4ILUA

Crystal structure of mycobacterium tuberculosis card
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
165
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALADAKAETILDEVLAAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis CarD, an essential RNA polymerase binding protein, reveals a quasidomain-swapped dimeric structural architecture
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords RNA polymerase-binding transcription factor CarD
total genus 45
structure length 165
sequence length 169
ec nomenclature
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4iluA02
4ILUA 4KBMB 4KMCA 4MFRA 2LT3A 4L5GA 4XAXB
chains in the Genus database with same CATH superfamily
2J4GA 1VCSA 4AKGA 2XHEB 2JQ9A 3A7MA 3HKBE 4GYRA 2V7KA 2X67A 5L4EA 5H6RB 3GWHA 1WR0A 5CA0E 4JI7T 2E9XA 3EI0A 2CBJA 2WCAA 4UR9A 4U2ZA 3NZPA 3Q5WA 1N33T 5JRCA 5JDHA 3AE3A 3UFEA 4CXWA 2Y8DA 2MTQA 2XASB 3D0TA 4BAYB 5LHHB 5HEGA 3PUXF 3NZQA 3F57A 3T8OA 4CN1A 1U5PA 4I0UA 3ZMSB 1T98A 1FEWA 2IDOB 2W62A 3RKGA 1W09A 3P7IA 4Z8XA 3TLUA 1D0ZA 4CN4A 3IA3A 2I0MA 2JQQA 4HWFA 5HWXA 5KX5E 3N9MA 2KNDA 3ETUA 4JEHB 3WAKA 2CM0A 4KUMB 3RYIE 1ZV4X 1GQEA 4K0KT 4H63V 1WRDA 4HFHA 4X62T 5ABGA 2MYSA 3PURA 4C91A 1OEDA 3KV9A 1S35A 1MMNA 2ACZA 2V6XA 2M6IA 4DR4T 2BG9E 3RRWA 4NUVA 4AIUA 2IW5B 2JPFA 4BA9A 3F31A 3AAEB 4U33A 2OA5A 4QXCB 3GMIA 4ISTA 2DNXA 3HR0A 4IIJE 3RIFA 2L9QA 2GK9A 1ZP0A 3UUMA 5AQQB 1J5ET 2EHOA 4OYKA 3AEGA 5FVKA 4YTNA 5C2TA 1D0YA 4LFBT 3P8CD 1SUMB 3IEEA 4YTPA 4ZS2A 5KDMC 2CE7A 3AA0B 3ZEFB 4ADZA 3JADA 2XSBA 2J1DG 1MMGA 3ANWA 3L39A 3AEFA 3NVOA 4N78D 4O4JE 5J2UE 3OTOT 3H3MA 3QC9A 5HWYA 2J47A 4IE4A 4HFVA 3ZMZB 2VVNA 3CVRA 3AEAA 3QB5K 5E0OA 3KV6A 4IL4A 5AQHB 2I6HA 5JVDE 1Z8UA 4JI6T 4PJJA 2BG9B 2YDQA 4EYYR 4AI6A 4TUYE 2E8IA 4WBOA 3SWHA 3FBLA 2V5CA 2B1EA 3ZYLA 4FJOA 3ABVA 1HG5A 5BMVE 2LE8A 5FL0A 3CKDA 4HE8A 4HFEA 4PJLA 4DVDA 4TWHA 2EHOB 3FZFB 4QH5A 1VCTA 4KMCA 5HXRA 1CUNA 4IHJE 3LK42 2CPTA 2OLTA 1QLBA 2OV9A 4QXBB 4KHZF 1D0XA 1KK7A 2Y6XA 3CPZA 2VL0A 3O1JA 5AQRB 2FJBA 4UVAB 5JR9A 3ZSSA 4NXMT 2RPAA 5L47A 3L3PA 4EZHA 5LYJE 1HF8A 4OFZA 2V5DA 2BBHA 3FZLB 2PJQA 2VB6A 4MLKA 3PJAJ 2ODVA 3B13A 3BQKA 2V7MA 3P4WA 3ESLA 4CI3B 5JREA 5LCYA 2V26A 2Q9QD 2WWUA 3A8YC 3AE2A 3CX7B 4UVCB 3K3NA 3KV5A 4EIWA 1WYBA 2BG9C 4DR3T 2BKOA 4QXHB 4IT4A 5AQFB 4X1IE 4DBRA 1UK5A 3FZMB 4UV9B 2QA7A 2CLYC 5FMNA 4AISA 4F8HA 2L8KA 4DR5T 3ZMVB 2VKOA 5JRCB 2X68A 2QYWA 3ZKRA 4A56A 5JR9C 5FY1A 4X5TA 4JLEA 4GK5E 4PK6A 4YJ2E 2LKHA 2BVMA 2IIUA 2UUCT 4CI1B 3ZC0A 1MNDA 3UULA 1UCUA 4B3MT 4ZZBA 2CXFA 3C4WA 4IREA 4G2AA 1E7PA 5HXHA 2H7OA 2WZIA 4U7IA 4JI2T 2IC6A 2K9AA 5L3EB 2QGSA 4B6XA 2V1DB 4DV7T 3UQ4A 3SS1A 4DBQA 4TX5A 3GA8A 3P4QA 4ZEYA 4GOUA 1X9BA 4YT0A 3VKGA 2P9BA 3O9XA 3RQWA 3HL6A 3AE8A 5TAOA 3CWZB 3AA7B 2XAHB 5DJQC 4DV5T 2VL8A 4ILCA 4DR6T 5LNKA 4WYVA 1OWAA 4A98A 2N9DA 5ABEA 3RRCA 1IJ5A 4XZCA 3PUZF 1H7CA 3HKDE 4HWHA 2W66A 1XZYA 2AXDS 1R8IA 3ONLC 3JCFA 1WFDA 4TWFA 4JBWF 3N9QA 4YSXA 5KXJA 2FJDA 4UVBB 4E7ZA 4OK0A 1XNRT 1HCIA 2VKDA 3AEBA 3CMLA 3FBZA 1T7SA 2N2NA 2YDRA 3Q5EA 4KP3C 4MALA 4YTMA 4BJMA 2NWBA 5ABFA 4ZXLA 4DNDA 4ZI7E 3NRXA 3AE7A 5AQUB 5ABFB 5JDFA 2N1GA 5HCJA 1JNRA 1CHUA 1OEDC 2XQ7A 3C51A 4IDQA 3UU4A 1NWMX 1UUSA 3VRAA 3MA9A 3PUQA 4LF5T 3AE1A 3TLWA 2YINA 3Q9DA 1YKHB 4KX6A 5FYMA 5LGNB 2LHNA 2Y48B 2W4XA 3ZN0B 2NTXA 5LOVE 4AKIA 5FVLA 4TWDA 1I94T 3RC3A 3KDSE 5JDLA 2XJ7A 2XQ3A 1XDOA 1FMVA 3NKZA 2HN2A 2MOZA 3CQCB 3RYCE 4TZ4C 4EEBA 3HI2A 4BJNA 2NW9A 4DV6T 2V7IA 3GN5B 1YQ4A 2XTLA 2IMLA 2JMKA 2CA5A 3AA6B 2BBJA 1KNZA 2VURA 3UUBA 1US7B 2KWIB 2YU1A 5JDMA 2BVLA 4IDOA 4YSZA 1YD8G 3QOFA 1T72A 2E9XB 1KEYA 3AVRA 3Q5DA 2JMHA 2C5IT 3ZT7A 3QK6A 1WR6A 2CRBA 1XMQT 4EYUA 3N2OA 3ANWB 5AQKB 4HFDA 3PUVF 4JUYA 2X66A 3MJXA 4L9IA 5EK3A 3RC8A 4PFOA 2EHOD 2VK9A 3RHWA 2LSIA 2LOSA 3RI5A 4IDPA 3EDUA 3ZCJA 5JDGA 4X66T 2WMOA 3RF1A 2XPKA 2LT3A 3ZJ2A 5LHGB 1L0VA 4JEUB 5DABA 4DIDB 4B3ST 2FUPA 2YOEA 3FB2A 4LMKA 4JI5T 3TLTA 3ZLIA 2C5KT 1HR0T 4HWIB 3ZJ1A 4AQFA 2DCFA 4Z90A 5L3GB 2XQ6A 1J1JA 3KINB 4L0RA 2MPKA 3N9OA 4PK5A 4COFA 5JDQA 2Q9QB 1EZ3A 4I55E 5DQVA 5AQGB 5LBQB 5LB7B 3RIUC 4CZZB 1D1CA 2X9WA 2WB5A 4HN9A 1LVKA 3UT5E 4LF9T 2H7VC 3AA1B 4B3TT 5LG3A 4U3CA 3Q5XA 5FNVE 1W0AA 3KVAA 3PU3A 4UF0A 2F4VT 3AE4A 1G73A 3AAIA 3PJAA 