4ILUA

Crystal structure of mycobacterium tuberculosis card
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
165
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALADAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase-binding transcription factor CarD
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 45
structure length 165
sequence length 169
ec nomenclature
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4iluA02
2LT3A 4KMCA 4L5GA 4XAXB 4MFRA 4KBMB 4ILUA
chains in the Genus database with same CATH superfamily
2V1DB 5HXCA 4ILCA 4U2ZA 4HEAA 2YU1A 3AE5A 3N9MA 4L9IA 4DV3T 4AIUA 3UU8A 4JI7T 2W61A 4ZXLA 1XMQT 3HL6A 4QX8B 1E1HB 2YN6A 1E7PA 5JDHA 1OEDB 3WAKA 4CN6A 4M1PA 2H88A 3O1HA 4AKHA 5L2LA 4JEUB 3AA0B 3UUMA 4A5XA 5AQPB 3A8YC 3AE2A 3QNUA 4X1YE 5DQWA 3FZMB 2W00A 5ABHA 2W2UA 3N9LA 3NVOA 2V7JA 3GWHA 2ZMAA 1N34T 2DLRA 1XDPA 3OJAA 1UX4A 3ZC0A 4E7SA 5LGNB 4ISTA 4BA9A 2BDEA 3ZCIA 2CLYB 3ZT5A 2KT9A 3H3AA 2X9XA 1HNZT 3QK6A 5H6QB 4BAYB 1CUNA 2KWHA 4I0UA 4P09A 1JNZA 1NENA 2YU2A 1OXZA 4IDQA 2ODUA 4X62T 3CQXC 3H37A 3SFEA 2XQ4A 2DWGA 3ETUA 1J5ET 1FEWA 4DNDA 2KSRA 2Y8DA 3NBXX 1WYCA 3WAJA 1Z8UA 2WMOA 3Q9DA 4O4IE 2LOPA 4JI1T 4DR6T 3UFEA 2OA5A 2L9QA 5ABEA 4TWHA 5AQGB 1WFDA 4UELA 2DWKA 3DJBA 3ZMSB 2XQ5A 4AKIA 3JAFA 3ZYLA 3EABA 3QC9A 4B3TT 4OYJA 3ZSSA 2H7OA 2C0SA 3V5SA 4GKKT 5M4YA 4GK0E 3ZN0B 2E9XB 2XUEA 2UXNB 1ZP0A 1QLBA 3ABVA 3TLSA 3RYIE 2YOEA 4NIQA 4P1NA 3ZCJA 1ZV4X 3GN5A 4PNIA 5AQHB 3K1SA 5L4HA 2X66A 2DL1A 2UXDT 2VQET 4JBWF 3EDUA 2KWIB 4IL4A 2EHOD 3MK7C 2J47A 1BR2A 4WNKA 3PUYF 3C50A 3GA8A 3BQIA 4IE0A 3B5MA 4DV7T 2J62A 4BJNA 4B3RT 4CXXA 1ZKEA 3LSVA 2PJQA 2Z6EA 5JH7E 5FNVE 3AVRA 4U2YA 3ZMZB 2YK0A 5AQOB 2IMLA 4IIJE 4P0BA 5HXRA 3T1YT 4F6RC 5JTGA 3KVBA 4MHCA 2Y48B 4IT4A 3PUVF 5ABFB 3VR9A 1T7SA 3E0ZA 2K5BB 3EAMA 2DNXA 2WDRA 4A97A 2UUBT 1LKXA 4LF7T 2W63A 4YSZA 1SUMB 1XMOT 4TNWA 4NUVA 3B13A 3J7Yq 4GIWA 2WQYA 3EDVA 3RQWA 2X68A 2N9DA 3AA7B 4X66T 3ZN1B 2BKPA 3AE8A 4DUZT 1WYBA 3AEAA 5F3JA 1HNWT 4ANJA 1OEDC 2LSIA 4DV4T 3E08A 5A1LA 2UUCT 1FMVA 4LMLA 2M6IA 3P4WA 4XAXB 4MFRA 4ZS2A 5LBMA 4DVDA 4QX7B 4KHPT 4LFBT 4LF8T 3KINB 4X1IE 2E2AA 2MYSA 3LBXB 3LG7A 3SWHA 5FL1A 2L8KA 3AA6B 2G0UA 4IDPA 5AFUL 3BK9A 2UXBT 2PFVA 3I9YA 2ZM6T 5JR9C 5CGMA 3L39A 2CM0A 1HF8A 5AQTB 2CE7A 4WW0A 5EK3A 3ZSTA 5HYAA 5LG4A 2WZHA 2XAJB 4UVAB 5FXXA 2BG9A 2VK9A 3UULA 4UF0A 2XQ9A 2VKHA 1MIVA 4HWHA 4QXHB 2UXCT 2VKOA 2QRXA 5HEHA 2V6YB 3Q5WA 4YSXA 3KBUA 5LYJE 4JYAT 4I55E 4HFDA 3IHRA 4EXTA 3P4QA 4GYRA 3Q5DA 4CN1A 3T1HT 2MPKA 4KP3C 4PK6A 2LSKA 1FIOA 3KDSE 2LSYA 4LFAT 3FXDB 1LRZA 4TUYE 2XJ7A 1D1BA 3CQGB 4YJ2E 4IE7A 1HFAA 3N9PA 1S35A 4CN4A 4KX6A 4OX9T 4UV9B 2EHOA 4UEMA 1KFYA 3UQ4A 4IE5A 4JI4T 4DV0T 5F5WA 3ONLC 4PFPA 2XM1A 4YHJA 5CA1E 2XAGB 3AECA 2NW9A 4A98A 5ETWA 2WU2A 4H9RC 2ODVA 2MAWA 4U74A 2JIWA 4Z91A 2J1DG 5IYZE 3N2OA 4CI3B 4UIGA 5FY1A 3ZJ1A 2CPTA 2M6BA 1HG5A 5LBQB 2LM2A 4Q25A 4L0RA 3Q5XA 1Y01A 2FJDA 3LK3B 3AE9A 4ZI7E 4O8SA 4ASKA 2Q9QB 3ZC1A 4HE8A 4TNVA 2IW5B 5IUXA 5LOVE 3RQUA 3I0OA 3NZPA 2K3WA 3RYHE 3L09A 1N36T 1KNZA 3FBLA 2N1GA 2WWVA 3DP7A 1Z0PA 3PUXF 3AE1A 2VQFT 3UTKA 2V5DA 3AE3A 1MIWA 4YTPA 4UR9A 2R6GF 2ES0A 2IDOB 3E22E 5FY7A 2WAUA 4JI2T 3ANWB 1LVFA 4TN7B 4JI6T 4TWDA 3FZKB 3ETVA 2NOXA 3MACA 5LMUT 3UU4A 2V26A 4KMCA 1T98A 3EUHA 3NWIA 1V9DA 5HXEA 5LHIB 2WP9A 2DCFA 5AQIB 4P0AA 2WZIA 3UT5E 5CA0E 3AEFA 3AE6A 5J2UE 2NTXA 4EGWA 1CHUA 1QUUA 2W4XA 4PFOA 2LSJA 4QKNA 2KNDA 5LP6E 2BS2A 4QH1A 3RPUA 2CEAA 2DI4A 3HKBE 2WMNA 3RIFA 4OHFA 1XZYA 2XQ3A 3BQKA 4C91A 2RPAA 2YKSA 3LDQB 5J0ZA 4H9PC 3CX8B 1XDOA 4DR7T 5L3CB 4IL9A 2X0HA 4PK5A 2CHNA 5JR9B 3UUBA 2XQ7A 3JC6C 1D0ZA 2JQ9A 1XWMA 3PDYA 2CXFA 4O4HE 3OPCA 2FJAA 2K24A 3LK2B 1XNRT 5CFBA 4NXNT 5LGUB 2FJEA 4DR3T 2CWYA 5LG3A 4DR4T 3AXJA 4EAHA 3CQCB 5FXVA 5FXWA 3V5UA 3TLTA 4AQGA 3MZKB 4NXMT 3N5LA 3N2GE 2LOSA 3F31A 4HWDA 3PU3A 3ZLIA 3T8OA 1ZEEA 4GYSA 1U4QA 4JI5T 4EOZB 3P8CD 1ZHCA 3FZLB 4UVBB 4WZXA 1EZ3A 4ZZBA 2WM9A 3PUWF 4DUYT 5LHGB 5JRCA 4YT0A 5LHHB 1NAFA 3MJXA 1VOMA 2JJ9A 5JDNA 2XQ6A 4FI5A 3HKEE 3AAIA 4ZZCA 4DBQA 4WBOA 4EEDA 1L0VA 2LRKA 3P4RA 2SPCA 3QUJA 3FBZA 3NRYA 2M67A 2WU5A 5BR8T 3ONJA 3PUSA 2PTFA 1HX8A 5AQRB 4PK4A 4I50E 4TZ4C 2IIUA 5ADXL 4CZZB 4AKRB 1M62A 2E9XD 4YFSA 3Q2MA 5DJQC 5C3JA 