3KVBA

Structure of kiaa1718 jumonji domain in complex with n-oxalylglycine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 113
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kvbA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kvbA01
2OQ7A 5K4LA 5FZ1A 5A80A 4LIVA 5FZ9A 4D6RA 4BISA 5FY8A 5FZAA 3LDBA 3PUAA 4CUGA 3K3NA 5FXXA 4CSWA 3AL5A 5FYZA 5FZKA 4QU1A 4TN7A 3AVRA 4Y3OA 4QXCA 3AVSA 5A7NA 3DXTA 5FYMA 4QWNA 4V2VA 5FZHA 2YBSA 4C8DA 5A7WA 3N9OA 4Y33A 5A3TA 5FWJA 5F39A 4LXLA 4LITA 2PXJA 5FBJA 5ISLA 4Y4RA 3N9NA 5IVJA 3U4SA 3KV4A 5FZIA 5FY1A 5FZOA 5CEHA 5FY7A 5FZ3A 5FZOB 2VD7A 5FZMA 5F3GA 2W2IA 5FZ7A 3K2OA 5FYSA 5FZ8A 4ASKA 5A1LA 2WWUA 4QX8A 5A7SA 3PUSA 3ZLIA 5F5AA 5FP4A 4GJZA 4E4HA 5A7OA 5FUPA 5FYUA 3AL6A 5IW0A 2Q8EA 5FZCA 5A7QA 5F3CA 2YU2A 3NJYA 3KV6A 4XDPA 5FYHA 5A3WA 5IWFA 5F32A 5A7WB 3UYJA 5LWBA 5FYVA 2XUEA 4CCJA 3PTRB 5LY1A 3PU8A 4IGPA 2XMLA 4CCLA 5FYYA 2OT7A 5F2SA 4CCNA 5IVYA 5FJKA 2YU1A 5FY5A 4GD4A 2GP3A 5FZFA 5FPVA 4HOOA 5FZ6A 2WWJA 4GJYA 4UF0A 5FPBA 5FYCA 4GAZA 5FXVA 5FXZA 4AAPA 5IVFA 5F3EA 3PUQA 3KVBA 3OPTA 4DIQA 5FPUA 5FY0A 5LY2A 4BXFA 2XXZA 4DO0A 3PURA 5FJHA 4CCKA 2GP5A 5IVEA 5FWEA 5KR7A 3K3OA 2Q8DA 4QX7A 2OS2A 2OQ6A 5FP3A 5FZDA 3N9PA 3OPWA 3KV9A 5IVVA 5FYBA 4CCOA 4EYUA 5FZGA 5FZBA 5F2WA 5FP7A 5A1FA 5FV3A 5A3PA 4NUBA 3ZPOA 3LD8A 5A3NA 4V2WA 4D6QA 4IGQA 5FPLA 5FPAA 5FXWA 5F5IA 4BU2A 3KVAA 2OX0A 3U78A 4URAA 5IVBA 2XDVA 4QXHA 5FP8A 4D6SA 1VRBA 2YBPA 4UF0B 4CCMA 4IGOA 3RVHA 5LW9A 3DXUA 4EZHA 5FZ0A 4HONA 5FUNA 5FY4A 4LIUA 4AI9A 2YBKA 5F5CA 5FP9A 2Q8CA 5F37A 3PDQA 4XDOA 4EZ4A 5ANQA 5FY9A 5FZEA 2P5BA 5F3IA 5FYTA 3N9QA 5A7PA 3PU3A 5IVCA 5FYIA 5FZLA 2YPDA 3KV5A 3N9MA 5E6HA 5FZ4A 4QXBA 3N9LA
chains in the Genus database with same CATH superfamily
4PI2A 3AXJA 5AQRB 2VQAA 1LCLA 4YFSA 2VECA 4YTNA 1AR73 1A78A 5CEHA 4ZOLE 2I6HA 3B9CA 1A6CA 3DV8A 2BBVA 5JMCA 4WM7A 3RX6A 2RR11 4JBWF 2H0BA 3VDDC 1X36A 3HNBM 1CAUA 3NZPA 4TUYE 4JV5T 1GQHA 5FPVA 1PM4A 4N7IA 1KNPA 2WA3A 2YC4A 2O8OA 4N43B 5HXRA 3MZHA 1WYBA 4H9NC 1W9YA 4HZFA 3D8CA 1N1YA 5BNNC 4HFHA 4D0QA 3OEAA 4ANJA 3M3QA 4JV4A 4J6GA 5JCTA 4DEVA 4BQ3A 2VUAA 1ASJ3 2WO1A 2NOXA 4TXWA 4CDWB 5F3IA 5JDNA 3C7OA 1MQTB 2WT1A 1OI6A 3LDBA 3PJYA 3OEBA 2JDKA 4ZI2D 5FZKA 1E1HB 1LVKA 1H6XA 5I8TA 3ZT7A 1UZYA 5EZYE 1HIXA 1G8WA 3H3UA 4OYJA 3O5SA 2WYSA 2BS2A 4GA9A 5J37A 3IN9A 1KK7A 1XYNA 2ZPXA 2V8SV 2BU9A 4AI2A 5FDBA 5LMUT 4EQVA 3HKDE 2YG0A 5ABFB 2OPKA 1RUE3 1AR72 1IBKT 1GP6A 3MJXA 2QUOA 1QOSA 1VBA1 3RZJA 1CIYA 2CNAA 5JZGC 2LW8A 3BIWE 3OUHA 3ZFFA 2RDRA 4YYOA 4OVEA 3S0MA 2P3IA 4HVOA 3K77A 5KHJA 4K0KT 1Z8UA 4WW0A 5HCBA 1PNFA 2P3JA 2CGOA 5AQSB 3FZFB 5EK3A 2SBAA 3POBA 4BA9A 5LGUB 4OI1A 2KT9A 4W8JA 2Z42A 1JNZA 1CPMA 3AB3B 2Q4SA 3U78A 2NR4A 4GZ9A 4HWHA 4BQ4A 3AMPA 1O3SA 3W5MA 2BKOA 3RHWA 5A7PA 5JSPA 4AQTA 2L9QA 4PLNA 1VBB2 2I0MA 3K3NA 3KGZA 1JUIA 4Y1ZA 3H3ZA 4R52A 5A7NA 5LJMA 3ABZA 1VAVA 1STMA 2V26A 2J47A 1SLAA 4I0UA 3SNMA 3UU8A 4AYUA 3ZLIA 2YUEA 4UFMA 4MO3M 2B4KA 4Y1XA 3T1YT 2PFVA 4PJLA 2MYSA 2W5FA 2BG9B 4OK0A 1RUE2 3IAQA 4DV0T 5LP6E 2HWB3 4PQ9A 1HF8A 3TN93 1R1A1 4P08A 3O1MA 2ERFA 4PIYA 2FJDA 2Y6KA 1H8TA 4Q0SA 3UUBA 1UIJA 2XG3A 5DN2A 3UU3A 3JUUA 1V6IA 3JZVA 3MPPG 3P6BA 1VIWB 3LZZA 3FHNA 1LOGA 4EN6B 5BNOC 3B5MA 5JOWA 2BVVA 4FXGB 2E9XA 1DGLA 3WUCA 3UFEA 4NO4A 5A80A 3GWHA 3VZJA 4B1LA 1IPKA 4CN4A 1V9DA 5BUVA 2O0OA 4D94A 4BQ2A 3I2KA 4C8DA 2RE9A 3NO8A 1JI6A 1H1MA 4IHJE 3ITQA 4NHKA 1X9TA 3JXSA 4KHPT 2VD7A 3RIUA 4XUTA 4AQSA 3RIAA 4L99A 3BTXA 3DECA 1OA3A 4O9GA 4HLTA 3QB5K 5CFDC 5F9TA 5FXZA 1RVF1 4RFRB 1WKYA 3GJBA 5IHYA 4OYKA 4Q4W3 4ARYA 3SLIA 5IFPA 4PK5A 1OEDE 2WT0A 3RYPA 4K6BA 2DWGA 1ODMA 1ND2C 2WABA 5ABEA 2LM2A 3UKNA 3AYAA 5ABJB 3WY6A 4QD2A 4ARXA 3IEEA 3LWCA 1VMJA 2R32A 4YFWA 4IDOA 1G8XA 3DXTA 5FQ0A 3KB5A 4HKWA 5AQIB 2WMNA 1US3A 1WZXA 2NTYA 1DG6A 1EAH1 4B3TT 3RWKX 4TZ4C 3D3AA 3UNPA 3J4UH 5FUPA 4FPJA 4QWNB 1UX7A 4H9PC 4COWA 4LOTA 3PU8A 5AQNB 4CI2B 3IPVB 2JB4A 3FBZA 2FHRA 2W63A 3SH3A 1W9TA 3VZMA 2D97A 5FUIA 4QX8B 5FPUA 2V09A 1XE0A 2CXLA 4RYDA 3G7DA 4OHFA 4FOYA 3RRCA 4BJMA 4EWDA 4D6QA 2R7EB 5IVBA 3OPZA 4FBFA 1KNRA 4QKBA 3HT1A 1VLNA 5HYAA 4A3XA 3BQLA 4BB3A 3PIJA 1ENRA 2V72A 3N3HA 2CBIA 1WW5A 5HI0A 3ETQA 1D0GA 4I4TE 1EYBA 3C4XA 1MIWA 1E57A 5GZDA 1HNWT 4E9KA 3JC6D 4ZU7A 1GNYA 2VKHA 3U3IA 3RG0A 5FZOB 2VOTA 3BODA 1K3IA 1PO13 2VQUA 1WW7A 4AVSA 3RQ0A 4DR1T 3PTRB 5DQVA 1BJQA 5FYYA 3WF3A 2QQUA 3RYHE 3A23A 3VZNA 1NA1C 3MF6A 4Y5TA 2FCTA 3H42B 3QH7A 1FOD1 1ZA7A 4COVA 2FBWA 5J09A 4CU6A 5T5OA 4UFLA 5JH7E 2P6CA 4A6SA 4BQ5A 4UIGA 4DUZT 3HQXA 3RI8A 3E08A 2C6SA 1OPOA 4MGIE 1FPN1 3TLVA 5IVCA 3TB0A 4IERA 1C4RA 3LBXB 1O4ZA 4EE2A 1B35B 4J25A 4TN7B 4MV2A 5ERLA 3N4MA 4QDSA 4MSVA 1RINA 5FREA 2JPFA 1WFDA 5A33B 2KNDA 1I6ZA 1FV3A 3Q8EA 3X29B 4A6OA 1VALA 4CI1B 1FJGT 1U5PA 1UW8A 2F4VT 1W99A 4IGUA 5CKNA 2V4VA 5F32A 3T2PA 2XJ7A 4LMFA 1PO12 5GZCA 5FZFA 5FXVA 3U14A 2VMGA 3TEXA 4Y5Z0 3Q8FA 2JDAA 4P5HA 4QGNA 3AZVA 3GN5B 3M3IA 4Z92B 3LDQB 3WQ0A 2AREA 3ZYBA 2W66A 2DWKA 1OBNA 4O61A 5C3OA 2XL7A 4R4ZA 4XF3A 4OX9T 2HN1A 