4ILUA

Crystal structure of mycobacterium tuberculosis card
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
165
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALADAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase-binding transcription factor CarD
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 45
structure length 165
sequence length 169
ec nomenclature
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4iluA02
4ILUA 2LT3A 4KMCA 4XAXB 4L5GA 4MFRA 4KBMB
chains in the Genus database with same CATH superfamily
4U31A 2M6BA 5LNKA 5JDMA 2Z6EA 1IBKT 4TV9E 5HXCA 4PFOA 4TN7B 1BR0A 4H63H 1QSDA 2ODVA 2WU5A 2LM9A 1V9DA 2D9DA 3NRYA 5ABFB 3PUWF 4YT0A 3ANWA 3EDUA 1WYBA 3AA6B 3D0TA 1OEDB 4EIWA 2V7KA 2K5BB 2E2AA 3RQWA 2WU2A 4U7IA 3WAJA 4U7YA 3RC3A 2XY8B 3KV9A 3ZLIA 4HFIA 2D2SA 1HF8A 4X5TA 4ZZCA 3Q5XA 5LOVE 4IDOA 2NW9A 3LK3B 2HN1A 2W63A 3HKBE 2CWYA 3LJCA 2C5KT 2EHOC 2RPAA 4JUYA 4ADZA 4I4TE 2JQQA 4ZI2C 1MIYA 2W0GA 4DMVA 2X9XA 1CUNA 1MMGA 1ZHCA 4I0UA 4JEHB 3AE4A 3ZC0A 5HEOA 2CHNA 3HKCE 4WZXA 2X9YA 4LMJA 4PW8A 4U3CA 2C0SA 1MNDA 4QXBB 1YD8G 2JRKA 2L3LA 3PUAA 2DL1A 2VK9A 3N2GE 4U2YA 5AQUB 2K24A 2RA1A 4AIUA 4EZ4A 3ZCIA 5F8PA 5HYAA 5KX5E 4U74A 2YK0A 4DV4T 5HEUA 1MMDA 2J47A 5CGMA 4LF7T 4KMCA 4GYRA 2VB6A 3AECA 1T8BA 3O1IA 4IL4A 3RHWA 3CX6B 3AXJB 3L09A 2VURA 5IHYA 3OPCA 1IJ5A 4QKNA 3FZMB 3FZLB 4HFDA 3HKDE 2CBIA 2PFVA 5JDQA 1CHUA 2I6HA 2KXPB 4HTEA 3RQUA 4IE4A 5JR9A 5LYJE 2W66A 2N2NA 4X64T 1M7KA 4ZS3A 4ANJA 2HPLA 3CK6A 3V5SA 3RI5A 5HWXA 3KVBA 3Q5EA 4PFPA 2DWGA 2JQKA 3FZKB 3N2OA 4ZI3D 3Q9DA 4IDQA 4AKGA 4O4HE 3J9X1 2LSKA 4O2BE 2E9XD 4PJNA 3AE9A 3QB5K 4LF6T 3UUXB 5GONE 3T1YT 3I0QA 2XTLA 3RC8A 5J2TE 1LRZA 3RX6A 2CM0A 5JDNA 2VVSA 4BA9A 4ILCA 5LGNB 1E2AA 1T98A 2N9DA 2CXFA 2A2FX 4CN1A 4OYKA 3CIRA 3AEAA 4ASKA 2A72A 2QVAA 4L9IA 4G63A 3E22E 4PJLA 2BKNA 2D5UA 1G8XA 4O4LE 2WWVA 1UX4A 5JVDE 4AKIA 2Q9QB 4ZZBA 2OV9A 3RKOA 1SE7A 2BG9B 3K8PC 2NW8A 4Z90A 3QC9A 2IHR1 5JH7E 2OA5A 4AKRB 2CA5A 4H9NC 3UU6A 4UIGA 5LBQB 3PTRB 4UVCB 3Q5WA 3AA1B 3NBXX 1XMQT 5C8YE 5LCYA 2YEVC 3AE8A 2VWAA 5LXTE 5LA6E 4MLKA 2XQ8A 2BVLA 3DP7A 4UF0B 3SS1A 3TLUA 1N33T 3HKEE 2IDOB 4NXMT 2ZM0A 1MIWA 3F57A 4HFCA 3CX7B 1MMAA 4PJMA 1VCSA 2CEAA 2LSJA 4WW0A 2V5CA 4IL9A 1LKXA 4CI3B 2E8IA 2LLYA 3SRZA 2KT9A 4H9RC 2X0HA 2WBLA 4IT4A 4DBQA 5FXXA 2V7IA 4JEUB 1T7SA 4AISA 4AQFC 4BJMA 1UGOA 1U5PA 4DR4T 3MZKB 4GYSA 5CJ5A 1HTJF 4PK5A 2ZLYA 4UVAB 4TWFA 2H3RA 3RRWA 2Y8DA 2Q9QC 3TLVA 3M65A 2WSSV 3GN5A 4KBMB 3VKGA 2L9QA 2W62A 4WYVA 2ODUA 2BG9C 4M1PA 4CZZB 3RRCA 3T1HT 1WLXA 2VASA 3EUHA 4YTPA 2BS4A 3FB2A 3VR8A 4YLHA 2X9HA 1HCIA 3ZT5A 4DMWA 3RPUA 3O1JA 1UK5A 4IDNA 5L3FB 5IYZE 2ZM2A 2XSBA 3N5LA 5LBMA 3AA7B 3LK2B 2J62A 3K3QC 3X1DA 4IE5A 5ABEA 4IREA 3OJAA 1LVKA 4JI5T 3UU4A 5AQVB 4AQGA 4EAHA 4YY3T 4XBFB 5HXHA 2UXDT 2WMOA 3NVOA 3MJXA 5HXSA 4UR9A 1HNXT 3AAIA 2XQAA 5HAXA 5AQFB 1WCRA 4A56A 4CI2B 2CBJA 2WDVA 4OYJA 1O3XA 4DV5T 4KUMB 3AA0B 2KLQA 3AAEB 3GMIA 3UULA 2PJQA 1XZYA 2X67A 3ONJA 3QB5A 2NWBA 1XDOA 2WWUA 4B3RT 3N9MA 3PDYA 4HEAA 1S94A 3Q5DA 5AQKB 1T72A 4WBOA 2VL8A 4WNKA 3GN5B 3QUJA 3A7MA 3C4XA 1EZ3A 2KZ7B 4P0BA 5L3GB 2FJBA 2PTFA 4DNDA 3VR9A 1YKHB 3AEDA 1UUSA 1XDPA 4H9OC 5LHGB 2B1EA 4LF8T 2JQ9A 4L0RA 2MTQA 4X1YE 2A3DA 2LJLA 2GK9A 3H3MA 4P09A 4X1KE 3J7Yq 5H6RB 4ZOLE 4XAXB 4EZHA 5JRCA 5LB7B 3N2KE 3LDQB 3ZN1B 4DBRA 5JREA 1WYCA 4EGWA 2R6GF 1SHZC 3ESLA 1I6ZA 2DHRA 2W00A 2EHOD 1B7TA 3P50A 3UU3A 3WAKA 4ZI2D 2DI4A 4OX9T 4EYYR 4HWIB 5LGUB 3C4WA 4DV1T 2CHOA 3I9WA 2H7VC 5DQWA 2RP4A 3AE2A 4IGUA 3ABVA 1BR2A 5CA0E 2E9XA 3CQXC 2XSAA 1D1CA 4TV8E 2H88A 4NUUA 2BS2A 3P4WA 4GOUA 3PUSA 3U3IA 3ZYMA 5AQPB 5M4YA 3P4RA 2CLYB 2LOSA 3UQ7A 3RLFF 3MA9A 3ZYKA 4CXYA 4ILAA 4HFVA 4H63V 2VVNA 3OYXA 3I0OA 3ZMZB 1QUUA 2YN6A 2DCFA 2IAKA 4GKJT 2DLRA 5FVLA 1HX1B 5F5WA 4A5XA 1NAFA 1KNZA 4YTNA 4GKKT 3VHLA 5FY0A 1HR0T 4DV6T 4K0KT 3BK9A 5AQIB 5L47A 4PK4A 3RYCE 5L4EA 4YHHT 3ETVA 3HA4A 1ZV4X 2AE9A 3ANWB 3PJAJ 4TUYE 1JNRA 3RIUA 4LF5T 2BKPA 5LGTB 4YJ2E 1N32T 3P4PA 1S35A 5C2TA 3E08A 3CQCB 3N9PA 1W0BA 3AVRA 4V1Av 4MFRA 2KINB 1OEDC 3UUNA 5JQGE 2UXCT 4QH4A 2YU1A 1J5WA 2J1DG 2X0LB 5FL1A 4F6RC 3ZN0B 4I43B 3UT5E 2FUPA 4H9SE 2Y48B 1YXRA 3AEEA 4QXCB 2SPCA 4ISSA 1G73A 3OKQA 3KDSE 3OVUA 2CLYC 5KMGP 1US7B 3AVSA 