3KVBA

Structure of kiaa1718 jumonji domain in complex with n-oxalylglycine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
total genus 113
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kvbA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kvbA01
3LDBA 3NJYA 5FZ3A 2Q8DA 5FV3A 5FYVA 5FZHA 4AAPA 5A7PA 4D6SA 5FP4A 4D6QA 4URAA 4LITA 4CCNA 5FXZA 5FZ9A 4IGPA 3PURA 5A7SA 5A3NA 2YPDA 3K3NA 3UYJA 4QWNA 2XXZA 5FPVA 4ASKA 4V2WA 5FYUA 3PTRB 3AVRA 5FWEA 4LIUA 5FZCA 4Y3OA 5F2WA 5FY4A 2OT7A 4QX7A 5FUNA 3KV5A 4GD4A 3RVHA 4UF0A 3N9OA 2OX0A 3PUQA 5LWBA 5FZGA 4LIVA 5FYBA 2P5BA 2OQ7A 5FP8A 5FJHA 1VRBA 3KVBA 5FY8A 3LD8A 5F39A 5FYMA 5IVVA 3AL6A 4Y33A 5FP9A 5LW9A 4QXHA 4GAZA 5FZIA 2W2IA 2XUEA 5F2SA 5FPAA 5FXVA 3U4SA 4IGQA 4Y4RA 4V2VA 5FZ8A 4GJZA 5FPUA 2OQ6A 4QXBA 5LY1A 5A3PA 5FZOB 5FPBA 5FP3A 4XDPA 4CCOA 5A3TA 5FYIA 5IVCA 2PXJA 5FZAA 5FZ1A 2XDVA 5IVJA 5F3EA 3N9NA 5FZ7A 4CUGA 4CCLA 3PUSA 5FZ0A 5A3WA 5A7WB 4HONA 5F3CA 5FZBA 5A1LA 2GP3A 2Q8EA 4DIQA 5FUPA 5F37A 5FYHA 3PUAA 2XMLA 5F3IA 5A7WA 3DXTA 2WWUA 5F3GA 5FXXA 2YBKA 5LY2A 4QXCA 5FYYA 5FY5A 4AI9A 5FBJA 2YBSA 3KV6A 5FZOA 5FWJA 3K3OA 3OPTA 4QU1A 5FY9A 4LXLA 4QX8A 4BXFA 4CCKA 4TN7A 5KR7A 5FYCA 5FYSA 5FZ6A 5FXWA 5IWFA 5IVYA 5IVEA 5FZEA 2GP5A 5A7OA 5E6HA 5FZFA 5A80A 5F5AA 5FYTA 4CCJA 3DXUA 4BU2A 2YU2A 5IVBA 3N9QA 4EYUA 5ANQA 4BISA 5F32A 3PDQA 5F5IA 5FPLA 5FY7A 5F5CA 4D6RA 3U78A 4GJYA 3N9MA 5FYZA 4EZHA 2YBPA 5A7NA 3AVSA 3AL5A 5ISLA 4E4HA 5FZKA 4CSWA 3KV9A 3PU8A 4C8DA 3KV4A 3KVAA 4UF0B 5FP7A 3ZLIA 4HOOA 3OPWA 5A7QA 2YU1A 4DO0A 2Q8CA 3PU3A 5FY1A 5FJKA 5K4LA 2VD7A 4XDOA 5IW0A 2OS2A 5FZMA 4CCMA 5IVFA 2WWJA 4IGOA 5FY0A 5FZLA 3N9LA 5FZDA 5A1FA 5CEHA 3K2OA 4NUBA 4EZ4A 5FZ4A 3N9PA 3ZPOA
chains in the Genus database with same CATH superfamily
2AEZA 4ISTA 3D4KA 3ZN0B 4R9CA 5BPXA 2Q8DA 5A33B 1VBB2 1VBA3 3WD5A 3DJBA 3AEDA 1ULDA 1UOGA 5D2AA 4ZI3D 2DBNA 2VZTA 4CTEA 4J6GA 2V7MA 2VQET 3S5AA 3LDRA 1OPMA 4GKKT 2GZWA 4NO4A 1TME2 1YUDA 2Y38A 1O7FA 2KWIB 3AFKA 5JCTA 3WF1A 1AXYA 5A3NA 2VGDA 4QHZA 4EB6E 1JYNA 1L7LA 2RJ2A 2CXDA 3C98B 5CB4E 2YC2A 3MIFA 4UT5A 1M06G 5L3BB 5GZEA 4P9WA 4KH9A 2DVGA 1LGBA 4ARYA 3K3QC 3HR0A 2WNEA 4AEMA 4DOUA 4KGQA 3AXJB 5A70A 1PGL1 3WQ7A 3UL2A 1Q8VA 4YVSA 2IW5B 4XZPA 3DPRB 1LOEA 5FUNA 1OXZA 3ZOIA 4GD4A 3IM0A 3N9OA 4LLOA 2R061 3P4RA 2RDNA 3JUUA 1WLXA 3ZC1A 1IPKA 1CZTA 4NHLA 4PLMA 5F5QA 3ZN1B 1JBCA 5E88A 1CIWA 4I50E 4CP9A 1LB2A 4RS5B 1LRZA 2IMLA 4EIWA 5DUVA 1RUD1 1FV2A 4BH9A 5IVVA 1POV0 1GQGA 4LPLA 3IBMA 2HWD3 4HK8A 1PGSA 1V6OA 3K1SA 3CKDA 4BQ4A 2HWC2 2WZ8A 1ZYBA 5FPAA 1OH3A 2CPTA 1W8HA 2P2KA 2WSSV 2XY8B 2BEOA 3GJAA 4A4AA 1FIOA 1LAJA 3H1YA 1Z7S2 4M1PA 4MOAA 3FLRA 4KBBA 5T5LA 4LMLA 4QX8B 5JIUA 5JPNB 1IGOA 4OI2A 1VLNA 1W6QA 2RR12 2ZJCA 1JS9A 2ZEXA 4AFAA 3I2HA 1U0AA 4AHWA 2VNVA 2PXJA 3EBRA 5JR9A 4FXKB 1O3TA 4ZKTB 4AQYT 3INAA 1RXGA 1LJ7A 2Z4FA 3POEA 3V56A 3ZXFA 2JD4A 4N9HA 3RI9A 3QK6A 2E26A 3B93A 2WM9A 1C8NA 2ZPXA 4FOQA 4BHPA 3RIAA 4HETA 5HI0A 4BJ0A 5IFPA 1FMWA 3L2YA 3DKWA 1VJ2A 4OYUA 1MZ5A 3NKTA 1G9AA 4XFFA 4I3GA 4YSFA 3GYDA 2W9XA 3JZVA 1ONAA 1NLSA 1OKOA 4HWHA 4Q0PA 5FY9A 1WA6X 1QDOA 3WINE 3VBFA 4CDQC 5FXWA 2XQ5A 4JEUB 4PAGA 4OX9T 1E5RA 3BODA 3LF7A 4N90A 5LBEA 1FPN2 3AE5A 2C26A 2UWBA 4U74A 2Q30A 2YROA 3RYRA 1M7KA 1YYNA 4U31A 4ILBA 3MW3A 4M4RA 1W6OA 3LEMA 5HCMA 5GLTA 4Q4V1 1HIXA 2WFF1 3I3QA 5CFDA 5EJ1B 5L9RA 5K8SA 2MEV3 1HS7A 3WW4A 5HYAA 2DCYA 3CX7B 5C9AA 4HFDA 2EHOA 4V1Av 1FNZA 1LESA 2BWCA 2BG9A 2WFF2 3POWA 4AI2A 4CCEA 1OA2A 4D6RA 4D7SA 3ITQA 2UXNB 5EYXA 1DU3D 4YNIA 3VD9A 5CFDC 1AZDA 1B7TA 3SNMA 4E4HA 1ENXA 3N2OA 3C4XA 1FAYA 4Q4X3 2VURA 3FLPA 1LEMA 1FNYA 4AEDA 4P5YA 2WDRA 2CE7A 1V9U3 2V4VA 2X0HA 3MW2A 4DR6T 3VB9A 1OSGA 4LLFA 4DXRA 4X1IE 4IE6A 1KGYA 4QU2A 4DR3T 5ABEA 1M62A 3Q5DA 1JI6A 1UY3A 4NRPA 3VDBA 1HB2A 4M3CF 1RUG1 2VMHA 4GB31 5M4YA 4I30A 4YVSC 2EVXA 1SACA 1JUHA 4BOWA 3N9LA 1B35B 3UGGA 2PHTA 4Y24A 4OHYA 2ZS6B 3OGGA 4Y4YA 1DLCA 3EI0A 3M1HA 1Y64B 2HWE2 2Y6GA 2VAUA 3CIHA 3MI8A 5IWAT 1SHWB 1Y01A 3AXDA 3R05A 4OULA 2JG9A 5FLIA 3WNXA 1RUC3 3IIIA 1F4AA 4AAPA 5HEGA 4XCAA 2CHOA 5FO8B 2X0YA 1NE4A 2D3RA 2ERFA 3SHRA 2P3IA 1JNZA 4CEYB 5JMOA 3AE1A 2PHDA 2XONA 2WYSA 2ZBJA 3E97A 1AYN3 2ZGMA 5CFCC 1FX5A 4IGPA 4NOTA 4D7TA 2WCAA 4HGAA 3OUIA 1A8DA 1O8SA 4YW6A 4FOWA 2ZEWA 4UFHA 1GBGA 5LOVE 1D4M2 2GU9A 4DBRA 3POFA 2XKOA 1SLTA 3IDAA 3A0KA 2OPWA 4I2OA 4Y20B 1I5ZA 5J98B 4H9SE 4BMBA 4PK4A 5FY4A 3VDAA 4XURA 1LOCA 2XOMA 3ZFGA 2HH7A 2HHHT 4HPKA 5CFCB 1LOGA 3QCWA 3RNSA 1VBC1 4FTSA 5JOYA 4XJ8A 3RYHE 4GK5E 5LG4A 2DCTA 2WO3A 4AK3A 4QDRA 4IQPA 3M4FA 3ZVXA 3VD5A 1ZX5A 4AQGA 4H55A 1N1SA 4HT1T 3GMIA 2Y0IA 5FY8A 2RMU1 3IT8A 3PVOA 3IWZA 2EAKA 1HX8A 2W1UA 2XHNA 4BQYA 4Y33A 2LM9A 4XACA 3C50A 1AR63 4URTA 5T3NA 1MMGA 3VZJA 5DUUA 3UFGA 4D7YA 5FXVA 4QHBA 2I07B 2QKDA 4ISQA 1W9RA 3E08A 3TNPB 1J3QA 2WABA 1UUSA 3AZXA 2P4EA 1Z7S3 4XAXB 1O4ZA 2XB6C 2XLFA 4N8MA 4QXBA 1VBB1 4KI0F 1XBFA 1YFUA 3V5UA 1OBNA 3PMEA 5FZOB 3VL9A 3FZKB 1NCRA 4FOVA 5A3TA 2A7AA 4LE4A 1BBT1 3I9WA 1NX9A 2V6YB 5AVAA 5FZ1A 5K7PA 3K75B 4KU8A 