5CBLA 3AE6A 3IMNA 5C3SA 1WCSA 2XKPA 3VBHB 1OEDA 3CL1A 4IDZA 2QDNA 4LQRA 4H7LA 3ZVXA 4Z90A 1Q43A 1RUG1 1MZFA 1HCIA 3ACGA 3FBMA 4XXAA 2XJTA 3AA1B 3VBSA 4ASMB 2HWD3 1IPSA 3JBG1 4I3PA 2XVLA 1WRDA 5HAXA 4H55A 2XPKA 2HWE3 5CYYA 1PGW2 5KXDA 3S4UA 3IB3A 4OQ8A 1CAXB 2RA1A 3BTZA 2UU8A 3VZLA 1D4M3 1IS5A 4UF0A 4HK8A 1ZBE3 3ACHA 2H89A 5KXEA 4N53A 2PYTA 3OJBA 3O0XA 1UOGA 3V0AA 4IEYA 4FTBA 3O1HA 2BS3A 1YUDA 2VKJA 1OLRA 2OW4A 3PLQA 4DBRA 2DTWA 5JVVA 2QRXA 1GV9A 2KWHA 1WA6X 4FPKA 1CAWA 2H7VC 2B45X 5AFBA 5FYTA 1EUTA 5FZ9A 4UXNB 2PHLA 1W8UA 5CFCB 2JX9A 5JR9C 2K0GA 3TLUA 4LLOA 2XGXA 4XJUA 2OXBA 3OOXA 5L4EA 4LXLA 1OUSA 4AEKA 4Q4Y2 1S1AA 1UD1A 3RZGA 3V5UA 3JAFA 1W6PA 4IT4A 4PCRA 4JKKA 1OLME 3G6JB 4O4LE 4WBNE 1KQRA 5KXCA 3ACFA 4KL1A 4Y22B 2YU2A 5DAWA 4EWEA 4C90A 3I9WA 1QHDA 2NYYA 3SC7X 5AQFB 3PUGA 3ES1A 3KCYA 1ZOYA 5FY0A 3RFRA 5H9SA 4AQ6A 1UY1A 2VNVA 2FUPA 4G2AA 4AVBA 1W6OA 1BBT3 2OQ6A 5CJ5A 3K4ZA 1WUVA 3E97A 1HX1B 5JIAA 3ZSEA 1W0NA 1N33T 4O8SA 2X51A 3ZSJA 2LLYA 3CF6E 5JSRA 1JTZX 3KV5A 3OJAA 1ZZBA 1W2UA 3H8UA 1NE6A 1O6UA 4QQOA 1DIWA 4ZHNA 2XY8B 3O4XE 2VCBA 2V7KA 3WW1A 3IDCB 1VRH2 2BPA2 3ZN6A 4Y33A 1F2NA 3W58A 4MVTA 4Y1YA 4P1NA 5DQ0A 3WQ1A 2R041 2XQ6A 2AUYA 3E22E 3VD7A 4YVWB 2E26A 1ND3A 3OPCA 2CGPA 4YW6A 3MK7C 3OUJA 1EUUA 4AGVA 3AMQA 5AQOB 3K46A 1IZ3A 3NVOA 3BALA 3GJAA 2QKDA 3B7MA 1NCQA 2XSAA 1RUJ2 4BK4A 1YQ4A 2VMFA 3WT3A 1NCRB 4NHLA 4XABA 3D6EA 4XE9A 2Z79A 1XRUA 5L3CB 1MEC2 4IGQA 2CXFA 4HFSA 1AX0A 4KBZA 3WW2A 3VN4A 1YFWA 2QYWA 3H7YA 3VBUA 2H3RA 5ANQA 1BMV1 5AQUB 5FVLA 1NEKA 3LOIA 3ZSTA 1Q8SA 3PUHA 2MAWA 4ATEA 5FMBA 4ORFA 2ZM6T 3V5SA 3BGAA 3TWIA 5JDQA 4LR4A 3W15B 5FYSA 4ASKA 3HKCE 2WNOA 2WZR3 2HEYF 4KX6A 5IK7A 4NIQA 4Z8XA 3HNYM 3WNOA 2WC2A 4XDPA 5FYHA 4YHHT 5BNPB 1T98A 4CDXC 5AC93 1QY4A 2VZTA 4XXPA 1VBD1 3KBUA 5GLVA 3ZKRA 1ULPA 4U3CA 3WLUA 4K40A 5CA6A 3KFWX 2ZKNA 1H9WA 4AWDA 5AQHB 3TEZA 2HBTA 4FPYA 3FC0A 5JRCA 4UVCB 1G9CA 1DQ6A 4QXHA 4AVVA 1AJOA 1CONA 1QNYA 3I2HA 5DZEA 4KH9A 2YXSA 1ZKEA 4UI9L 4XDOA 3FLPA 4MGZE 2RM23 5FZAA 2GU9A 2ENRA 3RZHA 4B1MA 4ZEYA 4DQAA 4OI0A 1HRV1 1JYWA 1S2KA 2BFUS 5HEHA 3VGIA 2A2FX 3U1XA 4I01A 2VW2A 1D0ZA 1AR71 4EN7B 4AKHA 3VKOA 1KEXA 1RTVA 5BV6A 5HWXA 3EYPA 4O9EA 3BUCA 4CDUB 2VUJA 5A7WB 2XQRA 4GULA 4IGPA 1OLMA 3OG2A 2BNOA 1ZZ9A 2BVLA 2YZ4A 2WUHA 3QUJA 1SLBA 1UXZA 2D93A 4CDQB 5F5WA 3BTYA 4BXSV 1M06G 1UN1A 2VWAA 1V0AA 2ET1A 5JLVA 1QNWA 4BCUA 5EJ3A 3Q5DA 2W61A 3P5BA 3HIFA 3B13A 5LA9A 2JKBA 1ZHCA 4UVAB 1H9PA 4DZGA 5DUXA 4EZ4A 3TLWA 1DYKA 1AUYA 3PU3A 3JD72 1VBB1 5FZLA 3VDBA 3ONJA 4FAHA 4BYYA 1WMFA 1UZVA 2E7QA 4JEUB 3AVSA 1YNAA 3L2HA 2XLGA 5ADXL 2EALA 3UETA 4XZUG 4CUAA 2GNTA 2RM22 3A0NA 4N9HA 4Q0PA 3UV9A 5LBFA 1J3RA 2IVJA 3LSEA 1OH4A 2N1GA 5J1GA 1QJU1 4JGZA 1W8WA 1MMAA 2CGNA 4F3JA 2XTLA 5L2LA 4LFCT 5FL1A 4W4ZA 2GMPA 4WM7B 2ACXA 2IMLA 2CLYC 5CZKA 1FAYA 1CAUB 4FFFA 1OFSA 1FV2A 4Q4X2 3KQ4B 4FTSA 1BR1A 2YOEA 4FO9A 5HEOA 1TMF3 3M8LA 3MXZA 3VBOB 5FR3A 4GK5E 4CP1A 3KVBA 1RB8G 3OBTA 2J1VA 3Q9DA 4GXLA 4XJ8A 5GJ6A 4HL0A 4CCOA 4P0AA 3B93A 4DINB 1T6BX 4LORA 2YBPA 3EBRA 1IZNB 2YDEA 4PDWA 1U0AA 3GCXA 1YJKA 2MEV1 5DDJ3 1A3KA 3ZMTB 3RKGA 3VKNA 3ZSSA 1D1BA 1B7TA 3N2KE 2EXJA 5LEJA 3C4ZA 4AXPA 3O14A 2E63A 1MIVA 2IXKA 2V5YA 1YHFA 3K8PC 4N78D 1SHWB 2R0HA 3KF5A 5JXJA 1HX6A 1JNRA 3UYJA 1XNTA 1YIFA 3ZFFB 1PNGA 1S0IA 4EROA 4YVSA 4DIQA 2VMIA 1CAVA 2YGLA 2D6LX 1UURA 2OLTA 5HV4A 4QM9A 1TMF2 5T5PA 5LK5A 1ENXA 5L7OA 1LOBA 2A71A 4A4AA 4JQTA 4NROA 1DQ1A 1R093 2QVAA 5HXHA 4LIUA 3I2IA 3CMLA 3AKQA 2P5BA 3PUWF 4NIGA 1BEV1 4I55E 2GAUA 4XW3A 1PO23 2CEAA 4K9SA 3UJOA 3LAGA 4D7YA 1IAPA 5F39A 3ZXLA 1IHMA 1C57A 3U4SA 4OHYA 1IS4A 2OA2A 1RUC1 3GZUC 2KR2A 4MG2A 2X0HA 1YYNA 1W39A 3RWNA 5EK2A 3AECA 3OGGA 3RC8A 1MNDA 4EOZB 3UGFA 5BNQA 4FP2A 3DPRB 5C2TA 1A8MA 1WW6A 4DMIA 4F83A 2XXZA 3EAMA 1MS4A 3OGRA 3LEMA 2JJ6A 5GZFA 4RQPA 1H8TB 1FNYA 2WFF2 2JDNA 5FP8A 3NNJA 5LRRA 2VMEA 1SFYA 4I2OA 5FZ0A 1WR6A 2DCJA 1WLCA 2SLIA 2E9XB 2P17A 5IUXA 3USSA 2WWSA 3AE8A 4XFGA 4U2ZA 4NIDA 4QU1A 4DIDB 2UYAA 3BTAA 3I3DA 4OULA 1MVQA 2DL1A 2V4AA 1T72A 2RMU3 2NP9A 1QJY3 3PMEA 3QH6A 3AFGA 4P00B 4N53C 1OWAA 4XMAA 2E5LT 2VNOA 2WB5A 3UGGA 4M01A 2WKKA 3NAPC 2YHJA 4XFHA 1GQPA 4XF1A 4M4RA 3W5NA 2GK9A 2B1EA 1JBCA 4QT6A 2JIGA 4P09A 4JDOA 2VZ1A 3PHMA 3GGLA 3VUOA 4CUCA 2RS13 2CWMA 3QOFA 2IUBA 1SFNA 1O91A 4TYSA 2VMDA 4GH4B 4E2GA 4RSUA 2OA5A 3SFDA 1HKDA 3ZR6A 1ZBA3 3T1LA 2BDRA 4I3GA 2LOSA 3QNUA 2AENA 4CCKA 1CVNA 2HKXA 2FJBA 3L9JT 4UBGA 1COV1 4R9BA 5FZBA 1MQTA 2FCVA 2JMHA 1I1EA 4JKLA 2I74A 2CHOA 2WFPA 4P9WA 1XJAA 1O3TA 2J1DG 1WA4A 5EIYB 2ZHNA 5HXEA 4UW6A 5FO9B 3T0BA 2YFZA 4DOUA 2FJEA 4LE3A 2WNUB 2ZEXA 2K48A 2W4XA 4EXTA 5FQ0B 4OHVA 2W1WA 5C33A 2VCCA 1W9SA 5HPOA 3WVJA 4CU7A 4FQZA 1OF4A 4MZUA 2KMFA 3ZN0B 4ZY9A 4PNIA 4LUMA 3CLPA 3ZXGA 4AQ2A 2RMU2 2JENA 3HKEE 1LKNA 3OGVA 2DUOA 3UUXB 1V9U3 1QJY2 5E88A 3APBA 5JZGB 2W52A 2F4PA 2CAVA 5IWFA 2FDKA 2JRKA 1T7SA 1XNCA 1UU6A 2X5IC 2W62A 3VL9A 4XIKA 5AVAA 1UOFA 5IAVA 2ZAHA 3LA3A 1ZVFA 2GALA 2WZIA 5AQQB 3O1VA 2JG8B 2Q9QC 4XQDA 1CJPA 5C4WC 2BJSA 1JHNA 4Q27A 