3KVBA

Structure of kiaa1718 jumonji domain in complex with n-oxalylglycine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kvbA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kvbA01
4IGPA 4GJZA 2OX0A 4QU1A 3KV4A 2OS2A 5FYYA 2P5BA 4QX8A 5FBJA 5FJHA 3LDBA 5FZ4A 3KV5A 5FZ8A 5IVCA 3PUQA 3N9QA 2Q8CA 2XXZA 5FYZA 3PU3A 5F2SA 2VD7A 3NJYA 4D6QA 3U4SA 5A1LA 3KV9A 4Y3OA 5FY1A 5FY0A 5FXWA 4EZ4A 5IVFA 5FY8A 5FYBA 3N9NA 4CCJA 3U78A 2GP3A 2Q8DA 5FWJA 3K3OA 3OPTA 4C8DA 5FZ7A 5A7QA 4IGQA 5ISLA 5LY2A 5FZHA 5FZ0A 5K4LA 5A1FA 2YU2A 5FXXA 5FP9A 4V2WA 5A80A 4QX7A 3RVHA 4EYUA 5FZCA 4URAA 5FZ1A 3UYJA 3N9MA 4UF0B 4CCLA 5IVEA 5A7WB 4HOOA 4CSWA 3DXUA 3ZLIA 5FZGA 5FZAA 4DIQA 5LW9A 2PXJA 2Q8EA 4CCMA 5FZ6A 5IVJA 4D6SA 4LXLA 4GD4A 2XDVA 5FZ9A 5FP7A 5FZOB 5FY4A 3AVSA 2OT7A 5FV3A 5LY1A 5F39A 4QXCA 5FYMA 5F5CA 5FYHA 4BU2A 2OQ6A 2WWJA 4QWNA 5FY5A 4D6RA 5A7SA 5FZKA 5IWFA 4HONA 5ANQA 5FZLA 5CEHA 5A3PA 5F3EA 5FJKA 5A7OA 2YBSA 5IW0A 4CCKA 5A7NA 5FP4A 3DXTA 5FY9A 5FZEA 3ZPOA 5KR7A 4CUGA 5F3CA 3N9LA 5FY7A 4QXBA 3PURA 5FYVA 3PUAA 4AAPA 5F3GA 2YBPA 3K3NA 4LITA 3PU8A 4UF0A 2GP5A 4V2VA 5FZDA 5A3TA 4CCNA 5FYTA 4GJYA 4BXFA 3KV6A 4E4HA 4DO0A 3N9OA 5FUPA 2WWUA 3PUSA 5FPUA 5FPBA 2XMLA 5FYUA 5A3WA 3KVAA 5FYSA 5FPAA 3OPWA 5FZOA 3AL6A 5F5AA 5FZFA 4EZHA 3AVRA 2YBKA 5FUNA 2YPDA 4LIUA 4QXHA 3PDQA 5FZMA 5FZ3A 4AI9A 3LD8A 5F32A 3N9PA 5FWEA 4XDOA 2YU1A 4IGOA 4NUBA 4TN7A 5F2WA 1VRBA 4CCOA 3KVBA 5FXZA 5E6HA 5A3NA 4XDPA 4GAZA 5FXVA 2W2IA 5A7PA 5F3IA 5FP3A 4BISA 5FZIA 5IVBA 3PTRB 5A7WA 5F37A 2XUEA 5FP8A 4ASKA 3AL5A 5FYIA 5IVVA 5FZBA 5FPLA 5LWBA 3K2OA 4LIVA 5F5IA 5FYCA 5IVYA 5FPVA 4Y4RA 4Y33A 2OQ7A
chains in the Genus database with same CATH superfamily
1FNZA 1RUF2 4CDWC 2VNOA 4UVBB 2FDKA 3IM0A 3JADA 3IMNA 5M4YA 5FY0A 1WMFA 2H0BA 5AQMB 3ZMZB 3NO8A 1U5XA 2RR13 4YM3A 4AGRA 2JG9A 1OD5A 3KQ4B 1G6NA 2O1QA 4NHMA 1W9RA 1YKHB 4QPYA 5FZKA 5FZLA 2BG9A 2W87A 2WC2A 3SS1A 4ES8A 5KR7A 3VDDA 1W0NA 4KGQA 1YI7A 1VB4A 1XPWA 3PUAA 5HEOA 2VC9A 1DP0A 2WABA 2VZUA 1TVGA 2WNUC 3LSVA 2CU5A 1FMD2 4Y5Z0 5FPBA 3HNYM 4UFHA 1GICA 4QM8A 5LJNA 2IC1A 3ROUA 1A78A 4AHZA 4HKAA 3SFEA 4HMZA 1CHUA 1UQXA 4QB6A 1XU1A 3UGHA 4EAHA 4LNVA 2D0TA 4QQHA 3SCHA 2D43A 2CL2A 1PX3A 4LF5T 2Q30A 4YM2A 4ILUA 2Q8DA 2UURA 1JW6A 3OYXA 2ZJCA 3ZEFB 3OGGA 1NCRB 1REDA 4PFOA 5AQIB 3MZKB 1VLNA 4AYUA 2CXDA 4LF6T 4N9IA 3I97A 4ORFA 3FN9A 1VRH1 5L3CB 2X5IA 5JXHA 5ACA1 4EE2A 1H2NA 4K7JA 2E33A 5IYYA 2JJ6A 5LMNT 4JCKA 3AMHA 3K3NA 1CAVA 2A3YA 1HR0T 2DVAA 1SLTA 3FMGA 2AC1A 2Y33A 4NN0A 4QX8B 4KBMB 4WVWA 4WZCA 1FYUA 1UXXX 5GM0A 3ZN1B 4ILAA 3ZFGA 5FCCA 4N53A 4Q4X2 2DVBA 1DQ4A 4X5TA 3UETA 3ZYKA 4IEUA 3VR8A 4R8HA 4FPOB 3LDQB 3MZHA 1UYYA 1ZZBA 5FYYA 3WP6A 3ZN4A 5BNNC 1ND3C 4M1PA 1SACA 2VH9A 1AXYA 5HCHA 3W59A 4IE6A 4FPHA 2CLYB 3POWA 3GMIA 5KX5E 4E27A 2O0OA 4GMP1 2J22A 3RRCA 1UX4A 3NSTA 3LWCA 4MGSA 2VKJA 2HLEA 4PQQA 2ODUA 2WIIB 5EJ1B 3CX6B 2B45X 4WBNE 3I2KA 5AQPB 4YVWC 4HFBA 2IFWA 3B01A 4NWVA 5GLUA 1VMHA 3N9LA 3HKBE 4OZOA 1LOFA 2XAJB 5J09A 4BYYA 5SV8A 3VBSB 1KQRA 2JMHA 3B9CA 4CCNA 3ZC0A 1J5ET 2N2NA 2WO3A 5JRCB 5AVAA 1R081 2H0VA 4G4FA 2O8QA 1E5HA 4PJMA 3CJIC 3WSOA 4JBWF 2Z6EA 4QHZA 3UUMA 3OVUA 2WQ4A 1JZ3A 2JQHA 1SHZC 3WNPA 4D8MA 4X1IE 3OSDA 4NR1A 4L5GA 5FP8A 1O4ZA 5ACA3 4JGYA 4QH5A 2PHTA 5FQ0A 4E2SA 4LJHA 4W50A 3VBFA 4QH4A 5G04L 1WCUA 2VZPA 5ABFB 5H6QB 3WW2A 3H8RA 3J9SA 3UJOA 5BYNA 1J1TA 4XAEA 4AQGA 2C1FA 1KD7A 5A7WB 4HFDA 2I6HA 3RZMA 5CA1E 4QAWA 1HV0A 2LRPA 2ZMKA 3TAYA 5A7SA 3RYRA 4OQ8A 4YHJA 2Y6FA 2ZEWA 2CBIA 3EVYA 3VBUB 1JZ4A 4UV9B 4GMP3 3JD72 3ZDSA 5CISA 3AMNA 4MX3A 2YK0A 4X66T 4K21A 5IK5A 1DGWA 4CCOA 3G7DA 5D8AA 2KSRA 4MGIE 1YHFA 3ZFFA 4QWNB 4AIUA 1FMD3 5FMCA 2VNRA 2ET1A 1Z0HA 1OLMA 5F5WA 5F7UA 2DWKA 5T5OA 5JR2A 2HWC2 4XUNA 1ND2A 4MGYE 4AVSA 1PGSA 4O2AE 2P5BA 2YUEA 1SLAA 5FBJA 5CA6A 5ABJA 2JG8C 4XZUG 3WX5A 5AQQB 2RP4A 1YWKA 4IEWA 4Q1PA 1MNEA 4ZOLE 2EF6A 1WA6X 3I3QA 4GA9A 4OK0A 1LEDA 2HN2A 3DKWA 1XNCA 4HBNA 5LA0A 2V7IA 4IE7A 1LECA 2LEHA 3ASIA 1NE6A 1W0BA 3DJBA 4P0AA 3Q8CA 2W68A 2PLV2 5HI0A 2ZEZA 2ZPXA 3WQ7A 1AX2A 2VUJA 1B7TA 3O1HA 1SA0E 2HYKA 2QDRA 1HJGA 4CDXB 3KGLA 4F8AA 3AAAB 2J1RA 2Y0IA 5FZEA 4QB2A 4G63A 2WYSA 2FJEA 4Q8LA 4QDQA 2JWPA 5CFDB 3PURA 2VW0A 2ZGQA 4B1MA 1SUMB 2WSVA 3JU9A 1UOJA 2QA7A 3JUUA 2XAGB 1DYKA 1EPWA 4Y1VA 3WQ0A 1I1EA 2YBKA 4QXHA 4TWHA 5DZEA 2QQKA 1QIQA 2NP9A 3FBMA 4XDPA 1CAUA 4C0BA 4Z1VA 4CP1A 2WLPA 1GUIA 3BIWE 3P4QA 2UWAA 4BHPA 2XQRA 4FPCA 3T2QA 4AQYT 2WT1A 1WYBA 4Q4X3 2V7KA 4FVVA 2J62A 4X8NA 3RJRA 1H7CA 5D21A 3ZSEA 4JQTA 3P3PA 5KMGP 1QF3A 4AHWA 2BOJA 5ANNA 1YO8A 5GZEA 2JECA 1AR61 5L47A 1DG6A 3P1IA 3JD71 4XETA 2H7OA 5FP7A 4F3JA 3LB9A 2ATFA 4AI6A 4UELA 4WM7A 4Z2WA 3DN7A 1BVP1 3EDVA 5FP4A 1CIYA 2M6IA 1HDKA 2JDNA 2HEYF 1LRZA 1J1LA 1G9AA 2HWC1 4FCAA 3AVRA 1RUD1 1PNFA 2CE7A 4CI2B 2DUQA 3PV0F 4ES9A 1ULEA 2XGXA 1GZCA 3MACA 2VMEA 3FZ3A 4B3NA 1IJ5A 2XONA 4UYBA 4CDWB 4XAAA 3U10A 3AX4A 2E6VA 5FJHA 2PLV1 4LHLA 3HKCE 5FOJB 2BEOA 4XIKA 2ZX1A 2W61A 5JR9B 2QQWA 5FUIA 4MHUA 1S35A 4MLKA 1CAXB 2BG9C 5FLJA 1W09A 3VDDC 