1JHJA 3J9X1 3NAPA 4CUGA 2DUQA 1JZ8A 3MLLA 1C57A 3WQBA 3FL7A 1WKYA 3NQHA 1S2KA 3JQXA 2VG9A 4LHLA 4M3CB 4NHMA 3LFIA 2LSGA 1FPN1 2R16A 1NYWA 2BU9A 2NPIA 5FYHA 1JZ5A 5ERLA 3WG2A 1SFYA 3WCRA 1W6NB 4NPMA 4HVRA 4PDWB 5FXXA 1AUYA 1IG3A 3KQRA 5CADA 1QH7A 4FFFA 1YXWA 2ZOEB 4MGIE 1LECA 5JDLA 3K3OA 2IVJA 1F5JA 1OT5A 2BDRA 4QU1A 4YZ4A 1DGLA 3HN1A 2B9VA 1RMU2 2XL9A 2BJSA 4KG8A 4QQOA 5FAXA 5FYSA 3QC9A 2WQ8A 3UKVA 3ZYBA 3AE2A 4AVAA 1O59A 3S57A 3ACHA 4L99A 1BMV1 1J3RA 4Z07A 1HN1A 4UV8B 5DJQC 1N34T 4LFAT 1BYHA 4LBLA 2ZGKA 2WJSA 4FP3A 2CWYA 5EJZB 5LBCA 2CAUA 5EV7A 4QX5A 3ACIA 2QQUA 1IHMA 4GQ7A 5C8WA 3CIRA 4H7MA 3FBZA 2B42B 1GNHA 1NCQB 2VU9A 5FCCA 4ZXEA 4B4QA 5I0DA 3BTZA 1JOPA 3MKDA 4EZHA 4KWJA 5C70A 1YW0A 2RJLA 4YW1A 2AH2A 5FZKA 4DY3A 4LO7A 4IGUA 1NA1A 2FBEA 3P7IA 4D0QA 3TEZA 5C3QA 1VBE1 2A9UA 2VMCA 2YU1A 3M3OA 1TNRA 3Q8CA 1APNA 4QAWA 5FR3A 5LB7B 3WAJA 1EP0A 3NKGA 3AYEA 4M3CE 4QT6A 5H9QA 4AR2A 4BIFA 1T7SA 2RR13 2J1EA 4IETA 3ZMUB 2FJBA 1UMIA 2DURA 2V26A 5FOBB 5FZMA 2XQ7A 1DGRA 3KMHA 4ES9A 4B6XA 5AQPB 5JTGA 1NT0A 4K1ZA 5CG8A 1MIWA 2CHNA 4L8QA 3AB3B 3HKCE 2R6GF 3DUIA 4EZ4A 2GNTA 3BPSA 1AX1A 5DUXA 1DDLA 3NV4A 1QXPA 5F5WA 1K45A 4JQRA 3WXPA 2WNVA 1RVF1 2D5UA 5FIXA 2CXFA 4Y1UA 4CP0A 4DBQA 4PHZA 4EROA 2QUOA 4CVUA 2B4KA 1CAVB 4K20A 2N1GA 3AEEA 3Q5WA 2X09A 2D6NA 3JC6C 3LBXA 4U2YA 1WWYA 4MBQA 5AQOB 1S1AA 1UW8A 4E7ZA 2VCCA 3CF6E 3OBZA 4LBKA 5IK4A 3BQIA 4LMJA 4QH1A 1Q5OA 2KR2A 1UU5A 3KCCA 3MUY1 2W92A 3BALA 4IV3B 1KJLA 2JG8C 3A7QA 5LCWL 2WDQA 2C5IT 1GQHA 1GV9A 1RGSA 2G4IA 3RRCA 3I3MA 3WR0A 4Y3OA 4GMP3 5L3GB 2ZM6T 3IB3A 3TYJA 3O1JA 3MO4A 2TNFA 4E4SA 5FMOS 1BEV1 5AQQB 1KNPA 4U2ZA 3OVUA 1H4GA 1P8JA 2HWF1 4W6YA 3IKWA 4RSUA 4P9JA 4XBNA 3BUCA 2RM22 4K1YA 2P37A 3R4DB 4HLTA 4LBQB 3I3DA 1MS8A 1UL9A 1K5MA 2WBLA 3A8YC 4DUZT 1BLZA 4JC1A 5F39A 3NKZA 4X8PA 1RVF2 2YDEA 4CU8A 3WHTA 1AYM1 1IS5A 1RUH1 4MALA 5LW9A 4ZU4A 2WU2A 1DQ4A 2ORZA 5EQUA 5C4WB 3PLQA 1L0VA 4DNDA 3J7MA 5LP6E 1QWRA 5T5PA 1AL21 3RLFF 4IGQA 4Y4RA 5HAXA 5C4WC 5I93A 5AQGB 2AXDS 5B4XA 4Z82A 4HTEA 3RPQA 3VBRC 4BAYB 1UIKA 4RQPA 4FI5A 4NWVA 4CEYC 1VRH2 5C9AC 5CVRA 3JBG1 4PQ9A 3SLIA 1AR81 2LEHA 1H1MA 1ND3A 5DG2A 1VCTA 2YDSA 3ZCIA 4QKNA 1HX1B 3D8CA 3GF6A 4E8CA 4LA2A 1J58A 5FUPA 4ZHNA 1JNRA 4E9KA 3MACA 4LF7T 2ZTNA 4K21A 4MSVA 3RMXA 2AC1A 3ETPA 3WF0A 4MO3M 1WMDA 4AHYA 2DHRA 2GC0A 5HV0A 3H3AA 4ES8A 1XNQT 3C7GA 3P8CD 2YBSA 3TNQA 3CQXC 4ILUA 4JEHB 1GZ9A 1YEWA 4O2AE 4XUNA 3VKOA 3ILRA 4UBHA 4XJZA 4CDWB 4OI4A 5JR2A 1K5JA 2K2SA 5FMBA 1Y9MA 2VZPA 3N7KA 4MUVA 4Q0SA 3U10A 1UK5A 1CIYA 1W2NA 4N53B 4XJUA 2YU2A 1XNAA 1MQTA 4LBNA 4OVEA 4Q4Y2 5H6RB 2J42A 4QPWA 5ANQA 1AYM3 5KWRA 2J1DG 3A4UA 5JWPA 1ZHCA 1XDPA 2ZGUA 4XE9A 2CXLA 3CL1A 5CA1E 2ADDA 4QD2A 2KXPB 5E8AA 3G06A 4JYAT 1Z0HA 4IE7A 1AL23 1QJU3 2P3KA 1JH5A 3AVSA 3MA9A 3VU7H 2W39A 3AL5A 4TWTA 4XETA 5EFUA 5FK8A 2WZR3 4ZEYA 3T30A 5A6XA 1QHDA 4W50A 2IC6A 3RC8A 1BEV2 1ODNA 1GNZA 1PM4A 2V7IA 3OTFA 3A7MA 4LA3A 4WM7C 3J4UH 5F6KA 5BNNB 2XVLA 5I0SA 3ZT5A 3DGTA 2ZZJA 4I01A 4QXKA 1AR83 3GCXA 2HKXA 3NMBA 2AR6A 1SLAA 2JKXA 3ZFFB 4YM3A 4FOYA 4CDWC 5ACA1 1D1BA 2CA5A 3HI2A 2XR4A 4L0RA 4IGOA 4XUPA 4BLJA 1GZCA 1C5IA 1OPOA 4S2GA 4IW3A 4AFDA 1ENQA 2ZXQA 1OH4A 2QQPA 1RMU1 5J1GA 4AKRB 1X36A 2JE9A 5LA6E 3JD73 3ZX7A 5LY1A 5LGNB 3BI3A 1WUVA 2Q1MA 3EXUA 3V65A 1HW5A 2FD8A 2OKXA 2GH2A 5ABJA 2M6IA 5LBQB 2ZEZA 1X8EA 2QRXA 1OLQA 2WNUA 2UY8A 2WNUB 5A6YA 1W3VA 4N7IA 2ZKLA 4JI0T 1JZ7A 3UJQA 1DU2A 1NG0A 3KSCA 4O7XA 2X0LB 4U7YA 4IL4A 1H2MA 2RE9A 4IEOA 4CCNA 4YZ5A 4AOCA 3CNAA 3V64A 4N78D 3T2PA 3ZSJA 4P9GA 2DVDA 2YDQA 4Q4Y3 3VBHC 4A56A 1H9PA 4RHV2 4Q4W2 2WZEA 1QLBA 1YC61 5IFTA 5CA6A 4EJRA 3RRDA 5KBFA 3ZFFA 1GZWA 3GDBA 5FBZA 2WZR1 2PMWB 5FZCA 3AE9A 2Y60A 5LB6A 2ZCWA 2RVAA 5FO7B 2QQWA 5BNNA 4YW3A 4IDZA 1GLHA 1LENA 3AB0A 1XXNA 5ABHA 3A0NA 4KI5M 1MMNA 1UQXA 3B5MA 3H7JA 3T1LA 4DINB 5C3SA 2D2SA 1S0FA 3M3IA 3IF8B 1ZA4A 5FFOC 2CLYC 1H1IA 3MHZA 4I02A 5HWYA 2CNAA 4F7ZA 3TN93 4F8HA 2HN1A 2XHEB 1OLRA 2IC9A 5LYJE 3IA3A 4N43A 3KT4A 1BR4A 4MGYE 4BQ5A 1MQTB 1ZBA1 4FPKA 4N53A 4QQ2A 5FZIA 4PJJA 4UVCB 1OMIA 4NUVA 1OQDA 1Q8OA 2C4XA 4IEWA 3SOLA 3ZC0A 4AGGA 2YC0A 4NJ4A 5FZ8A 2LHRA 3O1IA 3PUXF 1QJY1 3T1HT 1QU0A 2XM1A 2X66A 1VB4A 1W6PA 2HYXA 3POJA 5EWSA 3BN6A 4CDWA 1W0AA 3WT3A 1UMHA 3H3UA 3ZR6A 4YG6A 2C5KT 1VMJA 3HWJA 1ASJ3 1E5IA 3H3LA 3LSDA 3TLWA 1ODMA 4KBZA 2FJEA 3N9NA 4W4ZA 4YM1A 2OYZA 3EDVA 4ITCA 5A3WA 4XBLA 5A7WB 4UV9B 5JMCA 1WCQA 1DQ0A 5FDBA 3V5SA 2MBGA 3FUQA 1G73A 1FOD1 2Q8EA 2Q8OA 1QJX3 1WMEA 1VBD3 1J3PA 3MF9A 1ND3B 3P4SA 4JKLA 1O4YA 4YTPA 2HWF2 1MS1A 4DR4T 3EO6A 2JQQA 5CFBA 5LHGB 2ZGNA 5FYYA 2W1QA 4FQ4A 5SV8A 5FWJA 3UUBA 2D93A 4LUMA 4UBGA 3AA0B 4ZZ8A 4YGCA 3C7HA 1PNGA 3Q8AA 4K0UA 4YVWA 3SH3A 4YY3T 3MIEA 3VKGA 1UX5A 2B9UA 3VD3A 2F4PA 2E33A 3P4WA 2XHKA 3CO2A 5C4WA 1YD8G 1PO22 3RYKA 2CHHA 4KHZF 3BPZA 4QPGB 2DU0A 2DF7A 4JGZC 5FMDA 4EV0A 1FJGT 1VALA 4FVVA 3UU6A 4WVVA 5GLZA 3O1SA 1K5MB 4AW7A 3MGUA 3AP9A 1UO9A 4U36A 3NO8A 3LPFA 2QDRA 4XFCA 2JJ6A 4D3WA 5BNQA 2QQKA 2VXJA 3VUOA 2WZHA 1RTVA 3AAIA 1A3KA 3IZOA 3OCPA 4LBOA 