2XLFA 2YPJA 2XQ9A 2CXDA 4CZZB 5HEUA 1BCXA 1RMU3 3THDA 4AL9A 4CYDA 2VK9A 1WCQA 3SCFA 2QNKA 4LF6T 4HK9A 3RS6A 4HE8A 4AEDC 5LGNB 4HGAA 3VBFC 4E8DA 3ST7A 3VKHA 4I0BA 4XAXB 4AR2A 1RGSA 2LSJA 3EUHA 3NKZA 2E9XD 3NKTA 3O9XA 4AGGA 4GMP3 4QHOA 4LFAT 4NR1A 3ZSMA 1BVVA 2FMYA 4IE0A 5DAVA 1BYHA 1IBLT 1PGW1 3KT4A 4IREA 3PUVF 2D3PA 3AEDA 2VL4A 4LHKA 3NRXA 5FFOC 1CUNA 2MPFA 5FTTC 4PBOA 3ROUA 2GH8A 4Z2AA 5C5UA 1PX3A 1C8M3 1V9U2 4YM2A 2XQ8A 4PJJA 3IF8B 4I30A 2VZOA 4AHZA 4XCBA 3WNKA 3M3ZB 3AKSA 2VQET 1CD3G 1UCUA 3I59A 3EJKA 4ZHQE 4Y1VA 3P8CD 4TSVA 1U4QA 4LMJA 3I3BA 4IXLA 2PELA 4MXVA 5A32A 5EV7A 2UY8A 1VBC3 3JCFA 4LO4B 3DGTA 3HBZA 2DCFA 1LOEA 3AB0A 4RGKA 5IK5A 4IL4A 3M7AA 3RNSA 4WM8B 2C5IT 3ETPA 2YY1A 2DVDA 4Q4Y1 4XTPA 3SRZA 2ZS6B 2C0ZA 4O2BE 2R49A 2DBNA 4Z2WA 3FZKB 3NNFA 4WZFA 4DR7T 4B6XA 4AI0A 1CX4A 2EVXA 3FHIB 3HBKA 5LCYA 1AYM3 1WD3A 2ZEYA 4XUPA 1W8HA 3WF4A 1D0HA 4EIWA 3WP5A 3VHNA 2DCYA 3AP9A 2BOIA 3RRWA 2DVBA 4RS5A 1Q3EA 4PT6A 3N2OA 4EAHA 3POYA 5LZ6A 2G4IA 3D82A 4R9DA 1H30A 4E27A 1TME2 1HXS3 5FK8A 1GZWB 4DPNA 4LTAA 5ABJA 1C8M2 2VU9A 1SLLA 1ND2B 3LD8A 4L92A 4JI4T 1MS3A 3RVHA 2HWF3 3OF1A 1OEDB 2XLAA 4CTEA 2ARAA 1PM7A 3J7HA 2X29A 1HB4A 4Q0VA 4I0AA 2CU5A 2R1DA 5I0SA 1ULDA 1QQP2 4PLMA 4XEZA 4QWNA 4Q26A 5FKBA 2AC1A 4PF5A 1VRH1 4XVHA 3LFIA 4FI9A 4P02B 1VBC2 4OHWA 2CHHA 4URTA 1L3JA 3FLTA 3IPVA 5FY1A 3J8F1 3MIEA 3O1IA 2CV6A 5E16A 2NW7A 4QX8A 5KBFA 3WZ1A 2YN6A 3AP7A 3ZFGA 2ZXQA 3KWVA 2NP0A 2GSYA 3TAYA 2W00A 4Z8BA 1HJFA 2IXLA 1SHZC 1O8SA 5HXCA 5FKCA 2GDFA 3LDKA 2AACA 2X9YA 4OCTA 1RUJ1 1I3HA 1UYZA 2WS92 2Q8DA 4QQ2A 1ZRRA 3KV9A 2BBHA 4D8MA 3H3AA 4AHYA 1MEC1 1AR93 2WL1A 3FB2A 1LRZA 2WLQA 1H2LA 1EV13 4JGZC 4QDRA 3SQOA 3T8OA 5K0UC 4XF9A 4XDQA 5K4LA 4X64T 3GNEA 2NM1A 4AQYT 3HN1A 4F8HA 3RLFF 5IJRA 1LHVA 3TLTA 2QE3A 5FMNA 1SCRA 3FE5A 3T09A 2W94A 2PA7A 3ZCIA 4M0HA 1RJ7A 4TLFA 3SWHA 1TVGA 2DFBA 3GMIA 4U74A 1KD7A 4NWVA 1W90A 1IQDC 2BS4A 1JZ2A 3ORJA 5GLUA 3GCWA 3AXDA 2WLPA 3ZT6A 4PDWC 3AC0A 1S35A 1WLXA 4A98A 4GJYA 2DBIA 2GN7A 5FMDA 3TOJA 2ETEA 5I8YA 2WU2A 4ILCA 3CQXC 1DZRA 2PHUA 1PGL1 5ACA1 2C5KT 4XFFA 3LBXA 2WSUA 1B35A 5B2GB 3NQHA 5EHDA 5C7GA 2UWAA 4HVRA 1PVC3 5A33A 3ZIWA 1YFYA 3N9QA 3SHRA 2VVDA 4NHYA 5JXHA 4YW1A 1SDWA 2QQNA 2RJKA 5GZEA 3CVRA 5FXXA 1GWMA 1EV12 4KWJA 2LKGA 3M3EA 5FMOS 3BOPA 1OOPA 3AA0B 4XJZA 5LA1A 4OI4A 2J1RA 4YVSC 5L3FB 4ZI2C 1W8TA 3T08A 5EPAA 2D3SA 5LMNT 3B00A 5EQUA 3WR0A 3WAKA 5KHKA 3PNAA 1MMGA 2X10A 4ONUA 3QACA 1KITA 3GN5A 1ND3B 5L7OC 1L7QA 4PBPA 1E5SA 2OUHA 2FDJA 2MTQA 1QH7A 4GB33 4ISTA 3FZMB 3BVCA 4KBBA 3PUQA 3VBHA 2V6YB 1NCQB 2ZGQA 4IL7A 4AFMA 5IUQA 5E8AA 3SISA 3IA3A 2A75A 4NIIA 2YC0A 2Z69A 2GC1A 2XL9A 4CA9A 5LG3A 5E1RA 4PJMA 5J3UA 1GNHA 1H8VA 4JAAA 1G9AA 3VBUB 4Z91A 1ZRIA 3JD71 4QB2A 2VOXA 3EMRA 1XC6A 3AEGA 4P9LA 5AFUL 4BISA 4HMZA 1UU4A 5D21A 1HB3A 3NWKA 1GSLA 1J1TA 4IV3C 2IHR1 2FD8A 1PVC2 1PIV3 3C7FA 3PVOA 1CAXA 3CX6B 3KF3A 5KHGA 4COFA 3P4PA 1RXFA 1PHMA 2UUAT 5FY7A 4YTPA 2Q0AA 1HV0A 2IWGB 5A7SA 3KDSE 4RQPC 2WDVA 3WX5A 2YV8A 3F95A 2K9ZA 5JAXA 5SV5A 4JI7T 1DGRA 4AE2A 1T8BA 4CVUA 4Q4X1 3OTFA 4UFKA 1KRIA 3ZT5A 5BXXA 4KQ7A 5EK4A 3B02A 1YCIA 5T50A 2C5JA 4HFBA 3VRBA 2HJIA 1DFQA 4ILAA 3LIHA 4NPLA 4CEYA 1LHWA 2G1MA 4TWDA 4FSJA 1G9DA 1OA4A 3WI3A 4LE4A 1X9PA 4GB32 5F2WA 5FLJA 5CFCA 5JRCB 5LGTB 2OIIA 1ACCA 4HTEA 3T2OA 4RR3C 4EZHA 1QJFA 3E5XA 4LK6A 1HJGA 4QU2A 4A56A 4QX7B 4N43C 3ZN4A 3AXEA 2DDUA 1N1TA 5C70A 2B8MA 1ULFA 3ZMUB 4NMIA 2ZGUA 2LROA 3W59A 3QD6A 5FYMA 1W6QB 4JDMA 5FMCA 4W6YA 3T2TA 1G73A 1LENA 3AZYA 3ANWB 3PJQA 3T3YA 5FNVE 4IE4A 2XBO2 3UJQA 2ZX1A 5E0OA 3AEBA 3NNLA 4CDWC 1PIV2 4Q4V3 3WF0A 2FQPA 4QKNA 2A9UA 3RRDA 3RGLA 1MQTC 4Q1PA 5FBZA 1YXRA 3ZN5A 5B4NA 3AE7A 3J7Yq 3CKDA 1POV3 1ZZ8A 3F2ZA 5GZGA 2WDQA 2HYXA 2WNVC 1DU3D 1FX5A 3AMMA 2AXDS 2GNMA 2VB6A 2ZGKA 3OSDA 2XAGB 1POV0 2W9XA 1QUUA 4NUBA 4FOVA 5EXOA 1FMVA 2K9AA 3ALQA 1XMOT 3KS7A 1HFAA 1SACA 1G7YA 3QC9A 2H0VA 1IGOA 2HWC2 4YFZA 2CE7A 2XOMA 5FYIA 2BV4A 4NXMT 1IKPA 4LIVA 1QWRA 4XMIA 4RHV3 4CUGA 3I3QA 1OD5A 1QEXA 4OFZA 2VULA 1IOAA 3CZUA 3N9OA 4NIAA 3LK3B 3O1OA 4B29A 2ZX0A 3I2GA 5A6XA 4KNCA 2YDRA 3BOWA 2PAEA 1LTEA 4DV4T 1X82A 2DWRA 5A7OA 4JEHB 4QPGB 1QSDA 1UYPA 5LJNA 1NCRA 1J1JA 3J7MA 2QFEA 2XAJB 3CDZB 1XYPA 3GBFA 4B3MT 1CHUA 4QKDA 2LT3A 4Q4V2 2ADEA 4FPOB 2FZ2A 3H50A 1UXXX 3BU0A 5J98B 4L9IA 2OV9A 3UQ4A 2KZ7B 1GKBA 2WFF1 1FMWA 4B8EA 4DR3T 1V6LA 1KEYA 4JZRA 2XQXA 1JS9A 1SG3A 1FXZA 3KHCA 4IEVA 2BG9C 1PK6B 1NZCA 4FOWA 3WQ7A 4X62T 2ZMAA 2NQYA 2XHEB 5JTGA 1AYN3 2ZZJA 3ETUA 3P4QA 2PTFA 5HXVA 2RV9A 3AL5A 3N35A 4HWDA 1LECA 3D0SA 4LBNA 2LHNA 5LBBA 1LOAA 3LF7A 1HB2A 2WCAA 5BNPA 1X9BA 3ENRA 4BIFA 2Y33A 4WNKA 3LOBA 2H7OA 4RHV2 2BP6A 2K46A 5C8CB 1MZ5A 2Q5TA 1C1FA 3S5QA 3N2GE 1JHJA 1JZ6A 3BB6A 4QPIA 4H9RC 1E5RA 2Z5WA 2BZDA 1C5IA 5IYZE 4JVAA 4FFHA 3LG7A 2XHKA 5LY1A 2RS52 2YMZA 1AL23 5FJKA 1ULEA 1RUF2 4GALA 2XJPA 2XQ4A 4HOOA 3R4DB 4BE3A 3O12A 3WP6A 2RDSA 1S0GA 5T5JA 2W95A 2D6KA 4HPKA 1Z7S2 1UU5A 3I0QA 4ISQA 3MICA 1J3QA 4QH4A 5LHIB 1QU0A 2ZZQA 1Z0HA 5A70A 3V65A 2XAHB 1HQWA 3MLLA 4MGQA 