3KVBA

Structure of kiaa1718 jumonji domain in complex with n-oxalylglycine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
366
structure length
366
Chain Sequence
b'PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 113
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kvbA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kvbA01
4D6SA 5A7NA 5A80A 5A7WA 3DXUA 4QU1A 4GJZA 5FZIA 4HOOA 3AL6A 4NUBA 4LITA 4HONA 4EZ4A 5A3WA 5A3NA 5FZ7A 4Y33A 3PUQA 4Y3OA 5FUPA 5FZEA 5FZ4A 5LY1A 4BISA 5FPBA 2Q8CA 4LIVA 3PTRB 5IWFA 4UF0B 5IVYA 4D6RA 3KV9A 5FYMA 5FYTA 5ANQA 5FZ9A 2XMLA 4Y4RA 4QXBA 5F3CA 3AVRA 4ASKA 5KR7A 5ISLA 5FZDA 4URAA 3AVSA 3ZLIA 1VRBA 5FYSA 3K2OA 3PUSA 5FY4A 5FYIA 5FZKA 4DIQA 5FXZA 2YBSA 5A7QA 5FY0A 4IGQA 5FZBA 5FPAA 4CCKA 3PDQA 4CCOA 5FUNA 2OQ7A 4DO0A 4UF0A 2YPDA 5FP9A 2WWUA 5F2WA 5FYUA 5FZOB 3PU3A 3U4SA 5FZ6A 3K3NA 5IVCA 5FZ3A 5F32A 5FPVA 3N9NA 5K4LA 2WWJA 4IGOA 2XDVA 5FZ0A 4XDPA 3N9LA 2XXZA 4XDOA 4CSWA 4BXFA 2XUEA 5IVVA 5F5CA 4CCNA 4QX8A 5FPLA 2OQ6A 5FPUA 4GD4A 5FYYA 5F37A 2YU1A 5IVJA 3PU8A 3OPWA 5FZHA 5F5IA 4BU2A 2OT7A 4LIUA 5FZOA 2Q8EA 5FBJA 5F3EA 3NJYA 5FXWA 4IGPA 4E4HA 4QX7A 2OX0A 4QWNA 3OPTA 4QXCA 5F39A 5FWJA 5FJKA 5A7PA 4GJYA 2P5BA 5F2SA 5LWBA 5LW9A 3ZPOA 5IW0A 3LDBA 5FYBA 3RVHA 4V2VA 5FY5A 4LXLA 2W2IA 2Q8DA 5CEHA 3N9OA 5IVEA 3N9MA 4TN7A 5FZCA 4AI9A 4V2WA 5IVBA 3N9QA 3AL5A 5FYHA 5FYZA 5A7SA 2OS2A 5FYCA 5FZLA 5FV3A 2GP5A 5A3TA 3LD8A 3KV4A 5LY2A 4D6QA 5FY8A 3U78A 5FY9A 5FP7A 3KVAA 4QXHA 5FXVA 5FP8A 5FJHA 5A7OA 5FYVA 2YU2A 5FZMA 3PURA 5FZ8A 3UYJA 3KV6A 4GAZA 5FY7A 3KV5A 5FZFA 5A7WB 4CCJA 3DXTA 5FWEA 3PUAA 5F3IA 5F3GA 2PXJA 4C8DA 4CUGA 5FXXA 5A3PA 5FP3A 2VD7A 4CCLA 5A1FA 5A1LA 2YBKA 3N9PA 5FP4A 5E6HA 5FZAA 5FZGA 4AAPA 4CCMA 5IVFA 3K3OA 2GP3A 5F5AA 3KVBA 2YBPA 4EZHA 5FZ1A 4EYUA 5FY1A
chains in the Genus database with same CATH superfamily
1N1YA 4YNIA 3J4UH 4JCKA 1JZ2A 2OZ6A 2D5FA 3QLQA 4LF7T 3BALA 2B1EA 4AI6A 3ZXJA 4FOYA 4X66T 2GU9A 4MHUA 2ET7A 3M4FA 5GZCA 5J37A 1CAUB 1D4VB 3MUZ1 1GMMA 4YGCA 5DDJ1 3G06A 3ESLA 4HFSA 3F57A 1F31A 3I54A 5LG4A 5JVVA 2KNDA 4U2AA 2D0UA 1NX9A 5HI0A 1AYM2 2NTXA 5LOVE 2P1BA 3IZOA 3RQWA 4A44A 2WLPA 4YHHT 3I9WA 2WZR1 2PTFA 2HBUA 1RXGA 1VCSA 2C26A 3ZN1B 4Y26A 2W66A 3IEEA 3RI5A 4UV9B 5GZDA 2EHOA 2WU5A 3NMBA 2G19A 3UV9A 1X8MA 4I0BA 3BOPA 5FOBB 1PIV3 1S0GA 4AAXA 3AFGA 2QZ3A 1SPPB 1UYXA 4JTNA 2J1UA 4YW1A 2E5VA 2J7MA 4AI0A 1MS5A 3UQ7A 4I2OA 4CDQA 4PLMA 4WBOA 3J26N 2XM1A 3IBMA 3CQOA 3ZX7A 3UT5E 5IYYA 4YJ2E 2DNXA 4DPNA 2WAOA 2EXJA 2PHFA 2W1UA 1WMFA 4G2AA 3P8CD 4QX0A 1MMAA 3PE0A 3UU8A 5LBBA 1FATA 3ZFEC 2XQ8A 2D3PA 2DBNA 4LUMA 4KQ7A 2UURA 4YY3T 3CX7B 1KFYA 3QB5A 1JUIA 3AZXA 5A7PA 4TYSA 4EEDA 3VR8A 2XQ3A 2AGSA 4YM0A 1K45A 2UYBA 4HFIA 2BNOA 3GCWA 4FVVA 5EWSA 3WNPA 5CFCC 5A6ZA 2QFEA 4ILUA 1AXYA 4PJJA 4HGAA 4JI3T 4I02A 4ES8A 2D3SA 3AA1B 4CPBA 4BQXA 1C5IA 3HD8B 5EZYE 5C71A 5A7WA 3KB5A 1WZXA 1TME3 2YG0A 1N3PA 4XVHA 2LTNA 1S1AA 1LKNA 4ES9A 1NAFA 2Q8CA 4XYXA 5IVYA 4CDWA 3FUOA 4MGIE 4WBNE 3HBZA 4B8EA 3B5LB 4FP2A 2WFPA 3G7DA 4AKRB 3LQCA 4IDQA 4LKDA 3FHQA 1RC6A 4QPGA 1POV0 1UY1A 4UT5A 4YG0A 4FPYA 1LHWA 5IHRA 3QB5K 4YPJA 4LULA 4EN8B 4QGMA 3VKFC 3CMGA 5LMUT 4K1YA 2YMZA 2FMYA 3C98B 2W52A 3KCCA 4BPZA 1VAVA 5L4HA 2IAKA 2CMRA 3WNLA 1SLCA 3RYRA 2WUHA 3HKBE 2XQ4A 4JGYA 1ENRA 4UOJA 2HWB3 3V56A 1KF6A 3M65A 2G1MA 1NLRA 3DXUA 3IT8A 3AL6A 4ZU7A 1B35B 5FZ4A 2VQET 2YK0A 3FBZA 1C28A 1WLDA 5JDGA 1J83A 2X9HA 2W87A 4WBBA 2HWD2 1Z0PA 3EB7A 5JI7A 4CCKA 3AZYA 2Y6LA 1DFQA 4FOVA 4E2QA 1S35A 3EI0A 4QXCB 1CJPA 4MLKA 3H1YA 3V0BA 4DUYT 3GJAA 2E33A 3CMLA 1FMVA 2D43A 5FPLA 4LHSA 4CYDA 4UVCB 4OHFA 2FDIA 5EJ1B 5F3EA 1QJX3 3NJYA 3UULA 3E5UA 2FUPA 2WSVA 1MZFA 4Y4YA 1PK6A 2PHUA 2VZPA 1V9DA 4DINB 4ISRA 3VRAA 1VBB1 5FKBA 3SEEA 2ZACA 2ARXA 4E7SA 1YQ2A 1ZZBA 3G6JB 1XOYA 2GC1A 4P9JA 4UYBA 1H2MA 1SG3A 5G04L 1G86A 5GLUA 1RUE3 4N53A 3VZOA 2Y0OA 3VD7A 2YDSA 3Q5EA 1COV1 4UFJA 3VBSA 3LCPA 4CI2B 2JICA 2WNOA 4GH4A 2YXSA 2ENRA 3T2QA 1YC61 3RFRA 4EE2A 2WB5A 5AFEA 1VR3A 3O14A 4YW2A 1V6LA 4J2CA 2WYFA 3H7JA 2E9XC 5DQVA 2JWPA 2MPFA 3T3YA 3R4UA 1NY71 2CXLA 5F2WA 3LSEA 3H8RA 3WDVA 3WQBA 4LLFA 3FLTA 5T54A 4KMCA 5K0UC 3CZJA 3HNBM 1XNDA 1V9U3 2CL2A 4WM7A 3BB6A 2QQWA 2O8QA 4XFCA 4AG4A 4BQ5A 3FBMA 4CCEA 5FMBA 1YJKA 2ATFA 1ZNPA 1QXPA 1JZ8A 3VBOA 3WHTA 2CWMA 2B9VA 2D0TA 1UO9A 5FY7A 4PI0A 3KCYA 3KV5A 1AXKA 1TMF1 3AAAB 1QJU3 4GK0E 2VZVA 1D2QA 3OB8A 2QQPA 3EJKA 1BK0A 1S55A 4XXAA 3ZIWA 4DMVA 3BCWA 5FZIA 3MIEA 1DBNA 3NL1A 2YDEA 1UZVA 2Y6HA 4Z2WA 1IZ3A 2DWRA 2IC1A 4FSJA 2D6LX 4GMP1 1IHMA 3KV9A 1R091 1W04A 4LE4A 4AKIA 1RUH3 4AEDB 2X05A 1RVF3 1MIWA 4HXCA 5DUVA 1JZ3A 3M3ZB 1SBDA 4H2AA 4YGDA 4INDA 2Q9QC 1RL3A 3MA9A 4CDUC 2WNVA 4PAGA 2YOEA 3S7IA 5IUXA 1ZZCA 2V4AA 4B1LA 3U4XA 3DYOA 5FL1A 4TWFA 2P3YA 1PO12 4R9BA 3VZNA 4JEHB 5GZFA 1FJGT 4BQ4A 5CEHA 4AYUA 3ZVXA 3KLSA 1H4GA 2JKXA 2W94A 4OLLA 3O1PA 3T1LA 1NA1A 1OOPC 4HFDA 5HYAA 5FP7A 1RUD1 3DXTA 3Q8BA 3ZDVA 2W1QA 1VCTA 1AR82 3N3HA 2W67A 5JPMB 1XNKA 1YQ3A 1U5XA 4LO7A 3AXEA 4DV3T 3CX8B 1Z7S3 3AE1A 2YDRA 1FV3A 3CKDA 1VBC3 