  4AKI A;  4TN7 B;  2W0G A;  5HXH A;  4TV9 E;  4TZ4 C;  3ESL A;  4H9Q C;  2E9X A;  5H6R B;  3P8C D;  3CWZ B;  4C90 A;  4CXY A;  4F6R C;  3T8O A;  4JEU B;  3PUA A;  3SOL A;  2E8I A;  4GK0 E;  2PJQ A;  4I50 E;  4ISS A;  3NZP A;  4E7S A;  5HXE A;  2JQQ A;  2M67 A;  3N2O A;  2RA1 A;  3EUH A;  4EXT A;  2JPF A;  3Q5X A;  2EHO B;  2X51 A;  2YIN A;  5LBM A;  4K0U A;  2C0S A;  1UCU A;  5FY7 A;  3RYH E;  3VKH A;  3J7Y q;  3KFW X;  4MAL A;  5C8Y E;  3I1A A;  5F8P A;  2C5J A;  3RH3 A;  4BA9 A;  3CVR A;  4HTE A;  4KBM B;  2WMN A;  1MMG A;  2W61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...