4AOCA 4ZZCA 1GU3A 1SZBA 3T1MA 4BJ0A 2JDHA 3S7EA 1HB1A 3OD4A 2ZMNA 4YWAA 2IDOB 3EHKA 3CJIC 4QHZA 4ZZBA 4CDUA 3WNXA 5A7WA 5CADA 1PZ7A 1AYN2 1O3RA 3AYEA 1AL0G 4LITA 3QCWA 5L47A 5L9RA 1RUD1 2EXIA 2QVSB 2XM2A 3AAAB 3DL3A 5C5TA 2KWIB 2VKOA 5ABJC 4Y1UA 3AP5A 1YLLA 4EV6A 2RDQA 4DV5T 1OLQA 3AX4A 4F7ZA 5IFTA 3T4VA 2YINA 2RR13 5EJ1B 2UU9T 3RZKA 5APAA 2Y6FA 5CNAA 4NXNT 4BJNA 3HJRA 1WCRA 1X33A 2R061 1EPWA 3O1SA 4EN9B 4JI0T 1WR0A 3KBTA 1GZ9A 3H3LA 3M1HA 5KMGP 2ZGOA 3K3OA 4PF1A 3ZMNA 3NKGA 3FLRA 5J36A 2ZCWA 3WDWA 4IL9A 2HEVF 3WHUA 4B4QA 3HVDA 2BYVE 2WZHA 2HPJA 1AVBA 2YGMA 4H3WA 1VRBA 4KG8A 4LHNA 2ZKLA 1K5MB 2XQ5A 3P1IA 3N5LA 3LFMA 2A6VA 2N7GA 1R082 1RUOA 4LLFA 2K3WA 4KI5M 2B9VA 1S0EA 2A3DA 4FT8A 4XHXA 4JC1A 2D6OX 5FL0A 1HQLA 1RIRA 1GP4A 3LEIA 3AE4A 3L09A 4O65A 5L3DB 3PMSA 1VBE2 4DR4T 1XDPA 2E33A 4Y4RA 3V0BB 2R071 5FZIA 4LEJA 4QXBB 1FT9A 3VBOA 2CLYB 3THCA 3GZEA 2PHXA 4DMWA 2X68A 1CIWA 4E4HA 2X0LB 3VHOA 1JOJA 3C98B 2Q8OA 1CQ9A 5F3CA 4D7TA 5A1AA 5TAOA 1O8PA 2IAKA 5C9AB 5BR8T 1VBA3 2ES0A 2XQAA 1NLSA 4BXFA 4E7SA 2OS2A 4CXWA 4S2DA 1MNEA 1QJX1 1Y4WA 4ZXKA 4NHXA 1DCSA 1I5PA 5CISA 3KVAA 1TE1B 1RXGA 4CCMA 1WMDA 4AI9A 2WQZC 2YBKA 4MXWB 1FMD2 4LBKA 4P9XA 3M4FA 2ZGSA 3AKPA 3ONLC 3PUAA 3RQWA 2AEYA 4LJHA 3UKTA 3ZYKA 1H6YA 4PIZA 1DHKB 5BY5A 1D0YA 4MGYE 1EZ3A 4B3NA 4AVTA 1J84A 1W8OA 4YT0A 1NYWA 2DU1A 1ZZ6A 5FYUA 2WIIB 1AX1A 2JDPA 1B35C 3WF2A 4MADA 3C8XA 1BXHA 4C0HA 1HRI1 4EEBA 1AR61 2VBBA 3AJZA 1HR0T 4MALA 3TBDA 1TME1 3WXPA 4COYA 1R1A3 3AEFA 1ZNPA 5A3LA 3K75B 3POJA 1K42A 1WMXA 2SPCA 2LOPA 3R6NA 5A3NA 3NJXA 2UXXB 3FJSA 4YHJA 5FPZA 3POWA 1ASJ2 1Q8OA 3IIAA 5JXGA 4XF0A 5DMYA 4E7ZA 2WNEA 1S2EA 1JU3A 3D0JA 5LBQB 3HMYA 2P37A 4LFBT 3LA2A 1IG3A 1QQP1 4KBMB 3VRAA 1YC61 3MUY1 2LSKA 1S0BA 2KD7A 2WJSA 4NAOA 3LEKA 3I2DA 3N9NA 2B42B 3VBHC 2EXKA 2YB7A 3DPRA 5FZMA 5GKAC 3CWZB 2W2IA 3WNPA 2W92A 5J2UE 4AKIA 3PJAJ 1UNBA 4RA0A 1SBDA 3HEIA 3NV3A 4AF9A 1MACA 4DUVA 4UYBA 1YD8G 1V6MA 4HWCA 3ACLA 4D3WA 4JI2T 5HXMA 4QMAA 2HHHT 2WS91 1YW0A 3OBAA 4EB6E 1RVF3 2OZ6A 2HN2A 3WCRA 3UTKA 4CN6A 4M00A 5AQPB 2VTFA 3SH4A 5I91A 3WP3A 2D0TA 1PZ9A 5FCCA 1BLZA 1JOBA 3I59B 1U12A 1V6KA 4RD7A 1R1A2 4KMCA 5C3PA 3UGHA 4R8HA 3BN6A 1VAMA 5A32B 1NT0A 3FZLB 5FRAA 3VDDA 3ZXJA 4YW2A 4QB1A 3I2OA 2X9XA 2LUWA 1G9FA 3CIRA 5KX5E 1CZTA 4AQFC 4GH4A 1DYOA 5FPXA 4N7UA 1EAH3 4JRAA 4YZ1A 3R05A 2YDSA 3MLKA 3JADA 5L9VA 2VVFA 5K7PA 4U2YA 2Y0IA 4KI0F 3RJRA 2HWB2 1HNZT 3TN92 2WSVA 4COZA 4RS5B 4FVVA 2GH2A 1YQCA 4OUEA 3L3PA 3IDBB 5DXDA 3R4UA 3PUZF 2HYKA 2DYCA 5FJHA 3T2QA 1Y43B 2EA7A 2C26A 3I2JA 1RUI1 3AYDA 4DXTA 5SV8A 2WNUA 4CP9B 4XF4A 1Y9GA 2VNRA 5L3EB 5JDLA 1GWKA 4NE9A 5D1IA 3EB7A 4XFIA 1RVF2 2QGSA 2HH7A 2V7LA 1JYNA 1N1SA 2WZPP 3JB4C 3IIIA 2Y8KA 3OUIA 3DKQA 5JZGA 5F5QA 3H3MA 3DF0A 4SLIA 1W9WA 2JG9B 3B01A 1W6NB 3GZAA 2WDBA 2JG8A 3OY8B 2PG8A 2B76A 2OKXA 3ZFGB 2CTVA 3MFAA 2WAUA 4CCLA 3E6BA 4IETA 1SBFA 3CK6A 3I97A 2F6BA 1CN1A 4KWLA 4Q0UA 3RYIE 2Q9QB 1XDOA 1UMIA 2NZ9A 4Q4W2 4MGKE 1WYCA 3AE5A 2QQIA 4YVWC 5JOZA 1I5ZA 4BQ1A 1FOD3 5FP7A 2P6HA 5L3GB 1UZWA 1JXNA 1OD3A 3MACA 3VBFB 1S0DA 4FQ4A 3UUMA 2IIUA 1ONAA 3I1AA 5FZEA 2E7AA 4GYSA 1RHI1 4DRRA 3KM5A 2EHOB 3V56A 5I93A 1FPN3 3ZFEB 2Y64A 1U5ZA 2ARBA 4NRPA 1VJ2A 4BWOA 5JREA 5EWSA 2XR4A 2CM0A 1PMHX 4PW8A 1AXKA 3LKJA 3I8TA 5FZ8A 3ILRA 3MZKB 1W0BA 2DU0A 2XWBB 4GWMA 4LMLA 2P9BA 2D5HA 3D4KA 2ZX2A 4DUXA 4CEWB 3ZSLA 3I3EA 2MBGA 3WG1A 3CHXA 4XYXA 1UY4A 4ZU4A 4DO0A 5BYNA 3SFEA 1LVFA 1DP0A 2M6IA 2VH9A 1BZWA 5JPMB 1XU1A 3RYFE 4AISA 4U33A 4Q29A 1N1VA 3UL2A 4IUGA 1JYIA 2OX0A 5BNPC 2ES3A 1OVPA 4QGLA 3O1PA 2VZVA 4MBQA 2LJLA 3PL0A 4FPLA 3SITA 2UXNB 4WM8A 3LEGA 5EP9A 3O1TA 3GBGA 3T0AA 3N9LA 1GICA 3ZOIA 3AE3A 3AVRA 3I7DA 2P4EA 5CIRA 1MZEA 4XUQA 3QK6A 1OOPB 1RUG3 3R0RA 2Y6XA 4P9IA 4ZU5A 2WT2A 4BLIA 1T6GC 2XBO1 4HSJA 3UU6A 5C8YE 1FEWA 3JBG3 1FATA 1NOVA 1JZ5A 2BZBA 1PIV1 2JD9A 1LOFC 3WNNA 3WF1A 2WWUA 3CX8B 3LA7A 4GJZA 4AI8A 2WQ8A 1LEDA 1GZWA 4SBVA 4ZPIA 2B46X 4BZ4A 1ND2A 3ZX7A 2JXAA 4TV8E 1QF3A 4AQGA 1N3OA 1RC6A 4K3UA 4AAPA 1NY72 4WZXA 2EIBA 4QHBA 4DNYA 4LF7T 3ZXFA 5C3RA 1KGYA 1E2AA 3UT0A 4WBOA 3UUNA 3Q5WA 2LHRA 4RFT0 4UV9B 4CDUC 5D8AC 3P4RA 5AVPA 4XBNA 5FIXA 5FPLA 1L7LA 4HFVA 3VBRC 2VZPA 3AE2A 1Q56A 2YEVC 2HWC1 2IW5B 4W6XA 2VMHA 2E6VA 2WN2A 3EDVA 3B9IA 4CDQC 5E6HA 2XKOA 1NG0A 1VB2A 5DUVA 1W28A 5HCMA 2NN8A 3PTYA 4QQHA 3AE9A 1T2XA 2ZHLA 4DXSA 5A3TA 4AG4A 1O3XA 5ISLA 2ATFA 5BPXA 1KXGA 5F7UA 4YSYA 3MIBA 2E31A 3BQIA 2Y34A 3U75A 5LHHB 1MZ6A 2JJ9A 3JBG2 2XUEA 4AHXA 3B94A 3THTA 2N9DA 5CB7A 2FBEA 2BGCA 3RF1A 2PLV1 5F3EA 1POV1 2F17A 2J42A 4R9AA 4MOAA 2VZ3A 3NNGA 1REEA 4IV1B 1ENQA 5FWEA 4MHUA 4X65T 4CEYB 4ITCA 4QB6A 4WM7C 2I45A 4V1PA 4HFIA 2RS31 3R4SA 2P1BA 4IESA 5FPAA 3KT1A 3V64A 1LR5A 3ZYLA 5KHHA 4HFEA 5K0UB 2NMNA 3LJCA 2DVGA 5DABA 3VBOC 3ZR5A 4CZSA 4JI1T 3NRUA 4IIJE 2DI4A 2HWD2 4Z1VA 3CMGA 3NJZA 4UBHA 4EGWA 4XQ4A 3BPZA 3MIDA 2BTVC 1O7FA 1W6MB 3HL6A 1G9BA 2HWE2 4K8RB 2CBJA 4H7MA 4KU7A 5FOBB 5EFUA 2R043 2W47A 4Q0QA 3U11A 4I50E 5FMOL 4Y5SA 2RS51 1D4M2 4FPCA 2I07B 3SCGA 1RUF1 1ZBE2 1KS4A 