1H4HA 2L9LA 3LEGA 5FPBA 2V7LA 4I50E 3HI2A 3HQXA 5SV8A 4XFIA 3KQRA 3RS6A 2WFF3 4ITCA 1O3XA 3P4SA 1H2NA 5FXZA 1TEIA 2GC2A 3RF1A 3ZFFB 5JCTA 4LBMA 2VVDA 2X66A 4CSWA 3OYXA 1WCSA 3HPNA 3JC6C 4IEQA 4E9KA 2IDOB 1PNGA 2WNEA 3ZMVB 2E51A 2WRAA 4QX7A 3DKWA 3EBRA 2W0GA 4B4QA 1RUOA 3LA2A 1XE7A 4NROA 3POBA 1HRI2 1VRH3 3PJYA 1UF2C 4YVSC 3Q5WA 1LHNA 1MEC2 4XE9A 2RS52 2KR2A 3SRZA 2ZOEB 2AUYA 4MX3A 4E4DX 2Y33A 4NPRA 3DKQA 2D97A 2JEMA 3ITQA 1LU2A 1AYN1 1KFUL 5LBFA 4LLOA 2VTXA 4NMIA 3C7EA 5LRSA 3E0ZA 4Z82A 1GWLA 5IWFA 3POIA 1GP5A 5L3EB 1W6NB 2P2KA 4GA9A 4CU9A 2WQ4A 3VBRA 5ISLA 1EV11 2Q5TA 2YFUA 4XC9A 1UXZA 5BNOB 3AK0A 5C8CC 1MNEA 4B4RA 4BZ4A 4AI2A 4AI3A 4TV9E 1HJGA 4QB2A 5C8WA 3JAEA 3FFZA 4C0HA 5IVCA 5FZ0A 5HWYA 2RMU1 5FUIA 1BEV1 2V5CA 3VBSB 1Q8PA 2AYHA 5FZHA 2R063 1WKYA 4ZXLA 3PLQA 1O3QA 3KFWX 1MMGA 5JUVA 4GH4B 1GWMA 4XETA 4XQ4A 2WZR2 4C1XA 2KXPB 4BJMA 4TN7A 1NXD1 4DUWA 3VBUB 1GBGA 5LZ6A 3AL5A 3O0XA 4YM1A 2LSKA 4RS5A 1KXGA 2Z5WA 2TUNA 3Q9OA 1Q8SA 1XJAA 3M7AA 2H7OA 4XJUA 2CLYC 2IHR1 3J7HA 5BNNB 4AVVA 2PLV3 1CUNA 2VKHA 2VUDA 5ABJB 4Y33A 4W4ZA 1O59A 3VRBA 2HWF3 1HN0A 2P3IA 3HJRA 4R8HA 4IDOA 5ANQA 2WWVA 3NAPC 5L7OA 5A3OA 3UJQA 4Q2FA 3OGJA 2VG9A 4UFIA 2QJVA 3OUHA 2R073 3AAEB 2WBLA 2ZX4A 4CP9B 3I3DA 2XJTA 2W4XA 2LJLA 2WZHA 4CU8A 3ACIA 1OBNA 3AYAA 3CQCB 5JXHA 4DXTA 5JDMA 5IFTA 3ZSJA 4CQIA 4QXHB 4XFHA 4L2NA 3N9OA 3N9MA 1AR71 3NO8A 1J3RA 2WJSA 3RH3A 3EO6A 4XACA 3CL1A 2MAWA 3D6EA 1LJ7A 4N9IA 1A34A 2Q1MA 4XUPA 3DECA 3VBHB 5IATA 1DQ5A 4BM8A 1JZ7A 2WMOA 2O0OA 3MFCA 5ACA1 4WZXA 3K75B 3EDUA 2W62A 4C91A 2VUAA 2OIIA 4BE3A 3TRSB 2HBTA 4JAAA 4WNKA 1BQPA 3RJ2X 3PUQA 3Q2MA 3S30A 2EXKA 2BFUS 5A33B 2C6SA 3ZYHA 4CDXC 4KHPT 3GMIA 1W6PB 4J1XA 3EHKA 1T98A 1YKEB 3CF6E 3I9YA 4RL7A 4IGQA 2J1VA 2D93A 1KRIA 3T1YT 4KGGA 1FT9A 3NJVA 1J5ET 3OTFA 4QDQA 5F32A 4COYA 2ZX2A 5DXDA 2ORZA 1W6QA 4LQRA 3J7MA 1NENA 4RQPA 2WMNA 2NW7A 3VU7H 2CSGA 3JD73 5FBJA 2VCCA 4FPKA 3AE8A 1OEDE 2D6NA 2BPA2 2Z4FA 2RM21 4QPIA 5FY5A 2VTFA 2ZBJA 4JBWF 4AFBA 5FPXA 3BU7A 4XQWA 3SISA 2A9UA 5HCAA 3FZ3A 2BKOA 4HWFA 3VBFB 4SLIA 3I7DA 5TAOA 2GMMA 1KFXL 5KMGP 4BCUA 1XYOA 1CAVA 5FZ1A 3UJOA 3NNJA 3D5OA 1UX7A 3RWKX 1CGPA 2GNMA 4AI8A 5A3UA 4CXYA 3LSDA 1WBLA 4LUKA 3JQXA 5I0UA 1MQTC 2OPWA 5KBFA 2W08A 2ACXA 2WAAA 2ZEXA 1CQ9A 4M3CF 2VQTA 4XHBA 4H7LA 2SBAA 4JI8T 2VMFA 3I4IA 1MS9A 2PQQA 1IPSA 3GZTB 2LHRA 5CB7A 1RJ7A 5KXDA 3P4PA 2FCVA 4YFZA 3CNAA 3AKPA 4KGQA 1VBB2 4RGKA 5F3JA 1QJZA 2GH2A 4BHPA 4NIDA 2P3JA 2XJ7A 3KM5A 5FV3A 3THPA 3KZ4C 2VNRA 4BQYA 4KWJA 4LBQD 2ES0A 3MFAA 1YLLA 1RJ8A 4LR4A 4PJNA 3U3IA 1COV2 2VD7A 2EAKA 5A1LA 3R6NA 5HXHA 4COFA 2LT3A 2EF6A 5J98B 3J7LA 1MZ5A 2XKPA 4UV8B 3E5QA 5HEUA 3RKGA 1OQEA 4O4IE 4LK7A 2XQ5A 3WF0A 2NLRA 4UF0B 2XJSA 2P17A 4XBNA 3MLLA 3LEMA 5KR7A 1UX6A 4GALA 3UTKA 5LGTB 3Q9DA 4CN4A 4MXVA 4JKMA 1RIRA 2GSYA 1DYOA 2XQ7A 3WNKA 2BFUL 1AYM3 2EXHA 4HN0A 3P5BA 1NY72 3HQUA 4M3CB 4YZ3A 1ND3C 2GNBA 3U4SA 3WUCA 4CEWC 2AEYA 3T4HB 1O3SA 2R6QA 2QKDA 5CFDA 4XJ8A 5HCJA 4YSZA 1WW6A 2EICA 3MW4A 3SKJE 5FJKA 2GAUA 1NQJA 3T8OA 1B09A 3M3QA 3CHXA 4LXLA 4YZ1A 1EP0A 4AEMA 4FPGA 1HFAA 2CGNA 1REEA 4XHXA 3K4DA 4FP3A 1TMF2 1K5MC 4Y20A 2JQ9A 4SBVA 1W8FA 4E2GA 3MUY1 5LYJE 1KITA 4K3UA 2X51A 2W46A 1YEWA 2ZLYA 5CZKA 1FOD2 1UX5A 1C3HA 3VHRA 1FPN1 4XUNA 4LO5B 2V7MA 5BUVA 3GN5A 2XQAA 1VIWB 3MV11 2GZWA 4N43C 4YM3A 1KEXA 3T09A 2E6VA 4FXGB 4I0WB 1MS0A 1R092 4UR9A 5LJNA 4LO8A 3ZMZB 3F2EA 4YVWC 2GN7A 4O61A 1OD5A 3DYPA 3IKWA 3CBNA 5HXCA 3MW3A 1PVXA 3ZYJB 3NQHA 5IK4A 1PGL1 2OA2A 4LHKA 3WDYA 2NTYA 2X9YA 5ABEA 4IUGA 4EN9B 4IERA 1HNXT 4GK5E 1GQHA 4Q4V1 2FDJA 4R9AA 4Q0QA 1OWAA 2Q1FA 4LMLA 1DLCA 2H88A 2CXDA 2CM0A 5J2TE 3ZSMA 2ILMA 3D82A 5FZLA 4X20E 3BTXA 1WCKA 3VD4A 2VXRA 1PMJX 5E0OA 4ZI7E 1LGCA 3FBLA 4LA2A 5CA0E 3I3QA 2OZJA 5B4XA 1AXZA 1H9PA 5C3JA 3LZZA 5FUPA 3LEIA 3C51A 4RA0A 4XF9A 5LXTE 1OFNA 1UOGA 4TWHA 3HOBA 4X6QB 1UYPA 5AQSB 4X65T 1FV2A 4K20A 2BVVA 2ZMLA 3ZFGA 3PUWF 2XG3A 4XQDA 4ISQA 3EMRA 4WVZA 3AE7A 1NCQC 1YRZA 5L3BB 1SFYA 5LBQB 2K48A 2DVBA 2QQLA 2UU9T 2F4VT 4AKGA 3D4KA 4XBLA 3ACHA 2JE8A 5FYHA 5TSWA 3ZMUB 1LOGA 3LD8A 4MGYE 2RP4A 3WP6A 2NR4A 1SLAA 1QXRA 3OY8B 4CU6A 2Z6EA 2MBGA 5FP3A 4LA3A 4HZFA 3IPVA 3FHIB 1AYN2 1D0XA 3SCGA 5JSPA 4AK3A 1RUG1 1PVC2 5AQKB 4GXLA 3UT0A 1X8EA 5JOWA 1DZRA 2HWD3 3OD4A 2WABA 2PN5A 2F4LA 2VNVA 1KD7A 4AOCA 3OD0A 1EV12 1BVVA 1O4TA 4I01A 4Q27A 4K8RB 1VPHA 4PQ9A 1T2XA 4H7MA 5FZOB 3C7HA 1C8M1 3PMEA 4IXLA 2VU9A 3S0MA 5DMYA 1CR7A 4BXFA 1QOTA 3N2KE 2GNDA 1BEV2 2BGOA 4FJOA 3PIJA 1WRDA 5H9PA 2RS31 3QD6A 4RHV2 5IT6A 3THTA 4B3MT 4JX0A 5D21A 5FAXA 1XPWA 5KDMC 2YC4A 3R4SA 4RGGA 4FPFA 4LF4T 1VB4A 5E8AA 3W21A 2XPKA 4B1MA 1WMXA 1NCRB 5LNKA 1D0YA 2J1SA 2VVEA 3PUZF 5J36A 4KU8A 1IPKA 2OPKA 3ACGA 3NWKA 5F3IA 2EHOC 2RV9A 1A8DA 1PZ8A 1J3PA 5I8YA 4DZGA 2PQSA 4IE5A 5CFDB 4QXBB 5FLIA 2G0UA 3SFEA 5CA1E 4HVQA 1W0AA 4UVBB 5JSOA 5F3CA 2WNUB 3T08A 2J62A 4CDQC 3N7JA 1JOJA 4OUMA 1DGWA 4BA9A 3UUMA 2Q30A 3B9IA 3BQLA 2ZM8A 1WW5A 2JD9A 5FZ6A 2JD4A 4ZZ5A 3KGZA 5GZEA 4Y20B 1WLWA 2XVGA 1LAJA 1MPXA 1TG7A 4JKLA 4LT5A 4O4LE 3OCPA 2Z79A 