4HOOA 3OGRA 1NLRA 2MEV1 3ON7A 4U2YA 2JDZA 1VBE1 3VDAA 4BQ5A 2R042 4I3GA 1NQJA 1Y9GA 4EWDA 2DV9A 1KK7A 3TLTA 3ZYGA 1TG7A 3MLJA 2F17A 4UEMA 2DCJA 2WNUB 3AYAA 1AL0G 4YTNA 1EAH1 5FYTA 4GULA 5LCWL 1SLCA 4AVVA 5JDGA 3AE4A 4H9OC 4CQIA 5GONE 5GJ6A 1H8TA 2IUBA 2Z2SB 2JD9A 4QHOA 1FPN1 3A4UA 1JOBA 3CQXC 3M7AA 2XQ3A 3JD73 3ZMSB 4KHZF 5F37A 3ZXFA 3RKGA 4XJ8A 4KP3C 1W8HA 1V6MA 3BODA 4D69A 4YFWA 3E5QA 1I6XA 3AEEA 2LUWA 3LG7A 4LK7A 2CHNA 3EB7A 2WB5A 3WY6A 4DR5T 1WLDA 4KWLA 1YC61 4RQPB 3ZYLA 4P5YA 2HWC3 2LALA 4Y4YA 3VL9A 4D7YA 4EEDA 3RG0A 1VBB2 5DN2A 2VK9A 4MGZE 1UGOA 4QX5A 3KM5A 4P9JA 1ZNPA 5F9TA 4EV6A 1LNSA 3NNLA 5HXMA 4EN0A 3VRBA 1C5HA 2PLV3 2QKDA 3P8CD 4A3ZA 3CBNA 2PFVA 2XQ6A 4IEOA 3AECA 3ZFGC 2XBO2 1HRV2 5L3BB 5FPUA 4RYDA 3M3IA 2IZWA 3VBHA 1FX5A 4LBLA 2NW9A 3VKNA 5CA0E 3CL1A 4ZY9A 3GDBA 4OHVA 3BU0A 1LHUA 2Q1MA 1VBC2 2VG9A 2JKXA 2C5DA 4E4SA 3P5BA 2J1EA 1POV0 4OHFA 1D1AA 3B5LB 5BNNB 4DUXA 1ND3B 2PTFA 2LS6A 2FUPA 3UUBA 4JI6T 1YQ5A 3MUY1 1ZP0A 2F4PA 2G19A 5C3PA 3TLVA 2I0MA 5C70A 2DDUA 1V6NA 3GGLA 3OB8A 3VKGA 2V7MA 4BAYB 4MALA 5FBZA 2RMU2 2IXHA 1LOFC 1BEV2 3I54A 3B02A 1XWMA 2W62A 4AGGA 1KDMA 1KFYA 1IBMT 3LE0A 1OSGA 5L2LA 4YNIA 3O0VA 5FY7A 1IBKT 1GP4A 1TQ5A 1W6PA 2YFZA 2VOXA 3RMXA 4DBRA 1WKYA 2QVSB 4O8SA 4UW3A 3CJIB 5FZOA 4JGYC 1KFUL 5LRSA 5TAOA 2IHR1 3B69A 1QXJA 1QDOA 5C3RA 1XDOA 4FOYA 3VBFC 1O3RA 4TZDA 1DBNA 5L7OA 5FOBB 3MYXA 1GOFA 4YZ2A 2HJIA 1YFWA 1Q8SA 3VHPA 4LIVA 4MGQA 2QQVA 5DPNA 3VDCA 1US7B 3BYWA 1VBB1 1VIWB 2WY2A 2BVMA 1ZZ7A 3KFWX 1X9PA 4QGNA 3QUJA 2CMRA 3AKTA 4JI3T 4JDMA 4CCJA 4HWHA 1YFXA 5HV0A 2VECA 4WBBA 3A21A 4FT8A 2WU5A 2VZRA 2NLRA 3SQOA 1DQ2A 4Q0QA 1CZSA 1X79A 2PJQA 1WCDJ 1LENA 2E9XA 3GM8A 1XYNA 2VMIA 2XBO1 5TSWA 1HRV1 3V0BA 4P02B 4JHTA 1BR2A 4YZ1A 3EBRA 4TN7B 1FOD2 5CEHA 1GANA 1HS7A 1MQTA 4QB1A 5F3CA 5J48A 2R043 2NOXA 5D8AC 4MG2A 1W6NA 4GWMA 2VOWA 3NJXA 4V1PA 2MPFA 3LEMA 3T09A 2A6ZA 1ND2C 4CEYA 4MVTA 5CFBA 4AQ2A 4NUBA 1FIOA 1YJKA 2DU1A 1KDKA 3GALA 2X67A 2W2IA 4YZ5A 4RHV2 4LA2A 3V5SA 2Z79A 5FZBA 4UFKA 1JMUB 2WU2A 2ERFA 3KBTA 4E8CA 4DVDA 2RMU1 2H89A 1PO11 4MZUA 5JIAA 2X66A 1HN0A 4CCCA 3FBYA 4XMIA 1QU0A 4OLLA 4PIXA 2YU2A 3ZXDA 4UFJA 2K48A 3AP9A 3NWKA 1W9WA 2XH6A 1IPSA 2C4XA 3AXJB 3BKZA 1N1SA 1VBB3 5IW0A 4I0BA 2XVGA 2VR4A 4CA9A 4EWEA 3RS6A 1KITA 4B1LA 1MS1A 1MS8A 3ECQA 1W04A 3FBZA 4XW3A 5FUPA 4YLHA 4PF5A 3VN4A 2ARCA 3KZ4C 1GYKA 2CRBA 3FXDB 4OQ9A 3RQ0A 3R84B 2XBO3 2QNKA 4LE3A 1HRV3 1AJ3A 3KD4A 5EJ3A 4A98A 4NOTA 4PNIA 1OLRA 2YV8A 2O8OA 1HB2A 2VULA 1EV11 5C2TA 3T1MA 2V7LA 1AUYA 1VBC3 3R4DB 4UFIA 1D0YA 2V72A 1LJ7A 4M00A 3L9JT 2X51A 3OPZA 5FYBA 4YSFA 1W05A 1FMWA 1GSLA 3KBUA 1WD3A 5JVVA 4Q26A 5DQ0A 3O1SA 2OW4A 2K5BB 1Q8QA 5T52A 3IDAA 2XJPA 1UMZA 3JCIA 5LA6E 5BR8T 2BDRA 4BQWA 3O7OA 3FUQA 3SH5A 1IQAA 2OUHA 2V5DA 2RMU3 5LK5A 1HB1A 3AFGA 1BEV3 3CWZB 1PO13 1BYHA 4AFBA 1SG3A 1UY1A 4PJJA 5DAWA 5ERLA 1W06A 3FFQA 2LRKA 4OI1A 1ENQA 3ES1A 2AREA 5FYSA 1PVC2 4EZHA 3WD5A 1POV3 2VVNA 2IXCA 2WN3A 3I0OA 2BW8A 3HIFA 1BZWA 4XFIA 2RPAA 2ZAHA 1AYN1 5EK3A 1XBFA 1GLHA 2D7FA 1JNRA 2IVJA 2JG9B 5L3DB 4NJ4A 4OHYA 4YW6A 1H6XA 3RX6A 3IF8B 1MZEA 4HN1A 3U4SA 4QDRA 1ODMA 2DF7A 2BG9B 5LG3A 4C91A 3K8PC 3VDDB 4LF9T 1DCSA 3MIGA 3O9XA 3MJXA 4DMVA 5FZAA 1Q43A 4RS5A 3VD5A 1KNPA 2XUMA 3O1JA 4Y1YA 4J1XA 1EV13 3ES4A 4GZ9A 4ARYA 3ZYPA 4KX6A 3SLIA 3MIDA 4JAAA 2VNVA 3I2FA 5H9PA 1C4RA 2KMFA 2PHRA 5FYVA 2B5HA 1JNZA 2PTMA 2XQ9A 3WEZA 2J47A 2X9HA 3PU8A 1DGRA 4IEVA 3NV1A 1FOD3 2JDMA 1GNHA 2KM2A 4HG6B 4XFCA 1OVPA 5T50A 4NIIA 3RJ2X 2GZWA 4BIOA 4HFIA 4EYYR 2ZX4A 3W20A 1RUG2 2QUOA 4L0RA 1MIVA 4BA9A 1FI2A 2OQ7A 1NY72 1PIV2 3MIBA 5KHIA 3AA1B 1N36T 4UOJA 3DGTA 4UBHA 4RHV3 1M06G 4H2AA 4EZ4A 3QNUA 2ZOEB 3OF1A 1H9PA 2FCUA 1OWAA 2VUAA 5CG8A 4Z2AA 3AXDA 4NIDA 4GB31 4YSZA 5IHYA 2A1XA 3F95A 2G1MA 2YEVC 1CAVB 2X0HA 5EFUA 2DBNA 4B4PA 4HK9A 3ZOIA 1AYN3 3DF0A 4FOVA 2B46X 2OPWA 4A45A 4QXCA 3A5XA 2R072 3RLFF 3VBHC 2N1GA 1E2AA 5F6LB 4DV6T 3QBQA 1ODNA 2W52A 2BZBA 3ZFGB 1HX6A 4DZGA 3W21A 4LPLA 4FP2A 1BKZA 4CUCA 2ZM2A 3N9OA 2AEZA 5E1RA 2N7GA 3PUSA 3WP3A 5HXRA 1NE4A 5FO9B 2YU1A 4LBMA 1YQ4A 1O4YA 3FWEA 3NKZA 5JOZA 3KWVA 5DQVA 1C8NA 3H0OA 3GZEA 1YFYA 3CIRA 2FCTA 3TNPB 4GH4A 1X33A 3SKVA 2B1EA 4XCBA 2VUCA 2Y6LA 4TSVA 3FX3A 4P09A 4MYEA 3LGRA 3ONLC 2IFRA 2VQAA 3HD8B 3ITQA 3AE5A 2E7QA 4CI3B 2XL9A 1EUUA 2IDOB 1HNXT 1LVFA 2WSUA 5HXHA 3DPRC 2D93A 3JZVA 1Q5OA 1QH6A 2VBBA 3POBA 4X8PA 4P08A 2JIJA 1UZWA 1CX4A 2PAMA 1ZVFA 5FYMA 3ZJ2A 1JZ2A 5FY5A 3PJQA 3D4KA 3SKJE 2XAHB 2BS2A 4AI0A 2TNFA 1TMF2 4QGMA 2E32A 4PLMA 5DZFA 1RUG1 1NWMX 1JOPA 5C3OA 4Z82A 4JGYB 1BR1A 4OYKA 5JMOA 3QOFA 5FQ0B 2C0ZA 4B7EA 3HN3A 2ARXA 2VXRA 4M4RA 3VBFB 3Q8AA 1G9BA 4XQWA 1US3A 4Q27A 4G3YC 5E89A 4HWDA 3M1HA 4O61A 1UX6A 2KXPB 2AH2A 1PVC3 4UW6A 1QH7A 2W47A 2LHRA 4XUTA 3WW1A 5F5IA 5JXGA 4FXKB 3ZKRA 4PI2A 5FK7A 1QQP2 2LM9A 4XFFA 2Q8CA 4HXCA 1HXS2 4GIQA 4DQAA 4HPKA 1X82A 4INDA 5IUQA 2R071 4B4RA 3B57A 3Q8FA 1IZ3A 1WW6A 2WO1A 3L3PA 2QTWB 1QJU2 2XQ8A 3IAPA 1D1BA 2H3RA 4OYJA 1HX1B 2A75A 1H1AA 2JD4A 4Z07A 4A97A 4WM8C 4D94A 