5KXBA 4GQ7A 4P0BA 1UPSA 5JI9A 3UK9A 3BU7A 4B3ST 1Z7S1 3LPFA 2C0SA 3C50A 3ETVA 2RDNA 4NRMA 3HKBE 4JRLA 4DV1T 4W65A 4YG3A 1LOCA 3ZFFC 2HLEA 4HONA 1VB4A 3R84B 1QXRA 4LF9T 2BEOA 2RHPA 3UT5E 3ZM8A 5H9QA 1ZZCA 4MHRA 1QJZA 1XWMA 1EPZA 1WMEA 3W20A 2VUDA 2PAMA 2DUPA 5LNKA 2D44A 3RDIA 2KINB 4AFBA 2A3XA 2A6ZA 1Y7BA 3AJYA 4LKEA 4JHTA 1IJ6A 3TNPB 2IXJA 4E4ZA 3SEPA 3SKJE 1C5HA 5LXTE 3CZJA 3Q9OA 1A8DA 2V6YA 4AKRB 2ZGNA 3P4SA 2XJQA 3I54A 3CPZA 2UXCT 4U31A 4KWKA 5K9YA 3ZMSB 1JH5A 3M3OA 2OYZA 1E5HA 5GALA 1NENA 4M1PA 4HG6B 2ZMLA 1D0XA 4G4FA 5JPNB 1BBT2 1URXA 3UU5A 1VBD3 3RKOA 4A97A 2DF7A 1J3PA 3NVCA 2WSSV 2FCUA 2BGOA 1G86A 3VHPA 1LGCA 2CSGA 2LE8A 5FO8B 1WCKA 3RYCE 1OMIA 3K4DA 3ZXAC 5DUWA 4DY5A 2DUQA 2DHRA 1VCSA 3DPRC 2ZM8A 1MS9A 4AEJA 4G9SB 3MYXA 2KXLA 1R081 1YEWA 3ON7A 4R9CA 2ZX4A 4E2SA 4LT5A 1PMIA 1YQ5A 1NQDA 2G9GA 1H8TC 4QPYA 3W9AA 4FAGA 2D6PA 3ZPYA 2JQHA 4S2GA 3AFKA 3SXWA 3AZXA 1VBE1 3J26N 3J7NA 2JQQA 1HRV3 2E8IA 1UKGA 2E9XC 3DEMA 1Q5OA 1ULGA 2GC0A 2YROA 3CBNA 1KS5A 4QPIB 4NVPA 1UCXA 1OH3A 2VOKA 4U72A 3D0TA 2XJUA 1NAFA 2CA5A 2PBIA 2WWJA 3OGSA 5FVKA 3HOBA 5LK7B 3H9AA 2VKDA 2L8KA 3RIUC 1VR3A 2FDFA 5KR7A 2LRPA 2ACZA 4BMBA 4QX7A 5LA2A 4HPKB 3O0VA 1W3VA 4EWAA 5JR9A 5GLTA 2AGSA 4ATFA 4RR3B 5DAXA 1VBD2 1W6QA 4AVCA 4GH4C 3ZYHA 4MGSA 3ANWA 1FMD1 4JGYB 5FP9A 2Y6JA 1RL3A 4YNIA 5LEKA 4JTOA 3THPA 2I2SA 1VBB3 4DR2T 4KMQA 5LA6E 5HEGA 3VKLA 1H1AA 1ZREA 3FBLA 5KXJA 3WEZA 1ULCA 2PFWA 1WWYA 2WZR2 1K45A 1N36T 5T54A 5HCAA 3WG4A 1QJU3 4IEWA 4KG0A 2WNUC 4XAAA 4K20A 1HRV2 4YRDA 5AC92 2WNVB 1JYCA 1H2MA 1YRZA 1UK5A 3MEPA 2YDQA 2LKHA 5CB4E 1US7B 3AZZA 2NW8A 4BA6A 4IE7A 4WVMB 5I8SA 3VHRA 1E5IA 1US2A 4CPBA 4X6RB 1RITA 2W1SA 4NPMA 4CE8A 5JUVA 5FV3A 4OLLA 4V2WA 1F35A 3RZZA 1HQNA 1QDOA 5JDBA 1GOFA 1ASJ1 1UKRA 1XSRA 3DTOA 5M4YA 2JG8C 2ZACA 5CAZA 2VE1A 2WBKA 4R4XA 2DCKA 4DV3T 1W2TA 1BVP1 2XAFB 3AMHA 3MF9A 2WQYA 4A42A 2MEV3 4QPGA 1GR3A 1OFNA 1QDCA 4YY3T 3O7OA 1XNKA 3JCIA 3RGBA 3HI2A 1RUE1 1U5XA 2RPAA 2VW0A 1QOTA 4JI6T 3TLSA 4RL7A 1J83A 2W87A 2KA3A 3AP4A 2Y38A 1UY3A 1JODA 4WVZA 4L0RA 2XJSA 2OT7A 3KQRA 1LNSA 1R1ZA 1LEMA 2ARCA 3ZYIB 1QJU2 2A3WA 5A6YA 2G9FA 1PK6A 1W8FA 5JSOA 3VR9A 4D7SA 1DGWA 3FXDB 1S0FA 4IEUA 1CGPA 3A7QA 2H6CA 3H1WA 4X5TA 1UZ0A 2JDMA 4Y4YA 5KWRA 4MUVA 1RYYA 3F31A 4W6WA 4JUYA 3SMHA 1W9RA 1YIPA 2WYFA 4MLKA 2YFUA 2M6BA 5FOJB 1JW6A 4NRQA 1W2OA 5C8CA 3AKRA 1D1AA 2CYFA 4EN8B 2Y48B 5J48A 4YGCA 1I9RA 1UMZA 5CA1E 3VL8A 5LCWL 2CWSA 4TV9E 4DR6T 1BEV3 1DZTA 2DVFA 1DQ5A 2GC3A 4CDXA 1W09A 2J62A 3VV1A 4PK6A 2D6MA 3FXEB 4UW5A 2FDIA 2UXDT 4TZDA 1D7PM 2MEV2 2D7FA 3P50A 4IDPA 1RUC3 3LIGA 3MW2A 2HEWF 4EEDA 2Q8EA 3C7HA 3H1YA 3IMMA 1U5IA 2HWB1 3TN91 4WM8C 2C9KA 5JQGE 4QPWA 2C1FA 1HNXT 1TEIA 4GOUA 4B7EA 3O1UA 3VHLA 4IDQA 2E5VA 4G63A 3Q5EA 4L5GA 4AKGA 2B5HA 1XBFA 1H2KA 2P3YA 1SLIA 5F5IA 5C71A 1V70A 1DYPA 2CRBA 4WZCA 1CR7A 3MA9A 1AZDA 4GWNA 2X66A 5DDJ2 4H2AA 3VD9A 4HWIB 1IBMT 5EZWA 5HV0A 3OD0A 2WWVA 2VASA 2ID4A 3CJIB 5F6LB 2CCQA 3B57A 4L0PA 2LS6A 2D98A 2YBSA 3U10A 5I0TA 2PTMA 2AYHA 3ZO0B 2A1XA 4ISSA 4QH5A 2ZX3A 4META 5HCHA 1OEDC 2IFWA 2PHTA 3OTOT 1YI7A 1BEV2 2G9ZA 5F5AA 3CU7A 4LBMA 2IXCA 3FHAA 3EXUA 2ZTNA 1XU2A 3VBSC 1FYUA 2XJVA 5F2SA 5A6QA 3QBQA 1RUC2 1FIOA 1K5MA 5I0UA 4A2UA 2WAOA 1KFYA 4Q4W1 2IVIB 2XONA 3PVNA 3GXUA 5A1FA 1SMVA 3ZPOA 4F6RC 3IHRA 3ZMVB 3WINE 3GHNA 1COV3 1YKHB 3A0KA 1R092 4OUSA 2HPLA 3JQXA 2NTXA 2O8QA 3RSJA 3ZYFA 3MGUA 5GM0A 3ZEFB 5FY4A 5HBAA 3ZXEA 1VAKA 3CQOA 3V0BA 5JWPA 3TYJA 3Q8BA 3WG3A 4QXBA 1PO22 3LDRA 4Q8KA 3VDDB 3N7KA 2WP9A 2VZQA 1Y3TA 4UFJA 4KGGA 5L73A 3PUXF 4C91A 2J1UA 2PHFA 4YLHA 2EIEA 5C9AA 2V5CA 4PIXA 1W04A 2VMCA 3H1MA 3HWJA 4XTMA 3TKLB 1B09A 4AI1A 3KINB 1HS7A 3B69A 2J1AA 5BNNB 5GONE 5AQJB 4HN9A 2WY2A 1UYXA 4CCDA 3RZMA 4FTEA 2YC2A 4LA2A 4XAEA 2JD4A 5FZ6A 1L7RA 2W0GA 3PDYA 4BDVB 4MHCA 3AAIA 4MXWA 2D3RA 2K2SA 4HKAA 3ELNA 1DF0A 4FPGA 3OBVE 2DURA 2LSGA 3ZMZB 3WUDA 2CDOA 3OB8A 4PLOA 4Y24A 5LB7B 2D9DA 2JWPA 1GYKA 2XHNA 5H6QB 4IQPA 2WA4A 2VBDA 1H2NA 4WVVA 3VZKA 4CCEA 1COV2 1OKQA 1NX9A 4LO5B 5FKYA 4BM8A 4I09A 1UY0A 1K12A 2FDHA 1YXWA 4LNVA 1OQ1A 2V7JA 4QH1A 1MVEA 2A3YA 4LULA 3CJXA 4CU9A 3POIA 2XQ3A 4CP0A 2CDPA 1UYYA 2BGPA 3WCSA 2YYOA 4FI5A 3KV4A 4CN1A 1PO11 2Z2SB 3BIEA 1AX2A 5FZ7A 3VR8A 2DNXA 3UU4A 4UWDA 1MIYA 3VZOA 1HG2A 2RS12 2QDRA 3GZTB 4ZI3C 3E6DA 4LBJA 2X67A 1ZBA2 3ECQA 4UAPA 3CQCB 1UMHA 3IWZA 3POEA 1HW5A 1NZIA 4XBLA 4L8QA 1NY71 1TQ5A 3AAEB 4TX5A 3I2FA 5JOXA 4KWUA 3USUA 4IEQA 2DFCA 1ZRFA 3LCPA 2VQTA 1CWPA 1F15A 3ZC0A 4RGAA 1XXNA 1W8ZA 1ND3C 1VMHA 2X9WA 1O5LA 2BNNA 3N36A 5EJZB 3SKVA 1NLRA 3ZN1B 5DG2A 1LKXA 1H1IA 3RMXA 1O3QA 5L4HA 1KDMA 3ZSKA 1NKGA 4J1XA 3RYRA 5LG4A 2R1BA 3MW3A 3N9MA 1NCQC 5DG1A 4YGEA 2Y6LA 3MUZ1 2ZHKA 1HG5A 2LALA 4H9SE 4DXZA 1SPPB 2B39A 3LQCA 4HEAA 2VQFT 1W06A 4L2NA 3A5XA 1LESA 4YW7A 1JZ8A 2CHNA 3CQGB 3ACIA 5JR7B 4GMP0 3VBUC 4UFHA 1LRHA 1YJLA 4Q4Y3 4AHWA 1AJKA 4FP3A 4UT5A 4OFGA 3FN9A 1XE8A 1Y9QA 4L11A 3CKHA 2BDEA 1LHUA 2ADDA 1SDDB 3FX3A 2BW8A 1WBLA 2CWYA 3KCXA 4Q5OA 5JDHA 1ZA4A 4MYEA 2JQKA 2GC2A 5BNOB 4YGDA 3FBYA 