3VDDA 1EV13 2Q5TA 2E8IA 3HT1A 1REEA 3RS6A 3EJKA 4AVTA 1VBC2 1X8MA 4E4DX 5D1IA 3I3EA 5FL0A 4QX3A 5DZEA 3UQ4A 4UR9A 1BBT2 2LRLA 2RS13 2E9XD 1LKNA 3LK2B 3CZUA 3PUGA 1MVEA 4ERRA 4I09A 3VBSC 3AMPA 4V1PA 3T2TA 1DFQA 5HXRA 1PZ9A 2NW8A 5IUXA 3WNNA 4XQWA 3ZSEA 4YZ2A 2VBDA 5HBAA 5JZGB 5C3OA 1UD1A 4U33A 2FUPA 1HQWA 3K2OA 4Y5TA 4YG0A 3KCYA 2H88A 5LG3A 3MFAA 2PQQA 3VKFC 1TE1B 3HN3A 2VMGA 3VN4A 2W00A 4ZI7E 2LTNA 4PLNA 2ES3A 4E2GA 1NAFA 4WW0A 3QH6A 5FQ0B 4D69A 2RS51 1HXS2 4BMEA 5CA0E 4X1YE 4ZY9A 2QTWB 3VZLA 2F4LA 5M0TA 1AR73 2VM9A 2C9AA 3BOWA 4PJYA 5J2UE 2G19A 4RGGA 1MS4A 4YGEA 3VBSB 1MZEA 3ZFEA 5JPMB 1G9FA 2E2AA 2D3SA 3MUZ1 1JZ2A 3MJXA 1W06A 4EN7B 1HCIA 1HV1A 3LSEA 3AMMA 2JQ9A 2JB4A 4MGZE 4YVWC 2DCFA 1OQEA 4DEVA 3AKPA 5FKYA 1UX4A 4ILAA 2YN6A 3PTRB 1EPWA 1NE6A 2G9FA 4JDOA 3MW4A 4E2SA 1HJGA 1T6BX 2XLAA 2YXSA 1BJQA 1V0AA 1W8NA 2WS93 4QX7A 4HFEA 3B94A 3FBYA 1HLCA 2HWC1 4OHWA 1SCRA 2HWD2 4AYUA 1CAXA 3W5NA 4MLOA 4DV3T 5LATA 4CI1B 1X33A 4QGLA 3AP7A 1J1LA 4IL7A 3ZMSB 5LHHB 4XF9A 4GIQA 1D4VB 2ID4A 5TAOA 1REDA 1T98A 4GA9A 4JV4A 1H7CA 2XVKA 3P50A 4HMZA 3ANWB 2XQRA 1X7NA 5AFUL 3GZEA 4UYBA 2IXLA 2XUEA 4A45A 2WS92 2ZKNA 3RQ0A 4DUWA 4K8FA 1O3XA 1DYPA 1MIVA 3ZR5A 2XJPA 2Z2SB 4U7IA 1NOVA 2A70A 4E7SA 3T0BA 2NW7A 2XASB 4HWCA 1GQPA 2PFWA 2RS53 3NRUA 1H8TC 4KG0A 3TKLB 2YG0A 4XDPA 3RI5A 4EWEA 1LHWA 1HNWT 4GALA 3GCWA 4YLHA 3AE7A 1VMFA 4RFT0 1MPXA 1NUKA 5FZ7A 4YWAA 1XB9A 2D6PA 3UU8A 5FZBA 2ZM8A 4W6XA 2UYBA 3VDDC 1W8ZA 1EV12 5DAWA 3EABA 5KDMC 1R081 2PTMA 3ZXDA 1BXHA 1QJY2 2JEMA 3JXSA 4M3CA 4D94A 4R9BA 1YXRA 3UU3A 2PAKA 1JU4A 3NAPB 1SE7A 3I59A 3VKLA 4NIIA 5C2TA 4PK5A 3VHLA 1C8M1 2RA1A 1W9YA 2WUHA 2WS91 3PHMA 5A3MA 4JI4T 3MF6A 3WNPA 3KV6A 3UUMA 4CN6A 1V6MA 2I74A 5JSOA 3JU9A 1C3HA 1YQ6A 5IVYA 4QXCB 3I8TA 4CI2B 1D4M1 5DUWA 5T5OA 2L9LA 2QVSB 3C64A 2V72A 1AVBA 1I9RA 2XBO3 2VOTA 3KWVA 2VNGA 5KX5E 1E1HB 3ANWA 4HE8A 2R49A 4OZXA 2O8OA 1GP6A 3KB5A 4QDQA 4YLZA 2WWSA 4U2AA 5L7OB 4KMQA 5HWXA 2J47A 3VR9A 4DV2T 3LSVA 3BK9A 3N3HA 3X29B 3OGVA 1NWMX 5T54A 1KFUL 2Z5WA 4XYXA 3J9SA 4NIHA 3N9MA 1PX4A 2CRBA 3QNUA 4ZU5A 3TLTA 1Q8QA 5FMNA 3LDQB 3LGRA 3PJYA 4G9SB 4CSWA 3ZKRA 2WQZC 3I2KA 4ASLA 4QPGC 1GMMA 2P17A 1XOYA 5GLUA 3ZFGB 2BNMA 4A7KA 1ZM1A 5CFCA 5KHHA 3D5OA 4Y20A 1ZRCA 4GXLA 3IN9A 1F9KA 2B45X 1GOGA 4J1WA 2NWBA 4XF4A 3Q8FA 1ZRFA 3SITA 3H0OA 4CDXC 4EQVA 5LA1A 4NHXA 3K48A 1HXS1 3EDUA 3MDPA 1JTZX 4ZHQE 1W8UA 4MX3A 5A1FA 5ABJC 5JXGA 1JYIA 4BA6A 1AR61 1CAWA 3UETA 1QEXA 5LRSA 2E9XB 1QGLA 4RQPC 4XZUG 4CEYA 3BGAA 3HOBA 2YV8A 3O0VA 3GGLA 4FQZA 1JZ4A 1ENSA 2R042 3RDIA 3TOJA 2ODUA 3WP6A 1MVQA 1R093 4AXOA 1HNZT 4JHZA 2IFRA 3FJSA 5JZGC 3NV1A 4L0PA 4QH5A 1RUJ3 1D4M3 2JG9B 2VULA 1QJU2 4MV2A 1ZZ7A 3LDKA 4Q4W1 2BVMA 4JI1T 4IEUA 4AKLA 1JOBA 1U5XA 4JTOA 2QCSB 1N1YA 5FMCA 3RJ2X 2IAKA 3ZSTA 2C9KA 4HN9A 1BHGA 2CWOA 4MVTA 5EYYA 4YPJA 3V0AB 3EYPA 3H3ZA 5DMYA 3AMHA 3QD6A 2VR4A 1UKRA 4Q1RA 4YFWA 5BNNC 1D0ZA 4UXNB 2BS4A 4EOZB 5K0UA 4JVAA 4B3MT 4LO4B 2IFWA 1UURA 3C51A 1OURA 3BYWA 5L4EA 4AKGA 4OMCA 1ULFA 4XFAA 2JWPA 3AKQA 3HPNA 2DFBA 4ZZBA 3VDDB 3OKQA 1Q3EA 2XSBA 4HKWA 1SBFA 1K12A 3KZ4C 3O0WA 2L3LA 2I0MA 5H9PA 5FJHA 1GR3A 2BG9B 3GZAA 4EN9B 4NPRA 3O1PA 4WYVA 1HQLA 4GWIA 5ACA2 5KXDA 3LWCA 2PHRA 4GKJT 5J48A 4LULA 5CGMA 4A41A 2CL2A 1W6OB 4XXPA 4CEWC 2ZGTA 1WW5A 2JQKA 5KC6A 3U4SA 1W2TA 1KQRA 2YGMA 3TEWA 3APBA 4HFVA 3HNMA 5GZCA 4CU7A 2CTVA 5F7UA 3H8OA 2A6VA 1HRV3 3HT2A 2ZX4A 5DAVA 1PK6A 4B3ST 1AR82 4DEQA 2GNMA 3AMQA 4XJAA 2NYYA 1Y43B 1PMIA 1ASJ2 4WBNE 5FLHA 1AF9A 4ZXKA 2TEPA 2YC4A 4GWMA 1KXGA 3U3IA 5CISA 5HXVA 3M3QA 3Q8EA 4WNKA 1E57A 4RHV1 5A7WA 5JAXA 1NEKA 1JW6A 1PIV3 1UXZA 4DRRA 3IAPA 5FREA 4Z8BA 3AAEB 2B1EA 4H9PC 1J5ET 4QX8A 2I2SA 3VZMA 2VB6A 3UKNA 2HH9A 3ECQA 1RXFA 1ZV4X 3CHXA 4HN1A 3ACGA 3O1UA 2A75A 3D82A 2W67A 4H63H 4CUAA 5FOJB 1I3HA 4ZS3A 3W15B 1YQ8A 4BPZA 2WU5A 2JDPA 3NZPA 1LHVA 1MACA 5FMOL 2ORXA 1BVVA 3FN9A 3P4QA 4OHVA 1WLWA 2J1SA 4TX5A 2X9YA 2WNVC 4GKYA 4N43B 1POV1 3RZMA 1EAH2 4P5HA 4Q2FA 4RYDA 5H9RA 4CP9B 2FDFA 2FDHA 5JXJA 3ETVA 1UYXA 2ZAAA 2YBPA 4PJMA 2CM0A 3AZVA 2XJ7A 2HJIA 3EHKA 3M2MA 4K8RB 3RZZA 2FDIA 3S7IA 1O91A 4GMP1 2WKKA 2WO2A 2BERA 4LBQD 1OWAA 3P6BA 4LK6A 4IT4A 2ARBA 3ZFEC 2VY0A 3PU3A 2HLEA 2R063 3AYCA 4MLKA 1O5UA 3AXJA 1UCXA 2MOZA 1AYN2 4L5GA 4DMWA 5J2TE 1V6LA 2LALA 2R1DA 3NJZA 3UUXB 5CKQA 5ABGA 5C3JA 2Y6XA 2V5DA 3I4IA 5FY0A 1R8IA 4UELA 2D9DA 4GYRA 4COFA 1RUD3 1W04A 4LBJA 4UFIA 1I5PA 1FMD3 5JI9A 1PVC2 1H1AA 4KU7A 4NAMA 1OA4A 2GNDA 4P1NA 1GICA 2ZGRA 4MYEA 1PIV1 4HG6B 4DRVA 1YQ4A 3ZYLA 1YFWA 3QLQA 5DXDA 5FZ3A 2J62A 2RPAA 1ZBE3 4XCBA 5FV3A 3ZYHA 2ZLYA 1IPSA 3MLJA 3KHBA 3QH7A 4I0AA 3BVCA 4JI8T 1W9FA 2WT0A 2A3WA 1LOFA 2ES0A 4LOTA 4RD7A 5A33A 1UCUA 3F57A 4AISA 3C7FA 3LEKA 5FK7A 1RUE3 2VCAA 5EP9A 4DMIA 4UW4A 3L3PA 1XJAA 4PIXA 2ZMAA 1MMAA 2DU1A 3JBG3 3KFWX 4Q26A 1AL0G 5CYYA 5FLJA 2PLV2 5L9BA 5JDNA 3PUVF 1AJOA 3VBRB 4DPNA 2Y64A 2FMDA 4XF3A 1G9BA 1POV3 4ZONA 1E7PA 4QWNA 5CBLA 3VBOA 3L2HA 4L92A 4ASKA 2BBVA 4YVWB 1WYCA 2Y33A 3MPBA 1ZRRA 2JECA 3D0JA 2MPKA 2PBIA 3D3AA 5FWEA 2CGPA 