3KVBA

Structure of kiaa1718 jumonji domain in complex with n-oxalylglycine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 113
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kvbA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kvbA01
4AAPA 3KV6A 5FZMA 3PUQA 4GJZA 3PU8A 4UF0A 3N9NA 3LD8A 5FYVA 5F3IA 5FP4A 5F3GA 5IVVA 2YU2A 5ANQA 3AL5A 4C8DA 5IVYA 2YBKA 5ISLA 2YBSA 4CCLA 2PXJA 4QXBA 3DXTA 5F5CA 5FY4A 4CSWA 4GAZA 5FZ0A 4QU1A 5FXVA 5FZFA 5A7WB 5FPVA 5A1LA 2W2IA 5FY1A 5FXXA 2VD7A 4AI9A 4IGQA 4EZ4A 5F32A 5CEHA 3KV4A 2P5BA 5IVJA 5LY2A 5FZ8A 3KVBA 5F3EA 5IW0A 4LITA 4XDPA 3LDBA 4EYUA 5FP8A 4QX8A 4QXHA 5FZ6A 5FZ1A 5FY7A 5LW9A 3K3OA 5F5AA 5FBJA 3PU3A 5FUPA 5A7SA 5FZCA 5A3WA 5E6HA 4D6QA 5FV3A 2Q8DA 5F2WA 2Q8EA 4BU2A 5FZBA 4Y4RA 2YPDA 3N9QA 3OPTA 5FY5A 5IVCA 3PDQA 3DXUA 2YBPA 5FUNA 5A1FA 5A3TA 5IVFA 5FWJA 4HOOA 3N9PA 5FJKA 5FZ9A 5FPLA 5FZIA 3ZPOA 2OX0A 5F3CA 5IVBA 4CCNA 4CCKA 3K2OA 4NUBA 5FZOB 5K4LA 5FY9A 5F39A 3NJYA 4BISA 5FPAA 4HONA 4TN7A 5FYMA 4URAA 5FZLA 5FZ7A 5FYUA 5FZ4A 4CUGA 5FJHA 5IWFA 5A7WA 3ZLIA 3PUAA 4GJYA 4QX7A 5FYHA 5FP3A 3PTRB 5IVEA 5FZOA 3AVSA 3U78A 4LIUA 5FZDA 3UYJA 4ASKA 4CCOA 3KVAA 5FWEA 5FYBA 3OPWA 4UF0B 4BXFA 5FY0A 2OS2A 5FYIA 5FXZA 2WWJA 4Y33A 3N9LA 5FY8A 5FYSA 3K3NA 4CCMA 5FYYA 5LWBA 5FZ3A 4IGOA 4D6RA 4DO0A 5F5IA 2OT7A 5FZEA 2WWUA 2XUEA 3RVHA 3U4SA 2XXZA 4LXLA 5A80A 5LY1A 2XMLA 2Q8CA 2YU1A 3KV5A 4GD4A 5FYTA 5FP7A 3PURA 5A7PA 4EZHA 2XDVA 4DIQA 2OQ7A 4QWNA 5FYCA 2GP5A 4XDOA 5FXWA 3PUSA 5F37A 4E4HA 4IGPA 4V2VA 5A7NA 5FPUA 5FZAA 5KR7A 5FPBA 5F2SA 3N9MA 5FZGA 3N9OA 4V2WA 5FP9A 3AVRA 5A7QA 5FYZA 4D6SA 2GP3A 5A3PA 4CCJA 5A7OA 2OQ6A 4Y3OA 5FZHA 4QXCA 3KV9A 5FZKA 5A3NA 1VRBA 3AL6A 4LIVA
chains in the Genus database with same CATH superfamily
3PUQA 2WNVC 5K7PA 4HKAA 1EPWA 5ISLA 3W15B 4HVRA 2UUBT 2XR4A 2CXDA 4IEXA 1GUIA 5CKNA 5CEHA 4AI6A 4GH4A 5IWAT 5KXBA 1NCRC 2MYSA 2VL4A 4LA3A 4DV5T 4IDPA 5E6HA 1PIV1 4LF4T 2WSSV 1SBEA 1G73A 1W9YA 4MHRA 3O1UA 3R6NA 4JI0T 2L9QA 4KMCA 4PDWB 3BQLA 5JRCB 1N3QA 1PK6B 5LA9A 5DDJ3 1LEDA 1MR5A 1UF2C 2YDRA 1WW7A 1AL23 2DVFA 3EHZA 1ZM1A 1U5IA 5FQ0B 4O2AE 2FCUA 5FYSA 2A6XA 4D7YA 4U2AA 4I01A 2CGPA 1EYBA 4WZFA 4LO6B 1T72A 2RPAA 1CWPA 5FKCA 4QXHB 2VBBA 5A7NA 4XCBA 5A7QA 4IE5A 3SXWA 2R061 4L2NA 1CGPA 2BZDA 2P4EA 1UX6A 1FT9A 3C50A 2WFF1 3ACHA 4P0BA 4MBQA 2M6IA 4DEVA 2QVAA 2AXDS 1TMF1 1NA1A 4A6OA 4QKBA 4XZPA 4PJLA 1UPIA 2ZEXA 1KS5A 1MS1A 5DMYA 2BKOA 2PG8A 1OSGA 3RI8A 5LBMA 4EN6B 4IREA 2QDRA 1L7QA 3S4UA 3SHRA 2QQWA 4LBQA 4DXSA 1HN0A 2ZMKA 2BW8A 4UIGA 2VMDA 2X0YA 2RG4A 4KQ7A 3BTAA 2DCYA 1V70A 1HKDA 1OLRA 2CXLA 3CPZA 3LSVA 1SFYA 2VASA 3KMHA 2HWF3 2PHRA 2ZMNA 1SFPA 3ZMZB 4FQ4A 1W39A 1YO8A 5DQ0A 2VZTA 2VR4A 2OQ7A 3GN5B 2BEOA 3O0WA 1ZKEA 4PDWA 5JRCA 4AKHA 2XWBB 1AR61 2CXFA 4Z07A 4K21A 3C8XA 3QC9A 2J62A 1UKRA 2LT3A 1XE8A 3HR0A 3NWIA 5FQ0A 2ZZQA 1GNHA 3RQWA 5KHIA 4FCAA 4YHHT 4HK8A 2CWYA 3ZJ1A 2VH9A 1R081 1HV0A 1YI9A 1F4AA 2WM9A 4RFT0 5DAXA 2AENA 2KT9A 4QXHA 2WAAA 1WUVA 1UOJA 3RFRA 3NNGA 1UX5A 1YKHB 1DF0A 4AKGA 5FYMA 5FZLA 2GNTA 4KWLA 3TWIA 1TME1 4OVEA 3U14A 4KWUA 4FTBA 3TLSA 2Q4SA 2HN2A 3RC8A 3MW2A 1NE4A 3VZKA 4BXFA 4Q5OA 3F2ZA 2OYZA 1B7TA 5TSWA 4KG0A 4EE2A 2PLV1 5EYXA 1HQNA 4L9IA 3DPRA 4N53A 1O4YA 2EHOA 3UFEA 3GZTB 3NVOA 2BWCA 1YC61 1UZVA 1PNGA 3VBOC 5KR7A 1XNTA 4DINB 2XASB 5AC93 3DP7A 1W9TA 2JQQA 1WBFA 3KCXA 2F4LA 3MF9A 5KHKA 2WZR2 2JB8A 3KHBA 2XTLA 1PO12 3CNAA 3WW1A 4H9OC 4PT6A 1SLBA 4IGQA 4IEPA 5J98B 2Q8OA 3ZT5A 3J8F3 1REDA 4YVWC 3GN5A 1WA6X 1O59A 1YQ5A 4ZXEA 4D6QA 5IK7A 3EYPA 2D6NA 2K5BB 1K3IA 4HOOA 5CZKA 1HX8A 3O1VA 1XNRT 2WO7A 4UFJA 5KDMC 3RGBA 3KVAA 2P3YA 3VRBA 4TSVA 4JRAA 3C4WA 4YZ5A 5AQLB 2OT7A 2VOTA 2I0MA 3OSDA 4GK5E 2UXCT 1IZNB 1GWMA 1ZRRA 2V4AA 4OUMA 4DUYT 4JI1T 3Q9OA 3WDUA 3G6JB 4BDVB 1C1LA 4L92A 1POV3 4QB2A 4QXCA 1XRUA 3FJSA 2ARAA 1KFUL 2VWAA 1W8UA 4GOUA 2LRLA 4AGGA 2YGLA 2WNOA 4A45A 4B4QA 1BHGA 2VPVA 4MX3A 2RR11 3CDZB 2WBLA 4CI2B 3LE0A 4HPKB 2WDQA 4HZFA 2XVKA 1W0AA 1VCSA 2XVGA 4H7LA 1UPSA 2XQ5A 5A1FA 4NE9A 3N2OA 2ZGRA 3L8RA 1BBT2 4WM7C 5F39A 3O1PA 4JI8T 1L3JA 3GYDA 4BH9A 2D5HA 4O8SA 5FL0A 4GJYA 4FOWA 1T98A 1S0DA 4F6RC 1HB3A 2HWD2 4BE3A 4AFBA 1JYCA 2XONA 2LSIA 4U72A 3ZMSB 1OC1A 3OUJA 4CI1B 3FBLA 5E8AA 4K20A 4I0AA 3AAIA 5DDJ1 4XJZA 1SACA 1ZV4X 2VZRA 5FYZA 4CU8A 4W50A 5LASA 1AL21 4HXCA 4CDQC 1YI7A 4PBPA 1DHKB 1FI2A 4ATFA 4IEWA 3RQ0A 3KT1A 5BMVE 3Q9DA 1UU6A 2R6GF 5HEOA 2WA3A 5KWRA 5L3EB 4CN4A 1VAVA 4LNVA 2VCBA 4QGNA 3V5UA 3JCIA 2GAUA 3IAQA 5EJZB 2H0VA 3H8RA 1RUG2 1PZ9A 3JBG3 1GSLA 4CEWC 3AEAA 2WQYA 1W3VA 4OYUA 2DUOA 4XMIA 4AF9A 1MMNA 3NNMA 2RS13 2PTMA 4K8FA 2DL1A 4CVUA 3CK6A 1Z0PA 3P4RA 4DR7T 3NAPC 4HPKA 3B13A 3B00A 2UXDT 5FMDA 4XILA 2GNDA 3ACIA 2W91A 2ET1A 4IE6A 2JJ6A 2E63A 2ZM0A 3TN92 3FBZA 2BU9A 1AHSA 3KF5A 2E53A 4M0NA 4XIOA 2XKOA 1A3KA 2XAFB 4LBNA 2WU5A 1A6CA 3V56A 1LHUA 2XL7A 4W6XA 4QPIA 3THCA 3BVCA 5FFOC 5B4NA 4LUMA 1VBB2 4WZCA 5JDQA 2XM1A 4WBNE 3FHIB 2DWKA 1W04A 5KXJA 3HT1A 4DUZT 1W6MB 4META 4X1YE 2E9XD 4I2OA 5LK7B 5F2WA 5GZCA 5IFPA 3M3CA 2QUOA 2LM3A 