4ILUA

Crystal structure of mycobacterium tuberculosis card
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
165
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALADAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords RNA polymerase-binding transcription factor CarD
total genus 45
structure length 165
sequence length 169
ec nomenclature
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4iluA02
4L5GA 2LT3A 4ILUA 4MFRA 4XAXB 4KBMB 4KMCA
chains in the Genus database with same CATH superfamily
2FJBA 3ETUA 3LFMA 4HFDA 4YJ3E 2D0UA 1FMWA 2JMHA 2LHNA 2QYWA 3I9WA 4YTPA 5HXHA 5LB7B 2MAWA 4DMWA 2VQET 5TAOA 4JLEA 4DV6T 1US7B 3GA8A 4CI3B 5LGTB 2OV9A 1YKHB 2WBLA 5J0ZA 1W09A 4OFZA 3UUXB 4ASKA 4JI1T 3AEGA 3AE4A 3LJCA 3NVOA 5AQVB 3ZEFB 4TX5A 5HXCA 3U3IA 3T1HT 1WRDA 2N9DA 2PG8A 2V7MA 3EABA 1ZOYA 3PUYF 4L0RA 5DJQC 3ZMZB 2WP9A 2IMLA 5LYJE 2KZ7B 2WZHA 3ZYKA 1EZ3A 4Z91A 2ES0A 5F5WA 3ZC1A 4IE4A 2KWHA 4HFVA 3SOLA 5JRCB 2V6XA 3N9LA 5GONE 1E2AA 3UU8A 5FL0A 3AE3A 5ABFA 3AA6B 4ZI2D 2XQ9A 3MJXA 3FBLA 5LJNA 4K0KT 3P4PA 3AAIA 1MNEA 4UF0A 4U2ZA 3K3QC 4AKLA 2MYSA 3PE0A 3PURA 3W15B 1N36T 3QOFA 1I6ZA 3EUHA 2A3DA 3HKEE 4PJMA 2BKPA 5LBQB 4AKHA 4AKGA 1ZHCA 1X9BA 1OEDC 3ABVA 1NEKA 2MPKA 3MA9A 3OBVE 5DQVA 5H6RB 4KP3C 3SWHA 4X64T 4LMJA 4H9RC 4GYRA 2HPJA 3RH3A 2YDSA 4TZ4C 3I9YA 4EZHA 4O2BE 3C50A 2KMFA 3OKQA 1YD8G 2LSKA 1XWMA 4H63V 3T8OA 5JR9B 3ZT7A 3D0TA 4QH4A 1D1BA 3P4QA 5FXVA 4ERRA 2LOPA 2E9XA 5EK4A 3FZMB 2VKDA 5AQJB 1QLBA 2YOEA 3CX6B 4P1NA 1WR6A 5CFBA 3EI0A 2VKHA 3CQCB 5CA1E 4X62T 2UXDT 4ZXLA 1M62A 1WFDA 2DL1A 2KLQA 2LM2A 2XSBA 3NBXX 3HKBE 4IL9A 1S94A 2YU1A 2L8KA 3DTOA 4PW8A 3ZMVB 4EEBA 3AB3B 5M4YA 4JI8T 5C8YE 5LHHB 1U5PA 2MTQA 2M67A 1UK5A 2XTLA 5LCYA 4I43B 4WBNE 5HXSA 3FB2A 4DV0T 2L3LA 4UV8B 3ZCJA 2J4GA 4XBFB 3AE7A 4B3MT 3ZT6A 3AXJB 2A9UA 2XQAA 1SE7A 4H63H 5AQGB 4DR5T 1AJ3A 2KXPB 4XAXB 5AQPB 3Q5EA 4HEAA 3A7MA 3FHNA 5FYMA 3RGLA 4YSYA 4X65T 4X66T 3KBTA 3ZYMA 1OEDE 4LF8T 3HKCE 2VKOA 2X0LB 4QHOA 5JDHA 2JMKA 2WQYA 3JAEA 1OEDA 2BG9C 2R6GF 3PUWF 3V5SA 5J2TE 2JQKA 2K3WA 3AAAB 2XQ7A 5AQMB 3SRZA 2XAJB 1D0XA 2WWUA 2RPAA 3CX7B 3BQKA 1D0YA 2LOSA 2X68A 3K3OA 4IDPA 4O4IE 1W9RA 3NKZA 3RIFA 2X9YA 4JEHB 2DLRA 2JPFA 3KV4A 3SS1A 1FJGT 2H7VC 2KNDA 3FXDB 2B1EA 2WU5A 5AQKB 4QXCB 4QX8B 3ZSTA 3SFDA 1HG2A 1N32T 2YKSA 2CA5A 3C51A 2VL0A 2V7IA 2H3RA 2K24A 2KINB 1D1AA 3ESLA 3P4WA 2QGSA 4U7IA 3RIUA 5C3JA 2XQ8A 1KNZA 1WYBA 4ZI2C 1YQ3A 3AECA 3PDYA 4X1KE 5HYAA 5BR8T 4GKJT 3HA4A 4EGWA 2UXCT 4OK0A 4LF9T 4DIDB 1HR0T 2X9HA 1D1CA 1OEDB 3B5MA 3F57A 4NXMT 2E9XC 1UCUA 4MBQA 1QUUA 2J62A 1KEYA 3B13A 4JBWF 5L4EA 2X51A 4LMKA 2P9BA 2CMRA 2LSJA 3AA7B 3FZKB 2HN2A 2NWBA 2G0UA 2XM2A 2PJQA 3C64A 2QRXA 3PJAA 4KBMB 2BG9B 4V1Av 4A5XA 1XNQT 1JNZA 2V6YA 4H9OC 3J7Yq 2E5VA 2W62A 1XDOA 3JCFA 2BBJA 4WNKA 3LBXB 3RIUC 2CEAA 4UR9A 5LBMA 4UV9B 4JI3T 5JDGA 2CRBA 4PK6A 4ZI7E 2CHOA 2WDQA 1H7CA 3RYCE 5HCMA 4JYAT 5L3CB 2J1DG 1HS7A 5A1LA 3EDUA 4U74A 4I0UA 5AFUL 2UXBT 1Z0PA 2CE7A 4AQFC 4JI5T 5HCJA 2UUCT 4IE6A 5KMGP 4HKAA 2NTXA 3H37A 4AQFA 4YT0A 1T7SA 2VVNA 3CKDA 3ZSSA 2IUBA 3PUZF 4YSXA 3FBZA 2M6BA 3KBUA 2BDEA 2WWVA 4DBQA 2Q9QC 5L3FB 4HGAA 1YXRA 5HWXA 2E9XD 3AXJA 3CQGB 1HX1B 4DBRA 2DI4A 2RA1A 1G73A 4X1YE 4F6RC 1J5ET 4I55E 2MOZA 2RP4A 3PUXF 4HN9A 5HEUA 3IHRA 1XZYA 3ZN1B 4EYYR 2X0HA 2XY8B 4AKRB 4YTNA 4DR6T 2FJAA 5JR9C 4O2AE 4JI2T 5JH7E 3QNUA 3AEEA 4P0AA 3DJBA 4QH5A 5IYZE 1SA0E 2V7JA 4AIUA 3TLUA 4DVDA 4F8HA 5LHGB 4JEUB 2EHOA 5AQIB 4DV2T 3M65A 3F31A 3R6NA 3EHZA 1MNDA 1U4QA 5FY0A 3KVAA 1MIYA 2BS2A 2D0TA 2CHNA 3AE8A 3AAEB 3EVYA 3M3ZB 4AISA 4B6XA 1HF8A 2LT3A 3IF8B 2LSGA 3NZPA 3PJAJ 3RRCA 5AQNB 5JDQA 5CA0E 3MZKB 2F4VT 1D0ZA 3HI2A 5FXXA 2D9DA 3MKDA 2C5KT 1NWMX 5H6QB 3A5XA 5JDNA 5FP3A 5LMNT 3ONXA 2CCQA 3TLTA 3N9MA 2LSYA 4FJOA 5L4HA 1HTJF 3KV5A 5F3JA 4DUYT 3KDSE 4ISTA 2FBWA 2HPLA 2WZIA 5LOVE 1R8IA 3KV6A 4YFSA 2DWKA 1UX5A 4KHZF 1WCRA 4YJ2E 2CXFA 2FJDA 3U78A 4LF5T 3MACA 3CPZA 3QB5A 4ZOLE 3ANWA 5L2LA 4OYJA 3OPCA 3EAMA 3LDQB 1ZKEA 3CX8B 3GWHA 4MLKA 2V6YB 4PJLA 4EEDA 3RC8A 5HEHA 1ZV4X 3UU4A 4EXTA 1VCSA 2Y8DA 4HFCA 3ZN0B 5L3GB 4C91A 4DMVA 4YHJA 3TLVA 4GKKT 4TWDA 1E1HB 2XM1A 2LJLA 3N9QA 5HXEA 3QB5K 2I0MA 4U72A 1MMGA 1VRBA 1V9DA 3LK3B 4QX7B 1HFAA 5E0OA 5AQSB 3H3MA 5ABFB 2JQQA 