3O4XE 3HI2A 3P8CD 4C91A 3IBPA 3AEGA 3NZQA 2XHEB 3V5UA 1YQ4A 2BBHA 3K3OA 5FKYA 4YSZA 4JBWF 3PU3A 3R84B 4ZEYA 3CVRA 5HWYA 2CXLA 1UURA 1E1HB 3ZC1A 3K1SA 5L4HA 4F8HA 3UUBA 3RYHE 4DR7T 4DVDA 3EDVA 3F2EA 5HXEA 2N1GA 4QH5A 1UX5A 1W9RA 2E5VA 4MHCA 5KDMC 2YDRA 2WY2A 5JR9B 3A5XA 2XAHB 2NTYA 3NKZA 1M62A 3S4UA 3PUXF 4HGAA 3ZSTA 4CXXA 2MYSA 5AQNB 5AQHB 4X1IE 4YFSA 4PK6A 3RIFA 3OYZA 2X9WA 5FXWA 5TAOA 4HWCA 2VL0A 1WR6A 2QA7A 2UUBT 2LHNA 1OWAA 5J2UE 4JI1T 4ZI7E 3N9QA 3UU8A 5IWAT 4DR1T 4AI6A 2JPFA 2KSRA 2XAFB 2V7MA 1H7CA 4TNWA 4DR5T 1GQEA 3C64A 2D0UA 2V7JA 2V6YA 4OHFA 4XZCA 5AQLB 5ETWA 2MAWA 2Q9QD 2VKJA 3PV0F 2ACXA 3FXEB 2NR4A 2LSIA 2LSGA 1HX8A 5E0OA 2FJEA 1FJGT 1ZEEA 3KV6A 2JMKA 3B5MA 2BDEA 5LP6E 4IDZA 3ZMTB 4FJOA 2ZM6T 3CWZB 5L3EB 3AE1A 4H9PC 4DUYT 1MNEA 3A8YC 5L3DB 3QNUA 2B76A 1I94T 3UQ4A 2NTXA 3RKGA 4LFBT 2LKHA 2Y6XA 4PNIA 4GK0E 2VKHA 4ERRA 4HFEA 3ZMUB 2OLTA 4U72A 5EK3A 3P7IA 4I50E 5JTGA 3P4QA 4CN6A 3QOFA 3U78A 5JR9C 2H89A 3LBXA 2LRLA 5ADXL 2QGSA 4Z91A 3W15B 2XQ7A 3CX8B 3G06A 2X51A 2C5IT 3KBUA 1Y01A 3B57A 3K3NA 1WR0A 2NOXA 4TX5A 3UFGA 5JDGA 4QH1A 1ZKEA 3HL6A 5JDFA 1KFYA 5HCJA 2WMNA 2VKDA 5FL0A 1X9BA 2EHOA 3ZMSB 3GA8A 5LG3A 2HPJA 2FBWA 5LJMA 2JIWA 1BR1A 1FIOA 3LG7A 5AQOB 2WP9A 4YXDA 5F3JA 2IC9A 5JDHA 3MKDA 4B3ST 2KWIB 3DJBA 4QHOA 1R8IA 1SUMB 2IIUA 4EOZB 4IIJE 4IHJE 1MMNA 5A1LA 2LT3A 4O4IE 3E0ZA 4BJNA 1J1JA 2KNDA 2WB5A 4JI7T 1U4QA 3N9LA 3ZSSA 1WRDA 2CWOA 2H7OA 4TWHA 5DABA 4YJ3E 4O2AE 3JADA 2V1DB 3HR0A 3FHNA 3IHRA 2VKOA 3TLWA 5ABFA 4J2CA 1W09A 2K9AA 3FXDB 3OTOT 3MACA 5LHHB 2V8SV 5BR8T 4GIWA 2MOZA 3ETUA 5AQTB 3ZJ1A 1Z0PA 2WS3A 5LG4A 4PJJA 2QRXA 3L8RA 5ABHA 3BQIA 5HEHA 4OK0A 4JI2T 5CA1E 4DV7T 1E7PA 2PG8A 2XASB 3JC6C 1N34T 1NENA 3CMLA 3ZEFB 3RYIE 2P9BA 5FYMA 2E5LT 4AKHA 4N78D 3VU7H 3OBVE 3FZFB 3TLTA 3MK7C 3C98B 3ZT7A 1YW0A 4YSYA 5EZYE 3JAFA 4O8SA 1ZOYA 4JI4T 4EYUA 4B3MT 3EI0A 3FZHB 3N9NA 3AE3A 5AFUL 4UVBB 4L5GA 3TLSA 4HWFA 1HNZT 2W4XA 4DV2T 3AAAB 4YHJA 3CQGB 4QWNB 2LOPA 1IBMT 3IF8B 3AB3B 4ZS2A 1FMVA 4KI0F 2LKGA 1HS7A 3DTOA 1OEDE 4MALA 2UU9T 2LEHA 5AQGB 2XPKA 2XQ3A 2KMFA 2LRKA 3AXJA 4JI0T 5FY1A 5LHIB 4LF4T 4DR6T 4HKAA 1Y64B 2WQYA 4LMKA 4NIQA 1IJ6A 3WI3A 2ZM8A 3PUYF 5FY7A 2AXDS 3EAMA 2WM9A 2DWKA 4JYAT 3ONXA 4E7ZA 3KVAA 2ACZA 3H3AA 4ISTA 5JDLA 4NUVA 4A98A 5JRCB 4CI1B 2YU2A 4PAGA 2ES0A 3ZKRA 2CRBA 4U2ZA 4TWDA 4G2AA 3FBLA 2IUBA 1W0AA 3PUZF 2D0TA 2XQ6A 4HFBA 2XUEA 3QK6A 5LJNA 4Z8XA 2HH7A 4FI5A 4DR3T 5LMUT 4CN4A 2PBIA 5ABGA 3PJAA 3P4SA 5J0ZA 3ZYLA 2CPTA 2WZHA 3RIAA 4LFAT 5AQJB 3SFEA 3MXZA 5IUXA 3O9XA 4H9QC 4ZHQE 4ILBA 3C4ZA 3BQKA 2XAGB 3PUGA 2NP9A 2A9UA 2ZMAA 1L0VA 4AXPA 5BMVE 2E9XB 1VRBA 4DV3T 2X68A 4AQFA 4JI8T 5FNVE 5FP3A 3C51A 1WFDA 2YKSA 5FXVA 1QLBA 3AE7A 4COFA 4CXWA 3KBTA 3JCFA 2Q9QA 3ZJ2A 4P1NA 3C50A 2WZIA 3RF1A 3ZMVB 3UFEA 3PUVF 2XQ5A 2BG9A 3AE5A 3R6NA 4DO0A 4UV8B 1IBLT 4WBNE 2WDRA 1Z8UA 2M67A 2IC6A 3PUQA 4AKLA 4EEBA 5DQVA 2C5JA 2V6XA 4IE6A 4AQYT 4LMLA 1XMOT 3PE0A 2WCAA 1KNPA 4JV5T 1NEKA 4BAYB 4UF0A 2XM2A 2K3WA 1OXZA 4IDPA 2NW7A 4K0UA 3O1HA 2JJ9A 2XQ4A 3NZPA 4U33A 5L3BB 2CE7A 4P0AA 2XJ7A 3KINB 3PURA 3RYFE 3H37A 3SOLA 5CFBA 2XQ9A 2FJAA 3ZPOA 4HE8A 2QYWA 4ZI3C 1NWMX 2W61A 1FMWA 2CXDA 4I55E 1D0XA 1YQ3A 2XZEA 2E9XC 1D1AA 3PU8A 4ILUA 3T8OA 2BG9E 3VKHA 3ZT6A 4HWDA 4ZXLA 4X65T 4NXNT 1N36T 1IZNB 2X66A 4UEMA 4MBQA 5L3CB 3LFMA 3IA3A 4QX8B 1KEYA 3EABA 5HCMA 2HHHT 4A97A 2JQHA 2IMLA 4Q25A 1UCUA 1XWMA 2BBJA 2CCQA 3L39A 2BZBA 3LK42 2M6IA 2LM2A 2WDQA 4HN9A 5KXJA 2UXNB 1KK7A 4UV9B 2XAJB 5AQSB 1J5ET 3F31A 4CQIA 5FVKA 3AEBA 5FMNA 3KV4A 3KV5A 5LMNT 5L2LA 4KHPT 3TKLB 1XNQT 4KX6A 3UTKA 1AJ3A 1BR4A 3NRXA 3I9YA 2X0YA 1HG2A 4QX7B 3RIUC 4NPPA 4O4JE 4QXHB 5DJQC 5AQMB 2CMRA 4YSXA 2BS3A 2BKOA 3RGLA 1D1BA 5H6QB 3L3PA 1JNZA 2IW5B 3RH3A 2I0MA 2UUCT 1DU2A 3AEFA 2F4VT 4EXTA 5J1GA 4JLEA 3UUMA 4HWHA 5AQQB 1HNWT 4JI6T 4X62T 2KWHA 3N9OA 3FBZA 4EB6E 2V5DA 1LVFA 3VRAA 5C3JA 2YDQA 2YOEA 2G0UA 4LF9T 1XNRT 2V6YB 3SWHA 2VQET 2W2UA 4IE7A 2YINA 4GK5E 2UXXB 5HEGA 4KP3C 2MBGA 3M3ZB 3EVYA 3KFWX 1HFAA 1YKEB 1KNRA 2HN2A 3NWIA 5HXRA 2L8KA 3ZCJA 1VCTA 4LFCT 2W67A 2UXBT 2K48A 4DUZT 5FXZA 5EK4A 1MIVA 2DNXA 2I59A 1KF6A 2JMHA 2LHRA 2V26A 3ONLC 2LE8A 4YTMA 4UELA 3JC6D 4C90A 2UUAT 4IE0A 4KHZF 1D0YA 5AQRB 1FEWA 1ZP0A 5HEJA 3I1AA 3Q2MA 4JI3T 3LBXB 3CPZA 4EEDA 3UU5A 4HFHA 3SFDA 2V7LA 1OEDA 4DR2T 5CB4E 3AE6A 1VOMA 2VQFT 2J4GA 1IAPA 4TNVA 3B13A 1D0ZA 2XAQB 3IEEA 4B3TT 2MPKA 1HG5A 1SA0E 4DIDB 2WAUA 3CKDA 2EHOB 2XM1A 3BQLA 2YDSA 2LSYA 3VRBA 4B6XA 4UXNB 3JAEA 4TZ4C 4DV0T 4OFZA 3GWHA 2XQYA 4X66T 3EHZA 1X79A 5EK2A 2BVMA 4E7SA 2FJDA 3LSVA 4X20E 4EV6A