1SDDB 4OI0A 4XJAA 2GK9A 5C4WB 2ZHLA 2BOIA 3IA3A 2QQUA 3AE4A 1V0AA 2N9DA 4E9KA 4AI3A 4CCDA 2BVLA 1OT5A 3O7OA 3P8CD 4LKFA 1U0AA 5CFCB 3RKOA 3WF2A 2JRKA 5CU1A 1XNCA 2W00A 2XHEB 2NMNA 2JXAA 2VZPA 5HXVA 2G9FA 2BG9C 5DZFA 3M65A 3S7IA 2M6BA 5FK7A 3AL6A 3VZMA 3KV6A 4PFOA 4RR3A 4DS0A 4P9YA 3H42B 4PBOA 4CCLA 1AYN2 1R8IA 5FXXA 3JUUA 5DUUA 1CAWB 3HBKA 3PUVF 1DYOA 4A6SA 2I07B 4DMVA 3OD0A 4YW1A 2Z42A 5FY7A 5FZ1A 3VBSC 1H1IA 5K8SA 2YV8A 1W0BA 5AC91 2VVSA 4N90A 4F7ZA 4I43B 3ZPOA 2DLRA 2JDYA 4BISA 4LHKA 4MGQA 4LF8T 3OGSA 2Q9QC 5EWSA 3LOBA 1L0VA 1XMOT 1ZBE2 3J8F1 2ARXA 4IL9A 4OMCA 3OEAA 4ZU5A 1IKQA 2VMHA 1M7KA 1UIKA 3KDSE 2VW1A 1WFDA 4YSXA 2PBIA 1VBC2 1FOD2 2BQPA 2CY6A 3T3YA 4TZ4C 3BN6A 4I09A 3RHWA 2WY2A 3J4UH 1S0CA 1KJRA 5C8CC 4BM8A 1WWYA 2LHNA 5LBEA 3NV4A 4BIFA 3L9JT 5DAPA 3FWEA 3VGIA 5C5TA 2WN3A 4LMFA 3I2IA 2ES0A 5AQHB 2N1GA 1W06A 1XXNA 1DQ1A 2HBTA 4ZPIA 3ZIXA 2G9ZA 4XFCA 1EAH2 3TLTA 4Z91A 3BI3A 4HE8A 1XSRA 3HIFA 5C6CA 1Z8UA 4AEDB 2ZZJA 2XAHB 3SITA 2FZ1A 4LUKA 1POV1 3MXZA 1RVF2 4D8MA 2WO2A 1MZ6A 3N9QA 1S0EA 4AE2A 2Z4FA 3L2HA 2ZM8A 5AQIB 3BQIA 3FLRA 4X1KE 4P9IA 5LOVE 4BJ0A 1P8JA 1MMAA 4OHWA 3WF4A 1CAWA 1SEFA 4B3ST 3ZSLA 5FKBA 4BHPA 2W63A 1BR0A 4PJJA 4A3ZA 5FYIA 2LM9A 1W28A 5F5IA 3AP6A 5HAXA 3PUHA 4PK5A 2OKXA 4COUA 4YGEA 1LKNA 5AFBA 2XJ7A 3RZHA 4QQOA 3ZFFC 1UAIA 3BOWA 4R9DA 4YPJA 1GWLA 1CZSA 4KHZF 2V6YB 3WDWA 1RUJ3 1VJ2A 1LNSA 2CTVA 5FCCA 5LCWL 2RV9A 3BODA 1OUXA 1LKXA 2MBGA 4YSYA 1YD8G 1NZIA 1N36T 3IBMA 4B7EA 2L3LA 5L3CB 1JOBA 3GZAA 2E5VA 4YFWA 1O3TA 1G6NA 4XDPA 3A8YC 1D2QA 2A6WA 2QFEA 5FP8A 1UCUA 1BMV2 3PU3A 1SG3A 4COWA 4Y1ZA 4FTSA 2EIEA 4YSFA 4LBQD 3IZOA 4IDNA 2ID4A 2DNXA 5HEGA 1YIPA 3FBYA 3VN4A 4M3CF 1X7NA 5EK3A 2AEZA 4V1Av 1PO13 1FV2A 4DV6T 3AMMA 4WW0A 3ITQA 1BVP1 4CE8A 5FZOA 1LOEA 4DVDA 3A23A 4FOYA 1SA0E 1UXZA 4AEDA 1W2NA 4FT8A 3BU0A 2UUCT 2AUYA 4GWJA 4XXAA 5LGNB 2XB6C 1PMJX 2WNVB 1WMDA 4CP2A 3OYXA 2YMZA 1QJZA 5BNPB 3EABA 3JBG1 3KWVA 3AP5A 1AX1A 1PMHX 2ATFA 3OBAA 4DV3T 1W6PB 3AKPA 1GV9A 1KNPA 4LF7T 1NCRB 2RS11 3KV9A 1PZ8A 5FAXA 3D0TA 5JR7B 3X29B 4M3CB 3H9AA 4C8DA 2DWRA 3IAPA 2EAAA 2QVSB 1N1SA 4PNIA 4KHPT 4LO7A 1AX2A 1GQGA 5T5PA 3A22A 3ZFGA 4B8EA 2IVIB 1C5HA 3HQRA 4Y24A 2QTWB 3VBRB 3AP7A 2V6YA 3AAAB 1DBNA 2F6BA 2W95A 3F57A 1LGCA 1W0PA 2K9ZA 4ZI7E 4NIAA 2RMU1 1SCSA 5J7MA 3N7MA 3AK0A 2XQYA 3PTRB 5T50A 2W66A 5SV5A 2PQQA 3T2TA 4AVVA 4CCMA 3T2PA 4XAXB 3PUGA 1VAKA 4NN0A 1GZ9A 2B1EA 5EIYB 2Q30A 4I3PA 4Y20B 3OJBA 4XEZA 2IXHA 4WBBA 4DR1T 2V09A 2VMIA 3ZN1B 5JDMA 3AKSA 4ZHQE 5A3MA 1UO9A 4CUBA 3HNBM 5C3OA 4JKMA 3Q5DA 4XFFA 1YNAA 1Q3EA 4XQWA 2IXJA 2CMRA 4B6XA 2WNVA 2VBDA 4DB5A 5DQWA 4CN1A 3ZXDA 5BNPA 3BPSA 4KMQA 2QQPA 2JQKA 3GGLA 4N7IA 3VD5A 2YOEA 1H0BA 1W6PA 5L3FB 2Q8EA 4Q4Y2 1NCRA 3R4DB 2G0UA 2GC3A 4QKDA 4AHXA 1UU5A 2H89A 1UX4A 3RPQA 3URFA 1OF3A 3FFZA 1UMZA 5IWFA 2VXJA 2YG0A 4QXKA 4MH0E 4UF0B 1AX0A 1Q8OA 4UFIA 4MZUA 3WF0A 1OUSA 3DJBA 3UJOA 4DPNA 1QJU3 3U4SA 2LRPA 5FZEA 5FR3A 4KBMB 4PQQA 3MIHA 4COZA 2W1WA 2FCVA 4QX8B 4Y4YA 3VR8A 3ZSEA 1ALYA 3OYZA 3RX6A 2VECA 5HXMA 3FUOA 3VD7A 5AQVB 2JG9B 3ES1A 5FZMA 2ZX4A 1RIRA 3BGAA 4Q4V2 1DLCA 2VM9A 1UX7A 2W2IA 2WWSA 4DNDA 4EXTA 1S2BA 5JR2A 3DYPA 1S2KA 2NMOA 2RHPA 2HWC2 4CUAA 4P9GA 3L39A 4LHNA 1JNZA 3RC3A 1AJ3A 1HG5A 3KD4A 2DTWA 2YROA 3K2OA 1W6OA 5FPAA 1W2OA 2PTFA 5A3UA 3IBPA 5JVDE 3VBOB 2TUNA 1A8MA 1XDOA 5C9AC 1BCXA 2QCSB 1IKPA 1DGWA 3CMGA 4QX3A 4AVTA 5JUVA 4YNIA 2FDFA 4UFLA 1UYZA 1UQXA 3H1WA 2YPJA 4IUGA 1PVC2 1S4CA 5SV8A 2N2NA 2Y38A 1K5MC 4YVWB 3AKQA 3VRAA 5CKMA 2VZSA 2BZBA 4UF0A 2WZIA 1UOBA 4XZUG 2XQ8A 4HWCA 3EDUA 1JW6A 5GZGA 3I7DA 1UD1A 1XNDA 3T1YT 1QJFA 3OOXA 1GQHA 4QX8A 3ILRA 3AZWA 5C5UA 3I2FA 1S55A 3KLSA 3VL9A 3O4XE 1PGL2 1HX1B 1PGW1 4DMWA 3UU3A 1RUJ1 1KRIA 4IETA 4CDUC 2ORXA 4ISQA 4FTEA 3POSA 4P0AA 1BEV2 2QYWA 3ZLIA 1A78A 4AFCA 5T5LA 3UKVA 5L73A 1SE7A 4O9EA 5FZDA 2D3SA 5HCBA 4XIKA 4AI1A 4U7IA 4HFIA 1K12A 3M8LA 3N36A 1YQ3A 4CTEA 4U2YA 4IW3A 2C5JA 4BLIA 1C3HA 1NYWA 3WQ7A 1PO11 3LJCA 1K5JA 3OD4A 1R64A 2PHDA 5A70A 4URTA 1YCIA 3VBOA 4JKKA 1E5HA 5HCHA 2BBVA 3I49A 5FZFA 4DBRA 2AACA 2XUMA 2IVJA 3WNXA 3CF6E 1D4M3 2UY8A 4V1PA 4GB32 2RDNA 5LRRA 4G3YC 3Q8EA 4D7TA 4HK9A 3AZVA 3GJAA 1F9KA 4YVWA 4NXNT 1JHJA 4JBWF 2OXBA 3AE2A 1R093 2PHFA 4IEOA 3MIBA 3WD5A 1Y3TA 1F4HA 3P6BA 2K9AA 5IVEA 3RJRA 2OW4A 4CDQB 4IV3C 2FJAA 1RGSA 3ETVA 1O8PA 4I55E 5FY8A 4A42A 3K77A 1VPHA 3C98B 3RSJA 5LG4A 4M01A 2X0LB 1SHWB 2OPWA 4YW7A 4S2DA 4XDQA 4XUQA 1L7LA 1GZWB 1TNRA 5FPUA 4EWEA 1J1LA 3N9OA 3GA8A 4CCJA 3HNYM 4R4ZA 1X36A 4NMIA 1MS3A 2V4VA 1S0BA 1UL9A 4C0HA 3BTZA 1NLQA 4IERA 3K48A 5K0UB 2M67A 5JIUA 4CU9A 2WNUC 3WV6A 2E7TA 3K1SA 4YTPA 3NRXA 5LGUB 3IDCB 3LDBA 4UAPA 5JMCA 3O1SA 3K3OA 5J37A 5AQPB 5A7SA 2PAMA 4YSZA 1N32T 3HWJA 1ZZCA 2XQXA 4CDXC 1CX4A 2HWD1 2GC0A 4EB6E 5LJNA 1H1AA 4BYYA 3T1MA 4MXWB 4RGAA 1VMJA 1XNKA 3SFDA 4M0HA 4TXWA 1BLZA 4AWDA 2VKDA 4AVSA 2DCKA 2W0XA 2WL1A 3KQRA 1UZ0A 3I3MA 5FDBA 4HN9A 1XDPA 3GF6A 5CB4E 4H2AA 4CEYC 3AKTA 3M3EA 5LY1A 5LATA 3O9XA 2UU9T 1MIVA 3HA4A 4YXDA 5IATA 4EZHA 4E2GA 5FYCA 2DFCA 3W59A 