1T7SA

Structural genomics of caenorhabditis elegans: structure of bag-1 protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
129
structure length
129
Chain Sequence
DKIIVMGGKNALVDDAGFKMLMQYEKHNLSNLQKAYDLNLRDVADLERGFLEKPKQVEMGKKLEKKVKYFNEEAERHLETLDGMNIITETTPENQAKRNREKRKTLVNGIQTLLNQNDALLRRLQEYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG-1 cochaperone
publication title Structural genomics of Caenorhabditis elegans: structure of the BAG domain.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 42
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1t7sA00
3M3ZB 5AQKB 5AQVB 4HWFA 3A8YC 4HWCA 2D9DA 3FZLB 1T7SA 5AQTB 5AQFB 1HX1B 1UK5A 5AQPB 1I6ZA 3FZHB 5AQNB 1UGOA 5AQQB 5AQJB 1M62A 5AQGB 5AQHB 3FZKB 3LDQB 4HWDA 5AQMB 1M7KA 5AQLB 5AQOB 4HWHA 4HWIB 5AQUB 5AQSB 5AQIB 3FZMB 5AQRB 3FZFB
chains in the Genus database with same CATH superfamily
2BVLA 2Q9QD 3PU8A 1HG2A 4DV3T 2PJQA 2UXXB 2HH7A 4YXDA 3HR0A 3GN5B 5LJNA 1SE7A 2PFVA 5F5WA 4IDZA 3PUWF 5HXRA 2LSGA 2JJ9A 4PJLA 2BBJA 2XUEA 5LB7B 5AQFB 3AEAA 5LNKA 5L2LA 3T1HT 4ISSA 1XMQT 2SPCA 3KVBA 3CQXC 3ZYKA 4PJMA 4L9IA 4PK5A 4U72A 2CXLA 3ZLIA 5HCJA 3AAEB 3CX8B 5L3DB 3HI2A 4CXXA 1KFYA 2CCQA 2KSRA 2XASB 3K8PC 3VHLA 3ETUA 4U31A 1YW0A 3C64A 2ODUA 2WB5A 3NKZA 3CK6A 5ABEA 4DV0T 3KBUA 4DR1T 4QHOA 4HFEA 1T8BA 3HL6A 3PTRB 4ILAA 4K0KT 5IUXA 1LRZA 3ONXA 4CI1B 1YQ3A 4U33A 5L4HA 2BKNA 5FL0A 2WWUA 3A7MA 4EXTA 3EVYA 4IE5A 3RKOA 1HR0T 2ZMAA 2X68A 2WWVA 3Q2MA 2DLRA 3RC8A 4AKHA 3ZKRA 5ADXL 4O2AE 3ZSTA 1OEDC 4H9PC 3J9X1 4XBFB 3ZMZB 3Q5DA 2X51A 4HFHA 3UT5E 3AA6B 2YINA 1UK5A 3FHNA 3RI5A 1ZOYA 4X20E 4E7ZA 4FJOA 2RA1A 2X0LB 3AAIA 3S4UA 4BJMA 5JDGA 4JUYA 5LOVE 2BG9B 4G2AA 5LHGB 5JRCA 1D1BA 3AA1B 4TWHA 4JV5T 4KHPT 3MJXA 