4CUBA 1OFNA 5JH7E 2ODVA 4UXAA 5DDJ2 3RYFE 3N4MA 5IK7A 2OT7A 2XLGA 3I0QA 1MMDA 3IBPA 4X66T 4CCDA 3RVHA 3RZLA 1ULGA 3O4XE 4C90A 3ETUA 1DYKA 4RS5C 3B13A 4PCRA 3WF2A 4TWHA 1MEC1 4COZA 4YW5A 2R1BA 3X1DA 4B8EA 1IZ3A 1LHNA 2BUKA 4LKEA 4A98A 2NN8A 4AWDA 4HKLA 4XHXA 2W0GA 4QX2A 4NXNT 1DGWX 4A5XA 4Y5SA 1T6GC 4CUCA 3RWNA 2MEV1 1UZYA 3BQKA 1FV3A 2BBAA 4IE4A 4UAPA 5CKMA 5HEUA 5IHYA 2A71A 3U37A 2DI4A 5C6CA 3ZMZB 3EUHA 5CNAA 1JYTA 1N1TA 4B7EA 3U0ZA 1OVSA 3ZSLA 3BU0A 3RGBA 3SKJE 1SFPA 3N5LA 1F2NA 2CV6A 5JOWA 5AQVB 2UXCT 5L36A 1HB4A 4YW4A 3N7MA 2SPCA 1C28A 1V9U1 2RS31 4IEPA 3R4UA 2QQOA 2W52A 5FYIA 3GBGA 3KS7A 2WB5A 4L9IA 2MYSA 3AYAA 1SFNA 2GDFA 2P3YA 4XMIA 2BVBA 4JI5T 2GP3A 4P09A 1F5FA 1JN2P 3E5QA 1Y4WA 4BCUA 4Q8KA 2FCTA 2VNOA 2W94A 2ETEA 1KNRA 4D8MA 4XPVA 1WW7A 3DXTA 1UGOA 1C5HA 5LY2A 5IAXA 3KLSA 2A2FX 5JDBA 2NMOA 3ZXJA 5KXCA 2LHNA 1WCKA 1C1LA 2CAVA 3H9AA 2XZEA 3AA7B 1S0GA 4QQPA 4Y5Z0 4BJNA 1RUC1 3RZGA 3UU5A 2W47A 3VBHB 4Q27A 5FZ6A 2JMKA 2XTLA 1QY4A 4Q0VA 1SBDA 2XAGB 2WBKA 2F6BA 4A7ZA 2LSYA 5FZFA 4IE0A 3T0DA 3NL1A 1OC1A 1M4WA 4CCJA 1UY0A 3O1TA 4WVWA 5LA0A 4LQRA 3OUHA 3BTAA 3I2OA 1XE7A 2GC2A 4XHBA 4AEKA 3TEYA 2OVUA 4GIWA 2BNNA 5BNOB 4UFKA 2WINB 4Q4Y1 3AEBA 4IDPA 4IEYA 3VDCA 4B1LA 3JC6D 4KHPT 1MNDA 3VBUB 2CDPA 4FTEA 4XIKA 4CDUC 5A7NA 3PNAA 1UYPA 4LOSA 5AC93 1GFF2 3PU8A 1KEXA 3FHNA 3THCA 1X9TA 4AZZA 5T52A 2GALA 5FP7A 5J96B 4HOOA 4B3RT 1ZBA2 2QNKA 1D0YA 2C5JA 2G0UA 2ENRA 3K46A 1BK0A 1X9BA 2XQYA 1W8OA 3VZNA 3AZYA 5IW0A 3FBLA 4IDOA 3KBUA 4TWFA 2QBXA 3TN92 1CR7A 3SCFA 2RMU3 3BOPA 2J4GA 1IOAA 2EAAA 1GYKA 2H7OA 1G8WA 1HG2A 1MS9A 1RUI2 5BUVA 5GLWA 3EB7A 1CAVA 3OGSA 3LK42 1YQ3A 1OEDB 4ADZA 3RFRA 5C5TA 5FYVA 4B1MA 4GK0E 2UUCT 2CLYB 5EJ3A 4H9OC 3VGIA 1GWMA 1VAVA 3K77A 3OSDA 1HRI2 1HDKA 4NWWA 1KDKA 5JXIA 2FCVA 4FFGA 1IS3A 4LUKA 1QJZA 3ZYRA 4URAA 4XUTA 2K46A 2VECA 2YOEA 3EVYA 1S94A 3T4VA 2WFF3 3ONLC 4NUUA 2X5IB 2YZ4A 3Q9DA 4G63A 3S7EA 2V6XA 2JRKA 4CXWA 4YGDA 2QDNA 3CX8B 1TMF1 2YPDA 3V0AA 3OGJA 2VQTA 2JKBA 2KT9A 4PFPA 1A8MA 1WCSA 2A6XA 3WP5A 2PHFA 3IAQA 1MR5A 2KXLA 5AC91 2JXAA 2BZDA 1ENRA 3UGFA 4DUYT 3NWIA 4FPYA 5HXCA 4YM2A 3O1HA 2X10A 3OYWB 1NA1B 3FZLB 2PTFA 1YIFA 2DLRA 1ZA7A 1YNAA 1WMXA 2D6KA 4ZI2D 3RZKA 5LWBA 2E9XA 1G9DA 5SV5A 3J8F2 3WCSA 3KINB 2OQ7A 4JAAA 4DXTA 1V70A 3DN7A 4FSJA 2GN7A 4COYA 4WBOA 3AEGA 1KEYA 3A21A 1XWMA 1R092 3HAGA 2XQ9A 2WNOA 1I6XA 2TUNA 1CWPA 2KM2A 4UOJA 4AQFA 3FHQA 2H7VC 4IL9A 3PJAJ 4AKHA 1ZZ8A 2CGOA 2W2IA 3P1IA 3Q8BA 4A2UA 1UOBA 2QQVA 1CJDA 3O14A 3F95A 4QGNA 1CJPA 4BB3A 4BYYA 1OF4A 4XFIA 4HK9A 4OCTA 4A44A 1XZYA 1LOBA 3AJZA 3J8F3 1KFXL 2D6MA 2X9HA 5AQUB 2JDKA 5FZAA 1GOHA 3MV01 4CPBD 2QZ2A 1AYN1 4RGAA 2E6VA 3P5BA 4EGWA 3POIA 5J09A 1UY4A 2RR11 1ND2B 1TMF3 3MZHA 2ACZA 3N2KE 2VL4A 2XJTA 1VAMA 3T0AA 4RL7A 2J1AA 1UOFA 2K3WA 4NRMA 5LEKA 3Q5XA 2AREA 2YDRA 1QOOA 1F8VA 2W68A 3BKZA 4QXCA 2V5YA 2EIDA 4DIDB 2JE7A 1ULEA 1OUXA 1S0BA 1YQCA 1YRZA 4FPFA 1VBE2 1JYCA 1OI6A 4OUSA 2Q9QD 3ABZA 5FZOA 4BM8A 2XSAA 4BXFA 4QXBB 1VB2A 5FNVE 2HEWF 4YG3A 5DDJ3 5FYCA 5IWFA 5L73A 1W09A 3WW2A 3WZ1A 1CGPA 2RG4A 4COUA 5K0UC 3B5LB 3G6JB 3GZTB 4CCCA 4TNVA 2H0VA 2YINA 3I2FA 2PLV1 2VVFA 5JVVA 2VO5A 1LGCA 5I0RA 5FVLA 1YJKA 2FJAA 2GAUA 4TLGA 4HWFA 3ES1A 1UXXX 1CX4A 1WD4A 4WZFA 3P4PA 4GJYA 2VMEA 3KCXA 2OXBA 2ZX0A 1G9CA 4JBWF 1QXJA 4XDQA 1GWLA 1Z7S1 1AL22 2PHWA 1SDDB 3OOXA 4L97A 4SLIA 4WBBA 1MNEA 2UUBT 2JENA 2WL1A 2XWJB 3SH5A 2HWC3 1X82A 2Y6JA 5KHIA 2VVEA 4BDVB 3H8XA 4UI9L 4M00A 1NLQA 1PVXA 4MGKE 2VKOA 4MXWA 1VP6A 1O5LA 2E7TA 1XYPA 2H3RA 4E27A 5JSPA 1EUUA 5IVFA 3NRYA 3DP7A 4H9RC 1RUF3 4ONUA 3ZDVA 4XF0A 1SA0E 4UVAB 4XZCA 1RUC2 1FI2A 4YFSA 1L7QA 4O4JE 2YYOA 3LB9A 3N7LA 4EE2A 4ISRA 2VZ1A 4Q0QA 3PIGA 4I0WB 5FTTC 5GONE 4OYKA 1NQDA 1ZNPA 3ASIA 5BNPB 3CQGB 2VW0A 2VVSA 2IXJA 2GK9A 3LA7A 4Y26A 2C0ZA 2VOVA 2AGSA 3E5XA 2PQSA 4QX7B 5GM0A 1AR91 3RIUC 4MHUA 3H3MA 1HRI3 4XAAA 3H7YA 3MIBA 4CDUA 1EAH3 5FXZA 4YT0A 4J2CA 2PLV3 3E0ZA 3PURA 3GM8A 4FCAA 1N47A 2W87A 4FI9A 3AEAA 4OLLA 4AEDC 4PF5A 1FYUA 2CBJA 1YO8A 1TME1 2X5IA 2XGXA 1DHKB 4JZRA 3ZFEB 3VBSA 2PHXA 4EXTA 4N9IA 2K24A 4FPJA 3JCFA 2ZACA 5L47A 3ZKYA 1YLLA 4HVQA 1HQNA 2X5IC 1U5ZA 2DUPA 1UZ0A 4WVMB 5FQ0A 2LS6A 2WSUA 1JUIA 2ADEA 2JX9A 2R072 3ZYJB 3OBRA 5LGUB 1DYOA 2AACA 4KUMB 1JOJA 2F17A 3PUQA 4LMKA 3WEZA 4AE2A 3WOGA 4BA9A 1DQ6A 3H37A 1CUNA 2LROA 4LIVA 4WVZA 4AI3A 1YFXA 4NIQA 2A72A 1RUF1 4U3CA 1XNCA 2J22A 2FDGA 2E53A 1WCUA 4NIGA 1U4QA 5FP9A 3SKVA 5F3JA 3NSTA 4DV5T 1UN1A 2V73A 2WQ4A 2WAAA 1CN1A 2W4XA 3NNJA 4GAZA 1E2AA 2MAWA 1W2UA 4XILA 1RVF3 2N2NA 4PNIA 3F31A 3CVRA 1SDWA 4L9BA 4OHXA 3L8RA 3N36A 2SLIA 5F6LB 4A3ZA 4ASMB 3ELNA 5BYNA 3ZYKA 1AR93 1QJEA 1SCSA 3VBFB 1HRI1 3RZHA 5LCYA 2WR9A 2JD9A 2WSVA 4OZOA 2BBHA 4XBFB 3CLPA 5KHKA 2QQLA 1AXKA 4P14A 5ABJB 4XFHA 4P0BA 2WZIA 1WLDA 2WMOA 2O14A 4CYDA 1JMUB 3HJRA 4HZFA 1ZREA 2ZAHA 1LULA 3O5SA 3ZM8A 3BCWA 3CBNA 1HXS3 5AQLB 5BR8T 2VTFA 4KL1A 5F3IA 4JI6T 3RIUA 2E9XC 2XVGA 5ABFA 3GALA 1OVPA 3QBQA 5FKCA 1RMU3 1KNZA 3RX6A 2IWGB 3EHZA 1ZBE2 4FPOB 1CZVA 5G04L 2R7EB 1RJ7A 2IZWA 5G05L 