4WYVA 3RKOA 4X1KE 3OBVE 5AQQB 4AI6A 3ZT6A 2N2NA 2EHOB 4ZEYA 1IZNB 4OYKA 3GMIA 1U5PA 3JADA 2Q9QC 3D0TA 4KUMB 2BG9E 2CXLA 1W9RA 2I59A 5LA6E 3RI5A 2X9WA 3PUZF 1WR0A 2WB5A 2YEVC 2H89A 1I6ZA 2CMRA 1MNDA 2D2SA 3Q5EA 5CJ5A 4DV2T 3HR0A 4K0KT 2QVAA 2B76A 5AQSB 3RF1A 3ZYMA 2LT3A 3UUXB 2V5CA 1QSDA 2XPKA 2ZM8A 3AEDA 1IBMT 4EIWA 4IREA 2C5JA 4CXWA 1IBKT 3RYCE 4O2BE 5FKYA 3C64A 4H9SE 3L3PA 2IAKA 2XSBA 4ZHQE 3K3OA 3ZMUB 3RIUA 3CX7B 3WI3A 2LKHA 1UGOA 2A2FX 3K3NA 3X1DA 2XTLA 5HCMA 5JVDE 5LXTE 3PUQA 2OV9A 5JDMA 1W09A 3P4SA 3RRWA 2WDQA 2BVLA 4O4JE 3P4PA 4EB6E 5IWAT 1UX5A 2XM2A 3C4WA 5KX5E 2V7KA 2VWAA 2HN1A 4AQFC 1WCRA 2LM9A 3LK42 3MXZA 4YXDA 5AQJB 1BR1A 4X5TA 4I4TE 2V7MA 4ZI3C 3W15B 3QB5A 3SOLA 4ZI2C 4H9OC 1KNPA 4K0UA 2CCQA 4TV9E 3FB2A 3KV4A 4QXCB 3JC6D 3EHZA 2W67A 5LNKA 4XBFB 3I9WA 3RRCA 3AEBA 2VL0A 4C90A 2XQ8A 3UU5A 1NWMX 5LGTB 4UV8B 4KHZF 1GQEA 2VASA 2XASB 4JUYA 5HWYA 3PJAA 2IC9A 2HN2A 4AKLA 5JQGE 4DMWA 3AE7A 2D0TA 1UURA 4OK0A 1IJ5A 1BR0A 2HHHT 1YKHB 4CQIA 4HFCA 5J2TE 4LF6T 3VRBA 2X0YA 4WBNE 2JQQA 1HCIA 3O1JA 3PUAA 4U31A 4IDOA 5HEJA 5EZYE 4HWCA 4Z90A 4YSYA 4YTNA 2P9BA 3MKDA 3RC8A 3F2EA 2E9XA 4B6XA 2LRLA 3FZFB 4LMJA 2XQYA 5FL0A 3KBTA 4AKGA 2XZEA 3KV5A 1W0AA 4OFZA 3PV0F 4HWFA 3AAEB 3SFDA 3BQLA 2A3DA 2H3RA 4HTEA 3QB5K 2XY8B 4NUUA 2BBJA 2JPFA 3OTOT 3TKLB 1KEYA 2NWBA 1UK5A 5JREA 1D1CA 1G73A 4DR1T 1J1JA 1MMNA 2VKDA 3ESLA 3CWZB 4IE6A 3C4XA 2KXPB 2BKOA 4NPPA 2ZM0A 3PJAJ 2PBIA 4I43B 4IDNA 2NW7A 5FYMA 1W0BA 4G2AA 2LHRA 1YXRA 2W62A 2OLTA 4LMKA 3RKGA 2AE9A 2VL8A 3ZPOA 3AEEA 4JLEA 5L3DB 5AQUB 3CMLA 3P50A 2EHOC 4JEHB 2X9HA 1MMGA 2E5VA 1ZOYA 4H9QC 4HKAA 1IJ6A 1WR6A 3UQ7A 4UXNB 3O9XA 4KBMB 2KLQA 1T8BA 4AXPA 4ILBA 2IUBA 4PJJA 3GN5B 3TLVA 2LHNA 2B1EA 2MOZA 4X65T 3KFWX 1BR4A 3F57A 4N78D 1M7KA 4YHHT 3KV9A 2QGSA 1LVKA 2BKNA 4YJ3E 4GOUA 1VCTA 2FUPA 5TAOA 1HX1B 2I6HA 2VVSA 2WBLA 4IDZA 2YDSA 4U33A 3JCFA 1IBLT 4DR5T 4ISSA 1YKEB 3AB3B 3NRXA 4IHJE 3VR8A 4TWFA 4CI1B 2GK9A 4EEBA 1MMDA 4HN9A 4DR2T 3C51A 3VU7H 2FBWA 4COFA 2I0MA 3HKDE 1YQ4A 1UCUA 3LBXA 4ERRA 2MTQA 3NZQA 4PJMA 2CBIA 3UUNA 4LFCT 1WLXA 4DV6T 2LJLA 5ABGA 5AQLB 4QWNB 2ZLYA 1YD8G 4ZI3D 1D0YA 2LLYA 3SRZA 4PJLA 2L3LA 5AQKB 2C5IT 4ZI2D 2V6YA 2JQKA 3JAEA 4XZCA 1YQ3A 2WS3A 4E7ZA 2YDRA 4KI0F 2CA5A 3ZT7A 2V7LA 5HXHA 3ZJ2A 5J1GA 3M65A 5LCYA 3C4ZA 1MNEA 3LFMA 3ZYKA 5JDLA 3TLUA 3AA1B 4H63H 4H63V 4EV6A 4QXBB 4GK5E 4EYUA 2HH7A 3I1AA 2WDVA 5DABA 3I0QA 3C98B 3VHLA 5E0OA 3VKGA 1OEDE 4UVCB 3P7IA 3ONXA 5FVKA 4MLKA 3O4XE 2LE8A 1FMWA 5HEGA 2NW8A 3CKDA 5L3BB 4HFVA 2JRKA 3U3IA 5AQFB 5AQVB 2WWUA 3PU8A 1SE7A 2X0LB 1R8IA 2VVNA 2VKJA 3VRAA 1MMAA 2BG9B 1JNRA 4JI0T 4UF0B 3OKQA 4X20E 1Y64B 4HFBA 4DV1T 2KZ7B 2CHOA 3ZMVB 1H7CA 3KVAA 3DTOA 4H9NC 2HPLA 2Y6XA 1KF6A 5GONE 3RLFF 5LJMA 5AQMB 4CXYA 2W66A 3RC3A 2Q9QA 5LMNT 4DO0A 1SA0E 3AEGA 3J9X1 4L5GA 5FMNA 3IEEA 3S4UA 2QYWA 2UXXB 5L4EA 2BVMA 2XHEB 2BS3A 1OWAA 4EZ4A 2XAHB 3TLWA 1J5WA 2CWOA 2XAQB 1S94A 3EI0A 4YY3T 2UU9T 4QH4A 1HS7A 4MALA 4LF9T 5HEOA 5HEUA 4G63A 2KMFA 4ADZA 3ANWA 3FHNA 4TV8E 4V1Av 3PE0A 2F4VT 4DV5T 5F8PA 3U78A 2D5UA 3A5XA 1HNXT 3UFGA 2D0UA 4HFIA 2LKGA 3L8RA 2X67A 3AAAB 2VB6A 5FY0A 5L3GB 3ZEFB 3G06A 5HCJA 3HKCE 3CVRA 2IC6A 2WSSV 2DHRA 3IF8B 3RHWA 1OEDA 4LF5T 3K8PC 5L47A 3K3QC 2C5KT 4AQFA 2YINA 3OYXA 3N2KE 5JDGA 4B3MT 5L3FB 2JMKA 4PAGA 5DQVA 1X79A 5JR9A 5LB7B 1MIYA 4QH5A 2A72A 2A9UA 4FJOA 5FP3A 3PURA 5HWXA 2K9AA 2CBJA 4X64T 3IA3A 4PJNA 1HTJF 5EK2A 2X51A 3RIUC 2NR4A 2MBGA 3HI2A 2NTYA 2BBHA 1D0XA 2H7VC 4Z8XA 1SHZC 4DMVA 3ZMTB 2J4GA 1B7TA 3OYZA 2CXDA 4O4LE 4O2AE 2CRBA 1US7B 4BJMA 5FXZA 3RIAA 2RP4A 2ZM2A 4EZHA 5KDMC 4B3ST 3VKHA 1HR0T 3LJCA 1E2AA 5HAXA 4AISA 4JV5T 2CLYC 4U72A 2LSGA 1YW0A 1N33T 2K48A 3AVSA 4DIDB 4IE4A 4MBQA 1G8XA 2QA7A 4GKJT 1D1AA 5H6RB 2ACZA 5L3EB 2WY2A 5KMGP 4ILAA 1I94T 3CIRA 2BZBA 5IHYA 2WCAA 1XNQT 1DU2A 3N9OA 5JDFA 4YTMA 3KV6A 2V8SV 1UUSA 3CPZA 3PUGA 3AXJB 4U7YA 1O3XA 2E8IA 3PTRB 2W0GA 2UUAT 2BG9C 4U3CA 4TX5A 4HGAA 2IHR1 3FXEB 2FJBA 3R84B 1AJ3A 1HG2A 4F8HA 3QOFA 4A56A 4QHOA 4AQYT 2V6XA 1KNRA 2XAFB 1FJGT 4HFHA 2YDQA 4CI2B 3OVUA 3MA9A 4ILUA 2XQAA 4PW8A 5FVLA 1X9BA 3H3MA 2JMHA 4YLHA 5JRCB 4ZS3A 4U7IA 3N9QA 3NKZA 3IBPA 5KXJA 3EVYA 2E9XC 3SS1A 2X9YA 4LF4T 1WRDA 1NEKA 2D9DA 2NP9A 4EYYR 3CK6A 3CX6B 2Q9QD 3O1IA 5C8YE 5ABFA 3UU6A 2PG8A 1VCSA 4HWIB 1KK7A 5C2TA 2VURA 2ACXA 2HPJA 5HXSA 4DBRA 4IGUA 4J2CA 2KINB 3AE4A 5EK4A 3UU3A 3RH3A 2BS4A 5LJNA 1N32T 2AXDS 4ZOLE 5JDQA 2RA1A 3RX6A 2JQHA 3B57A 3ZKRA 3M3ZB 3RGLA 4JI3T 1VRBA 1IAPA 4JI8T 3FZHB 2E5LT 5AQNB 2XSAA 3A7MA 2LEHA 3HA4A 5CB4E 1T72A 5BMVE 3RYFE 4HFEA 2V7IA 3N9NA 3R6NA