1JI6A 1WRDA 4O2BE 2R1DA 1VIWB 1BVVA 5LHHB 1G7YA 2WA4A 4XW3A 2VZ3A 3MICA 4NVPA 4AHWA 4CDQA 5F3GA 4XABA 1YRZA 4AGVA 1QJX2 4RYDA 3HKDE 5FOJB 2EIDA 2HHHT 4NHYA 2A1XA 4M3CE 1VBD3 1CD3G 1I5PA 1PIV2 4GWIA 4H9RC 1JYWA 4IE4A 3FUQA 4MV2A 4LF6T 2YEVC 2CWMA 5DQVA 4ONUA 1IG0A 2CU5A 3AYEA 4LBKA 4H9QC 3ETPA 5C2TA 4B3RT 1UURA 5K9YA 3TN91 4OHXA 2RM23 3FN9A 3NV3A 1JTZX 1OURA 3PUZF 3OG2A 3F31A 3ZSSA 2RDSA 5LA6E 5J3UA 4Q4W3 5L3BB 4U74A 1W9SA 1F8VA 3S5AA 4X6RB 4AEJA 4YYOA 4LBMA 1AR92 3AZYA 2DVDA 2ZKLA 5CYYA 2R062 1OH4A 3A7MA 4IEVA 5C8WA 3UFGA 5ABHA 5TAOA 3VBSB 2D6MA 3P1IA 2IXIA 2JIJA 2JDMA 5FPXA 5GM0A 5JOWA 3ZXGA 3UT5E 5KXDA 3FB2A 1NXD1 1TMF2 3N4MA 5A7WB 5A1LA 4YG0A 1UYPA 2MAWA 1MNEA 4JV5T 4E8DA 1OEDE 1G9CA 3TEXA 2PN5A 2JDUA 1WCDJ 3CBNA 2ZLYA 5EQUA 5KHGA 5JR9C 5FPZA 1ULEA 2H0BA 4I0BA 5JOZA 4I3GA 4N43B 1G8XA 4X5TA 4PHZA 1QEXA 5D2AA 1CIWA 1H4HA 4LE4A 4Q2FA 1H4GA 1XB9A 4AKRB 4PDWC 5HI0A 1PK6C 5A33B 2EIBA 2DFBA 3J7MA 4OCTA 3U11A 1YFUA 1AVBA 5LHIB 1O5LA 4U31A 1IJ6A 4YG6A 4D6RA 3ME2A 2XMLA 2NTXA 4DRRA 4B1MA 4QM9A 4EN0A 2WP9A 1RUF2 3WG4A 2QDNA 3O1TA 3RYCE 4MYEA 3WDYA 4XETA 1AR62 2ZEWA 4QM8A 3QOPA 2V73A 3ZFEB 2BG9A 3ZXJA 2WIIB 4E4SA 4JGYB 3AE9A 3R84B 5HXHA 1R082 1Y43B 1U12A 4H63V 3ENRA 1ZEEA 5FMBA 5DG1A 4EWAA 3WI3A 3CLPA 3FZKB 1UY1A 2RS52 1HNWT 5GZDA 1FMVA 2V5YA 2X5IB 4CA9A 5C8YE 2XAQB 3DXUA 3VBSA 5T54A 1VBC1 5LCYA 2D44A 4ISTA 1DGRA 4Q4V3 4AK3A 1OFSA 2I45A 1WMXA 1BXHA 3HKCE 3I0QA 1TME2 2B42B 5A7WA 4CDWB 1D4M1 3CL1A 1CAXB 3MDPA 3ZFFB 4R9BA 3UYJA 2WWVA 2CWSA 4PI2A 3WNLA 1AUYA 3RIAA 2KSRA 3LKJA 4MHUA 3H3MA 3AE3A 4FO9A 3M7AA 1R091 3IMMA 2F17A 3SISA 4NHMA 4N43A 4XF4A 2VY0A 1IZ3A 3TBDA 5LHGB 4V2VA 5F5WA 5LEKA 5JSRA 2OIIA 4LO8A 5A33A 3ZYKA 5C8CA 5FVKA 2WKKA 4Y1UA 4LIVA 3AXEA 1OPOA 4J1WA 3RNSA 4YY3T 4AQYT 1KGYA 4XUTA 4O4LE 1WLTA 4JI4T 2R32A 3OB8A 4CXYA 4Q0PA 2NPIA 4ET7A 3J26N 3I2GA 4S2GA 3VKLA 2E26A 3H7JA 5LRSA 3BPZA 3I0OA 1HRV3 3BKZA 1UU4A 2YK0A 5BNOB 3CHXA 3ZFEA 3IWZA 1UXXX 3T0DA 1E5SA 2VKOA 3I9YA 1SLAA 2ZXQA 3MPPG 4DV4T 5FY9A 1SCRA 3FZHB 4TN7A 1LOAA 3U07A 2EIGA 2GALA 2CE7A 2HWE3 5BXXA 1JOPA 5JQGE 3ZKUA 2WZ8A 1RHI3 3X1DA 3K4AA 3KQ4B 2ODUA 4NPMA 4TWDA 3N9LA 3PIGA 4A7ZA 5AQOB 5JI9A 2X5IA 4QX1A 4FOQA 1RUC2 3BYWA 2WDBA 2Y26A 3BTYA 4JI2T 2HWB2 4CDWA 3RDIA 2ZEZA 2XQ3A 1FJGT 4LFCT 1CAXA 4PK4A 3ZFFA 1ZZ6A 1H30A 1BMV1 4LHLA 3KS7A 5L4HA 3KT4A 5I8TA 3QUJA 1FMD2 1D0HA 1U5XA 2YBKA 3RYHE 5JDBA 4HFSA 3C4ZA 1HNXT 3KV4A 3AE1A 4YVSC 3IEEA 1K45A 2ETEA 3LA2A 2RR12 3V0BB 3ZVXA 2LTNA 1HJGA 1PX3A 4L11A 2JECA 2D98A 3D5OA 2VMGA 2BS2A 3I2KA 1US7B 4IEQA 3WCRA 2RA1A 4H3WA 1ULOA 4D69A 4D94A 2C9KA 3JAEA 1VBD1 1LOGA 2W1QA 1G9FA 4S2HA 4LLFA 1ENRA 2BDEA 3RRCA 2XBO3 3TOJA 3CJIB 1OA3A 3ZSKA 5LEJA 1UYYA 5DDJ2 2XJQA 4TLFA 3KCYA 4TZDA 4YZ4A 3VD3A 2GP3A 1AL22 2ZX0A 3H50A 1HB1A 2RM21 2HH7A 4HWFA 5EK2A 5HBAA 2Q1FA 2VL0A 2WN2A 4Q4W1 2H7VC 4AKLA 3HT2A 2DVBA 5DAQA 3IHRA 1XYPA 3UQ4A 4DXZA 1QY4A 2XKPA 2I6HA 3ZDVA 4B4RA 2D6OX 3JB4C 1RINA 1T6GC 1WMEA 2VVEA 4LORA 4K0KT 4YGBA 2NYYA 4CI3B 3RLFF 1YJKA 4U33A 3AX4A 2IIUA 4AQ6A 1O6UA 4MO3M 2XUEA 4ASLA 4KNCA 2LKGA 1O7FA 1W8TA 2JIWA 2GP5A 1S1AA 2Q5TA 4YM1A 3ACLA 4FPJA 3MW3A 1IAPA 3BQKA 5F6KA 4NIIA 3EI0A 4LULA 3KSCA 3OBTA 2HWF2 2ZGMA 1LENA 4Q4Y1 2UWAA 3E5QA 1R1A3 2GNBA 1OOPC 2YGMA 3WQ1A 1XNQT 2PFWA 4FFFA 4RHV3 3P3PA 3G06A 1JNRA 4QMAA 3FLTA 2ZGKA 2KM2A 1D1BA 5F5AA 2W52A 5C9AB 2DU0A 2CNAA 2OVUA 2VNOA 3I97A 1XNAA 4RFRB 1Q43A 2VXRA 4O61A 4R9AA 1HDKA 2BWAA 3THTA 1JZ7A 1U5PA 3H0OA 5L9VA 1OA2A 1ND3C 4UW3A 1I1EA 3SNMA 2Z6EA 2R0HA 3M3QA 5ABFA 4PIZA 1K5MB 2PHXA 1X9PA 5ABGA 4CCCA 4QXBB 4C91A 1OQEA 2VQUA 2XVLA 2Y6HA 2CWOA 2WQZC 1J3QA 2JG8C 1NLRA 4XBLA 2MOZA 4Q4V1 1H2NA 3VKHA 1WLXA 2A6VA 2X9YA 4I0UA 3FL7A 1NWMX 2J1AA 2PFVA 5ERLA 3ZCIA 4NO4A 3OUHA 2TEPA 3GZEA 2HWC1 5ANQA 2A75A 2QQNA 3I59B 1NAEA 2VQET 2W61A 3RS6A 5JDFA 1IBLT 4CDUB 1JS9A 2PMWB 3IIAA 2D5FA 3CO2A 5CG8A 4B29A 4MUVA 2DCFA 4K6BA 5AC92 3SCFA 1HW5A 4HWDA 5IK8A 4W4ZA 2FMDA 5C4WC 1IS6A 2PELA 3Q8FA 3RWNA 3PUWF 1RUD3 1DU3D 4ITCA 3V0AB 3J8F2 1QHDA 4LJHA 1FIOA 5CFCC 1LEMA 1VLNA 1PVC1 3WF3A 3VBUB 5C3RA 1Y9MA 1KEXA 3RYRA 4BJMA 2VZ1A 5C9AA 3VBFB 5JDLA 4ZHNA 1WYBA 1CJDA 1O4TA 4E4DX 1BYHA 1OVSA 4OK0A 4ZZ8A 3JD73 2FHRA 5HXEA 1JZ5A 4GKXA 5FZGA 5FP9A 3WQBA 3IT8A 1DLLA 2IFRA 1KS4A 1QJY3 4LFBT 3ZXAC 2XH6A 2BGCA 5FYVA 2YB7A 1K5MA 4P9LA 1PGL1 5IVYA 4QXBA 1QOSA 2MHFA 4H7MA 1ZBA3 1S0GA 2BPA2 1D0XA 1W03A 4KL1A 3O1IA 3E6DA 1BEV1 3VDDB 2ZOEB 2BFUS 3BU7A 3ON7A 3UUNA 4B1LA 4BOWA 2FBWA 3V5SA 4GK0E 2D3PA 3U10A 3TNQA 5FRAA 5GLUA 5ACA3 4JGZB 2FDJA 4AEMA 3NO8A 2VKHA 3Q5WA 5HEJA 3MIGA 2AR6A 3POBA 3I59A 5BNNB 1JODA 2Z5WA 4CDUA 4FI5A 1RUH3 2B76A 3WW2A 3ZPYA 2ILMA 1JYVA 2Z69A 2GC1A 4W65A 2A7AA 3DKWA 4UFMA 3NV2A 4NWVA 3LFIA 1ZRCA 3PUYF 3Q8AA 2BV4A 2OUJA 4DEQA 1HRI3 5JREA 4S2FA 3V0AA 4GB31 4FOVA 4HG6B 2XBO1 1QDCA 1OA4A 3VBUA 4HL0A 3PVNA 4DV2T 4RS5B 4EQVA 2ZEYA 3VBFA 5ADXL 1DFQA 3MYXA 5AQSB 5FY1A 2WO3A 3W20A 3ZXEA 5F3EA 1LU2A 3E6CC 4O4HE 3M4FA 3RWKX 1MEC3 4QDQA 2VUCA 1LHOA 1DQ4A 3MF6A 1FX5A 4COFA 4AI0A 2HLEA 5DJQC 3MUY1 5GJ6A 