5HEHA 3UUNA 5AQNB 3S4UA 2J62A 4WNKA 1BR4A 4ZI2C 4Z91A 2CWOA 2VKHA 5C3JA 2XQYA 3AE5A 2CHOA 3VRBA 3ZT5A 3EABA 4DR2T 4QKNA 4WW0A 3ZYMA 5EZYE 4LF8T 3ETVA 4DUZT 2WWVA 4PW8A 1N36T 4JI8T 3RKOA 5HEJA 2DLRA 2V6YB 3IF8B 5EK4A 5A1LA 4ZOLE 4ZI2D 1UGOA 3FZHB 1IBLT 2VKJA 5CFBA 2CXLA 3LK2B 1KFYA 5AQOB 4AKLA 2FBWA 3W15B 4HKAA 3N9LA 4O4HE 2KWHA 2D2SA 5FL1A 2LJLA 3LFMA 5AQSB 2ZM6T 3LBXB 1YKEB 3RQUA 1MIYA 3I9YA 4L5GA 1YXRA 2M6BA 2WSSV 3B57A 3LBXA 4X1YE 5FXWA 2A72A 1IZNB 5JTGA 4QX7B 4X65T 2WM9A 4GIWA 2A9UA 4CXXA 1MIVA 2BZBA 5L3CB 4GYSA 5CJ5A 2D0UA 3O4XE 2D5UA 2WP9A 4IE6A 4YXDA 5ABHA 2UXDT 3NWIA 1ZOYA 3R6NA 3KBUA 2QVAA 2E2AA 3RIAA 4ILAA 4O2BE 3SFDA 3VHLA 2XZEA 3N2KE 3FXEB 2W0GA 2LHRA 2X9YA 2ZM0A 3PUAA 4XAXB 3KFWX 5F5WA 3BQLA 4IDNA 3IHRA 5CGMA 3OJAA 2SPCA 4P09A 3AB3B 5AFUL 1XNQT 4UXNB 3OVUA 1W9RA 2LRKA 3HA4A 5JQGE 4TNVA 2CXDA 3KV4A 3RLFF 2WAUA 2XAJB 2CMRA 3N2GE 4I50E 4H9SE 1M62A 5LP6E 3E0ZA 1HNZT 4OX9T 2KSRA 5HAXA 1KNPA 5CB4E 3N9PA 1W0BA 2H3RA 2W00A 3K3OA 4O2AE 2IAKA 2R6GF 4EGWA 3RYHE 5M4YA 1IBKT 1HNWT 4A5XA 2XQAA 4YSYA 5HXCA 1SA0E 1WLXA 4HEAA 5AQIB 3CQXC 4IDZA 5EK2A 2IHR1 2RA1A 4P1NA 5FKYA 1N32T 5FXZA 4DUYT 2WDVA 5LGTB 2XAFB 2HPLA 3G06A 2WMNA 3UFGA 5LMUT 4ERRA 5IWAT 5LMNT 1BR2A 4PFPA 2KZ7B 4M1PA 4JI1T 1HX8A 4GKKT 4ANJA 3MKDA 4PJMA 2W61A 4HGAA 2X0LB 2V7LA 2KINB 2WU2A 2HPJA 3LDQB 1E1HB 3ONJA 3ZMUB 5J0ZA 3UTKA 2Q9QC 2NTYA 4F6RC 3VU7H 1MNEA 2LM9A 4K0UA 5LG4A 5FY0A 4TNWA 1KF6A 3N9NA 2XQ9A 5FP3A 1YW0A 1WCRA 2WU5A 4P0BA 4IL9A 3CX8B 2NW7A 3CQGB 5L3BB 2LSJA 2E9XC 3C4XA 4IE5A 4UV8B 4EZ4A 5IUXA 2E5LT 2MAWA 1NENA 3ZSTA 3BK9A 5BR8T 1JNZA 4EB6E 4YHHT 4H9OC 3MACA 4DV4T 2M67A 3OKQA 3C98B 3MZKB 2V6YA 2XY8B 3ZC1A 4CQIA 3PU8A 4AXPA 2XAQB 4EAHA 3VKHA 4LMLA 4AQGA 4NIQA 3I9WA 3I0OA 1Y64B 3MXZA 2WS3A 3C50A 4HTEA 4OYJA 2CEAA 3QUJA 2JIWA 4X64T 4DV2T 3T1YT 5DQWA 3OYZA 3QB5A 2Z6EA 4HWDA 3EVYA 4MBQA 2ZM2A 5L2LA 2BKNA 2UXBT 1D1AA 5F3JA 4ZI3D 4QHOA 2ODUA 3ZN1B 2B76A 4HFCA 2NW8A 3AXJB 1FIOA 3J9X1 2VWAA 3O1IA 5IHYA 1WYCA 2XAGB 3NRYA 4H63H 2FJAA 2DI4A 3AEEA 2WQYA 5HXEA 4V1Av 4ZHQE 4ZZCA 2Q9QA 1AJ3A 1ZEEA 3AVSA 2L3LA 1MMDA 2HN1A 2VASA 3I0QA 3K8PC 4U31A 4YLHA 5AQMB 2IC9A 3BQIA 4ASKA 5L4HA 4DV1T 5ADXL 5GONE 3PDYA 4TN7B 5LXTE 3EAMA 4UF0B 4YJ3E 1V9DA 3RH3A 1BR0A 5AQVB 4TV9E 5AQPB 2H88A 2YEVC 4ISSA 4O4IE 5JH7E 3UQ7A 5LJMA 3LG7A 2NP9A 2UUAT 2K3WA 3LK3B 1XMOT 3SFEA 4PJNA 4LMJA 1M7KA 1XDPA 3P4SA 4LFCT 1Y01A 3DP7A 4C90A 2I59A 3L8RA 2X0YA 4EXTA 3MK7C 3OYXA 4LF7T 4H9PC 2ES0A 3B5MA 3H37A 4PK4A 4KI0F 5FXXA 4NXNT 4DR7T 3UU3A 4DMWA 2ACXA 3HKCE 2LOPA 2ZLYA 2AE9A 2XM1A 3JAFA 3RGLA 4JV5T 4Q25A 3JAEA 2LRLA 4DV0T 3WI3A 2PG8A 4MHCA 5HEOA 2DWGA 4LFAT 1OEDE 2K48A 1IBMT 3HKEE 4TV8E 2DL1A 2CWYA 2DWKA 2RP4A 4ILBA 4UEMA 2VVSA 3AE9A 2BG9A 2CLYB 3PUYF 2V7JA 4ZS3A 2WBLA 2VQET 4GKJT 4ILUA 3VR8A 2YDSA 3FXDB 2LSGA 4MFRA 3EDVA 1SE7A 2QRXA 5HEUA 3AE6A 4LF4T 1FJGT 3H3AA 3A5XA 4B3RT 2WDQA 3SOLA 1E2AA 3RX6A 5AQLB 3KBTA 3N5LA 5CA1E 3OBVE 2PBIA 1T8BA 4G63A 4HFIA 5JR9B 1XWMA 3R84B 2FJEA 1KNRA 2BDEA 2XQ8A 3K1SA 4WZXA 3J7Yq 1HG2A 2CHNA 2KMFA 1N34T 3FZKB 3ZYKA 4H9QC 5AQJB 4AQFC 4EEDA 2X0HA 2D0TA 3SRZA 4CXYA 3DTOA 2ZM8A 4H9RC 3UU6A 1S94A 4UELA 4EV6A 5LGUB 4IGUA 5H6QB 2NOXA 4PAGA 5LBMA 1OXZA 5FY7A 3TKLB 1J5WA 3T1HT 2KT9A 1VRBA 3E08A 3M3ZB 4AKHA 3NBXX 3UU8A 1SHZC 2C0SA 1HTJF 2W63A 2CCQA 3JC6C 2X9HA 3VR9A 1UX4A 1LVFA 2DHRA 3ZMTB 3V5SA 3DJBA 5FXVA 3M65A 4P0AA 3PTRB 1DU2A 3EHZA 3CX6B 2WY2A 3U78A 1Z0PA 1FMWA 1UX5A 4A97A 3KVBA 2KLQA 3PUGA 4CN6A 5LJNA 4QH1A 1I6ZA 1MIWA 3L09A 3Q2MA 2UU9T 5AQTB 4AQYT 1LKXA 1MMAA 1QUUA 2XSAA 3AXJA 3P4RA 2BS4A 4QX8B 3CIRA 1ZKEA 3EUHA 2MBGA 4J2CA 4DMVA 5ETWA 4DV3T 3IBPA 2JQHA 3ONXA 1VOMA 4UIGA 4X20E 1OEDB 2A3DA 2JJ9A 2YK0A 4I4TE 3CK6A 4O4LE 4KHPT 1NAFA 2H89A 3AEDA 2K5BB 1X79A 5IYZE 2LM2A 2A2FX 5C8YE 4LF6T 2UXCT 1HS7A 5J1GA 4QWNB 3RYFE 4CI2B 3AECA 4U72A 4YFSA 4JI3T 4NUUA 4FI5A 2HH7A 4U2YA 1LRZA 3PV0F 2D9DA 4IE0A 5LA6E 3ZPOA 2VQFT 5LHIB 2W67A 3JC6D 4O8SA 3V5UA 3C64A 4PNIA 5HXSA 2C5JA 3FHNA 3LSVA 3PUSA 2BS3A 3PUWF 4KBMB 3LJCA 4IE7A 4DO0A 1HFAA 2LLYA 4E7SA 3O1HA 1QSDA 2WZHA 4WBNE 2ZMAA 1IJ6A 3OPCA 4ZI3C 3TLSA 5L3DB 2LEHA 3QNUA 4NPPA 2UXNB 3TLVA 2BKPA 5F8PA 5JDNA 3X1DA 4JI4T 5KMGP 3WAJA 1O3XA 1YQ3A 4U7YA 2PTFA 2JRKA 2G0UA 1HX1B 3E22E 5L3FB 2XM2A 2YKSA 4DR1T 2X9XA 1G8XA 4XBFB 2W2UA 2LKGA 1B7TA 2YN6A 2IUBA 1BR1A 2WDRA 3C4ZA 3U3IA 3UU5A 3UUXB 1ZHCA 2XQ4A 4HWCA 2XUEA 4OHFA 2UUBT 2UXXB 2LSYA 5HYAA 2X51A 1UURA 2K24A 2CBIA 4YHJA 2E9XD 4AKRB 2V8SV 4GK0E 3K3QC 4JI0T 4U74A 3PE0A 2KXPB 4H9NC 2HHHT 4I43B 2BS2A 3P4PA 2PFVA 4YY3T 1IAPA 3RPUA 2E5VA 1D1BA 4QH4A 3F2EA 4X1KE 5HCMA 2XQ5A 3AAAB 4EOZB 1U4QA 2JQKA 3ZCIA 3ZT6A 3GN5A 3P50A 4HFBA 2LSKA 4JYAT 5J2TE 2EHOC 2NR4A 1NEKA 3RIUA 2YU2A 3I1AA 1HNXT