3HA4A 1DQ4A 3VKMA 1N47A 1BK1A 1BR0A 4XIOA 2A6WA 4H63V 5ABHA 5IVVA 1RMU2 4EN0A 1JN2P 3WD5A 3FMGA 1S0CA 4XJ9A 2IXHA 4KP3C 1BKZA 1CESA 3WDUA 3BYWA 2JEMA 2CL2A 2L3LA 3KZ4C 1UQXA 2NWBA 1C3HA 1KJLA 1W0AA 3NAPA 1G6NA 2YPDA 4CXYA 1DBNA 2HWD1 3POFA 4B4PA 5CFDB 4V1Av 4UW3A 1GWLA 5B4XA 3I49A 2HWE1 5IHRA 5LYJE 5CKMA 1CX1A 4O2AE 1VRH3 4YGBA 1TNRA 2B7YA 5DAQA 5JMOA 1WCUA 3SCHA 3J8F3 3T4HB 1YFUA 1HX8A 4YM3A 2BBJA 2C4XA 2D5UA 2EIGA 1GANA 1W2AX 3VDAA 4N9IA 4DR5T 1D4M1 4BH9A 3ESLA 2PHWA 2D2SA 1ZBE1 4K1YA 4CP9A 5K8SA 1CJDA 2JECA 3ZYPA 2VL8A 2WDRA 3WW3A 2VNGA 3MIGA 1RUH3 2UURA 3B5LB 3VU7H 1GOGA 2WN3A 3LGRA 1RUJ3 1YQ8A 3H8OA 4YW3A 4URAA 4D6SA 4IGOA 3DXUA 1MEC3 1UOJA 2WZEA 4UW4A 2ZEWA 2VOWA 4NPRA 5A3OA 1HDKA 2CPTA 4GKXA 3C51A 3DP7A 1SLCA 2DCZA 3A4UA 2JG9A 4H9OC 1W6NA 3RMYA 4K0UA 3E6CC 3OY8A 3AKTA 3M2MA 3ZCJA 1LHNA 2X5IA 2QTWB 3T0DA 1MS0A 4RN5A 1F9KA 2VURA 2WS3A 2AEZA 4OI2A 3DCQA 2Q9QA 5C4WA 1XSQA 2V7IA 1AYM2 2L9LA 3MKDA 2B9UA 4NIHA 3VD3A 3RI5A 4JDNA 1J5WA 4M4PA 1SUMB 4CQIA 1OC1A 4LF4T 2OZJA 5AQMB 2QQLA 3KMHA 5J0ZA 4HXCA 5FY5A 3J8F2 2VBPA 3H7JA 4AEDA 1BBT1 3P3NA 3HPNA 5LY2A 3VBFA 5EYXA 3FZ3A 4FJOA 1HXS2 3JAEA 2WR9A 3OYWB 2W1QA 5IVEA 1DDLA 1S55A 1KJRA 3URFA 1GQEA 2EHOA 4QPGC 3I0OA 2C9AA 3DYMA 3IDAA 2HWF2 3ZFEA 1MMNA 5ACA3 4K1ZA 3FL7A 3ABVA 1RUH2 1U5YA 3LSDA 3H8RA 4O7XA 4MLOA 1GOHA 2D6NA 2W2UA 4NN0A 2ORXA 1WD4A 3L39A 4HFDA 4AKLA 4Y3OA 3WOGA 5F3JA 3H0OA 3ZDSA 3KHBA 2VGDA 2KM2A 4LBQA 4JI8T 1PK6C 4CEWA 3UKVA 3AA7B 1NA1B 1GFF2 2I59A 4X20E 5H9PA 1ZRCA 2CY6A 1DLLA 4JLEA 2W08A 2E7TA 1IS3A 5AQLB 1NAEA 3AL6A 3FUOA 1QIQA 3NJYA 5A3WA 3U07A 5EYYA 1X8EA 5FYVA 3DYOA 4P9GA 2XASB 1Y01A 5LBCA 1UIKA 4GWIA 4OHZA 2VW1A 2VY0A 2D43A 2VQ0A 4YG0A 4GWJA 5C8CC 2VPVA 1F5JA 2MPKA 2A6YA 3ME2A 4M3CB 2R0FA 4ZZ8A 2AH2A 1AR92 3HN3A 2XSBA 5FYBA 2E53A 4X1KE 4TNWA 1BQPA 2JMKA 2J1SA 1JYTA 2OVUA 4IE6A 3ATGA 5HWYA 2J4GA 2G0UA 2C5DA 1W3XA 3E5UA 1PGL2 5ACA2 4ILUA 5AQTB 3T1HT 4CCJA 4A7KA 3R6SA 3M70A 2JB8A 2ILMA 1HN1A 5F6KA 3JD73 1UWWA 4HSLA 5JDMA 4YW5A 1GNZA 1PMJX 5KC5A 3UFGA 5FWJA 3CO2A 1ZV4X 3EDUA 2PXJA 3AMNA 5JR2A 1APNA 1LGBA 1VCTA 2WZR1 2BWCA 1O4TA 2DCTA 3TEYA 5A1LA 1PGSA 3SOLA 2VAUA 1QXJA 4HN0A 4UOJA 4OHXA 5L36A 3WHTA 5AC91 3HR0A 3S5AA 3A7MA 4YPJA 1O4YA 4Q4X3 2EIDA 1ENSA 4PAGA 2WRAA 5LRSA 4KUMB 2XQYA 3NWIA 5D8AB 4DB5A 5FLIA 3VBRB 2GZWA 4YLZA 1W8NA 3KT7A 1R64A 1OURA 4H9QC 2PHRA 2EAKA 2JDUA 4HKOA 5E89A 1XNQT 2RM21 3PDQA 2CMRA 4WBBA 4M0NA 1ZM1A 2X9HA 1ZX5A 5M0TA 4DVDA 3W21A 1ULOA 4QXCA 3AEEA 4X8NA 1F8VA 1OA2A 1YI9A 2BKPA 4XBQA 2BUKA 3CX7B 1K5MC 1X50A 5FZ3A 1X7NA 2VR4A 1LU2A 2P34A 3PUSA 3AXJB 1TG7A 2X09A 5HCJA 4IV1A 3AA6B 4XILA 3RIFA 4ERRA 4S2FA 3WSOA 4YZ5A 4FPFA 4QX3A 3BCWA 4QGMA 2ET7A 3IAPA 5K0UA 4GIWA 1HTJF 1C28A 2GP5A 1DLCA 2QCSB 3AZWA 3HAGA 5FZDA 5AQVB 1RJ8A 3Q5XA 2VCAA 2Y6GA 2CWOA 2GNDA 4NOTA 5JR9B 2E51A 2GMMA 4ASLA 4PHZA 4AVAA 5C9AC 4WV8A 2QQOA 1UF2C 4U7YA 2H6BA 1W6MA 3GBWA 3LK2B 4ZI3D 2E32A 2NPIA 3AK0A 4XFBA 4PFOA 5J96B 2K24A 2BKNA 1CZVA 2R16A 1GUIA 4ZI7E 3ZYJB 2JE8A 1ZRDA 4HANA 2JIJA 1EP0A 5BMVE 2WU5A 3P3PA 3WDTA 3WAJA 3H37A 5AQGB 1MMDA 2J1TA 1LU1A 2P3KA 2ODVA 3FFQA 4LKFA 2ZOEB 4DFSA 3OKQA 1TMF1 2QQWA 4LBLA 1VPHA 4TTGA 2GP3A 5DQWA 4ZXEA 1SEFA 4CXXA 2N2NA 3PVEA 3IKWA 3M3CA 4QKFA 4YZ3A 3OPWA 5KC6A 5A3PA 5ANNA 2LRLA 2NLRA 4Q25A 3A22A 2WFF3 3MO4A 3ASIA 3OBZA 4QAWA 4BQWA 1UUSA 1NQJA 3QOPA 5DDJ1 4BK5A 1YQ3A 1W0PA 3WP4A 2VVSA 4YJ2E 3MLJA 1OQEA 3VD5A 2XUMA 4JKMA 2Z4FA 3NV1A 4ZS3A 5LBMA 4LF8T 3UESA 2DTYA 4K7JA 1UOBA 4INDA 3U4XA 5DJQC 1OPMA 4EV0A 5I0DA 3E1F1 3DJBA 2TEPA 2R6QA 5ABGA 2BG9E 2VM9A 3KLSA 1UPIA 1VP6A 1BK0A 4AK3A 4YM0A 2TBVA 4Y20A 3EO6A 1KFXL 5A3MA 2ZBJA 3NW4A 3OYXA 4QDQA 1FNZA 4JYAT 3K3QC 1W03A 1FI2A 3INAA 4A7ZA 2XWJB 5FZGA 3ZC1A 2JE9A 4IV3A 3QB5A 4ILBA 4NWWA 2AE9A 2KXPB 5T55A 1OUXA 1R091 1XNBA 1NLQA 1W9FA 4NAMA 1M7KA 3OVUA 2GMEA 1N34T 3WDYA 4BIOA 4IEOA 1AR83 1TZOA 4CU8A 3C2UA 2UWCA 1PO21 1L0VA 4JI3T 4ES9A 5L19A 4CDXB 4H63H 4O4JE 1KNZA 4I02A 3I4IA 2ZGRA 2RP4A 3RJ2X 5L3BB 4NUVA 1OSGA 3KSCA 5J2TE 1RUD3 5FP4A 3ZJ2A 2J7MA 2QZ2A 5DPNA 2V73A 4Q2FA 4RR3A 4YTMA 3M65A 4TWFA 4AFAA 3HT2A 3WNMA 2IFRA 4BQXA 4N43A 1V6OA 4X1IE 4JGYA 3MDPA 4LHLA 2R063 1O5UA 2O1QA 2ZM2A 5T3NA 1I94T 1REDA 3POGA 5TSWA 4YZ2A 2UY9A 4IEZA 4JHZA 3E5QA 5LBEA 4CPBD 1J1LA 4E2QA 4RS5C 4H14A 2W67A 2Y0OA 1V6NA 2Q8CA 2VCMA 1AJ3A 1OKOA 4CDWA 4YW4A 2ZHMA 3L2YA 5FY9A 2ZGMA 4TWTA 3B3QE 2K5BB 3MV11 1DGRN 2JQ9A 2DVAA 2RMU1 3C7GA 3MW4A 1QJY1 1AR82 1WW4A 4U2AA 1XOYA 3ILFA 4QX1A 3C64A 1IS6A 2WNVA 1HLCA 4DS0A 1AF9A 1PVXA 3GF6A 5ABFA 3VDCA 2R073 2IC1A 2LSYA 1SLTA 4LO7A 2RS11 4WVMA 1BR4A 1AL22 1CPNA 1DQ2A 4E8CA 2ARXA 1ZBA1 1OF3A 4KU8A 5IVYA 2ZLYA 1RUD2 3IBPA 5FYCA 4GAZA 5IVFA 2BQPA 4JQRA 4A44A 2JG9C 2LM3A 1V00A 1IKQA 1GZTA 3ZFGC 4GIQA 2RVAA 1D2QA 1QJX3 3N7MA 3U0ZA 1LB2A 1XPWA 2XZEA 2R062 1POQA 3C7EA 1K5JA 3BQKA 1S4CA 5LASA 3OCPA 2P2KA 3ZYGA 1MPXA 2WO7A 1AHSA 4P5YA 4FOQA 3QLQA 4PK4A 4TNVA 4AXOA 1LODA 3GDBA 3DUIA 2QQMA 5H9RA 3NMBA 4PI0A 4BQYA 2X53S 1Q8QA 4LKDA 1PZ8A 1V9U1 5LB6A 3MIHA 4MGTA 2W39A 2EHOC 3AEAA 