5FZ9A 1BR1A 4CCNA 4AW7A 1QIQA 3S7EA 1LHWA 1KDMA 4PIYA 3Q8BA 4C1WA 4NOTA 1WLWA 2GNMA 4NRMA 2V72A 3VDAA 5BYNA 4DV7T 4ADZA 5JAXA 2ZM6T 2IUWA 4SLIA 1COV3 1RITA 1V6LA 1H6YA 3LIGA 4IV3A 2A3XA 2H6CA 4I0WB 4P09A 4H9PC 5CFDB 3JBG2 2WRAA 4L0PA 2IC1A 1GZTA 4YZ2A 4QQ2A 1X79A 5JCTA 2XLGA 4AL9A 1IHMA 2E2AA 3KBUA 5BNNA 2RS12 3MIDA 3FHAA 1NLSA 5JXHA 3H3AA 1KEYA 4BK5A 1VBA3 3TNPB 3BTXA 2HBUA 5IHYA 1SDWA 4FXGB 2WNEA 3RYKA 3OCPA 3H1MA 4JZRA 5KC6A 5JTGA 2ACZA 2ES3A 4ERRA 4Z2AA 1T2XA 2ZGSA 2XG3A 5FBJA 5FUPA 1Q56A 2JDNA 5IT6A 3LB9A 5CKQA 1CPNA 4ZKTB 2UWCA 4Q4X2 5D21A 2HKXA 1VCTA 2XQ4A 1JUIA 3ZYMA 2CV6A 3QD6A 1R1A1 1IBKT 4IEUA 2A3WA 4RS5A 1XU1A 4CDXA 2WDRA 3H3LA 1D1AA 4QT6A 4A98A 3PJQA 4LBOA 3AM2A 4AFAA 2VUDA 1XZYA 3ORJA 5LP6E 1JHNA 2OS2A 5FXZA 3LEKA 3TB0A 2JDPA 1D0YA 3S5QA 1CZVA 1FYUA 3SEEA 4CEYA 5M0TA 1N47A 5BNPC 3T0AA 1QJX1 3WNKA 2WZHA 1HNZT 2R7EB 3ESLA 1H7CA 4EN9B 1SLTA 1B35C 4DOUA 3ZXKA 4XQDA 1XYNA 5EYYA 3GHMA 4NIGA 3THPA 2DVAA 5DZEA 5JR9B 5JXJA 5KHHA 5EP9A 1WZXA 5HEUA 4DV1T 2CDOA 3AYDA 1IS4A 2YDQA 2LE8A 2VD7A 2OPKA 1KDKA 1S0JA 3GBFA 4AHZA 3EMRA 5L4EA 4AAXA 3AMQA 2ZA9A 3D82A 2R30A 3ONJA 1MS0A 4AFMA 3M2MA 1F5FA 3VBRC 3SH5A 2YFZA 1M62A 4OHVA 3N9PA 5IVBA 2BERA 3RZJA 3UU6A 3GCXA 1JU4A 3OJAA 5A6YA 2DYCA 2F4PA 3LGRA 3ZYGA 3KINB 2IW5B 4U7YA 3SC7X 1AR91 1LB2A 3ZT7A 1WLDA 3QH7A 5GLVA 5FWEA 3OPWA 5L19A 4KBZA 3PDYA 3VD9A 2CM0A 4CRQA 3SCGA 3BB6A 5M4YA 3RRDA 1H1MA 4OZOA 3ALQA 2KWHA 1EUUA 3B02A 4HFCA 2GN3A 1XC6A 4OYJA 4R8HA 1RUD1 4YW5A 5KBFA 3AEFA 1N33T 1UOFA 2WS3A 5AFEA 1W6QA 4Q0UA 4OX9T 4P5HA 2ARCA 1UZYA 4L8QA 1H8VA 1ZX5A 3ZO0B 1OEDC 4K8RB 3P4QA 3P5BA 3K46A 4GWNA 3WY6A 3JD71 1UY3A 5D8AC 3USUB 1LCLA 1FNYA 3U1XA 2AEYA 2LSKA 1QJY1 4A3XA 3OPTA 2W68A 5LMUT 5FBZA 4FPFA 3C7OA 5JR9A 5EPAA 1BJQA 1ZBA1 3AFGA 5FZ7A 5L9RA 2C26A 3IB3A 3AMHA 4BQ4A 4O65A 1RUF1 2DBIA 5FP3A 2KZ7B 1LAJA 4LIUA 1RYYA 3P4SA 2R043 2XJRA 1PK6A 4UV8B 5LK5A 2QQOA 4A5XA 2WYSA 2Y60A 2A71A 1U5YA 4TV9E 5ACA1 1GANA 2VKJA 1ZZ7A 1SUMB 2JMHA 4MVTA 1UMIA 1H9PA 2G4IA 2NTYA 2XQ6A 3KZ4C 4V2WA 3PL0A 1GWKA 1RUH1 4GYRA 3IN9A 5HEHA 2AE9A 4TNWA 4AGRA 3E5XA 3I3BA 2RS51 2XPKA 5LGTB 1AYM3 2JG9C 2VOWA 4E4ZA 2YBSA 5A32B 3QOFA 5IFTA 5DUWA 1Q8PA 2RDRA 1C28A 1YQ4A 1Y4WA 4NPRA 4IL7A 3RMXA 4JUYA 3IDEA 3LSEA 2QQVA 1RUI3 1BQPA 3AYCA 4KX6A 5I93A 2Y6JA 1GR3A 1IG3A 1PGW2 3I3QA 3SOLA 1RUJ2 3FZMB 3WP6A 4HSJA 1G9DA 4XFGA 2Z79A 5I8SA 3UNPA 4AEKA 4LA2A 1NCQB 3SQOA 2QBXA 5FO7B 1LTEA 4FPGA 1W0NA 2PAEA 1UGOA 5E0OA 3NZPA 3WR0A 3RZKA 2C0SA 3JQXA 5FMNA 3USUA 1MEC1 4CZSA 3S6PA 4CP9B 4KI5M 5FL1A 4PJMA 3KF3A 1T7SA 5LA1A 1HQWA 4MLKA 2ZM2A 3N5LA 1S0FA 1SZBA 3O12A 4X65T 4DBQA 1N1VA 4YGDA 2LALA 2ET7A 4MXVA 3WNMA 4YVSB 4OZXA 3ABVA 1G8WA 3D0SA 5FZHA 4Q26A 1BK0A 2YZ4A 2GMMA 5IHRA 3SH3A 4JEUB 2BS4A 3MUZ1 1COV1 3T0BA 4ZS2A 3A4UA 3UUXB 3WEZA 2NW8A 3RZGA 4XJ8A 3RYIE 2I74A 1HJFA 2LSYA 3ZCJA 3CU7A 4WVZA 3E97A 3DECA 5A3OA 3WSOA 3M3IA 3A21A 1VBA1 3LPFA 3Q5XA 1OI6A 3UUBA 2Y6GA 4BK4A 5A32A 5CADA 3C7FA 1S35A 2FCTA 1RUC1 2WJSA 1TE1B 3ZOIA 2NP0A 4EYYR 4LT5A 4AXOA 4N9HA 2HWB1 3I54A 4UVBB 3K3NA 4XAEA 5F3JA 1F35A 2MEV3 4JDOA 4J1XA 3NVCA 4QGLA 2QRXA 5JH7E 4IDZA 1FMD1 4L99A 1NT0A 3O0VA 1NCQA 5FPBA 4G9SB 3I2OA 2B9UA 5EJ3A 1QGLA 4QPGB 4XZCA 5J36A 5J96B 4LF5T 4UW5A 4CP9A 2QGSA 1QXPA 1YEWA 2DTYA 3N7JA 3DN7A 4JCKA 4K40A 2XY8B 4YVSA 2XLAA 3MA9A 2WSUA 3A7QA 5HV4A 3QLQA 2RS32 1RJ7A 5FJKA 4NPLA 3CQGB 3RIUC 4QWNB 3ZKRA 3AB0A 3F95A 5FJHA 3WT3A 1LRZA 2A2FX 3C7EA 5HXSA 3TEYA 3AEDA 2VVDA 4OHYA 2QQMA 3AJZA 3N2GE 2Y6FA 2IHR1 1Q8QA 2O8QA 2LM2A 1MMDA 2P6CA 2PHUA 1OOPB 4GMP0 3EJKA 5J2UE 3PE0A 3OBRA 2RJKA 5HYAA 4HFVA 1HF8A 4RSUA 5DZGA 1FV3A 3IM0A 2ZCWA 4BAYB 3N7KA 4JTOA 2PA7A 1QJU2 1FPN3 1QSDA 3HMYA 2HN1A 3CQCB 3N7LA 5K0UC 1KQRA 1WKYA 3KVBA 2R6QA 5CNAA 1IGOA 1ND3B 3UKTA 2E5LT 3AECA 3MHZA 3MEPA 3HEIA 4M00A 3RH3A 1ULGA 1DQ0A 4NAMA 2OZJA 4PI0A 3EBRA 3VZNA 1BR2A 2W4XA 1XBFA 2JG8B 3LEGA 3TRSB 3N2KE 4LLOA 1A34A 1AXZA 5L2LA 4E8CA 4CCOA 1LVKA 3U0ZA 4C0BA 4AZZA 3WAKA 2X29A 3P4PA 2NWBA 3E6BA 2WT1A 4Q4X3 2HWF1 4LPLA 3VL8A 4IESA 4YTNA 3NBXX 2WMNA 4QWNA 2VMFA 1YJLA 3ZYJB 1QH7A 2D5UA 2B39A 4XTPA 3FC0A 3VBHC 3I2HA 2TNFA 2R041 1LODA 4YM2A 4UI9L 3WG2A 3EO6A 5LB7B 2HPJA 3H7YA 5G04L 4GIQA 4FVVA 4XAAA 4CSWA 3BK9A 4X64T 5J48A 5IVJA 1WR6A 1OOPA 4ZXLA 3ACGA 5LZ6A 1Z78A 1IPSA 4HFDA 5J09A 1ZP0A 1H8TB 3CIRA 4DNYA 5JWPA 5E89A 3T8OA 1X8MA 1AYM1 3T2OA 2D6KA 2X0HA 4H14A 4GXLA 1HCIA 3B5LB 2QA7A 2XJUA 4CUGA 1XU2A 3ROUA 4YT0A 4CXXA 4XF1A 5EJ1B 1ND3A 1U5ZA 5EZWA 2FDHA 1ND2C 4LKEA 1GICA 5HXRA 3JU9A 4DMIA 4DR2T 1WCUA 3U4XA 4CXWA 1N34T 3GXUA 2XDVA 2DI4A 3RZLA 5F37A 3SKVA 2B5HA 2JG8A 4MGIE 5F2SA 1XNBA 3WLUA 1UWWA 4IHJE 2WFF3 4BA6A 2RJLA 3AE5A 1KNRA 4E27A 2WC2A 4BQWA 4QX0A 3N9NA 3WP4A 3VHRA 1DGRN 1CHUA 5EZYE 4Z92B 4KG8A 2AREA 1YHFA 3J9SA 5A6ZA 1EP0A 4ZI2C 3UQ7A 5DUXA 2BBJA 1KITA 4XHXA 4ILBA 2VOXA 1X8EA 1V6JA 3P3NA 4LMJA 3O1OA 2HEWF 1ZREA 2J1UA 4HVOA 3RYPA 2ZABA 3OTOT 5T52A 5HCJA 1W6MA 5FUIA 4WVVA 4OUEA 4N43C 5GLTA 2LS6A 3PJAJ 3IF8B 2CHOA 1ACCA 1D4M2 5C4WA 4ARYA 1H2KA 2VCCA 2VAUA 2LROA 1CVNA 