5JQGE 2X68A 3VBHA 4CN4A 5ANNA 4IHJE 3LA2A 1PVC1 4LXLA 2BPA2 2DWRA 4CCLA 4YJ3E 1R091 1TNFA 4IREA 3RH3A 2JICA 4O9GA 3WG3A 2VZRA 4CDXA 1E5HA 2WYFA 3JQWA 2OUJA 4S2HA 3IPVA 1XC6A 3T1YT 3LKJA 3VBOB 4F3JA 2R062 3BIWE 5L2LA 2VPVA 5JSRA 5FPLA 4AIUA 2A5ZA 4RS5A 2UXDT 4NR1A 1XNRT 2BYVE 1ZZCA 1TG7A 3LPGA 2VUJA 3LAGA 3FXEB 3WDUA 3ZXKA 3I1AA 2E63A 2DYCA 5AFEA 1W6PB 2LSIA 3D6EA 4N53C 4YARA 2BFUS 1YI9A 2PYTA 1XNBA 2VUCA 5APAA 3T2OA 3WX5A 3UJOA 2QFEA 4CPBA 4YZ1A 2LUWA 1SLBA 1TQ5A 1WR6A 2VD7A 3ILFA 4JDNA 4BQ2A 1LR5A 3A22A 3AZZA 3VR8A 2HPLA 2LSJA 3M65A 3IMMA 3T3YA 3IHRA 4A42A 2CY6A 4CCMA 3I9YA 2J1VA 2JG9C 3ZYIB 5DAQA 2I6HA 3R6NA 3WF3A 2E31A 2IUBA 4RR3B 5FZ4A 3VHPA 5CAZA 4HEAA 3ZT6A 5HCHA 3LIHA 3B69A 4PIYA 4GMP0 5IJRA 4K0KT 1ALYA 4QMAA 3RKGA 4C1XA 3BQLA 4ZI3C 5FP4A 4AI6A 1WLTA 2Y8KA 1LU1A 5CIRA 1IS6A 1O3RA 1XYOA 2IUWA 4M0HA 4YZ3A 3CKHA 4CZSA 1UX7A 3J7Yq 1ASJ1 3AP6A 4XMAA 2W3JA 1WW4A 5FZ9A 4QWNB 4LKFA 1DGRN 3F2EA 4LO8A 3DKQA 5A7SA 4QKBA 1HR0T 1KDMA 3CEWA 4B4PA 2R0HA 2FDJA 4TNWA 1H0BA 2XBO2 5FPVA 3R4SA 3VBRA 4AQTA 4JLEA 2PHLA 2W1WA 3VLBB 1O8PA 4CXXA 4TLFA 4ZXLA 2R043 1MZ6A 3WDTA 4QX1A 4LKDA 2PFVA 2CU5A 2YMZA 3UT5E 3O1OA 1XDOA 4DFSA 1MS0A 5C7GA 2OX0A 4E8DA 1GNYA 1H2NA 2GN3A 2E5VA 3LOIA 1YWKA 4ATFA 4IXLA 2XAQB 3ZKUA 4FAGA 3TWIA 4XW3A 2QE3A 2IXIA 3W21A 4AVSA 4QKDA 4ISSA 1YFYA 1I94T 3ZSSA 3WI3A 2YFUA 3HIFA 1PGW2 2W62A 1HJFA 2J1UA 2VC9A 1COV3 3GN5B 5HXHA 1PZ8A 1HF8A 1W2OA 4OUEA 4COWA 2VL8A 5IK8A 3OYZA 4QH4A 1OOPC 3G7DA 2WZR2 2OW4A 4AVVA 4CN1A 1UYZA 1A6CA 3P3NA 5A3OA 1W2AX 3URFA 5HCJA 1Q8SA 1WR0A 4KMCA 4Z8XA 1ULPA 2JDAA 2MNGA 3AFGA 3AMNA 2XDVA 4P08A 2ARXA 4XQ4A 1HG5A 2VXRA 1QOTA 1LU2A 4TV8E 2D0TA 2MPFA 1PIV2 3AM2A 5D8AA 2RS11 3ROUA 5FO9B 1S0DA 2YPJA 3FFQA 1WLCA 1R1A3 4I0UA 3WQ1A 2JMHA 2DDUA 2A6ZA 3PUAA 2XMLA 2EALA 3D0SA 4H7LA 3NV3A 4PBOA 3IDEA 4OHZA 3H8UA 5JUVA 3AKRA 4JUYA 4LORA 2WWUA 3T8OA 4ZI2C 3PUIA 4JGZB 5IATA 1LGNA 1DCSA 4P0AA 3CJIC 2X8KA 4HBNA 4QX0A 2VNRA 1ZBE1 4DR7T 2WY2A 4O2BE 5AQTB 3OPCA 5EZYE 4YHHT 1F15A 2WQYA 5LBMA 1SQ4A 1VBA1 1HX6A 1CESA 1DZTA 4LO5B 2XM2A 1D2QA 2KZ7B 4YSZA 2EXIA 4NMIA 4FJOA 5FYTA 4DB5A 1OUSA 5HEJA 5LA2A 3HKBE 4EYUA 3OEAA 4O61A 2YUEA 3ACFA 1K3IA 3WNLA 1SHZC 4EWAA 1IG0A 3PDQA 3RMYA 1XNKA 3WDYA 1RL3A 2QQJA 3ZXLA 2XKPA 4AQSA 3L09A 4DVDA 2OUHA 5JR9C 4META 1COV1 1WA4A 2I45A 4HVOA 4Q0UA 1LNSA 1PK6B 1BR0A 1CX1A 2WLPA 5L7OC 3IDCB 1NAEA 2BV4A 1T8BA 4H3WA 3WG1A 3ZXEA 3GHMA 1V6KA 3POBA 2LRKA 1UMZA 2X9WA 3F2ZA 3HEIA 2Q8CA 3V0BB 1YIPA 3FMGA 1VPHA 2QA7A 1RITA 4RA0A 5JRCA 3SS1A 4PI0A 4BWOA 4JTNA 2L8KA 3DCQA 2D40A 4OYJA 1YCIA 4X6RB 1UZWA 5A32B 3VHRA 4Q4X2 1VBD2 2QGSA 4GH4C 4WM8B 3IDBB 3WUCA 3AXEA 1NKGA 1SUMB 4YGBA 1YKEB 1C1FA 1VBD1 2PA7A 2KMFA 1PO11 4XUQA 2CWMA 4CEWB 1DQ2A 2K5BB 4UVBB 1WGPA 2BBJA 1BZWA 4JDMA 2FCUA 3LDBA 1H4HA 4AFBA 1K42A 3NJYA 1OEDE 2QJVA 2VQ0A 2W63A 2W91A 4E2QA 3S6PA 1IJ6A 2C6SA 2KWHA 5LK7B 3RHWA 4A97A 2UXBT 1WRDA 2VJXA 4YHJA 4JX0A 3I2JA 2HEYF 2W46A 3OTOT 1BQPA 5JDQA 1D7PM 1GP5A 1OFSA 2EIBA 2RM23 5K0UB 2Q1FA 2BKOA 2W66A 2WWVA 1WW6A 2UWCA 3I2GA 3IIAA 4P9LA 4HFIA 1JODA 4DR2T 5DQWA 3HKDE 4AI8A 2CBIA 2XG3A 3VKMA 5IYYA 3LJCA 4FPGA 2XQ3A 5KHGA 1ULCA 1IQDC 1OOPB 3KF3A 4WM7A 3FZHB 1YJLA 3C7OA 2XQXA 2XXZA 3B00A 4TWDA 5LGTB 4ZZCA 2VZ3A 3VD4A 4V2WA 2DTWA 1AR92 5FYUA 2JJ9A 4LMFA 4X6QB 4YXDA 5HCAA 5J7MA 2A1XA 2ZMNA 1O4TA 2GSYA 3MXZA 1EV11 3NAPC 3ONXA 4OQ9A 3SCHA 3HNBM 4FPHA 4LKSA 2VH9A 3SEEA 4AQ6A 5AQFB 2VWAA 1V9U2 3M70A 1X79A 3ZDSA 3ABVA 5T55A 3MV11 4AL9A 5E1RA 1CAWB 4JI2T 4XXAA 1POQA 5ADXL 1AX0A 1LOFC 2BW8A 3CQOA 3KVBA 1NXMA 2C5DA 5BNPC 3I97A 3MYXA 4Q4V3 4QB2A 3ST7A 3MZKB 4W65A 5LJMA 1KD7A 1QQP3 4FO9A 4EYYR 1BR1A 4G4FA 4QXHA 4IESA 2DVAA 2MEV2 2QQNA 2JIGA 3POGA 4JI7T 1HKDA 2Y6FA 1FMD2 3ZXAC 1XMOT 5FVKA 2Z79A 3LEIA 2OQ6A 3FFZA 1PX3A 4Q4X1 1PZ7A 2NLRA 5KMGP 3I7DA 4CU9A 4AGRA 1SLIA 4LE3A 1UIJA 4KWUA 3UTKA 4XC9A 1RUI1 2EHOC 4UW3A 4OFGA 3ZIWA 3EAMA 2BFUL 4HKOA 3ORJA 5LNKA 2VKDA 2ZGLA 5L7OA 4LF8T 1RJ8A 2UURA 4O8SA 2OA5A 1NA1C 1UWWA 2E32A 2RMU2 2W2UA 3FHIB 4GB33 3B7MA 2IXKA 4Q29A 4R9DA 4CRQA 5JREA 3PTYA 1U12A 3Q9OA 2J1RA 1NY71 3NNGA 4YJ2E 3HMYA 1BR2A 1Q43A 3LEGA 2ZHKA 5E0OA 3WDVA 2BZBA 2ILMA 4AFMA 3FE5A 2ZM0A 3M3CA 4C91A 2K9AA 4QB6A 4BXSV 1G6NA 1MQTC 1PO23 1I1EA 5FKBA 5FZEA 4PDWA 2ACXA 2XQ6A 4PJNA 3RQUA 3I59B 1VBA2 1IKPA 3DXUA 3HKEE 2LT3A 3NBXX 5JDHA 2D44A 2VVDA 3OG2A 4MXVA 4PQQA 1CVNA 1QQP1 1ZP0A 2EF6A 4QKFA 4BISA 5J37A 2M6BA 3OEBA 4E4ZA 4F83A 3KM5A 5JOZA 2V6YA 3WG4A 4A6OA 5DQVA 3PV0F 1S2EA 3KHCA 1NCRB 2QVAA 1RUF2 5ISLA 4AXPA 2YEVC 4K9SA 3JADA 1Y9QA 1OLME 1SLCA 1COV2 2G9ZA 2RS12 1FATA 1XRUA 2WRAA 4I0BA 4WZCA 1OHFA 2RV9A 4GH4B 3UFEA 5FY1A 1X9PA 1RUI3 3JBG2 4WV8A 4NHKA 1GP4A 4JI3T 1RYYA 4XDOA 1REFA 5IHRA 5EHDA 3ATGA 2XAFB 3NJVA 2EIGA 1XYNA 4R8HA 4XBQA 4EN8B 4K3UA 3C4WA 4Y22A 2X05A 2J1TA 1W0OA 4NUBA 3ZMOA 4ARXA 4QPIB 1UZVA 1WBLA 4DY5A 2YHJA 3UUNA 4HN0A 1CAXB 5DPNA 3U11A 1D0XA 1AR72 4QPIC 1BKZA 3C8XA 3C2UA 3POSA 1PO21 3OUJA 4COVA 3UGHA 5I8YA 4B4RA 3O12A 3SCGA 1VE0A 3O7OA 2JDNA 1Z8UA 2PJQA 1B09A 2E7AA 3FLTA 4NXMT 4PF1A 