chains in the Genus database with same CATH topology
2V1DB 4YJ2E 5JDMA 4IE7A 5HXCA 3KVAA 1HFAA 3N9PA 3DTOA 4H9NC 2HPLA 1S35A 2Y6XA 3RRWA 4HEAA 2YU1A 3N9MA 4L9IA 2BVLA 4O4JE 5GONE 4UV9B 2W61A 4EB6E 2EHOA 4UEMA 5LJMA 4IE5A 4CXYA 3HL6A 4QX8B 1UX5A 1E1HB 3RC3A 2Q9QA 5JDHA 3C4WA 5KX5E 3WAKA 2V7KA 2VWAA 4DO0A 1SA0E 3J9X1 4PFPA 4L5GA 3LK42 2LM9A 4M1PA 4YHJA 5FMNA 3IEEA 4AQFC 3MXZA 5CA1E 2XAGB 3S4UA 2NW9A 3O1HA 5ETWA 2UXXB 4H9RC 2ODVA 2BVMA 4U74A 2XHEB 1BR1A 4AKHA 2J1DG 5IYZE 1OWAA 3N2OA 4JEUB 3AA0B 4I4TE 2V7MA 4UIGA 5FY1A 2XAHB 4ZI3C 3UUMA 3ZJ1A 4EZ4A 4X1YE 5DQWA 2CWOA 1HG5A 5LBQB 2W00A 2XAQB 3W15B 1S94A 1HS7A 3SOLA 4L0RA 4ZI2C 3N9LA 3Q5XA 4MALA 2V7JA 3GWHA 3LK3B 4H9OC 2ZMAA 4K0UA 2DLRA 3OJAA 4ZI7E 1UX4A 2CCQA 4TV9E 3FB2A 4E7SA 3KV4A 4QXCB 3JC6D 4G63A 5LGNB 3ZC0A 5LNKA 2KMFA 4XBFB 4ISTA 4BA9A 4O8SA 4ADZA 4ASKA 2Q9QB 2BDEA 3I9WA 4HE8A 3ZC1A 3RRCA 3ANWA 3ZCIA 4C90A 3FHNA 2IW5B 4TV8E 4V1Av 1NWMX 2CLYB 5LOVE 3PE0A 3I0OA 2KT9A 3H3AA 3NZPA 5F8PA 5LGTB 2X9XA 4UV8B 3RYHE 3L09A 3QK6A 3U78A 1KNZA 2D5UA 5H6QB 3FBLA 2VASA 1CUNA 3A5XA 2N1GA 2XASB 2KWHA 1Z0PA 3DP7A 4JUYA 4P09A 5HWYA 3UTKA 2D0UA 2YU2A 1OXZA 2IC9A 2X67A 3AAAB 1MIWA 4AKLA 2VB6A 4DMWA 5JQGE 2ODUA 2D0TA 5FY0A 2ES0A 5L3GB 3CQXC 3H37A 4OK0A 1IJ5A 1BR0A 3ZEFB 2DWGA 3ETUA 1FEWA 3E22E 4DNDA 1YKHB 4CQIA 5FY7A 5J2TE 2Y8DA 2WAUA 3HKCE 3CVRA 3ANWB 2IC6A 1LVFA 2WSSV 3NBXX 4TN7B 4WBNE 2JQQA 1WYCA 2DHRA 3IF8B 1HCIA 3WAJA 3O1JA 3PUAA 2WMOA 3Q9DA 3K8PC 5EZYE 4O4IE 3ETVA 2LOPA 2P9BA 3K3QC 2NOXA 3MKDA 2C5KT 3UFEA 3RC8A 3MACA 4AQFA 2OA5A 3F2EA 2E9XA 2L9QA 2V26A 2YINA 4KMCA 1T98A 3EUHA 4B6XA 3OYXA 2XQYA 4BAYB 1V9DA 5HXEA 5LHIB 3KBTA 4AKGA 2DCFA 4P0AA 4UELA 2DWKA 3N2KE 3KV5A 3UT5E 5CA0E 3DJBA 3ZMSB 5J2UE 5JDGA 5L3FB 2NTXA 4OFZA 1QUUA 3AAEB 4AKIA 3ZYLA 2JMKA 3BQLA 4PAGA 5DQVA 3QC9A 4PFOA 2A3DA 2LSJA 1X79A 4QKNA 4OYJA 2H3RA 5JR9A 4HTEA 1MIYA 2H7OA 4NUUA 2KNDA 5LP6E 2JPFA 3RPUA 2CEAA 2C0SA 2A72A 3TKLB 2DI4A 3V5SA 3HKBE 4FJOA 2NWBA 2WMNA 5FP3A 5JREA 1D1CA 5M4YA 4GK0E 2E9XB 3PURA 4OHFA 3ZN0B 1G73A 2XUEA 5HWXA 1MMNA 2K9AA 3BQKA 4C91A 2VKDA 3ESLA 3CWZB 4IE6A 4PJNA 2UXNB 3C4XA 2KXPB 1HTJF 5EK2A 2X51A 2ZM0A 4H9PC 2MBGA 3HI2A 3CX8B 3RYIE 2PBIA 4I43B 2NW7A 5FYMA 2NTYA 5L3CB 1D0XA 4G2AA 2H7VC 2LHRA 4Z8XA 1SHZC 4PK5A 3ZCJA 1ZV4X 3GN5A 4PNIA 4DMVA 2W62A 3ZMTB 5JR9B 1B7TA 2X66A 3OYZA 3JC6C 2CXDA 1D0ZA 4O4LE 4O2AE 1US7B 4BJMA 5FXZA 2VL8A 3EDUA 3PDYA 2RP4A 2ZM2A 2KWIB 3ZPOA 4EZHA 2CXFA 4O4HE 5L2LA 5KDMC 4JLEA 5L3DB 2EHOD 3CMLA 3MK7C 3VKHA 1BR2A 4WNKA 2K24A 3C50A 2EHOC 3LK2B 3LJCA 3GA8A 4JEHB 5LGUB 3BQIA 2CWYA 1MMGA 2X9HA 4IE0A 5HAXA 4BJNA 4CXXA 1ZKEA 2CLYC 4EAHA 4H9QC 3CQCB 4HKAA 5FXVA 4U72A 2LSGA 1YW0A 1IJ6A 1WR6A 5FXWA 3V5UA 4UXNB 4AQGA 2K48A 3MZKB 3O9XA 3AVSA 3N5LA 4KBMB 4IE4A 3N2GE 2PJQA 2KLQA 2LOSA 2Z6EA 1G8XA 4MBQA 4AXPA 3F31A 4PJJA 2QA7A 3GN5B 2LHNA 5JH7E 3PU3A 5FNVE 3ZLIA 1D1AA 3T8OA 5H6RB 1ZEEA 3AVRA 2B1EA 2MOZA 4GYSA 3ZMZB 5L3EB 3KFWX 2YK0A 1U4QA 5KMGP 1BR4A 3F57A 4EOZB 4N78D 2BZBA 3KV9A 5IHYA 4IIJE 2QGSA 1LVKA 3N9OA 4P0BA 4YJ3E 5HXRA 5JDFA 3KV6A 4GOUA 4F6RC 3P8CD 1ZHCA 3KVBA 4MHCA 2Y48B 4UVBB 5TAOA 1EZ3A 3CPZA 3PUGA 2WM9A 3E0ZA 2K5BB 2WBLA 4IDZA 2DNXA 1O3XA 2E8IA 3PTRB 5LHGB 1LKXA 2W0GA 5JRCA 2W63A 5LHHB 1NAFA 3MJXA 4NUVA 1VOMA 2JJ9A 3B13A 4HGAA 4TX5A 5JDNA 4FI5A 3FXEB 4ISSA 3R84B 3J7Yq 3HKEE 1HG2A 1YKEB 3AAIA 1AJ3A 3AB3B 4A56A 4QHOA 3NRXA 4IHJE 4DBQA 4WBOA 2GK9A 4GIWA 1MMDA 4HN9A 4CI1B 3C51A 3EDVA 3VU7H 3HKDE 2XAFB 1UCUA 2SPCA 4CI2B 3LBXA 4ERRA 2MTQA 3QUJA 3MA9A 3NZQA 2X68A 3FBZA 3NRYA 2M67A 2N9DA 3AA7B 4ILUA 3PUSA 3ZN1B 4PJMA 4PW8A 3UUNA 1WYBA 1HX8A 1WLXA 5F3JA 4ANJA 2JMHA 4YLHA 5JRCB 2LSIA 4ZS3A 4PK4A 4I50E 4TZ4C 3E08A 5ADXL 5A1LA 1FMVA 2LJLA 3N9QA 4CZZB 4AKRB 3IBPA 2E9XD 4YFSA 4XAXB 4QWNB 4MFRA 3EVYA 2E9XC 3Q2MA 4ZS2A 2ZLYA 5LBMA 1YD8G 2X9YA 4QX7B 1D1BA 3SS1A 4DVDA 5DJQC 3KINB 4X1IE 3RKOA 1WRDA 2MYSA 1D0YA 4ZI3D 2NP9A 3SRZA 3LBXB 3LG7A 3SWHA 4EYYR 4X1KE 