5HXCA 1J1JA 4GK0E 1D1CA 4LFBT 2UXBT 2CM0A 2NW8A 3NZQA 5LMNT 2EHOB 3RIUC 2XQ5A 1IZNB 4EB6E 4JI0T 3N2OA 3LK2B 4COFA 2CRBA 4P0AA 1W0BA 3UQ4A 2H88A 4U2YA 3U78A 4ANJA 5CB4E 2JQ9A 5HEOA 3RYHE 1OEDA 3CX7B 5H6RB 2XM2A 5E0OA 1ZHCA 1SHZC 5JVDE 2WY2A 2WU2A 5LBMA 4H9RC 2LSIA 2UUCT 4GIWA 2WQYA 3I9YA 4ZS2A 4AKRB 1UX5A 2WP9A 5L3FB 2X0YA 2DL1A 4BJNA 4DR6T 3R84B 3AA7B 5J1GA 3FZHB 4CXWA 5ABFA 3VRBA 1GQEA 3UU8A 3FZKB 1XZYA 3L3PA 1KEYA 4OHFA 3ANWA 3EI0A 2VVNA 4DUZT 4YFSA 5LG4A 4HFCA 3SS1A 4AISA 4UVCB 4WZXA 4PJJA 3OJAA 5ETWA 4LF9T 3EUHA 3RIUA 3ZMUB 4EEBA 4QXBB 3OVUA 5AQIB 5IHYA 3FZMB 1NEKA 2VL0A 5J0ZA 5HXEA 3A5XA 1IBMT 4NUVA 5DQVA 2Z6EA 2A9UA 2H3RA 4JI5T 5JDMA 3AAAB 3BQIA 3GN5A 3RC3A 3K3NA 3CQCB 4A98A 4QH4A 3ESLA 2GK9A 2UU9T 2I6HA 2NR4A 3VKHA 1T72A 4IE4A 3UU5A 5HWYA 4TUYE 2YK0A 3KVAA 2LOSA 3N9MA 4CZZB 3TLSA 5JH7E 3OPCA 3C4XA 3AE3A 3ZC1A 3I1AA 4BAYB 2VB6A 2V5DA 5LMUT 2LM2A 1XWMA 3HKEE 4DBRA 3A8YC 2E5VA 2JMHA 4H9NC 2W4XA 3N9QA 1YD8G 4LMLA 2JPFA 4L5GA 3PURA 4CQIA 5J2TE 3ZN1B 2DI4A 3ZYMA 2V5CA 2JMKA 2B1EA 4X62T 2IDOB 1G73A 4NIQA 2WM9A 2YEVC 5JRCB 2W2UA 3MKDA 1DU2A 1WR0A 1IAPA 3UU6A 1D1AA 4NXNT 2KNDA 4EAHA 5L4EA 5FY1A 2CMRA 2A2FX 5JDLA 4A5XA 2D5UA 4IE6A 5FMNA 4DR7T 4XZCA 2HN1A 2QA7A 4MALA 4A56A 4LF5T 2LOPA 5AQLB 2WU5A 4CXYA 4YSZA 2UXCT 4X64T 2C5KT 5AQRB 2XPKA 3RYCE 2BVMA 3AEBA 4O8SA 4EIWA 4AKLA 3G06A 2AXDS 4HE8A 5LG3A 3DJBA 3RH3A 3AE1A 3NRXA 1M7KA 3NBXX 3EABA 2XSBA 1US7B 2C5JA 2KWHA 4GYRA 4A97A 2G0UA 2X66A 1BR0A 2P9BA 2XQYA 5LP6E 2EHOD 1KF6A 4IE0A 3C51A 4ZS3A 2BKPA 2BKOA 4EGWA 3UU4A 1R8IA 3O1HA 4DVDA 3L09A 5ABFB 4K0UA 2XQAA 1HNWT 5LBQB 5AQPB 1Z8UA 5KDMC 2BS4A 4PW8A 2H7OA 4YJ2E 3AEEA 4BA9A 2A3DA 4P1NA 2HPJA 2X9XA 4WW0A 3VR8A 2WMOA 4UEMA 3M65A 1NENA 4GK5E 5CFBA 3I0QA 5L3CB 