4IL9A 3U75A 2KA3A 4B7EA 4QWNA 5C3RA 2C0SA 4ASLA 3POJA 2V6YA 2JJ9A 1T6GC 4L11A 1AR72 3ZSKA 1WMDA 4KI5M 1XDPA 4BIFA 3KVAA 5FP8A 1WW7A 1FIOA 2CE7A 5C6CA 3NV3A 2WT1A 1LRZA 5ACA2 1OH4A 1DGRA 5BNPB 2Q4SA 2BP6A 3OGVA 4Q0PA 1H2KA 5AFBA 2QA7A 4J1WA 1QLBA 4URTA 4LF6T 1MR5A 4JGZB 4W65A 4Q8LA 3BGAA 3GNEA 1VMJA 1RMU2 3SWHA 2VCBA 2WLQA 4Q4X1 4JI2T 2CTVA 4EN6B 5HCFA 2R042 1PO13 2X68A 4L0PA 1ZA4A 4CVUA 4X1YE 3TLVA 4AFCA 4QX8A 2ZTNA 3I8TA 1ASJ1 1OHFA 4ARYA 1X50A 3TB0A 4Z92B 3MBWA 4ZHNA 4LMJA 4JI0T 1YNAA 4AGRA 2RM22 3EABA 1ZRFA 4AQ2A 3RGBA 2UXBT 1XC6A 1UGOA 4I3PA 5AQTB 2Q1ZB 1IS5A 4FAHA 3RZKA 5JR9A 4GKYA 1AR83 3CIRA 1IQDC 3I3EA 5JWPA 3ZFFC 4PT6A 1PZ9A 4M4RA 1GZWB 4YWAA 4DEQA 4HKWA 2WN3A 3GCXA 3K3OA 1SLTA 4HL0A 1QDCA 3TKLB 2M67A 1ND2A 1OEDA 4A98A 3HQRA 4QKFA 4OHZA 4LK6A 3CK6A 4IV3B 5JREA 4HBNA 5A70A 1SDWA 1W8HA 4XJAA 4DRRA 4D0QA 1R1A1 2ORXA 2Q8OA 2VMHA 4TLFA 4RR3B 1I1EA 4ZKTB 5FPZA 4AVCA 2OQ7A 4B3TT 1EYBA 3ZYMA 4NRPA 4IESA 2HWC1 3HKDE 4DRVA 3DN7A 1H1MA 2BWAA 3ACFA 3ZN5A 2V72A 3KINB 3RZLA 4U72A 4YZ4A 4QMAA 3UUNA 1XXNA 1HRI3 2ZHNA 3ZXEA 4XF3A 4HANA 2IFWA 3WAKA 1IS4A 4CZZB 5JOXA 1MEC3 1PK6C 2RS53 3OYZA 3ZEFB 3JAFA 2D6KA 4R9DA 5IUQA 1GYKA 4LFCT 5BNOC 1RTVA 2BGCA 2CWYA 1O8PA 4UXAA 2ARBA 4N53C 2AR6A 4CDUA 4Q4Y1 3AXJA 3JADA 4EYUA 3VBSC 5A7NA 4FTBA 4Y1YA 4L8QA 4GH4C 4L9IA 3SOLA 1SQ4A 5EYYA 3VKNA 3BI3A 2A5ZA 4DXSA 3OBRA 1EAH1 1CX4A 4GWJA 1W8UA 2VQ0A 5LA0A 1CPMA 1S0EA 3VBUC 4LOTA 3U11A 5F7UA 4AQTA 1ZZ7A 2QQNA 2WZPP 2CXFA 1LHOA 4EWEA 3FB2A 4XDOA 2RDRA 2WA3A 4JC1A 1W2UA 4PK6A 3X29B 3MIDA 5FCCA 2WZR3 4ZEYA 5BNNC 3AE4A 1OPMA 5FKCA 4FCAA 4OUSA 2VZOA 3RZZA 5C3OA 4X8PA 1ST8A 3DPRA 3BUCA 1WCUA 3TEXA 4ONUA 3L2YA 1QNWA 2G9ZA 2Y64A 1J1LA 4M00A 1XSQA 3NJZA 4BOWA 4DB5A 4GKXA 1I94T 1S0DA 5IHYA 3UETA 3ACLA 5CIRA 2KWIB 1KNRA 4U7IA 4P9GA 5AQNB 5DQ0A 3E97A 4IEZA 2VZ1A 1FPN2 3BPZA 2XWJB 1LVKA 1QXJA 2AZ5A 3PUHA 3MKDA 3FFQA 1ULGA 5AVPA 3USUA 3IAQA 4LORA 2C5JA 2L9QA 1LOFA 4AHZA 5FYTA 1PM4A 1BYHA 5J7MA 3AMNA 3R4DB 1JU4A 2NP0A 3FLPA 2BVMA 2B9UA 2B39A 1GKBA 2BJSA 1PGL2 3PU3A 3THCA 2YFZA 1OT5A 5K4LA 4H63V 1DYKA 1DZTA 5D8AB 2WNVC 4YVSA 2XBO1 3NKZA 5A32A 4X6RB 4IEOA 3W9AA 5JXGA 4AHWA 5DJQC 5L36A 1US3A 5J09A 1YUDA 3V5UA 4META 1F9KA 3NKTA 2RR11 3ECQA 4ZXKA 1JZ6A 1HIXA 2TBVA 1CWPA 5F5QA 1CZVA 4KU7A 4CEYB 2KT9A 3BQKA 5A7SA 2PJQA 4E8CA 4HWIB 2WT2A 4GAZA 3CDZB 4P9XA 1NA1C 1X7NA 4IW3A 3UUXB 1R64A 3V0AA 4RYDA 1QQP1 1W90A 5E89A 2BOJA 2R30A 4DIDB 1BJQA 1HKDA 3K8PC 4Y22B 2FCUA 2DCJA 4NHLA 4B4PA 4Y3OA 1ZRCA 1JZ4A 1N1SA 2ZGMA 4E2SA 5GM0A 3D3AA 2K2SA 2BRTA 3WT3A 2ADEA 1X9TA 5FY4A 4QQLA 3WG1A 3LG7A 4XCBA 2LUWA 4GZ9A 1CIWA 3NJXA 4HVRA 3RYPA 3VDCA 2YYOA 3B13A 4ZU5A 4GYSA 4QM9A 4YFSA 2ZAAA 5L3GB 1SBEA 3TLWA 4JKKA 3U07A 2V6XA 3OSDA 4MO3M 1GFF2 4AI9A 1UQXA 1SFPA 4Q1PA 4H14A 5H9SA 1Q5OA 1S0JA 1LULA 1PM7A 3BTZA 5E88A 4S2FA 3NAPA 3RNSA 3NNMA 3AKTA 4XIKA 1DLLA 4LF5T 4QX5A 5GONE 3OJAA 4B3ST 1C1FA 4Z07A 4YW7A 1WR0A 1RUG2 1FMD1 5LBMA 2VMCA 1UUSA 2NZ9A 3ZN4A 1U5IA 2WYSA 1V6KA 3O1HA 4DR1T 1LU1A 4KG0A 3WDXA 4Z91A 4GQ7A 2Y6XA 5C9AA 4OI1A 2XPJA 3OBVE 5HEJA 1RUI1 1H0BA 2CBIA 4KBBA 4MADA 2ZS6B 3OVUA 3VBRC 4U31A 4AQFC 1JYCA 1DU3D 3ZYPA 3P50A 1C8M2 1PX4A 2ADDA 1QJY1 1UZWA 1C57A 5FYYA 4FT8A 1QWRA 3ETVA 2A6YA 2RS32 2OT7A 2QVSB 3SXWA 3AE9A 5FWJA 4CCCA 1QOOA 5AQLB 2V7JA 4A2UA 4U3CA 3MF9A 4EV0A 1OD3A 2WZ8A 2VQUA 4YG3A 3T2TA 1COV3 4AKLA 4CDXA 3HKEE 2ARAA 4DMIA 3O1IA 1X82A 4A4AA 1Y9GA 2F17A 2ZGPA 3CJIB 2P4EA 4TUYE 2CGOA 2EXIA 1GQGA 1MIVA 5ETWA 3H8OA 1JHJA 1ZZ8A 3I2DA 3INAA 5A3NA 3RC8A 1SHWB 5DG1A 3V65A 3FX3A 1O5LA 1CAWA 1YIFA 2JDKA 2ZGTA 4XURA 5BPXA 3VD5A 1NZCA 1T72A 4ZXEA 1E5SA 2YY1A 5I0DA 1S2EA 5A6YA 4JI7T 4XZPA 5FPVA 1PMHX 5F37A 5IVJA 5T5PA 2MPKA 2JB8A 2V7KA 1D0ZA 1UK5A 2P5BA 1TNFA 2W3JA 3RVHA 1WGPA 5KC6A 2O8OA 4NIAA 2RHPA 1TMF3 5IK8A 1DGWX 5IAXA 1V6IA 4PJLA 4AL9A 1X79A 1FOD3 3NRYA 1MQTA 1C8NA 4HMZA 2VKDA 4IV1A 2VZSA 2WBKA 1QY4A 5FZAA 3PVBB 5A6XA 2IFRA 2VVFA 5LHIB 4GMP3 1R093 1UPSA 1ZVFA 1LEMA 2FDFA 5CVRA 2JJ6A 1F5JA 3ONJA 5LJMA 1JTZX 2W9XA 1W09A 2AACA 5C4WB 4EAHA 2VW0A 4QB6A 5A7QA 4Q4X2 1OUXA 1XE0A 1A78A 4N9HA 4ANJA 3E5XA 2RE9A 2XUEA 1BLZA 3N2GE 1ASJ2 3V0AB 1CAUA 1IBKT 4AFDA 2LM3A 4EGWA 1H8TB 4LE3A 4XMIA 4RQPC 3EQEA 1WA4A 3C2UA 2B5HA 5EV7A 3UNPA 1HTJF 4AI1A 3ZYIB 4V1Av 2K0GA 2X8KA 2DCYA 4GKJT 1JNZA 4S2GA 4QPIC 3A7QA 4XBFB 5FXVA 4Q8KA 5LATA 3M1HA 4LEJA 2YV8A 3H3MA 3WV6A 3RYFE 3C50A 3CQXC 2ZGUA 2YBKA 1W05A 2XH6A 4U7YA 5A80A 1NE6A 2LALA 4HONA 3ZXFA 2IWGB 1SPPA 1G9FA 1R1A2 4ASKA 2QQJA 1XSRA 2GK9A 1LOCA 3PUSA 5L9RA 3J7Yq 5I8SA 3VDDB 1QJU1 2J4GA 2HWC2 4HPKB 2ZX3A 1ENQA 3FXDB 1SACA 2J42A 1W39A 4QAWA 3WQ0A 4BYYA 2K5BB 1SLLA 1PZ7A 3WDUA 3ZMSB 1UU4A 5GLTA 2JQHA 2HPLA 4OI2A 2OW4A 2DURA 3TAYA 1GZTA 4AVSA 5BR8T 3EUHA 2VOVA 3N36A 2WZEA 3AMPA 2VNGA 4HFEA 3KD4A 5LGUB 1AYN3 1Y4WA 3C8XA 3QUJA 4F83A 1PVC3 4Q25A 1G9BA 2W92A 3U1XA 3ZC0A 1RB8G 2N7GA 4Y5Z0 4Q4Y2 3KVBA 3PVOA 2Y0IA 3Q8AA 4ISSA 3H8XA 2QQVA 4OMDA 4PBPA 4LITA 1EV13 1HRV1 5AQPB 4IL4A 1EAH2 1H7CA 4TV8E 4DV6T 2PHXA 3RIAA 3CEWA 3MHZA 4BQ2A 3P7IA 3RMXA 3RZJA 4YTNA 