1J5ET 3LF7A 2D6PA 3RF1A 5LB6A 1RUE3 1DQ5A 5GONE 1O91A 5KMGP 1W8WA 5CFCA 3WDVA 4I50E 5JXGA 4LXLA 3AYAA 2WBKA 3RIFA 1R092 3KV5A 5FYTA 1ENQA 2W87A 3ZXLA 3HN3A 4YGCA 3L3PA 4O4JE 4PW8A 3ZSJA 4QAWA 2VG9A 1F5JA 3ZFEC 3CZUA 3NNJA 3ZR6A 5LNKA 3J7LA 3AP4A 1ULFA 3VV1A 5C33A 2YU2A 2VMEA 4JGYC 1GZCA 2VCAA 2OA5A 2SLIA 2ZHKA 1UY2A 2D6LX 3OEBA 5L7OB 5KX5E 2ACXA 4B3NA 2VTXJ 2DURA 1IBMT 2GU9A 4LMKA 2VZQA 2X5IC 2LW8A 4UXNB 4PQ9A 4TTGA 3W5NA 1EPZA 3B3QE 1W8FA 4JAAA 2WLPA 3R6SA 2LSGA 4CDWC 4MLOA 3SLIA 4ZXKA 2ZMLA 3NV1A 2BRTA 2IDOB 1W3XA 5F5QA 1GOGA 2XZEA 3AJYA 1WW6A 3CX8B 3HKBE 4MGTA 4P9JA 2WS93 3RI5A 3G7DA 1EUTA 3WP3A 4QX5A 4OYKA 1TQ5A 3PUSA 2WT0A 4K1YA 3IDBB 2P3IA 5A3PA 3ONLC 5C70A 2VU9A 4LBLA 3GALA 1CN1A 4HKLA 2MPKA 1YFXA 4GH4B 3NNFA 2G9GA 5LG3A 4MGYE 2N7GA 4ARXA 1OLME 4ILCA 2EXKA 3IIIA 1TZOA 5F32A 2WB5A 4FJOA 2GMPA 3L09A 5LW9A 3ZYRA 4G63A 5CFBA 3WCSA 3UJQA 3LEMA 1X9BA 2NP9A 1E2AA 5BNOC 3L2YA 1HX6A 1SPPB 4HMZA 1FPN1 3GCWA 5FO9B 3OY8B 2JPFA 3JCFA 3J7NA 2R073 5F1RA 4KBBA 3HNMA 1VBD2 4FPCA 3KB5A 4FAGA 5L7OA 4CU7A 1F15A 4RGKA 2J22A 2FDIA 4XUOA 1B35B 3ZDSA 4HWIB 1NQDA 4MHCA 1AR73 4OMDA 3POFA 4JLEA 2CDPA 5A7PA 4CN6A 3AB3B 2BOJA 2ZHMA 4LK7A 1D1CA 3OGGA 4BLJA 1MNDA 1KK7A 2RM22 1ST8A 4GALA 3ZSTA 2B8MA 1K42A 1CAUB 2VTFA 3UK9A 3JADA 1NA1B 3FHQA 1EV13 3ATGA 4Q4W2 2O14A 2R1BA 4Q4X1 1PHMA 1MACA 4J25A 2FJBA 3WQ0A 2JE9A 3SMHA 2UWBA 3H3ZA 2CBIA 3POIA 3FBMA 1GLHA 1OFNA 4GKKT 2C5IT 2CGNA 1QU0A 3JQWA 5H9RA 4NHKA 1CZTA 4TX5A 2Y34A 3NMBA 3WINE 2XQ9A 4EWDA 3OPCA 2Q1MA 1XJAA 4P5YA 1RMU2 4EEDA 4A7KA 5FY0A 4X66T 3KHCA 4ILAA 2IXCA 3ZYFA 5E1RA 1OQDA 4Q27A 5I8YA 4IGOA 4L97A 1Z7S2 4QQPA 2QJVA 3CJIC 5FLIA 5I0UA 3R0RA 4FPEA 4R9CA 1SPPA 2RS33 2WYFA 2YHJA 1OEDB 3EHKA 3OY8A 1ZZ8A 1SFNA 3OGRA 1JYNA 3J9X1 5D8AB 3EDVA 2Y8DA 3AFKA 2LJLA 3VKNA 1QWRA 4JX0A 3K4DA 3WX5A 3EUHA 2BFUL 1B35A 2UYBA 3AXJB 1W09A 3AKRA 2VZVA 3OKQA 2V8SV 4CUCA 1F2NA 1NEKA 5J0ZA 2W1UA 5F8PA 1M06G 1LOCA 4M3CA 2D3RA 3QACA 4ZZBA 3OBZA 4X62T 1WCSA 1DZRA 4TNVA 2GSYA 4Q0SA 4LO5B 1CAUA 4XHBA 2UU8A 3V65A 2ZKNA 3SFEA 5FWJA 5A3LA 5FREA 2ZJCA 2FDGA 1YWKA 1VBE3 1LJ7A 3VBRA 2QZ2A 2XQ7A 4YHJA 5FMOS 2B46X 1O3XA 5F6LB 3J7HA 4TWHA 3IPVB 4QB1A 5FYBA 4ATEA 1VALA 3DPRB 4N53B 1JZ4A 1RUOA 2EHOB 3FZ3A 1WCRA 1QJEA 3D0JA 2RDQA 3C7GA 5CBLA 3WNOA 2FJDA 4YZ1A 3W5MA 1W2TA 4XACA 4AOCA 4DV0T 3N35A 1XMQT 4Y20A 4QHZA 5T55A 3OVUA 2AC1A 4LKSA 2J4GA 5GALA 4QH4A 3HL6A 2V7LA 1V9U3 3A0KA 1RUE1 3PU8A 2J1RA 2E6VA 3GZUC 1QNWA 3K4ZA 5DPNA 3WNPA 2O0OA 4LITA 3E1F1 4BQ2A 3AEBA 1OEDA 3QB5A 1QXJA 3UV9A 3ETQA 2WCAA 2R16A 3ZM8A 4I4TE 5D8AA 3FXDB 2P9BA 1ASJ3 1R1ZA 5ETWA 4WV8A 2OX0A 1MIWA 3AXJA 4XUNA 4XMAA 1I6ZA 3LZZA 2BGPA 2VBPA 4WVMB 1S2EA 2NW7A 5AQKB 1H6XA 1S0IA 1HRV2 5APAA 3P4WA 4DXTA 4AHYA 4JVAA 2E32A 3NKGA 2DCJA 2ZGOA 4QXCB 1QUUA 1W8HA 1PGSA 1QLBA 2HWE2 2VW0A 4JV4A 1RHI2 1E1HB 2BTVC 1GP6A 3IPVA 3DV8A 5HWYA 1TG7A 5KXCA 1C8M3 3H37A 1DYPA 5IVVA 1J3RA 2WS91 4ZS3A 3AA1B 2EA7A 4AVBA 3M3ZB 1OXZA 1UIJA 3C7HA 2JG9A 5IK5A 2X67A 1E57A 2RP4A 4KUMB 1DQ2A 2A5ZA 3ZR5A 5T5OA 4ZONA 3JXSA 1D0GA 3SWHA 3WHUA 1MS5A 1LVFA 5IVCA 1NOVA 2X8KA 4AVCA 3ZYBA 2J42A 3RRWA 3ZYHA 1DU2A 5FVLA 4IGUA 1US3A 2JE7A 4AQFC 1Q5OA 1N1YA 1XYOA 2Y64A 4QHBA 3ABZA 4QB6A 1XQNA 4ASKA 2NLRA 5A1AA 5J1XA 2MNGA 1WW5A 2A6ZA 4AISA 3VBUC 1DG6A 5KHJA 4MADA 2DVGA 4YW6A 3VBFC 4GZ9A 3DCQA 4UXAA 1X9TA 1UN1A 1M4WA 4BPZA 3FHNA 5FXWA 4UR9A 1WGPA 1CESA 1GKBA 3UGFA 2R071 5J1GA 2IAKA 5CGMA 3THDA 4G4FA 3H8XA 4B7KA 4UV9B 4OI4A 5LBQB 4BQ5A 4FXKB 4WVMA 3WUCA 2XBO2 1IS3A 4N78D 1W9FA 1PVXA 1AR71 1N3PA 1LU1A 3DXTA 1ZZBA 3WNNA 2EXIA 1J1TA 1KXGA 4QX7B 3HQUA 3WF1A 2XQRA 3VKGA 2Y48B 2DU1A 4QKNA 2B9VA 2J1VA 2FZ2A 3VDDC 5JPMB 3LSDA 2YXSA 1AR83 5AQUB 1ULCA 3VZLA 3ZN4A 4O9GA 1MMGA 1L7RA 4RQPB 2UY9A 2VGDA 2BVMA 2O1QA 1EV11 4JGZC 2LKHA 4DUWA 3MIEA 1LHVA 4DIDB 2NOXA 1TNFA 4D0QA 3LOIA 5BNNC 4ZU4A 3HR9A 2ZGTA 3LEIA 3W9AA 1VOMA 3RQUA 1FAYA 3UGGA 4DY3A 3KM5A 2KD7A 5LYJE 4FFIA 3B5MA 3MLKA 2ZX2A 5FP7A 1US2A 3CKHA 4O7XA 4PLNA 4PF1A 4NUUA 3ONXA 3LCPA 4QPIB 4IE7A 2ZTNA 4XBFB 4GA9A 2ADDA 3LA7A 1PZ7A 1Z0HA 1O3RA 4RS5C 4COYA 3R4UA 5I91A 4PAGA 2RS31 5I0TA 4A41A 4YJ3E 5LJMA 2VUJA 4GMP3 1DYKA 2RVAA 4P9WA 3D3AA 5H6RB 1SQ4A 1YYNA 3TLUA 2HH9A 4JRLA 1A8DA 4XFAA 2YBPA 5FUNA 1RL3A 1R1A2 1ZRFA 5CVRA 3FFQA 1RC6A 2JDHA 4URAA 4RHV2 3RIUA 4QDSA 4QX7A 3BCWA 4GKJT 3VBHB 3LDQB 4B3MT 1NY71 1O8SA 2JDAA 1E7PA 1N1TA 1G86A 5FKYA 2GC2A 3ST7A 1D2SA 1LOFC 4RQPA 4HFHA 1QJU1 2GN7A 1VBE1 1HG2A 1QQP3 4YW2A 5CFDC 4FP2A 5I0DA 1CQ9A 4RR3B 2IXKA 5JOXA 1ENXA 4UYBA 3NL1A 1YIFA 2F4VT 4Q1PA 5JZGC 1GZWA 2C6SA 1C1FA 5JDNA 2KR2A 5HCAA 4JQTA 4XFIA 2W2UA 4AYUA 3MACA 2W67A 4F8AA 2DCZA 5L3DB 2V7KA 2CPTA 1F31A 1SMVA 3RGLA 2XWJB 1HB4A 4AI9A 2P5BA 4BZ4A 1W8OA 4AXPA 3LAGA 1JMUB 5K0UA 1LULA 4P08A 2YFUA 5FLJA 1SBFA 1O3QA 5CA1E 1AJKA 3AAEB 1V9U1 1KNZA 2K0GA 5JMOA 1ND2B 2ZGLA 4IL4A 4MFRA 2W5FA 3LK3B 2RMU3 4IV1B 4OFGA 4DY5A 3EQEA 2FUPA 4DRVA 1DGLA 2YKSA 5FYUA 1RJ8A 1ZA4A 3KFWX 3VR9A 1VRH3 2O8OA 5C3QA 5IJRA 3PMSA 2XSAA 5AVPA 4ZOLE 1FEWA 3U37A 1IPJA 4MXWA 1ASJ1 1MQTB 2Q8CA 