1BBT3 2W1SA 4QPIA 5GZDA 4BLIA 4FBFA 5JOXA 2Q0AA 4LFBT 1L7RA 2C1FA 3E5UA 4Y22B 1IBKT 5DN2A 3J7HA 4R4ZA 2HYKA 3K3NA 4DMVA 1PMJX 4MZUA 2N9DA 2GMEA 2VTXJ 1X50A 3ZFGC 2Q9QB 1YQ5A 1IPJA 3FC0A 3C7EA 4JRLA 4YYOA 2QYWA 3WP3A 5LEJA 4O65A 1MS3A 2X51A 1YI7A 1MEC2 1QIQA 1QDCA 4GH4A 3PDYA 4H63V 1IBLT 2LRPA 2VW2A 5F2WA 5HPOA 1J1JA 1S0IA 3DYOA 3JB8A 4FXGB 4S2FA 4UF0A 3RYIE 1QUUA 1PGW1 2WAOA 1J5WA 4AQ2A 2Y8DA 3OPZA 1GKBA 1QH6A 2DNXA 2NTXA 5DDJ1 1KRIA 5LRRA 3NJXA 2FZ1A 2FDKA 3RC3A 5JZGA 1QOSA 1B35A 4EEBA 4OUMA 2WT2A 5FYMA 2YB7A 4P00B 4ZU7A 2Q1ZB 3BIEA 2YKSA 4XEZA 4O4HE 5L3EB 4RR3C 2VVNA 4DUXA 1C8M2 3E6BA 2WO7A 3TB0A 2HBUA 3B57A 5LA9A 3H42B 1LHUA 3C4ZA 1D0HA 2FHRA 2ZHLA 4V2VA 2OZ6A 4INDA 3VHNA 2JIJA 2R0FA 2AUYA 4FT8A 5D21A 4AEDB 3NWKA 1JU3A 2UWAA 3R6SA 2QQMA 2PAMA 4IEQA 4MGSA 4GYSA 3TEXA 4F8AA 3KGLA 2LW8A 3VD7A 3SFDA 3SFEA 4FFHA 1TZOA 4LF4T 4GWNA 5F3EA 4DV1T 3FZFB 3PUSA 3R0RA 5FZ0A 4KX6A 3AK0A 5CJ5A 2EHOB 4B3TT 5AC92 5L3DB 3DEMA 4QPGA 5IAVA 5CFDB 4TZDA 2W5FA 4CQIA 2V8SV 3JAFA 2IIUA 3OYXA 4KP3C 2OA2A 1YKHB 3VBUC 3WF4A 1OD3A 4TSVA 5F8PA 3JCIA 4FTBA 3K4AA 5DG1A 2D5FA 4NPLA 5FY5A 2JE8A 5IYZE 2CWSA 4DV0T 2NM1A 3KT7A 4G3YC 2BKPA 3ZYPA 4BQXA 1VBC3 2D6LX 2JB8A 5KR7A 3J7NA 4TN7A 4YSXA 1ACCA 5GLVA 1S0EA 1WYBA 4OHFA 4BQ1A 5A3UA 5BMVE 2LM2A 4UFLA 1RUJ2 2E7QA 3H1WA 5C8CC 1QSDA 3HA4A 4TUYE 1RB8G 1RUE1 2XPJA 4LR4A 1EAH1 4QXHB 2LOSA 3B9CA 5FUIA 4A7YA 5E89A 1HFAA 3U1XA 1QJFA 2KD7A 2ZHMA 2DTYA 4A6SA 3OBTA 2CDOA 4W8JA 4QHOA 5JIAA 3T09A 4Z92B 1UY1A 4AVCA 1V9DA 5JR9B 2ZEYA 3PL0A 1OLMA 4H9NC 2JDUA 3ETQA 4DV7T 1W6QB 3ZN4A 5EK2A 1JZ3A 4PJLA 4LT5A 1H6XA 2LOPA 2P9BA 3LFMA 2DV9A 3PE0A 5LJNA 1VBB3 2ZA9A 3ZLIA 3EMRA 2NP9A 3NVCA 2NOXA 4RN5A 3THTA 4C1WA 1NQJA 3AP4A 1XSRA 2VUDA 1VRH3 3UNPA 1SBEA 3KBTA 2NTYA 3HQXA 5CKNA 4PLOA 2PAEA 5EK3A 3NV2A 3RQWA 4CXYA 4AFCA 2DCJA 3QOPA 1US3A 1KS5A 1QNWA 2EICA 2JDZA 1BVP1 1EYBA 1FPN3 1OOPA 2AE9A 1U5YA 1KS4A 4WM7B 5FZLA 4KNCA 3AECA 4XUOA 4RHV3 2RJKA 2R30A 4Z91A 2ZGPA 1RUH3 4M01A 4AI1A 5KXEA 1Q8PA 2P6HA 3T4HB 5JVDE 2DCKA 3MPPG 4TTGA 1NY72 5LK5A 3RIFA 3OD4A 3WLUA 4TXWA 5H9SA 3K8PC 3WUDA 4L2NA 3DPRA 3GWHA 1HRV2 3U4XA 4D6QA 4DNYA 5DQ0A 1GZWB 3AX4A 1AJ3A 1XNDA 1GSLA 3GXUA 4XIOA 1XMQT 2KLQA 2VTXA 4YRDA 3VRAA 4LTAA 5C8CA 3ME2A 4MHRA 5F1RA 4DR5T 3OY8A 4EWDA 4O4IE 1PGL2 4WZXA 3H50A 4NHYA 3ZIXA 5KHJA 1OXCA 4ZOLE 2SBAA 3HD8B 4ZPIA 4YW2A 1HNXT 3SMHA 5A32A 3O1VA 5JDGA 4LNVA 3NVOA 1W9WA 2Y0OA 2OV9A 4IEZA 3ZSMA 5FPZA 3V0BA 5AQRB 2BS2A 2VOWA 4AF9A 3BTYA 1HB3A 3W9AA 3WW3A 2G9GA 1UOJA 4C0BA 4MFRA 3B9IA 2A6YA 3BTXA 1NZIA 3ZYMA 1VRH1 4FPLA 5J36A 4I55E 2FMYA 4CZZB 4QPYA 1RUD2 2HN2A 2G1MA 3KT1A 1VRBA 2BGPA 5GKAC 3VV1A 2H0BA 4OK0A 1L3JA 3N2GE 1FMD1 3WV6A 1UKGA 2VCMA 4MGQA 4XTPA 1H9WA 1ZKEA 3VKHA 1H8TA 2R32A 1RUH2 3E22E 4M0NA 1VAKA 5F2SA 1QJU1 1TVGA 5A1AA 4DXZA 1W9TA 4H2AA 4PDWC 1T2XA 1CD3G 5DZFA 3USUB 2Y34A 3QOFA 3TLVA 1JXNA 2Y6KA 3I54A 3KF5A 4MADA 2Z69A 2B76A 2C0SA 3CK6A 1W99A 3U07A 4ZZ5A 3QB5A 1URXA 1W0PA 3TBDA 3Q2MA 1ZZ9A 5F3CA 5A1LA 1EY2A 1W8WA 5ACA3 5J1XA 3TAYA 1GOFA 4FPCA 4HFHA 4IUGA 2WZPP 3DPRC 1G8XA 2LM3A 3W5MA 3WVJA 5D8AB 2JIWA 2WP9A 1AXZA 2B46X 2EHOD 5ETWA 3FWEA 3OJAA 4HSJA 3UESA 5BY5A 3OBAA 3TRSB 4AI9A 1LVKA 4MH0E 2XQ4A 1WCRA 3RJRA 1LCLA 2HWF3 1WMFA 1MEC3 1VMHA 4Q4V2 3PVNA 3USUA 2V1DB 2HPJA 3FB2A 2RS52 4AVBA 4GULA 4N7UA 4CA9A 3NNLA 4JGYA 3UT0A 4UIGA 3CU7A 1H6YA 3ZJ1A 1GQEA 1R1A2 4I3PA 2ZZQA 3S5QA 1A34A 4BU2A 3E6CC 3NRXA 4Q8LA 3T08A 3S4UA 5HCBA 4AAXA 2W08A 3LCPA 2R073 4X1KE 1XU2A 2DVBA 2HWD1 3I2DA 4KWLA 4AHZA 1HTJF 1D0GA 4QDSA 4I4TE 2XJVA 4RGKA 2VZQA 2CEAA 5JXHA 4R52A 4Z90A 1VCSA 4PIZA 2BKNA 1TEIA 3K4ZA 2GC3A 4RQPB 3UV9A 4BE3A 1G7YA 5FPXA 3KDSE 1I6ZA 2ZGQA 3I2IA 4JQTA 4C8DA 1O3SA 3KV4A 2DUOA 3KVAA 3GBWA 4O4LE 3WNOA 5FL1A 1F35A 4X5TA 4AQFC 1FMVA 4ANJA 2P3JA 3AZWA 4QB1A 1J84A 4UWDA 2RS33 5A7QA 4DS0A 5LMNT 5IK5A 3ESLA 4HFBA 2XL7A 4Z2AA 1OKQA 3VZOA 4Z2WA 3FZMB 2NR4A 1QXRA 5T5JA 3UKTA 1EPZA 5LXTE 2Y48B 3O1RA 2IDOB 1SEFA 3OY8B 2UUAT 3QB5K 1R082 2B8MA 3DF0A 3ON7A 4JCKA 3THDA 2BVVA 2FQPA 1OD5A 2TBVA 3AE4A 4KWKA 2AENA 4LBQA 2WNUC 3VHOA 4CCKA 2WDVA 2IC1A 4IDNA 1W3XA 4AHXA 5C71A 3MFCA 2I59A 3CX6B 4EAHA 2NQYA 1RUE2 2VQAA 1N3OA 1V00A 3DECA 5A7PA 1MZFA 1N36T 5HCFA 3AKSA 1B35C 3J8F1 4J25A 1BMV2 1DZQA 4YSYA 2BWAA 1OF3A 4IV3A 2VOXA 5T50A 4RR3A 4XQDA 4AKIA 1ZZ6A 4P9IA 4PI2A 2R071 4DXSA 5CU1A 3MIGA 3ZN6A 3H1MA 4KGGA 3JB4C 1KJRA 3ZMTB 3M8LA 1MIYA 3I0OA 4IV3C 4HL0A 4JKMA 4Y1XA 3LBXB 4F6RC 1H30A 1GUIA 3E1F1 5I8TA 2E51A 3AVRA 2VMFA 2EXJA 4Q1PA 4JGYC 2W61A 4LFCT 2WC2A 2WDBA 3SXWA 2DCZA 1D1AA 1W90A 1CHUA 2BP6A 1SPPA 1UZZA 2ZMLA 2XPKA 4Y1ZA 2CYFA 2NMNA 3MIHA 2BVLA 2OZJA 2WNVB 1J1TA 4N43C 4TYSA 3R84B 3NW4A 5AVPA 1QMJA 4RFRB 3OB8A 2P5BA 4IIJE 5FYBA 1N33T 3HQUA 5FZGA 2PN5A 1RUG3 2WA4A 1A78A 3ALQA 1OEDC 1VR3A 4KQ7A 1SLLA 4OI1A 1O3QA 4PK6A 3AL6A 4FP2A 3VL8A 1Y7BA 3HNYM 2ATFA 2VBBA 3LIGA 3PVEA 2EA7A 3WDWA 3WSOA 2LSKA 3IPVB 3JD71 4ATEA 4YFZA 5CG9A 2YGLA 3WQ0A 5C3PA 3SQOA 4CDXB 3ZEFB 1Z0PA 2DFCA 1LHOA 5AQJB 3SH4A 1ZOYA 3GA8A 4PFOA 3SWHA 2E5LT 4TN7B 5I0UA 