1BEV3 5H9QA 5CG8A 5JIAA 4PI2A 1QGLA 1Q43A 4RHV3 5JOZA 5IVVA 4JHZA 1W9RA 2VTXJ 5FPUA 2N9DA 2Y6JA 4DOUA 4DNYA 4I09A 4LFAT 5CFDC 2JG8B 4WZCA 2FBWA 4IEUA 1BCXA 3AZZA 3D0TA 4ASMB 1DQ0A 3O1OA 3IDEA 2VPVA 1MACA 2HPJA 2UY8A 2KM2A 3AECA 2RDSA 4X1KE 1N33T 2HEYF 5FZ8A 1RYYA 3LSVA 2LROA 4WVMB 3AYEA 2E63A 2BS4A 3SNMA 2X0YA 5FXXA 1ODMA 4NXNT 2C9AA 4LFBT 5LA6E 5I0SA 2Y60A 2J1DG 3RYIE 3LJCA 2WT0A 3F2ZA 2VZ3A 3AP7A 2XR4A 1MMNA 1ZX5A 1FAYA 1VRH1 2WM9A 2A70A 5KHIA 4WM8A 3EDVA 2DU0A 1B35A 2VNOA 1JH5A 2G9FA 4OZOA 1OXCA 1CIYA 4P14A 4OHXA 4B29A 2XBO2 3ZN6B 5JR2A 4D7TA 1PNFA 5DZGA 1EUTA 5BNPC 3T1HT 4QXCA 3OPTA 1AR73 1QEXA 3VGIA 2J1EA 2OVUA 3PVEA 3H9AA 1ONAA 2RR12 5IYZE 5T52A 1W0NA 2LSIA 3I2JA 3I0OA 3L3PA 2PHTA 2WQYA 4CP2A 2I2SA 3ZMTB 2C4XA 1LGBA 1US7B 1QH6A 4JGZC 1IBLT 1UY4A 5ACA3 4AGVA 4FTEA 3PV0F 1XNRT 1WD3A 3I2FA 1QQP2 3VHPA 4JRLA 4BK5A 1U5ZA 4H3WA 1LR5A 3UU6A 1YXRA 2A6VA 4OI4A 3MW2A 4M3CE 2X0HA 1Q56A 4MGKE 5GALA 1RMU3 2W2UA 2ES3A 3A0KA 1BR4A 3RI9A 3HNYM 2DUPA 2JE9A 2XMLA 1Y9QA 1LGNA 2R043 2ET1A 1UIKA 3AVSA 3K2OA 1G8XA 2W95A 2JKBA 3O1MA 3WVJA 1AZDA 3T2PA 3K77A 4O8SA 3BTAA 3ZFGC 2PLV1 1PMIA 1XU2A 2RM23 3OEAA 4YHJA 3AYDA 3UU5A 2P3KA 2N2NA 3LF7A 2K46A 1ZOYA 2E7AA 1NLQA 2XVLA 4IV3C 2BU9A 3BKZA 4K7JA 5DZFA 3E22E 2JDZA 4O9GA 4COZA 1GANA 3OTOT 2BDRA 1E57A 2E8IA 4JQTA 5DUUA 1G9DA 4RR3C 1R082 4YARA 1CVNA 1ZYBA 1SA0E 1XNQT 4Z8BA 3LDKA 1UMZA 3LK3B 2XONA 3U14A 4U36A 3HR9A 2E5LT 1W28A 4EEBA 4DMWA 3B93A 2LHNA 3IWZA 4I3GA 3ETUA 4NHYA 3OBAA 1FMD2 4EN7B 2HN1A 4M01A 1W8NA 1KK7A 3GHMA 3FHAA 1VBE1 5DZEA 3L8RA 5F9TA 5LHHB 1D0HA 1E5IA 3HEIA 3R0RA 1RUI2 2DF7A 1EPWA 5FPAA 2X09A 4AEDA 3N5LA 3O1SA 1BBT1 4KWUA 1QJY2 4FPEA 2A6XA 3RZMA 5EZWA 1K5JA 4CXWA 4NIHA 5CFCB 1UZ0A 3GM8A 2DUQA 5J1XA 3LDBA 3NVCA 3C3VA 2W2IA 4MXWB 1ZREA 3CIHA 4W6XA 2WQZC 4DY5A 4A41A 4TLGA 4IE6A 2WO7A 4QQHA 2YU2A 2I0MA 3DCQA 2JQKA 5EYXA 3M8LA 4XFFA 2FCTA 5DUXA 1XMQT 2LKHA 3JD71 2PFWA 4NO4A 3NKGA 2ARCA 4HTEA 5JDQA 1KJRA 4P02B 1CONA 3AE5A 4P5HA 2ZGNA 3RSJA 3BN6A 1O91A 4BISA 1D2SA 1WLXA 2BYVE 1XYNA 3APBA 3P3PA 4Y24A 2VWAA 4OQ9A 2ZHLA 5AQJB 3J9X1 4QD2A 5LGNB 2IUBA 4Y5TA 4WVWA 3FJSA 4ZI3C 1IPJA 4A6OA 2XSBA 1VMFA 2XQYA 1HXS1 4HKOA 5BXXA 3ZFFA 4D7SA 2VMDA 1HX1B 3ME2A 1TVGA 1ZBA3 2I07B 2BV4A 4AE2A 3AJYA 2KLQA 3WX5A 2LRLA 2IIUA 5C3PA 5JRCB 3ETQA 1J1TA 4CU7A 4D6QA 3DL3A 5EPAA 4WM8B 1ODNA 1T8BA 1FPN3 1UCUA 1GNZA 3KSCA 1GUIA 1MVQA 5D8AC 1YFXA 3BOWA 2ZMNA 4YYOA 2D3RA 1XWMA 1IG0A 2X67A 1T6BX 5T50A 2GNTA 4X1IE 4CI3B 3Q8FA 1OA4A 3F31A 5FK8A 1F8VA 4DR2T 2EIDA 3WF2A 2DFCA 3E1F1 4CEYC 5FZDA 2TEPA 2R7EB 2XY8B 5FMDA 4XILA 2NMOA 1OVSA 4NOTA 4KP3C 3J8F1 4UXNB 1W6NA 4PF5A 3VKGA 1MIYA 2E9XD 5BNOA 2RG4A 4ERRA 3VKOA 4DFSA 2QYWA 5DN2A 5JQGE 4OYUA 4NIQA 4OQ8A 5FYCA 5A3TA 4QX3A 2TNFA 1CZTA 3LPGA 3GA8A 2HN2A 3H1MA 3PJAA 3VBUA 2CWSA 5JR9C 1AR91 1PX3A 1DP0A 2ZABA 3E6CC 4CUBA 2ZKLA 5L73A 2E9XB 5C7GA 3CX6B 4HWCA 4MV2A 1HB3A 5EXOA 1IOAA 1Q8OA 3MIBA 4QX1A 1HS7A 4PQQA 5A3WA 5LK5A 1IAPA 4XTPA 1ND2C 1OEDC 5BNNA 4Q5OA 3M3CA 1JYNA 4QXKA 1FI2A 4XMAA 2GH8A 2D7FA 2EIEA 5ABJA 1UPIA 5K0UB 2B4KA 4IE7A 1F5FA 4A6SA 4J25A 3MV01 1HNZT 4I4TE 3SH5A 1JUHA 5FZ3A 3ZSEA 4ZY9A 1N47A 3CZUA 3ZCJA 4CCNA 2OQ6A 4PIZA 2W1WA 2WDQA 3RJRA 2Q9QD 3S7EA 3ANWB 5I0TA 2DVDA 1Z8UA 4CP9A 3FL7A 4L9BA 1SLIA 3FZFB 4Q26A 3F95A 2VOXA 3BIWE 5JMCA 2VUCA 2YDQA 2UYAA 3FMGA 4QXHA 1CAXB 4OFZA 3H1WA 1WD4A 1RUG3 1LENA 3LEKA 2QQKA 2C1FA 3AKSA 3WP3A 4YW6A 3VBHA 2Q9QB 1WCDJ 1L0VA 3ZO0B 3SHRA 1YFWA 2ZMAA 1HRV2 1K42A 4N8MA 3LBXB 3QC9A 4JZRA 1S2BA 5BMVE 1C8M3 3ZLIA 2IXHA 2DTWA 1BVP1 5A33A 5IK5A 5JXJA 5CAZA 1W6PA 2RS33 5FRAA 2XHNA 5F5WA 5CG9A 3CJIC 2HJIA 4F8AA 1W2TA 1CZSA 3S57A 1YI9A 2QDNA 4BU2A 3WD5A 3N2OA 1OOPB 3NNGA 5DG2A 2SPCA 2FJEA 4G63A 2WO3A 1BK1A 3O0WA 4XFAA 2FHRA 2DTYA 3JC6D 4H9PC 3DPRC 5KC5A 3CQGB 2BG9E 1JOBA 3GZAA 4F7ZA 5CGMA 1XQNA 3T0BA 4IREA 4EIWA 4JLEA 1WLCA 4LHNA 4CCLA 5AQOB 1DQ1A 1GOFA 2XGXA 3WF4A 4R9CA 5IWAT 3VBFA 1RUJ3 4L92A 4QDSA 3PUVF 1SFNA 3ES1A 1W99A 4KH9A 1ZBE1 1LOFC 2YBSA 3PDQA 1SEFA 4EWDA 2VURA 3DF0A 2I6HA 4FPCA 3TBDA 3O1RA 3MF6A 2A6WA 3OEBA 1G9AA 3VZMA 4UEMA 2HWD1 1ZV4X 3H50A 3ZOIA 2ZGQA 3D8CA 3AKQA 1AL21 2VW2A 3TEZA 1GZ9A 1HV0A 2ETEA 5C4WC 3N7LA 4EOZB 3UKTA 2C5DA 2X0LB 4A3XA 4DV2T 4UVAB 4HG6B 5GJ6A 3U37A 4RN5A 3P3NA 1OSGA 4O9EA 3Q5XA 4OYKA 4DVDA 3O1UA 1NYWA 5A1FA 2BERA 4AQFA 4QKBA 4IETA 1AUYA 5C8CB 4WV8A 4JHTA 4NRQA 5DDJ2 2D5HA 5E16A 4LO6B 4Q4X3 2CHNA 1EUUA 1MS8A 2E7QA 3RLFF 3PVNA 3C4WA 3OYWB 5FY0A 1R1ZA 1ASJ3 4UF0A 2OUJA 3FXEB 2WWUA 1HCIA 1UKGA 2PLV2 2VC9A 4ARXA 3ZYFA 3OPWA 1QUUA 3DYMA 4M3CA 4B7KA 2UUCT 4TNVA 3EYPA 4JI6T 4ZPIA 2R49A 4NAMA 1HLCA 1WYCA 3P4QA 2UXNB 3AMQA 3MPPG 5ABFB 4Z2AA 3VDDC 5FJHA 4XJWA 5JZGB 3T30A 2VR4A 3V64A 2NW8A 5A3LA 4DV1T 4XAEA 4QU2A 4AEKA 5DABA 4UIGA 1NXMA 2B45X 5EJZB 3QBQA 5FO8B 3K4ZA 4AISA 1R1A3 2JDPA 1X9BA 3HWJA 1VBE2 2JX9A 1Q8QA 3R84B 1UOJA 2AE9A 4TNWA 3GZEA 2HWC3 2RJLA 5LCYA 2Y34A 1OPOA 5C9AC 1AF9A 2VMIA 4QGLA 1BBT2 5C5TA 5CYYA 3K3NA 2UUBT 3AE3A 3PL0A 3ASIA 2RS11 5FQ0B 5HXVA 4QPWA 2C5KT 4O4HE 1GR3A 1SDDB 4QPYA 1AVBA 4LIUA 