3EXUA 2D93A 1IS5A 2OUHA 1LOBA 2W94A 4XDOA 1RUD2 1E5RA 4FBFA 3TLVA 3ZN5A 2V6XA 3VZOA 4INDA 5ANNA 1RMU3 3ZXFA 4IE0A 3VBHA 2EXHA 4BIOA 2YC2A 5HPOA 2Y0OA 2WAUA 3I2JA 3KT7A 5F7UA 4GAZA 2BP6A 1Z7S3 1YQ6A 4OHZA 5FZ0A 1AF9A 1SLLA 4EZ4A 5IAVA 3HVDA 2CHHA 3JD72 1T8BA 3NKTA 1ZOYA 3E22E 3B69A 2A70A 5BV6A 2XJSA 1U4QA 3CIHA 2JDKA 2R49A 2ENRA 3VHOA 2UURA 1QJY2 2E7QA 4Y4RA 1GOHA 1VB2A 4BJNA 3MO4A 1C8M1 5IVFA 3C4XA 3A0NA 1JXNA 2W9XA 3T30A 3AE7A 3WVJA 1ZBA2 2FQPA 4KGGA 1C4RA 5E16A 4X20E 4YZ3A 1J1JA 4EIWA 1UZZA 3VDBA 4L0RA 2WWJA 2DV9A 5ACA2 1ND2A 2W47A 2FBEA 3PURA 5IUQA 1D7PM 3QK6A 4IV1A 2B45X 2V7MA 4QQLA 5FIXA 1YUDA 2XOMA 3MZKB 4Z8XA 2VCMA 1RUH2 2OQ6A 4M4PA 4RA0A 2EALA 1CX1A 3D4KA 4LOSA 5FZKA 5A3NA 1MIYA 2B4KA 3DL3A 4K9SA 4R52A 3S30A 2AH2A 5I0RA 1NQJA 4XOGA 4JHZA 3SH4A 2XHKA 1MQTA 5FPVA 1O3SA 4BA9A 2IZWA 2CBJA 1YQ2A 1HRI2 2JMKA 3OGJA 3RJ2X 4FPHA 4GKYA 3PTYA 5A3WA 2YUEA 3MGUA 4Z8BA 4A97A 2K48A 5FZIA 4JI6T 5FZOB 3T2QA 1I9RA 3GBGA 2BNOA 3H8UA 2JENA 1HLCA 4Y22B 1ZYBA 1QH6A 2W39A 3AMPA 3NJVA 4NHXA 1MEC2 5IUXA 5ABJB 1KFYA 1BK1A 3E0ZA 2D7FA 4BCUA 4ZI3D 1AR81 3PLQA 4YWAA 4HSLA 2CEAA 4Q29A 1DZTA 4GULA 3VU7H 4X8NA 3ZN6B 4PK6A 2VW2A 2CGOA 1UNBA 2D9DA 1ZRDA 5L47A 5GZFA 1NENA 2CLYB 1J58A 2H6BA 4HN0A 3CQXC 4UW6A 1CUNA 4LO4B 4H9NC 1COV2 5C3PA 3ZFGB 2IXLA 2YY1A 4P02B 3B93A 4XBNA 5KXEA 4JGYA 3GJBA 1Y01A 3SKJE 4EYUA 4AFDA 1OPMA 4OQ8A 3I9WA 3WOGA 5CG9A 2B7YA 3ANWB 1DP0A 2H88A 3K51A 4NIHA 1VBA2 3C3VA 3OYWB 4XF9A 4CPBA 3K75B 3DEMA 2ZGPA 1NCQC 3T4VA 3HJRA 4BMBA 3KCCA 3WP5A 1HXS2 4GMP1 2JKBA 1XE7A 5DN2A 3VLBB 2JX9A 3MBWA 1MS4A 5C7GA 4ISSA 4E7SA 1DDLA 4EJRA 2WZR3 4HFEA 2VMCA 4WVWA 4BQ3A 3V64A 1EY2A 4TWTA 4DFSA 3NKZA 4JTNA 1WD3A 4XPVA 3LK2B 1JU3A 4K7JA 3CWZB 2UYAA 4A4AA 2RE9A 4Y22A 1UMHA 3CQOA 3I3EA 5ABJA 3NJZA 5B2GB 3ILNA 1RXGA 2K2SA 1V6NA 2PXJA 3BIWE 4EV0A 1LHNA 2YINA 5FO8B 4AG4A 4AVAA 1QQP1 1PO22 1WYCA 4NUVA 2XJTA 3LQCA 2VNGA 2D97A 1WMFA 3ZN6A 5LXTE 1SBDA 2W62A 4XXPA 4BU2A 5FZBA 2BS3A 4KGQA 2IFWA 3I4IA 3PHMA 4CCKA 4LQRA 5JPNB 5BNOA 4AQ2A 4HETA 1HR0T 3B9CA 3KBTA 2V26A 2BKNA 4B4PA 3PUAA 4UW4A 2A73B 5A6XA 2I59A 3MFAA 4I30A 2DCTA 4DR4T 1AZDA 3WDXA 5C71A 4CP1A 5ABEA 2WQ8A 5JOYA 3UTKA 2NN8A 2E31A 3ANWA 1T6BX 3OYWA 4UVAB 1H9WA 2R0FA 3VKFC 4W8JA 4DIQA 1STMA 1RTVA 2C9AA 4LKDA 1VRH1 4AR2A 4QPGC 3UESA 1VRBA 1ZHCA 1URXA 4CYDA 2EHOD 1V6IA 3AE6A 2PQSA 4A2UA 3GMIA 3VB9A 1BBT3 3ZC0A 4BB3A 1RB8G 1W9WA 3NJXA 5IW0A 1MS9A 1VE0A 3HOBA 3SRZA 2VC9A 3J7Yq 1W6NB 3RG0A 2YN6A 2HWD3 2KMFA 4IDQA 1RMU1 4MOAA 1W6OB 1LGNA 1LGBA 4F3JA 1X50A 3V0BA 5FLHA 2E33A 4I02A 4Q8KA 4SBVA 1Z7S1 5JXIA 4PLMA 4KU8A 4GIWA 1UYXA 3MLJA 1J59A 5E88A 2VVNA 2IC9A 4XF0A 4KP3C 2FD8A 3ZMOA 3F2EA 1WCQA 1OMIA 2XSBA 4EROA 5FTTC 3TYJA 4X1IE 5T5JA 2K3WA 4H63H 3JAFA 4XF3A 1ZZ9A 4RGGA 3MFCA 2ZGUA 4HT1T 3W58A 3CJIA 1REFA 1Q8SA 3OGVA 3AE8A 1OHFA 3FX3A 4UBHA 4YLHA 4CCEA 4YG3A 3LK42 2R042 2LEHA 4XE9A 1YFYA 1MZFA 3POYA 4P9XA 2ZS6B 4UT5A 4HEAA 1RUG3 3LG7A 3D8CA 1QXRA 4L9BA 3NSTA 5FOBB 3ECQA 2ZAHA 2RJ2A 2FMYA 1C8NA 2GMEA 4QHOA 1OF4A 1AJOA 2BUKA 3MV01 4IDOA 1W9RA 2W92A 1AYM2 1FNZA 2V7IA 3DYMA 3LWCA 4N8MA 3WW4A 4NUBA 2WINB 5BUVA 1KF6A 3TN93 4YM0A 4YFSA 3D6EA 4BQ1A 3O1JA 3ZJ2A 4K3UA 5BY5A 1RUI2 1Y64B 1W6NA 2CCQA 3AZZA 2VUAA 1J5WA 5B4XA 2GDFA 1VBB3 4W6WA 3MZHA 2TBVA 2WDVA 2HJIA 1XWMA 3JC6D 3RZZA 1HN1A 4WBOA 2WQ4A 4AAPA 4UFHA 4GJZA 1ZRIA 2P6HA 3M1HA 1GNYA 3AL5A 3SCHA 2ORZA 1NE6A 2W08A 2P37A 5AQMB 5FNVE 4XQ4A 5CA6A 5F9TA 3LDRA 2VZUA 1HTJF 5IYYA 2MTQA 2VE1A 3E5UA 3ZYIB 2X9XA 2C5KT 1H8TC 3GDBA 1HRV1 4CP0A 3RYFE 3EVYA 3FZFB 1NUKA 2L8KA 4LMLA 4H55A 5CA0E 4FP3A 1JH5A 2JICA 5FZ4A 4JEHB 4L5GA 2OA2A 3HBZA 4EGWA 2HWE1 1W8ZA 1RHI1 2PYTA 1KJLA 4DO0A 4N9IA 1WA4A 1UKGA 1AYN3 3Q2MA 4BWOA 1VP6A 1Y7BA 5H9PA 3B01A 4DR3T 3B94A 5JIAA 2YYOA 3ZMTB 3S57A 4PJYA 2X05A 3C51A 1LRHA 2C24A 2XL9A 2ZAAA 5JVVA 3PJAA 2MEV2 2WZR1 4NAOA 1WLCA 4WM8C 4QH1A 1NKGA 2VL8A 1IQDC 1N3OA 4NR1A 3ASIA 1UY4A 1YLLA 4FPKA 3FLPA 1ZBE3 2E9XC 4H9SE 2BKPA 1APNA 3AA0B 1VBC3 1FOD3 2BBHA 5KC5A 4QH5A 2VOKA 3UUMA 3PJYA 1DIWA 2CHNA 4C1XA 4WM7B 5F3CA 2E51A 2XGXA 3DYOA 1V00A 3CJXA 4QPYA 1QNYA 1G9AA 3UU5A 2UXNB 1V9DA 4AQFA 4ZEYA 4ASMB 3RKGA 1DCSA 4Y33A 4Y26A 1E5IA 1JOJA 4P14A 4Y5TA 4X8PA 4AKIA 3POGA 3R4SA 2P17A 1ONAA 1EAH3 3UU8A 1V6OA 4UVCB 3NRUA 3O14A 2VTXA 4ZU7A 2VB6A 1AXYA 1RVF3 4EAHA 1J84A 1HIXA 5HWXA 5F3IA 5FP4A 4ILUA 2WMOA 2OZ6A 3RPUA 2G1MA 4XFHA 5F5CA 1JZ6A 5FXVA 3C2UA 4J2CA 4XJWA 3TLWA 4HLTA 1PM7A 2HEVF 1ULPA 5L7OC 4OQ9A 5CB7A 2EVXA 1GU3A 1VR3A 3RMYA 5FMOL 2YPDA 2QZ3A 4DQAA 2DDUA 3VDDA 1H2MA 3DF0A 4PCRA 3VD4A 2JIGA 3PV0F 4ANJA 1OKQA 1FPN2 4UEMA 1BBT1 3WDTA 4CEWB 1UOGA 3NJYA 2W0GA 4GWMA 3M70A 3M3OA 4JI5T 4QPWA 4JGZA 3HI2A 3ZKYA 2WO1A 1ODMA 1WBLA 4EEBA 3HN1A 1QOTA 5HCFA 3WXPA 3NAPB 4P1NA 5JZGB 2WFPA 3VHNA 4OHFA 5IYZE 1I3HA 2C1FA 5DG2A 4HANA 4GD4A 2D43A 3QNUA 4WM7A 2Z2SB 5IAXA 2IMLA 1UK5A 3WG3A 3O1RA 2FJEA 4Y3OA 4Y1VA 1HXS3 4WNKA 4LEJA 2P1BA 4GH4C 2LHRA 2E9QA 4U2ZA 4QGMA 4ZI2D 3AC0A 4AQGA 3EB7A 3OUIA 2X51A 3ZN0B 4RHV1 3ZIWA 4WYVA 1AXKA 3OF1A 4ZI3C 3LFMA 3DKQA 4IEYA 