1XZYA 3H8XA 4UR9A 5FAXA 2RR12 4EJRA 5JOYA 3ZFEC 4ISRA 5A7QA 1YWKA 2TUNA 3VD4A 2BG9A 2R072 5CFBA 4GD4A 2NMOA 2VL0A 5DZFA 1W0OA 3HD8B 2R30A 1HRI3 1SBEA 2RJLA 5IT6A 2AZ5A 1AR63 2ZEZA 2F4LA 1AXYA 1RMU1 1TME3 4E4SA 2PQQA 5HXSA 1UX5A 4DUWA 4XJAA 2XDVA 1LGNA 4CEWC 4UFIA 4XZPA 3RC3A 4FPEA 1OHFA 1QJX2 4XPVA 1JZ4A 3GA8A 3HQRA 1GMMA 5KDMC 3HNMA 2XAQB 5FZ1A 4NUUA 4S2HA 2IC9A 2ORZA 2OUJA 1GP5A 3PE0A 5LOVE 4GMP1 1QQP3 3CNAA 1YKEB 3EABA 1OVSA 1W05A 1UL9A 3J9SA 4FFIA 4HN1A 2Q1ZB 2QJVA 2PJQA 5IW0A 4WYVA 3GALA 3ZXKA 3EHZA 5KHIA 1VBA2 1C8M1 3TNQA 1OOPC 2Q1MA 1SA0E 4RGGA 3O0WA 2V6XA 1S94A 2YU1A 3F2EA 2JDZA 4YZ4A 1LULA 2W3JA 1GZCA 4AFDA 1NXMA 2XJRA 4U36A 3VKFC 3USUB 3MIFA 4AIUA 1W2NA 1M4WA 3FHQA 3F57A 4P9YA 1Z78A 1XNRT 2IZWA 5F8PA 2KSRA 1IG0A 2LRKA 2WS93 2WAAA 4HWFA 3PJAA 1E7PA 2NW9A 3CJIA 1V6JA 2CAUA 1HRI2 3ZMOA 1C1LA 4O4IE 1AR62 2E9QA 2WO2A 1XMQT 1Q8PA 2VVEA 1VBC1 1WLDA 1MS1A 4X1YE 2RJ2A 2Q1FA 5FY8A 2MHFA 3CIHA 5DAPA 5JIUA 4DV6T 1OXCA 3A21A 3NZQA 5J7MA 3ONXA 3S7IA 1H7CA 1QMJA 4TWHA 5IATA 3WV6A 4ES8A 2Y6HA 4XUNA 1AYM1 1Y64B 3MI8A 5LHGB 1UAIA 1SQ4A 1JOPA 4JI5T 3VBSB 2PN5A 4OMCA 2WZ8A 4K21A 3BKZA 2A6XA 3BPSA 3LE0A 4OMDA 4CCCA 3IBMA 3EVYA 2M67A 4UVBB 3I9YA 2VO5A 3E0ZA 4MH0E 2QA7A 5HEJA 1HXS1 4GKYA 2FMDA 2VG9A 4D69A 5DZGA 4AI6A 4Q1RA 2VC9A 4OYUA 3HR9A 2LEHA 1J58A 2HWF1 3FUQA 4BPZA 2UYBA 1QKQA 2E2AA 1RUI3 1RUH1 4DRVA 4XZCA 3VLBB 4UF0B 2D5FA 3IDEA 4N53B 5F37A 1RUNA 2FJAA 2V5DA 4LUKA 3V0AB 3NAPB 3AYCA 4IV1C 1XYOA 4G3YC 4CEYC 1OXZA 5JDGA 1IPJA 3EI0A 2WQ4A 4ET7A 3VB9A 1TNFA 4CSWA 1ALYA 3G06A 1SCSA 5BNNA 5IYYA 1O59A 3ZKYA 5CFCC 4AAXA 4PFPA 1CAWB 2Q30A 5FLHA 3Q8AA 3SS1A 5FZOA 1C8NA 1QLBA 4XBFB 2BBAA 4TLGA 3JB8A 4DV7T 2VJXA 5AQKB 4JX0A 1UO9A 2Z6EA 4DBQA 5FZCA 3FWEA 4XUOA 1NWMX 2IC6A 2TNFA 3NL1A 2W68A 2XMLA 2WINB 5I0RA 1GQGA 1Q8VA 5CU1A 1WLWA 4LA3A 3NNMA 1W6PB 3I3MA 1S2BA 3PURA 2D40A 1AR91 4UXAA 2BERA 2Y8DA 3RQUA 2VXJA 3ZIXA 3MV01 2R6GF 1VMFA 1EV11 3KGLA 2XH6A 5LW9A 3L8RA 1JZ3A 1PX4A 2O14A 1QGLA 2ZGPA 3NRYA 5H6RB 5F5CA 4J1WA 1W6OB 3HQUA 3LK42 2EF6A 2XM1A 1HN0A 3EQEA 1RUI2 1UZZA 2LSIA 2UUCT 5G04L 1WBFA 4TN7A 1RHI3 2J22A 3Q2MA 5IK4A 2X5IB 1MS8A 4LO8A 4BOWA 4HVQA 2WO3A 3X1DA 4LHSA 2JICA 4HKLA 3LB9A 5JVDE 1EAH2 1NUKA 4XFCA 5C4WB 3S30A 4PQQA 4I0WB 2V1DB 2QQJA 5CVRA 1N3QA 4XFAA 2PAKA 3N7JA 1N3PA 3ZN6B 1R8IA 3C3VA 2W46A 4CCNA 5JXIA 4N8MA 4QQPA 4K8FA 4O4HE 4AEDB 5FPBA 1N32T 3RYKA 3OPTA 4B4RA 1NXD1 3DN7A 5FP3A 3AE1A 3O1JA 4OQ9A 1D1CA 4BMEA 3J9X1 3C4WA 2UUBT 1NCRC 4NJ4A 1SPPA 1PVC1 5F1RA 2PHDA 1MS5A 1QOOA 4L9BA 1JZ7A 1MR5A 2HH9A 2ZGTA 2C24A 1ODNA 2YK0A 5T5LA 1UGOA 1QXPA 1KDKA 1JU4A 5C3QA 2OQ7A 2A72A 1XNDA 2ODUA 5LA0A 4CUBA 4WVWA 1GBGA 4V2VA 3K48A 4IEPA 4B3RT 4LBQB 3GM8A 1DU2A 4OZXA 4XACA 4PJNA 3CEWA 1WCDJ 4YXDA 2UXBT 3IT8A 4M3CE 4HFCA 4P14A 1RHI2 5BNOA 5F3GA 4HBNA 2LTNA 1QH6A 4FFGA 2QQPA 1F31A 2XBO3 1XNAA 2ZGLA 4LK7A 4GYRA 4W50A 3MPBA 1OQDA 4EYYR 3KCCA 4XOGA 1XE7A 1DZQA 4GB31 2BVMA 5G05L 4QM8A 5A3UA 3IM0A 2ZM0A 5ETWA 1JYVA 4LF5T 1UX4A 3RPQA 3ZYRA 1FOD2 1YO8A 4LBOA 4QPIC 2JE7A 2X0YA 4AGRA 3WG2A 2RG4A 5CFDA 4U7IA 1ZP0A 2IXIA 1H4GA 4XURA 4L97A 4IE5A 4Q8LA 3JU9A 5FUNA 3N7LA 4AQFA 4AI3A 5GLZA 4QX0A 4HT1T 1FPN2 2HWC3 4YM1A 3NV4A 2JDYA 2EICA 4D6RA 1QJEA 1X79A 4QXHB 4XCAA 5FO7B 3K4AA 3WW4A 1ZEEA 4X8PA 1F4HA 4A3ZA 4MFRA 2QZ3A 5CKQA 5CA0E 1YQ2A 4CI3B 2VUCA 3A8YC 4I43B 5IWAT 5T52A 4JGYC 1DQ0A 4ADZA 4YSFA 3PUYF 2W1UA 2XB6C 4YSZA 4GKKT 5FK7A 4Y22A 3UQ7A 4DEQA 2Q9QD 3ZKUA 2KLQA 2BOJA 4AW7A 4KGQA 5D2AA 4F8AA 3PIGA 1XB9A 2A73B 4QX5A 1BR2A 4UELA 3LPGA 3IZOA 1IQAA 2JKXA 2HBUA 4C0BA 2PLV3 4ZONA 2XPJA 4ZZ5A 1H0BA 3NSTA 1REFA 3BI3A 4BU2A 1IJ5A 3TEWA 3OYZA 2G19A 4BLJA 5A6ZA 2DV9A 2RS33 4XC9A 4M3CF 4B7KA 2EHOD 5DUUA 1YFXA 3D5OA 1VOMA 2VVNA 2DLRA 3DKWA 4P9JA 2X05A 2Y26A 1UY2A 3PUIA 4A5XA 1RUG2 1JUHA 3ILNA 4HETA 5CG9A 4QXCB 5FZHA 2ZMKA 1I6XA 1J59A 4AZZA 4LPLA 4E4DX 4OZOA 1X8MA 3SH5A 2UWBA 3POSA 2ZAAA 5FBJA 4Q4V1 2A7AA 3P4WA 4LBQD 4YVWA 2J1EA 3OYWA 2BWAA 4YARA 5C3JA 3AM2A 2W91A 5C6CA 4KHZF 4CRQA 2FDGA 5C8WA 3FZHB 3KV6A 1GLHA 4A41A 3LSVA 5AFEA 2EAAA 2LM9A 1P8JA 3BK9A 3GHMA 1ST8A 4DXRA 4JGZB 2BRTA 3PVBB 2RS53 1RUF3 1SFPA 2MOZA 4NHMA 3Q8CA 4X66T 3RI9A 2ZABA 3P7IA 1HV1A 5IK8A 2W0XA 1KFUL 4JTNA 4EYUA 3WDXA 2D0UA 1VE0A 4YJ3E 4X6QB 1Z7S3 4LO6B 4DNDA 1AXZA 5LATA 1ZZ7A 2XVKA 2PLV2 1JYXA 3S57A 3PV0F 3NBXX 2IUWA 4GKJT 2VXRA 4N90A 4RHV1 1NA1A 2QQKA 2RS32 3NV2A 1Z0PA 2FZ1A 2Y60A 4JCKA 3MFCA 4YSXA 4PDWB 3DYPA 1SE7A 4QXKA 4PJYA 2GNBA 4DUYT 5IVJA 4FXKB 5GLWA 2EXHA 3ZDVA 4GK0E 3RZLA 2BVBA 4ZXLA 5JI7A 2XVGA 3RH3A 2A70A 3OGJA 1F4AA 3NJVA 3AP6A 4M3CA 2MNGA 1D2SA 2BNMA 2PQSA 5LWBA 2WMOA 5CG8A 4BHPA 1XQNA 1M62A 4QX2A 4C1WA 4UEMA 2JIWA 4BAYB 1A34A 4C1XA 3O1RA 3JC6C 1WGPA 4XQWA 2WBLA 4FCAA 3JQWA 2QQVA 3GYDA 3ZYMA 5FXWA 2BFUL 4MX3A 4YVSB 1YQ6A 4ZKTB 3K51A 2ZJCA 1J5ET 4DV2T 3VKGA 1AYN1 3J7LA 4IDNA 3WQBA 1CAVB 2VZRA 4IEXA 1LHOA 1LOFA 3UULA 4QQLA 4ZS2A 4XJWA 4XETA 4CP2A 4XHBA 1NE4A 2OPWA 3MHZA 4YG6A 5IAXA 1F5FA 1JMUB 2V7MA 1D4VB 3ES4A 1WLTA 5FYZA 5L7OB 1R083 1AR81 4COUA 4A7YA 2VTXA 3SEEA 1OT5A 4Z82A 1S0JA 3WNLA 1LJ7A 3KD4A 3OBRA 2H88A 3S6PA 4LMKA 4AFCA 2PMWB 1VBE3 2R042 4AEMA 4IW3A 3K2OA 3ZXDA 2ZA9A 3K1SA 4UV8B 2X8KA 5JDFA 5D8AA 1AL21 1H4HA 2VZUA 2QBXA 1LAJA 2VTXJ 4Z07A 3WDVA 2VZSA 3VBRA 4OUMA 1EY2A 1CZSA 3U37A 4FPHA 3TRSB 4Y20B 4J2CA 3FFZA 2WM9A 2YKSA 4CDQA 5CGMA 2VOVA 4DMVA 3ZJ1A 3N9PA 1BHGA 1DGWX 1UX6A 5J1XA 1Y9MA 2XQ7A 4DY3A 4A45A 4IV3B 4LKSA 2A5ZA 2AR6A 1ZYBA 1KF6A 3RPUA 4NPPA 3MBWA 3T30A 4Y26A 5HCFA 5L9BA 2GN3A 1BMV2 4LOSA 5FZ4A 1FMD3 4RQPB