2VECA 3AEEA 1E5RA 2KMFA 4EYYR 1W2AX 3VKLA 3V5SA 3A22A 3FC0A 2VULA 3HL6A 3MEPA 3QH7A 2J22A 3ELNA 4IEPA 1J1JA 3S5QA 5LA9A 3ZXDA 1LRHA 5FY9A 2WSSV 4AZZA 4Q4Y3 4ZONA 4MHRA 5D2AA 1BXHA 4MYEA 5HEOA 3VDAA 1DCSA 3TNPB 3ETPA 3IB3A 3WUDA 4OI0A 1EAH3 4YZ2A 3O4XE 3VHLA 2RA1A 2ODUA 2QTWB 1ZHCA 2DYCA 5FYMA 3QCWA 4HFCA 1AR81 5GLWA 4Q4W1 4LBNA 4KWLA 3WW3A 1V6JA 3B57A 5DAQA 2X9WA 1X9PA 1Y64B 4AQ6A 1LODA 1FMWA 1DU2A 1QHDA 4CN6A 3RGLA 2VL4A 3N9NA 4Q0SA 4J6GA 2XOMA 1WMEA 1HXS2 3A7MA 5F5CA 1YHFA 5F1RA 5K8SA 4Q0VA 5J1GA 4MGTA 1OLME 4V1PA 4XBQA 5LEJA 2WS3A 4OX9T 2XLGA 4D94A 3NV2A 1Y01A 4C0BA 1NG0A 3ZKYA 4NUUA 5FYZA 4OK0A 3UGFA 4GB33 2NPIA 1CHUA 2HH9A 3QNUA 1O4YA 3AM2A 2IXCA 4QM8A 4HKAA 1VAKA 1W9WA 2Y8KA 1UU5A 2F6BA 2QQOA 2YEVC 4IV1C 3E6DA 1YKHB 1O7FA 3OY8A 3ZDSA 5AFUL 3MACA 3AJZA 3SFDA 4ZI2C 1OLQA 5GZGA 4FO9A 2CDPA 2EA7A 3TEYA 2HWE1 4B3NA 2QUOA 4HWDA 4N90A 4H9NC 1DF0A 3I2GA 2XBO3 3J8F2 4KWKA 3RX6A 5IFPA 4H63H 4P0BA 2VZQA 2WU2A 2Y8DA 3SMHA 2XQRA 2YC0A 4IL7A 5C3SA 2RR13 5LA2A 3MO4A 3JCIA 4PHZA 3ZYLA 4BLIA 5CKMA 4LBLA 5FZOA 3GBGA 3NNLA 3ONLC 2CY6A 2JG9A 2UWCA 1AHSA 3DGTA 2LM2A 4V2VA 2W63A 1TNRA 4AQGA 1B7TA 1HG2A 3O5SA 2CBJA 1WA6X 1QQP3 4W8JA 5IJRA 1F15A 1GOHA 1AX2A 1FYUA 1I3HA 3KV6A 2JDAA 2WA4A 4P08A 3PUAA 1AR92 1NCRA 3IMNA 4HFBA 4KUMB 1I6XA 4P09A 4FXKB 4MUVA 2VKJA 1XNAA 3MGUA 3N4MA 1S0CA 4EZHA 4HKLA 5FY1A 2CNAA 3TN91 5T3NA 3ZSTA 4EROA 4COVA 2MEV1 2NN8A 1ND3B 4LBQB 3PHMA 1S0BA 1OQ1A 4CEWB 4GWNA 1UYYA 4DS0A 2DL1A 3ZPYA 5F6KA 1RUNA 5FZ9A 4QXBA 1UNBA 2AENA 4DV4T 3VKHA 2C5IT 2Z42A 3KGLA 2HKXA 1D0GA 4LBOA 3ZT5A 1L7LA 2WNUA 5KXJA 2YPJA 3LB9A 2H7VC 2N1GA 4ZS3A 1LKXA 3RHWA 4KL1A 1UY3A 5FXWA 2W00A 1ENSA 3VUOA 4IE4A 1J3QA 4DR5T 1K5MB 4PFPA 3BK9A 4M1PA 3FZKB 4HN1A 5LP6E 4XAXB 1R083 4IQPA 3EXUA 1YJLA 2FD8A 3KWVA 3SITA 4KHZF 1XB9A 3OUIA 2H0BA 3POFA 4QQPA 3LE0A 1QSDA 4N43B 1FMD3 3L39A 4AIUA 4ATFA 4YVWB 4NR1A 2GP3A 4ORFA 2IUWA 2C0ZA 3WF3A 4P0AA 3I59B 1QOSA 3QOPA 1WWYA 1OXZA 4XUOA 2VL0A 3B02A 1RUI3 4NAOA 1KEYA 1FX5A 4LIVA 5BNPA 4YT0A 2DVAA 1XNBA 2XJVA 1DQ4A 1QJY3 2PHRA 3I97A 3C7GA 1S94A 1UOBA 2O14A 4JGZA 3RDIA 4PCRA 1WCRA 2QVAA 1IQAA 3W20A 1BR0A 3RC3A 3VR9A 3POYA 1WFDA 3L9JT 3RRDA 1RUD2 2ZEYA 2XM2A 2QZ2A 4XZCA 1XU1A 1GP6A 1VMHA 2VZUA 1W2OA 5H9RA 1VBD1 4OMCA 4XF0A 2ZHKA 4JV4A 1YFYA 3ZXGA 3N9QA 1Y3TA 4Y5SA 4QX2A 2ZM2A 4GOUA 3VZKA 1E7PA 1OF3A 4QB1A 2AREA 1ZRDA 5DAXA 2JMKA 1W6OB 1F4HA 3ZIXA 3I3BA 2D44A 4XOGA 2XAJB 2CYFA 1JYXA 4U74A 3K51A 1GZWA 3SQOA 4DXRA 4M0NA 3K46A 1LOBA 1NWMX 1Y9MA 1YO8A 2BG9A 1NCQB 2PHWA 3M2MA 1U12A 1ZBE2 4URAA 2NWBA 4IV3A 1IZNB 4OVEA 1UMHA 4AQYT 4WM8C 4ZHQE 5DAWA 3KF5A 1B35C 1OKOA 3ST7A 4XDPA 3GBFA 2GMEA 3L2HA 4RR3A 4Y1ZA 2W5FA 1Q3EA 1W6MB 2YU1A 4PF1A 4IGUA 1FNYA 1WR6A 3RZGA 1LVFA 4YLHA 1LEDA 1VLNA 4U2ZA 4ADZA 3B5MA 1UY0A 1RHI1 1AL22 5L2LA 5LBEA 3JBG1 5IVBA 2RDQA 1FXZA 3WW2A 2X5IB 3SH4A 2UXDT 1ULCA 1ZM1A 1JU3A 3I2IA 3GJBA 4QKDA 2J1RA 3ATGA 2Z2SB 4C8DA 2V5DA 3JZVA 1HR0T 2PHLA 2C9KA 1KS4A 5F5AA 2CV6A 2JIWA 2I74A 2DWGA 2XAQB 4LBKA 1Q8VA 4TTGA 1YIPA 2OXBA 3KHBA 2XLFA 1D7PM 2EHOD 1HW5A 4WW0A 2JG9B 2RMU2 4W6WA 2ZGLA 2M6IA 3BTYA 2ZGRA 3LA3A 4RFT0 1VBA1 3ZKUA 2Y6FA 2CCQA 3B7MA 5FO7B 4DEVA 4HEAA 4HT1T 2DVFA 2QQMA 5M4YA 1OLRA 2XXZA 1KGYA 3W5MA 1YQ8A 2NQYA 2VW1A 3OPZA 5IK7A 2CHHA 2ZJCA 1UY2A 4TX5A 4BXSV 2B8MA 3ZXAC 3OUJA 3C7OA 2EHOB 4DV0T 2CU5A 4LF9T 3NZPA 3POWA 2OS2A 5BNQA 1JYTA 3UL2A 1D1AA 2DU1A 3KV4A 1WBFA 2ZMKA 2JECA 1AR61 1RXFA 3IF8B 1AJ3A 3GBWA 5E6HA 3VHOA 2V09A 1JI6A 4CDQB 2R32A 1ZZ6A 1OA3A 4AGGA 2PELA 2PAKA 5C8YE 2Y26A 4K1ZA 3PMSA 2ZZQA 2VBDA 3RYKA 4YZ5A 2WC2A 3AP4A 4U2YA 4CPBD 1H6YA 3VKMA 1FOD1 1E5HA 3JB8A 1XYPA 3W58A 3WP5A 5HAXA 4FFHA 1LESA 4KG8A 2FMDA 1JN2P 3C4XA 3FZMB 2DDUA 3O1TA 2RS12 4AEDC 3ZT7A 1D4M1 3USSA 1NLSA 3HAGA 2HYKA 3AZVA 2PHDA 5HPOA 4LKEA 3W59A 5JLVA 3GYDA 5DUWA 5D8AA 2ZKNA 3RYCE 1REDA 1SHZC 4M0HA 4R4ZA 1WLTA 3AEBA 2VKOA 5GKAC 4NHKA 3FBYA 1YQCA 4YSFA 2CHOA 5AC91 4PW8A 4MGSA 4MGQA 2VMEA 3U10A 1P8JA 4OULA 2JDMA 4FFFA 5FLJA 3O7OA 2CWOA 2M6BA 4PNIA 2Q0AA 5A7WB 2XJRA 4CEYA 3WEZA 3O0VA 4XDQA 1HRV3 3N7KA 2BBVA 4YGEA 2VQAA 2BGPA 1QJEA 4CDWB 2XTLA 1C1LA 4F8HA 1BR1A 3TNQA 4Y22A 1RUC1 3WCRA 2LW8A 1XNTA 4Q4W2 4IT4A 4QPGB 2LRKA 1M7KA 4WVVA 4K9SA 3ZMOA 5FUNA 3AAIA 4MGZE 2YN6A 2YPDA 4KX6A 4AVTA 1H1AA 4A97A 1HQNA 2XDVA 3ZJ1A 4BQ1A 5KXBA 1W9TA 4BWOA 3FLRA 4LKFA 1CX1A 3RIUC 3RPQA 4CE8A 4AKHA 1POV1 3CLPA 1I5PA 1FEWA 3ZT6A 1WW4A 4JGYB 1NEKA 2BG9B 5KXEA 5AQFB 1ZKEA 3DUIA 1NAEA 3MIGA 5LHGB 2J1TA 3FZLB 3H3ZA 1D1CA 4QHZA 4NPPA 2NYYA 2G4IA 1YD8G 3POGA 1OLMA 1W3VA 4H55A 1W9SA 3SLIA 2Y38A 3AB3B 4AHXA 2VCMA 4EZ4A 3OBZA 3IBPA 4GKKT 5FZEA 4ET7A 4HLTA 4GWMA 2K9ZA 3PJQA 3QK6A 4O2AE 2A6ZA 4ZU4A 2HWE2 4UFHA 3V0BB 2VY0A 1HX8A 2L3LA 3VV1A 3KQ4B 3JXSA 1PVC1 4CCOA 4LHLA 1H6XA 4P9WA 1LOAA 1SBFA 4PJYA 3VLBB 1PK6B 4HE8A 1RUF1 3SEPA 5JIUA 2XB6C 4IEWA 2YROA 3UKVA 4DNDA 3VL8A 1OKQA 1F35A 5KHKA 1QDOA 5A1AA 3I1AA 1X36A 3S4UA 4D3WA 4N53B 3KBUA 1PO21 1SE7A 1RITA 4KMQA 2NOXA 4FPLA 4RHV1 5ABHA 3ILFA 2PYTA 5JDHA 2QBXA 3SCHA 1Z78A 3CJXA 3M70A 3VN4A 4R4XA 3MIFA 4TZDA 