3NRYA 1S35A 1IJ6A 3U3IA 3B5MA 3OKQA 3HKDE 3PUQA 4JI7T 2KLQA 2KMFA 3AXJA 3ZT5A 1XDPA 3EDUA 5EK3A 2X9WA 4OYJA 5L3BB 4ZI7E 2YDQA 5AQOB 3BQLA 4UIGA 3ONLC 1J5WA 1QSDA 3MK7C 3RYFE 1ZEEA 4WBNE 3PUSA 4DIDB 3RX6A 4B3TT 4ZI2D 1HCIA 1Y64B 2LSKA 2J62A 4JI2T 4IGUA 5FXXA 4PNIA 5FP3A 3LG7A 1HTJF 4X65T 4XAXB 5FNVE 3L39A 2LE8A 2CBJA 5LYJE 3DTOA 1OWAA 3FB2A 4I0UA 5JR9B 4U2ZA 2OA5A 5H6QB 4DMVA 4I50E 2IAKA 3ONJA 2I0MA 3O1JA 5FKYA 3ZT6A 4F8HA 4DR4T 2JIWA 2WDQA 5FVKA 2WDVA 5LGNB 1G8XA 4YSXA 2K48A 3ZYLA 2DWGA 4WNKA 4HWIB 4O4HE 3AECA 4TNWA 3GWHA 2QRXA 3PDYA 2XTLA 3RLFF 4EZHA 4H9SE 3F31A 3MACA 3MA9A 2V6YB 3JCFA 1D0XA 3MXZA 4JI1T 4YT0A 2N1GA 2FJAA 1KNRA 3AE7A 2XQ9A 5FXWA 5LJMA 1N33T 4JBWF 2IC9A 3F2EA 3AVRA 4DV5T 3OTOT 2W67A 3KINB 4DNDA 5LHHB 2HHHT 2WMNA 2FJDA 1NAFA 2RP4A 5EK4A 5AQKB 2MAWA 3RQUA 3N2GE 4UF0A 5LHIB 2D0TA 4AQFC 3AE2A 3VU7H 3UUMA 3SWHA 4ZZCA 4ISTA 4U7IA 3ZJ2A 2M6BA 1HFAA 2V7MA 4HWDA 5L47A 1N34T 3ZC0A 3PUGA 5JTGA 3FBLA 5FY7A 3RRCA 2F4VT 1KNPA 3EAMA 3O1IA 3CMLA 3ZEFB 2DWKA 3V5UA 5JDFA 4PJNA 4EZ4A 5CJ5A 4IL4A 2ACZA 3RQWA 4LF6T 3P7IA 4B3RT 3JAEA 2MOZA 3J7Yq 2H7VC 4H63H 4O4IE 1E1HB 1HX1B 3FXEB 2PTFA 4DMWA 4UV8B 5F3JA 4PK6A 4YLHA 1BR1A 4MHCA 1WYCA 2QYWA 4UVAB 2CPTA 3E22E 2XHEB 5AQVB 3QB5K 1HS7A 1QUUA 3LK42 3AXJB 4CI3B 3R6NA 4QKNA 1T7SA 1J5ET 1MMNA 1L0VA 2M6IA 3KV6A 4TV8E 2V26A 4CN4A 1UUSA 4ERRA 2W66A 4O4LE 4HFIA 3NWIA 2MBGA 2WDRA 2YDSA 3LFMA 2E8IA 5L3EB 3PJAA 2CHNA 4LF7T 4HFDA 2CWYA 4AQFA 2CWOA 2C0SA 5JR9C 4LF8T 1SA0E 4HGAA 4LFCT 4DV2T 5TAOA 3ZJ1A 4EYUA 4V1Av 3N9PA 2LM9A 5JDHA 3CPZA 2XAJB 3K3OA 3AEDA 3HKBE 2WSSV 5AQJB 5ABHA 4ZI3C 4C91A 2LSYA 3UUBA 4JI6T 5HCMA 5BR8T 3TLUA 2CXFA 4MBQA 1OXZA 3VRAA 4DUYT 2LRLA 4M1PA 2HPLA 1S94A 2D9DA 3UFEA 1MIVA 3GMIA 4KP3C 4QWNB 5FYMA 