2X9WA 2FUPA 1FEWA 1B7TA 4TV9E 3CVRA 2Q9QA 3OVUA 4YTMA 5AQHB 2MBGA 1IJ5A 2J47A 4H9SE 2CM0A 4QXBB 3P4SA 2K5BB 3CWZB 4G63A 2CXDA 4CI2B 5LG4A 1NAFA 4TNVA 4DV7T 4DR7T 5LGNB 2IW5B 4HFIA 3IEEA 1FIOA 4U2YA 2K48A 5JQGE 2WSSV 1J5WA 2DWGA 3RI5A 2XPKA 2Q9QB 2XUEA 5FY7A 4CN6A 4ILUA 2IHR1 3UULA 2LE8A 4ADZA 2C5JA 1J1JA 3N2KE 2Q9QD 5LP6E 3OTOT 2IC9A 3J9X1 1IBMT 4IHJE 2NOXA 3LSVA 4H9PC 4ILBA 5C2TA 5L3BB 5ETWA 4PAGA 2XQ4A 2YK0A 3E08A 2BZBA 4I50E 4EYUA 3L3PA 3MXZA 2ZM0A 1Y64B 3UUNA 2A72A 3Q5XA 3I0QA 3AE5A 3ONLC 4HFHA 3RX6A 4CXXA 4YXDA 3OYXA 4GK5E 2JJ9A 2VL8A 4IE5A 4NIQA 4NUVA 3ZMTB 4E7SA 4TN7B 3FZLB 1L0VA 2QA7A 4IE0A 3K1SA 2W63A 2NTYA 4QWNB 5JR9A 3SFEA 5JREA 1I94T 4WZXA 3TLSA 3C4WA 4JI7T 1OXZA 1T8BA 1M7KA 3QC9A 2V5CA 4JI4T 2UUBT 5FVLA 2DHRA 3LK2B 3CK6A 4DV3T 4ILCA 2XASB 4COFA 4O4HE 4X5TA 4KHPT 3V5UA 1KNPA 2PFVA 2CWYA 2IC6A 4ZS2A 5HAXA 4TNWA 1KF6A 4EOZB 1W0AA 4PK4A 2XHEB 3C4ZA 3UQ4A 4DUZT 2HH7A 4PFOA 3HL6A 2W61A 4WW0A 4IE7A 3N9PA 4ILAA 4QH1A 2IDOB 2JIWA 5AQQB 3FZHB 2XAGB 5AQOB 3OJAA 5JDFA 4BAYB 3I0OA 4BJMA 4BJNA 5JVDE 2LKHA 1KK7A 1LVKA 1HX8A 3N9OA 4OHFA 1XMQT 5LMUT 2PBIA 3NRXA 2WMOA 3UU5A 2JRKA 5IHYA 4DNDA 3JC6D 5AQFB 2B76A 2X0YA 1LRZA 4AKIA 1YKEB 3VU7H 3KVBA 3O1IA 3Q9DA 2LKGA 4BA9A 4DO0A 5IWAT 4G2AA 5ADXL 3RKGA 3LK42 3RC3A 3ONJA 5F8PA 5LGUB 2V1DB 3MK7C 1KNRA 2NR4A 3RYHE 4DV4T 5LJMA 3Q5WA 4DV5T 4EV6A 5FVKA 3AE6A 4UXNB 4GIWA 3RLFF 3AEAA 3UT5E 2EHOC 4U3CA 4O4JE 1XMOT 2A2FX 2WB5A 2WDRA 2IIUA 3WI3A 4P09A 1ZEEA 3IA3A 3KV9A 3L8RA 3UQ7A 2CLYB 2BS3A 2W67A 2KSRA 4NUUA 5ABGA 2BKNA 3NRYA 3E0ZA 4IDZA 3PU8A 3NZQA 4QXHB 3VR9A 2AE9A 2VB6A 4EIWA 4JV5T 1MMNA 2OA5A 3ZT5A 4L5GA 5AQTB 4UF0B 4HWIB 5AQUB 2Z6EA 3ZCIA 4PNIA 4MFRA 4A56A 1IJ6A 3JC6C 2WS3A 2XQ3A 4I4TE 4LFBT 2YN6A 5DQWA 1HNWT 3RYIE 2BG9A 1UUSA 2C5IT 2I6HA 3KFWX 4N78D 4UEMA 2W2UA 2WY2A 5DABA 5FY1A 4WYVA 5CJ5A 1IBLT 2ODVA 3UUMA 3GMIA 4JI6T 4UVBB 4JUYA 4CZZB 5EZYE 2K9AA 2FJEA 4UELA 1IZNB 4X1IE 5AQRB 5KX5E 4FI5A 4P0BA 3UFEA 5LXTE 5KXJA 2BS4A 2H7OA 3IBPA 1VCTA 3L09A 3QUJA 4HWCA 4IT4A 2ZM8A 4ZZBA 3ZYLA 4OX9T 3VHLA 4A98A 3I1AA 3G06A 2DNXA 3UTKA 4PFPA 1IBKT 1CUNA 5EK3A 3AA0B 5L3EB 4X20E 2BG9E 2ZM6T 2UUAT 2LLYA 4TV8E 1T98A 3AEFA 2X67A 5FNVE 4OYKA 1WR0A 2JQ9A 3O4XE 5CB4E 4B3TT 2ODUA 1CHUA 2YU2A 4YLHA 4ISSA 2VURA 4CN1A 3WAJA 2LSIA 2VVSA 1UGOA 3B57A 4DR3T 2DCFA 4IDOA 2H88A 2IAKA 1E7PA 2XJ7A 4CI1B 1BR4A 3ZMUB 3Q2MA 3E22E 3VRAA 3UUBA 4HTEA 4DR2T 5FL1A 5HEJA 2XQ6A 4HWDA 5AQLB 3RF1A 5KDMC 5LA6E 4GOUA 4YY3T 5ABHA 2KWIB 4KMCA 4Z8XA 2LHRA 2GK9A 2LM9A 2X66A 2N1GA 2XAFB 3A8YC 3K8PC 3O9XA 5HXRA 1MMDA 4IIJE 5L3DB 2LEHA 3TLWA 3BQLA 4EAHA 1O3XA 4NXNT 2H89A 3KINB 4K0UA 1LVFA 3RHWA 3ZJ1A 4CN4A 2BBHA 4AQYT 5FXWA 2V7KA 3ZMSB 2BVLA 5BMVE 2Y6XA 4AI6A 3RYFE 2YDRA 1UX4A 1N34T 3RPUA 3P50A 4PJNA 3VRBA 1BR0A 2LRLA 3BQIA 3P4RA 2EHOD 2KT9A 2UXXB 3AA1B 4DR1T 4JI0T 1N33T 2PTFA 4GYSA 4Q25A 3VKGA 2EHOB 5JDMA 1XNRT 4LFCT 2WCAA 2AXDS 3ETVA 3N5LA 4IL4A 4LFAT 3AVSA 1WLXA 2VWAA 2WM9A 4J2CA 4U33A 5CGMA 2CLYC 2I59A 4PJJA 1VOMA 2XQYA 4IDNA 1HG5A 4TWFA 3ZKRA 4E7ZA 2UXNB 2XZEA 3EDVA 2L9QA 2VKJA 2C0SA 2HN1A 3H3AA 3N9NA 3PTRB 4HWHA 3UU3A 2CBIA 4LF4T 3K3NA 2W0GA 3RIAA 1Z8UA 5ABEA 4YSZA 3AE9A 3F2EA 3FXEB 4U7YA 1FMVA 1GQEA 4MHCA 5IUXA 3PUSA 5HWYA 2BVMA 2LRKA 4KI0F 3BK9A 3ZJ2A 4AQGA 4ZEYA 4ZI3D 2E5LT 2E9XB 3ZPOA 3JADA 4HE8A 5LHIB 2JQHA 2D5UA 4NPPA 1MIVA 3T1YT 1Y01A 3N2OA 3AE2A 3N2GE 4O4LE 4B3RT 3AE1A 2NP9A 4IREA 4QKNA 5HEOA 3C4XA 4UIGA 4ANJA 2QVAA 2ZMAA 3FZFB 2ZLYA 3PUGA 3CIRA 2SPCA 3PUAA 3RQUA 3AEDA 4HWFA 4ZS3A 3WAKA 2W00A 2W4XA 4H9QC 2XAHB 5FXZA 4TUYE 2V26A 4EB6E 4XZCA 3NWIA 1KFYA 2E8IA 2ZM2A 3JAFA 5JDLA 4U31A 3CMLA 2CWOA 4M1PA 3P7IA 3AVRA 4WBOA 3R84B 1DU2A 1X79A 2ACXA 2CXLA 4AXPA 3LBXA 2VASA 4HFBA 2BKOA 4EZ4A 4PK5A 3LG7A 3O1HA 4LMLA 3PUQA 2ACZA 1UURA 3RKOA 4DV1T 4L9IA 1T72A 1YW0A 1SUMB 2OLTA 1YQ4A 1OWAA 1ZP0A 2V7LA 2Y48B 3PUVF 4KX6A 4Z90A 4LF7T 5JRCA 2XAQB 3O1JA 1HCIA 2CBJA 3P8CD 3PU3A 3Q5DA 1IAPA 4ZI3C 3X1DA 5EK2A 4MALA 1SHZC 1BR2A 4UVAB 3RQWA 1LKXA 3HKDE 3PV0F 2M6IA 2WU2A 2NW9A 3VR8A 4DR4T 5FKYA 3CQXC 4UVCB 2WDVA 4GK0E 2V8SV 4IGUA 4CXWA 4TWHA 3ZC0A 2NW8A 4ZZCA 2XSAA 4ZHQE 2WMNA 5JTGA 3ANWB 4CXYA 1XDPA 2XQ5A 2YEVC 3DP7A 2N2NA 2UU9T 1HNZT 3VKHA 3UU6A 5J1GA 5L47A 5LG3A 4CQIA 4YHHT 2D2SA 1W0BA 3UFGA 4HFEA 4KUMB 3TKLB 2YINA 3S4UA 3C98B 2V5DA 3L39A 2WAUA 2VQFT 1HNXT 3GN5B 4B3ST 5J2UE 1MMAA 2HHHT 2E2AA 4H9NC 5HEGA 1S35A 3ZLIA 2YDQA 5LNKA 2CPTA 1WYCA 3OYZA 2X9XA 5FMNA 3RRWA 3HR0A 1JNRA 1G8XA 1NENA 4C90A 4IDQA 1BR1A 1QSDA 1MIWA 2VK9A 2NW7A 4O8SA 4LF6T 3AEBA 3GN5A 2W66A 3QK6A 4A97A