chains in the Genus database with same CATH topology
4AKGA 2XHEB 3HKBE 4GYRA 2V7KA 2X67A 5H6RB 3GWHA 5CA0E 2E9XA 5JRCA 3NZPA 3Q5WA 5JDHA 3UFEA 4CXWA 2Y8DA 2MTQA 2XASB 3D0TA 4BAYB 5LHHB 3T8OA 3NZQA 3F57A 1U5PA 3ZMSB 1T98A 1FEWA 2W62A 3P7IA 4Z8XA 5HWXA 1D0ZA 5KX5E 2JQQA 3N9MA 2KNDA 3ETUA 4JEHB 3WAKA 2CM0A 4KUMB 3RYIE 1ZV4X 4H63V 1WRDA 2MYSA 3PURA 3KV9A 1S35A 1MMNA 3RRWA 4NUVA 2IW5B 2JPFA 4BA9A 3F31A 3AAEB 2OA5A 4QXCB 3GMIA 4ISTA 2DNXA 3HR0A 4IIJE 3UUMA 2L9QA 2GK9A 4CI1B 2EHOA 4OYKA 1D0YA 3P8CD 3IEEA 4ZS2A 5KDMC 2CE7A 3AA0B 3ZEFB 4ADZA 4N78D 2J1DG 1MMGA 3ANWA 4O4JE 5J2UE 3QC9A 5HWYA 4IE4A 4HFVA 3ZMZB 3CVRA 5E0OA 3KV6A 5JVDE 4PJJA 4EYYR 4AI6A 4TUYE 2E8IA 4WBOA 3SWHA 3FBLA 2B1EA 3ZYLA 4FJOA 1HG5A 5BMVE 2LE8A 4DVDA 3CKDA 4HE8A 4PJLA 5HXRA 2EHOB 4KMCA 1CUNA 4IHJE 3LK42 4QXBB 1D0XA 1KK7A 2Y6XA 3CPZA 3O1JA 5JR9A 4UVAB 3L3PA 4EZHA 5LYJE 1HF8A 4OFZA 2PJQA 2VB6A 4MLKA 4CI3B 2ODVA 3B13A 3BQKA 2V7MA 3ESLA 5JREA 5LCYA 2V26A 2Q9QD 2WWUA 3CX7B 4UVCB 3K3NA 3KV5A 4EIWA 1WYBA 4QXHB 4X1IE 4DBRA 4UV9B 2QA7A 2CLYC 5FMNA 2L8KA 3ZMVB 2VKOA 5JRCB 2X68A 4A56A 5JR9C 5FY1A 4JLEA 4GK5E 4PK6A 4YJ2E 2BVMA 3ZC0A 1MNDA 3UULA 1UCUA 2CXFA 3C4WA 4G2AA 5HXHA 2H7OA 5L3EB 2IC6A 2K9AA 2QGSA 4B6XA 2V1DB 3SS1A 4DBQA 4TX5A 3GA8A 3VKGA 4GOUA 2P9BA 3O9XA 3HL6A 5TAOA 3CWZB 3AA7B 2XAHB 5DJQC 2VL8A 5LNKA 1OWAA 2N9DA 3RRCA 1IJ5A 4XZCA 1H7CA 3HKDE 3N9QA 4UVBB 4E7ZA 4OK0A 1HCIA 2VKDA 4KP3C 3CMLA 3FBZA 3RX6A 2N2NA 4BJMA 4MALA 2NWBA 4DNDA 4ZI7E 3NRXA 5JDFA 2N1GA 3C51A 1NWMX 3MA9A 3PUQA 2YINA 3Q9DA 1YKHB 5FYMA 2LHNA 2Y48B 3ZN0B 2NTXA 5LOVE 4AKIA 3RC3A 3KDSE 5JDLA 1FMVA 2MOZA 3CQCB 3RYCE 4TZ4C 3HI2A 4BJNA 2NW9A 2V7IA 3GN5B 2XTLA 2JMKA 3AA6B 2CA5A 1KNZA 1US7B 2KWIB 2YU1A 5JDMA 2BVLA 1YD8G 2E9XB 3AVRA 2JMHA 2C5IT 3QK6A 1WR6A 4EYUA 3N2OA 3ANWB 4JUYA 2X66A 3MJXA 4L9IA 5EK3A 3RC8A 4PFOA 2EHOD 2VK9A 5JDGA 2LSIA 2LOSA 3ZCJA 3EDUA 2WMOA 2LT3A 3ZJ2A 5LHGB 4JEUB 5DABA 3FB2A 3ZLIA 2C5KT 3ZJ1A 4AQFA 2DCFA 5L3GB 3KINB 4L0RA 3N9OA 4PK5A 5JDQA 2Q9QB 1EZ3A 4I55E 5DQVA 4CZZB 5LBQB 1D1CA 2X9WA 4HN9A 1LVKA 3UT5E 2H7VC 3AA1B 3Q5XA 5FNVE 3KVAA 3PU3A 4UF0A 1G73A 3AAIA 3UUNA 4ZI2C 3S4UA 4WNKA 1BR4A 2CWOA 2VKHA 2XQYA 4QKNA 4WW0A 3ZYMA 5EZYE 3ETVA 4PW8A 3RKOA 2DLRA 3IF8B 5EK4A 5A1LA 4ZOLE 2VKJA 2CXLA 3LK2B 4AKLA 3W15B 4HKAA 3N9LA 4O4HE 2KWHA 2D2SA 2LJLA 3LFMA 3LBXB 1YKEB 1MIYA 3I9YA 4L5GA 3B57A 2WSSV 4X1YE 3LBXA 5FXWA 2A72A 1IZNB 4QX7B 2WM9A 4GIWA 4CXXA 1MIVA 2BZBA 5L3CB 4GYSA 2D0UA 3O4XE 2D5UA 4IE6A 3R6NA 3KBUA 3VHLA 4O2BE 3N2KE 3FXEB 2W0GA 2LHRA 2X9YA 2ZM0A 3PUAA 4XAXB 3KFWX 4C91A 3BQLA 5LXTE 3IHRA 3OJAA 2SPCA 4P09A 3AB3B 5AFUL 4UXNB 5JQGE 3HA4A 4ZI2D 2CXDA 3KV4A 2WAUA 2XAJB 2CMRA 3N2GE 4I50E 4H9SE 5LP6E 3E0ZA 5HAXA 5CB4E 3N9PA 2H3RA 2W00A 3K3OA 4O2AE 2IAKA 3RYHE 5M4YA 5HXCA 1SA0E 1WLXA 4HEAA 5EK2A 3CQXC 4IDZA 2RA1A 5FXZA 5LGTB 2XAFB 2HPLA 2WMNA 4ERRA 1BR2A 4PFPA 2KZ7B 4M1PA 1HX8A 4ANJA 3MKDA 4PJMA 2W61A 4HGAA 2X0LB 2V7LA 2KINB 3ZMUB 2HPJA 1E1HB 3UTKA 2Q9QC 2NTYA 4F6RC 3VU7H 1MNEA 2LM9A 4K0UA 5LG4A 5FY0A 3N9NA 5FP3A 1YW0A 4P0BA 3CX8B 2NW7A 3CQGB 5L3BB 2LSJA 2E9XC 3C4XA 4IE5A 4UV8B 4EZ4A 3BK9A 4EB6E 4H9OC 3MACA 2M67A 3OKQA 3C98B 3MZKB 4CQIA 3ZC1A 3PU8A 4AXPA 2XAQB 4EAHA 3VKHA 4AQGA 3I9WA 3I0OA 1Y64B 3MXZA 4HTEA 3C50A 4OYJA 2CEAA 3QUJA 5DQWA 3OYZA 2Z6EA 3EVYA 4MBQA 2ZM2A 5L2LA 1D1AA 5F3JA 4ZI3D 4QHOA 2ODUA 3ZN1B 2NW8A 3J9X1 1FIOA 2VWAA 3O1IA 5IHYA 1WYCA 2XAGB 3NRYA 4H63H 5HXEA 2DI4A 4V1Av 4ZHQE 2Q9QA 1AJ3A 1ZEEA 3AVSA 2L3LA 1MMDA 2VASA 3I0QA 3K8PC 4YLHA 4ASKA 2IC9A 3BQIA 5ADXL 5GONE 3PDYA 4TN7B 4UF0B 4YJ3E 1V9DA 3RH3A 1BR0A 4TV9E 2YEVC 4ISSA 4O4IE 5JH7E 5LJMA 3LG7A 2NP9A 3LK3B 4PJNA 3DP7A 4C90A 2I59A 4EXTA 3MK7C 3OYXA 4H9PC 2ES0A 3H37A 4PK4A 5FXXA 4DMWA 2ACXA 3HKCE 2LOPA 2ZLYA 3WI3A 2PG8A 4MHCA 2DWGA 2K48A 3HKEE 4TV8E 2CWYA 2DWKA 2RP4A 4UEMA 2CLYB 2V7JA 4ZS3A 