chains in the Genus database with same CATH topology
3C4ZA 2X9HA 2XAGB 3BQKA 3PUGA 2NP9A 2ZMAA 1HCIA 4PK6A 3OYZA 4AXPA 4DMWA 5BMVE 2E9XB 5JDMA 2Z6EA 1VRBA 3O1JA 2X9WA 3RPUA 5LNKA 4TV9E 5FXWA 5TAOA 2X68A 5HXCA 4PFOA 4AQFA 5FNVE 1WR6A 2QA7A 4TN7B 5FP3A 5L3FB 5IYZE 1BR0A 2LHNA 1OWAA 5J2UE 3C51A 2ZM2A 4H63H 3N5LA 5LBMA 3AA7B 3LK2B 1QSDA 2ODVA 4ZI7E 3K3QC 5FXVA 4IE5A 3N9QA 2LM9A 3OJAA 1LVKA 4AQGA 1V9DA 4AI6A 4EAHA 2JPFA 4CXWA 3KBTA 4XBFB 5HXHA 2WMOA 3NRYA 2XAFB 2Q9QA 3MJXA 3ZJ2A 5HXSA 2V7MA 3ANWA 3C50A 1H7CA 3AAIA 5HAXA 3EDUA 1WYBA 3AA6B 3C64A 3ZMVB 3D0TA 2D0UA 4A56A 4CI2B 3UFEA 4EIWA 2V7JA 2V7KA 2K5BB 4OHFA 4XZCA 5ETWA 4OYJA 3R6NA 1O3XA 2Q9QD 2VKJA 3WAJA 2ACXA 3FXEB 4UV8B 4DO0A 4WBNE 3RC3A 2LSIA 4KUMB 3AA0B 3KV9A 2KLQA 3ZLIA 2M67A 3AAEB 3GMIA 2D2SA 2IC6A 2LSGA 1HX8A 2PJQA 2X67A 3UULA 3PUQA 4AKLA 5E0OA 1ZEEA 2NWBA 2WWUA 3KV6A 1HF8A 5DQVA 2C5JA 3N9MA 3PDYA 2JMKA 3Q5XA 5LOVE 2BDEA 5LP6E 2NW9A 4HEAA 4IE6A 3LK3B 4IDZA 2W63A 3HKBE 3ZMTB 2CWYA 1S94A 3LJCA 4FJOA 3CWZB 5L3EB 3PE0A 2C5KT 4H9PC 1MNEA 2EHOC 4JUYA 4BAYB 5L3DB 4WBOA 4UF0A 4ADZA 4I4TE 2JQQA 2VL8A 4WNKA 1OXZA 3GN5B 2NW7A 3QUJA 2NTXA 3O1HA 4K0UA 1MIYA 3C4XA 4ZI2C 1EZ3A 2JJ9A 2W0GA 4PNIA 2Y6XA 3NZPA 2KZ7B 4P0BA 5L3BB 2CE7A 5L3GB 4DMVA 2X9XA 4GK0E 2VKHA 4ERRA 1CUNA 3ZMUB 4U72A 1MMGA 1ZHCA 5EK3A 4JEHB 4DNDA 4P0AA 1YKHB 3ZC0A 3P7IA 4I50E 3HKCE 2X9YA 3KINB 4PW8A 2C0SA 3PURA 1MNDA 4H9OC 4QXBB 3RYFE 2B1EA 5LHGB 1YD8G 3H37A 3SOLA 3U78A 5JR9C 2JRKA 3LBXA 5ADXL 2QGSA 3ZPOA 2L3LA 2MTQA 3PUAA 4L0RA 3W15B 4HE8A 4X1YE 3CX8B 2A3DA 2VK9A 2LJLA 3N2GE 2X51A 2C5IT 2GK9A 4P09A 4X1KE 3J7Yq 5H6RB 4ZOLE 4ZI3C 3KBUA 2K24A 2RA1A 3B57A 1NWMX 3K3NA 2W61A 1FMWA 2CXDA 2NOXA 4TX5A 3ZCIA 4EZ4A 5F8PA 4I55E 5HYAA 4U74A 5KX5E 1D0XA 2YK0A 2E9XC 4XAXB 5JDGA 4EZHA 1ZKEA 3HL6A 1D1AA 3PU8A 1MMDA 5JDFA 5JRCA 4ILUA 3T8OA 4KMCA 4GYRA 3N2KE 2VB6A 2WMNA 2VKDA 2EHOA 3ZMSB 3GA8A 3O1IA 2HPJA 3ZN1B 4DBRA 5JREA 3VKHA 1WYCA 3CX6B 1SHZC 3ESLA 3L09A 5LJMA 1BR1A 1IZNB 5IHYA 1FIOA 2X66A 3LG7A 1IJ5A 2DHRA 4QKNA 4UEMA 4MBQA 5L3CB 2W00A 3LFMA 2EHOD 5F3JA 4QX8B 2IC9A 1B7TA 5JDHA 3HKDE 3MKDA 3WAKA 2PFVA 5JDQA 4ZI2D 2KWIB 3DJBA 2DI4A 2KXPB 4HTEA 4QHOA 4IE4A 5JR9A 4EYYR 5LYJE 4EOZB 4IIJE 1UCUA 4IHJE 2N2NA 1MMNA 5A1LA 5LGUB 4ZS3A 2LT3A 2CCQA 4O4IE 4ANJA 2HPLA 3C4WA 2BZBA 3LK42 3I9WA 2H7VC 3V5SA 5DQWA 2RP4A 3E0ZA 4HN9A 4IGUA 5HWXA 3KVBA 4PFPA 1BR2A 5CA0E 2E9XA 3CQXC 2UXNB 1KK7A 4UV9B 4BJNA 2DWGA 1D1CA 4TV8E 2XAJB 3N2OA 4ZI3D 3Q9DA 4NUUA 4AKGA 2KNDA 3F31A 4GOUA 4O4HE 4CQIA 1U4QA 3J9X1 3N9LA 2LSKA 4O2BE 1WRDA 2CWOA 2H7OA 2E9XD 3PUSA 4YJ3E 3KV4A 4O2AE 5DABA 5FMNA 3U3IA 2V1DB 3ZYMA 3HR0A 3KV5A 4PJNA 5L2LA 3FHNA 3IHRA 3TKLB 5M4YA 3UTKA 1AJ3A 1BR4A 2CLYB 2LOSA 2VKOA 3NRXA 3UUXB 5GONE 3I9YA 3MA9A 4J2CA 1HG2A 3ZYKA 4CXYA 2K9AA 3FXDB 3MACA 4QX7B 3I0QA 5LHHB 2XTLA 3RC8A 5J2TE 1LRZA 4GIWA 4HFVA 4O4JE 2MOZA 2CM0A 4H63V 3OYXA 4QXHB 3ETUA 5DJQC 3RX6A 3ZJ1A 4BA9A 5JDNA 5LGNB 2CMRA 3I0OA 1T98A 1Z0PA 1D1BA 1QUUA 2N9DA 3ZMZB 5LG4A 2DCFA 4PJJA 2CXFA 2IAKA 2A2FX 5H6QB 2DLRA 3L3PA 4OYKA 2IW5B 3BQIA 3RH3A 4ASKA 2A72A 4OK0A 1NAFA 5CA1E 4L9IA 2PG8A 2XASB 3JC6C 4EXTA 5J1GA 1KNZA 3VHLA 4G63A 3CMLA 5FY0A 4JLEA 3UUMA 3ZEFB 3RYIE 3E22E 2P9BA 4PJLA 5FYMA 3BK9A 2D5UA 1G8XA 4O4LE 4AKHA 4PK4A 2KWHA 1UX4A 4N78D 3VU7H 3RYCE 3OBVE 5JVDE 3N9OA 3FBZA 3MK7C 4AKIA 4EB6E 3C98B 1YW0A 2Q9QB 3ETVA 5EZYE 1LVFA 3HA4A 4O8SA 1ZV4X 3ANWB 3RKOA 4TUYE 2G0UA 4EYUA 3SWHA 5LGTB 4YJ2E 3N9NA 4IE7A 1S35A 2YINA 4GK5E 5AFUL 2UXXB 3K8PC 4L5GA 2NW8A 4UVBB 3E08A 3AAAB 3CQCB 3QC9A 3N9PA 4YHJA 4KP3C 5JH7E 3AVRA 4V1Av 2OA5A 2MBGA 4MFRA 2KINB 3CQGB 4AKRB 4ZHQE 3EVYA 4QWNB 3UUNA 2LOPA 3KFWX 3IF8B 1HFAA 2CA5A 4H9NC 5JQGE 1YKEB 4UIGA 2YU1A 5LBQB 3PTRB 2J1DG 4UVCB 3AB3B 3Q5WA 2X0LB 3AA1B 5HXRA 4ZS2A 2L8KA 3NBXX 1FMVA 3ZCJA 5C8YE 4F6RC 3ZN0B 4I43B 5LCYA 2YEVC 1HS7A 3DTOA 2VWAA 2K48A 4MALA 5LXTE 2LEHA 5LA6E 3UT5E 5FXZA 5EK4A 4MLKA 4H9SE 1MIVA 2Y48B 2BVLA 2DNXA 