1WCQA 1YQ4A 5DDJ3 1LECA 2XLAA 3WR0A 3TN92 3R05A 2XQXA 3HIFA 3CJIA 2MEV2 4NE9A 4UBHA 1VB2A 4LBJA 2LS6A 2BVBA 3KCXA 2BKNA 2P34A 5EJ3A 2UWAA 1QIQA 3T0AA 3PDYA 4E4SA 2VXJA 1NE4A 4AR2A 2D5UA 4XIOA 4FFGA 4P5YA 3OGSA 1ULFA 5ABJC 3LFMA 4YW5A 5JZGC 3LOBA 2VK9A 4MVTA 4WM7B 4A56A 3VD3A 2R16A 2P6HA 4XUQA 4GD4A 2XSAA 1N32T 4I55E 4YSXA 2QE3A 4FPHA 2WS91 1ZZ9A 2FZ1A 4BDVB 5I8TA 1QH7A 1BKZA 5EP9A 3VBOB 1YQ5A 4KI0F 2SLIA 3ZYGA 2K3WA 3POEA 4DR3T 5ABGA 4IIJE 2DUOA 5FVLA 2WCAA 1ULDA 3H7YA 2D2SA 2LSJA 3PNAA 3WW4A 1NOVA 2GMPA 3O12A 2JDYA 3FUQA 3HT2A 1GOGA 2WDBA 5FZFA 2JRKA 3C4ZA 1SZBA 3MI8A 1JYIA 2XASB 4BLJA 3CO2A 4AWDA 1VBE3 4MFRA 4FTSA 4MG2A 1VP6A 3ZR5A 1PGW1 3HN3A 3MLKA 2LE8A 1MS4A 2R6GF 4N7UA 3D0SA 2V4VA 2VVNA 3VBHC 4O7XA 2WNVB 3SCFA 3NNFA 5K9YA 4L0RA 2HEWF 4FQZA 1BBT3 4Y1UA 1MMDA 2ACZA 2XWBB 1ZP0A 4Q4V2 4IEYA 4OUEA 1YYNA 2V1DB 5C4WA 4X64T 3C64A 2DWKA 4S2DA 1TZOA 3S5AA 1ZRIA 1ZRRA 3MPBA 5H6QB 2R1BA 1RMU1 4QGNA 4ZZCA 3KS7A 1NA1B 2R041 2MNGA 4EB6E 2X29A 4LO4B 1VBD2 1LHVA 2B7YA 3T0DA 5J48A 1H8TA 4RD7A 3OPCA 1YWKA 3LDQB 4XUTA 3CKHA 2KSRA 1DHKB 3RZHA 3MK7C 4BMEA 3MZHA 2DFBA 5LY2A 1XNCA 2YINA 1JS9A 5FYVA 2VJXA 3S6PA 5HXSA 5GLVA 1UL9A 2UXXB 2DHRA 5F3GA 2JDUA 5JTGA 1DQ6A 1G9CA 4WYVA 5FBZA 3P4RA 3VL9A 3KDSE 5KHJA 3AE2A 4G3YC 1PIV1 3W5NA 1GQPA 5JXIA 3VBFC 2GDFA 4RSUA 4IHJE 2A3WA 3A8YC 3QOFA 4GYRA 4O4JE 5FYIA 3ZSLA 4LMFA 1HXS3 2QQUA 1M62A 3MYXA 4JV5T 4IDNA 4QX7B 5E1RA 4NPMA 1A8MA 4LMKA 3VDDA 4N78D 2JB4A 5AQVB 2WAUA 1Y7BA 1W0PA 4E4HA 4JUYA 4HPKA 2GC3A 1RHI2 1SMVA 2W1SA 4NPLA 3JBG2 3AFKA 5LASA 3ALQA 3WDTA 5L9VA 1GICA 4B6XA 1JYWA 1JNRA 3T2OA 2V7IA 3ES4A 4L5GA 2OV9A 2XAGB 1H2LA 2FQPA 1LTEA 2YUEA 4PIYA 4K6BA 2A3XA 1W8OA 5K7PA 2ZCWA 1UZYA 4UFLA 3WNMA 4QKNA 1O8SA 4A7ZA 3VBRB 2ZEZA 2WR9A 4TWTA 4D7YA 2BZBA 3GZUC 1N36T 1E2AA 5JDBA 3LA7A 2JQQA 3J8F3 2VOKA 1TME1 1VBB3 2IVIB 3HVDA 1M4WA 1ZA7A 3I3MA 1IG3A 4JEUB 1VBA2 1UZZA 1UIJA 2FDGA 4NN0A 3M3EA 2ZPXA 4K21A 5D1IA 4ZZBA 4F6RC 1BR2A 1AJKA 2XUMA 3KHCA 5AVAA 4TN7B 3EHZA 4CP0A 3AEDA 2PBIA 3ILRA 4RS5B 1UN1A 2XAHB 4UI9L 5JMOA 2B46X 5CKQA 4UW3A 2WN2A 4QH4A 1IGOA 2JG8A 4QH1A 2VASA 3VDBA 3IM0A 1AR93 3JUUA 4P9IA 1JYVA 4KBZA 4NUVA 1AR62 4CCJA 3JU9A 5APAA 5T5JA 3GF6A 1JXNA 1ZBA1 3ZSSA 4DR4T 4D69A 2VUJA 3A5XA 5L7OB 4WVMA 1VALA 1KNPA 2HWB1 1GZCA 2QQIA 3RRWA 4OZXA 4P9LA 4K0UA 4H9RC 4A7YA 5J96B 3ZR6A 1J5WA 2DCTA 3AVRA 1GSLA 1GWKA 2IXKA 1UMIA 4EN0A 5FYSA 3KBTA 2WO1A 3RQ0A 4QHOA 3CWZB 3UESA 3PJAJ 3T4VA 1W8TA 1D4M2 1JHNA 4FPOB 4PK4A 1ULOA 5F5IA 3AKRA 1URXA 4NHMA 4IGPA 5LK7B 4DR7T 2VAUA 3ZN6A 5FKYA 3MLJA 1BMV1 1YQ6A 2EVXA 2WP9A 1W8WA 1QJX1 4MBQA 3ZXLA 5AC92 4V2WA 4Z90A 2MOZA 4HK8A 1SUMB 2HLEA 5EK4A 5J0ZA 3HR0A 4M4PA 1E1HB 5A7OA 4PDWA 3K3QC 1J59A 1U0AA 3ZXKA 4HETA 5ERLA 3EVYA 1V6NA 5FLHA 4Z1VA 5DAVA 5BYNA 3GGLA 1RUE1 4JTOA 4K0KT 2YBPA 3AP5A 2OYZA 4QU1A 5AQIB 3ZCIA 4GJZA 1V0AA 1S2KA 5HV4A 3IIAA 5I0RA 2LOPA 1UX4A 4KNCA 1O5UA 5LY1A 2FDHA 2J47A 3ABVA 1RUC2 5EFUA 4AXPA 1DG6A 5FK7A 1IS6A 4X5TA 2E9QA 1W6QB 4DV7T 4RQPB 4XW3A 1OURA 5FP9A 2JDHA 3TEWA 1RUD3 3ON7A 1V00A 4QT6A 2DCKA 1W8ZA 4XFGA 4QPIB 4MLOA 4XTMA 4YFWA 4TWDA 1HG5A 3I2OA 1W3XA 3WNXA 4JDMA 2BVLA 3H0OA 2WSUA 4X8NA 3MICA 1EPZA 2EIGA 4PLNA 3OJBA 4XXPA 2LRPA 1S0FA 2H6CA 5FZCA 2ZGKA 1V9U1 3VB9A 3H42B 4EWAA 4FBFA 2MHFA 4FFIA 4NVPA 3RRCA 1CAVB 3ORJA 2PXJA 5A3PA 3VHNA 1MS3A 3MIHA 2P9BA 5IVFA 1YCIA 3WOGA 3QACA 1IJ6A 2ZZJA 2LM9A 1DIWA 1CD3G 2AH2A 4ZZ8A 1ZBE3 1DQ2A 4YW4A 3ZYRA 3HBKA 2E31A 2VBBA 4WZFA 2OUHA 2WQ8A 5L47A 1XRUA 3C7FA 2JXAA 4MZUA 3ZMNA 1W0BA 2X5IC 3OBTA 1LOEA 1GQEA 1RUH1 2W68A 4I30A 1RVF1 3ZFEA 1WYBA 1V6OA 4NIIA 1HB1A 3ROUA 1AL23 1RUF2 3IA3A 2PG8A 1H9WA 3P4WA 4XCAA 4BJNA 2ZM6T 4XFBA 4BQ3A 4BK4A 2I59A 2JG9C 5CFCA 2Y6KA 4UFMA 4LTAA 3OKQA 3K1SA 1PO22 4UWDA 2IXJA 3WCSA 2BOIA 1EZ3A 2XAFB 4N7IA 1TQ5A 4YW3A 3LGRA 2E26A 3WG2A 2BBJA 3UYJA 3PURA 4ATEA 2HHHT 4OFGA 4MXWA 3KT1A 1DGRN 2KINB 5FP4A 3NVOA 4AAPA 5JI9A 5JDLA 1NCRC 4U33A 4AHYA 2CAUA 4HFVA 2AXDS 2RMU3 1STMA 3TLTA 3HN1A 5FDBA 5JR7B 2A3DA 2D9DA 4FOQA 1O4ZA 4XJZA 3AMMA 1AX1A 1OFSA 1SLBA 4D6RA 1O3RA 1KNZA 1Z7S1 1VBC1 3RKOA 1HX6A 4O2BE 3PIGA 2UY9A 2VGDA 2W39A 5DPNA 1VJ2A 2AEZA 5JPNB 2WFF1 3GWHA 2K9AA 3B3QE 5J3UA 1RUJ1 2ZM0A 2WNUC 5FMCA 4IEVA 2WS92 3ZKRA 3P1IA 3TYJA 4KBMB 4DY3A 2BKPA 2IZWA 3Q8EA 1I6ZA 4XF1A 5LW9A 3WAJA 2GN3A 2VCAA 4UW6A 3NW4A 3R6SA 5KX5E 3LDRA 3WY6A 2IMLA 5HXRA 3RI8A 5CJ5A 4P00B 2BNMA 4DUXA 3AMHA 5ANNA 2HEVF 2CPTA 4BH9A 2CAVA 3POSA 3GN5B 5JRCA 5L3FB 3E08A 3B00A 1HF8A 1H1IA 2ZA9A 2C24A 4W50A 2V8SV 3IHRA 2VQFT 2ZAHA 2DVGA 2E32A 2I45A 1PGW2 2O1QA 3WI3A 5FMOS 2ZGOA 2NMNA 4UFKA 5CB4E 4BMBA 1S4CA 5CU1A 1F2NA 3IIIA 4E7ZA 4TSVA 2RS13 2FJDA 5KWRA 1MNDA 4FQ4A 4K40A 1VE0A 1DGLA 5LRRA 4PDWB 1C5HA 3ONXA 3OGRA 4YG6A 4XPVA 1X33A 1I5ZA 4NHXA 4CDWC 4TZ4C 5FR3A 2XJUA 3B69A 2JDNA 3MDPA 3HNMA 3U0ZA 2R061 2FJBA 4H9QC 1IKQA 2XQ6A 1NUKA 5FMNA 2WZIA 2ZXQA 5CADA 4Q1RA 3DTOA 1LNSA 5FOJB 3GXUA 4QPGC 3A4UA 4JDNA 2FZ2A 4UBGA 2PFVA 1SCSA 1DDLA 1OVPA 5F6LB 3AEFA 1N3OA 3IDCB 1AX0A 2RJ2A 4JRAA 5DQWA 5C33A 3NV1A 3O1VA 1HDKA 2KD7A 4YTMA 4FAGA 