chains in the Genus database with same CATH topology
1D1AA 5K4LA 4D6RA 1HG5A 4LIVA 2Y48B 5FZ9A 4UXNB 4H9SE 5FY8A 3PUAA 4CUGA 5JDMA 5CA1E 1X79A 4JEUB 3IEEA 4OFZA 2K48A 4QXHB 3AVSA 4TV9E 5JR9C 5ADXL 1G8XA 3DXTA 5LNKA 1ZEEA 4EXTA 3NZQA 4YFSA 3ZYKA 2KINB 4HEAA 4MFRA 3ONXA 1H7CA 3N9OA 3A5XA 1D0YA 4H63H 4O4JE 5FWJA 1EZ3A 2WMNA 3LK3B 5FMNA 1ZV4X 5CA0E 5JREA 1KNZA 4LXLA 2NTYA 3EDUA 4PK6A 2PXJA 3FXEB 4CI3B 5CEHA 2CM0A 2KMFA 2RP4A 4ZOLE 3ZN0B 2N1GA 3CQGB 4I43B 5J1GA 3V5UA 4NUVA 5L3BB 4PW8A 1IJ6A 1MMAA 4PNIA 3ZCIA 4ADZA 1Y64B 5J2TE 5FZ8A 5A1LA 5LXTE 3SOLA 2XTLA 5L2LA 4TZ4C 3HKEE 3MZKB 5LHGB 5FP4A 4AKRB 5A7OA 2ACXA 3RX6A 3SWHA 3UUXB 4O4LE 5FUPA 4JEHB 5FYUA 2BDEA 4WBNE 3GMIA 4QWNB 2P9BA 2CLYC 4U74A 2Q8EA 1QSDA 4H9PC 3CPZA 5LJNA 2Q9QD 2KLQA 2YU2A 3ZJ2A 5IWFA 3ZMSB 4C90A 3I9WA 2XAJB 2JRKA 2CWYA 3NZPA 3PU8A 3HR0A 4TUYE 2W62A 2LT3A 3EVYA 5JDHA 1BR1A 2M67A 4UVBB 4CI2B 4M1PA 1S35A 1WLXA 3I9YA 3M65A 3E0ZA 2MBGA 3FBZA 5JQGE 1D0XA 3PUGA 5FPVA 3MXZA 4GJYA 1BR2A 2W63A 4UELA 2QA7A 3HA4A 4GK5E 4GOUA 4QX8B 5FPUA 3KVBA 3VHLA 5FY0A 4MALA 4PAGA 2Q9QC 5HXRA 4X1IE 3RKOA 2CXLA 4DO0A 4L9IA 1BR0A 4KUMB 3CQXC 4G2AA 1WYBA 4G63A 1LVFA 2XQYA 4H9NC 2KZ7B 3Q9DA 4H63V 2OQ6A 2WSSV 4AI6A 4L5GA 5IVVA 2C5KT 4OHFA 4AKGA 4CCOA 3RRCA 2CXDA 2LEHA 2LE8A 2SPCA 1FMWA 2LOPA 3LBXA 2ZM2A 4BJMA 4P0AA 3RYFE 3R6NA 4CZZB 5A3NA 4D6QA 3RYCE 2UXXB 4BU2A 5F5IA 2OX0A 5IVBA 1IJ5A 2VK9A 3OYZA 4YHJA 4KP3C 4XZCA 4ANJA 4UF0B 2YBPA 4MBQA 2LJLA 1IZNB 2EHOD 5HYAA 2DHRA 2UXNB 3MA9A 4H9QC 4O8SA 2X51A 4HE8A 4E7ZA 2L3LA 2ZM8A 2Q8CA 2X66A 5F37A 1AJ3A 5LGNB 2NWBA 3BQLA 3PDQA 2NOXA 1VOMA 2ZMAA 4HGAA 2CMRA 5FY9A 2XHEB 5LBQB 5F3IA 5JDNA 3N9QA 2YPDA 3KV5A 3OJAA 4CXYA 2DLRA 3N9LA 3ETUA 4I4TE 2X9HA 2VASA 3C4XA 2K5BB 3VKHA 1OXZA 4DVDA 4XAXB 5JDGA 3ZMTB 1MIWA 3LDBA 3CVRA 5FXXA 4CSWA 3AL5A 2CCQA 4ZI2D 5FZKA 2LSJA 3AVRA 1E1HB 3EUHA 1LVKA 3B57A 4KBMB 4QXCA 4V1Av 3O4XE 4QXCB 1D1BA 2E9XD 1B7TA 2V7KA 2LHNA 5FZHA 3AA0B 2LSKA 3JC6D 3N2KE 3QK6A 3O9XA 2YBSA 4PFPA 2Y6XA 5EZYE 3WAJA 4Y33A 3C64A 3C4ZA 3CX7B 4OYJA 4ISSA 4AXPA 5LYJE 5L3FB 4O2AE 5FBJA 3N9NA 1MIVA 2VKHA 2H7OA 4WNKA 3SS1A 5C8YE 3U3IA 2JQQA 5FZOA 1FEWA 5FZ3A 4QHOA 5FZOB 1KK7A 5FZMA 2E8IA 3CWZB 4ZI2C 2W2IA 2BZBA 3E22E 4IE0A 4XBFB 3N2GE 3K8PC 2E9XC 2WWUA 3HKDE 4N78D 5J2UE 3PUSA 3WAKA 5F5AA 3CX8B 4AKIA 4GJZA 1MMGA 2LSYA 4H9RC 1HX8A 3GN5A 3MJXA 3AA6B 1BR4A 5IYZE 2Z6EA 4DBQA 3NRXA 5FZCA 4ERRA 2D5UA 3LG7A 1CUNA 3KV6A 3MK7C 1NWMX 3UYJA 2IC6A 3PTRB 5DQVA 5LY1A 4U72A 2XMLA 5FYYA 1YD8G 2LM9A 3ESLA 2MTQA 3D0TA 1NAFA 2CA5A 5F2SA 2D2SA 3BK9A 5IVYA 2ZLYA 2PBIA 5FJKA 3IBPA 4TV8E 3RYHE 4AQGA 4ISTA 4HOOA 2WWJA 5FYCA 4GAZA 1FIOA 4AAPA 2VL8A 5IVFA 3PUQA 4DIQA 2MOZA 2VKDA 4GIWA 4PJJA 1HTJF 2L8KA 3PURA 3IF8B 4WW0A 2GP5A 3P7IA 5KR7A 3VU7H 1YW0A 4EB6E 4QX7A 4WBOA 5FZDA 3UUNA 5EK3A 3UTKA 3I0QA 3Q5WA 4BA9A 3Q5XA 4EYUA 5LGUB 2Y8DA 5A1FA 2D0UA 2CWOA 5JR9A 2LHRA 5JR9B 3ZPOA 4YJ3E 4F6RC 2D0TA 2KT9A 3IHRA 4UV9B 5L3CB 1UCUA 5LHIB 3ZMVB 4IGQA 2CXFA 3AB3B 5FPLA 3U78A 1YKHB 4HFVA 4ZHQE 4URAA 4DNDA 2XAHB 4D6SA 5LW9A 5JH7E 2HPLA 3P8CD 4IGOA 2NTXA 3DXUA 1U4QA 4UIGA 4KMCA 2YEVC 3NRYA 3ZEFB 2IW5B 5H6RB 4PJMA 5FY4A 5HXHA 4LIUA 3ANWA 3E08A 3BQKA 5FP9A 3NBXX 5F5CA 3LK2B 3CMLA 3EDVA 2H3RA 5ANQA 2P5BA 4ZI3D 5A7PA 3LK42 3C51A 5IVCA 3DP7A 2L9QA 5E6HA 4QXBA 3LBXB 4H9OC 4PFOA 5AFUL 2K24A 2LSIA 4K0UA 1Z0PA 4BISA 2DCFA 4I55E 3K3NA 4PK4A 4TN7A 2CEAA 4TN7B 5LA6E 5A7NA 3ZCJA 2X9XA 5LJMA 3Q2MA 2JPFA 4C91A 5A7WA 3V5SA 2C5IT 4ZI7E 3CX6B 1IAPA 5A3TA 5F39A 2V26A 1O3XA 2KNDA 4LITA 3FBLA 5ISLA 4YLHA 5IVJA 5BMVE 3U4SA 5KX5E 3SRZA 4GK0E 5FY7A 5JDQA 4AQFC 5JVDE 2Q9QA 4O2BE 3AAAB 3RH3A 2V7IA 3TKLB 3W15B 4CI1B 4ASKA 5FYSA 3HKCE 1U5PA 5A7SA 3KDSE 2KWIB 3H37A 3MKDA 3ZLIA 3KINB 2VKOA 1MMDA 4B6XA 2EHOC 3BQIA 5EK2A 2V1DB 1HS7A 5LCYA 2ODVA 4Z8XA 5GONE 3RC8A 1MNDA 4IGUA 4HN9A 4EOZB 5LHHB 5A7QA 2JJ9A 4XDPA 4EIWA 5FYHA 2PFVA 5F32A 5LWBA 2WMOA 3OKQA 4CQIA 2XUEA 2YINA 4PJLA 3RRWA 2MYSA 1T98A 2N9DA 4CCNA 4OK0A 5FY5A 4GD4A 2GP3A 5DQWA 5EK4A 5FZFA 5FZ6A 4O4HE 4CXXA 2N2NA 4UEMA 5FPBA 2W0GA 3KBUA 3N2OA 5FXVA 3PDYA 4BAYB 4BJNA 4EAHA 5LP6E 1HF8A 3L3PA 5F3EA 5CB4E 1US7B 2C5JA 3OPTA 3JC6C 4MHCA 5LY2A 4FJOA 2NW8A 3AAIA 2XXZA 3KBTA 3KFWX 4IE7A 5FJHA 5IVEA 5FWEA 3GN5B 5KMGP 3K3OA 4HKAA 5FP3A 3O1JA 3OPWA 1D1CA 2WBLA 3OBVE 3WI3A 2EHOA 3J9X1 5A3PA 3C4WA 2LSGA 5F2WA 3I0OA 5HXSA 5FV3A 2DWKA 3LD8A 5JRCA 1UX5A 1MMNA 3ZMZB 3ZYMA 5JRCB 4V2WA 4UVCB 5FXWA 5FPAA 5LGTB 2HPJA 2XDVA 4QXHA 5FP8A 1VRBA 3ZYLA 4HTEA 5L3EB 3RVHA 5JDLA 3RC3A 2QGSA 4EZHA 3FHNA 5FZ0A 1WR6A 5H6QB 3VKGA