chains in the Genus database with same CATH topology
3ETUA 3LFMA 4YJ3E 2D0UA 1FMWA 2JMHA 2LHNA 3I9WA 5HXHA 5TAOA 4JLEA 1US7B 3GA8A 4CI3B 5LGTB 1YKHB 2WBLA 4OFZA 3UUXB 4ASKA 3LJCA 3ZEFB 4TX5A 5HXCA 3U3IA 1WRDA 2N9DA 2PG8A 2V7MA 4L0RA 3ZMZB 5DJQC 5LYJE 2KZ7B 3ZYKA 1EZ3A 2ES0A 3ZC1A 4IE4A 2KWHA 4HFVA 3SOLA 5JRCB 3N9LA 5GONE 3AA6B 4ZI2D 3MJXA 3FBLA 5LJNA 3AAIA 1MNEA 4UF0A 3K3QC 4AKLA 2MYSA 3PE0A 3PURA 3W15B 3EUHA 2A3DA 3HKEE 4PJMA 5LBQB 4AKHA 4AKGA 1ZHCA 3MA9A 3OBVE 3SWHA 5DQVA 5H6RB 4KP3C 4H9RC 4GYRA 2HPJA 3RH3A 4TZ4C 3I9YA 4EZHA 4O2BE 3C50A 2KMFA 3OKQA 1YD8G 2LSKA 4H63V 3T8OA 5JR9B 3D0TA 1D1BA 5FXVA 4ERRA 2LOPA 2E9XA 5EK4A 2VKDA 3CX6B 1WR6A 2VKHA 3CQCB 5CA1E 2KLQA 5DABA 3NBXX 3HKBE 1S94A 2YU1A 2L8KA 3DTOA 4PW8A 3ZMVB 3AB3B 5M4YA 5C8YE 5LHHB 1U5PA 2MTQA 2M67A 2XTLA 5LCYA 4I43B 4WBNE 5HXSA 3FB2A 2L3LA 4UV8B 3ZCJA 4XBFB 4H63H 1AJ3A 2KXPB 4HEAA 5FYMA 3FHNA 3KBTA 3ZYMA 3HKCE 2VKOA 2X0LB 4QHOA 5JDHA 2JMKA 3V5SA 5J2TE 3AAAB 3SRZA 2XAJB 1D0XA 2WWUA 3CX7B 3BQKA 1D0YA 2LOSA 2X68A 3K3OA 4O4IE 2X9YA 4JEHB 2DLRA 2JPFA 3KV4A 3SS1A 2H7VC 3FXDB 2KNDA 2B1EA 4QXCB 4QX8B 1HG2A 2CA5A 3C51A 2V7IA 2H3RA 2K24A 2KINB 3ESLA 1D1AA 2QGSA 1WYBA 4ZI2C 4X1KE 5HYAA 3PDYA 3HA4A 4OK0A 2X9HA 1D1CA 3F57A 2E9XC 1UCUA 4MBQA 1QUUA 3B13A 2X51A 4XAXB 2P9BA 2CMRA 2LSJA 3AA7B 4PJNA 5HXRA 2NWBA 2G0UA 4KBMB 2PJQA 3C64A 4V1Av 4H9OC 3J7Yq 2W62A 4WNKA 3LBXB 2CEAA 5LBMA 1KNZA 4UV9B 5JDGA 4ZI7E 4PK6A 1HS7A 1H7CA 3RYCE 5L3CB 2J1DG 5A1LA 3EDUA 4U74A 5AFUL 1Z0PA 2CE7A 4AQFC 4IE6A 4HKAA 2NTXA 3H37A 4AQFA 3CKDA 3FBZA 3KBUA 2BDEA 4DBQA 2Q9QC 5L3FB 4HGAA 2E9XD 3CQGB 4DBRA 2DI4A 2RA1A 1G73A 4X1YE 4F6RC 4I55E 2MOZA 2RP4A 4HN9A 5HWXA 3IHRA 4EYYR 4AKRB 5JR9C 4O2AE 5JH7E 4P0AA 3DJBA 5IYZE 1SA0E 2V7JA 4DVDA 5LHGB 4JEUB 2EHOA 3M65A 3F31A 3R6NA 1MNDA 1U4QA 5FY0A 3KVAA 1MIYA 2D0TA 3EVYA 3AAEB 4B6XA 1HF8A 2LT3A 3IF8B 2LSGA 3NZPA 3RRCA 5JDQA 5CA0E 3MZKB 1D0ZA 3HI2A 5FXXA 3MKDA 2C5KT 1NWMX 5H6QB 3A5XA 5JDNA 5FP3A 3ONXA 2CCQA 3N9MA 2LSYA 4FJOA 1HTJF 3KV5A 5F3JA 3KDSE 4ISTA 2HPLA 5LOVE 3KV6A 4YFSA 2DWKA 1UX5A 4YJ2E 2CXFA 3U78A 3MACA 3CPZA 4ZOLE 3ANWA 5L2LA 4OYJA 1ZKEA 3CX8B 3GWHA 4MLKA 4PJLA 3RC8A 1ZV4X 4EXTA 2Y8DA 3ZN0B 4C91A 4DMVA 4YHJA 1E1HB 3N9QA 2LJLA 5HXEA 4U72A 1MMGA 1VRBA 1V9DA 3LK3B 4QX7B 1HFAA 5E0OA 2JQQA 2X9WA 1FEWA 1B7TA 4TV9E 3CVRA 2Q9QA 2MBGA 1IJ5A 4H9SE 2CM0A 4QXBB 4G63A 2K5BB 3CWZB 2CXDA 4CI2B 5LG4A 1NAFA 5LGNB 2IW5B 3IEEA 1FIOA 2K48A 5JQGE 2WSSV 2DWGA 2Q9QB 2XUEA 5FY7A 4ILUA 4ADZA 3UULA 2LE8A 2C5JA 5LP6E 3N2KE 2Q9QD 2IC9A 3J9X1 4IHJE 2NOXA 4H9PC 5L3BB 5ETWA 4PAGA 3E08A 2YK0A 2BZBA 4I50E 4EYUA 3L3PA 3MXZA 2ZM0A 1Y64B 3UUNA 2A72A 3Q5XA 3I0QA 4CXXA 3RX6A 3OYXA 4GK5E 2JJ9A 2VL8A 4IE5A 4NUVA 3ZMTB 4E7SA 5KMGP 4TN7B 3ZN1B 2QA7A 4IE0A 4QWNB 2W63A 2NTYA 5JR9A 5JREA 3C4WA 1OXZA 3QC9A 2DHRA 3LK2B 2XASB 4O4HE 3V5UA 2PFVA 2CWYA 2IC6A 4ZS2A 5HAXA 4EOZB 4PK4A 2XHEB 3C4ZA 2HH7A 4PFOA 3HL6A 2W61A 4WW0A 4IE7A 3N9PA 5JDFA 4BJMA 2XAGB 5LGUB 3OJAA 4BJNA 4BAYB 3I0OA 5JVDE 1KK7A 1LVKA 1HX8A 3N9OA 4OHFA 2PBIA 3NRXA 2WMOA 2JRKA 5IHYA 4DNDA 3JC6D 1LRZA 4AKIA 1YKEB 3VU7H 3KVBA 3O1IA 3Q9DA 4BA9A 4DO0A 4G2AA 5ADXL 3LK42 3RC3A 5F8PA 2V1DB 3MK7C 3RYHE 5LJMA 3Q5WA 4UXNB 4GIWA 3UT5E 2EHOC 4O4JE 2A2FX 3WI3A 4P09A 1ZEEA 3KV9A 2CLYB 4NUUA 3NRYA 3E0ZA 4IDZA 3PU8A 3NZQA 4QXHB 4EIWA 2VB6A 1MMNA 2OA5A 4L5GA 4UF0B 3ZCIA 2Z6EA 4PNIA 4MFRA 4A56A 1IJ6A 3JC6C 4I4TE 5DQWA 3RYIE 2C5IT 4N78D 3KFWX 4UEMA 5FY1A 2ODVA 3UUMA 3GMIA 4UVBB 4JUYA 4CZZB 5EZYE 2K9AA 4UELA 1IZNB 4X1IE 5LXTE 4FI5A 4P0BA 3UFEA 2H7OA 3IBPA 3L09A 3QUJA 5L3GB 2ZM8A 3ZYLA 3VHLA 3I1AA 2DNXA 3UTKA 4PFPA 1CUNA 5EK3A 3AA0B 5L3EB 4X20E 4TV8E 1T98A 2X67A 5FNVE 4OYKA 3O4XE 5CB4E 2ODUA 2YU2A 4YLHA 4ISSA 3WAJA 2LSIA 3B57A 2DCFA 2IAKA 4CI1B 1BR4A 3ZMUB 3Q2MA 3E22E 4HTEA 5KDMC 5LA6E 4GOUA 2KWIB 4KMCA 4Z8XA 2LHRA 2GK9A 2LM9A 2X66A 2N1GA 2XAFB 3K8PC 3O9XA 1MMDA 4IIJE 5L3DB 2LEHA 3BQLA 4EAHA 1O3XA 3KINB 4K0UA 1LVFA 3ZJ1A 5FXWA 2V7KA 3ZMSB 