4PJLA 2L8KA 3AA6B 2L3LA 3OBVE 2G0UA 2C5IT 5AFUL 3BK9A 4ZI2D 4AI6A 2N2NA 2PFVA 3CX6B 3I9YA 2Q9QD 4XZCA 2EHOB 5JR9C 1IZNB 4OYKA 3GMIA 1U5PA 3O1IA 2Q9QC 3D0TA 4KUMB 5C8YE 2CXLA 2CM0A 2PG8A 1HF8A 2I59A 3ZMVB 2CE7A 4WW0A 5EK3A 1KK7A 5LA6E 4E7ZA 5HYAA 5LG4A 2CA5A 2V7LA 5HXHA 3ZJ2A 5J1GA 2X9WA 3M65A 2XAJB 4UVAB 5LCYA 2ACXA 2HPJA 2YEVC 5FXXA 5HXSA 2CMRA 1MNDA 3C4ZA 2VK9A 4DBRA 3UULA 2D2SA 1MNEA 3LFMA 4IGUA 4J2CA 2KINB 4UF0A 5EK4A 3ZYKA 5JDLA 3HR0A 4CI3B 3RH3A 3AA1B 2VKHA 4H63V 4H63H 4QXBB 5LJNA 4GK5E 1MIVA 2HH7A 4EYUA 3I1AA 4QXHB 2VKOA 5DABA 3I0QA 3C98B 3VHLA 3Q5WA 4ZOLE 3KBUA 5E0OA 3ZYMA 2LT3A 2RA1A 5JDQA 3VKGA 4UVCB 5LYJE 3UUXB 1QSDA 2ZM8A 3P7IA 4I55E 4EIWA 3ONXA 3IHRA 3RX6A 3B57A 2C5JA 2LE8A 3O4XE 1FMWA 4MLKA 4CXWA 4EXTA 1VRBA 1IAPA 3RYCE 2NW8A 4O2BE 3CKDA 5L3BB 4HFVA 2JRKA 3C64A 4H9SE 3U3IA 3L3PA 4GYRA 2WWUA 3PU8A 2IAKA 2X0LB 4ZHQE 3K3OA 3ZMUB 2VKJA 2LEHA 3HA4A 3CX7B 1MMAA 5CB4E 5BMVE 3WI3A 4KP3C 4UF0B 4PK6A 2LSKA 1FIOA 2A2FX 3K3NA 3KDSE 3OKQA 3RYFE 2V7IA 2LSYA 3R6NA 3N9NA 3FXDB 4X20E 1LRZA 1Y64B 2XTLA 4TUYE 5JVDE 5LXTE 3PUQA 2KZ7B 3CQGB 1H7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT3 A;  4KMC A;  4L5G A;  4XAX B;  4MFR A;  4KBM B;  4ILU A; 
#chains in the Genus database with same CATH topology
 2V1D B;  5HXC A;  4ILC A;  4U2Z A;  4HEA A;  2YU1 A;  3AE5 A;  3N9M A;  4L9I A;  4DV3 T;  4AIU A;  3UU8 A;  4JI7 T;  2W61 A;  4ZXL A;  1XMQ T;  3HL6 A;  4QX8 B;  1E1H B;  2YN6 A;  1E7P A;  5JDH A;  1OED B;  3WAK A;  4CN6 A;  4M1P A;  2H88 A;  3O1H A;  4AKH A;  5L2L A;  4JEU B;  3AA0 B;  3UUM A;  4A5X A;  5AQP B;  3A8Y C;  3AE2 A;  3QNU A;  4X1Y E;  5DQW A;  3FZM B;  2W00 A;  5ABH A;  2W2U A;  3N9L A;  3NVO A;  2V7J A;  3GWH A;  2ZMA A;  1N34 T;  2DLR A;  1XDP A;  3OJA A;  1UX4 A;  3ZC0 A;  4E7S A;  5LGN B;  4IST A;  4BA9 A;  2BDE A;  3ZCI A;  2CLY B;  3ZT5 A;  2KT9 A;  3H3A A;  2X9X A;  1HNZ T;  3QK6 A;  5H6Q B;  4BAY B;  1CUN A;  2KWH A;  4I0U A;  4P09 A;  1JNZ A;  1NEN A;  2YU2 A;  1OXZ A;  4IDQ A;  2ODU A;  4X62 T;  3CQX C;  3H37 A;  3SFE A;  2XQ4 A;  2DWG A;  3ETU A;  1J5E T;  1FEW A;  4DND A;  2KSR A;  2Y8D A;  3NBX X;  1WYC A;  3WAJ A;  1Z8U A;  2WMO A;  3Q9D A;  4O4I E;  2LOP A;  4JI1 T;  4DR6 T;  3UFE A;  2OA5 A;  2L9Q A;  5ABE A;  4TWH A;  5AQG B;  1WFD A;  4UEL A;  2DWK A;  3DJB A;  3ZMS B;  2XQ5 A;  4AKI A;  3JAF A;  3ZYL A;  3EAB A;  3QC9 A;  4B3T T;  4OYJ A;  3ZSS A;  2H7O A;  2C0S A;  3V5S A;  4GKK T;  5M4Y A;  4GK0 E;  3ZN0 B;  2E9X B;  2XUE A;  2UXN B;  1ZP0 A;  1QLB A;  3ABV A;  3TLS A;  3RYI E;  2YOE A;  4NIQ A;  4P1N A;  3ZCJ A;  1ZV4 X;  3GN5 A;  4PNI A;  5AQH B;  3K1S A;  5L4H A;  2X66 A;  2DL1 A;  2UXD T;  2VQE T;  4JBW F;  3EDU A;  2KWI B;  4IL4 A;  2EHO D;  3MK7 C;  2J47 A;  1BR2 A;  4WNK A;  3PUY F;  3C50 A;  3GA8 A;  3BQI A;  4IE0 A;  3B5M A;  4DV7 T;  2J62 A;  4BJN A;  4B3R T;  4CXX A;  1ZKE A;  3LSV A;  2PJQ A;  2Z6E A;  5JH7 E;  5FNV E;  3AVR A;  4U2Y A;  3ZMZ B;  2YK0 A;  5AQO B;  2IML A;  4IIJ E;  4P0B A;  5HXR A;  3T1Y T;  4F6R C;  5JTG A;  3KVB A;  4MHC A;  2Y48 B;  4IT4 A;  3PUV F;  5ABF B;  3VR9 A;  1T7S A;  3E0Z A;  2K5B B;  3EAM A;  2DNX A;  2WDR A;  4A97 A;  2UUB T;  1LKX A;  4LF7 T;  2W63 A;  4YSZ A;  1SUM B;  1XMO T;  4TNW A;  4NUV A;  3B13 A;  3J7Y q;  4GIW A;  2WQY A;  3EDV A;  3RQW A;  2X68 A;  2N9D A;  3AA7 B;  4X66 T;  3ZN1 B;  2BKP A;  3AE8 A;  4DUZ T;  1WYB A;  3AEA A;  5F3J A;  1HNW T;  4ANJ A;  1OED C;  2LSI A;  4DV4 T;  3E08 A;  5A1L A;  2UUC T;  1FMV A;  4LML A;  2M6I A;  3P4W A;  4XAX B;  4MFR A;  4ZS2 A;  5LBM A;  4DVD A;  4QX7 B;  4KHP T;  4LFB T;  4LF8 T;  3KIN B;  4X1I E;  2E2A A;  2MYS A;  3LBX B;  3LG7 A;  3SWH A;  5FL1 A;  2L8K A;  3AA6 B;  2G0U A;  4IDP A;  5AFU L;  3BK9 A;  2UXB T;  2PFV A;  3I9Y A;  2ZM6 T;  5JR9 C;  5CGM A;  3L39 A;  2CM0 A;  1HF8 A;  5AQT B;  2CE7 A;  4WW0 A;  5EK3 A;  3ZST A;  5HYA A;  5LG4 A;  2WZH A;  2XAJ B;  4UVA B;  5FXX A;  2BG9 A;  2VK9 A;  3UUL A;  4UF0 A;  2XQ9 A;  2VKH A;  1MIV A;  4HWH A;  4QXH B;  2UXC T;  2VKO A;  2QRX A;  5HEH A;  2V6Y B;  3Q5W A;  4YSX A;  3KBU A;  5LYJ E;  4JYA T;  4I55 E;  4HFD A;  3IHR A;  4EXT A;  3P4Q A;  4GYR A;  3Q5D A;  4CN1 A;  3T1H T;  2MPK A;  4KP3 