5JUVA 3JBG2 1N1VA 2IC6A 3AVSA 2GMMA 2XJTA 3WDUA 2NQYA 4Y24A 5EK4A 1QJY1 1ULGA 3WI3A 5D8AB 4O4IE 3T0BA 4CEYC 3N2OA 3ZFFB 1D2QA 4H14A 1MMNA 2F4LA 4B4QA 1UY2A 2EAKA 1ND2B 3ZSSA 4ISQA 3ZMVB 2RA1A 4Y22A 2BP6A 1IPJA 2C26A 4O2BE 5F5AA 5FMDA 2YPDA 5ABJB 4AKIA 3WXPA 4N90A 1JZ5A 4AZZA 1IKPA 1YQ6A 3J4UH 4XPVA 2B4KA 2UY9A 3B93A 3J7HA 3DECA 4MXWA 5GKAC 3AL5A 1RUNA 2VQFT 2BWAA 1IG3A 4EN8B 5AFEA 2ID4A 2XQ4A 1LTEA 4KBZA 1RUG3 3QCWA 1ZBE2 5LZ6A 3T2OA 3VBOA 3FL7A 3AE3A 4EB6E 2CEAA 1BVVA 3IPVA 5FKBA 4AL9A 4QU2A 2VTXJ 1SQ4A 1PIV3 4WVVA 4CRQA 5EXOA 1OC1A 4H9PC 4IQPA 2W92A 3RPUA 2W08A 3P4RA 2ZGMA 5EZYE 1DQ6A 3V65A 1Q8PA 5LY1A 4QXHB 3GBFA 2XLGA 4WZFA 3S0MA 4JGZC 3RH3A 3KT4A 2JENA 4D0QA 4RR3A 4TZ4C 4IXLA 2LHNA 1CAUB 1P8JA 3C4WA 3UGFA 1X7NA 3WAJA 5L19A 4CEWA 2DBIA 1W2TA 3NRUA 2R073 4XF3A 4BPZA 4E4HA 3AA7B 4DO0A 2WAAA 3MW3A 2J1TA 3LIGA 4CXYA 1OOPA 5FPAA 2FDGA 2E8IA 5AFUL 2VOVA 3FHQA 3S5AA 1HTJF 3LFIA 5HCJA 4A5XA 5CB4E 5GLTA 3K4AA 1QY4A 2OKXA 3T2PA 3AEGA 4QGLA 4ZXKA 1W8WA 5CG9A 2VMHA 1L0VA 1GBGA 3JBG1 4LFCT 3BPSA 2VOTA 4FSJA 1IBLT 3WNXA 3CMGA 1S55A 3H7JA 4KG0A 5CZKA 1K45A 3ZXKA 5LW9A 2BTVC 1W6QA 5JOWA 1MNDA 3NKGA 4LBQD 4GWIA 4XJ9A 4EXTA 1XSQA 2CWSA 4AEJA 5DUXA 1M4WA 2CHHA 3RDIA 1K5JA 1PZ8A 3SNMA 3KV6A 1O8SA 3POIA 1V0AA 1OUXA 1TMF3 1JUHA 1D1CA 3PUIA 4LF7T 1F5FA 1ZBE1 2UXCT 2BGOA 4YTPA 2R30A 3J8F2 2Y34A 1VBD2 2WM9A 3WNNA 5HPOA 5AQUB 1AR72 4FPEA 3ONXA 3LA7A 1APNA 2JQQA 4RS5C 1CD3G 1ASJ2 4QKNA 2D0UA 1XNBA 1QJX1 3KSCA 1QQP3 3ZYJB 1AYM1 1HXS3 2UXNB 2D2SA 2JRKA 3D82A 4I43B 3ILNA 2EVXA 1NQDA 2H6BA 4IGUA 5J37A 3L39A 1H8TB 1KNRA 1QJU3 4W6YA 4P0BA 5AQVB 2BWCA 3ZN6A 3JB4C 3BTYA 2IIUA 1RIRA 3ACGA 2V8SV 4CUGA 3JBG3 4RD7A 5KXBA 2R0FA 1XNKA 4CN6A 3PUXF 1GP6A 1DGRN 4JI5T 4AR2A 2HPJA 2K46A 3RYKA 2YYOA 3WOGA 2R7EB 2FDHA 4NHLA 5LEKA 1SBEA 3EMRA 3FLTA 1HJFA 1I94T 1HKDA 5CBLA 2Z69A 1V70A 3ACIA 1RGSA 2VVEA 1N1YA 3NQHA 1N3QA 1UMHA 3BIEA 1PZ9A 5K9YA 3H42B 3LK42 2D5HA 2E5LT 1Q8VA 1Z7S1 1JUIA 3UQ7A 3VZOA 4Q25A 5JMCA 3VD4A 4IL7A 4F7ZA 1ZBE3 5JLVA 4J1WA 1S2BA 4JRAA 2HWE2 4P9XA 3LEGA 4PK4A 2RM22 3VBHB 5EIYB 2JB4A 2WFF2 2PMWB 4NAMA 1W2OA 5LBMA 1X8EA 4YVSA 5ANQA 2VQET 1I5PA 2JICA 2XSBA 5C9AA 4BZ4A 3J8F1 3PHMA 2GP5A 3DTOA 4GH4C 3I3DA 4AG4A 2ZM8A 1AYM3 4H7MA 3UQ4A 3M8LA 2X9WA 2V4AA 2EHOD 3O1OA 5FRAA 4LBJA 1DQ5A 3UULA 2W63A 1ASJ1 1KGYA 1B35A 2JX9A 4Y4RA 1X36A 2K2SA 4JTNA 4GJZA 1BCXA 4HEAA 3LDBA 1QDCA 2EXHA 4FAGA 1T6GC 1RC6A 2A73B 3WNKA 1PMIA 3DPRB 3H8XA 3FZMB 3R6NA 2QBXA 2PELA 2TUNA 3D0SA 2BBHA 5LBCA 1BBT1 1W6PB 1UZVA 4M0NA 1V6OA 3SITA 1WA4A 4LEJA 3RF1A 4FJOA 3VKMA 2FDFA 1JS9A 2KLQA 4IEXA 5FZOB 3NW4A 3LDRA 1FJGT 4J25A 3RQWA 2FBEA 4F6RC 2YMZA 2DU0A 3T2TA 4Q29A 1T72A 1Z7S3 3BB6A 4CU6A 2IMLA 4HFSA 3ZT5A 3UUNA 1HQNA 3H3LA 5D2AA 5C8CA 3I3EA 4Q2FA 5LG4A 5DABA 4PK6A 4ZEYA 3Q5EA 3UKVA 1OH3A 2VL8A 1NXD1 1LCLA 3GZUC 1Z78A 4DV0T 3BCWA 3K2OA 5IVYA 2E9XB 1U12A 3MUZ1 2A3XA 2EIBA 1M7KA 1BHGA 3ANWA 4UXNB 3KV4A 2HWE1 3V0BB 3J8F3 4MUVA 4AOCA 3EAMA 4P9LA 2RM21 1N32T 1ULOA 5IVFA 3DUIA 1VBD3 3T0AA 2WNEA 1IS4A 3F31A 3WP4A 3VB9A 1AR73 1D4M2 4WM8B 2ES3A 1H4HA 1W6NB 1SLIA 4GKJT 1DLLA 4NVPA 3BGAA 5FDBA 4XYXA 1ASJ3 4JI1T 4B3TT 4OUMA 1UYXA 4CEYB 3D3AA 2DTYA 4BH9A 2UUCT 3P4SA 3RI9A 3CHXA 4CCKA 1PVXA 5HWYA 2E7AA 3HR9A 4E4DX 3K77A 1LOCA 4XUQA 1YIPA 1KEYA 3RRDA 2PHWA 3E6BA 4I50E 4FTBA 5JDHA 4DMWA 3ETQA 5A70A 2QQPA 4DINB 3VBOC 1SBDA 4Z90A 5KC6A 4DV1T 3A22A 1JU4A 3GF6A 3AE7A 3IWZA 3RHWA 4YM1A 3HBKA 2IC9A 2EA7A 4H63V 1UURA 3B94A 2QGSA 3ZMOA 3VLBB 2RJKA 5T5LA 2PHLA 1XNAA 4C8DA 2JIWA 4OFZA 3AXEA 4E8DA 5F8PA 2VCMA 5CJ5A 4XHXA 5FZGA 3RPQA 2E5VA 3MO4A 1R092 3TEWA 4BLJA 1GV9A 5I93A 2TBVA 3OPCA 5CGMA 5DAVA 3WG3A 1CAWB 2HH9A 1OOPC 4I55E 5A3PA 2HWE3 1DZTA 4LHSA 3HN1A 1K42A 4IV3A 2Y8KA 2XWBB 2RM23 4XBNA 2VMDA 2CCQA 4QXBA 3SWHA 1CESA 2WFF3 3SFDA 2E51A 3UFGA 3TEZA 1T98A 4AFAA 2A7AA 3RYFE 4ZKTB 3OOXA 1NA1C 5L9BA 1OF3A 4LO7A 4WYVA 3ZSLA 4XXAA 4AI3A 1W3XA 1V6KA 3CX8B 1WD4A 2JPFA 3I9YA 2HEVF 2QFEA 5K0UA 3U1XA 4I0WB 1PMHX 3EDUA 4LFBT 4K20A 1D4M1 3BN6A 5LMUT 2PHUA 4JKLA 5JDBA 1KRIA 2C6SA 5JDFA 4Q1RA 5CFCA 1XYOA 4GWNA 3ZMUB 3TBDA 3LJCA 3K3OA 2WBKA 4U7YA 1HNWT 1XE0A 1DLCA 4OUEA 2W39A 3ZYHA 3GZAA 4GK0E 4DNYA 2BVBA 5GZFA 5IWAT 2V09A 1W8ZA 1OEDE 2NMNA 5F5CA 3UU8A 5AVPA 4D6RA 2ENRA 1SCRA 5J7MA 5LHGB 2C9AA 1JYTA 1PGL2 4COVA 5LP6E 2GH2A 2IW5B 1W8FA 2I59A 2MBGA 1PM7A 1O3SA 2QZ3A 2OA2A 4AFCA 4EEBA 3M70A 4TWFA 4HVRA 1UUSA 2Y8DA 3N7KA 2ORZA 3K48A 2LSYA 4HWCA 4XZPA 4XE9A 4OHWA 3KF5A 2P3KA 3CX7B 2BNOA 4LORA 4QQLA 3MFCA 1O6UA 2XOMA 4RS5B 3PUQA 3I8TA 4C1XA 1R091 5F6KA 1S1AA 4QHBA 3AMMA 4DNDA 4M3CE 1RJ7A 1HRI2 1JBCA 1QOTA 4COWA 2WNVA 3R4SA 2CGNA 3LEIA 2WBLA 5DUVA 3D0JA 2ZCWA 3AZWA 2D97A 2WZHA 3O0XA 3DXUA 1L3JA 3WQ1A 3RWKX 1RHI2 2VY0A 3NL1A 2XJ7A 1UYPA 5KHKA 4QPIA 1G9DA 1YKEB 1WBLA 1D4M3 1MMDA 4XMAA 1GZWA 4AI1A 2D5FA 5AQSB 1L7QA 3AP5A 4YGDA 3RYIE 4P1NA 1NZIA 4LQRA 3WNLA 2M67A 4UF0A 1WLXA 1VBA2 5A3LA 2ZGLA 3FBLA 1PZ7A 4BA6A 2LE8A 4K3UA 3ZPYA 1UU6A 4GYRA 2V5CA 2JIGA 2BS4A 5EHDA 2W2UA 4CYDA 3FE5A 1PK6A 5JDQA 1AXKA 1ZRIA 