2WBLA 4ILUA 3FXDB 2LSGA 4MFRA 3EDVA 3H3AA 3A5XA 3SOLA 3KBTA 3N5LA 5CA1E 3OBVE 2PBIA 4G63A 5JR9B 3R84B 2BDEA 3J7Yq 1HG2A 2KMFA 3ZYKA 4H9QC 4AQFC 4CXYA 2D0TA 3SRZA 3DTOA 2ZM8A 4H9RC 1S94A 4UELA 5LGUB 4IGUA 5H6QB 2NOXA 4PAGA 5LBMA 1OXZA 5FY7A 3TKLB 2KT9A 1VRBA 3E08A 4AKHA 3NBXX 1SHZC 2C0SA 1HTJF 2W63A 2CCQA 3JC6C 2X9HA 1UX4A 1LVFA 2DHRA 3ZMTB 3V5SA 3DJBA 5FXVA 3M65A 4P0AA 3PTRB 3CX6B 3U78A 1Z0PA 1FMWA 1UX5A 3KVBA 2KLQA 3PUGA 5LJNA 1MIWA 3L09A 3Q2MA 1LKXA 1MMAA 1QUUA 2MBGA 4QX8B 1ZKEA 3EUHA 4J2CA 4DMVA 5ETWA 3IBPA 3ONXA 4X20E 1VOMA 4UIGA 2A3DA 2YK0A 2JJ9A 4O4LE 4I4TE 1NAFA 2K5BB 1X79A 5IYZE 2A2FX 5C8YE 1HS7A 5J1GA 4QWNB 3RYFE 4CI2B 4U72A 4YFSA 4NUUA 4FI5A 2HH7A 1LRZA 5LA6E 4IE0A 3ZPOA 5LHIB 3JC6D 4O8SA 3V5UA 3C64A 4PNIA 5HXSA 2C5JA 3FHNA 3PUSA 4KBMB 3LJCA 4IE7A 4DO0A 1HFAA 4E7SA 3O1HA 1QSDA 4WBNE 2ZMAA 1IJ6A 4ZI3C 5L3DB 2LEHA 2UXNB 5JDNA 5F8PA 5KMGP 3WAJA 1O3XA 2JRKA 2G0UA 3E22E 5L3FB 4XBFB 2X9XA 1G8XA 1B7TA 1BR1A 3C4ZA 3U3IA 3UUXB 5LGNB 1ZHCA 2XUEA 4OHFA 2UXXB 2LSYA 5HYAA 2X51A 2K24A 4YHJA 2E9XD 4AKRB 4GK0E 3K3QC 4U74A 3PE0A 2KXPB 4H9NC 4I43B 2PFVA 1IAPA 3RPUA 4X1KE 1D1BA 3F2EA 3AAAB 4EOZB 1U4QA 3ZCIA 3GN5A 2LSKA 5J2TE 2EHOC 2YU2A 3I1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILU A;  4KBM B;  4KMC A;  4MFR A;  2LT3 A;  4L5G A;  4XAX B; 
#chains in the Genus database with same CATH topology
 2J4G A;  1VCS A;  4AKG A;  2XHE B;  2JQ9 A;  3A7M A;  3HKB E;  4GYR A;  2V7K A;  2X67 A;  5L4E A;  5H6R B;  3GWH A;  1WR0 A;  5CA0 E;  4JI7 T;  2E9X A;  3EI0 A;  2CBJ A;  2WCA A;  4UR9 A;  4U2Z A;  3NZP A;  3Q5W A;  1N33 T;  5JRC A;  5JDH A;  3AE3 A;  3UFE A;  4CXW A;  2Y8D A;  2MTQ A;  2XAS B;  3D0T A;  4BAY B;  5LHH B;  5HEG A;  3PUX F;  3NZQ A;  3F57 A;  3T8O A;  4CN1 A;  1U5P A;  4I0U A;  3ZMS B;  1T98 A;  1FEW A;  2IDO B;  2W62 A;  3RKG A;  1W09 A;  3P7I A;  4Z8X A;  3TLU A;  1D0Z A;  4CN4 A;  3IA3 A;  2I0M A;  2JQQ A;  4HWF A;  5HWX A;  5KX5 E;  3N9M A;  2KND A;  3ETU A;  4JEH B;  3WAK A;  2CM0 A;  4KUM B;  3RYI E;  1ZV4 X;  1GQE A;  4K0K T;  4H63 V;  1WRD A;  4HFH A;  4X62 T;  5ABG A;  2MYS A;  3PUR A;  4C91 A;  1OED A;  3KV9 A;  1S35 A;  1MMN A;  2ACZ A;  2V6X A;  2M6I A;  4DR4 T;  2BG9 E;  3RRW A;  4NUV A;  4AIU A;  2IW5 B;  2JPF A;  4BA9 A;  3F31 A;  3AAE B;  4U33 A;  2OA5 A;  4QXC B;  3GMI A;  4IST A;  2DNX A;  3HR0 A;  4IIJ E;  3RIF A;  2L9Q A;  2GK9 A;  1ZP0 A;  3UUM A;  5AQQ B;  1J5E T;  2EHO A;  4OYK A;  3AEG A;  5FVK A;  4YTN A;  5C2T A;  1D0Y A;  4LFB T;  3P8C D;  1SUM B;  3IEE A;  4YTP A;  4ZS2 A;  5KDM C;  2CE7 A;  3AA0 B;  3ZEF B;  4ADZ A;  3JAD A;  2XSB A;  2J1D G;  1MMG A;  3ANW A;  3L39 A;  3AEF A;  3NVO A;  4N78 D;  4O4J E;  5J2U E;  3OTO T;  3H3M A;  3QC9 A;  5HWY A;  2J47 A;  4IE4 A;  4HFV A;  3ZMZ B;  2VVN A;  3CVR A;  3AEA A;  3QB5 K;  5E0O A;  3KV6 A;  4IL4 A;  5AQH B;  2I6H A;  5JVD E;  1Z8U A;  4JI6 T;  4PJJ A;  2BG9 B;  2YDQ A;  4EYY R;  4AI6 A;  4TUY E;  2E8I A;  4WBO A;  3SWH A;  3FBL A;  2V5C A;  2B1E A;  3ZYL A;  4FJO A;  3ABV A;  1HG5 A;  5BMV E;  2LE8 A;  5FL0 A;  3CKD A;  4HE8 A;  4HFE A;  4PJL A;  4DVD A;  4TWH A;  2EHO B;  3FZF B;  4QH5 A;  1VCT A;  4KMC A;  5HXR A;  1CUN A;  4IHJ E;  3LK4 2;  2CPT A;  2OLT A;  1QLB A;  2OV9 A;  4QXB B;  4KHZ F;  1D0X A;  1KK7 A;  2Y6X A;  3CPZ A;  2VL0 A;  3O1J A;  5AQR B;  2FJB A;  4UVA B;  5JR9 A;  3ZSS A;  4NXM T;  2RPA A;  5L47 A;  3L3P A;  4EZH A;  5LYJ E;  1HF8 A;  4OFZ A;  2V5D A;  2BBH A;  3FZL B;  2PJQ A;  2VB6 A;  4MLK A;  3PJA J;  2ODV A;  3B13 A;  3BQK A;  2V7M A;  3P4W A;  3ESL A;  4CI3 B;  5JRE A;  5LCY A;  2V26 A;  2Q9Q D;  2WWU A;  3A8Y C;  3AE2 A;  3CX7 B;  4UVC B;  3K3N A;  3KV5 A;  4EIW A;  1WYB A;  2BG9 C;  4DR3 T;  2BKO A;  4QXH B;  4IT4 A;  5AQF B;  4X1I E;  4DBR A;  1UK5 A;  3FZM B;  4UV9 B;  2QA7 A;  2CLY C;  5FMN A;  4AIS A;  4F8H A;  2L8K A;  4DR5 T;  3ZMV B;  2VKO A;  5JRC B;  2X68 A;  2QYW A;  3ZKR A;  4A56 A;  5JR9 C;  5FY1 A;  4X5T A;  4JLE A;  4GK5 E;  4PK6 A;  4YJ2 E;  2LKH A;  2BVM A;  2IIU A;  2UUC T;  4CI1 B;  3ZC0 A;  1MND A;  3UUL A;  1UCU A;  4B3M T;  4ZZB A;  2CXF A;  3C4W A;  4IRE A;  4G2A A;  1E7P A;  5HXH A;  2H7O A;  2WZI A;  4U7I A;  4JI2 T;  2IC6 A;  2K9A A;  5L3E B;  2QGS A;  