3A23A 5FPUA 1RINA 1KITA 4AEJA 1N3QA 4B3NA 2GC1A 2D97A 2UU8A 2V4AA 2LLYA 2XQAA 1CAUB 2YY1A 4HFSA 3E6DA 3ZYFA 2OPKA 5IVCA 1RUOA 3AEFA 2V5CA 5ABFB 1NCQA 2VZOA 4HONA 4EEDA 3NNFA 4ORFA 5KXBA 1NENA 4OQ8A 3PUHA 2HWB3 1PO12 1SZBA 5JDFA 3GNEA 5HV4A 5TSWA 1CONA 1ULOA 4CU6A 5A6ZA 4NN0A 2ZABA 4Z1VA 1RIRA 3POYA 4YTNA 1S55A 1XE8A 4YW7A 4HFCA 2XWBB 4NIDA 2BRTA 2AEYA 3AJYA 4XTMA 3IEEA 4HSLA 2WN2A 4IDQA 5L4HA 2RDQA 1WFDA 4QM9A 2O8QA 3SISA 1DBNA 1F31A 1W8FA 1D1CA 2ZMKA 5CZKA 3U14A 1WZXA 2JDYA 3CDZB 3ZXGA 2CSGA 2RM21 1W6NA 4NRQA 5A80A 4IV1B 2O1QA 1UU6A 1AR71 3TN91 5GJ6A 1S4CA 3M3EA 2ZX3A 5LBBA 5IVBA 1XPWA 1ZRDA 3LK3B 4HANA 3SC7X 5FY7A 1SMVA 3WNMA 1ZBA3 1UNBA 3BB6A 5C33A 4MHCA 3KGZA 1TME3 2KINB 2VE1A 2VK9A 4K7JA 2V7LA 4XOGA 3RRWA 1F4HA 1ZZBA 5FYZA 3HBKA 3S0MA 2GH8A 1C4RA 5LASA 1MS5A 2BNOA 2UU9T 2H6CA 2RHPA 5CB7A 5JR7B 3WDXA 4KBMB 2JG8B 1ZEEA 4UF0B 3LA3A 3LZZA 4P02B 2Q9QC 1Y3TA 2XH6A 3OPWA 4QQHA 3Q5EA 2UY9A 4WVMA 3CJIA 4G2AA 2VZVA 2RS32 3HBZA 4R9AA 4ILCA 3IMNA 1YHFA 2Y6HA 4FFIA 1WBFA 4LO6B 3RG0A 1NLRA 5L3CB 2BQPA 3USSA 2Q9QA 2HWB1 4U72A 2N7GA 2P34A 3AYDA 5AQSB 1AJKA 1FOD2 2WWJA 4L11A 3MICA 3ZO0B 4IEXA 1DZRA 1DGWA 3UQ7A 2BS3A 2LKHA 2WMNA 2HWB2 1ST8A 5C8YE 2MHFA 2XJRA 4K6BA 3ZPOA 4IE5A 1H8VA 2X53S 3ACLA 5H6QB 1V6IA 3SRZA 1V6NA 4CDUB 3WAKA 4XJ9A 4EN6B 2BGOA 4HPKB 2X9XA 1ND2C 1STMA 3RWKX 3ZN5A 5BNOC 2RP4A 4UEMA 2HEVF 5J3UA 4MG2A 3OD0A 5BNPA 4CP2A 1AX2A 3AE3A 2IXHA 1PHMA 2KSRA 4P9YA 4YM0A 2D5HA 4IEVA 4ET7A 5EIYB 2EIEA 4Q5OA 2GNBA 2M67A 2A73B 2HWE3 1W0BA 2LE8A 5KC5A 1W03A 2BGCA 1W28A 1XE0A 4AG4A 2VCBA 2ZGSA 2QQIA 5L9VA 1E5SA 4LHSA 1R1ZA 4XJWA 4EV6A 4MXWB 5E16A 2CGNA 1JZ6A 3A5XA 1DQ1A 3T2QA 3LQCA 4LEJA 3WNKA 3AKTA 5J0ZA 5LHIB 3RSJA 3KV5A 1VBE3 3DYPA 3ES4A 1JYXA 4PW8A 2LKGA 1VIWB 1QQP2 1BCXA 2VUAA 5I0TA 4LF9T 4B29A 2YK0A 2A3XA 3AE8A 5FP8A 1LEDA 2D7FA 4I43B 1U5PA 3ZYGA 4BIOA 2FZ2A 3AE6A 2PELA 2IVIB 2WN3A 2VL0A 4JHTA 2VZUA 2J7MA 2BTVC 4X8NA 1N3PA 5FRAA 1XNTA 5DABA 5AQHB 4CI3B 5AQMB 2EXKA 2KA3A 2XQ8A 3GHNA 3BU7A 3VZKA 3DL3A 4PBPA 1RHI2 3MIDA 1HN0A 1IQAA 3ONJA 3I49A 2LJLA 3CJIB 3RKOA 1KFYA 5HEHA 5KXJA 2VKJA 1UX6A 4B7KA 4K40A 3M7AA 5IUQA 2JG8A 2XAJB 2D43A 4S2DA 1XU1A 1US2A 2JDHA 5A3PA 4LJHA 4CCOA 3AA1B 3NZQA 1DQ5A 3AA6B 4LF5T 5C3RA 2VZSA 3OJBA 3DYMA 3JD72 1HV0A 2HWE1 1S2BA 2D0UA 1BK1A 1CPMA 2AYHA 2WFPA 3UU4A 5DAPA 5C9AB 4X64T 4PT6A 5DAXA 1J83A 5F37A 2K0GA 3DTOA 2V7JA 1RC6A 1ND2A 1YQ2A 4GKXA 5K9YA 4QQLA 3CJXA 3O1MA 4IV1A 1S0CA 2CMRA 4GZ9A 3CMLA 1QKQA 5F3GA 5A3LA 2YBKA 2NP0A 1VOMA 4NE9A 1S35A 1WD3A 2PHUA 3B01A 4GWJA 5BXXA 2VQUA 2BG9E 3ILNA 3QUJA 1CZSA 4FAHA 3OPTA 4NROA 4IV1C 1EZ3A 1W8TA 4OFZA 1BEV3 3O9XA 5JLVA 4JRAA 3GZUC 4XFGA 2E9QA 1GANA 2VMDA 5A7OA 2ARCA 3VBOC 1Z78A 5E6HA 4LF6T 5EK4A 3LG7A 3FHAA 3P3PA 5F5AA 1H2LA 2ZX1A 3ZPYA 5AFBA 5HXSA 4Q4W3 4BK5A 1RHI1 1TMF2 1JYWA 3CWZB 4H14A 3N9QA 3N7JA 2D3PA 3FXDB 1Q56A 2PG8A 5F5IA 1PK6C 1G86A 2VOKA 3L39A 3ZMVB 1FXZA 2DWKA 2B39A 2WIIB 2WS3A 2BDEA 2KNDA 1T72A 1CAUA 3MLKA 3OGRA 5F9TA 2WA3A 1QJX2 3WY6A 3KV9A 3FUOA 1IJ5A 1UAIA 3KQ4B 1W9SA 3OYWA 4NIAA 4BJMA 3FZ3A 5HEOA 4DO0A 1GZTA 2Y6LA 4EN0A 4OI0A 1AHSA 2XJSA 4XABA 1OQ1A 4TZ4C 4XVHA 2ZGOA 2W95A 1UF2C 2ZM2A 3THPA 4CE8A 5FJKA 5K4LA 3N35A 3OBVE 5B2GB 2VQFT 3HQRA 1R083 1U5IA 1UU4A 3VKNA 2K48A 4HXCA 1JHNA 3PJQA 5FZDA 5CEHA 2NW9A 4BZ4A 5C5UA 2HBTA 3J7LA 5D8AC 1D2SA 1JYVA 5JDMA 3N9PA 3TLUA 5HXEA 1C8M3 2H6BA 3CQCB 3HVDA 4J1XA 4XFBA 3MEPA 5EXOA 5BV6A 4DUVA 2JPFA 3RGLA 4X20E 1PVC3 1SPPB 3FX3A 5FZHA 4LBMA 3WHUA 5L3FB 1UY2A 4D6SA 2OIIA 4DZGA 2Z6EA 4DV6T 1RUG2 5IT6A 4JKKA 1OEDA 2DVFA 4GOUA 2B5HA 4Y1YA 1SG3A 2DL1A 2WO1A 4QM8A 2D98A 2XBO1 2VKHA 4X62T 1RHI3 4LITA 2AZ5A 4Y1VA 3AC0A 1GU3A 1HB1A 3NNMA 1AYM2 4CEWA 1UPIA 2X67A 1UYYA 2P1BA 3ZN6B 2B7YA 4WM8A 3QACA 3TLSA 2P6CA 5EPAA 3S30A 3UYJA 1KF6A 4NAOA 3CMGA 5AQKB 1LTEA 3RYCE 2A6WA 1N32T 2F4VT 3MK7C 3RYPA 1R64A 5JRCB 3J26N 4BQWA 1RUNA 4LIUA 1WCDJ 2V09A 1V6JA 1ZVFA 1QF3A 4NVPA 3OF1A 4JV5T 3ZMNA 2CCQA 3GBFA 1KK7A 1NCQC 2GMPA 1DG6A 4DV4T 1S0JA 3T1MA 2D6OX 2IXCA 4MGTA 2K9ZA 4BK4A 2JDMA 2XJQA 1CPNA 2ARAA 2VBPA 4XF1A 3SEPA 4TV9E 3W59A 2A3DA 3PIJA 5A6QA 4CP1A 2Z42A 3VBUA 2XJUA 4GB32 3O0XA 3LD8A 5LBFA 2R6QA 5BNOA 4LHKA 5C8CB 5L19A 3RI8A 1LODA 1US7B 3VBFC 4CDQA 2ET7A 4QGMA 5HXMA 2DBIA 2RDRA 1AR62 1PMHX 4HWIB 3HR9A 4UFMA 2L9QA 1DP0A 3H8RA 1GWKA 3RZJA 3ZT7A 3PUWF 1LVFA 5AQIB 4UW5A 3ENRA 4GJZA 4M4PA 3AAAB 1PM7A 3ZCJA 1O6UA 3ZFFC 1EUTA 1RUJ1 5FPBA 1W6MA 5FP3A 3M3ZB 2BG9C 2JQHA 4H9QC 3ZJ2A 1NZCA 1QNYA 2YFZA 3PMSA 4FPEA 4AGVA 4JGZA 5IVJA 2BOIA 1IZNB 3UULA 2XAHB 4DR1T 2RDSA 2FJDA 4YVSB 2UYAA 1IKQA 4BQ3A 4DQAA 1NCRC 5LZ6A 1DIWA 1LRHA 4X65T 4DIQA 5GZFA 3LE0A 4A3XA 1DLLA 3UK9A 2V7KA 1LKXA 4NPPA 3PUYF 2A3YA 1PO13 4UFJA 4HWDA 4C0HA 2VASA 1FT9A 2QZ3A 4JGYB 5JI7A 2FBWA 2IHR1 5LMUT 2WLQA 2R041 3AP5A 4UW6A 3HL6A 5FBJA 3PJAA 1UPSA 2VW1A 1CQ9A 2X29A 4O9EA 2NZ9A 3I3BA 3EQEA 5B4NA 2MTQA 3K51A 4R4XA 5IVEA 2VMIA 2ZHNA 1N1VA 3C3VA 2GP5A 4XAEA 3GN5A 3PVBB 5EZWA 4IERA 1W0NA 3L9JT 3MBWA 5GALA 4AI0A 1XSQA 2C24A 3VRBA 4ZS2A 1PNFA 2DWGA 3B02A 1IS4A 3JAEA 3B3QE 5F32A 3WP4A 3DV8A 1NXD1 2UXXB 5F5CA 2XUMA 3U78A 2OLTA 5AQNB 1K5MC 4HKAA 4SBVA 1W6MB 2Y26A 1QJY3 1OA3A 2ET1A 1J59A 3W20A 1HRV1 2H89A 3FBMA 4LHNA 3ZSKA 3LOBA 1IAPA 1XQNA 2WAUA 4WM8C 3W58A 2W0XA 2ZX2A 3U75A 1H8TB 5DZGA 4YTMA 5I8SA 4W6WA 1Y9GA 1IBMT 2O0OA 1ZRIA 3RPUA 3CZJA 5GZGA 5I91A 3CPZA 4LK7A 3D0TA 2Q4SA 1R1A1 2OS2A 4CDQB 1FEWA 1FOD3 2EXHA 2GMMA 1LOAA 1QJX1 3WW1A 3K4DA 2BOJA 1DF0A 2WT1A 3GJBA 4OMDA 4P9XA 1W05A 4Q25A 3RF1A 3KD4A 1H2KA 1ND3C 1W39A 3PUZF