2UUAT 3ZSJA 2HWB1 1Y4WA 3SH3A 4NPMA 4DR6T 4WV8A 1VCSA 1A8DA 3PIGA 4OI2A 2BS3A 3IIIA 1XU2A 2RS52 4QXCB 1O91A 1QMJA 3QC9A 4AFMA 5J0ZA 5CKNA 3U78A 4ZZ8A 1MIYA 2KWHA 1OPMA 4L99A 3ZSTA 3HWJA 4UVAB 3ALQA 2XQXA 2VZQA 3TWIA 3ZJ1A 3ZSKA 5FK8A 1I5ZA 2D98A 5CFDC 5FO8B 4L9IA 4META 4LMJA 1WLCA 3P7IA 2UXBT 1QNYA 1R093 2B9UA 4L97A 3NJVA 2XVLA 2RR11 3C98B 5FAXA 1O8PA 4GH4B 4CP9A 4LITA 4AFDA 2CPTA 2MOZA 4TWTA 4HANA 1ZZ8A 1XYPA 2D6LX 2VPVA 4W6XA 2ZLYA 1B35C 5HEUA 4DRVA 4O65A 2X09A 3NV2A 4IV1A 2K3WA 1HIXA 3ZN0B 4DUVA 1PGW2 3HR0A 3WG1A 5IVBA 5JOYA 3NZPA 4P9GA 1Q8OA 2MPKA 2BFUS 5LWBA 3AP6A 1OMIA 2CBJA 1WBFA 3CIHA 4OULA 3VV1A 3I3BA 5FKCA 1DFQA 1REFA 2X9YA 1UW8A 5EWSA 2H7VC 1NOVA 4DOUA 1RHI1 2NWBA 2FMDA 4N7IA 1QJFA 1W8OA 3DCQA 4A6SA 2XQ7A 1A6CA 1REEA 2YFUA 1GNZA 5IVEA 3ZLIA 2LT3A 5HEGA 1OXZA 2HWB3 2GC0A 2LROA 3T3YA 1Y3TA 1WYCA 4MGKE 2P3JA 5LHIB 3EHZA 1NCQC 1S2KA 3AMQA 1LKNA 3UV9A 3HI2A 4GYSA 2GAUA 3H7YA 3ORJA 5IJRA 3Q5XA 1YFUA 3TRSB 1UPSA 3WHTA 1HQWA 2A70A 3LCPA 4AQFA 4ZXLA 2W95A 4UT5A 2Z4FA 5K8SA 4HPKB 2RS51 1QKQA 3IN9A 3NZQA 2BRTA 2PQSA 1ZREA 1ZZ9A 4XF0A 1JYIA 2B8MA 1R64A 4HVOA 3NRXA 1ZA4A 1XE8A 3K46A 1OH4A 1V6JA 5JR9C 4PHZA 1XSRA 2OS2A 3KQRA 5A3UA 3RI5A 4BMEA 3HL6A 4S2GA 3I49A 4ERRA 2PQQA 3S5QA 1W9SA 3ZO0B 3FZHB 2EICA 1H2LA 2ZHMA 2XJRA 2BUKA 4FOWA 1COV2 2WQZC 2DFCA 2ORXA 3AAIA 4M4PA 4Y22B 1HRI3 5HCFA 4K0KT 1AF9A 4FXGB 3PJYA 3H1MA 2ZHLA 3O4XE 2CA5A 4DUWA 4CP0A 3P4WA 3OTFA 3FC0A 3N7MA 4FTEA 2JDPA 3MV01 2YDQA 4MXWB 1RHI3 2PFWA 1PGW1 1VAVA 3MPPG 4SLIA 5F3JA 3B7MA 1RXGA 3ZVXA 4EQVA 3KVAA 4OFGA 2K9ZA 3VBOB 5HCMA 1K5MA 3AB0A 1S0CA 2G4IA 3RNSA 3UJQA 4B3MT 4NRPA 2WDQA 5DDJ2 1U5IA 1Q56A 1J5WA 2ES0A 4U2ZA 3BTZA 5CKMA 1VBA3 2RE9A 4LBKA 5FPLA 4RQPC 3IBPA 3BOPA 5CAZA 3GHMA 1D4VB 3KLSA 1RMU2 3KV9A 5CKQA 3GWHA 4RR3B 2BNNA 2W4XA 1O59A 2CGOA 3L09A 2W1UA 3USUA 1ENXA 2RS53 4AGVA 2NP0A 1UN1A 4IV3C 3EABA 2XLFA 4MADA 1RUE2 1XJAA 1OOPB 2XJQA 5LBBA 2JDUA 2W1WA 1UWWA 1RUF1 5F3EA 1W6OA 1BR0A 3H3UA 4TX5A 3JQXA 1D0GA 2WWSA 2WNOA 1NA1B 4ARXA 2KWIB 3HPNA 3EJKA 2E63A 3C7OA 3LK2B 5C33A 3RGBA 2QQUA 4CN1A 5IAXA 1WMEA 2ZMLA 5CFCC 4YT0A 3Q5DA 3VHOA 5A7WA 3MHZA 1G7YA 5IFPA 3N35A 1NG0A 2WO7A 2PAKA 1D0HA 2GC1A 2IXKA 4P14A 4ZPIA 1OA2A 3OCPA 1COV1 1AXZA 2WS92 4NHYA 2ZTNA 1W6QB 4GKKT 1IQDC 2UXXB 4XF4A 1FMD1 3LSEA 5I8SA 5AQGB 5FXXA 4YZ3A 3EHKA 4AVCA 3RVHA 4CU7A 4ATEA 4TTGA 3MIFA 3GXUA 3O1IA 3HEIA 2YN6A 5J98B 4BWOA 1AR92 1O3QA 1GKBA 4YZ4A 2LM3A 3MIEA 3GCWA 4AEDA 4QWNA 2ZM0A 3THDA 3WT3A 1QXPA 5DDJ1 2UUBT 1IS5A 1LESA 4AI8A 3N2KE 1DQ0A 4B29A 3POGA 5FZFA 3T08A 1W2AX 4AQSA 1W8TA 3P6BA 3PUYF 2PBIA 1RMU1 2ZMAA 3AYEA 2D6KA 5JOXA 3A7QA 2PA7A 2W1QA 4PW8A 4IE5A 2P17A 1WCKA 3DL3A 4M3CF 4U2AA 1RUF3 1ZA7A 3C4XA 3BK9A 2YZ4A 5ABHA 1NZCA 3K51A 3KT7A 1C3HA 1RUE1 4OZXA 4YWAA 4DUZT 1CGPA 4CU9A 4QPIC 3ZN6B 1ALYA 2BYVE 1GQEA 1DIWA 4FPJA 1TME2 2VE1A 3PMEA 4Q4X1 4CDQA 4JI7T 5ETWA 4AEMA 5IWFA 2VAUA 4JDOA 5JSPA 4YARA 5LRRA 5JZGA 1COV3 2F6BA 2GDFA 3TN92 3AEDA 5DAQA 2OIIA 1LGCA 1PK6C 2DCYA 2W91A 2XMLA 2W66A 4KGGA 3KT1A 1GR3A 4BOWA 1DZQA 2WDVA 2VO5A 1UY3A 1W39A 2VTXA 4X65T 3IDBB 3BQLA 3HAGA 3ZM8A 2Z5WA 3JQWA 2B39A 4LBQA 3R0RA 4AISA 3MW4A 1A3KA 1DHKB 2SBAA 5DDJ3 2GMPA 3B3QE 1AR91 4IUGA 3QK6A 1ZM1A 1F15A 3TOJA 5JR7B 2JDYA 4YVSB 5BPXA 1ENRA 1JN2P 2Q4SA 3AZVA 3ZXAC 1RMU3 1R1ZA 2FZ1A 3SC7X 3AJZA 2ZGUA 1OFSA 4UXAA 2A6XA 3BTAA 5BUVA 2VXJA 4F83A 1IS3A 3T4HB 1M62A 3H3MA 1CPMA 3GJAA 4IDPA 3ETPA 4Q4W2 1FEWA 1RUE3 4HN9A 1QOSA 4FBFA 1MS0A 1QWRA 3U0ZA 4U74A 5GLWA 4ZI2D 3BUCA 5C3JA 1B35B 3X1DA 4IESA 5H9QA 3VR9A 3VKHA 4NXMT 1RUI2 4YGBA 4LIUA 3ZYIB 3AA0B 1W9YA 1S0GA 3VZKA 4NO4A 2YG0A 4R9CA 2XASB 5F3IA 2MHFA 3N4MA 1CQ9A 3UU5A 3WCSA 4E9KA 2WJSA 2IXJA 5HXVA 4HZFA 3C7FA 1MEC2 1TME1 1CWPA 1S94A 4QMAA 4I09A 3BQKA 1WW7A 1GP5A 2QE3A 2WNUA 3JAFA 3ZFEC 2ACXA 3M3ZB 1EY2A 2JQKA 4FPGA 4TV9E 4FFIA 2V7JA 4BK4A 2WS93 3RMYA 2KNDA 3VD7A 1UO9A 3RI8A 3VUOA 1DU3D 1NCQB 4TV8E 3N7JA 5C8CB 4TYSA 1W6MA 1FMVA 1AR82 3APBA 4XFBA 5H9SA 1IJ6A 1H2KA 3WINE 2BU9A 2LW8A 4AQFC 2V4VA 1AR93 4XBLA 4A4AA 5L3EB 2LSJA 3VHNA 1LODA 3ANWB 4I3PA 1HG2A 2FHRA 4UFMA 4EN9B 2X05A 2JG9C 1F4AA 1ZKEA 2AXDS 1IS6A 3AA6B 1VAKA 2NN8A 2G0UA 3CKHA 2NYYA 4LKSA 3ZKYA 3IEEA 3KHBA 4CZZB 3QH7A 1FATA 2MAWA 2RS32 2DCZA 1X8MA 4DV4T 3POFA 5FY1A 3RYHE 1W0PA 2CAUA 4YG0A 2FCVA 4PIYA 3IB3A 5L73A 1YUDA 4YGCA 4O4JE 3PUHA 2ZGNA 3GBWA 2D6MA 4Q4W1 5JI7A 3VZJA 1J58A 2EHOA 4U3CA 4EN7B 3NBXX 2A3WA 3RIAA 2ZKNA 2Q8OA 1RUI1 4RA0A 4HONA 1D0ZA 3MA9A 3W15B 4AK3A 2BPA2 1TME3 5FLIA 1K5MC 2PHFA 5C6CA 3CQGB 3WVJA 2F4VT 1ND3A 3RZLA 2A2FX 3OBVE 4CCEA 2VVSA 3INAA 2WZ8A 3IDEA 1BMV2 2WO2A 5GLVA 3TN93 5EV7A 3PJAA 5AQLB 4KH9A 4JC1A 3ZXJA 3OUJA 1PMJX 4YVWA 2KZ7B 4QX0A 2X5IC 5FPVA 3H1WA 3DV8A 4QU1A 2GNBA 1QGLA 2R1DA 3RWNA 4K8FA 3I3MA 2KT9A 1LRHA 4Y3OA 3JAEA 4IEZA 2D3RA 3WAKA 4W65A 3FLPA 1MMGA 2WP9A 4V1Av 4JKMA 4XC9A 5JTGA 4KU7A 2VZOA 4OX9T 4IV3B 4XJAA 3VD3A 1POQA 2VZ1A 4AKHA 4QXBB 2NR4A 4DR4T 3PIJA 1LU2A 1GZTA 4C1WA 2RG4A 4XZCA 4N53C 2XKPA 3E6CC 4A7YA 3P4PA 1XC6A 1E5RA 1RL3A 3IDCB 3OJAA 2J1VA 