4B6X A;  2V1D B;  4DV7 T;  3UQ4 A;  3SS1 A;  4DBQ A;  4TX5 A;  3GA8 A;  3P4Q A;  4ZEY A;  4GOU A;  1X9B A;  4YT0 A;  3VKG A;  2P9B A;  3O9X A;  3RQW A;  3HL6 A;  3AE8 A;  5TAO A;  3CWZ B;  3AA7 B;  2XAH B;  5DJQ C;  4DV5 T;  2VL8 A;  4ILC A;  4DR6 T;  5LNK A;  4WYV A;  1OWA A;  4A98 A;  2N9D A;  5ABE A;  3RRC A;  1IJ5 A;  4XZC A;  3PUZ F;  1H7C A;  3HKD E;  4HWH A;  2W66 A;  1XZY A;  2AXD S;  1R8I A;  3ONL C;  3JCF A;  1WFD A;  4TWF A;  4JBW F;  3N9Q A;  4YSX A;  5KXJ A;  2FJD A;  4UVB B;  4E7Z A;  4OK0 A;  1XNR T;  1HCI A;  2VKD A;  3AEB A;  3CML A;  3FBZ A;  1T7S A;  2N2N A;  2YDR A;  3Q5E A;  4KP3 C;  4MAL A;  4YTM A;  4BJM A;  2NWB A;  5ABF A;  4ZXL A;  4DND A;  4ZI7 E;  3NRX A;  3AE7 A;  5AQU B;  5ABF B;  5JDF A;  2N1G A;  5HCJ A;  1JNR A;  1CHU A;  1OED C;  2XQ7 A;  3C51 A;  4IDQ A;  3UU4 A;  1NWM X;  1UUS A;  3VRA A;  3MA9 A;  3PUQ A;  4LF5 T;  3AE1 A;  3TLW A;  2YIN A;  3Q9D A;  1YKH B;  4KX6 A;  5FYM A;  5LGN B;  2LHN A;  2Y48 B;  2W4X A;  3ZN0 B;  2NTX A;  5LOV E;  4AKI A;  5FVL A;  4TWD A;  1I94 T;  3RC3 A;  3KDS E;  5JDL A;  2XJ7 A;  2XQ3 A;  1XDO A;  1FMV A;  3NKZ A;  2HN2 A;  2MOZ A;  3CQC B;  3RYC E;  4TZ4 C;  4EEB A;  3HI2 A;  4BJN A;  2NW9 A;  4DV6 T;  2V7I A;  3GN5 B;  1YQ4 A;  2XTL A;  2IML A;  2JMK A;  2CA5 A;  3AA6 B;  2BBJ A;  1KNZ A;  2VUR A;  3UUB A;  1US7 B;  2KWI B;  2YU1 A;  5JDM A;  2BVL A;  4IDO A;  4YSZ A;  1YD8 G;  3QOF A;  1T72 A;  2E9X B;  1KEY A;  3AVR A;  3Q5D A;  2JMH A;  2C5I T;  3ZT7 A;  3QK6 A;  1WR6 A;  2CRB A;  1XMQ T;  4EYU A;  3N2O A;  3ANW B;  5AQK B;  4HFD A;  3PUV F;  4JUY A;  2X66 A;  3MJX A;  4L9I A;  5EK3 A;  3RC8 A;  4PFO A;  2EHO D;  2VK9 A;  3RHW A;  2LSI A;  2LOS A;  3RI5 A;  4IDP A;  3EDU A;  3ZCJ A;  5JDG A;  4X66 T;  2WMO A;  3RF1 A;  2XPK A;  2LT3 A;  3ZJ2 A;  5LHG B;  1L0V A;  4JEU B;  5DAB A;  4DID B;  4B3S T;  2FUP A;  2YOE A;  3FB2 A;  4LMK A;  4JI5 T;  3TLT A;  3ZLI A;  2C5K T;  1HR0 T;  4HWI B;  3ZJ1 A;  4AQF A;  2DCF A;  4Z90 A;  5L3G B;  2XQ6 A;  1J1J A;  3KIN B;  4L0R A;  2MPK A;  3N9O A;  4PK5 A;  4COF A;  5JDQ A;  2Q9Q B;  1EZ3 A;  4I55 E;  5DQV A;  5AQG B;  5LBQ B;  5LB7 B;  3RIU C;  4CZZ B;  1D1C A;  2X9W A;  2WB5 A;  4HN9 A;  1LVK A;  3UT5 E;  4LF9 T;  2H7V C;  3AA1 B;  4B3T T;  5LG3 A;  4U3C A;  3Q5X A;  5FNV E;  1W0A A;  3KVA A;  3PU3 A;  4UF0 A;  2F4V T;  3AE4 A;  1G73 A;  3AAI A;  3PJA A;  5HEH A;  3UUN A;  5AQN B;  3S4U A;  2J62 A;  4WNK A;  1BR4 A;  4ZI2 C;  4Z91 A;  2CWO A;  2VKH A;  5C3J A;  2XQY A;  3AE5 A;  2CHO A;  3VRB A;  3ZT5 A;  3EAB A;  4DR2 T;  4QKN A;  4WW0 A;  3ZYM A;  5EZY E;  4LF8 T;  3ETV A;  4DUZ T;  2WWV A;  4PW8 A;  1N36 T;  4JI8 T;  3RKO A;  5HEJ A;  2DLR A;  2V6Y B;  3IF8 B;  5EK4 A;  5A1L A;  4ZOL E;  4ZI2 D;  1UGO A;  3FZH B;  1IBL T;  2VKJ A;  5CFB A;  2CXL A;  3LK2 B;  1KFY A;  5AQO B;  4AKL A;  2FBW A;  3W15 B;  4HKA A;  3N9L A;  4O4H E;  2KWH A;  2D2S A;  5FL1 A;  2LJL A;  3LFM A;  5AQS B;  2ZM6 T;  3LBX B;  1YKE B;  3RQU A;  1MIY A;  3I9Y A;  4L5G A;  1YXR A;  2M6B A;  2WSS V;  3B57 A;  3LBX A;  4X1Y E;  5FXW A;  2A72 A;  1IZN B;  5JTG A;  4QX7 B;  4X65 T;  2WM9 A;  4GIW A;  2A9U A;  4CXX A;  1MIV A;  2BZB A;  5L3C B;  4GYS A;  5CJ5 A;  2D0U A;  3O4X E;  2D5U A;  2WP9 A;  4IE6 A;  4YXD A;  5ABH A;  2UXD T;  3NWI A;  1ZOY A;  3R6N A;  3KBU A;  2QVA A;  2E2A A;  3RIA A;  4ILA A;  4O2B E;  3SFD A;  3VHL A;  2XZE A;  3N2K E;  3FXE B;  2W0G A;  2LHR A;  2X9Y A;  2ZM0 A;  3PUA A;  4XAX B;  3KFW X;  5F5W A;  3BQL A;  4IDN A;  3IHR A;  5CGM A;  3OJA A;  2SPC A;  4P09 A;  3AB3 B;  5AFU L;  1XNQ T;  4UXN B;  3OVU A;  1W9R A;  2LRK A;  3HA4 A;  5JQG E;  4TNV A;  2CXD A;  3KV4 A;  3RLF F;  2WAU A;  2XAJ B;  2CMR A;  3N2G E;  4I50 E;  4H9S E;  1M62 A;  5LP6 E;  3E0Z A;  1HNZ T;  4OX9 T;  2KSR A;  5HAX A;  1KNP A;  5CB4 E;  3N9P A;  1W0B A;  2H3R A;  2W00 A;  3K3O A;  4O2A E;  2IAK A;  2R6G F;  4EGW A;  3RYH E;  5M4Y A;  1IBK T;  1HNW T;  4A5X A;  2XQA A;  4YSY A;  5HXC A;  1SA0 E;  1WLX A;  4HEA A;  5AQI B;  3CQX C;  4IDZ A;  5EK2 A;  2IHR 1;  2RA1 A;  4P1N A;  5FKY A;  1N32 T;  5FXZ A;  4DUY T;  2WDV A;  5LGT B;  2XAF B;  2HPL A;  3G06 A;  2WMN A;  3UFG A;  5LMU T;  4ERR A;  5IWA T;  5LMN T;  1BR2 