C;  4PK6 A;  2LSK A;  1FIO A;  3KDS E;  2LSY A;  4LFA T;  3FXD B;  1LRZ A;  4TUY E;  2XJ7 A;  1D1B A;  3CQG B;  4YJ2 E;  4IE7 A;  1HFA A;  3N9P A;  1S35 A;  4CN4 A;  4KX6 A;  4OX9 T;  4UV9 B;  2EHO A;  4UEM A;  1KFY A;  3UQ4 A;  4IE5 A;  4JI4 T;  4DV0 T;  5F5W A;  3ONL C;  4PFP A;  2XM1 A;  4YHJ A;  5CA1 E;  2XAG B;  3AEC A;  2NW9 A;  4A98 A;  5ETW A;  2WU2 A;  4H9R C;  2ODV A;  2MAW A;  4U74 A;  2JIW A;  4Z91 A;  2J1D G;  5IYZ E;  3N2O A;  4CI3 B;  4UIG A;  5FY1 A;  3ZJ1 A;  2CPT A;  2M6B A;  1HG5 A;  5LBQ B;  2LM2 A;  4Q25 A;  4L0R A;  3Q5X A;  1Y01 A;  2FJD A;  3LK3 B;  3AE9 A;  4ZI7 E;  4O8S A;  4ASK A;  2Q9Q B;  3ZC1 A;  4HE8 A;  4TNV A;  2IW5 B;  5IUX A;  5LOV E;  3RQU A;  3I0O A;  3NZP A;  2K3W A;  3RYH E;  3L09 A;  1N36 T;  1KNZ A;  3FBL A;  2N1G A;  2WWV A;  3DP7 A;  1Z0P A;  3PUX F;  3AE1 A;  2VQF T;  3UTK A;  2V5D A;  3AE3 A;  1MIW A;  4YTP A;  4UR9 A;  2R6G F;  2ES0 A;  2IDO B;  3E22 E;  5FY7 A;  2WAU A;  4JI2 T;  3ANW B;  1LVF A;  4TN7 B;  4JI6 T;  4TWD A;  3FZK B;  3ETV A;  2NOX A;  3MAC A;  5LMU T;  3UU4 A;  2V26 A;  4KMC A;  1T98 A;  3EUH A;  3NWI A;  1V9D A;  5HXE A;  5LHI B;  2WP9 A;  2DCF A;  5AQI B;  4P0A A;  2WZI A;  3UT5 E;  5CA0 E;  3AEF A;  3AE6 A;  5J2U E;  2NTX A;  4EGW A;  1CHU A;  1QUU A;  2W4X A;  4PFO A;  2LSJ A;  4QKN A;  2KND A;  5LP6 E;  2BS2 A;  4QH1 A;  3RPU A;  2CEA A;  2DI4 A;  3HKB E;  2WMN A;  3RIF A;  4OHF A;  1XZY A;  2XQ3 A;  3BQK A;  4C91 A;  2RPA A;  2YKS A;  3LDQ B;  5J0Z A;  4H9P C;  3CX8 B;  1XDO A;  4DR7 T;  5L3C B;  4IL9 A;  2X0H A;  4PK5 A;  2CHN A;  5JR9 B;  3UUB A;  2XQ7 A;  3JC6 C;  1D0Z A;  2JQ9 A;  1XWM A;  3PDY A;  2CXF A;  4O4H E;  3OPC A;  2FJA A;  2K24 A;  3LK2 B;  1XNR T;  5CFB A;  4NXN T;  5LGU B;  2FJE A;  4DR3 T;  2CWY A;  5LG3 A;  4DR4 T;  3AXJ A;  4EAH A;  3CQC B;  5FXV A;  5FXW A;  3V5U A;  3TLT A;  4AQG A;  3MZK B;  4NXM T;  3N5L A;  3N2G E;  2LOS A;  3F31 A;  4HWD A;  3PU3 A;  3ZLI A;  3T8O A;  1ZEE A;  4GYS A;  1U4Q A;  4JI5 T;  4EOZ B;  3P8C D;  1ZHC A;  3FZL B;  4UVB B;  4WZX A;  1EZ3 A;  4ZZB A;  2WM9 A;  3PUW F;  4DUY T;  5LHG B;  5JRC A;  4YT0 A;  5LHH B;  1NAF A;  3MJX A;  1VOM A;  2JJ9 A;  5JDN A;  2XQ6 A;  4FI5 A;  3HKE E;  3AAI A;  4ZZC A;  4DBQ A;  4WBO A;  4EED A;  1L0V A;  2LRK A;  3P4R A;  2SPC A;  3QUJ A;  3FBZ A;  3NRY A;  2M67 A;  2WU5 A;  5BR8 T;  3ONJ A;  3PUS A;  2PTF A;  1HX8 A;  5AQR B;  4PK4 A;  4I50 E;  4TZ4 C;  2IIU A;  5ADX L;  4CZZ B;  4AKR B;  1M62 A;  2E9X D;  4YFS A;  3Q2M A;  5DJQ C;  5C3J A;  4WYV A;  3RKO A;  4X1K E;  3OBV E;  5AQQ B;  4AI6 A;  3ZT6 A;  2N2N A;  2EHO B;  4ZEY A;  1IZN B;  4OYK A;  3GMI A;  1U5P A;  3JAD A;  2Q9Q C;  3D0T A;  4KUM B;  2BG9 E;  2CXL A;  1W9R A;  2I59 A;  5LA6 E;  3RI5 A;  2X9W A;  3PUZ F;  1WR0 A;  2WB5 A;  2YEV C;  2H89 A;  1I6Z A;  2CMR A;  1MND A;  2D2S A;  3Q5E A;  5CJ5 A;  4DV2 T;  3HR0 A;  4K0K T;  2QVA A;  2B76 A;  5AQS B;  3RF1 A;  3ZYM A;  2LT3 A;  3UUX B;  2V5C A;  1QSD A;  2XPK A;  2ZM8 A;  3AED A;  1IBM T;  4EIW A;  4IRE A;  2C5J A;  4CXW A;  1IBK T;  3RYC E;  4O2B E;  5FKY A;  3C64 A;  4H9S E;  3L3P A;  2IAK A;  2XSB A;  4ZHQ E;  3K3O A;  3ZMU B;  3RIU A;  3CX7 B;  3WI3 A;  2LKH A;  1UGO A;  2A2F X;  3K3N A;  3X1D A;  2XTL A;  5HCM A;  5JVD E;  5LXT E;  3PUQ A;  2OV9 A;  5JDM A;  1W09 A;  3P4S A;  3RRW A;  2WDQ A;  2BVL A;  4O4J E;  3P4P A;  4EB6 E;  5IWA T;  1UX5 A;  2XM2 A;  3C4W A;  5KX5 E;  2V7K A;  2VWA A;  2HN1 A;  4AQF C;  1WCR A;  2LM9 A;  3LK4 2;  3MXZ A;  4YXD A;  5AQJ B;  1BR1 A;  4X5T A;  4I4T E;  2V7M A;  4ZI3 C;  3W15 B;  3QB5 A;  3SOL A;  4ZI2 C;  4H9O C;  1KNP A;  4K0U A;  2CCQ A;  4TV9 E;  3FB2 A;  3KV4 A;  4QXC B;  3JC6 D;  3EHZ A;  2W67 A;  5LNK A;  4XBF B;  3I9W A;  3RRC A;  3AEB A;  2VL0 A;  4C90 A;  2XQ8 A;  3UU5 A;  1NWM X;  5LGT B;  4UV8 B;  4KHZ F;  1GQE A;  2VAS A;  2XAS B;  4JUY A;  5HWY A;  3PJA A;  2IC9 A;  2HN2 A;  4AKL A;  5JQG E;  4DMW A;  3AE7 A;  2D0T A;  1UUR A;  4OK0 A;  1IJ5 A;  1BR0 A;  2HHH T;  1YKH B;  4CQI A;  4HFC A;  5J2T E;  4LF6 T;  3VRB A;  2X0Y A;  4WBN E;  2JQQ A;  1HCI A;  3O1J A;  3PUA A;  4U31 A;  4IDO A;  5HEJ A;  5EZY E;  4HWC A;  4Z90 A;  4YSY A;  4YTN A;  2P9B A;  3MKD A;  3RC8 A;  3F2E A;  2E9X A;  4B6X A;  2LRL A;  3FZF B;  4LMJ A;  2XQY A;  5FL0 A;  3KBT A;  4AKG A;  2XZE A;  3KV5 A;  1W0A A;  4OFZ A;  3PV0 F;  4HWF A;  3AAE B;  3SFD A;  3BQL A;  2A3D A;  2H3R A;  4HTE A;  3QB5 K;  2XY8 B;  4NUU A;  2BBJ A;  2JPF A;  3OTO T;  3TKL B;  1KEY A;  2NWB A;  1UK5 A;  5JRE A;  1D1C A;  1G73 A;  4DR1 T;  1J1J A;  1MMN A;  2VKD A;  3ESL A;  3CWZ B;  4IE6 A;  3C4X A;  2KXP B;  2BKO A;  4NPP A;  2ZM0 A;  3PJA J;  2PBI A;  4I43 B;  4IDN A;  2NW7 A;  5FYM A;  1W0B A;  4G2A A;  2LHR A;  1YXR A;  2W62 A;  2OLT A;  4LMK A;  3RKG A;  2AE9 A;  2VL8 A;  3ZPO A;  3AEE A;  4JLE A;  5L3D B;  5AQU B;  3CML A;  3P50 A;  2EHO C;  4JEH B;  2X9H A;  1MMG A;  2E5V A;  1ZOY A;  4H9Q C;  4HKA A;  1IJ6 A;  1WR6 A;  3UQ7 A;  4UXN B;  3O9X A;  4KBM B;  2KLQ A;  1T8B A;  4AXP A;  4ILB A;  2IUB A;  4PJJ A;  3GN5 B;  3TLV A;  2LHN A;  2B1E A;  2MOZ A;  4X65 T;  3KFW X;  1BR4 A;  3F57 A;  4N78 D;  1M7K A;  4YHH T;  3KV9 A;  2QGS A;  1LVK A;  2BKN A;  4YJ3 E;  4GOU A;  1VCT A;  2FUP A;  5TAO A;  1HX1 B;  2I6H A;  2VVS A;  2WBL A;  4IDZ A;  2YDS A;  4U33 A;  3JCF A;  1IBL T;  4DR5 T;  4ISS A;  1YKE B;  3AB3 B;  3NRX A;  4IHJ E;  3VR8 A;  4TWF A;  4CI1 B;  2GK9 A;  4EEB A;  1MMD A;  4HN9 A;  4DR2 T;  3C51 A;  3VU7 H;  2FBW A;  4COF A;  2I0M A;  3HKD E;  1YQ4 A;  1UCU A;  3LBX A;  4ERR A;  2MTQ A;  3NZQ A;  4PJM A;  2CBI A;  3UUN A;  4LFC T;  1WLX A;  4DV6 T;  2LJL A;  5ABG A;  5AQL B;  4QWN B;  2ZLY A;  1YD8 G;  4ZI3 D;  1D0Y A;  2LLY A;  3SRZ A;  4PJL A;  2L3L A;  5AQK B;  2C5I T;  4ZI2 D;  2V6Y A;  2JQK A;  3JAE A;  4XZC A;  1YQ3 A;  2WS3 A;  4E7Z A;  2YDR A;  4KI0 F;  2CA5 A;  3ZT7 A;  2V7L A;  5HXH A;  3ZJ2 A;  5J1G A;  3M65 A;  5LCY A;  3C4Z A;  1MNE A;  3LFM A;  3ZYK A;  5JDL A;  3TLU A;  3AA1 B;  4H63 H;  4H63 V;  4EV6 A;  4QXB B;  4GK5 E;  4EYU A;  2HH7 A;  3I1A A;  2WDV A;  5DAB A;  3I0Q A;  3C98 B;  3VHL A;  5E0O A;  3VKG A;  1OED E;  4UVC B;  3P7I A;  3ONX A;  5FVK A;  4MLK A;  3O4X E;  2LE8 A;  1FMW A;  5HEG A;  2NW8 A;  3CKD A;  5L3B B;  4HFV A;  2JRK A;  3U3I A;  5AQF B;  5AQV B;  2WWU A;  3PU8 A;  1SE7 A;  2X0L B;  1R8I A;  2VVN A;  2VKJ A;  3VRA A;  1MMA A;  2BG9 B;  1JNR A;  4JI0 T;  4UF0 B;  3OKQ A;  4X20 E;  1Y64 B;  4HFB A;  4DV1 T;  2KZ7 B;  2CHO A;  3ZMV B;  1H7C A;  3KVA A;  3DTO A;  4H9N C;  2HPL A;  2Y6X A;  1KF6 A;  5GON E;  3RLF F;  5LJM A;  5AQM B;  4CXY A;  2W66 A;  3RC3 A;  2Q9Q A;  5LMN T;  4DO0 A;  1SA0 E;  3AEG A;  3J9X 1;  4L5G A;  5FMN A;  3IEE A;  3S4U A;  2QYW A;  2UXX B;  5L4E A;  2BVM A;  2XHE B;  2BS3 A;  1OWA A;  4EZ4 A;  2XAH B;  3TLW A;  1J5W A;  2CWO A;  2XAQ B;  1S94 A;  3EI0 A;  4YY3 T;  2UU9 T;  4QH4 A;  1HS7 A;  4MAL A;  4LF9 T;  5HEO A;  5HEU A;  4G63 A;  2KMF A;  4ADZ A;  3ANW A;  3FHN A;  4TV8 E;  4V1A v;  3PE0 A;  2F4V T;  4DV5 T;  5F8P A;  3U78 A;  2D5U A;  3A5X A;  1HNX T;  3UFG A;  2D0U A;  4HFI A;  2LKG A;  3L8R A;  2X67 A;  3AAA B;  2VB6 A;  5FY0 A;  5L3G B;  3ZEF B;  3G06 A;  5HCJ A;  3HKC E;  3CVR A;  2IC6 A;  2WSS V;  2DHR A;  3IF8 B;  3RHW A;  1OED A;  4LF5 T;  3K8P C;  5L47 A;  3K3Q C;  2C5K T;  4AQF A;  2YIN A;  3OYX A;  3N2K E;  5JDG A;  4B3M T;  5L3F B;  2JMK A;  4PAG A;  5DQV A;  1X79 A;  5JR9 A;  5LB7 B;  1MIY A;  4QH5 A;  2A72 A;  2A9U A;  4FJO A;  5FP3 A;  3PUR A;  5HWX A;  2K9A A;  2CBJ A;  4X64 T;  3IA3 A;  4PJN A;  1HTJ F;  5EK2 A;  2X51 A;  3RIU C;  2NR4 A;  2MBG A;  3HI2 A;  2NTY A;  2BBH A;  1D0X A;  2H7V C;  4Z8X A;  1SHZ C;  4DMV A;  3ZMT B;  2J4G A;  1B7T A;  3OYZ A;  2CXD A;  4O4L E;  4O2A E;  2CRB A;  1US7 B;  4BJM A;  5FXZ A;  3RIA A;  2RP4 A;  2ZM2 A;  4EZH A;  5KDM C;  4B3S T;  3VKH A;  1HR0 T;  3LJC A;  1E2A A;  5HAX A;  4AIS A;  4JV5 T;  2CLY C;  4U72 A;  2LSG A;  1YW0 A;  1N33 T;  2K48 A;  3AVS A;  4DID B;  4IE4 A;  4MBQ A;  1G8X A;  2QA7 A;  4GKJ T;  1D1A A;  5H6R B;  2ACZ A;  5L3E B;  2WY2 A;  5KMG P;  4ILA A;  1I94 T;  3CIR A;  2BZB A;  5IHY A;  2WCA A;  1XNQ T;  1DU2 A;  3N9O A;  5JDF A;  4YTM A;  3KV6 A;  2V8S V;  1UUS A;  3CPZ A;  3PUG A;  3AXJ B;  4U7Y A;  1O3X A;  2E8I A;  3PTR B;  2W0G A;  2UUA T;  2BG9 C;  4U3C A;  4TX5 A;  4HGA A;  2IHR 1;  3FXE B;  2FJB A;  3R84 B;  1AJ3 A;  