4JQRA 4KMQA 5CADA 2Y48B 4CUBA 5FVLA 1F4HA 1IPKA 2V6YA 4L0PA 4LO4B 1CONA 3THCA 3WF2A 5DUUA 2C9KA 4BXFA 1D2SA 5LHHB 1NENA 1W9TA 1R1A2 5CFCB 5FZMA 5HAXA 4Q4W3 2RS31 1VMFA 5CB7A 1QSDA 4CPBD 4FQ4A 2WA3A 3LKJA 1G9CA 2R041 3CNAA 5FLHA 5HCAA 1RUI3 3NV4A 4MV2A 1X50A 4OI4A 2WDRA 2XJVA 4ZONA 1IZNB 3POYA 5BNPA 1ZZCA 3SRZA 1W8NA 2CXLA 5IK4A 1XZYA 4AKLA 4HETA 5FZ8A 5IVCA 3E0ZA 4LMFA 1ZRDA 2VQ0A 3BVCA 4LO5B 2FQPA 3HJRA 4ASLA 2JXAA 1MEC3 4WW0A 2LKHA 4AF9A 1IOAA 4EROA 3ZKUA 2GMEA 4FPFA 5EP9A 1QHDA 3WCRA 4N43A 1XOYA 4CVUA 4XXPA 1BMV1 3ETVA 1CUNA 5J1GA 3ZYRA 3SEEA 1LHOA 3OUIA 5LB7B 4PLOA 2JG8A 3MF9A 2Q0AA 4JYAT 3UU6A 2ZS6B 4EGWA 5ADXL 3WUDA 3QH6A 2AEYA 4IW3A 1S2EA 1NEKA 5FXZA 1LOBA 1XB9A 2TEPA 5C4WA 3I9WA 2XUEA 4NPRA 2XPKA 5IVVA 3AZXA 4AKGA 3FZKB 1TZOA 2OVUA 4Y1ZA 4YW1A 1FT9A 1OA3A 4N9HA 3WDTA 2D6NA 1W3VA 2Y6HA 5JWPA 2VWAA 1GQHA 3PU3A 1UU5A 1EP0A 4QPIB 2Y38A 1WLWA 4CDQC 3O5SA 3N9NA 5DQWA 1GZWB 4CCDA 1NXMA 2RS33 3I2IA 2Q9QD 5FMBA 3VBRA 4PQ9A 4XFGA 1OPOA 5JZGC 1VBC1 2HWD2 4UF0B 1GU3A 2P2KA 2KD7A 4OMDA 3H50A 3TNQA 4H55A 1WLTA 3ZFFC 2DVGA 4BJMA 4L2NA 4BQ4A 1RUJ2 1B09A 3IMMA 2YPJA 4DXSA 4Z8BA 1UL9A 1OQ1A 1HW5A 3WUCA 5A7OA 3WQBA 2VUDA 2ZA9A 5LA9A 2VL0A 2CSGA 3WZ1A 5ABJC 3C50A 1PK6B 1NT0A 2AACA 4BJNA 4FPLA 4AKRB 3DP7A 1MZ6A 4EWAA 4PAGA 2ADEA 4RGKA 3A8YC 5BV6A 3C7HA 3AL6A 3NRYA 5JDLA 3B00A 2IXIA 1BEV1 1NUKA 3Q2MA 1OXCA 2IWGB 3U14A 3E22E 5C3QA 2OXBA 4Q0SA 5FREA 2DHRA 1VRH2 4PT6A 3NJZA 3ILFA 5ACA2 1POV1 4AVTA 5FVKA 4GMP0 1VE0A 3FFZA 4FQZA 4J6GA 3CEWA 2J1DG 3AYCA 1WRDA 3CQCB 4KWUA 1YXRA 4MHCA 2MTQA 3USSA 1BLZA 1SFYA 2J1SA 3WG4A 4CP9B 1IGOA 2H88A 3UYJA 4XVHA 1JU3A 4I02A 3ABZA 4LHNA 2X8KA 2B42B 4HT1T 5FZ6A 4COFA 1KXGA 1U5ZA 3HNBM 4HLTA 3AC0A 4XBQA 5T55A 2HKXA 4IV1B 2KR2A 3DEMA 4DUYT 1AJKA 1RITA 1SDDB 3OEBA 1FAYA 1E5IA 3H1YA 4CN4A 2A6YA 4LOTA 3ZIXA 2V1DB 5FZ3A 4AI9A 3PVNA 4K9SA 4KQ7A 2JDAA 1HF8A 4WZXA 3HVDA 5C7GA 2ILMA 1CJPA 4PCRA 4UVCB 3B9IA 1VMJA 1JYVA 4XHBA 4AVBA 4KL1A 1R1A3 1LOEA 1UZZA 2H6CA 1FOD1 2D40A 3TLUA 4WM7C 3DYPA 3DYOA 1RXFA 2ETEA 2HWD1 3SHRA 4BE3A 1YD8G 4I2OA 1XNQT 4BQXA 4BQ3A 4YHHT 3ZFEB 3F2ZA 2AENA 1RUJ1 2VBPA 4IEPA 4I0UA 3MPBA 1R082 5I8YA 4QX1A 2I2SA 4WNKA 1HLCA 3U37A 4RHV1 1KNZA 1WFDA 3T4VA 2OV9A 3LIHA 1ULCA 5FY4A 4UV8B 4C0HA 1S0DA 2XJUA 2WKKA 5C3SA 4PJLA 3C51A 3S4UA 4IT4A 3BALA 4N78D 1YQCA 3VRAA 3UGGA 2VCAA 2YY1A 2YDSA 2I07B 1ZV4X 1LGBA 3B13A 3AZZA 4HGAA 2ZGKA 2RHPA 1KS5A 3GBGA 4GAZA 3C3VA 3X29B 1JYXA 3W5NA 4XTPA 1KF6A 4ASKA 1OT5A 4HKOA 1UYZA 4ZZ5A 4OHZA 5KHJA 3H3ZA 4TWDA 4L9BA 3QLQA 3E6DA 2W67A 4ZI3D 2A71A 1YQ2A 4KWJA 5EPAA 2EHOC 2BJSA 2GP3A 2UXDT 4LF8T 3POEA 3MI8A 3RZJA 5FZHA 4TLFA 1S0EA 1H8TC 3VHLA 5A80A 4QX7A 4Y5TA 4HE8A 5LOVE 2XDVA 3HNMA 2WZIA 4LK6A 3ZXGA 5LK7B 4Q0UA 1K5MB 4H9RC 3ME2A 2HWD3 5FJKA 5LB6A 2YBSA 1T8BA 5KHGA 3AE2A 1RUJ3 3DYMA 4AWDA 5DXDA 3J26N 4AEKA 5I8TA 2VQUA 4OVEA 2Y60A 3VKFC 2YDRA 2A6VA 4P9WA 4YW5A 1MS3A 2L3LA 4FOQA 2HBUA 2VCCA 5EQUA 4YYOA 2VTFA 2X5IB 3UKNA 5JPNB 3USUB 2WWVA 4KUMB 5HXEA 5FYIA 5FMNA 4H3WA 1S0FA 4W4ZA 3QACA 2ZHKA 3CVRA 3V5UA 5K7PA 4NIAA 3GZTB 4D7SA 4LO8A 4JRLA 4BDVB 1YLLA 4HWIB 1VRH3 4BCUA 1PVC1 1UIJA 1W6OB 2GNMA 5A32A 5A1FA 3O1UA 1OBNA 4L8QA 3MFAA 5B2GB 4N53B 4URAA 2X68A 1O5UA 2BNMA 4CSWA 4FPYA 4LXLA 2WUHA 1SHWB 3BTXA 5F39A 5FYHA 2E31A 2E26A 4QXKA 2AGSA 1QOOA 3PE0A 3GYDA 5KWRA 1ZRRA 2ZGPA 2BKOA 3KCXA 4PIZA 2BZDA 5GZDA 3HBZA 1LHWA 3NVCA 4B3ST 5F3GA 5HXCA 3T0DA 1CN1A 3PUGA 2G9GA 2D3SA 5LGNB 1H0BA 4FI9A 4GIWA 1HV1A 1GWKA 5BNPC 3VD9A 4XDOA 5F2WA 4AHXA 1ZHCA 1C1FA 3PVOA 4ASMB 1BJQA 1PNGA 4CXXA 3N36A 4MLOA 1AR62 4NIQA 4GXLA 1UCUA 2IVIB 2L9QA 1QLBA 1V6IA 1JZ6A 1QXRA 5LA2A 3AB3B 3O1RA 4WVMA 3KINB 3WDXA 4AEDB 2P34A 2L8KA 4N43C 2FJAA 1WR0A 4UFLA 4IDOA 2YC4A 3U4XA 3D6EA 3G06A 5FP9A 3TLSA 1I6ZA 4X64T 1RUD2 2VW2A 4V2WA 3AKQA 2P37A 5IT6A 3MF6A 4CCMA 3R05A 1Z0PA 4CXWA 5FZ9A 5L7OC 2J4GA 5JDNA 1R083 3C4ZA 4CDUA 4AW7A 1GQGA 1ACCA 1NY71 1PIV1 1UAIA 1XE7A 4QKBA 3IBMA 4RL7A 1W9FA 3E5XA 2W46A 4K0UA 5AQHB 1UOBA 1J3PA 3F57A 3MKDA 2EXIA 3KB5A 4JUYA 1N3PA 5FZDA 5C4WC 2ZACA 2LSIA 2XVKA 4HL0A 1ULFA 3ZYBA 1MZFA 5LBQB 1LHVA 2E9XC 2DNXA 4CI1B 3RZZA 1C5IA 2NTYA 1W2UA 3C64A 5FXVA 2MEV2 1VBE2 3IHRA 5I0DA 2A5ZA 1T2XA 3HKEE 4ET7A 4FPKA 4GK5E 5IUXA 4OI0A 4DV2T 1MQTC 2OLTA 2YINA 3VBRC 1MZ5A 4KMCA 2OZ6A 4CDQB 5KXEA 3CQOA 3T1LA 5FYZA 2XAFB 3SCFA 1G73A 5LBEA 4D3WA 1EAH2 2VZVA 3JXSA 5JZGB 4IE4A 4JVAA 2DVDA 3PL0A 2X10A 2ZM6T 3GN5A 2UY8A 5AQRB 5FZCA 3RKOA 4HVQA 1FPN2 4IEQA 4XF9A 3WDVA 4NPPA 4XJZA 5E0OA 2A9UA 4E7ZA 4XACA 3OYZA 2WWJA 5DJQC 2DVFA 1UU4A 2VZSA 3UTKA 2XY8B 1RUH2 2YBPA 4L11A 4DIDB 3AKSA 4NHKA 1Y9MA 3BPZA 1J1JA 2VKOA 4LBQB 2FMYA 2FZ2A 2ZEXA 3MXZA 1RINA 2WN2A 1SFPA 4XQ4A 2FD8A 4YGEA 2A72A 5L4EA 4O9EA 3M3EA 2XWJB 4XIOA 4G9SB 5HCBA 3L2HA 1BQPA 1CVNA 1N34T 5A33A 4Y33A 1VALA 3JC6D 3BQIA 1TMF1 2VU9A 1N1TA 1V00A 1AHSA 1NX9A 3KF3A 2J1UA 5LGTB 1X9TA 2GNDA 1H1IA 5IFTA 4Y20A 4UR9A 3RGLA 4JV5T 2J7MA 3OGSA 5K4LA 3BU7A 3K75B 3MV11 5FTTC 3W9AA 2XAQB 5EYYA 3T1YT 2EXJA 2OZJA 2I74A 4DXTA 2ACZA 4F8HA 4YG3A 1RYYA 2DCFA 