4KI0F 1CONA 2JEMA 5L36A 1RUG1 5FMCA 2BVBA 3MV11 4NIDA 2Y6XA 3H1YA 4LOTA 3LA3A 1REEA 4XYXA 2XAGB 1I94T 1PO23 2ZACA 4XBQA 2VULA 2J7MA 3H8OA 3UETA 2YC0A 4PF5A 3Q5EA 2XPJA 4ISRA 2H7OA 2W3JA 3UKNA 1GP5A 1YXWA 2Y6LA 4ZY9A 4Y5Z0 4CEWA 5FZAA 4Z90A 2BG9B 2PHTA 3EAMA 1LOFA 2JD4A 4A44A 4FFGA 4D6SA 1NZCA 5CFDA 1DZQA 4Q25A 2PHLA 3NW4A 1OLQA 2IC6A 4KWJA 2VURA 4QU2A 3AXDA 1NA1C 3NAPA 5IK4A 1QDOA 3NZQA 4Z82A 5JZGA 3SS1A 2LSJA 3INAA 1VBB1 3IDAA 4K1ZA 4ES9A 5LBFA 2WU2A 1IQAA 3TEWA 4AI2A 3PIJA 1XE0A 2XM2A 1W0OA 5AQFB 3H3UA 5FV3A 1HFAA 2WFF2 1V6MA 4YFZA 1JUHA 4AQTA 2BGOA 4MALA 4JDMA 4CPBD 5A3TA 2WT2A 5JSPA 2NZ9A 5FPLA 2WZEA 1KFXL 5EFUA 2Q9QB 1CAVB 4DR5T 2XJVA 3BUCA 3AP9A 2SPCA 4DZGA 1HS7A 2XQAA 3LDKA 4FI9A 4HGAA 3APBA 3RVHA 3B9IA 2YDSA 5A80A 1OKOA 3OPZA 2EICA 5C8CB 2OV9A 2Q1ZB 1FATA 1MS8A 2BDRA 3SEPA 1HB2A 3ZC1A 3UT0A 2ZX1A 4JI7T 3W21A 4Q4Y3 1RUE2 2Y0IA 2GZWA 2OLTA 5FY4A 3U75A 1AYN1 4XTMA 4K0UA 1JZ2A 5AFUL 1CPMA 4R4XA 4MG2A 4A56A 2CSGA 4Y1YA 1FXZA 4E7ZA 4F8HA 4TN7B 1ZVFA 3USSA 5C3SA 2GH2A 3O1HA 1SLCA 1WR0A 3NWKA 1Q8VA 1TVGA 3ELNA 3MPBA 1ZBE1 1XPWA 3ZMVB 4JDNA 3DPRC 4N53C 4AIUA 3GM8A 4XJUA 2EHOC 1IOAA 5FYYA 1FOD1 3CMLA 5LWBA 3T08A 1IJ5A 4F83A 1JYXA 2V5CA 3VDCA 3VZJA 5CIRA 5BR8T 1NX9A 3ILFA 1W90A 4IGPA 2Q9QA 4ZZ5A 1CAVA 2HWC3 2YDEA 4IXLA 5GKAC 4YRDA 2PLV2 3O0XA 3P50A 1HRI1 1QKQA 1PMIA 3NNLA 2WS92 5L9BA 4HKWA 1EAH1 2WSVA 5DXDA 1C57A 2KNDA 3NQHA 4DUVA 1YXRA 3U3IA 5FZ8A 2KXLA 5C3JA 4EN7B 2KINB 3RZMA 4XC9A 1MPXA 5HV0A 1WW4A 1RVF1 4LBJA 1OVPA 2D0UA 2ZHNA 3A5XA 2CL2A 1YW0A 1CR7A 2LLYA 5LBBA 3I1AA 3DTOA 1O4ZA 5AQTB 3NRYA 1ZNPA 2Y8KA 2P3KA 2QQJA 1SHZC 1PVC3 1BR4A 3HAGA 2DBNA 4XFBA 5FYHA 4OULA 2DUQA 3CX6B 3C64A 3ZMNA 4UWDA 2X09A 3K8PC 3MIFA 3ES4A 1HV1A 2SBAA 2V7JA 3CZJA 3CKDA 3GWHA 2YU1A 4HBNA 4NRPA 5AQNB 1YKEB 1D4VB 2X10A 4XJ9A 4EV6A 2V5DA 3MW4A 3ZEFB 2R072 1B09A 2MPFA 2DHRA 1EZ3A 1KD7A 3UL2A 2UXBT 4HVQA 2JD9A 2ADEA 3DGTA 3S0MA 4FAHA 1UY0A 3LIHA 2WAOA 1AR72 1UCXA 4BQXA 2JQ9A 1DGWX 2ZGQA 1W05A 2E7AA 5H9QA 4QU1A 5EK4A 2CAVA 5CAZA 1BEV3 1ZA7A 2JE8A 2J1TA 4TLGA 2X68A 4IIJE 2BNMA 2IWGB 4IT4A 1IPKA 5FZCA 3WUDA 5BPXA 2YC4A 1HXS1 3PVOA 2LRKA 3GBWA 1EV12 3PNAA 1POQA 2XAJB 1GBGA 5DUVA 4X6QB 3UGHA 2Q0AA 1OXCA 1RUNA 3JC6C 2X66A 1POV0 1UZWA 4N7UA 2EF6A 2PHWA 1PNFA 4PLOA 3LBXB 4PIXA 3PVBB 1S94A 5JDGA 1GFF2 2XLFA 2C5DA 1OWAA 4EOZB 4GB33 4YM3A 3I2DA 4CZZB 1PO21 2DUPA 4ZZCA 4EN8B 4DR6T 4HKOA 4TWFA 3I8TA 4QDRA 4MGKE 2HYXA 4AI8A 3QBQA 2EAKA 4RL7A 2P2KA 1GOFA 1Y9QA 4DXRA 1OLMA 2NR4A 3POWA 1HQLA 3IMNA 1J3PA 4Z2WA 2VJXA 2VQ0A 3AEGA 4UBGA 5BNQA 5FY5A 3BOPA 4BQYA 4RQPC 1MVQA 2X9HA 3OBVE 5H9SA 4TV8E 3PMEA 4HONA 1LECA 2VO5A 1NAFA 4NIQA 5ABFB 4TUYE 4W6YA 3ZYLA 2JQHA 3KGZA 1OD5A 3CVRA 3AZXA 1NY72 2LOSA 1OH3A 2A6YA 1YFWA 5DAWA 4YTMA 5FZ3A 1YQ8A 1GQEA 2QKDA 4G2AA 1VBE2 1WCKA 1C5IA 1NG0A 3JZVA 3POEA 4IQPA 4NWWA 2CAUA 5LBCA 4OFZA 4QPIC 1UUSA 2WZPP 3GHNA 2HEYF 5D1IA 1GYKA 3B7MA 3FZLB 1PX4A 4QPGA 3HD8B 4QD2A 3LBXA 4JI3T 1LR5A 3K3QC 4FFHA 4JC1A 5CJ5A 2JB4A 2QQKA 2VNVA 2D2SA 5HXCA 4CU6A 2WUHA 2I2SA 4NHLA 4BMEA 2AYHA 1V9U2 4CQIA 4XUPA 3RI9A 5AQRB 3WAJA 1LESA 2NW9A 1QOOA 4NPPA 3FMGA 1GP4A 4HFBA 4D7SA 1XSQA 3N3HA 2ZMAA 1VB4A 4GYSA 3FXEB 4LE3A 1X33A 4NRQA 1JN2P 5LA0A 1ASJ2 2NQYA 3WW3A 3CX7B 1QJX3 2CA5A 5AQQB 2QQIA 4QKFA 3T1LA 1XOYA 4OI1A 5AQJB 4XCAA 3KGLA 2K24A 5GZEA 4MGZE 3AVRA 3FE5A 3ETUA 4RR3C 1W99A 1PIV3 3JB8A 4J6GA 2KXPB 2BG9E 4UFKA 1QF3A 4LR4A 3LD8A 4NJ4A 1JZ8A 4M4RA 2AGSA 2BYVE 2L9LA 3WZ1A 2UUAT 4B3TT 3MLLA 3QCWA 4P00B 4E2QA 2XJPA 2BJSA 1QMJA 4XVHA 1OBNA 2C4XA 2Y6KA 2CRBA 1I6XA 2J1EA 2VK9A 2QE3A 2J1SA 2ZPXA 1CIYA 1RUI1 1W8NA 1C8M2 2GH8A 2ZGNA 4RN5A 5A6QA 2VNRA 4LFAT 1W2AX 3VUOA 4IV1C 1AR93 1ENSA 2HYKA 3VHPA 4M1PA 3MI8A 4HWHA 4D3WA 5LMNT 2WLQA 2R063 2A72A 2FDKA 4U3CA 3VHLA 4KH9A 4Q0QA 2D0TA 4MSVA 4UELA 4U36A 4KU7A 1TMF3 1MQTC 4WM8B 2DF7A 4JHTA 4TYSA 1MZ5A 4IEZA 2E9XB 1MZEA 4Y5SA 2D40A 1J83A 1MVEA 4LHSA 3ACFA 4LF9T 2J1DG 5CISA 4NXMT 3HQXA 2E8IA 5T3NA 1CJPA 1I5ZA 4A7YA 1JZ3A 1DQ6A 1VMHA 2H3RA 5GLZA 3ZSMA 1H2LA 3T1HT 1NXMA 1AL0G 2BNNA 2ERFA 5J2TE 3TEZA 4YJ2E 3I3DA 5K4LA 1H8TA 2AZ5A 1X82A 2W46A 1RUF3 4HTEA 1WD4A 4Z1VA 2A9UA 1TEIA 4JQRA 3BIEA 1AR63 3T09A 2VVFA 4IV3B 3WG1A 1AR82 3AMNA 3P7IA 5JLVA 2WWUA 5DABA 4Q1RA 1R083 2X53S 4PFPA 2MEV1 3BALA 3MKDA 4FPOB 1GMMA 4COVA 3N9MA 5DAVA 1JBCA 1JYIA 2RS53 5EHDA 3DUIA 2X9WA 2P3JA 1SLIA 1Y9GA 4FQZA 2VOVA 4OI2A 4AQSA 2EXJA 2ZBJA 4Q8LA 3CEWA 2WNUB 1YQCA 1TME3 5JI7A 1OQ1A 3R05A 2IUBA 2KA3A 4WM8A 4Y1XA 2ODVA 2VQFT 4GQ7A 3UU4A 2LUWA 2WR9A 5GLWA 4JKLA 2Q8DA 3B57A 2E9XA 2JKXA 2V1DB 4CDXB 2PLV3 2A3DA 3PDQA 4YARA 3AEEA 3OTFA 3TKLB 3HKEE 1D0ZA 1PM4A 5HCMA 3PVEA 5H6QB 5G05L 5AVAA 4BXSV 4LTAA 4AEDC 4UOJA 3ZT6A 4HN1A 4LK6A 1W2UA 4O4IE 4XURA 3AVSA 4DUXA 1GQPA 3U78A 3VKOA 3ZYPA 3T4HB 4JYAT 3GNEA 5ABJC 2A3YA 2JDZA 2NM1A 4QX2A 2PAKA 4CEYB 1V6KA 2BVVA 1G9BA 3QB5K 3ZX7A 5JSOA 2ZX3A 4WZXA 4PJNA 3LPGA 3Q8CA 4ES8A 4YLZA 2VQTA 1VMFA 2C0ZA 4NROA 5A7OA 1FMWA 3AA7B 2G19A 2CLYC 2W1SA 1GNZA 3PUIA 3UULA 2LOPA 1VAMA 2QNKA 2QQLA 1BKZA 4FPLA 2JWPA 4KWKA 2DWGA 5JDHA 3ZFGC 3IKWA 1OD3A 2HPLA 4RD7A 2UXXB 1QQP2 2J47A 5LY2A 3WHTA 3HPNA 3QH6A 1RXFA 1ULDA 2BBAA 5EXOA 5FZ6A 2KLQA 3E08A 4YW3A 4FPYA 2CYFA 1UW8A 4Q0VA 2PJQA 4QQHA 2Y33A 1BZWA 4OLLA 5FK8A 3PUXF 2VQAA 1RUC3 1O5UA 2WNUA 2WABA 3ZMUB 4ORFA 3AA6B 2HWB3 3MJXA 3TAYA 2JJ9A 3VKMA 4C90A 4FSJA 5LA2A 1ODNA 4E2SA 1FMD3 2K46A 1JYTA 5EV7A 3POJA 2XXZA 2XHNA 2RMU2 5L3GB 1W6QB 2Q9QD 4E4HA 5AQGB 3MK7C 2VZOA 2RR13 4YW4A 1VRH2 3O1MA 3O5SA 4MGSA 5I0SA 2ARBA 2P34A 4LBQB 2KWIB 4OUSA