2BVLA 5BMVE 2Y6XA 4AI6A 3RYFE 1UX4A 3RPUA 1BR0A 3BQIA 2EHOD 2KT9A 2UXXB 3AA1B 3VKGA 4GYSA 2EHOB 5JDMA 3ETVA 3N5LA 3AVSA 1WLXA 2VWAA 2WM9A 4J2CA 5KX5E 2CLYC 2I59A 4PJJA 1VOMA 2XQYA 4E7ZA 1HG5A 2UXNB 3EDVA 3N9NA 2L9QA 2VKJA 2C0SA 3PTRB 3H3AA 3K3NA 2W0GA 3F2EA 3FXEB 1FMVA 4MHCA 3PUSA 5HWYA 2BVMA 3ZJ2A 4AQGA 3BK9A 4ZI3D 2E9XB 3ZPOA 4HE8A 5LHIB 2D5UA 1MIVA 3N2OA 3N2GE 4O4LE 2NP9A 4QKNA 3C4XA 4UIGA 4ANJA 2ZMAA 2ZLYA 3PUGA 3PUAA 2SPCA 4ZS3A 3WAKA 2W00A 4H9QC 2XAHB 5FXZA 4TUYE 2V26A 4EB6E 4XZCA 2E8IA 2ZM2A 5JDLA 3CMLA 2CWOA 4M1PA 3P7IA 3AVRA 4WBOA 3R84B 1X79A 2ACXA 2CXLA 4AXPA 3LBXA 2VASA 4EZ4A 4PK5A 3LG7A 3O1HA 3PUQA 3RKOA 4L9IA 1YW0A 2Y48B 4DMWA 1OWAA 2V7LA 5JRCA 2XAQB 3O1JA 1HCIA 3P8CD 5EK2A 3PU3A 4ZI3C 1IAPA 4MALA 1SHZC 1BR2A 4UVAB 1LKXA 3HKDE 2NW9A 3CQXC 4UVCB 4GK0E 4IGUA 4CXWA 3ZC0A 2NW8A 4ZHQE 2WMNA 3ANWB 4CXYA 2YEVC 3DP7A 2N2NA 3VKHA 5J1GA 4CQIA 2D2SA 4KUMB 3TKLB 2YINA 3S4UA 3C98B 2WAUA 3GN5B 5J2UE 1MMAA 4H9NC 1S35A 3ZLIA 5LNKA 1WYCA 3OYZA 2X9XA 5FMNA 3RRWA 3HR0A 1G8XA 4C90A 1BR1A 2VK9A 1QSDA 1MIWA 2NW7A 4O8SA 3GN5A 3QK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5G A;  2LT3 A;  4ILU A;  4MFR A;  4XAX B;  4KBM B;  4KMC A; 
#chains in the Genus database with same CATH topology
 2FJB A;  3ETU A;  3LFM A;  4HFD A;  4YJ3 E;  2D0U A;  1FMW A;  2JMH A;  2LHN A;  2QYW A;  3I9W A;  4YTP A;  5HXH A;  5LB7 B;  2MAW A;  4DMW A;  2VQE T;  5TAO A;  4JLE A;  4DV6 T;  1US7 B;  3GA8 A;  4CI3 B;  5LGT B;  2OV9 A;  1YKH B;  2WBL A;  5J0Z A;  1W09 A;  4OFZ A;  3UUX B;  4ASK A;  4JI1 T;  3AEG A;  3AE4 A;  3LJC A;  3NVO A;  5AQV B;  3ZEF B;  4TX5 A;  5HXC A;  3U3I A;  3T1H T;  1WRD A;  2N9D A;  2PG8 A;  2V7M A;  3EAB A;  1ZOY A;  3PUY F;  4L0R A;  5DJQ C;  3ZMZ B;  2WP9 A;  2IML A;  5LYJ E;  2KZ7 B;  2WZH A;  3ZYK A;  1EZ3 A;  4Z91 A;  2ES0 A;  5F5W A;  3ZC1 A;  4IE4 A;  2KWH A;  4HFV A;  3SOL A;  5JRC B;  2V6X A;  3N9L A;  5GON E;  1E2A A;  3UU8 A;  5FL0 A;  3AE3 A;  5ABF A;  3AA6 B;  4ZI2 D;  2XQ9 A;  3MJX A;  3FBL A;  5LJN A;  4K0K T;  3P4P A;  3AAI A;  1MNE A;  4UF0 A;  4U2Z A;  3K3Q C;  4AKL A;  2MYS A;  3PE0 A;  3PUR A;  3W15 B;  1N36 T;  3QOF A;  1I6Z A;  3EUH A;  2A3D A;  3HKE E;  4PJM A;  2BKP A;  5LBQ B;  4AKH A;  4AKG A;  1ZHC A;  1X9B A;  1OED C;  3ABV A;  1NEK A;  2MPK A;  3MA9 A;  3OBV E;  5DQV A;  5H6R B;  4KP3 C;  3SWH A;  4X64 T;  4LMJ A;  4H9R C;  4GYR A;  2HPJ A;  3RH3 A;  2YDS A;  4TZ4 C;  3I9Y A;  4EZH A;  4O2B E;  3C50 A;  2KMF A;  3OKQ A;  1YD8 G;  2LSK A;  1XWM A;  4H63 V;  3T8O A;  5JR9 B;  3ZT7 A;  3D0T A;  4QH4 A;  1D1B A;  3P4Q A;  5FXV A;  4ERR A;  2LOP A;  2E9X A;  5EK4 A;  3FZM B;  2VKD A;  5AQJ B;  1QLB A;  2YOE A;  3CX6 B;  4P1N A;  1WR6 A;  5CFB A;  3EI0 A;  2VKH A;  3CQC B;  5CA1 E;  4X62 T;  2UXD T;  4ZXL A;  1M62 A;  1WFD A;  2DL1 A;  2KLQ A;  2LM2 A;  2XSB A;  3NBX X;  3HKB E;  4IL9 A;  1S94 A;  2YU1 A;  2L8K A;  3DTO A;  4PW8 A;  3ZMV B;  4EEB A;  3AB3 B;  5M4Y A;  4JI8 T;  5C8Y E;  5LHH B;  1U5P A;  2MTQ A;  2M67 A;  1UK5 A;  2XTL A;  5LCY A;  4I43 B;  4WBN E;  5HXS A;  3FB2 A;  4DV0 T;  2L3L A;  4UV8 B;  3ZCJ A;  2J4G A;  4XBF B;  3AE7 A;  4B3M T;  3ZT6 A;  3AXJ B;  2A9U A;  2XQA A;  1SE7 A;  4H63 H;  5AQG B;  4DR5 T;  1AJ3 A;  2KXP B;  4XAX B;  5AQP B;  3Q5E A;  4HEA A;  3A7M A;  3FHN A;  5FYM A;  3RGL A;  4YSY A;  4X65 T;  4X66 T;  3KBT A;  3ZYM A;  1OED E;  4LF8 T;  3HKC E;  2VKO A;  2X0L B;  4QHO A;  5JDH A;  2JMK A;  2WQY A;  3JAE A;  1OED A;  2BG9 C;  2R6G F;  3PUW F;  3V5S A;  5J2T E;  2JQK A;  2K3W A;  3AAA B;  2XQ7 A;  5AQM B;  3SRZ A;  2XAJ B;  1D0X A;  2WWU A;  2RPA A;  3CX7 B;  3BQK A;  1D0Y A;  2LOS A;  2X68 A;  3K3O A;  4IDP A;  4O4I E;  1W9R A;  3NKZ A;  3RIF A;  2X9Y A;  4JEH B;  2DLR A;  2JPF A;  3KV4 A;  3SS1 A;  1FJG T;  2H7V C;  2KND A;  3FXD B;  2B1E A;  2WU5 A;  5AQK B;  4QXC B;  4QX8 B;  3ZST A;  3SFD A;  1HG2 A;  1N32 T;  2YKS A;  2CA5 A;  3C51 A;  2VL0 A;  2V7I A;  2H3R A;  2K24 A;  2KIN B;  1D1A A;  3ESL A;  3P4W A;  2QGS A;  4U7I A;  3RIU A;  5C3J A;  2XQ8 A;  1KNZ A;  1WYB A;  4ZI2 C;  1YQ3 A;  3AEC A;  3PDY A;  4X1K E;  5HYA A;  5BR8 T;  4GKJ T;  3HA4 A;  4EGW A;  2UXC T;  4OK0 A;  4LF9 T;  4DID B;  1HR0 T;  