2I59A 2JMHA 2LHRA 2V26A 3DP7A 2KMFA 2LE8A 4UF0B 3SS1A 4UELA 3JC6D 4C90A 4QXCB 4IE0A 2SPCA 3HKEE 4ISSA 1G73A 3OKQA 3KDSE 2CLYC 2ZM0A 5FY1A 1D0YA 1MIWA 5LHIB 5KMGP 1US7B 1FEWA 3AVSA 3F57A 4HKAA 1Y64B 3O4XE 3I1AA 3HI2A 3CX7B 1MMAA 4PJMA 1IJ6A 3P8CD 3Q2MA 3WI3A 4C91A 2CEAA 2LSJA 4WW0A 2ZM8A 3IBPA 3LBXB 3CPZA 1LKXA 3NZQA 4CI3B 2XHEB 2V7LA 5FY7A 3V5UA 2E8IA 2WM9A 2DWKA 3K3OA 5CB4E 3SRZA 1VOMA 2KT9A 3ONXA 1IAPA 4E7ZA 3KVAA 4H9RC 2WBLA 3H3AA 3B13A 3PU3A 4ISTA 5JDLA 1D0ZA 2XAQB 3IEEA 3R84B 4DBQA 5FXXA 3CVRA 2V7IA 4JEUB 4NUVA 1HG5A 1SA0E 5JRCB 5HWYA 4CI1B 2YU2A 4AQFC 4PAGA 2CXLA 2ES0A 2WAUA 4BJMA 1E1HB 3CKDA 2EHOB 3FBLA 4G2AA 1U5PA 3ZC1A 3BQLA 3MZKB 4GYSA 2LSYA 2D0TA 4B6XA 3RYHE 1HTJF 4PK5A 4UXNB 4TZ4C 2ZLYA 2XUEA 4DVDA 3EDVA 3QK6A 3F2EA 4UVAB 5HXEA 2H3RA 5LJNA 3RRWA 4Z8XA 2Y8DA 2HH7A 2Q9QC 4FI5A 4OFZA 3M65A 3GWHA 2N1GA 2PBIA 2XQYA 1UX5A 2WSSV 3GN5A 4KBMB 3ZYLA 3VKGA 4MHCA 2L9QA 2W62A 5KDMC 2ODUA 5JR9B 3A5XA 2XAHB 2NTYA 1X79A 4M1PA 3S4UA 5EK2A 2BVMA 4CZZB 3RRCA 4E7SA 4HGAA 4CXXA 1WLXA 2VASA 3EUHA 2MYSA 3MXZA 3FB2A 3O9XA 4YLHA 4X1IE 4H9QC 4X20E 4YFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILU A;  2LT3 A;  4KMC A;  4XAX B;  4L5G A;  4MFR A;  4KBM B; 
#chains in the Genus database with same CATH topology
 4U31 A;  2M6B A;  5LNK A;  5JDM A;  2Z6E A;  1IBK T;  4TV9 E;  5HXC A;  4PFO A;  4TN7 B;  1BR0 A;  4H63 H;  1QSD A;  2ODV A;  2WU5 A;  2LM9 A;  1V9D A;  2D9D A;  3NRY A;  5ABF B;  3PUW F;  4YT0 A;  3ANW A;  3EDU A;  1WYB A;  3AA6 B;  3D0T A;  1OED B;  4EIW A;  2V7K A;  2K5B B;  2E2A A;  3RQW A;  2WU2 A;  4U7I A;  3WAJ A;  4U7Y A;  3RC3 A;  2XY8 B;  3KV9 A;  3ZLI A;  4HFI A;  2D2S A;  1HF8 A;  4X5T A;  4ZZC A;  3Q5X A;  5LOV E;  4IDO A;  2NW9 A;  3LK3 B;  2HN1 A;  2W63 A;  3HKB E;  2CWY A;  3LJC A;  2C5K T;  2EHO C;  2RPA A;  4JUY A;  4ADZ A;  4I4T E;  2JQQ A;  4ZI2 C;  1MIY A;  2W0G A;  4DMV A;  2X9X A;  1CUN A;  1MMG A;  1ZHC A;  4I0U A;  4JEH B;  3AE4 A;  3ZC0 A;  5HEO A;  2CHN A;  3HKC E;  4WZX A;  2X9Y A;  4LMJ A;  4PW8 A;  4U3C A;  2C0S A;  1MND A;  4QXB B;  1YD8 G;  2JRK A;  2L3L A;  3PUA A;  2DL1 A;  2VK9 A;  3N2G E;  4U2Y A;  5AQU B;  2K24 A;  2RA1 A;  4AIU A;  4EZ4 A;  3ZCI A;  5F8P A;  5HYA A;  5KX5 E;  4U74 A;  2YK0 A;  4DV4 T;  5HEU A;  1MMD A;  2J47 A;  5CGM A;  4LF7 T;  4KMC A;  4GYR A;  2VB6 A;  3AEC A;  1T8B A;  3O1I A;  4IL4 A;  3RHW A;  3CX6 B;  3AXJ B;  3L09 A;  2VUR A;  5IHY A;  3OPC A;  1IJ5 A;  4QKN A;  3FZM B;  3FZL B;  4HFD A;  3HKD E;  2CBI A;  2PFV A;  5JDQ A;  1CHU A;  2I6H A;  2KXP B;  4HTE A;  3RQU A;  4IE4 A;  5JR9 A;  5LYJ E;  2W66 A;  2N2N A;  4X64 T;  1M7K A;  4ZS3 A;  4ANJ A;  2HPL A;  3CK6 A;  3V5S A;  3RI5 A;  5HWX A;  3KVB A;  3Q5E A;  4PFP A;  2DWG A;  2JQK A;  3FZK B;  3N2O A;  4ZI3 D;  3Q9D A;  4IDQ A;  4AKG A;  4O4H E;  3J9X 1;  2LSK A;  4O2B E;  2E9X D;  4PJN A;  3AE9 A;  3QB5 K;  4LF6 T;  3UUX B;  5GON E;  3T1Y T;  3I0Q A;  2XTL A;  3RC8 A;  5J2T E;  1LRZ A;  3RX6 A;  2CM0 A;  5JDN A;  2VVS A;  4BA9 A;  4ILC A;  5LGN B;  1E2A A;  1T98 A;  2N9D A;  2CXF A;  2A2F X;  4CN1 A;  4OYK A;  3CIR A;  3AEA A;  4ASK A;  2A72 A;  2QVA A;  4L9I A;  4G63 A;  3E22 E;  4PJL A;  2BKN A;  2D5U A;  1G8X A;  4O4L E;  2WWV A;  1UX4 A;  5JVD E;  4AKI A;  2Q9Q B;  4ZZB A;  2OV9 A;  3RKO A;  1SE7 A;  2BG9 B;  3K8P C;  2NW8 A;  4Z90 A;  3QC9 A;  2IHR 1;  5JH7 E;  2OA5 A;  4AKR B;  2CA5 A;  4H9N C;  3UU6 A;  4UIG A;  5LBQ B;  3PTR B;  4UVC B;  3Q5W A;  3AA1 B;  3NBX X;  1XMQ T;  5C8Y E;  5LCY A;  2YEV C;  3AE8 A;  2VWA A;  5LXT E;  5LA6 E;  4MLK A;  2XQ8 A;  2BVL A;  3DP7 A;  4UF0 B;  3SS1 A;  3TLU A;  1N33 T;  3HKE E;  2IDO B;  4NXM T;  2ZM0 A;  1MIW A;  3F57 A;  4HFC A;  3CX7 B;  1MMA A;  4PJM A;  1VCS A;  2CEA A;  2LSJ A;  4WW0 A;  2V5C A;  4IL9 A;  1LKX A;  4CI3 B;  2E8I A;  2LLY A;  3SRZ A;  2KT9 A;  4H9R C;  2X0H A;  2WBL A;  4IT4 A;  4DBQ A;  5FXX A;  2V7I A;  4JEU B;  1T7S A;  4AIS A;  4AQF C;  4BJM A;  1UGO A;  1U5P A;  4DR4 T;  3MZK B;  4GYS A;  5CJ5 A;  1HTJ F;  4PK5 A;  2ZLY A;  4UVA B;  4TWF A;  2H3R A;  3RRW A;  2Y8D A;  2Q9Q C;  3TLV A;  3M65 A;  2WSS V;  3GN5 A;  4KBM B;  3VKG A;  2L9Q A;  2W62 A;  4WYV A;  2ODU A;  2BG9 C;  4M1P A;  4CZZ B;  3RRC A;  3T1H T;  1WLX A;  2VAS A;  3EUH A;  4YTP A;  2BS4 A;  3FB2 A;  3VR8 A;  4YLH A;  2X9H A;  1HCI A;  3ZT5 A;  4DMW A;  3RPU A;  3O1J A;  1UK5 A;  4IDN A;  5L3F B;  5IYZ E;  2ZM2 A;  2XSB A;  3N5L A;  5LBM A;  3AA7 B;  3LK2 B;  2J62 A;  3K3Q C;  3X1D A;  4IE5 A;  5ABE A;  4IRE A;  3OJA A;  1LVK A;  4JI5 T;  3UU4 A;  5AQV B;  4AQG A;  4EAH A;  4YY3 T;  4XBF B;  5HXH A;  2UXD T;  2WMO A;  3NVO A;  3MJX A;  5HXS A;  4UR9 A;  1HNX T;  3AAI A;  2XQA A;  5HAX A;  5AQF B;  1WCR A;  4A56 A;  4CI2 B;  2CBJ A;  2WDV A;  4OYJ A;  1O3X A;  4DV5 T;  4KUM B;  3AA0 B;  2KLQ A;  3AAE B;  3GMI A;  3UUL A;  2PJQ A;  1XZY A;  2X67 A;  3ONJ A;  3QB5 A;  2NWB A;  1XDO A;  2WWU A;  4B3R T;  3N9M A;  3PDY A;  4HEA A;  1S94 A;  3Q5D A;  5AQK B;  1T72 A;  4WBO A;  2VL8 A;  4WNK A;  3GN5 B;  3QUJ A;  3A7M A;  3C4X A;  1EZ3 A;  2KZ7 B;  4P0B A;  5L3G B;  2FJB A;  2PTF A;  4DND A;  3VR9 A;  1YKH B;  3AED A;  1UUS A;  1XDP A;  4H9O C;  5LHG B;  2B1E A;  4LF8 T;  2JQ9 A;  4L0R A;  2MTQ A;  4X1Y E;  2A3D A;  2LJL A;  2GK9 A;  3H3M A;  4P09 A;  4X1K E;  3J7Y q;  5H6R B;  4ZOL E;  4XAX B;  4EZH A;  5JRC A;  5LB7 B;  3N2K E;  3LDQ B;  3ZN1 B;  4DBR A;  5JRE A;  1WYC A;  4EGW A;  2R6G F;  1SHZ C;  3ESL A;  1I6Z A;  2DHR A;  2W00 A;  2EHO D;  1B7T A;  3P50 A;  3UU3 A;  3WAK A;  4ZI2 D;  2DI4 A;  4OX9 T;  4EYY R;  4HWI B;  5LGU B;  3C4W A;  4DV1 T;  2CHO A;  3I9W A;  2H7V C;  5DQW A;  2RP4 A;  3AE2 A;  4IGU A;  3ABV A;  1BR2 A;  5CA0 E;  2E9X A;  3CQX C;  2XSA A;  1D1C A;  4TV8 E;  2H88 A;  4NUU A;  2BS2 A;  3P4W A;  4GOU A;  3PUS A;  3U3I A;  3ZYM A;  5AQP B;  5M4Y A;  3P4R A;  2CLY B;  2LOS A;  3UQ7 A;  3RLF F;  3MA9 A;  3ZYK A;  4CXY A;  4ILA A;  4HFV A;  4H63 V;  2VVN A;  3OYX A;  3I0O A;  3ZMZ B;  1QUU A;  2YN6 A;  2DCF A;  2IAK A;  4GKJ T;  2DLR A;  5FVL A;  1HX1 B;  5F5W A;  4A5X A;  1NAF A;  1KNZ A;  4YTN A;  4GKK T;  3VHL A;  5FY0 A;  1HR0 T;  4DV6 T;  4K0K T;  3BK9 A;  5AQI B;  5L47 A;  4PK4 A;  3RYC E;  5L4E A;  4YHH T;  3ETV A;  3HA4 A;  1ZV4 X;  2AE9 A;  3ANW B;  3PJA J;  4TUY E;  1JNR A;  3RIU A;  4LF5 T;  2BKP A;  5LGT B;  4YJ2 E;  1N32 T;  3P4P A;  1S35 A;  5C2T A;  3E08 A;  3CQC B;  3N9P A;  1W0B A;  3AVR A;  4V1A v;  4MFR A;  2KIN B;  1OED C;  3UUN A;  5JQG E;  2UXC T;  4QH4 A;  2YU1 A;  1J5W A;  2J1D G;  2X0L B;  5FL1 A;  4F6R C;  3ZN0 B;  4I43 B;  3UT5 E;  2FUP A;  4H9S E;  2Y48 B;  1YXR A;  3AEE A;  4QXC B;  2SPC A;  4ISS A;  1G73 A;  3OKQ A;  3KDS E;  3OVU A;  2CLY C;  5KMG P;  1US7 B;  3AVS A;  3O4X E;  3HI2 A;  3P8C D;  4C91 A;  3IBP A;  3AEG A;  3NZQ A;  2XHE B;  3V5U A;  1YQ4 A;  2BBH A;  3K3O A;  5FKY A;  4YSZ A;  4JBW F;  3PU3 A;  3R84 B;  4ZEY A;  3CVR A;  5HWY A;  2CXL A;  1UUR A;  1E1H B;  3ZC1 A;  3K1S A;  5L4H A;  4F8H A;  3UUB A;  3RYH E;  4DR7 T;  4DVD A;  3EDV A;  3F2E A;  5HXE A;  2N1G A;  4QH5 A;  1UX5 A;  1W9R A;  2E5V A;  4MHC A;  5KDM C;  2YDR A;  2WY2 A;  5JR9 B;  3A5X A;  2XAH B;  2NTY A;  3NKZ A;  1M62 A;  3S4U A;  3PUX F;  4HGA A;  3ZST A;  4CXX A;  2MYS A;  5AQN B;  5AQH B;  4X1I E;  4YFS A;  4PK6 A;  3RIF A;  3OYZ A;  2X9W A;  5FXW A;  5TAO A;  4HWC A;  2VL0 A;  1WR6 A;  2QA7 A;  2UUB T;  2LHN A;  1OWA A;  5J2U E;  4JI1 T;  4ZI7 E;  3N9Q A;  3UU8 A;  5IWA T;  4DR1 T;  4AI6 A;  2JPF A;  2KSR A;  2XAF B;  2V7M A;  1H7C A;  4TNW A;  4DR5 T;  1GQE A;  3C64 A;  2D0U A;  2V7J A;  2V6Y A;  4OHF A;  4XZC A;  5AQL B;  5ETW A;  2MAW A;  2Q9Q D;  2VKJ A;  3PV0 F;  2ACX A;  3FXE B;  2NR4 A;  2LSI A;  2LSG A;  1HX8 A;  5E0O A;  2FJE A;  1FJG T;  1ZEE A;  3KV6 A;  2JMK A;  3B5M A;  2BDE A;  5LP6 E;  4IDZ A;  3ZMT B;  4FJO A;  2ZM6 T;  3CWZ B;  5L3E B;  3AE1 A;  4H9P C;  4DUY T;  1MNE A;  3A8Y C;  5L3D B;  3QNU A;  2B76 A;  1I94 T;  3UQ4 A;  2NTX A;  3RKG A;  4LFB T;  2LKH A;  2Y6X A;  4PNI A;  4GK0 E;  2VKH A;  4ERR A;  4HFE A;  3ZMU B;  2OLT A;  4U72 A;  5EK3 A;  3P7I A;  4I50 E;  5JTG A;  3P4Q A;  4CN6 A;  3QOF A;  3U78 A;  5JR9 C;  2H89 A;  3LBX A;  2LRL A;  5ADX L;  2QGS A;  4Z91 A;  3W15 B;  2XQ7 A;  3CX8 B;  3G06 A;  2X51 A;  2C5I T;  3KBU A;  1Y01 A;  3B57 A;  3K3N A;  1WR0 A;  2NOX A;  4TX5 A;  3UFG A;  5JDG A;  4QH1 A;  1ZKE A;  3HL6 A;  5JDF A;  1KFY