A;  4PFP A;  2KZ7 B;  4M1P A;  4JI1 T;  1HX8 A;  4GKK T;  4ANJ A;  3MKD A;  4PJM A;  2W61 A;  4HGA A;  2X0L B;  2V7L A;  2KIN B;  2WU2 A;  2HPJ A;  3LDQ B;  1E1H B;  3ONJ A;  3ZMU B;  5J0Z A;  3UTK A;  2Q9Q C;  2NTY A;  4F6R C;  3VU7 H;  1MNE A;  2LM9 A;  4K0U A;  5LG4 A;  5FY0 A;  4TNW A;  1KF6 A;  3N9N A;  2XQ9 A;  5FP3 A;  1YW0 A;  1WCR A;  2WU5 A;  4P0B A;  4IL9 A;  3CX8 B;  2NW7 A;  3CQG B;  5L3B B;  2LSJ A;  2E9X C;  3C4X A;  4IE5 A;  4UV8 B;  4EZ4 A;  5IUX A;  2E5L T;  2MAW A;  1NEN A;  3ZST A;  3BK9 A;  5BR8 T;  1JNZ A;  4EB6 E;  4YHH T;  4H9O C;  3MAC A;  4DV4 T;  2M67 A;  3OKQ A;  3C98 B;  3MZK B;  2V6Y A;  2XY8 B;  3ZC1 A;  4CQI A;  3PU8 A;  4AXP A;  2XAQ B;  4EAH A;  3VKH A;  4LML A;  4AQG A;  4NIQ A;  3I9W A;  3I0O A;  1Y64 B;  3MXZ A;  2WS3 A;  3C50 A;  4HTE A;  4OYJ A;  2CEA A;  3QUJ A;  2JIW A;  4X64 T;  4DV2 T;  3T1Y T;  5DQW A;  3OYZ A;  3QB5 A;  2Z6E A;  4HWD A;  3EVY A;  4MBQ A;  2ZM2 A;  5L2L A;  2BKN A;  2UXB T;  1D1A A;  5F3J A;  4ZI3 D;  4QHO A;  2ODU A;  3ZN1 B;  2B76 A;  4HFC A;  2NW8 A;  3AXJ B;  1FIO A;  3J9X 1;  2VWA A;  3O1I A;  5IHY A;  1WYC A;  2XAG B;  3NRY A;  4H63 H;  2FJA A;  2DI4 A;  3AEE A;  2WQY A;  5HXE A;  4V1A v;  4ZHQ E;  4ZZC A;  2Q9Q A;  1AJ3 A;  1ZEE A;  3AVS A;  2L3L A;  1MMD A;  2HN1 A;  2VAS A;  3I0Q A;  3K8P C;  4U31 A;  4YLH A;  5AQM B;  2IC9 A;  3BQI A;  4ASK A;  5L4H A;  4DV1 T;  5ADX L;  5GON E;  3PDY A;  4TN7 B;  5LXT E;  3EAM A;  4UF0 B;  4YJ3 E;  1V9D A;  3RH3 A;  1BR0 A;  5AQV B;  4TV9 E;  5AQP B;  2H88 A;  2YEV C;  4ISS A;  4O4I E;  5JH7 E;  3UQ7 A;  5LJM A;  3LG7 A;  2NP9 A;  2UUA T;  2K3W A;  3LK3 B;  1XMO T;  3SFE A;  4PJN A;  4LMJ A;  1M7K A;  1XDP A;  3P4S A;  4LFC T;  1Y01 A;  3DP7 A;  4C90 A;  2I59 A;  3L8R A;  2X0Y A;  4EXT A;  3MK7 C;  3OYX A;  4LF7 T;  4H9P C;  2ES0 A;  3B5M A;  3H37 A;  4PK4 A;  4KI0 F;  5FXX A;  4NXN T;  4DR7 T;  3UU3 A;  4DMW A;  2ACX A;  3HKC E;  2LOP A;  2ZLY A;  2AE9 A;  2XM1 A;  3JAF A;  3RGL A;  4JV5 T;  4Q25 A;  3JAE A;  2LRL A;  4DV0 T;  3WI3 A;  2PG8 A;  4MHC A;  5HEO A;  2DWG A;  4LFA T;  1OED E;  2K48 A;  1IBM T;  3HKE E;  4TV8 E;  2DL1 A;  2CWY A;  2DWK A;  2RP4 A;  4ILB A;  4UEM A;  2VVS A;  3AE9 A;  2BG9 A;  2CLY B;  3PUY F;  2V7J A;  4ZS3 A;  2WBL A;  2VQE T;  4GKJ T;  4ILU A;  3VR8 A;  2YDS A;  3FXD B;  2LSG A;  4MFR A;  3EDV A;  1SE7 A;  2QRX A;  5HEU A;  3AE6 A;  4LF4 T;  1FJG T;  3H3A A;  3A5X A;  4B3R T;  2WDQ A;  3SOL A;  1E2A A;  3RX6 A;  5AQL B;  3KBT A;  3N5L A;  5CA1 E;  3OBV E;  2PBI A;  1T8B A;  4G63 A;  4HFI A;  5JR9 B;  1XWM A;  3R84 B;  2FJE A;  1KNR A;  2BDE A;  2XQ8 A;  3K1S A;  4WZX A;  3J7Y q;  1HG2 A;  2CHN A;  2KMF A;  1N34 T;  3FZK B;  3ZYK A;  4H9Q C;  5AQJ B;  4AQF C;  4EED A;  2X0H A;  2D0T A;  3SRZ A;  4CXY A;  3DTO A;  2ZM8 A;  4H9R C;  3UU6 A;  1S94 A;  4UEL A;  4EV6 A;  5LGU B;  4IGU A;  5H6Q B;  2NOX A;  4PAG A;  5LBM A;  1OXZ A;  5FY7 A;  3TKL B;  1J5W A;  3T1H T;  2KT9 A;  1VRB A;  3E08 A;  3M3Z B;  4AKH A;  3NBX X;  3UU8 A;  1SHZ C;  2C0S A;  1HTJ F;  2W63 A;  2CCQ A;  3JC6 C;  2X9H A;  3VR9 A;  1UX4 A;  1LVF A;  2DHR A;  3ZMT B;  3V5S A;  3DJB A;  5FXV A;  3M65 A;  4P0A A;  3PTR B;  1DU2 A;  3EHZ A;  3CX6 B;  2WY2 A;  3U78 A;  1Z0P A;  1FMW A;  1UX5 A;  4A97 A;  3KVB A;  2KLQ A;  3PUG A;  4CN6 A;  5LJN A;  4QH1 A;  1I6Z A;  1MIW A;  3L09 A;  3Q2M A;  2UU9 T;  5AQT B;  4AQY T;  1LKX A;  1MMA A;  1QUU A;  2XSA A;  3AXJ A;  3P4R A;  2BS4 A;  4QX8 B;  3CIR A;  1ZKE A;  3EUH A;  2MBG A;  4J2C A;  4DMV A;  5ETW A;  4DV3 T;  3IBP A;  2JQH A;  3ONX A;  1VOM A;  4UIG A;  4X20 E;  1OED B;  2A3D A;  2JJ9 A;  2YK0 A;  4I4T E;  3CK6 A;  4O4L E;  4KHP T;  1NAF A;  2H89 A;  3AED A;  2K5B B;  1X79 A;  5IYZ E;  2LM2 A;  2A2F X;  5C8Y E;  4LF6 T;  2UXC T;  1HS7 A;  5J1G A;  4QWN B;  3RYF E;  4CI2 B;  3AEC A;  4U72 A;  4YFS A;  4JI3 T;  4NUU A;  4FI5 A;  2HH7 A;  4U2Y A;  1LRZ A;  3PV0 F;  2D9D A;  4IE0 A;  5LA6 E;  3ZPO A;  2VQF T;  5LHI B;  2W67 A;  3JC6 D;  4O8S A;  3V5U A;  3C64 A;  4PNI A;  5HXS A;  2C5J A;  3FHN A;  3LSV A;  3PUS A;  2BS3 A;  3PUW F;  4KBM B;  3LJC A;  4IE7 A;  4DO0 A;  1HFA A;  2LLY A;  4E7S A;  3O1H A;  1QSD A;  2WZH A;  4WBN E;  2ZMA A;  1IJ6 