2X9H A;  1D1C A;  1OED B;  3B5M A;  3F57 A;  4NXM T;  2E9X C;  1UCU A;  4MBQ A;  1QUU A;  2J62 A;  1KEY A;  3B13 A;  4JBW F;  5L4E A;  2X51 A;  4LMK A;  2P9B A;  2CMR A;  2LSJ A;  3AA7 B;  3FZK B;  2HN2 A;  2NWB A;  2G0U A;  2XM2 A;  2PJQ A;  3C64 A;  2QRX A;  3PJA A;  4KBM B;  2BG9 B;  4V1A v;  4A5X A;  1XNQ T;  1JNZ A;  2V6Y A;  4H9O C;  3J7Y q;  2E5V A;  2W62 A;  1XDO A;  3JCF A;  2BBJ A;  4WNK A;  3LBX B;  3RIU C;  2CEA A;  4UR9 A;  5LBM A;  4UV9 B;  4JI3 T;  5JDG A;  2CRB A;  4PK6 A;  4ZI7 E;  2CHO A;  2WDQ A;  1H7C A;  3RYC E;  5HCM A;  4JYA T;  5L3C B;  2J1D G;  1HS7 A;  5A1L A;  3EDU A;  4U74 A;  4I0U A;  5AFU L;  2UXB T;  1Z0P A;  2CE7 A;  4AQF C;  4JI5 T;  5HCJ A;  2UUC T;  4IE6 A;  5KMG P;  4HKA A;  2NTX A;  3H37 A;  4AQF A;  4YT0 A;  1T7S A;  2VVN A;  3CKD A;  3ZSS A;  2IUB A;  3PUZ F;  4YSX A;  3FBZ A;  2M6B A;  3KBU A;  2BDE A;  2WWV A;  4DBQ A;  2Q9Q C;  5L3F B;  4HGA A;  1YXR A;  5HWX A;  2E9X D;  3AXJ A;  3CQG B;  1HX1 B;  4DBR A;  2DI4 A;  2RA1 A;  1G73 A;  4X1Y E;  4F6R C;  1J5E T;  4I55 E;  2MOZ A;  2RP4 A;  3PUX F;  4HN9 A;  5HEU A;  3IHR A;  1XZY A;  3ZN1 B;  4EYY R;  2X0H A;  2XY8 B;  4AKR B;  4YTN A;  4DR6 T;  2FJA A;  5JR9 C;  4O2A E;  4JI2 T;  5JH7 E;  3QNU A;  3AEE A;  4P0A A;  3DJB A;  4QH5 A;  5IYZ E;  1SA0 E;  2V7J A;  4AIU A;  3TLU A;  4DVD A;  4F8H A;  5LHG B;  4JEU B;  2EHO A;  5AQI B;  4DV2 T;  3M65 A;  3F31 A;  3R6N A;  3EHZ A;  1MND A;  1U4Q A;  5FY0 A;  3KVA A;  1MIY A;  2BS2 A;  2D0T A;  2CHN A;  3AE8 A;  3AAE B;  3EVY A;  3M3Z B;  4AIS A;  4B6X A;  1HF8 A;  2LT3 A;  3IF8 B;  2LSG A;  3NZP A;  3PJA J;  3RRC A;  5AQN B;  5JDQ A;  5CA0 E;  3MZK B;  2F4V T;  1D0Z A;  3HI2 A;  5FXX A;  2D9D A;  3MKD A;  2C5K T;  1NWM X;  5H6Q B;  3A5X A;  5JDN A;  5FP3 A;  5LMN T;  3ONX A;  2CCQ A;  3TLT A;  3N9M A;  2LSY A;  4FJO A;  5L4H A;  1HTJ F;  3KV5 A;  5F3J A;  4DUY T;  3KDS E;  4IST A;  2FBW A;  2HPL A;  2WZI A;  5LOV E;  1R8I A;  3KV6 A;  4YFS A;  2DWK A;  1UX5 A;  4KHZ F;  1WCR A;  4YJ2 E;  2CXF A;  2FJD A;  3U78 A;  4LF5 T;  3MAC A;  3CPZ A;  3QB5 A;  4ZOL E;  3ANW A;  5L2L A;  4OYJ A;  3OPC A;  3EAM A;  3LDQ B;  1ZKE A;  3CX8 B;  3GWH A;  4MLK A;  2V6Y B;  4PJL A;  4EED A;  3RC8 A;  5HEH A;  1ZV4 X;  3UU4 A;  4EXT A;  1VCS A;  2Y8D A;  4HFC A;  3ZN0 B;  5L3G B;  4C91 A;  4DMV A;  4YHJ A;  3TLV A;  4GKK T;  4TWD A;  1E1H B;  2XM1 A;  2LJL A;  3N9Q A;  5HXE A;  3QB5 K;  2I0M A;  4U72 A;  1MMG A;  1VRB A;  1V9D A;  3LK3 B;  4QX7 B;  1HFA A;  5E0O A;  5AQS B;  3H3M A;  5ABF B;  2JQQ A;  2X9W A;  2FUP A;  1FEW A;  1B7T A;  4TV9 E;  3CVR A;  2Q9Q A;  3OVU A;  4YTM A;  5AQH B;  2MBG A;  1IJ5 A;  2J47 A;  4H9S E;  2CM0 A;  4QXB B;  3P4S A;  2K5B B;  3CWZ B;  4G63 A;  2CXD A;  4CI2 B;  5LG4 A;  1NAF A;  4TNV A;  4DV7 T;  4DR7 T;  5LGN B;  2IW5 B;  4HFI A;  3IEE A;  1FIO A;  4U2Y A;  2K48 A;  5JQG E;  2WSS V;  1J5W A;  2DWG A;  3RI5 A;  2XPK A;  2Q9Q B;  2XUE A;  5FY7 A;  4CN6 A;  4ILU A;  2IHR 1;  3UUL A;  2LE8 A;  4ADZ A;  2C5J A;  1J1J A;  3N2K E;  2Q9Q D;  5LP6 E;  3OTO T;  2IC9 A;  3J9X 1;  1IBM T;  4IHJ E;  2NOX A;  3LSV A;  4H9P C;  4ILB A;  5C2T A;  5L3B B;  5ETW A;  4PAG A;  2XQ4 A;  2YK0 A;  3E08 A;  2BZB A;  4I50 E;  4EYU A;  3L3P A;  3MXZ A;  2ZM0 A;  1Y64 B;  3UUN A;  2A72 A;  3Q5X A;  3I0Q A;  3AE5 A;  3ONL C;  4HFH A;  3RX6 A;  4CXX A;  4YXD A;  3OYX A;  4GK5 E;  2JJ9 A;  2VL8 A;  4IE5 A;  4NIQ A;  4NUV A;  3ZMT B;  4E7S A;  4TN7 B;  3FZL B;  1L0V A;  2QA7 A;  4IE0 A;  3K1S A;  2W63 A;  2NTY A;  4QWN B;  5JR9 A;  3SFE A;  5JRE A;  1I94 T;  4WZX A;  3TLS A;  3C4W A;  4JI7 T;  1OXZ A;  1T8B A;  1M7K A;  3QC9 A;  2V5C A;  4JI4 T;  2UUB T;  5FVL A;  2DHR A;  3LK2 B;  3CK6 A;  4DV3 T;  4ILC A;  2XAS B;  4COF A;  4O4H E;  4X5T A;  4KHP T;  3V5U A;  1KNP A;  2PFV A;  2CWY A;  2IC6 A;  4ZS2 A;  5HAX A;  4TNW A;  1KF6 A;  4EOZ B;  1W0A A;  4PK4 A;  2XHE B;  3C4Z A;  3UQ4 A;  4DUZ T;  2HH7 A;  4PFO A;  3HL6 A;  2W61 A;  4WW0 A;  4IE7 A;  3N9P A;  4ILA A;  4QH1 A;  2IDO B;  2JIW A;  5AQQ B;  3FZH B;  2XAG B;  5AQO B;  3OJA A;  5JDF A;  4BAY B;  3I0O A;  4BJM A;  4BJN A;  5JVD E;  2LKH A;  1KK7 A;  1LVK A;  1HX8 A;  3N9O A;  4OHF A;  1XMQ T;  