1HG2 A;  4F8H A;  3QOF A;  4A56 A;  4QHO A;  4AQY T;  2V6X A;  1KNR A;  2XAF B;  1FJG T;  4HFH A;  2YDQ A;  4CI2 B;  3OVU A;  3MA9 A;  4ILU A;  2XQA A;  4PW8 A;  5FVL A;  1X9B A;  3H3M A;  2JMH A;  4YLH A;  5JRC B;  4ZS3 A;  4U7I A;  3N9Q A;  3NKZ A;  3IBP A;  5KXJ A;  3EVY A;  2E9X C;  3SS1 A;  2X9Y A;  4LF4 T;  1WRD A;  1NEK A;  2D9D A;  2NP9 A;  4EYY R;  3CK6 A;  3CX6 B;  2Q9Q D;  3O1I A;  5C8Y E;  5ABF A;  3UU6 A;  2PG8 A;  1VCS A;  4HWI B;  1KK7 A;  5C2T A;  2VUR A;  2ACX A;  2HPJ A;  5HXS A;  4DBR A;  4IGU A;  4J2C A;  2KIN B;  3AE4 A;  5EK4 A;  3UU3 A;  3RH3 A;  2BS4 A;  5LJN A;  1N32 T;  2AXD S;  4ZOL E;  5JDQ A;  2RA1 A;  3RX6 A;  2JQH A;  3B57 A;  3ZKR A;  3M3Z B;  3RGL A;  4JI3 T;  1VRB A;  1IAP A;  4JI8 T;  3FZH B;  2E5L T;  5AQN B;  2XSA A;  3A7M A;  2LEH A;  3HA4 A;  5CB4 E;  1T72 A;  5BMV E;  3RYF E;  4HFE A;  2V7I A;  3N9N A;  3R6N A; 
#chains in the Genus database with same CATH homology
 2V1D B;  4YJ2 E;  5JDM A;  4IE7 A;  5HXC A;  3KVA A;  1HFA A;  3N9P A;  3DTO A;  4H9N C;  2HPL A;  1S35 A;  2Y6X A;  3RRW A;  4HEA A;  2YU1 A;  3N9M A;  4L9I A;  2BVL A;  4O4J E;  5GON E;  4UV9 B;  2W61 A;  4EB6 E;  2EHO A;  4UEM A;  5LJM A;  4IE5 A;  4CXY A;  3HL6 A;  4QX8 B;  1UX5 A;  1E1H B;  3RC3 A;  2Q9Q A;  5JDH A;  3C4W A;  5KX5 E;  3WAK A;  2V7K A;  2VWA A;  4DO0 A;  1SA0 E;  3J9X 1;  4PFP A;  4L5G A;  3LK4 2;  2LM9 A;  4M1P A;  4YHJ A;  5FMN A;  3IEE A;  4AQF C;  3MXZ A;  5CA1 E;  2XAG B;  3S4U A;  2NW9 A;  3O1H A;  5ETW A;  2UXX B;  4H9R C;  2ODV A;  2BVM A;  4U74 A;  2XHE B;  1BR1 A;  4AKH A;  2J1D G;  5IYZ E;  1OWA A;  3N2O A;  4JEU B;  3AA0 B;  4I4T E;  2V7M A;  4UIG A;  5FY1 A;  2XAH B;  4ZI3 C;  3UUM A;  3ZJ1 A;  4EZ4 A;  4X1Y E;  5DQW A;  2CWO A;  1HG5 A;  5LBQ B;  2W00 A;  2XAQ B;  3W15 B;  1S94 A;  1HS7 A;  3SOL A;  4L0R A;  4ZI2 C;  3N9L A;  3Q5X A;  4MAL A;  2V7J A;  3GWH A;  3LK3 B;  4H9O C;  2ZMA A;  4K0U A;  2DLR A;  3OJA A;  4ZI7 E;  1UX4 A;  2CCQ A;  4TV9 E;  3FB2 A;  4E7S A;  3KV4 A;  4QXC B;  3JC6 D;  4G63 A;  5LGN B;  3ZC0 A;  5LNK A;  2KMF A;  4XBF B;  4IST A;  4BA9 A;  4O8S A;  4ADZ A;  4ASK A;  2Q9Q B;  2BDE A;  3I9W A;  4HE8 A;  3ZC1 A;  3RRC A;  3ANW A;  3ZCI A;  4C90 A;  3FHN A;  2IW5 B;  4TV8 E;  4V1A v;  1NWM X;  2CLY B;  5LOV E;  3PE0 A;  3I0O A;  2KT9 A;  3H3A A;  3NZP A;  5F8P A;  5LGT B;  2X9X A;  4UV8 B;  3RYH E;  3L09 A;  3QK6 A;  3U78 A;  1KNZ A;  2D5U A;  5H6Q B;  3FBL A;  2VAS A;  1CUN A;  3A5X A;  2N1G A;  2XAS B;  2KWH A;  1Z0P A;  3DP7 A;  4JUY A;  4P09 A;  5HWY A;  3UTK A;  2D0U A;  2YU2 A;  1OXZ A;  2IC9 A;  2X67 A;  3AAA B;  1MIW A;  4AKL A;  2VB6 A;  4DMW A;  5JQG E;  2ODU A;  2D0T A;  5FY0 A;  2ES0 A;  5L3G B;  3CQX C;  3H37 A;  4OK0 A;  1IJ5 A;  1BR0 A;  3ZEF B;  2DWG A;  3ETU A;  1FEW A;  3E22 E;  4DND A;  1YKH B;  4CQI A;  5FY7 A;  5J2T E;  2Y8D A;  2WAU A;  3HKC E;  3CVR A;  3ANW B;  2IC6 A;  1LVF A;  2WSS V;  3NBX X;  4TN7 B;  4WBN E;  2JQQ A;  1WYC A;  2DHR A;  3IF8 B;  1HCI A;  3WAJ A;  3O1J A;  3PUA A;  2WMO A;  3Q9D A;  3K8P C;  5EZY E;  4O4I E;  3ETV A;  2LOP A;  2P9B A;  3K3Q C;  2NOX A;  3MKD A;  2C5K T;  3UFE A;  3RC8 A;  3MAC A;  4AQF A;  2OA5 A;  3F2E A;  2E9X A;  2L9Q A;  2V26 A;  2YIN A;  4KMC A;  1T98 A;  3EUH A;  4B6X A;  3OYX A;  2XQY A;  4BAY B;  1V9D A;  5HXE A;  5LHI B;  3KBT A;  4AKG A;  2DCF A;  4P0A A;  4UEL A;  2DWK A;  3N2K E;  3KV5 A;  3UT5 E;  5CA0 E;  3DJB A;  3ZMS B;  5J2U E;  5JDG A;  5L3F B;  2NTX A;  4OFZ A;  1QUU A;  3AAE B;  4AKI A;  3ZYL A;  2JMK A;  3BQL A;  4PAG A;  5DQV A;  3QC9 A;  4PFO A;  2A3D A;  2LSJ A;  1X79 A;  4QKN A;  4OYJ A;  2H3R A;  5JR9 A;  4HTE A;  1MIY A;  2H7O A;  4NUU A;  2KND A;  5LP6 E;  2JPF A;  3RPU A;  2CEA A;  2C0S A;  2A72 A;  3TKL B;  2DI4 A;  3V5S A;  3HKB E;  4FJO A;  2NWB A;  2WMN A;  5FP3 A;  5JRE A;  1D1C A;  5M4Y A;  4GK0 E;  2E9X B;  3PUR A;  4OHF A;  3ZN0 B;  1G73 A;  2XUE A;  5HWX A;  1MMN A;  2K9A A;  3BQK A;  4C91 A;  2VKD A;  3ESL A;  3CWZ B;  4IE6 A;  4PJN A;  2UXN B;  3C4X A;  2KXP B;  1HTJ F;  5EK2 A;  2X51 A;  2ZM0 A;  4H9P C;  2MBG A;  3HI2 A;  3CX8 B;  3RYI E;  2PBI A;  4I43 B;  2NW7 A;  5FYM A;  2NTY A;  5L3C B;  1D0X A;  4G2A A;  