A;  3OPC A;  4ZI3 C;  3TLS A;  5L3D B;  2LEH A;  3QNU A;  4NPP A;  2UXN B;  3TLV A;  2BKP A;  5F8P A;  5JDN A;  3X1D A;  4JI4 T;  5KMG P;  3WAJ A;  1O3X A;  1YQ3 A;  4U7Y A;  2PTF A;  2JRK A;  2G0U A;  1HX1 B;  3E22 E;  5L3F B;  2XM2 A;  2YKS A;  4DR1 T;  2X9X A;  1G8X A;  4XBF B;  2W2U A;  2LKG A;  1B7T A;  2YN6 A;  2IUB A;  1BR1 A;  2WDR A;  3C4Z A;  3U3I A;  3UU5 A;  3UUX B;  1ZHC A;  2XQ4 A;  4HWC A;  2XUE A;  4OHF A;  2UUB T;  2UXX B;  2LSY A;  5HYA A;  2X51 A;  1UUR A;  2K24 A;  2CBI A;  4YHJ A;  2E9X D;  4AKR B;  2V8S V;  4GK0 E;  3K3Q C;  4JI0 T;  4U74 A;  3PE0 A;  2KXP B;  4H9N C;  2HHH T;  4I43 B;  2BS2 A;  3P4P A;  2PFV A;  4YY3 T;  1IAP A;  3RPU A;  2E5V A;  1D1B A;  4QH4 A;  3F2E A;  4X1K E;  5HCM A;  2XQ5 A;  3AAA B;  4EOZ B;  1U4Q A;  2JQK A;  3ZCI A;  3ZT6 A;  3GN5 A;  3P50 A;  4HFB A;  2LSK A;  4JYA T;  5J2T E;  2EHO C;  2NR4 A;  1NEK A;  3RIU A;  2YU2 A;  3I1A A;  1HNX T; 
#chains in the Genus database with same CATH homology
 4AKG A;  2XHE B;  3HKB E;  4GYR A;  2V7K A;  2X67 A;  5H6R B;  3GWH A;  5CA0 E;  2E9X A;  5JRC A;  3NZP A;  3Q5W A;  5JDH A;  3UFE A;  4CXW A;  2Y8D A;  2MTQ A;  2XAS B;  3D0T A;  4BAY B;  5LHH B;  3T8O A;  3NZQ A;  3F57 A;  1U5P A;  3ZMS B;  1T98 A;  1FEW A;  2W62 A;  3P7I A;  4Z8X A;  5HWX A;  1D0Z A;  5KX5 E;  2JQQ A;  3N9M A;  2KND A;  3ETU A;  4JEH B;  3WAK A;  2CM0 A;  4KUM B;  3RYI E;  1ZV4 X;  4H63 V;  1WRD A;  2MYS A;  3PUR A;  3KV9 A;  1S35 A;  1MMN A;  3RRW A;  4NUV A;  2IW5 B;  2JPF A;  4BA9 A;  3F31 A;  3AAE B;  2OA5 A;  4QXC B;  3GMI A;  4IST A;  2DNX A;  3HR0 A;  4IIJ E;  3UUM A;  2L9Q A;  2GK9 A;  4CI1 B;  2EHO A;  4OYK A;  1D0Y A;  3P8C D;  3IEE A;  4ZS2 A;  5KDM C;  2CE7 A;  3AA0 B;  3ZEF B;  4ADZ A;  4N78 D;  2J1D G;  1MMG A;  3ANW A;  4O4J E;  5J2U E;  3QC9 A;  5HWY A;  4IE4 A;  4HFV A;  3ZMZ B;  3CVR A;  5E0O A;  3KV6 A;  5JVD E;  4PJJ A;  4EYY R;  4AI6 A;  4TUY E;  2E8I A;  4WBO A;  3SWH A;  3FBL A;  2B1E A;  3ZYL A;  4FJO A;  1HG5 A;  5BMV E;  2LE8 A;  4DVD A;  3CKD A;  4HE8 A;  4PJL A;  5HXR A;  2EHO B;  4KMC A;  1CUN A;  4IHJ E;  3LK4 2;  4QXB B;  1D0X A;  1KK7 A;  2Y6X A;  3CPZ A;  3O1J A;  5JR9 A;  4UVA B;  3L3P A;  4EZH A;  5LYJ E;  1HF8 A;  4OFZ A;  2PJQ A;  2VB6 A;  4MLK A;  4CI3 B;  2ODV A;  3B13 A;  3BQK A;  2V7M A;  3ESL A;  5JRE A;  5LCY A;  2V26 A;  2Q9Q D;  2WWU A;  3CX7 B;  4UVC B;  3K3N A;  3KV5 A;  4EIW A;  1WYB A;  4QXH B;  4X1I E;  4DBR A;  4UV9 B;  2QA7 A;  2CLY C;  5FMN A;  2L8K A;  3ZMV B;  2VKO A;  5JRC B;  2X68 A;  4A56 A;  5JR9 C;  5FY1 A;  4JLE A;  4GK5 E;  4PK6 A;  4YJ2 E;  2BVM A;  3ZC0 A;  1MND A;  3UUL A;  1UCU A;  2CXF A;  3C4W A;  4G2A A;  5HXH A;  2H7O A;  5L3E B;  2IC6 A;  2K9A A;  2QGS A;  4B6X A;  2V1D B;  3SS1 A;  4DBQ A;  4TX5 A;  3GA8 A;  3VKG A;  4GOU A;  2P9B A;  3O9X A;  3HL6 A;  5TAO A;  3CWZ B;  3AA7 B;  2XAH B;  5DJQ C;  2VL8 A;  5LNK A;  1OWA A;  2N9D A;  3RRC A;  1IJ5 A;  4XZC A;  1H7C A;  3HKD E;  3N9Q A;  4UVB B;  4E7Z A;  4OK0 A;  1HCI A;  2VKD A;  4KP3 C;  3CML A;  3FBZ A;  3RX6 A;  2N2N A;  4BJM A;  4MAL A;  2NWB A;  4DND A;  4ZI7 E;  3NRX A;  5JDF A;  2N1G A;  3C51 A;  1NWM X;  3MA9 A;  3PUQ A;  2YIN A;  3Q9D A;  1YKH B;  5FYM A;  2LHN A;  2Y48 B;  3ZN0 B;  2NTX A;  5LOV E;  4AKI A;  3RC3 A;  3KDS E;  5JDL A;  1FMV A;  2MOZ A;  3CQC B;  3RYC E;  4TZ4 C;  3HI2 A;  4BJN A;  2NW9 A;  2V7I A;  3GN5 B;  2XTL A;  2JMK A;  3AA6 B;  2CA5 A;  1KNZ A;  1US7 B;  2KWI B;  2YU1 A;  5JDM A;  2BVL A;  1YD8 G;  2E9X B;  3AVR A;  2JMH A;  2C5I T;  3QK6 A;  1WR6 A;  4EYU A;  3N2O A;  3ANW B;  4JUY A;  2X66 A;  3MJX A;  4L9I A;  5EK3 A;  3RC8 A;  4PFO A;  2EHO D;  2VK9 A;  5JDG A;  2LSI A;  2LOS A;  3ZCJ A;  3EDU A;  2WMO A;  2LT3 A;  3ZJ2 A;  5LHG B;  4JEU B;  5DAB A;  3FB2 A;  3ZLI A;  2C5K T;  3ZJ1 A;  4AQF A;  2DCF A;  5L3G B;  3KIN B;  4L0R A;  3N9O A;  4PK5 A;  5JDQ A;  2Q9Q B;  1EZ3 A;  4I55 E;  5DQV A;  4CZZ B;  5LBQ B;  1D1C A;  2X9W A;  4HN9 A;  1LVK A;  3UT5 E;  2H7V C;  3AA1 B;  3Q5X A;  5FNV E;  3KVA A;  3PU3 A;  4UF0 A;  1G73 A;  3AAI A;  3UUN A;  4ZI2 C;  3S4U A;  4WNK A;  1BR4 A;  2CWO A;  2VKH A;  2XQY A;  4QKN A;  4WW0 A;  3ZYM A;  5EZY E;  3ETV A;  4PW8 A;  3RKO A;  2DLR A;  