5LMU T;  2PBI A;  3NRX A;  2WMO A;  3UU5 A;  2JRK A;  5IHY A;  4DND A;  3JC6 D;  5AQF B;  2B76 A;  2X0Y A;  1LRZ A;  4AKI A;  1YKE B;  3VU7 H;  3KVB A;  3O1I A;  3Q9D A;  2LKG A;  4BA9 A;  4DO0 A;  5IWA T;  4G2A A;  5ADX L;  3RKG A;  3LK4 2;  3RC3 A;  3ONJ A;  5F8P A;  5LGU B;  2V1D B;  3MK7 C;  1KNR A;  2NR4 A;  3RYH E;  4DV4 T;  5LJM A;  3Q5W A;  4DV5 T;  4EV6 A;  5FVK A;  3AE6 A;  4UXN B;  4GIW A;  3RLF F;  3AEA A;  3UT5 E;  2EHO C;  4U3C A;  4O4J E;  1XMO T;  2A2F X;  2WB5 A;  2WDR A;  2IIU A;  3WI3 A;  4P09 A;  1ZEE A;  3IA3 A;  3KV9 A;  3L8R A;  3UQ7 A;  2CLY B;  2BS3 A;  2W67 A;  2KSR A;  4NUU A;  5ABG A;  2BKN A;  3NRY A;  3E0Z A;  4IDZ A;  3PU8 A;  3NZQ A;  4QXH B;  3VR9 A;  2AE9 A;  2VB6 A;  4EIW A;  4JV5 T;  1MMN A;  2OA5 A;  3ZT5 A;  4L5G A;  5AQT B;  4UF0 B;  4HWI B;  5AQU B;  2Z6E A;  3ZCI A;  4PNI A;  4MFR A;  4A56 A;  1IJ6 A;  3JC6 C;  2WS3 A;  2XQ3 A;  4I4T E;  4LFB T;  2YN6 A;  5DQW A;  1HNW T;  3RYI E;  2BG9 A;  1UUS A;  2C5I T;  2I6H A;  3KFW X;  4N78 D;  4UEM A;  2W2U A;  2WY2 A;  5DAB A;  5FY1 A;  4WYV A;  5CJ5 A;  1IBL T;  2ODV A;  3UUM A;  3GMI A;  4JI6 T;  4UVB B;  4JUY A;  4CZZ B;  5EZY E;  2K9A A;  2FJE A;  4UEL A;  1IZN B;  4X1I E;  5AQR B;  5KX5 E;  4FI5 A;  4P0B A;  3UFE A;  5LXT E;  5KXJ A;  2BS4 A;  2H7O A;  3IBP A;  1VCT A;  3L09 A;  3QUJ A;  4HWC A;  4IT4 A;  2ZM8 A;  4ZZB A;  3ZYL A;  4OX9 T;  3VHL A;  4A98 A;  3I1A A;  3G06 A;  2DNX A;  3UTK A;  4PFP A;  1IBK T;  1CUN A;  5EK3 A;  3AA0 B;  5L3E B;  4X20 E;  2BG9 E;  2ZM6 T;  2UUA T;  2LLY A;  4TV8 E;  1T98 A;  3AEF A;  2X67 A;  5FNV E;  4OYK A;  1WR0 A;  2JQ9 A;  3O4X E;  5CB4 E;  4B3T T;  2ODU A;  1CHU A;  2YU2 A;  4YLH A;  4ISS A;  2VUR A;  4CN1 A;  3WAJ A;  2LSI A;  2VVS A;  1UGO A;  3B57 A;  4DR3 T;  2DCF A;  4IDO A;  2H88 A;  2IAK A;  1E7P A;  2XJ7 A;  4CI1 B;  1BR4 A;  3ZMU B;  3Q2M A;  3E22 E;  3VRA A;  3UUB A;  4HTE A;  4DR2 T;  5FL1 A;  5HEJ A;  2XQ6 A;  4HWD A;  5AQL B;  3RF1 A;  5KDM C;  5LA6 E;  4GOU A;  4YY3 T;  5ABH A;  2KWI B;  4KMC A;  4Z8X A;  2LHR A;  2GK9 A;  2LM9 A;  2X66 A;  2N1G A;  2XAF B;  3A8Y C;  3K8P C;  3O9X A;  5HXR A;  1MMD A;  4IIJ E;  5L3D B;  2LEH A;  3TLW A;  3BQL A;  4EAH A;  1O3X A;  4NXN T;  2H89 A;  3KIN B;  4K0U A;  1LVF A;  3RHW A;  3ZJ1 A;  4CN4 A;  2BBH A;  4AQY T;  5FXW A;  2V7K A;  3ZMS B;  2BVL A;  5BMV E;  2Y6X A;  4AI6 A;  3RYF E;  2YDR A;  1UX4 A;  1N34 T;  3RPU A;  3P50 A;  4PJN A;  3VRB A;  1BR0 A;  2LRL A;  3BQI A;  3P4R A;  2EHO D;  2KT9 A;  2UXX B;  3AA1 B;  4DR1 T;  4JI0 T;  1N33 T;  2PTF A;  4GYS A;  4Q25 A;  3VKG A;  2EHO B;  5JDM A;  1XNR T;  4LFC T;  2WCA A;  2AXD S;  3ETV A;  3N5L A;  4IL4 A;  4LFA T;  3AVS A;  1WLX A;  2VWA A;  2WM9 A;  4J2C A;  4U33 A;  5CGM A;  2CLY C;  2I59 A;  4PJJ A;  1VOM A;  2XQY A;  4IDN A;  1HG5 A;  4TWF A;  3ZKR A;  4E7Z A;  2UXN B;  2XZE A;  3EDV A;  2L9Q A;  2VKJ A;  2C0S A;  2HN1 A;  3H3A A;  3N9N A;  3PTR B;  4HWH A;  3UU3 A;  2CBI A;  4LF4 T;  3K3N A;  2W0G A;  3RIA A;  1Z8U A;  5ABE A;  4YSZ A;  3AE9 A;  3F2E A;  3FXE B;  4U7Y A;  1FMV A;  1GQE A;  4MHC A;  5IUX A;  3PUS A;  5HWY A;  2BVM A;  2LRK A;  4KI0 F;  3BK9 A;  3ZJ2 A;  4AQG A;  4ZEY A;  4ZI3 D;  2E5L T;  2E9X B;  3ZPO A;  3JAD A;  4HE8 A;  5LHI B;  2JQH A;  2D5U A;  4NPP A;  1MIV A;  3T1Y T;  1Y01 A;  3N2O A;  3AE2 A;  3N2G E;  4O4L E;  4B3R T;  3AE1 A;  2NP9 A;  4IRE A;  4QKN A;  5HEO A;  3C4X A;  4UIG A;  4ANJ A;  2QVA A;  2ZMA A;  3FZF B;  2ZLY A;  3PUG A;  3CIR A;  2SPC A;  3PUA A;  3RQU A;  3AED A;  4HWF A;  4ZS3 A;  3WAK A;  2W00 A;  2W4X A;  4H9Q C;  2XAH B;  5FXZ A;  4TUY E;  2V26 A;  4EB6 E;  4XZC A;  3NWI A;  1KFY A;  2E8I A;  2ZM2 A;  3JAF A;  5JDL A;  4U31 A;  3CML A;  2CWO A;  4M1P A;  3P7I A;  3AVR A;  4WBO A;  3R84 B;  1DU2 A;  1X79 A;  2ACX A;  2CXL A;  4AXP A;  3LBX A;  2VAS A;  4HFB A;  2BKO A;  4EZ4 A;  4PK5 A;  3LG7 A;  3O1H A;  4LML A;  3PUQ A;  2ACZ A;  1UUR A;  3RKO A;  4DV1 T;  4L9I A;  1T72 A;  1YW0 A;  1SUM B;  2OLT A;  1YQ4 A;  1OWA A;  1ZP0 A;  2V7L A;  2Y48 B;  3PUV F;  4KX6 A;  4Z90 A;  4LF7 T;  5JRC A;  2XAQ B;  3O1J A;  1HCI A;  2CBJ A;  3P8C D;  3PU3 A;  3Q5D A;  1IAP A;  4ZI3 C;  3X1D A;  5EK2 A;  