chains in the Genus database with same CATH topology
2ES0A 2N1GA 5FZMA 3PUQA 3H37A 3LD8A 3QUJA 5F3IA 4ILUA 4HKAA 5FP4A 2WAUA 5FYVA 5F3GA 5IVVA 2WMOA 2VWAA 3GMIA 3RPUA 4GOUA 2YBKA 5IVYA 1QSDA 3RYHE 4ZS3A 3W15B 4QXBA 5ISLA 3AA1B 5F5CA 3ZC0A 4GAZA 3HKDE 1OXZA 3CQCB 4HE8A 2CXDA 5FXVA 5FZ0A 2KNDA 4J2CA 2W2IA 3C4ZA 4DNDA 4EXTA 4EZ4A 2X67A 5F32A 4AI6A 2RP4A 3KV4A 3U3IA 5CEHA 1D0XA 5FZ8A 3KVBA 3IEEA 4KUMB 5IW0A 2KINB 3E22E 4FJOA 3O1IA 3L09A 3SRZA 5LW9A 2MYSA 2WBLA 3J7Yq 1U4QA 2XAHB 4G63A 4CI2B 3UUNA 5E6HA 2VK9A 3SWHA 2NP9A 2KMFA 3MXZA 2LSKA 2WSSV 4H9RC 1LVFA 4Y4RA 3V5SA 2YPDA 4GK0E 4BJNA 2D0UA 3N9QA 3A5XA 3OPTA 4IE4A 1G73A 3RH3A 5IVCA 5IVFA 5A1FA 3RC3A 3C4XA 3N2OA 1AJ3A 1US7B 1HG5A 1YW0A 2ZM8A 3RRWA 3BQIA 2YEVC 2VKHA 3I1AA 3DTOA 3Q5WA 2RA1A 4IGUA 4ANJA 4UEMA 4X1KE 3R6NA 3K2OA 5JR9A 1BR2A 5DQVA 5LOVE 5F39A 3NJYA 2L9QA 4KMCA 5FPAA 2W0GA 3NRYA 4M1PA 2JPFA 4AQFC 4H9QC 3BQLA 5JRCB 3IBPA 4GIWA 5JVDE 5FZ7A 1MMAA 4O8SA 3N2KE 3HI2A 4X20E 2IC9A 1SHZC 1BR4A 4GJYA 4FI5A 5L2LA 5FYHA 5FP3A 2A72A 2KZ7B 4KP3C 4EIWA 4LIUA 3CX6B 1T98A 4CCOA 3C64A 1LVKA 4ASKA 2W63A 3F2EA 4F6RC 1BR0A 4O2AE 4PJJA 3VHLA 4UV8B 5FYIA 2BDEA 3F31A 4L0RA 3K8PC 3RRCA 2LM9A 2WWJA 5FYSA 2D0TA 4UELA 3WAKA 4MHCA 4OHFA 4X1IE 5IYZE 5LA6E 5F5IA 2NWBA 2V7JA 4TV9E 4H63H 5HAXA 2LSIA 3CKDA 4U72A 3GWHA 2VKJA 2YU1A 4U74A 4PK5A 3ZMSB 3FBLA 4CI1B 5L3BB 4GD4A 4JLEA 3PURA 5A7PA 3FHNA 3QK6A 1YKEB 2JMHA 3NBXX 2WMNA 3AB3B 4QWNA 4QXHB 5FXWA 5A7NA 3AAIA 2V7MA 2NTYA 2D5UA 3ZEFB 1ZV4X 4V2WA 1D1CA 3MZKB 5J1GA 2IAKA 5A7QA 5FYZA 2GP3A 4IE5A 1MNDA 4Z8XA 4YLHA 2E9XB 5JREA 2OQ6A 2N2NA 2DHRA 1EZ3A 4GYRA 4UV9B 1KK7A 4Y3OA 3LK42 5LBQB 2LEHA 5FZKA 5A3NA 4WNKA 5TAOA 2HH7A 2BZBA 1MIYA 5EK2A 5LGTB 4N78D 4UF0A 2HPJA 3C50A 1LKXA 2MBGA 4P0BA 4MBQA 1YD8G 5BMVE 4HEAA 2J1DG 2LHRA 3FB2A 3LG7A 3UT5E 2YBSA 3DXTA 4CSWA 2H7VC 2L3LA 3BK9A 5ADXL 5L3CB 3Q9DA 4AKLA 4QU1A 5EK4A 2E8IA 5FPVA 3EDUA 5A1LA 5A7WB 5FY1A 5IVJA 4QX7B 3IHRA 4ZI2D 1WR6A 4BA9A 5F3EA 1MNEA 2X68A 4JUYA 4IIJE 4O4HE 4XDPA 3VKGA 2Y48B 4PJLA 4AQGA 4QKNA 5FP8A 4QX8A 1UCUA 5L3EB 2X51A 3ZN0B 3PU3A 2JMKA 2PG8A 5FZCA 5A3WA 4QHOA 5LBMA 3O4XE 3V5UA 2ZLYA 4ZI3C 3SOLA 2H3RA 4DMWA 3LFMA 3S4UA 5JR9C 3T8OA 2DNXA 2C5IT 1MMGA 5DJQC 2BVMA 2K48A 1G8XA 1BR1A 2V7IA 4TX5A 5J2TE 5FZ9A 5FZIA 4YJ2E 1HCIA 4CCNA 2XAJB 4NUBA 5FZOB 5K4LA 4UIGA 2Y6XA 5EK3A 2QA7A 4V1Av 4P0AA 2NOXA 4HTEA 4AKRB 4CUGA 4YFSA 4WW0A 5E0OA 3ZLIA 4CXXA 3JC6C 2XAGB 2X66A 3NZPA 3O1JA 4CI3B 5LHIB 1MMNA 3ZJ2A 5FZOA 2C0SA 2CXLA 4DVDA 5FZDA 3CPZA 5FMNA 1SA0E 5FY0A 2VASA 1VOMA 4ADZA 3E0ZA 1Y64B 1Z0PA 2CCQA 4PJMA 5HXRA 4ZI3D 3B13A 1IJ6A 4CXWA 3P7IA 4IGOA 3LBXB 5LYJE 5LGNB 4D6RA 3ZMZB 1S94A 2WWUA 2XUEA 5DABA 5JDGA 4MLKA 2ZM2A 2CEAA 3N5LA 2NTXA 2XMLA 2H7OA 3OYXA 4PFPA 5FP7A 4P09A 4H9PC 2XDVA 1OWAA 2DI4A 4IE6A 4DBQA 2OQ7A 3VU7H 2ZM0A 3MKDA 2C5JA 2GP5A 3FBZA 1X79A 5F37A 3GN5B 4PK6A 4EOZB 1ZKEA 5FZAA 3LJCA 4CZZB 4NUUA 3RYCE 3N9MA 5F2SA 5JRCA 3KBUA 3JC6D 3ONXA 4D6SA 4AKHA 3J9X1 1IAPA 3BQKA 4IE7A 2CXFA 3EDVA 2CLYB 3QC9A 2Y8DA 5FZHA 3KV9A 4IHJE 2XAFB 2X9WA 2LT3A 3HR0A 2LJLA 4WBOA 3CQXC 2IC6A 3H3AA 1CUNA 4AAPA 4GJZA 4XBFB 3D0TA 4H9NC 4JEUB 3N9NA 3EUHA 4ZS2A 5FJKA 5IHYA 5EZYE 3NZQA 3R84B 5HXHA 3AL5A 4C8DA 2CWYA 3UUXB 3SS1A 3ZJ1A 2LSJA 4ZI2C 2NW8A 3OKQA 5FZFA 4PAGA 5JDQA 2WM9A 4H63V 4DBRA 4WBNE 5FNVE 1ZEEA 3RYIE 4PNIA 5F8PA 2DWKA 4ERRA 4YJ3E 5LJMA 2LSYA 4EYUA 2KT9A 4QXHA 1D1BA 2ODVA 3WI3A 3ZCJA 3I9WA 5F5AA 5FBJA 1HTJF 5FUPA 5H6RB 2MTQA 4X1YE 2E9XD 5FV3A 2Q8DA 5F2WA 1HFAA 3B57A 1FMVA 2E9XA 1UX5A 5C8YE 3ANWB 2X9XA 2V1DB 2C5KT 2XAQB 2A3DA 5FY5A 3PDQA 3DXUA 3AAAB 2GK9A 2YBPA 5FUNA 5A3TA 4MALA 3ZYMA 3RYFE 3EVYA 1YKHB 5FWJA 3Q5XA 5LCYA 2L8KA 3TKLB 5FPLA 3F57A 4ISTA 2X9HA 3HKEE 4AKGA 1U5PA 3OBVE 4TV8E 5CA0E 2Q9QB 4HONA 1D0ZA 1NAFA 2N9DA 3HKCE 3IF8B 4YHJA 5FYMA 4ZI7E 4TUYE 5FZLA 3I0QA 5H6QB 1D1AA 5FZ4A 4URAA 1S35A 1O3XA 2BVLA 5A7WA 4JEHB 2Z6EA 3ZYLA 2K9AA 2XQYA 3CVRA 4QX7A 4L5GA 3P8CD 4O4IE 3PTRB 3RC8A 5IVEA 4EYYR 3AVSA 5LP6E 3U78A 3UYJA 2SPCA 5FYBA 1HS7A 3RKOA 2LOSA 4BXFA 2OS2A 2EHOB 3ETVA 5FXZA 4I55E 4HGAA 4UVBB 3K3NA 1B7TA 5FY8A 4CCMA 2JRKA 5GONE 4ISSA 5F3JA 4XAXB 5KMGP 4QXBB 4C91A 3PUGA 3C98B 4E7SA 2W00A 5FZ3A 4DO0A 3RVHA 1D0YA 2B1EA 4I50E 5LG4A 4LXLA 5A80A 2CWOA 4L9IA 3KV5A 2XHEB 2EHOA 2X0LB 5FYTA 3Q2MA 3UFEA 4G2AA 2MOZA 4PJNA 4IDZA 5JH7E 1HG2A 3VKHA 1WLXA 5LHGB 4V2VA 5FPUA 2X9YA 5KR7A 3LK2B 5FPBA 3L3PA 3CWZB 1NWMX 3N9OA 3ZC1A 4O4JE 4PW8A 3GA8A 3ZMTB 2XASB 4CCJA 3ZN1B 5JDMA 2PFVA 3ESLA 3M65A 5A7OA 1FMWA 1H7CA 4OFZA 4XZCA 3AA7B 3C51A 3ZCIA 3ZYKA 3HL6A