2H7V C;  2LHR A;  4Z8X A;  1SHZ C;  4PK5 A;  3ZCJ A;  1ZV4 X;  3GN5 A;  4PNI A;  4DMV A;  2W62 A;  3ZMT B;  5JR9 B;  1B7T A;  2X66 A;  3OYZ A;  3JC6 C;  2CXD A;  1D0Z A;  4O4L E;  4O2A E;  1US7 B;  4BJM A;  5FXZ A;  2VL8 A;  3EDU A;  3PDY A;  2RP4 A;  2ZM2 A;  2KWI B;  3ZPO A;  4EZH A;  2CXF A;  4O4H E;  5L2L A;  5KDM C;  4JLE A;  5L3D B;  2EHO D;  3CML A;  3MK7 C;  3VKH A;  1BR2 A;  4WNK A;  2K24 A;  3C50 A;  2EHO C;  3LK2 B;  3LJC A;  3GA8 A;  4JEH B;  5LGU B;  3BQI A;  2CWY A;  1MMG A;  2X9H A;  4IE0 A;  5HAX A;  4BJN A;  4CXX A;  1ZKE A;  2CLY C;  4EAH A;  4H9Q C;  3CQC B;  4HKA A;  5FXV A;  4U72 A;  2LSG A;  1YW0 A;  1IJ6 A;  1WR6 A;  5FXW A;  3V5U A;  4UXN B;  4AQG A;  2K48 A;  3MZK B;  3O9X A;  3AVS A;  3N5L A;  4KBM B;  4IE4 A;  3N2G E;  2PJQ A;  2KLQ A;  2LOS A;  2Z6E A;  1G8X A;  4MBQ A;  4AXP A;  3F31 A;  4PJJ A;  2QA7 A;  3GN5 B;  2LHN A;  5JH7 E;  3PU3 A;  5FNV E;  3ZLI A;  1D1A A;  3T8O A;  5H6R B;  1ZEE A;  3AVR A;  2B1E A;  2MOZ A;  4GYS A;  3ZMZ B;  5L3E B;  3KFW X;  2YK0 A;  1U4Q A;  5KMG P;  1BR4 A;  3F57 A;  4EOZ B;  4N78 D;  2BZB A;  3KV9 A;  5IHY A;  4IIJ E;  2QGS A;  1LVK A;  3N9O A;  4P0B A;  4YJ3 E;  5HXR A;  5JDF A;  3KV6 A;  4GOU A;  4F6R C;  3P8C D;  1ZHC A;  3KVB A;  4MHC A;  2Y48 B;  4UVB B;  5TAO A;  1EZ3 A;  3CPZ A;  3PUG A;  2WM9 A;  3E0Z A;  2K5B B;  2WBL A;  4IDZ A;  2DNX A;  1O3X A;  2E8I A;  3PTR B;  5LHG B;  1LKX A;  2W0G A;  5JRC A;  2W63 A;  5LHH B;  1NAF A;  3MJX A;  4NUV A;  1VOM A;  2JJ9 A;  3B13 A;  4HGA A;  4TX5 A;  5JDN A;  4FI5 A;  3FXE B;  4ISS A;  3R84 B;  3J7Y q;  3HKE E;  1HG2 A;  1YKE B;  3AAI A;  1AJ3 A;  3AB3 B;  4A56 A;  4QHO A;  3NRX A;  4IHJ E;  4DBQ A;  4WBO A;  2GK9 A;  4GIW A;  1MMD A;  4HN9 A;  4CI1 B;  3C51 A;  3EDV A;  3VU7 H;  3HKD E;  2XAF B;  1UCU A;  2SPC A;  4CI2 B;  3LBX A;  4ERR A;  2MTQ A;  3QUJ A;  3MA9 A;  3NZQ A;  2X68 A;  3FBZ A;  3NRY A;  2M67 A;  2N9D A;  3AA7 B;  4ILU A;  3PUS A;  3ZN1 B;  4PJM A;  4PW8 A;  3UUN A;  1WYB A;  1HX8 A;  1WLX A;  5F3J A;  4ANJ A;  2JMH A;  4YLH A;  5JRC B;  2LSI A;  4ZS3 A;  4PK4 A;  4I50 E;  4TZ4 C;  3E08 A;  5ADX L;  5A1L A;  1FMV A;  2LJL A;  3N9Q A;  4CZZ B;  4AKR B;  3IBP A;  2E9X D;  4YFS A;  4XAX B;  4QWN B;  4MFR A;  3EVY A;  2E9X C;  3Q2M A;  4ZS2 A;  2ZLY A;  5LBM A;  1YD8 G;  2X9Y A;  4QX7 B;  1D1B A;  3SS1 A;  4DVD A;  5DJQ C;  3KIN B;  4X1I E;  3RKO A;  1WRD A;  2MYS A;  1D0Y A;  4ZI3 D;  2NP9 A;  3SRZ A;  3LBX B;  3LG7 A;  3SWH A;  4EYY R;  4X1K E;  4PJL A;  2L8K A;  3AA6 B;  2L3L A;  3OBV E;  2G0U A;  2C5I T;  5AFU L;  3BK9 A;  4ZI2 D;  4AI6 A;  2N2N A;  2PFV A;  3CX6 B;  3I9Y A;  2Q9Q D;  4XZC A;  2EHO B;  5JR9 C;  1IZN B;  4OYK A;  3GMI A;  1U5P A;  3O1I A;  2Q9Q C;  3D0T A;  4KUM B;  5C8Y E;  2CXL A;  2CM0 A;  2PG8 A;  1HF8 A;  2I59 A;  3ZMV B;  2CE7 A;  4WW0 A;  5EK3 A;  1KK7 A;  5LA6 E;  4E7Z A;  5HYA A;  5LG4 A;  2CA5 A;  2V7L A;  5HXH A;  3ZJ2 A;  5J1G A;  2X9W A;  3M65 A;  2XAJ B;  4UVA B;  5LCY A;  2ACX A;  2HPJ A;  2YEV C;  5FXX A;  5HXS A;  2CMR A;  1MND A;  3C4Z A;  2VK9 A;  4DBR A;  3UUL A;  2D2S A;  1MNE A;  3LFM A;  4IGU A;  4J2C A;  2KIN B;  4UF0 A;  5EK4 A;  3ZYK A;  5JDL A;  3HR0 A;  4CI3 B;  3RH3 A;  3AA1 B;  2VKH A;  4H63 V;  4H63 H;  4QXB B;  5LJN A;  4GK5 E;  1MIV A;  2HH7 A;  4EYU A;  3I1A A;  4QXH B;  2VKO A;  5DAB A;  3I0Q A;  3C98 B;  3VHL A;  3Q5W A;  4ZOL E;  3KBU A;  5E0O A;  3ZYM A;  2LT3 A;  2RA1 A;  5JDQ A;  3VKG A;  4UVC B;  5LYJ E;  3UUX B;  1QSD A;  2ZM8 A;  3P7I A;  4I55 E;  4EIW A;  3ONX A;  3IHR A;  3RX6 A;  3B57 A;  2C5J A;  2LE8 A;  3O4X E;  1FMW A;  4MLK A;  4CXW A;  4EXT A;  1VRB A;  1IAP A;  3RYC E;  2NW8 A;  4O2B E;  3CKD A;  5L3B B;  4HFV A;  2JRK A;  3C64 A;  4H9S E;  3U3I A;  3L3P A;  4GYR A;  2WWU A;  3PU8 A;  2IAK A;  2X0L B;  4ZHQ E;  3K3O A;  3ZMU B;  2VKJ A;  2LEH A;  3HA4 A;  3CX7 B;  1MMA A;  5CB4 E;  5BMV E;  3WI3 A;  4KP3 C;  4UF0 B;  4PK6 A;  2LSK A;  1FIO A;  2A2F X;  3K3N A;  3KDS E;  3OKQ A;  3RYF E;  2V7I A;  2LSY A;  3R6N A;  3N9N A;  3FXD B;  4X20 E;  1LRZ A;  1Y64 B;  2XTL A;  4TUY E;  5JVD E;  5LXT E;  3PUQ A;  2KZ7 B;  3CQG B;  1H7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...