chains in the Genus database with same CATH topology
4OYKA 4ISTA 3ZN0B 2Q8DA 3CQGB 2GK9A 2W00A 3DJBA 3K8PC 4QX7B 3GWHA 4ZI7E 1NAFA 4WW0A 4ZI3D 2V7MA 4D6QA 5CA0E 4X1YE 5J2UE 1AJ3A 2KWIB 2KLQA 5FXZA 4J2CA 3E0ZA 3MJXA 3PURA 5A3NA 1HCIA 4EB6E 2CXDA 3C98B 4O4IE 5CB4E 2DCFA 5L3BB 4ZOLE 4EXTA 1UX4A 3PTRB 2K24A 3K3QC 3HR0A 5JDGA 2IW5B 4QX7A 5FUNA 1OXZA 4GD4A 3N9OA 4MFRA 5LGUB 4KUMB 3ZYMA 3PUQA 1WLXA 3ZC1A 4I55E 4CI1B 4BA9A 4CZZB 3H37A 1CUNA 3ZN1B 4LIVA 4I50E 3ZMSB 5LHHB 1VRBA 2A72A 1LRZA 5TAOA 1T98A 4EIWA 5IVVA 4OK0A 1H7CA 3N2GE 1U4QA 3ANWB 5FP9A 5AFUL 5F3JA 3CKDA 4GAZA 1ZKEA 2XUEA 3VKHA 5F2SA 5FPAA 3E22E 1O3XA 2N2NA 3F31A 2WSSV 1MIVA 3CVRA 4PNIA 1FIOA 4M1PA 4E7SA 3ZYKA 2NW7A 2XASB 4QX8B 5LCYA 3TKLB 4XDPA 2C0SA 4XBFB 2PXJA 5JR9A 4P0BA 3Q2MA 5FZ7A 4YLHA 2WMOA 4CCLA 5F3CA 5FZBA 5A1LA 2ZM8A 3QK6A 5KDMC 2WM9A 5F3IA 1G8XA 2E9XC 1FMWA 1KNZA 3RX6A 4PK5A 2EHOD 5ETWA 3VHLA 2RA1A 3OJAA 5JQGE 2X68A 4AI9A 1LVKA 3KV6A 4IHJE 3UUMA 5FY9A 4LXLA 4YJ3E 5FXWA 4JEUB 4PAGA 3RH3A 5IVYA 2V1DB 2HPJA 3FB2A 4QXCB 4CI2B 4U74A 4UIGA 3C64A 3ZJ1A 4BU2A 3NRXA 5KX5E 1E1HB 3ANWA 4HE8A 3S4UA 1HS7A 4X1KE 5HYAA 3CX7B 5L2LA 2EHOA 4V1Av 5HWXA 1HTJF 5FPLA 4I4TE 3BK9A 4D6RA 1NWMX 2CEAA 2UXNB 3N9MA 1B7TA 5FMNA 4E4HA 3N2OA 3C4XA 3FXEB 3KDSE 4CSWA 3I1AA 4C8DA 3KV4A 3KVAA 4O4LE 2LSIA 4AQFC 1FMVA 2CE7A 4ANJA 5A7QA 3ESLA 4X1IE 4IE6A 1WR6A 2NWBA 2VD7A 5LXTE 2Y48B 2HPLA 2LSJA 3M65A 5M4YA 4CCMA 3IHRA 3EDUA 3I9YA 3N9LA 4ZHQE 5A1FA 3R6NA 5FZ4A 2E9XB 1Y64B 4HEAA 2I59A 3CX6B 4EAHA 2ODUA 4AAPA 3BQLA 4ZI3C 5FP4A 5A7PA 4AI6A 3J7Yq 2BVMA 4AKLA 4AKIA 5FZ9A 4QWNB 4IGPA 2IAKA 3F2EA 4HGAA 2CWOA 4HN9A 5A7SA 3ZMTB 5LOVE 1MIYA 3I0OA 5FPVA 3LBXB 1D0ZA 4JLEA 4UXNB 4F6RC 4EOZB 4DBRA 3AVRA 2W61A 3C51A 4CXXA 4H9SE 4PK4A 5FY4A 1D1AA 4AKGA 2PFVA 2HH7A 3UT5E 2OX0A 2BVLA 3OKQA 3R84B 4GK5E 3RYHE 5LG4A 5FZGA 5FYBA 2P5BA 2XAQB 4IIJE 2L3LA 4AQGA 5FJHA 3GMIA 5FY8A 4PK6A 1HX8A 3AL6A 4ISSA 4Y33A 2LM9A 3C50A 5JVDE 3WI3A 1MMGA 2LSKA 2W62A 5FXVA 3GN5B 5HXHA 3U4SA 1HF8A 3E08A 2VL8A 1Z0PA 3OYZA 4HFVA 3ZEFB 3GA8A 4PFOA 3SWHA 4QXBA 4TN7B 4XAXB 5FPUA 3V5UA 5FZOB 4KMCA 4Z8XA 5A3TA 5IVCA 3I9WA 5FZ1A 2XDVA 1HG5A 4CUGA 4TV8E 2D0TA 3J9X1 4HONA 4WBNE 2LSGA 5JDFA 2JMHA 5FYHA 3PUAA 2XMLA 3U3IA 4WNKA 5A7WA 4JUYA 2WWUA 5FXXA 3T8OA 4ZI2C 4P0AA 3IEEA 3AAEB 2B1EA 4H9PC 5JDLA 3K3OA 4QU1A 4CCKA 5EZYE 4O2BE 4QX8A 2VB6A 5LBMA 5FYSA 1D1CA 3QC9A 1ZV4X 2KZ7B 5A80A 4FJOA 5FYTA 4H63H 4UV8B 5DJQC 4ZS3A 3W15B 3HKBE 2CWYA 3NZPA 4EYUA 5IVBA 1SHZC 3LK3B 5FY7A 3PDQA 4TX5A 2X9YA 3FBZA 4MHCA 3L09A 2KINB 4DVDA 2VK9A 5JR9C 2V7LA 3RRWA 3MKDA 3ETVA 4EZHA 5FYZA 2YBPA 4PJMA 1YW0A 2CM0A 1BR0A 5FZKA 4KBMB 1ZEEA 4IGUA 4UF0B 3P7IA 1OWAA 2Q9QC 3OPWA 2X9WA 2YU1A 2Q8CA 3PU3A 4G2AA 4MLKA 2QA7A 2MOZA 4L5GA 4DMWA 3SS1A 3WAJA 5J2TE 5JRCA 2L8KA 3UUXB 5L3CB 4OYJA 2Q9QA 2Y6XA 3ZMUB 2QGSA 2V26A 4U72A 5FZMA 2WWJA 5FY0A 4UELA 4GYRA 4B6XA 1MIWA 1YKEB 2WMNA 2KMFA 3AB3B 3HKCE 5C8YE 2K5BB 4UVBB 4EZ4A 3ZPOA 4IE5A 3ZYLA 5H6QB 3LDBA 3SRZA 3NJYA 5FZ3A 2D5UA 3WAKA 2W63A 5FV3A 2ZLYA 2CXFA 1IJ6A 2X9XA 2KWHA 4DBQA 2RP4A 1WRDA 4UEMA 4YHJA 2ES0A 1UCUA 3F57A 5JDQA 2N1GA 3Q5WA 3L3PA 3JC6C 2ZMAA 1MMAA 3LBXA 3KFWX 4MBQA 2M67A 3HKDE 5DQWA 2LE8A 4E7ZA 5JDNA 3LJCA 3BQIA 4QWNA 2XXZA 5LGTB 4ASKA 4V2WA 5FYUA 1WYCA 2JJ9A 2C5IT 2PBIA 3A5XA 5FWEA 3RRCA 3MXZA 2ODVA 5JH7E 3ONXA 3RYFE 5L3GB 4Y3OA 2OT7A 3I0QA 1MMDA 3IBPA 3KV5A 3O1JA 5LHIB 3RVHA 3O4XE 4C90A 3ETUA 2VWAA 4PW8A 3B13A 1X79A 2YK0A 5FP8A 4I43B 1U5PA 5ADXL 2W0GA 3KVBA 2WBLA 5F39A 3MZKB 3BQKA 5LJMA 4IE4A 5DABA 4CI3B 5IHYA 4MALA 1BR1A 4EYYR 2DI4A 4QXHA 5LW9A 3ZMZB 3EUHA 4DNDA 5LP6E 2LJLA 4IGQA 4Y4RA 3RKOA 5HAXA 2VKJA 3N5LA 2OQ6A 5LY1A 2XAJB 4HTEA 5KMGP 4BAYB 5A3PA 4CCOA 2SPCA 3AA1B 3NZQA 3AA6B 4FI5A 5FYIA 3UTKA 2EHOC 2LEHA 4L9IA 2MYSA 2D0UA 3ZCIA 5LNKA 2VKDA 4QKNA 2GP3A 4O8SA 2OA5A 4P09A 5FUPA 5F37A 3DTOA 2V7JA 3MACA 5JREA 2CMRA 2DHRA 3CMLA 3DXTA 5F3GA 5LY2A 4YJ2E 2YBKA 1VOMA 3H3AA 1S35A 1BR2A 2A2FX 3P8CD 2LHNA 5E0OA 2BZBA 3QUJA 2YBSA 3AA7B 3OPTA 2ZM0A 3CQXC 4ILUA 4JEHB 2K9AA 1EZ3A 4O2AE 4OFZA 4BJNA 4C91A 3O9XA 5FZ6A 2JMKA 2XTLA 2XAGB 5FZEA 5A7OA 2LSYA 2ACXA 4IE0A 4PJNA 5EK4A 3LG7A 5E6HA 5F5AA 5FZFA 4CCJA 5HXSA 3DXUA 2YU2A 2LT3A 3CWZB 3HKEE 3N9QA 3NBXX 5H6RB 5JDHA 5ANQA 3FXDB 4GIWA 2J1DG 2PG8A 1ZHCA 4BISA 5F5IA 2CXLA 3ZMVB 3JC6D 1MNDA 2DWKA 5CA1E 2KXPB 4IE7A 2BDEA 2KNDA 5DQVA 3AVSA 3MA9A 3VU7H 3AL5A 5A7NA 5ISLA 3KV9A 4AXPA 2YEVC 3PU8A 3FHNA 1IJ5A 2IC6A 3RC8A 5FP7A 4HOOA 2V7IA 4BJMA 4DO0A 1D0YA 2C5JA 2G0UA 3UFEA 5FY1A 4TZ4C 2XQYA 2ZM2A 5FJKA 5K4LA 4XDOA 3OBVE