3IF8 B;  5EK4 A;  5A1L A;  4ZOL E;  2VKJ A;  2CXL A;  3LK2 B;  4AKL A;  3W15 B;  4HKA A;  3N9L A;  4O4H E;  2KWH A;  2D2S A;  2LJL A;  3LFM A;  3LBX B;  1YKE B;  1MIY A;  3I9Y A;  4L5G A;  3B57 A;  2WSS V;  4X1Y E;  3LBX A;  5FXW A;  2A72 A;  1IZN B;  4QX7 B;  2WM9 A;  4GIW A;  4CXX A;  1MIV A;  2BZB A;  5L3C B;  4GYS A;  2D0U A;  3O4X E;  2D5U A;  4IE6 A;  3R6N A;  3KBU A;  3VHL A;  4O2B E;  3N2K E;  3FXE B;  2W0G A;  2LHR A;  2X9Y A;  2ZM0 A;  3PUA A;  4XAX B;  3KFW X;  4C91 A;  3BQL A;  5LXT E;  3IHR A;  3OJA A;  2SPC A;  4P09 A;  3AB3 B;  5AFU L;  4UXN B;  5JQG E;  3HA4 A;  4ZI2 D;  2CXD A;  3KV4 A;  2WAU A;  2XAJ B;  2CMR A;  3N2G E;  4I50 E;  4H9S E;  5LP6 E;  3E0Z A;  5HAX A;  5CB4 E;  3N9P A;  2H3R A;  2W00 A;  3K3O A;  4O2A E;  2IAK A;  3RYH E;  5M4Y A;  5HXC A;  1SA0 E;  1WLX A;  4HEA A;  5EK2 A;  3CQX C;  4IDZ A;  2RA1 A;  5FXZ A;  5LGT B;  2XAF B;  2HPL A;  2WMN A;  4ERR A;  1BR2 A;  4PFP A;  2KZ7 B;  4M1P A;  1HX8 A;  4ANJ A;  3MKD A;  4PJM A;  2W61 A;  4HGA A;  2X0L B;  2V7L A;  2KIN B;  3ZMU B;  2HPJ A;  1E1H B;  3UTK A;  2Q9Q C;  2NTY A;  4F6R C;  3VU7 H;  1MNE A;  2LM9 A;  4K0U A;  5LG4 A;  5FY0 A;  3N9N A;  5FP3 A;  1YW0 A;  4P0B A;  3CX8 B;  2NW7 A;  3CQG B;  5L3B B;  2LSJ A;  2E9X C;  3C4X A;  4IE5 A;  4UV8 B;  4EZ4 A;  3BK9 A;  4EB6 E;  4H9O C;  3MAC A;  2M67 A;  3OKQ A;  3C98 B;  3MZK B;  4CQI A;  3ZC1 A;  3PU8 A;  4AXP A;  2XAQ B;  4EAH A;  3VKH A;  4AQG A;  3I9W A;  3I0O A;  1Y64 B;  3MXZ A;  4HTE A;  3C50 A;  4OYJ A;  2CEA A;  3QUJ A;  5DQW A;  3OYZ A;  2Z6E A;  3EVY A;  4MBQ A;  2ZM2 A;  5L2L A;  1D1A A;  5F3J A;  4ZI3 D;  4QHO A;  2ODU A;  3ZN1 B;  2NW8 A;  3J9X 1;  1FIO A;  2VWA A;  3O1I A;  5IHY A;  1WYC A;  2XAG B;  3NRY A;  4H63 H;  5HXE A;  2DI4 A;  4V1A v;  4ZHQ E;  2Q9Q A;  1AJ3 A;  1ZEE A;  3AVS A;  2L3L A;  1MMD A;  2VAS A;  3I0Q A;  3K8P C;  4YLH A;  4ASK A;  2IC9 A;  3BQI A;  5ADX L;  5GON E;  3PDY A;  4TN7 B;  4UF0 B;  4YJ3 E;  1V9D A;  3RH3 A;  1BR0 A;  4TV9 E;  2YEV C;  4ISS A;  4O4I E;  5JH7 E;  5LJM A;  3LG7 A;  2NP9 A;  3LK3 B;  4PJN A;  3DP7 A;  4C90 A;  2I59 A;  4EXT A;  3MK7 C;  3OYX A;  4H9P C;  2ES0 A;  3H37 A;  4PK4 A;  5FXX A;  4DMW A;  2ACX A;  3HKC E;  2LOP A;  2ZLY A;  3WI3 A;  2PG8 A;  4MHC A;  2DWG A;  2K48 A;  3HKE E;  4TV8 E;  2CWY A;  2DWK A;  2RP4 A;  4UEM A;  2CLY B;  2V7J A;  4ZS3 A;  2WBL A;  4ILU A;  3FXD B;  2LSG A;  4MFR A;  3EDV A;  3H3A A;  3A5X A;  3SOL A;  3KBT A;  3N5L A;  5CA1 E;  3OBV E;  2PBI A;  4G63 A;  5JR9 B;  3R84 B;  2BDE A;  3J7Y q;  1HG2 A;  2KMF A;  3ZYK A;  4H9Q C;  4AQF C;  4CXY A;  2D0T A;  3SRZ A;  3DTO A;  2ZM8 A;  4H9R C;  1S94 A;  4UEL A;  5LGU B;  4IGU A;  5H6Q B;  2NOX A;  4PAG A;  5LBM A;  1OXZ A;  5FY7 A;  3TKL B;  2KT9 A;  1VRB A;  3E08 A;  4AKH A;  3NBX X;  1SHZ C;  2C0S A;  1HTJ F;  2W63 A;  2CCQ A;  3JC6 C;  2X9H A;  1UX4 A;  1LVF A;  2DHR A;  3ZMT B;  3V5S A;  3DJB A;  5FXV A;  3M65 A;  4P0A A;  3PTR B;  3CX6 B;  3U78 A;  1Z0P A;  1FMW A;  1UX5 A;  3KVB A;  2KLQ A;  3PUG A;  5LJN A;  1MIW A;  3L09 A;  3Q2M A;  1LKX A;  1MMA A;  1QUU A;  2MBG A;  4QX8 B;  1ZKE A;  3EUH A;  4J2C A;  4DMV A;  5ETW A;  3IBP A;  3ONX A;  4X20 E;  1VOM A;  4UIG A;  2A3D A;  2YK0 A;  2JJ9 A;  4O4L E;  4I4T E;  1NAF A;  2K5B B;  1X79 A;  5IYZ E;  2A2F X;  5C8Y E;  1HS7 A;  5J1G A;  4QWN B;  3RYF E;  4CI2 B;  4U72 A;  4YFS A;  4NUU A;  4FI5 A;  2HH7 A;  1LRZ A;  5LA6 E;  4IE0 A;  3ZPO A;  5LHI B;  3JC6 D;  4O8S A;  3V5U A;  3C64 A;  4PNI A;  5HXS A;  2C5J A;  3FHN A;  3PUS A;  4KBM B;  3LJC A;  4IE7 A;  4DO0 A;  1HFA A;  4E7S A;  3O1H A;  1QSD A;  4WBN E;  2ZMA A;  1IJ6 A;  4ZI3 C;  5L3D B;  2LEH A;  2UXN B;  5JDN A;  5F8P A;  5KMG P;  3WAJ A;  1O3X A;  2JRK A;  2G0U A;  3E22 E;  5L3F B;  4XBF B;  2X9X A;  1G8X A;  1B7T A;  1BR1 A;  3C4Z A;  3U3I A;  3UUX B;  5LGN B;  1ZHC A;  2XUE A;  4OHF A;  2UXX B;  2LSY A;  5HYA A;  2X51 A;  2K24 A;  4YHJ A;  2E9X D;  4AKR B;  4GK0 E;  3K3Q C;  4U74 A;  3PE0 A;  2KXP B;  4H9N C;  4I43 B;  2PFV A;  1IAP A;  3RPU A;  4X1K E;  1D1B A;  3F2E A;  3AAA B;  4EOZ B;  1U4Q A;  3ZCI A;  3GN5 A;  2LSK A;  5J2T E;  2EHO C;  2YU2 A;  3I1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...