1PIV2 4Q4W3 3PUYF 2E9XA 2EALA 2D6OX 1V6MA 3AX4A 4DBRA 3HA4A 3ZFGB 2J1AA 3IAPA 4Y4RA 2WWSA 2E53A 4HVOA 2E2AA 1CESA 4JGYC 2BG9C 2HWF1 2PAMA 2AC1A 5JSRA 2YKSA 2W91A 4COUA 3O9XA 1F4AA 5K0UA 3P6BA 5H6RB 2WIIB 2R071 3BU0A 2Q8EA 3IDBB 2A2FX 4G4FA 5ADXL 3JQWA 4A7KA 4TXWA 2ID4A 5FYBA 3BVCA 4CI1B 4GMP0 2BUKA 3ANWA 3HKCE 4LPLA 4MOAA 1NKGA 3DP7A 5AQQB 5FL0A 1NZIA 2IVJA 3IPVB 2PMWB 2VM9A 4EV6A 2R0FA 2KXLA 3A0NA 3E6BA 1YW0A 1U5YA 5J2UE 2P37A 2QGSA 2RJKA 4HFHA 2IW5B 1ENXA 3ZFEB 4I0UA 5SV5A 4IE0A 1CAXA 2XZEA 5JOYA 1IS3A 4PIXA 2ZGSA 4Q29A 1REFA 1YI7A 4NIGA 2H3RA 3B9CA 1RGSA 3H3AA 5LMNT 2HWE3 5FZ7A 4PJMA 1QKQA 3I2KA 5L3DB 3JCFA 3AP9A 2V5YA 3UK9A 3KMHA 5GLZA 3RPUA 2W61A 2XL7A 2LSGA 4XABA 2Q9QA 1TME2 4DUVA 3I0QA 1L3JA 4HWHA 5FMOL 1G7YA 2ERFA 1XE8A 2RDNA 3LBXA 1UU6A 2QRXA 5L3CB 1ZEEA 2ODVA 2VE1A 4FPJA 3N9LA 1D1BA 2CEAA 5LBCA 5T5LA 2H6BA 4AFMA 1LHUA 4PK5A 4DBQA 3LAGA 2LOSA 3KF3A 2GC0A 4ZI3D 3UFGA 3WHUA 1OI6A 1W9YA 3GHNA 1OOPA 5IVEA 3BODA 4D8MA 3NV4A 4NRMA 4LF8T 3N7MA 5FVKA 4LJHA 3CU7A 4BQWA 5FNVE 2XJPA 5JAXA 3BIEA 1W2NA 1KDKA 4BIOA 3TN93 4L97A 3H3LA 3ZYKA 2MEV3 1J84A 4WM7C 3N9PA 1ZBA2 3GALA 2BS2A 2OLTA 4HOOA 3PUGA 4PFOA 2HWB2 5CFBA 3J7NA 3LK2B 3RIUA 4GB31 3VBOC 3VZJA 1XMOT 1CN1A 1KDMA 2NW9A 1VRBA 4IDZA 2R0HA 3SS1A 1QMJA 2NM1A 2BNNA 5FYUA 5HCMA 2LEHA 4QWNB 4GIQA 3D0JA 2L8KA 1O3TA 2V6YB 2XHEB 1UAIA 1N1VA 2BWCA 2ZEWA 4XF4A 2OX0A 5AQGB 3W15B 5LWBA 5HCBA 5LG3A 2VB6A 1BMV2 1XDOA 1QJX2 4AVBA 3B94A 4LOSA 1LCLA 1HQWA 3KT4A 2BDEA 2W47A 1NQDA 1HV1A 2GALA 3WQ1A 2MYSA 5JH7E 5FTTC 1DYPA 3CVRA 3FHNA 5B4NA 3L09A 4A5XA 4ILBA 3WINE 5LCWL 3AP6A 1OH3A 1RUE2 2A73B 3OG2A 4D6SA 1PGSA 3WG3A 2G9GA 4OHVA 1T7SA 4K8FA 3ENRA 4QHBA 2BW8A 4Q4V3 3H3UA 2VZTA 2UUAT 4Q0UA 5C8CA 3O1JA 2B76A 4XAAA 5FZKA 1R8IA 1BZWA 1HN1A 4QX8B 2XVKA 5FREA 4DUZT 2Y6GA 4A3ZA 3UU4A 4G9SB 4JYAT 1HB4A 4JI5T 3RIFA 3OYWA 3X1DA 4DXZA 2A1XA 1AYM1 3PU8A 4DV5T 2JENA 5BV6A 1VBD3 3K48A 3TLSA 5F39A 1VOMA 2PAEA 5A6QA 4GIWA 4BB3A 1ULPA 1PHMA 5JR9B 4ISTA 4R52A 2Z69A 1V9U2 5AQRB 2LSYA 3ZN0B 3RYHE 5FY8A 2A75A 3WW1A 3M3OA 3AXDA 5IAVA 2H0VA 3ABZA 1ND2B 1OEDB 5CA6A 1XZYA 1US2A 4JQRA 5HV0A 5ABFA 2A7AA 4Y1VA 4DQAA 5C5UA 2CA5A 2LLYA 5JZGA 3T1MA 1QJU2 3HMYA 4LNVA 3OOXA 2XQ9A 1R081 3LWCA 4S2HA 2YHJA 2BBAA 4F3JA 5EHDA 5AQMB 1HQLA 1EY2A 1APNA 3FWEA 4CUAA 2HYXA 4EQVA 5LB7B 5FZBA 4JI1T 1RUH2 4DO0A 1RVF2 3SH3A 4YGBA 1GU3A 4IGOA 4MHCA 1RHI3 5EK2A 5HEHA 3JBG3 1W06A 4OHYA 5EK3A 2RPAA 2X9XA 1JW6A 3M3IA 3VD9A 5F2SA 5FQ0A 1V70A 2MTQA 1KJLA 2IC6A 2QDRA 4HSLA 3ZYBA 4IDPA 4AXOA 5HXMA 3LIGA 4YXDA 4AF9A 4CDUB 3Q5DA 4AQSA 2WKKA 3AXJB 1YXWA 2F4PA 1G6NA 4E8DA 4CN1A 3UU3A 3IDAA 2H89A 2ZX0A 4Z8XA 1A3KA 4AFAA 2JE7A 1UKRA 1OQDA 1LB2A 2DI4A 4RS5C 3UUBA 1SCRA 1VBA3 3LK42 5JDNA 1G8WA 3AB0A 1Z7S2 1CPNA 2FJAA 4FI5A 1VBC2 3J9SA 3GDBA 4YSYA 2WDRA 1QF3A 2YZ4A 2VL8A 3AA0B 1W03A 1ULEA 5CKNA 4DR6T 3BYWA 1S0IA 3HT1A 2WFF2 3PTYA 4H9SE 2WWJA 3WLUA 5HEGA 1IJ5A 2BEOA 3IMMA 3AEGA 2DV9A 4L99A 3DPRB 4CRQA 2X53S 2HH7A 1RUJ2 4QDRA 4I43B 2W0XA 4YM2A 5T55A 5CNAA 1GNYA 3LOIA 3SC7X 5L7OC 1OA2A 4MSVA 5FO9B 2JMHA 2DLRA 2FBEA 3AYCA 1W9FA 3H8UA 1ALYA 1AR63 5FIXA 4COWA 1Y43B 5T5OA 5CISA 3OGGA 4AEJA 5HWXA 1YFUA 5JDFA 1U5PA 5EQUA 4Y1XA 4AW7A 2B42B 2PTMA 5FWEA 3PUIA 1VRH2 5F8PA 1JZ5A 2UWBA 3USUB 2FDKA 4QQ2A 2VOTA 3RQUA 1OC1A 4O65A 5CBLA 3LKJA 5I91A 1JBCA 4E4ZA 2D40A 5BY5A 4NXMT 1WUVA 2DBIA 5L9BA 5I93A 2R1DA 4CTEA 2ZX1A 2EIBA 4YTPA 4DIQA 4YVSB 4X62T 1J58A 2ZHMA 3WDWA 3RG0A 3K4AA 5A32B 1D4M3 2IXIA 2QCSB 1FNZA 1C4RA 2CDOA 4RFRB 2YB7A 1K3IA 4QH5A 4BA6A 4BJ0A 3WNOA 2UXCT 3AZWA 3UGGA 2XJQA 1N34T 2XL9A 3B01A 4OYJA 4H9OC 2PA7A 2CGPA 5AC93 1HB2A 4HK9A 2JIGA 2R062 1GV9A 2JPFA 4JI4T 3JB4C 3LPFA 3BPSA 1UCXA 4ZOLE 3EAMA 3DV8A 1H8TC 2OA5A 3U78A 4I0AA 2A3YA 5EIYB 5L4EA 1A6CA 1UYZA 3TLUA 2LKGA 1OMIA 4EXTA 2VOWA 2KZ7B 2BS3A 3ILNA 2CRBA 3THDA 4FOWA 4A42A 1UXXX 2OKXA 4CCDA 2WY2A 1RUC3 4C1WA 3WP4A 5C70A 2A72A 2V26A 3NRUA 1RINA 3WG4A 4JDOA 1L7QA 3H37A 2UU8A 1GP4A 3ZM8A 4YJ3E 3FE5A 5LA1A 3AA6B 1ND3A 2X10A 2VH9A 4LBQA 2HWF2 2WINB 4CEWA 5A3MA 2D98A 2JIJA 4XJ9A 4P1NA 4MALA 4HN9A 3MXZA 2CLYB 4FI9A 5LEKA 3FZHB 2R072 1POV3 2P6CA 4AVAA 1KQRA 3IN9A 4OCTA 1BHGA 4BAYB 4E27A 1L7RA 2YC2A 2Y48B 3NRXA 2BTVC 3WZ1A 3UKNA 5FFOC 1OF4A 2Q8DA 3NAPB 1UW8A 3TOJA 1W0OA 1UWWA 2GP5A 3TWIA 1K5MA 1UOFA 4LKSA 1DZQA 4CA9A 1CJDA 2WL1A 4JVAA 3A21A 5FZMA 4EJRA 5JVDE 3WNNA 4YLZA 4B3RT 1QU0A 2DCZA 4UELA 2IC9A 1U4QA 1HJFA 3UGHA 5G05L 1AJOA 5KXCA 5M0TA 3AC0A 3UQ4A 3Q8CA 4N43A 3WQ7A 5C9AB 1MVEA 4NUBA 4CXXA 2WDVA 5KHGA 4YRDA 3AE6A 1KS5A 4YVWA 4ILCA 3OF1A 2D6PA 4MH0E 3I59A 1IBMT 1N1TA 3RWNA 2KWHA 1ACCA 1GLHA 4XZUG 1UD1A 1RUF3 3UFEA 1UURA 5AQHB 1GNHA 3URFA 3VZLA 4OHWA 4C90A 3FN9A 2IXLA 2VVSA 2NP9A 2YGLA 1PO11 2RVAA 4PBOA 4IEXA 4NWWA 1JODA 5DAPA 3NSTA 1PO23 4RGAA 4GWIA 4W6YA 3WXPA 3QH6A 3SKVA 1MZ6A 3DJBA 3N35A 4CDXB 3I49A 3LIHA 4ILAA 3JD72 2E7TA 1O6UA 1POQA 4HSJA 1XBFA 3LFIA 1IKPA 4A45A 4XEZA 1M06G 2VO5A 1K12A 5C3QA 2XKOA 3RMYA 2JG8C 2VZRA 1AL0G 1JMUB 1G73A 4CUCA 5HCHA 3I2HA 3AEAA 1TE1B 2BZDA 3NZQA 2DCFA 1I9RA 2QNKA 3KT7A 1VAMA 1CAWB 3A23A 2BBHA 4UW4A 1NT0A 1MZEA 1JOPA 5HXEA 1HNWT 2EAAA 1W6OA 1N3QA 2VMGA 2D6MA 4GB32 3PTRB 1MS1A 3BQIA 3DEMA 5AQUB 3ZJ2A 3MZKB 2YGMA 4CZSA 3WSOA 2K24A 3NWIA 4ZI2D 5C2TA 4UW5A 2WS93 1NCQA 4P9YA 4NWVA 5KHHA 2BQPA 1QJFA 2XHKA 3ZC1A 5HBAA 3MJXA 4PLOA 2VBPA 5B2GB 4GJYA 4GULA 2V73A 3ZPOA 1W6MA 5IW0A 3CPZA 4QQOA 1MQTB 4NJ4A 4CP1A 1HRI1 4IV1B 3WF1A 1OUSA 1Z0HA 4UAPA 1QNYA 1H30A 1MEC1 2WO2A 2RS51 3PUXF 3NBXX 4CUGA 5L19A 4PDWC 2X5IA 4ZS2A 5FZGA 4CCMA 2A71A 5LB6A 1H8VA 3AA7B