4A3XA 3U3IA 2XHEB 5KXJA 1QQP1 1HXS1 4ILBA 1OEDA 2QQMA 5HEHA 1WR6A 2ZZJA 4KI5M 2WRAA 3ZCJA 1ULDA 3ZXLA 1QJU1 2P3YA 2YDEA 2CWYA 1GOGA 1VCTA 1H1MA 4MSVA 3GJBA 3V56A 2RDQA 3SEPA 1UXZA 4WM7B 5FZIA 3J7Yq 2HBTA 4OCTA 2WSSV 3OYWA 2CAVA 3KHCA 4HFHA 4DV7T 1UY0A 1CPNA 2JQ9A 2BQPA 2WS3A 1AR63 4ISRA 1W6MB 1E57A 5FXWA 1E5SA 5T5PA 4O4HE 2QDNA 1AZDA 1HFAA 5DG2A 4C90A 5JAXA 5LJMA 2CXFA 4XJUA 4EYUA 2BG9E 2WMNA 1LKXA 2W9XA 3OBRA 2C5KT 4RGAA 1RUH1 4DPNA 2Q8EA 3CKDA 3OTOT 1AX1A 4M3CA 2DCTA 2RDNA 3E97A 3ZMNA 3WF1A 1RUD3 2GNTA 3NWIA 3I2DA 1SZBA 2K24A 4COZA 2WQ8A 4GALA 1LGNA 3ZR6A 5FPZA 5EK2A 4X6RB 4Y1UA 3TEYA 3AJYA 3BOWA 1DQ1A 1X9BA 3VZMA 5FYUA 3AFKA 3OPWA 3V0AA 4EJRA 4HFVA 4R9DA 4UW4A 4GQ7A 3AEBA 2XR4A 4P9IA 4DR7T 3J7LA 4AVAA 1L7RA 3WV6A 4XDQA 3ACLA 1QJEA 2HHHT 2JEMA 2JJ9A 1PM4A 1HG5A 4GKXA 2K0GA 3LOIA 2CWMA 4AAPA 4NROA 4LT5A 3IIAA 1R8IA 2EHOB 2MEV3 2ET7A 3EXUA 1VBE3 1FXZA 1JHJA 5F2SA 2VD7A 2O14A 3PUWF 5JDMA 4JDNA 5GZGA 4YRDA 3MW2A 5J36A 1TNFA 1ZYBA 2C0SA 3OY8A 2Y6XA 3CMLA 2Q1FA 4B3RT 1EAH3 1UD1A 3I7DA 4PF1A 3MICA 4PBOA 4UIGA 1MMAA 3MGUA 3WDYA 1JYWA 4N8MA 2JB8A 5C8YE 3O0WA 1FPN3 2VW1A 4K1YA 3HA4A 2W0XA 5LA1A 1YXWA 1UKGA 5A6ZA 3LPGA 2P9BA 3WG2A 4YVWB 4Q0PA 4CUAA 1PO12 5L3GB 3R6SA 3H8OA 4B6XA 4XILA 2PYTA 1YCIA 4TLGA 2QRXA 2RJ2A 3DPRA 4OMCA 2Z42A 3SMHA 1RUH3 4ATFA 5A3NA 3I59A 4HWFA 2GC3A 3PJAJ 4LR4A 2ZMNA 2BOIA 4IDQA 3GCXA 2XB6C 1AVBA 2W00A 2JDKA 3FHNA 4IDZA 1CR7A 3WR0A 2D44A 2OX0A 5FZ4A 3C2UA 5CU1A 4XABA 4K6BA 5A1LA 3GNEA 1VPHA 4R4ZA 2L9LA 2BVVA 3O1TA 1QJZA 4P00B 2V6YB 2P6HA 2UWBA 4NUVA 5JIUA 2WFPA 4MGTA 5IVJA 1VBD1 4IEYA 1HX8A 4DXRA 1SLLA 3M3QA 2YHJA 1EV12 4Z92B 5C71A 2WAUA 2FDIA 1JOJA 1AR71 3W5MA 3AM2A 2BVLA 3FXEB 3NAPA 4NXNT 3RC8A 3ZCIA 1AL22 3TYJA 2HWF2 4LMLA 5BNPB 1LULA 2M6BA 3RSJA 2PHXA 3MLKA 4WM8A 4K1ZA 2LRLA 2DTWA 3PTRB 1VR3A 3UESA 4ZXEA 4U7IA 3MLLA 3POSA 2Y6JA 1UX5A 2XQAA 2KINB 1Y64B 1SMVA 3D8CA 4EV0A 3FHIB 4N43B 3P50A 4J2CA 2UWCA 3RQUA 4YM0A 3DKQA 4CDUC 1PO22 4LTAA 3WF0A 1WMDA 1IAPA 4A44A 1Y7BA 2JG8B 3ZMTB 4QX2A 5L7OB 2R16A 4PI0A 3ELNA 1F5JA 3OGJA 4JHZA 3ILRA 1SPPA 4QPWA 4ZU7A 1AYN2 2OUJA 4QD2A 5EJZB 2AYHA 3PDYA 3ST7A 2YB7A 3ZPOA 2BFUL 1ZZ6A 5C4WB 5FO7B 2C5JA 2BKNA 1OKQA 4E2QA 1WCRA 2DWRA 3QB5K 2VVDA 1H30A 3AK0A 1OLME 2XJSA 3VL8A 2PN5A 3LD8A 2P1BA 5BY5A 5B4XA 2VGDA 5BNOA 4S2FA 3O14A 2VOKA 2WFF1 3D5OA 1MQTB 3U75A 4AQ6A 3VBRB 1F31A 4IREA 2JKBA 4JGZA 3L2YA 5DAXA 1MS4A 1U5PA 4XQDA 2DYCA 1CAWA 1ST8A 2W94A 4D6QA 3MIHA 2E9QA 3JB8A 3CU7A 3HMYA 2R0HA 5AQJB 4CP2A 4H63H 2R6GF 3N9MA 1C8M2 3OBZA 3KMHA 4CPBA 3AE9A 1AL21 1O5LA 3FJSA 2HWF1 4JX0A 5J2TE 4I4TE 5FL1A 2HPLA 4YTMA 4M01A 4A6OA 1JODA 4ZS2A 4BLIA 5HXSA 4MBQA 1GWLA 1F8VA 1C28A 2XG3A 2WZPP 3LOBA 2X29A 1E7PA 1V6LA 3TKLB 2BBVA 4RN5A 4KBBA 2ZX3A 5J3UA 4NE9A 2BBJA 4GB32 2CGPA 1YIFA 3KVBA 1FV2A 3VZNA 2HN1A 4XFAA 2C5IT 1KJRA 1ENSA 4KG8A 1OF4A 3SISA 1PO21 4IIJE 2XM1A 2Y6KA 4YFSA 4A42A 4RR3C 3ETUA 3G6JB 3BI3A 1Q3EA 3MK7C 2RS12 3N9QA 4CEWC 3CK6A 4LKDA 1NLQA 3URFA 4QPGA 4Q5OA 3UL2A 4H9SE 4G2AA 1W8UA 4E7SA 2BV4A 4NMIA 4ZU4A 3VKOA 4DIQA 1VB2A 3H3AA 3LSDA 3V64A 4YG6A 1OEDC 1LOAA 3RIUA 4PBPA 3FLRA 5BXXA 4BU2A 2XHNA 1DU2A 2ODVA 3I2HA 3PLQA 4NIGA 3E08A 3QB5A 1CZVA 1DYPA 2GALA 2UYAA 3DXTA 2W1SA 5FL0A 2V6XA 4QDSA 1XXNA 1UIKA 4SBVA 1ZRCA 3AZYA 2JE9A 4URTA 1K12A 1AJOA 1U4QA 1Y43B 3FZLB 1OA4A 1OKOA 3WLUA 2Q9QA 1AL23 2VZTA 2V5YA 5E6HA 4R4XA 4JI8T 2HWF3 1ZRFA 1RTVA 2AZ5A 3W58A 2OYZA 1I9RA 2CYFA 1ZX5A 4M0HA 4U31A 1C57A 3LBXA 2HYXA 4YY3T 4LHKA 4QQPA 1C8M1 4PDWA 3AEAA 2EALA 4X6QB 2VZ3A 4R9BA 3PUZF 3RYCE 1YQ3A 3IKWA 2CDOA 2HH7A 4FFHA 1WWYA 4JKKA 4LUMA 4IERA 1SE7A 5FFOC 1XMQT 1PO23 1ONAA 4UWDA 3LPFA 2AUYA 3L8RA 4QKDA 3RZHA 3UU3A 1W28A 3CF6E 3HT1A 1JZ7A 3T8OA 4JEHB 4V2VA 4U36A 5LASA 5KHHA 5CVRA 2R32A 2WL1A 2LOSA 2QQNA 4BM8A 2YROA 1LB2A 4BQ1A 5FMOL 4WBOA 1V9U2 5F32A 5G05L 1W90A 4H9QC 2CY6A 5JI9A 2X0LB 3WNMA 2RS11 1S0BA 5APAA 4YJ2E 1OLQA 1NLSA 4Z91A 3AKPA 4YSXA 2VCBA 5JREA 3QD6A 4ZI2C 3M4FA 4QX7B 2YC2A 4FAHA 1QJY2 5AC92 3K4ZA 5A3OA 4HK8A 4JZRA 4EIWA 3ZN5A 2ZABA 4DFSA 3ZYFA 1A8MA 1MS5A 4QQOA 4AE2A 2DL1A 4X1YE 5GZCA 1H6YA 5HV4A 1UY4A 4HSLA 2KA3A 3GA8A 5I0TA 2P3IA 4I01A 3NMBA 5FV3A 4KHPT 3H37A 1GZ9A 2EXKA 3NKTA 1DGLA 2V26A 1C8M3 1W03A 3T1HT 2VKDA 5J1XA 4I30A 4LULA 2WDBA 3NNGA 4DEQA 2LOPA 4DMIA 4S2HA 2YGMA 1S0JA 1XNTA 4X62T 4A7KA 3F2EA 3RZGA 3CZJA 1NAFA 4TNVA 2VNGA 5AQNB 4MXVA 5CIRA 3IT8A 1PHMA 1SDWA 1JH5A 5A7PA 5AQKB 2B7YA 2R062 5A32B 3TB0A 2NTXA 1VOMA 2ZGRA 4GB33 1HN1A 3MEPA 4YVSC 1PGL1 2N9DA 1VAMA 1UCXA 5C9AC 2XQYA 4K40A 3HKDE 5IK7A 4HN0A 5FY8A 4U33A 4RFRB 4QX3A 2MNGA 4Q8KA 4ZHQE 2NPIA 2WZEA 3UK9A 2RS13 1DF0A 1JHNA 4ANJA 4CCLA 3WDWA 3C8XA 3K3QC 2GK9A 3Q8EA 3WNOA 3NAPC 2OA5A 4FFFA 3SOLA 2LTNA 1MVEA 5KC5A 1TEIA 1V9U1 3VZLA 2NM1A 3ZSMA 3MBWA 2WMOA 4JI4T 1SFNA 1QNWA 4BMBA 2R6QA 2VBDA 1HRI1 3CDZB 5T3NA 2CWOA 5IAVA 4AXOA 1DDLA 5AC91 4WVMB 4LLOA 4HFEA 4XF1A 2W3JA 3Q9OA 3S57A 4IE0A 1YRZA 4PLNA 2AR6A 3O1MA 4OHXA 2VL4A 1XNRT 5KXCA 5FYCA 1Z8UA 1H2MA 2ZAAA 5C8WA 2A6WA 3PUVF 2WQYA 5C5UA 1LAJA 1AX0A 5BNQA 