A;  5HCJ A;  2WMN A;  2VKD A;  5FL0 A;  1X9B A;  2EHO A;  3ZMS B;  3GA8 A;  5LG3 A;  2HPJ A;  2FBW A;  5LJM A;  2JIW A;  1BR1 A;  1FIO A;  3LG7 A;  5AQO B;  2WP9 A;  4YXD A;  5F3J A;  2IC9 A;  5JDH A;  3MKD A;  4B3S T;  2KWI B;  3DJB A;  4QHO A;  1R8I A;  1SUM B;  2IIU A;  4EOZ B;  4IIJ E;  4IHJ E;  1MMN A;  5A1L A;  2LT3 A;  4O4I E;  3E0Z A;  4BJN A;  1J1J A;  2KND A;  2WB5 A;  4JI7 T;  1U4Q A;  3N9L A;  3ZSS A;  1WRD A;  2CWO A;  2H7O A;  4TWH A;  5DAB A;  4YJ3 E;  4O2A E;  3JAD A;  2V1D B;  3HR0 A;  3FHN A;  3IHR A;  2VKO A;  3TLW A;  5ABF A;  4J2C A;  1W09 A;  2K9A A;  3FXD B;  3OTO T;  3MAC A;  5LHH B;  2V8S V;  5BR8 T;  4GIW A;  2MOZ A;  3ETU A;  5AQT B;  3ZJ1 A;  1Z0P A;  2WS3 A;  5LG4 A;  4PJJ A;  2QRX A;  3L8R A;  5ABH A;  3BQI A;  5HEH A;  4OK0 A;  4JI2 T;  5CA1 E;  4DV7 T;  1E7P A;  2PG8 A;  2XAS B;  3JC6 C;  1N34 T;  1NEN A;  3CML A;  3ZEF B;  3RYI E;  2P9B A;  5FYM A;  2E5L T;  4AKH A;  4N78 D;  3VU7 H;  3OBV E;  3FZF B;  3TLT A;  3MK7 C;  3C98 B;  3ZT7 A;  1YW0 A;  4YSY A;  5EZY E;  3JAF A;  4O8S A;  1ZOY A;  4JI4 T;  4EYU A;  4B3M T;  3EI0 A;  3FZH B;  3N9N A;  3AE3 A;  5AFU L;  4UVB B;  4L5G A;  3TLS A;  4HWF A;  1HNZ T;  2W4X A;  4DV2 T;  3AAA B;  4YHJ A;  3CQG B;  4QWN B;  2LOP A;  1IBM T;  3IF8 B;  3AB3 B;  4ZS2 A;  1FMV A;  4KI0 F;  2LKG A;  1HS7 A;  3DTO A;  1OED E;  4MAL A;  2UU9 T;  2LEH A;  5AQG B;  2XPK A;  2XQ3 A;  2KMF A;  2LRK A;  3AXJ A;  4JI0 T;  5FY1 A;  5LHI B;  4LF4 T;  4DR6 T;  4HKA A;  1Y64 B;  2WQY A;  4LMK A;  4NIQ A;  1IJ6 A;  3WI3 A;  2ZM8 A;  3PUY F;  5FY7 A;  2AXD S;  3EAM A;  2WM9 A;  2DWK A;  4JYA T;  3ONX A;  4E7Z A;  3KVA A;  2ACZ A;  3H3A A;  4IST A;  5JDL A;  4NUV A;  4A98 A;  5JRC B;  4CI1 B;  2YU2 A;  4PAG A;  2ES0 A;  3ZKR A;  2CRB A;  4U2Z A;  4TWD A;  4G2A A;  3FBL A;  2IUB A;  1W0A A;  3PUZ F;  2D0T A;  2XQ6 A;  4HFB A;  2XUE A;  3QK6 A;  5LJN A;  4Z8X A;  2HH7 A;  4FI5 A;  4DR3 T;  5LMU T;  4CN4 A;  2PBI A;  5ABG A;  3PJA A;  3P4S A;  5J0Z A;  3ZYL A;  2CPT A;  2WZH A;  3RIA A;  4LFA T;  5AQJ B;  3SFE A;  3MXZ A;  5IUX A;  3O9X A;  4H9Q C;  4ZHQ E;  4ILB A;  3C4Z A;  3BQK A;  2XAG B;  3PUG A;  2NP9 A;  2A9U A;  2ZMA A;  1L0V A;  4AXP A;  5BMV E;  2E9X B;  1VRB A;  4DV3 T;  2X68 A;  4AQF A;  4JI8 T;  5FNV E;  5FP3 A;  3C51 A;  1WFD A;  2YKS A;  5FXV A;  1QLB A;  3AE7 A;  4COF A;  4CXW A;  3KBT A;  3JCF A;  2Q9Q A;  3ZJ2 A;  4P1N A;  3C50 A;  2WZI A;  3RF1 A;  3ZMV B;  3UFE A;  3PUV F;  2XQ5 A;  2BG9 A;  3AE5 A;  3R6N A;  4DO0 A;  4UV8 B;  1IBL T;  4WBN E;  2WDR A;  1Z8U A;  2M67 A;  2IC6 A;  3PUQ A;  4AKL A;  4EEB A;  5DQV A;  2C5J A;  2V6X A;  4IE6 A;  4AQY T;  4LML A;  1XMO T;  3PE0 A;  2WCA A;  1KNP A;  4JV5 T;  1NEK A;  4BAY B;  4UF0 A;  2XM2 A;  2K3W A;  1OXZ A;  4IDP A;  2NW7 A;  4K0U A;  3O1H A;  2JJ9 A;  2XQ4 A;  3NZP A;  4U33 A;  5L3B B;  2CE7 A;  4P0A A;  2XJ7 A;  3KIN B;  3PUR A;  3RYF E;  3H37 A;  3SOL A;  5CFB A;  2XQ9 A;  2FJA A;  3ZPO A;  4HE8 A;  2QYW A;  4ZI3 C;  1NWM X;  2W61 A;  1FMW A;  2CXD A;  4I55 E;  1D0X A;  1YQ3 A;  2XZE A;  2E9X C;  1D1A A;  3PU8 A;  4ILU A;  3T8O A;  2BG9 E;  3VKH A;  3ZT6 A;  4HWD A;  4ZXL A;  4X65 T;  4NXN T;  1N36 T;  1IZN B;  2X66 A;  4UEM A;  4MBQ A;  5L3C B;  3LFM A;  3IA3 A;  4QX8 B;  1KEY A;  3EAB A;  5HCM A;  2HHH T;  4A97 A;  2JQH A;  2IML A;  4Q25 A;  1UCU A;  1XWM A;  2BBJ A;  2CCQ A;  3L39 A;  2BZB A;  3LK4 2;  2M6I A;  2LM2 A;  2WDQ A;  4HN9 A;  5KXJ A;  2UXN B;  1KK7 A;  4UV9 B;  2XAJ B;  5AQS B;  1J5E T;  3F31 A;  4CQI A;  5FVK A;  3AEB A;  5FMN A;  3KV4 A;  3KV5 A;  5LMN T;  5L2L A;  4KHP T;  3TKL B;  1XNQ T;  4KX6 A;  3UTK A;  1AJ3 A;  1BR4 A;  3NRX A;  3I9Y A;  2X0Y A;  1HG2 A;  4QX7 B;  3RIU C;  4NPP A;  4O4J E;  4QXH B;  5DJQ C;  5AQM B;  2CMR A;  4YSX A;  2BS3 A;  2BKO A;  3RGL A;  1D1B A;  5H6Q B;  3L3P A;  1JNZ A;  2IW5 B;  3RH3 A;  2I0M A;  2UUC T;  1DU2 A;  3AEF A;  2F4V T;  4EXT A;  5J1G A;  4JLE A;  3UUM A;  4HWH A;  5AQQ B;  1HNW T;  4JI6 T;  4X62 T;  2KWH A;  3N9O A;  3FBZ A;  4EB6 E;  2V5D A;  1LVF A;  3VRA A;  5C3J A;  2YDQ A;  2YOE A;  2G0U A;  4LF9 T;  1XNR T;  2V6Y B;  3SWH A;  2VQE T;  2W2U A;  4IE7 A;  2YIN A;  4GK5 E;  2UXX B;  5HEG A;  