chains in the Genus database with same CATH topology
3ETUA 4QKNA 3GN5A 5A80A 1CUNA 2Q9QB 2XAJB 4HOOA 2QA7A 3O4XE 2A3DA 3AB3B 2VKHA 4U74A 3VHLA 4EZ4A 4HONA 2RA1A 3IBPA 3PUGA 4PFOA 4Y33A 2ZMAA 4Y3OA 5FZEA 1KK7A 3LK2B 2ODUA 2BZBA 3LBXB 1ZHCA 4J2CA 3QC9A 1NWMX 2B1EA 4AI6A 4D6RA 2JQQA 5FYMA 5LHHB 5LJNA 5ANQA 3QK6A 4O2AE 2E9XC 4ASKA 5DQVA 3ZMZB 1KNZA 2NW9A 5BMVE 3F2EA 2GK9A 4URAA 3ZLIA 1VRBA 4DIQA 3PUSA 4IDZA 5FY4A 1HX8A 2NWBA 3LG7A 3J7Yq 1IZNB 3RKOA 2L3LA 3SWHA 3B57A 4O2BE 4JEUB 2X9WA 5FPAA 1Y64B 3SS1A 4CCOA 5HXCA 4ZHQE 2CXLA 5F2WA 5FYUA 3N5LA 1FMWA 2LEHA 3GWHA 4QWNB 3ESLA 2K9AA 2NTYA 2X68A 3F57A 3N9NA 2X9YA 3FXDB 4XDPA 3AAEB 4X1YE 5LG4A 2WBLA 2KNDA 5F5CA 2D0UA 4HE8A 2L8KA 2K5BB 2ZM0A 4CXWA 4F6RC 2XHEB 4QX8A 2NTXA 2YU1A 3ZMSB 4IGUA 3B13A 4BU2A 1BR2A 4KMCA 5LOVE 2LJLA 3N2OA 4GYSA 4TN7B 4GK5E 1WR6A 5J1GA 1LVFA 4KBMB 4OYJA 2OX0A 4YFSA 4H9OC 4YLHA 4ADZA 2PBIA 2SPCA 4DNDA 5L3GB 3CQCB 3W15B 2HPLA 5LWBA 4G63A 1OWAA 5L2LA 5LW9A 2XAHB 5JDMA 3WAJA 4CQIA 3LDBA 3I9WA 3I1AA 2CXDA 4QXHB 2VB6A 2JPFA 3S4UA 2CM0A 5KX5E 2W2IA 5J2TE 3N9OA 5HXRA 3N9MA 3JC6D 3KBUA 4AI9A 4H9PC 5IVBA 4NUUA 3RH3A 3CQGB 5FYZA 2VASA 4ZOLE 2BDEA 3ZN1B 4OK0A 5FZLA 3EUHA 3IEEA 2NOXA 4X20E 2OA5A 4IE6A 2MYSA 4UV9B 5JR9A 2EHOA 3U78A 5JH7E 5LGUB 2YU2A 2D0TA 5JDHA 5FY7A 4NUVA 3KV5A 3GN5B 4EIWA 5JRCA 3AAAB 4JLEA 5L3FB 4CCJA 3E08A 4GK0E 3QUJA 4EXTA 5E0OA 4C8DA 1HF8A 4ZI7E 3CVRA 2KZ7B 3FBLA 2WMOA 3FHNA 4HKAA 4CCLA 3L09A 3ZC0A 3IHRA 3K3OA 2YEVC 3EDUA 5F5AA 2W62A 3KVBA 4HTEA 4C91A 5GONE 3OJAA 5CA0E 2DWGA 1YKHB 2XAQB 4DMVA 5JDQA 4D6SA 3A5XA 3TKLB 2M67A 4ISSA 5FZIA 5AFUL 3WI3A 4WNKA 4LITA 3MACA 2A72A 5LBMA 3PUQA 2V26A 3RRWA 4ZI2C 5FUPA 2EHOD 3Q2MA 4K0UA 4H9RC 4WW0A 5JREA 4BISA 3C51A 1WLXA 5LXTE 5CB4E 1H7CA 3KV9A 4TV8E 3O1HA 4AKIA 3GMIA 3AVRA 3H37A 1MIWA 1T98A 2Y6XA 4WBOA 1YKEB 2VWAA 4YJ3E 3O1JA 3I9YA 3PDYA 4E7ZA 3P7IA 5FYSA 3AA6B 5FZKA 3KBTA 3OBVE 3J9X1 4H9NC 4QHOA 2YBSA 3UT5E 3CWZB 4QX8B 2Q9QC 5LGNB 2D5UA 4IGQA 3MA9A 3PDQA 4PAGA 1MNDA 4YJ2E 2OQ7A 2CCQA 3LFMA 2DNXA 4AQFC 3RX6A 3ZYMA 4H63H 4HEAA 2VK9A 4P0BA 4G2AA 3P8CD 4ZI3C 5F32A 1MMAA 3HKDE 3ONXA 3PE0A 4MALA 5M4YA 4HN9A 4A56A 2Y8DA 3MXZA 2CLYB 2XXZA 5IVVA 2XQYA 5FPUA 2N9DA 2WMNA 4PK4A 4GD4A 5FYYA 5L3BB 4I55E 3KINB 3ETVA 3PU8A 4UEMA 2NW7A 4U72A 3VU7H 5F5IA 3ZYLA 3CX7B 2OT7A 5FZOA 5FBJA 4TZ4C 4IGPA 1ZV4X 4TX5A 5F39A 5LBQB 5FWJA 1VOMA 3UUNA 2K48A 4BAYB 5A7PA 2V7JA 4GIWA 2KLQA 2Y48B 4JEHB 3NRXA 5JR9B 2EHOB 4V2VA 4H9QC 3WAKA 5FY5A 4CZZB 4AKGA 3D0TA 2W63A 4ISTA 2Q8DA 5CEHA 4AQGA 5FMNA 4MBQA 1B7TA 1HG2A 5JRCB 2HPJA 3OYZA 4V2WA 3NZPA 2MOZA 4EOZB 5FYHA 4IIJE 2LSYA 2OS2A 3DTOA 3ZEFB 3ZN0B 2GP5A 2D2SA 3ZMUB 1D1AA 2LSJA 2X0LB 3LD8A 4AKLA 3KV4A 4D6QA 4X1KE 4UVAB 3RYHE 5FY8A 5EK4A 5HYAA 2RP4A 5FP7A 3HR0A 4ILUA 4PJJA 1E1HB 5A7OA 3K3QC 5FZMA 5FZ8A 5JVDE 3HKEE 3KV6A 2PFVA 4HGAA 5FZFA 3Q5XA 1UCUA 3O1IA 2JRKA 3EVYA 4OYKA 4DVDA 2CWYA 3C4ZA 3DXTA 3IF8B 3PUAA 2Z6EA 2MBGA 3AA1B 1AJ3A 4KUMB 5FXXA 4P09A 5FP3A 4TUYE 5A1FA 5TAOA 2VKJA 5KMGP 2XASB 4UELA 5E6HA 2IC9A 1MIVA 1U4QA 5EZYE 1D0XA 2CA5A 5LA6E 4AQFA 2X67A 2YBPA 5DQWA 4EZHA 4MFRA 5FZ1A 4EYUA 5FY1A 5A7NA 2J1DG 5ETWA 5A7WA 4QU1A 3ZCIA 4GJZA 4X1IE 3RYIE 3LJCA 4NUBA 4CI3B 4L9IA 3SOLA 4CXXA 5A3NA 2LOPA 2LE8A 3CX8B 1UX4A 3RC8A 5C8YE 2E9XA 3F31A 3CKDA 5LY1A 1MMNA 4DBRA 4CXYA 3HA4A 1NAFA 5FPBA 2V7LA 4I50E 2Q8CA 3HI2A 5IVYA 2WM9A 5FZ9A 4L0RA 4Y4RA 4QXBA 4WBNE 1MMDA 4AXPA 5FZDA 3EDVA 1O3XA 3C4WA 2KWHA 5FXZA 3VKHA 2ACXA 5FY0A 5FZBA 2C5IT 2CXFA 5HAXA 4AKRB 3UFEA 4UF0A 4DO0A 4KP3C 3FXEB 4UXNB 2V1DB 2WWUA 5FP9A 5FZOB 3C64A 1HCIA 2DWKA 3FB2A 3C4XA 3O9XA 5FPVA 3VKGA 4IGOA 2X66A 1MIYA 4MHCA 2E9XD 2H7VC 2N1GA 4C90A 4XDOA 4CSWA 2LHRA 3OYXA 4BXFA 2NP9A 5H6RB 3N2KE 4ZS3A 1LKXA 5EK2A 3JC6C 4PK6A 5F37A 5IVJA 4FJOA 3OPWA 1WRDA 1QUUA 1HG5A 3ZMVB 5H6QB 2Q8EA 2A2FX 5FXWA 2W00A 2V7KA 4QX7A 4QXCA 3OPTA 1D0ZA 4ERRA 5EK3A 5ADXL 2BVLA 2X9XA 2P5BA 4IE4A 2W0GA 3RYCE 1SHZC 5F2SA 4PFPA 5IYZE 5KDMC 3BK9A 4M1PA 2MTQA 3RVHA 3DJBA 5FYBA 4EB6E 2LSIA 5JQGE 3I0OA 3L3PA 4CI1B 5LP6E 2VKOA 4XAXB 5F3JA 2IC6A 3C98B 3ZMTB 5FZCA 1WYCA 3ANWA 3HKCE 1US7B 5LNKA 4PW8A 3DP7A 5FYCA 2IAKA 5FV3A 1D0YA 2CMRA 2UXNB 5A3TA 3MK7C 5LY2A 2YINA 4PJLA 3GA8A 1X79A 3Q5WA 5FJHA 5FYVA 3RRCA 2CWOA 5HXSA 4PNIA 5IHYA 2ES0A 3NRYA 1G73A 2NW8A 1QSDA 2UXXB 5A7WB 1YW0A 2DHRA 3HKBE 4PJNA 3U3IA 5F3IA 3SRZA 5J2UE 5JR9C 5F3GA 2EHOC 2PXJA 2KWIB 2QGSA 2VKDA 5A3PA 2VD7A 2IW5B 3NZQA 2DCFA 5DABA 5A1LA 4UIGA 2E9XB 5FZAA 4Z8XA 2P9BA 3R6NA 4IE0A 5HXHA 5IVFA 2GP3A 2LT3A 3CX6B 1IJ6A 3M65A 5LHIB 3KDSE 4P0AA 2XTLA