2XZEA 1MIWA 2JMKA 4CDUB 4YLZA 4JV4A 1T7SA 3D0TA 5CYYA 1UNBA 1A34A 5H9RA 1VBA1 1IHMA 2IXLA 5FZ0A 5C8CC 2BDEA 1KFXL 4COYA 4NRMA 3HOBA 1MACA 4GD4A 4LF4T 4XTMA 2NZ9A 4P5HA 5E88A 2JE8A 4U72A 1K3IA 1DGWX 5D1IA 2CV6A 3WW4A 2RV9A 2PG8A 5EZWA 1NCRA 5L36A 1CJDA 2GH8A 4ISSA 3CO2A 4NAOA 5BNOC 2R061 4MFRA 1VJ2A 4EN6B 4GJYA 4QM9A 2WWUA 2I45A 1QJX2 4QQ2A 4A2UA 4RFT0 1AYM2 1JTZX 3TLWA 4YJ3E 1YNAA 2D6OX 1N33T 2WINB 4BISA 2VKHA 1W0OA 1XRUA 2XM2A 3GN5B 1J3RA 3NNFA 1V9U3 2PHDA 5I0RA 4DBQA 3ZC1A 4E4ZA 2B76A 5A1AA 1LVKA 1W0AA 2ZGTA 4QX8A 4DXZA 2G9ZA 2BBAA 3WF4A 3ZYMA 3N2GE 3NJYA 3O12A 1ULPA 3O1VA 3NNJA 3T30A 3OJBA 1BK1A 4LE4A 1QJY3 5AC93 3B5MA 5JXIA 2DLRA 2D3PA 1OI6A 4XFHA 1NA1A 3RIFA 2SPCA 4X20E 1Y01A 3AYDA 4KU8A 1US2A 2LSGA 2LJLA 5B4NA 4QH1A 3N5LA 2VMFA 2B9VA 4DR2T 3I1AA 5JQGE 3I0QA 4HKWA 1GMMA 3IPVB 5F5QA 2MYSA 2ADDA 1JYNA 4IL9A 1DZRA 1MPXA 3FZFB 5A33B 2LSKA 1Z7S2 1PX4A 5A3WA 5L4HA 4O9GA 4MHRA 3PDQA 2QZ2A 2UU9T 1KS4A 5DUWA 1RB8G 2NW7A 2BGPA 3UT5E 3RZKA 4P9YA 4L92A 3UT0A 4Y20B 1UOFA 1S0IA 1D0XA 3CZUA 4KNCA 4JEUB 4R9AA 3VBSA 4QPGC 4Y5SA 4BQ2A 1LU1A 1J3QA 3AE8A 5JRCA 1CX1A 4IGPA 4Q4Y2 4LOSA 3EQEA 4CEWB 2EAAA 5ABGA 3VKLA 2WLQA 4DR1T 4FO9A 2R063 4LA3A 4YPJA 5LXTE 1FV3A 3ZX7A 4ZZBA 5KDMC 5IYZE 2NMOA 3RIUC 2J42A 1O3XA 1STMA 4AAXA 4JI2T 3M2MA 1OD3A 2AE9A 2JDHA 1LEMA 1OEDB 1G9FA 1ZOYA 3VDBA 2ZGSA 3LEKA 1HNZT 3K4DA 5LYJE 2CDPA 1T6BX 4LKFA 4LUKA 1XQNA 5K0UC 2ZX0A 1UZ0A 5ABFA 3KGZA 5E16A 3OEAA 3LA2A 2FBWA 4Q4V2 2Q9QC 4FFGA 2V73A 2Y6GA 5HBAA 1I3HA 3OYWB 3J7NA 4TUYE 2CTVA 2J1AA 3RFRA 2XL7A 3EUHA 3S6PA 4AXPA 5FUNA 4Q0VA 3N9PA 3LFMA 1BBT2 1VRBA 4UI9L 1NAEA 1OQDA 3KCYA 1E1HB 2FJDA 4CZSA 4PDWC 5FMOS 1Y9QA 4A56A 1WW5A 4YW7A 3PVBB 3VBUA 5LGUB 3ZT7A 4YW3A 3EI0A 3UUXB 5F1RA 3IA3A 4M3CB 4R52A 3THTA 1MS9A 4IL4A 2WR9A 2ARAA 2RDSA 4OUSA 3NVOA 4HKLA 4CU8A 1XDPA 1H9WA 1OUSA 2Y64A 4BJ0A 5LATA 4D6SA 1YJLA 3V0AB 1MVQA 1V9DA 2ZKLA 4NHXA 1S4CA 3KS7A 1BK0A 4LBNA 2XSAA 2ZZQA 1EZ3A 4E2GA 2ZEYA 3GHNA 3THPA 2WNVC 4ZS3A 4K8RB 4YXDA 4Q4Y1 3KDSE 1IG0A 4XEZA 4CDXA 4TNWA 2E2AA 4KWKA 2CNAA 1SBFA 2SLIA 2DUPA 4O7XA 5FP3A 3RRWA 5ABEA 5CFDA 4ADZA 1U5YA 1QJX3 4X1KE 4B7KA 3OY8B 2BERA 4RGGA 1LR5A 1YEWA 2XKOA 3CJXA 3O1PA 1GWMA 4HFCA 5J2UE 3ZT6A 5ISLA 1SEFA 4A41A 2QQLA 2ZXQA 4Q4V1 1YQ8A 3H9AA 3A23A 5HYAA 2LM2A 3WW3A 1F9KA 4GWJA 1KJLA 2GU9A 5AQOB 2IAKA 4NIHA 4YW2A 4DV3T 5KBFA 1NKGA 3I59B 2WS91 2DI4A 3IZOA 3OG2A 1EYBA 4S2DA 4AHYA 4XURA 2QQJA 2R1BA 1L7LA 3A0KA 3S30A 3J7MA 3AMPA 4PK5A 3OUHA 1W99A 3Q5WA 5JSRA 3PVEA 3TEXA 2W5FA 2VJXA 1RVF2 2DURA 2XTLA 5HEJA 1H4GA 4Z8XA 3C7EA 5C5TA 3I2JA 1FNYA 4IETA 2DUOA 1NCQA 5C9AB 2VASA 1GNYA 4I0AA 1URXA 2YOEA 5I0SA 3NNMA 3FHAA 4MH0E 2WT0A 2XXZA 4MOAA 5I0UA 1RUOA 2Y26A 3OPTA 5FZ7A 4XBFB 5LY2A 4Q4Y3 1RUC2 3NAPB 4CDWA 3OBTA 4XOGA 3NV3A 4IV1C 3QOPA 4HTEA 4RSUA 2BKPA 3ACHA 2YGLA 4ZI3C 2A3DA 1G86A 4BXSV 3LK3B 3VU7H 5JR9A 3Q9DA 3RYPA 5A6YA 5GALA 3HQUA 1CAXA 3VHRA 3ZR5A 1JZ8A 2Q1ZB 4FTSA 2ZBJA 1BR4A 2WT2A 3EYPA 2EIEA 4ZI7E 2YKSA 1J59A 4Q4V3 1OQEA 4B8EA 3SH4A 2QJVA 4ZZCA 5DZGA 2EIGA 2ZX2A 2WYFA 2ZGOA 5IATA 1KEXA 5L3FB 5LBFA 1UF2C 1BBT3 2EIDA 5FR3A 2RJLA 1GOHA 2VVFA 3WHUA 2JE7A 3KV5A 3OD4A 2YC0A 3TN91 1SCSA 1SPPB 3LA3A 3POJA 3AKRA 5A7QA 4BQYA 5M0TA 1VP6A 2WAOA 4UBGA 4W8JA 1NCRC 5HWXA 2GC2A 4QT6A 2VB6A 5JXJA 5JPMB 2OT7A 5SV5A 4DR3T 4DRRA 2P4EA 2GN3A 4RQPA 3VGIA 4ISTA 4KI0F 2QVAA 5BNOB 1QEXA 4UAPA 2D5UA 1RVF1 3ONJA 1G8WA 1TE1B 4JGZB 1XNDA 5A3TA 3M3CA 3S7EA 4IHJE 4W6WA 4NRQA 4AQTA 2E9XD 2PAEA 5I91A 1O4TA 5L9VA 2W0GA 3OBAA 5GLZA 3LQCA 1CZTA 5IHRA 2WZR2 1W2NA 1JXNA 3RC3A 5L9RA 3OKQA 4ITCA 3ABVA 3P3NA 1RUC1 3AE1A 5A6XA 2QYWA 4ZU5A 3IAQA 1H8VA 1F2NA 3SCGA 2CLYC 4LKEA 4N7UA 2VQTA 4IDNA 5BNNA 3ENRA 3R4UA 2VM9A 3PMSA 4ONUA 4GOUA 1YYNA 1SLBA 2HWB2 3LZZA 1DYOA 4ZHNA 3WP5A 3AAEB 1C1LA 1MEC1 3EO6A 3A7MA 3LAGA 1ZBA2 2BGCA 2X9XA 1NYWA 2R49A 1N3OA 4LMKA 3C7GA 1WUVA 4PJNA 2WCAA 3UNPA 3AP7A 3VBSC 1JI6A 2P6CA 4FP3A 2WA4A 3WF3A 1JYCA 3I2GA 1N47A 5FPXA 4EOZB 4NUUA 4QPGB 4FI5A 5T54A 5DAPA 1J84A 5FIXA 2DFBA 1AR81 3HT2A 1OVSA 2FDJA 2RDRA 1WW4A 2RVAA 2ARBA 3CJIA 2X53S 2X0YA 2E53A 1RVF3 3ZXEA 4PFPA 2C24A 4DY5A 3K1SA 2RR12 4GKYA 5T5JA 3ZDVA 4H9NC 1WCSA 2XPJA 2DCKA 4IGQA 4JTOA 1UKRA 4H7LA 3CLPA 5E8AA 5FZ1A 1OHFA 4JI0T 4XJWA 4LO6B 5K0UB 1YI9A 3I2OA 1D7PM 5FKYA 2ZHNA 4LLFA 1BXHA 1RUC3 2QQIA 2Q9QB 1O3TA 1J83A 1RJ8A 4QKFA 5A7NA 1UX7A 2CHOA 2WZR1 3ATGA 5AFBA 4YW4A 5EYXA 3U07A 3U11A 3AP4A 3LBXB 4DB5A 4AI2A 3VBUC 4ILCA 5JVDE 2NW8A 2KXLA 4PDWB 4PJYA 3PTYA 4TN7A 4OYUA 3I4IA 4NWWA 2XHKA 4XUPA 1QUUA 5JSOA 2QCSB 4AEDC 5JH7E 2OPKA 1XMOT 3OGVA 4XAXB 2YXSA 2CM0A 4Y1XA 3AE6A 1WZXA 5FWJA 3LF7A 5AQFB 2GSYA 3UKTA 3ESLA 4LBOA 4NPLA 2VMGA 4BK5A 3FB2A 4DEVA 4MO3M 4CE8A 1YW0A 1ZBA1 4YFZA 3JC6C 3CPZA 2PXJA 3ZIWA 4YSYA 1AR83 4BIFA 2IUWA 5AQTB 4D7TA 2OQ6A 2DWGA 1IKQA 3FUOA 4WVZA 2HEWF 3PNAA 3N3HA 1LHNA 1U0AA 1LOGA 4CDXC 2VURA 5A6QA 3SXWA 3MDPA 2FJBA 2WNVB 5A3MA 4CTEA 1UK5A 4BB3A 3A0NA 5FNVE 4XUOA 3AXJA 2G9FA 1F35A 1UZYA 4IGOA 3S7IA 3AEFA 5LNKA 5H6RB 2D6PA 5J96B 5CNAA 3E1F1 4O4LE 2K9AA 5JCTA 2QQOA 2WZR3 2XQ5A 5DMYA 1GFF2 1WMXA 4XCAA 3JCFA 1HCIA 2LKGA 1EPZA 3M3OA 5LCYA 1HQLA 4UW5A 1OURA 1R1A1 2Q5TA 5LEJA 2UYBA 1WGPA 3M65A 2D9DA 2LLYA 2GN7A 4LFAT 3E5UA 3UFEA 2E7TA 2XLAA 1GQPA 1HB4A 4COUA 5FY9A 3KCCA 1HB3A 2UU8A 1MR5A 1UPIA 3Q8BA 4DS0A 3ZFEA 3UU4A 1ZEEA 1TNRA 1ZBA3 5FWEA 1UOGA 2VMCA 1OFNA 5BMVE 1O7FA 4HSJA 5IK8A 2Y0OA 1WCQA 1CIWA 1G8XA 3J9X1 4JLEA 4DY3A 4Y26A 5DG1A 3OD0A 1EUTA 3H8UA 1UMIA 3HQXA 3ACFA 4DV5T 3HQRA 4TXWA 4A7ZA 5KXDA 3N7LA 3LDKA