4KP3 C;  2MBG A;  3M3Z B;  3EVY A;  3KFW X;  1HFA A;  1YKE B;  1KNR A;  2HN2 A;  3NWI A;  5HXR A;  2L8K A;  3ZCJ A;  1VCT A;  4LFC T;  2W67 A;  2UXB T;  2K48 A;  4DUZ T;  5FXZ A;  5EK4 A;  1MIV A;  2DNX A;  2I59 A;  1KF6 A;  2JMH A;  2LHR A;  2V26 A;  3ONL C;  2LE8 A;  4YTM A;  4UEL A;  3JC6 D;  4C90 A;  2UUA T;  4IE0 A;  4KHZ F;  1D0Y A;  5AQR B;  1FEW A;  1ZP0 A;  5HEJ A;  3I1A A;  3Q2M A;  4JI3 T;  3LBX B;  3CPZ A;  4EED A;  3UU5 A;  4HFH A;  3SFD A;  2V7L A;  1OED A;  4DR2 T;  5CB4 E;  3AE6 A;  1VOM A;  2VQF T;  2J4G A;  1IAP A;  4TNV A;  3B13 A;  1D0Z A;  2XAQ B;  3IEE A;  4B3T T;  2MPK A;  1HG5 A;  1SA0 E;  4DID B;  2WAU A;  3CKD A;  2EHO B;  2XM1 A;  3BQL A;  2YDS A;  2LSY A;  3VRB A;  4B6X A;  4UXN B;  3JAE A;  4TZ4 C;  4DV0 T;  4OFZ A;  3GWH A;  2XQY A;  4X66 T;  3EHZ A;  1X79 A;  5EK2 A;  2BVM A;  4E7S A;  2FJD A;  3LSV A;  4X20 E;  4EV6 A; 
#chains in the Genus database with same CATH homology
 3C4Z A;  2X9H A;  2XAG B;  3BQK A;  3PUG A;  2NP9 A;  2ZMA A;  1HCI A;  4PK6 A;  3OYZ A;  4AXP A;  4DMW A;  5BMV E;  2E9X B;  5JDM A;  2Z6E A;  1VRB A;  3O1J A;  2X9W A;  3RPU A;  5LNK A;  4TV9 E;  5FXW A;  5TAO A;  2X68 A;  5HXC A;  4PFO A;  4AQF A;  5FNV E;  1WR6 A;  2QA7 A;  4TN7 B;  5FP3 A;  5L3F B;  5IYZ E;  1BR0 A;  2LHN A;  1OWA A;  5J2U E;  3C51 A;  2ZM2 A;  4H63 H;  3N5L A;  5LBM A;  3AA7 B;  3LK2 B;  1QSD A;  2ODV A;  4ZI7 E;  3K3Q C;  5FXV A;  4IE5 A;  3N9Q A;  2LM9 A;  3OJA A;  1LVK A;  4AQG A;  1V9D A;  4AI6 A;  4EAH A;  2JPF A;  4CXW A;  3KBT A;  4XBF B;  5HXH A;  2WMO A;  3NRY A;  2XAF B;  2Q9Q A;  3MJX A;  3ZJ2 A;  5HXS A;  2V7M A;  3ANW A;  3C50 A;  1H7C A;  3AAI A;  5HAX A;  3EDU A;  1WYB A;  3AA6 B;  3C64 A;  3ZMV B;  3D0T A;  2D0U A;  4A56 A;  4CI2 B;  3UFE A;  4EIW A;  2V7J A;  2V7K A;  2K5B B;  4OHF A;  4XZC A;  5ETW A;  4OYJ A;  3R6N A;  1O3X A;  2Q9Q D;  2VKJ A;  3WAJ A;  2ACX A;  3FXE B;  4UV8 B;  4DO0 A;  4WBN E;  3RC3 A;  2LSI A;  4KUM B;  3AA0 B;  3KV9 A;  2KLQ A;  3ZLI A;  2M67 A;  3AAE B;  3GMI A;  2D2S A;  2IC6 A;  2LSG A;  1HX8 A;  2PJQ A;  2X67 A;  3UUL A;  3PUQ A;  4AKL A;  5E0O A;  1ZEE A;  2NWB A;  2WWU A;  3KV6 A;  1HF8 A;  5DQV A;  2C5J A;  3N9M A;  3PDY A;  2JMK A;  3Q5X A;  5LOV E;  2BDE A;  5LP6 E;  2NW9 A;  4HEA A;  4IE6 A;  3LK3 B;  4IDZ A;  2W63 A;  3HKB E;  3ZMT B;  2CWY A;  1S94 A;  3LJC A;  4FJO A;  3CWZ B;  5L3E B;  3PE0 A;  2C5K T;  4H9P C;  1MNE A;  2EHO C;  4JUY A;  4BAY B;  5L3D B;  4WBO A;  4UF0 A;  4ADZ A;  4I4T E;  2JQQ A;  2VL8 A;  4WNK A;  1OXZ A;  3GN5 B;  2NW7 A;  3QUJ A;  2NTX A;  3O1H A;  4K0U A;  1MIY A;  3C4X A;  4ZI2 C;  1EZ3 A;  2JJ9 A;  2W0G A;  4PNI A;  2Y6X A;  3NZP A;  2KZ7 B;  4P0B A;  5L3B B;  2CE7 A;  5L3G B;  4DMV A;  2X9X A;  4GK0 E;  2VKH A;  4ERR A;  1CUN A;  3ZMU B;  4U72 A;  1MMG A;  1ZHC A;  5EK3 A;  4JEH B;  4DND A;  4P0A A;  1YKH B;  3ZC0 A;  3P7I A;  4I50 E;  3HKC E;  2X9Y A;  3KIN B;  4PW8 A;  2C0S A;  3PUR A;  1MND A;  4H9O C;  4QXB B;  3RYF E;  2B1E A;  5LHG B;  1YD8 G;  3H37 A;  3SOL A;  3U78 A;  5JR9 C;  2JRK A;  3LBX A;  5ADX L;  2QGS A;  3ZPO A;  2L3L A;  2MTQ A;  3PUA A;  4L0R A;  3W15 B;  4HE8 A;  4X1Y E;  3CX8 B;  2A3D A;  2VK9 A;  2LJL A;  3N2G E;  2X51 A;  2C5I T;  2GK9 A;  4P09 A;  4X1K E;  3J7Y q;  5H6R B;  4ZOL E;  4ZI3 C;  3KBU A;  2K24 A;  2RA1 A;  3B57 A;  1NWM X;  3K3N A;  2W61 A;  1FMW A;  2CXD A;  2NOX A;  4TX5 A;  3ZCI A;  4EZ4 A;  5F8P A;  4I55 E;  5HYA A;  4U74 A;  5KX5 E;  1D0X A;  2YK0 A;  2E9X C;  4XAX B;  5JDG A;  4EZH A;  1ZKE A;  3HL6 A;  1D1A A;  3PU8 A;  1MMD A;  5JDF A;  5JRC A;  4ILU A;  3T8O A;  4KMC A;  4GYR A;  3N2K E;  2VB6 A;  2WMN A;  2VKD A;  2EHO A;  3ZMS B;  3GA8 A;  3O1I A;  2HPJ A;  3ZN1 B;  4DBR A;  5JRE A;  3VKH A;  1WYC A;  3CX6 B;  1SHZ C;  3ESL A;  3L09 A;  5LJM A;  1BR1 A;  1IZN B;  5IHY A;  1FIO A;  2X66 A;  3LG7 A;  1IJ5 A;  2DHR A;  4QKN A;  4UEM A;  4MBQ A;  5L3C B;  2W00 A;  3LFM A;  2EHO D;  5F3J A;  4QX8 B;  2IC9 A;  1B7T A;  5JDH A;  3HKD E;  3MKD A;  3WAK A;  2PFV A;  5JDQ A;  4ZI2 D;  2KWI B;  3DJB A;  2DI4 A;  2KXP B;  4HTE A;  4QHO A;  4IE4 A;  5JR9 A;  4EYY R;  5LYJ E;  4EOZ B;  4IIJ E;  1UCU A;  4IHJ E;  2N2N A;  1MMN A;  