4MAL A;  1SHZ C;  1BR2 A;  4UVA B;  3RQW A;  1LKX A;  3HKD E;  3PV0 F;  2M6I A;  2WU2 A;  2NW9 A;  3VR8 A;  4DR4 T;  5FKY A;  3CQX C;  4UVC B;  2WDV A;  4GK0 E;  2V8S V;  4IGU A;  4CXW A;  4TWH A;  3ZC0 A;  2NW8 A;  4ZZC A;  2XSA A;  4ZHQ E;  2WMN A;  5JTG A;  3ANW B;  4CXY A;  1XDP A;  2XQ5 A;  2YEV C;  3DP7 A;  2N2N A;  2UU9 T;  1HNZ T;  3VKH A;  3UU6 A;  5J1G A;  5L47 A;  5LG3 A;  4CQI A;  4YHH T;  2D2S A;  1W0B A;  3UFG A;  4HFE A;  4KUM B;  3TKL B;  2YIN A;  3S4U A;  3C98 B;  2V5D A;  3L39 A;  2WAU A;  2VQF T;  1HNX T;  3GN5 B;  4B3S T;  5J2U E;  1MMA A;  2HHH T;  2E2A A;  4H9N C;  5HEG A;  1S35 A;  3ZLI A;  2YDQ A;  5LNK A;  2CPT A;  1WYC A;  3OYZ A;  2X9X A;  5FMN A;  3RRW A;  3HR0 A;  1JNR A;  1G8X A;  1NEN A;  4C90 A;  4IDQ A;  1BR1 A;  1QSD A;  1MIW A;  2VK9 A;  2NW7 A;  4O8S A;  4LF6 T;  3AEB A;  3GN5 A;  2W66 A;  3QK6 A;  4A97 A; 
#chains in the Genus database with same CATH homology
 3ETU A;  3LFM A;  4YJ3 E;  2D0U A;  1FMW A;  2JMH A;  2LHN A;  3I9W A;  5HXH A;  5TAO A;  4JLE A;  1US7 B;  3GA8 A;  4CI3 B;  5LGT B;  1YKH B;  2WBL A;  4OFZ A;  3UUX B;  4ASK A;  3LJC A;  3ZEF B;  4TX5 A;  5HXC A;  3U3I A;  1WRD A;  2N9D A;  2PG8 A;  2V7M A;  4L0R A;  3ZMZ B;  5DJQ C;  5LYJ E;  2KZ7 B;  3ZYK A;  1EZ3 A;  2ES0 A;  3ZC1 A;  4IE4 A;  2KWH A;  4HFV A;  3SOL A;  5JRC B;  3N9L A;  5GON E;  3AA6 B;  4ZI2 D;  3MJX A;  3FBL A;  5LJN A;  3AAI A;  1MNE A;  4UF0 A;  3K3Q C;  4AKL A;  2MYS A;  3PE0 A;  3PUR A;  3W15 B;  3EUH A;  2A3D A;  3HKE E;  4PJM A;  5LBQ B;  4AKH A;  4AKG A;  1ZHC A;  3MA9 A;  3OBV E;  3SWH A;  5DQV A;  5H6R B;  4KP3 C;  4H9R C;  4GYR A;  2HPJ A;  3RH3 A;  4TZ4 C;  3I9Y A;  4EZH A;  4O2B E;  3C50 A;  2KMF A;  3OKQ A;  1YD8 G;  2LSK A;  4H63 V;  3T8O A;  5JR9 B;  3D0T A;  1D1B A;  5FXV A;  4ERR A;  2LOP A;  2E9X A;  5EK4 A;  2VKD A;  3CX6 B;  1WR6 A;  2VKH A;  3CQC B;  5CA1 E;  2KLQ A;  5DAB A;  3NBX X;  3HKB E;  1S94 A;  2YU1 A;  2L8K A;  3DTO A;  4PW8 A;  3ZMV B;  3AB3 B;  5M4Y A;  5C8Y E;  5LHH B;  1U5P A;  2MTQ A;  2M67 A;  2XTL A;  5LCY A;  4I43 B;  4WBN E;  5HXS A;  3FB2 A;  2L3L A;  4UV8 B;  3ZCJ A;  4XBF B;  4H63 H;  1AJ3 A;  2KXP B;  4HEA A;  5FYM A;  3FHN A;  3KBT A;  3ZYM A;  3HKC E;  2VKO A;  2X0L B;  4QHO A;  5JDH A;  2JMK A;  3V5S A;  5J2T E;  3AAA B;  3SRZ A;  2XAJ B;  1D0X A;  2WWU A;  3CX7 B;  3BQK A;  1D0Y A;  2LOS A;  2X68 A;  3K3O A;  4O4I E;  2X9Y A;  4JEH B;  2DLR A;  2JPF A;  3KV4 A;  3SS1 A;  2H7V C;  3FXD B;  2KND A;  2B1E A;  4QXC B;  4QX8 B;  1HG2 A;  2CA5 A;  3C51 A;  2V7I A;  2H3R A;  2K24 A;  2KIN B;  3ESL A;  1D1A A;  2QGS A;  1WYB A;  4ZI2 C;  4X1K E;  5HYA A;  3PDY A;  3HA4 A;  4OK0 A;  2X9H A;  1D1C A;  3F57 A;  2E9X C;  1UCU A;  4MBQ A;  1QUU A;  3B13 A;  2X51 A;  4XAX B;  2P9B A;  2CMR A;  2LSJ A;  3AA7 B;  4PJN A;  5HXR A;  2NWB A;  2G0U A;  4KBM B;  2PJQ A;  3C64 A;  4V1A v;  4H9O C;  3J7Y q;  2W62 A;  4WNK A;  3LBX B;  2CEA A;  5LBM A;  1KNZ A;  4UV9 B;  5JDG A;  4ZI7 E;  4PK6 A;  1HS7 A;  1H7C A;  3RYC E;  5L3C B;  2J1D G;  5A1L A;  3EDU A;  4U74 A;  5AFU L;  1Z0P A;  2CE7 A;  4AQF C;  4IE6 A;  4HKA A;  2NTX A;  3H37 A;  4AQF A;  3CKD A;  3FBZ A;  3KBU A;  2BDE A;  4DBQ A;  2Q9Q C;  5L3F B;  4HGA A;  2E9X D;  3CQG B;  4DBR A;  2DI4 A;  2RA1 A;  1G73 A;  4X1Y E;  4F6R C;  4I55 E;  2MOZ A;  2RP4 A;  4HN9 A;  5HWX A;  3IHR A;  4EYY R;  4AKR B;  5JR9 C;  4O2A E;  5JH7 E;  4P0A A;  3DJB A;  5IYZ E;  1SA0 E;  2V7J A;  4DVD A;  5LHG B;  4JEU B;  2EHO A;  3M65 A;  3F31 A;  3R6N A;  1MND A;  1U4Q A;  5FY0 A;  3KVA A;  1MIY A;  2D0T A;  3EVY A;  3AAE B;  4B6X A;  1HF8 A;  2LT3 A;  3IF8 B;  2LSG A;  3NZP A;  3RRC A;  5JDQ A;  5CA0 E;  3MZK B;  1D0Z A;  3HI2 A;  5FXX A;  3MKD A;  2C5K T;  1NWM X;  5H6Q B;  3A5X A;  5JDN A;  5FP3 A;  3ONX A;  2CCQ A;  3N9M A;  2LSY A;  4FJO A;  1HTJ F;  3KV5 A;  5F3J A;  3KDS E;  4IST A;  2HPL A;  5LOV E;  3KV6 A;  4YFS A;  2DWK A;  1UX5 A;  4YJ2 E;  2CXF A;  3U78 A;  3MAC A;  3CPZ A;  4ZOL E;  3ANW A;  5L2L A;  4OYJ A;  1ZKE A;  3CX8 B;  3GWH A;  4MLK A;  4PJL A;  3RC8 A;  1ZV4 X;  4EXT A;  2Y8D A;  3ZN0 B;  4C91 A;  4DMV A;  4YHJ A;  1E1H B;  3N9Q A;  2LJL A;  5HXE A;  4U72 A;  1MMG