chains in the Genus database with same CATH topology
5L3DB 1U5PA 4GJZA 3UUXB 3CVRA 4HEAA 4O2AE 3V5UA 2P5BA 5FBJA 3LDBA 4UVBB 1S94A 3PUQA 2VWAA 3RX6A 3PU3A 2RP4A 2XQYA 3IF8B 1MNEA 4D6QA 3U4SA 3KV9A 3HKDE 4ZOLE 2CEAA 5FY0A 5FXWA 4EB6E 3BQKA 5M4YA 5FY8A 3N9NA 4O4HE 5DQWA 3GWHA 4OK0A 3R6NA 4DNDA 2ACXA 4C91A 1HFAA 4ZHQE 4C90A 2V7IA 3K8PC 4IE7A 3L09A 4TV9E 5LJMA 3ZMZB 4H9PC 5A1FA 2Q9QD 2CXFA 2V7JA 2LEHA 2WBLA 3VKGA 2CLYC 2KNDA 2V7MA 3RPUA 4BAYB 4EYUA 3DJBA 4MALA 3O9XA 4P0AA 4H63H 4ANJA 4URAA 2WMNA 1LKXA 3N9MA 4UF0B 4CCLA 2C5KT 2X68A 3K3QC 2GK9A 4CSWA 3DXUA 3MJXA 4DMVA 5FZAA 2Q8EA 4D6SA 4LXLA 3CKDA 4FJOA 4BJMA 4GOUA 5EZYE 1B7TA 3O1HA 2KLQA 5FZOB 1SA0E 2W62A 3O1JA 4TV8E 2OA5A 5LY1A 4QXHB 1V9DA 5J2TE 5F39A 3SOLA 4I4TE 5FYHA 1FMVA 1YKEB 2HPLA 1MMDA 1YKHB 3RH3A 5FZKA 4ZS2A 5FZLA 1IJ6A 4F6RC 5F3EA 5A7OA 5HXSA 4MBQA 3PE0A 4TZ4C 3AAEB 4AQFC 2K24A 3AAAB 5L2LA 3SS1A 5KR7A 5FZEA 2LHNA 1BR0A 4G63A 3RYIE 5FY7A 3C4WA 2WMOA 3C50A 2KMFA 2X9XA 4TX5A 5EK2A 5L3EB 2LSJA 5FYVA 3PURA 3PUAA 3WAJA 5F3GA 5HXCA 2X9HA 4BJNA 3TKLB 3PU8A 2M67A 4UF0A 3DP7A 4AKRB 4PAGA 3PUGA 4PJNA 5LGNB 4DBRA 4O8SA 3AA7B 4DO0A 4E4HA 1EZ3A 2QA7A 1WLXA 2KWIB 2CWOA 4GIWA 3UUNA 5FPBA 3ANWB 4CXYA 5FYUA 2XAGB 5FPAA 3OPWA 5FZOA 3LK2B 3AL6A 4ZS3A 1HG2A 4HFVA 2YBKA 4QXHA 3KDSE 3FBLA 5LJNA 2E8IA 2LE8A 5LG4A 4XDOA 5TAOA 5DABA 5F2WA 4PK6A 3NRYA 5JDLA 5AFUL 3KVBA 1ZHCA 2NP9A 4GYRA 4HKAA 3Q2MA 1HTJF 4EOZB 2VL8A 2C5IT 4NUUA 4FI5A 4IE0A 1ZKEA 4EYYR 4XDPA 4CXXA 3E22E 5FP3A 3AA6B 3RRWA 5JDQA 5A7WA 4L0RA 2G0UA 4ADZA 5CB4E 1MIVA 4X1KE 2JJ9A 4EAHA 4BA9A 3K2OA 1HG5A 4LIVA 1UCUA 5FYCA 2DHRA 2D0TA 5IVYA 2E9XB 3IEEA 4IIJE 2OQ7A 1US7B 4YFSA 3ETUA 4CZZB 2BVMA 2L9QA 3ANWA 3KV4A 4UXNB 4AAPA 3KFWX 2EHOB 3AA1B 1WYBA 3AB3B 2V7KA 3MK7C 4PFPA 3N9QA 3QUJA 1MIWA 2JMKA 3KINB 2VD7A 5F2SA 2CMRA 4QXCB 2J1DG 5FY1A 3RYHE 4EZ4A 5IVFA 4ILUA 2UXXB 3QC9A 1H7CA 5J2UE 4CCJA 3U78A 3D0TA 4H9NC 5JDMA 2Q8DA 1MIYA 2KWHA 1WRDA 2L8KA 3CQCB 5KMGP 1OWAA 3OYXA 3ZEFB 3F31A 4IGQA 5ISLA 4MHCA 2MTQA 4UVAB 5FZ0A 2BDEA 4O4JE 5IHYA 1X79A 5FXXA 4H9SE 4G2AA 2C0SA 2PJQA 4PFOA 5FP9A 2YEVC 4V2WA 3RVHA 4E7SA 2E9XA 2Y6XA 5FZ1A 3UYJA 3MZKB 3CMLA 3ZJ1A 5LW9A 4DIQA 3O1IA 4CCMA 5FZ6A 1Z0PA 3H3AA 5HYAA 4CXWA 2EHOA 4GD4A 5FZ9A 2CXDA 5FP7A 2H7OA 3NBXX 4UIGA 5JDNA 1MMAA 4L9IA 4QXCA 3C4ZA 4AI6A 4BU2A 3A5XA 1BR2A 4U72A 1MNDA 4UELA 5L3CB 2ODVA 4TN7B 4QWNA 2ZM0A 2Q9QB 4HONA 5C8YE 1D0ZA 2N1GA 3MA9A 2PG8A 3W15B 5CEHA 2IAKA 3E08A 1HS7A 3P7IA 4CCKA 4EXTA 3EDVA 3DXTA 5FP4A 2BZBA 5A7NA 5HWYA 5F3CA 2DI4A 3HA4A 3CQGB 4K0UA 2NOXA 3C98B 2P9BA 3F57A 3MKDA 4ISSA 2A2FX 3K3NA 3OBVE 4LITA 5L3GB 4JUYA 4MFRA 5FZDA 2MOZA 4B6XA 3N2KE 4GJYA 2LSIA 3LBXB 1LRZA 3KV6A 2ZM2A 3N9OA 4PK5A 2WWUA 3PUSA 4QX8B 2ZLYA 5FZFA 4I50E 5JVDE 3AVRA 2V1DB 1U4QA 5HXRA 5FZ3A 1D1CA 2NW8A 4KBMB 5JDHA 4AI9A 2CE7A 4CI2B 4DMWA 5LBQB 2YU1A 4NUBA 1FIOA 1HF8A 4TN7A 3Q5WA 2E9XC 2Q9QA 2DNXA 4CI1B 2PBIA 2X67A 4UVCB 5E6HA 5DQVA 2NTYA 3ZN1B 2ZMAA 5A3NA 3C64A 5FXVA 3ZN0B 4YJ3E 2W2IA 3HR0A 2XTLA 4BISA 2VKHA 3MACA 5IVBA 4PW8A 4IE5A 3NZPA 1QUUA 3IHRA 4Z8XA 1IJ5A 3GN5B 3V5SA 3ZYKA 3HKEE 5FZBA 2KZ7B 5LWBA 4DBQA 2WM9A 5JH7E 3ZC1A 2B1EA 3C4XA 4GK5E 4XAXB 2W00A 3BK9A 2IC9A 5FPVA 3LBXA 2VASA 3KBTA 4H63V 2YINA 3FHNA 4IDZA 4DVDA 2OX0A 4QU1A 4KMCA 5FYYA 1LVKA 4QX8A 2QGSA 5FJHA 5FZ4A 4P09A 2X9YA 1YD8G 3ONXA 2H7VC 2XXZA 5FYZA 2CM0A 2KT9A 2XAFB 4M1PA 3ZYMA 3HKCE 1G73A 3N2GE 3NJYA 5A1LA 4Y3OA 2JQQA 4CI3B 2X66A 3WAKA 2W61A 5FWJA 4IE6A 1MMGA 2NWBA 3OPTA 5JR9B 5FZ7A 4C8DA 4V1Av 3ESLA 2CLYB 4QKNA 1LVFA 3GMIA 5KX5E 3RYCE 4XBFB 2D0UA 4OFZA 5LY2A 4IE4A 5HXHA 1S35A 2DLRA 4MLKA 2HH7A 2YU2A 3GN5A 3FB2A 4AKHA 5F8PA 4QXBB 3RRCA 1YW0A 1UX4A 2K48A 2UXNB 2SPCA 4X20E 5FZCA 4NUVA 2VKJA 3RKOA 5IVEA 2D2SA 2JRKA 3JC6C 3ZLIA 4HOOA 5FZGA 4WNKA 2ODUA 3CPZA 2LSGA 4HTEA 4I43B 2PXJA 3CX6B 2LJLA 5IVJA 2LT3A 1KNZA 4XZCA 4WBNE 5E0OA 4E7ZA 1OXZA 3N5LA 4IGUA 4ZI3C 5FY4A 2A3DA 5FYMA 3ZJ2A 3OYZA 4UV8B 1HX8A 3OJAA 1WYCA 2OQ6A 3I1AA 3LK3B 5DJQC 5ETWA 5JQGE 2WWJA 3I0QA 4P0BA 3VU7H 5LHIB 5FY5A 5IWFA 4I55E 5JR9A 5A3PA 2DWGA 3Q9DA 2XAHB 1KK7A 4PJLA 5IW0A 2WAUA 4CUGA 3C51A 2Y48B 3N9LA 3S4UA 4Y4RA 3HKBE 2MYSA 4UEMA 3UTKA 2CCQA 2XAJB 3HI2A 4QXBA 2BVLA 3FXEB 4GYSA 3SWHA 3RC8A 1NWMX 3ZCIA 2YBPA 4N78D 3T8OA 4JEHB 3FBZA 4V2VA 2JMHA 1BR1A 4CCNA 3Q5XA 2LSKA 3ZC0A 5FYTA 2N2NA 1BR4A 4BXFA 5JRCB 5FUPA 4OYKA 2VKOA 1T98A 4ZI7E 4YLHA 5LHHB 2HPJA 5FNVE 5JDGA 2XMLA 4H9OC 2LOSA 5A3WA 4CQIA 3RYFE 1ZV4X 5GONE 3MXZA 5FZMA 4AQFA 4PJMA 4WBOA 3B13A 5HAXA 3PDQA 5F32A 3FXDB 4H9QC 4IGOA 3R84B 1QSDA 4HGAA 2X0LB