5A1L A;  5LGU B;  4ZS3 A;  2LT3 A;  2CCQ A;  4O4I E;  4ANJ A;  2HPL A;  3C4W A;  2BZB A;  3LK4 2;  3I9W A;  2H7V C;  3V5S A;  5DQW A;  2RP4 A;  3E0Z A;  4HN9 A;  4IGU A;  5HWX A;  3KVB A;  4PFP A;  1BR2 A;  5CA0 E;  2E9X A;  3CQX C;  2UXN B;  1KK7 A;  4UV9 B;  4BJN A;  2DWG A;  1D1C A;  4TV8 E;  2XAJ B;  3N2O A;  4ZI3 D;  3Q9D A;  4NUU A;  4AKG A;  2KND A;  3F31 A;  4GOU A;  4O4H E;  4CQI A;  1U4Q A;  3J9X 1;  3N9L A;  2LSK A;  4O2B E;  1WRD A;  2CWO A;  2H7O A;  2E9X D;  3PUS A;  4YJ3 E;  3KV4 A;  4O2A E;  5DAB A;  5FMN A;  3U3I A;  2V1D B;  3ZYM A;  3HR0 A;  3KV5 A;  4PJN A;  5L2L A;  3FHN A;  3IHR A;  3TKL B;  5M4Y A;  3UTK A;  1AJ3 A;  1BR4 A;  2CLY B;  2LOS A;  2VKO A;  3NRX A;  3UUX B;  5GON E;  3I9Y A;  3MA9 A;  4J2C A;  1HG2 A;  3ZYK A;  4CXY A;  2K9A A;  3FXD B;  3MAC A;  4QX7 B;  3I0Q A;  5LHH B;  2XTL A;  3RC8 A;  5J2T E;  1LRZ A;  4GIW A;  4HFV A;  4O4J E;  2MOZ A;  2CM0 A;  4H63 V;  3OYX A;  4QXH B;  3ETU A;  5DJQ C;  3RX6 A;  3ZJ1 A;  4BA9 A;  5JDN A;  5LGN B;  2CMR A;  3I0O A;  1T98 A;  1Z0P A;  1D1B A;  1QUU A;  2N9D A;  3ZMZ B;  5LG4 A;  2DCF A;  4PJJ A;  2CXF A;  2IAK A;  2A2F X;  5H6Q B;  2DLR A;  3L3P A;  4OYK A;  2IW5 B;  3BQI A;  3RH3 A;  4ASK A;  2A72 A;  4OK0 A;  1NAF A;  5CA1 E;  4L9I A;  2PG8 A;  2XAS B;  3JC6 C;  4EXT A;  5J1G A;  1KNZ A;  3VHL A;  4G63 A;  3CML A;  5FY0 A;  4JLE A;  3UUM A;  3ZEF B;  3RYI E;  3E22 E;  2P9B A;  4PJL A;  5FYM A;  3BK9 A;  2D5U A;  1G8X A;  4O4L E;  4AKH A;  4PK4 A;  2KWH A;  1UX4 A;  4N78 D;  3VU7 H;  3RYC E;  3OBV E;  5JVD E;  3N9O A;  3FBZ A;  3MK7 C;  4AKI A;  4EB6 E;  3C98 B;  1YW0 A;  2Q9Q B;  3ETV A;  5EZY E;  1LVF A;  3HA4 A;  4O8S A;  1ZV4 X;  3ANW B;  3RKO A;  4TUY E;  2G0U A;  4EYU A;  3SWH A;  5LGT B;  4YJ2 E;  3N9N A;  4IE7 A;  1S35 A;  2YIN A;  4GK5 E;  5AFU L;  2UXX B;  3K8P C;  4L5G A;  2NW8 A;  4UVB B;  3E08 A;  3AAA B;  3CQC B;  3QC9 A;  3N9P A;  4YHJ A;  4KP3 C;  5JH7 E;  3AVR A;  4V1A v;  2OA5 A;  2MBG A;  4MFR A;  2KIN B;  3CQG B;  4AKR B;  4ZHQ E;  3EVY A;  4QWN B;  3UUN A;  2LOP A;  3KFW X;  3IF8 B;  1HFA A;  2CA5 A;  4H9N C;  5JQG E;  1YKE B;  4UIG A;  2YU1 A;  5LBQ B;  3PTR B;  2J1D G;  4UVC B;  3AB3 B;  3Q5W A;  2X0L B;  3AA1 B;  5HXR A;  4ZS2 A;  2L8K A;  3NBX X;  1FMV A;  3ZCJ A;  5C8Y E;  4F6R C;  3ZN0 B;  4I43 B;  5LCY A;  2YEV C;  1HS7 A;  3DTO A;  2VWA A;  2K48 A;  4MAL A;  5LXT E;  2LEH A;  5LA6 E;  3UT5 E;  5FXZ A;  5EK4 A;  4MLK A;  4H9S E;  1MIV A;  2Y48 B;  2BVL A;  2DNX A;  2I59 A;  2JMH A;  2LHR A;  2V26 A;  3DP7 A;  2KMF A;  2LE8 A;  4UF0 B;  3SS1 A;  4UEL A;  3JC6 D;  4C90 A;  4QXC B;  4IE0 A;  2SPC A;  3HKE E;  4ISS A;  1G73 A;  3OKQ A;  3KDS E;  2CLY C;  2ZM0 A;  5FY1 A;  1D0Y A;  1MIW A;  5LHI B;  5KMG P;  1US7 B;  1FEW A;  3AVS A;  3F57 A;  4HKA A;  1Y64 B;  3O4X E;  3I1A A;  3HI2 A;  3CX7 B;  1MMA A;  4PJM A;  1IJ6 A;  3P8C D;  3Q2M A;  3WI3 A;  4C91 A;  2CEA A;  2LSJ A;  4WW0 A;  2ZM8 A;  3IBP A;  3LBX B;  3CPZ A;  1LKX A;  3NZQ A;  4CI3 B;  2XHE B;  2V7L A;  5FY7 A;  3V5U A;  2E8I A;  2WM9 A;  2DWK A;  3K3O A;  5CB4 E;  3SRZ A;  1VOM A;  2KT9 A;  3ONX A;  1IAP A;  4E7Z A;  3KVA A;  4H9R C;  2WBL A;  3H3A A;  3B13 A;  3PU3 A;  4IST A;  5JDL A;  1D0Z A;  2XAQ B;  3IEE A;  3R84 B;  4DBQ A;  5FXX A;  3CVR A;  2V7I A;  4JEU B;  4NUV A;  1HG5 A;  1SA0 E;  5JRC B;  5HWY A;  4CI1 B;  2YU2 A;  4AQF C;  4PAG A;  2CXL A;  2ES0 A;  2WAU A;  4BJM A;  1E1H B;  3CKD A;  2EHO B;  3FBL A;  4G2A A;  1U5P A;  3ZC1 A;  3BQL A;  3MZK B;  4GYS A;  2LSY A;  2D0T A;  4B6X A;  3RYH E;  1HTJ F;  4PK5 A;  4UXN B;  4TZ4 C;  2ZLY A;  2XUE A;  4DVD A;  3EDV A;  3QK6 A;  3F2E A;  4UVA B;  5HXE A;  2H3R A;  5LJN A;  3RRW A;  4Z8X A;  2Y8D A;  2HH7 A;  2Q9Q C;  4FI5 A;  4OFZ A;  3M65 A;  3GWH A;  2N1G A;  2PBI A;  2XQY A;  1UX5 A;  2WSS V;  3GN5 A;  4KBM B;  3ZYL A;  3VKG A;  4MHC A;  2L9Q A;  2W62 A;  5KDM C;  2ODU A;  5JR9 B;  3A5X A;  2XAH B;  2NTY A;  1X79 A;  4M1P A;  3S4U A;  5EK2 A;  2BVM A;  4CZZ B;  3RRC A;  4E7S A;  4HGA A;  4CXX A;  1WLX A;  2VAS A;  3EUH A;  2MYS A;  3MXZ A;  3FB2 A;  3O9X A;  4YLH A;  4X1I E;  4H9Q C;  4X20 E;  4YFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...