A;  1VRB A;  1V9D A;  3LK3 B;  4QX7 B;  1HFA A;  5E0O A;  2JQQ A;  2X9W A;  1FEW A;  1B7T A;  4TV9 E;  3CVR A;  2Q9Q A;  2MBG A;  1IJ5 A;  4H9S E;  2CM0 A;  4QXB B;  4G63 A;  2K5B B;  3CWZ B;  2CXD A;  4CI2 B;  5LG4 A;  1NAF A;  5LGN B;  2IW5 B;  3IEE A;  1FIO A;  2K48 A;  5JQG E;  2WSS V;  2DWG A;  2Q9Q B;  2XUE A;  5FY7 A;  4ILU A;  4ADZ A;  3UUL A;  2LE8 A;  2C5J A;  5LP6 E;  3N2K E;  2Q9Q D;  2IC9 A;  3J9X 1;  4IHJ E;  2NOX A;  4H9P C;  5L3B B;  5ETW A;  4PAG A;  3E08 A;  2YK0 A;  2BZB A;  4I50 E;  4EYU A;  3L3P A;  3MXZ A;  2ZM0 A;  1Y64 B;  3UUN A;  2A72 A;  3Q5X A;  3I0Q A;  4CXX A;  3RX6 A;  3OYX A;  4GK5 E;  2JJ9 A;  2VL8 A;  4IE5 A;  4NUV A;  3ZMT B;  4E7S A;  5KMG P;  4TN7 B;  3ZN1 B;  2QA7 A;  4IE0 A;  4QWN B;  2W63 A;  2NTY A;  5JR9 A;  5JRE A;  3C4W A;  1OXZ A;  3QC9 A;  2DHR A;  3LK2 B;  2XAS B;  4O4H E;  3V5U A;  2PFV A;  2CWY A;  2IC6 A;  4ZS2 A;  5HAX A;  4EOZ B;  4PK4 A;  2XHE B;  3C4Z A;  2HH7 A;  4PFO A;  3HL6 A;  2W61 A;  4WW0 A;  4IE7 A;  3N9P A;  5JDF A;  4BJM A;  2XAG B;  5LGU B;  3OJA A;  4BJN A;  4BAY B;  3I0O A;  5JVD E;  1KK7 A;  1LVK A;  1HX8 A;  3N9O A;  4OHF A;  2PBI A;  3NRX A;  2WMO A;  2JRK A;  5IHY A;  4DND A;  3JC6 D;  1LRZ A;  4AKI A;  1YKE B;  3VU7 H;  3KVB A;  3O1I A;  3Q9D A;  4BA9 A;  4DO0 A;  4G2A A;  5ADX L;  3LK4 2;  3RC3 A;  5F8P A;  2V1D B;  3MK7 C;  3RYH E;  5LJM A;  3Q5W A;  4UXN B;  4GIW A;  3UT5 E;  2EHO C;  4O4J E;  2A2F X;  3WI3 A;  4P09 A;  1ZEE A;  3KV9 A;  2CLY B;  4NUU A;  3NRY A;  3E0Z A;  4IDZ A;  3PU8 A;  3NZQ A;  4QXH B;  4EIW A;  2VB6 A;  1MMN A;  2OA5 A;  4L5G A;  4UF0 B;  3ZCI A;  2Z6E A;  4PNI A;  4MFR A;  4A56 A;  1IJ6 A;  3JC6 C;  4I4T E;  5DQW A;  3RYI E;  2C5I T;  4N78 D;  3KFW X;  4UEM A;  5FY1 A;  2ODV A;  3UUM A;  3GMI A;  4UVB B;  4JUY A;  4CZZ B;  5EZY E;  2K9A A;  4UEL A;  1IZN B;  4X1I E;  5LXT E;  4FI5 A;  4P0B A;  3UFE A;  2H7O A;  3IBP A;  3L09 A;  3QUJ A;  5L3G B;  2ZM8 A;  3ZYL A;  3VHL A;  3I1A A;  2DNX A;  3UTK A;  4PFP A;  1CUN A;  5EK3 A;  3AA0 B;  5L3E B;  4X20 E;  4TV8 E;  1T98 A;  2X67 A;  5FNV E;  4OYK A;  3O4X E;  5CB4 E;  2ODU A;  2YU2 A;  4YLH A;  4ISS A;  3WAJ A;  2LSI A;  3B57 A;  2DCF A;  2IAK A;  4CI1 B;  1BR4 A;  3ZMU B;  3Q2M A;  3E22 E;  4HTE A;  5KDM C;  5LA6 E;  4GOU A;  2KWI B;  4KMC A;  4Z8X A;  2LHR A;  2GK9 A;  2LM9 A;  2X66 A;  2N1G A;  2XAF B;  3K8P C;  3O9X A;  1MMD A;  4IIJ E;  5L3D B;  2LEH A;  3BQL A;  4EAH A;  1O3X A;  3KIN B;  4K0U A;  1LVF A;  3ZJ1 A;  5FXW A;  2V7K A;  3ZMS B;  2BVL A;  5BMV E;  2Y6X A;  4AI6 A;  3RYF E;  1UX4 A;  3RPU A;  1BR0 A;  3BQI A;  2EHO D;  2KT9 A;  2UXX B;  3AA1 B;  3VKG A;  4GYS A;  2EHO B;  5JDM A;  3ETV A;  3N5L A;  3AVS A;  1WLX A;  2VWA A;  2WM9 A;  4J2C A;  5KX5 E;  2CLY C;  2I59 A;  4PJJ A;  1VOM A;  2XQY A;  4E7Z A;  1HG5 A;  2UXN B;  3EDV A;  3N9N A;  2L9Q A;  2VKJ A;  2C0S A;  3PTR B;  3H3A A;  3K3N A;  2W0G A;  3F2E A;  3FXE B;  1FMV A;  4MHC A;  3PUS A;  5HWY A;  2BVM A;  3ZJ2 A;  4AQG A;  3BK9 A;  4ZI3 D;  2E9X B;  3ZPO A;  4HE8 A;  5LHI B;  2D5U A;  1MIV A;  3N2O A;  3N2G E;  4O4L E;  2NP9 A;  4QKN A;  3C4X A;  4UIG A;  4ANJ A;  2ZMA A;  2ZLY A;  3PUG A;  3PUA A;  2SPC A;  4ZS3 A;  3WAK A;  2W00 A;  4H9Q C;  2XAH B;  5FXZ A;  4TUY E;  2V26 A;  4EB6 E;  4XZC A;  2E8I A;  2ZM2 A;  5JDL A;  3CML A;  2CWO A;  4M1P A;  3P7I A;  3AVR A;  4WBO A;  3R84 B;  1X79 A;  2ACX A;  2CXL A;  4AXP A;  3LBX A;  2VAS A;  4EZ4 A;  4PK5 A;  3LG7 A;  3O1H A;  3PUQ A;  3RKO A;  4L9I A;  1YW0 A;  2Y48 B;  4DMW A;  1OWA A;  2V7L A;  5JRC A;  2XAQ B;  3O1J A;  1HCI A;  3P8C D;  5EK2 A;  3PU3 A;  4ZI3 C;  1IAP A;  4MAL A;  1SHZ C;  1BR2 A;  4UVA B;  1LKX A;  3HKD E;  2NW9 A;  3CQX C;  4UVC B;  4GK0 E;  4IGU A;  4CXW A;  3ZC0 A;  2NW8 A;  4ZHQ E;  2WMN A;  3ANW B;  4CXY A;  2YEV C;  3DP7 A;  2N2N A;  3VKH A;  5J1G A;  4CQI A;  2D2S A;  4KUM B;  3TKL B;  2YIN A;  3S4U A;  3C98 B;  2WAU A;  3GN5 B;  5J2U E;  1MMA A;  4H9N C;  1S35 A;  3ZLI A;  5LNK A;  1WYC A;  3OYZ A;  2X9X A;  5FMN A;  3RRW A;  3HR0 A;  1G8X A;  4C90 A;  1BR1 A;  2VK9 A;  1QSD A;  1MIW A;  2NW7 A;  4O8S A;  3GN5 A;  3QK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...