3UUNA 4JEHB 2KZ7B 2FBWA 3P8CD 3EHZA 5GONE 2YU2A 1UCUA 4I4TE 2LT3A 3WAJA 4UR9A 5FL1A 2LKHA 3Q9DA 2HN2A 2IMLA 3N9LA 4EOZB 4YHHT 4GOUA 4O2BE 1ZKEA 5AQMB 3T8OA 2NOXA 4MFRA 2VQFT 1IBKT 1NWMX 3OYXA 1XMOT 2IW5B 2CE7A 2JQKA 2R6GF 5HEGA 3KBTA 1QLBA 2XSAA 1YXRA 2UXDT 1FMWA 2N2NA 2WCAA 3KFWX 3PUAA 4F6RC 2LKGA 4IHJE 4YSYA 4DBQA 5JR9A 1LVFA 4JI3T 4UF0B 3M3ZB 4OX9T 3H3MA 3Q5XA 4I43B 5FXVA 2X0HA 4YTMA 5AQTB 5BMVE 5HXSA 4KI0F 3O9XA 3IHRA 3ZN0B 1X9BA 4MLKA 3ZCIA 1U4QA 3PV0F 4DV1T 2XQ8A 2XQ6A 4OYKA 3Q5WA 5F8PA 1Y01A 2BG9E 3PE0A 4UVBB 4QX8B 2V1DB 1HNXT 4ILUA 3VKGA 3CX6B 4KX6A 2V6YA 2V7JA 4O4JE 4QXHB 1HNZT 2XAHB 3P4WA 3JADA 1D0ZA 4JI4T 4YHJA 3RIAA 3X1DA 2E5LT 1IBLT 4UXNB 1Z0PA 3PU3A 2E9XC 2IIUA 4KHZF 3C4ZA 4HKAA 2VQET 2C5IT 1UGOA 2W0GA 1MMGA 3DP7A 1JNRA 4HFVA 4CI2B 2BDEA 1O3XA 2Q9QC 2W61A 3LBXB 2D2SA 5IYZE 3PUYF 4AKGA 1D0YA 3AE5A 3W15B 4HEAA 2CA5A 1MNEA 4DR5T 4CN1A 3RHWA 2XAFB 2NW9A 2I59A 5HXHA 5AQHB 3O4XE 2H89A 3PUVF 5C3JA 3RGLA 5M4YA 4U74A 2ZM2A 2V7KA 1XDOA 4TWDA 5AQSB 3CIRA 4B6XA 3AB3B 3QOFA 5HEHA 1MIWA 3CKDA 1JNZA 3GA8A 2XQ4A 1I94T 3N9OA 3RYIE 3RIFA 3L8RA 3C50A 5AFUL 3SOLA 5C2TA 4QX7B 4AXPA 2X9YA 2V7LA 3TKLB 2J1DG 3JAFA 2JRKA 5EK2A 4HWHA 2XAGB 2XM1A 2YDRA 3AVSA 2DHRA 2ZM8A 1KNZA 2E9XA 2DNXA 5JDQA 3CQGB 3ZPOA 4HWFA 3MZKB 1EZ3A 4X1IE 3AEGA 4X66T 1W09A 3KV5A 2VKOA 5AQGB 1WLXA 3QC9A 3QNUA 2Q9QA 2XY8B 3RRWA 2LEHA 3K3QC 4NPPA 2XJ7A 4U3CA 2NW7A 1CUNA 2X67A 3UTKA 4HN9A 2FUPA 3IEEA 3HKCE 3IA3A 2KXPB 2LHNA 2BZBA 3I9WA 4HTEA 4LMJA 2OLTA 3WAKA 4LF4T 2AE9A 4GKKT 5DJQC 1HX8A 2J47A 5HEUA 2B76A 3NZPA 2VK9A 4G63A 3N2KE 3P4PA 3ZMSB 4ZEYA 2N9DA 3B57A 2MYSA 4UV9B 5DQWA 4EV6A 5LGTB 2KWIB 1N36T 3AE8A 2IUBA 2YOEA 1UURA 4I55E 4NXMT 4Z8XA 2WS3A 5DABA 5FVLA 3F57A 4GKJT 1AJ3A 4GYSA 1LVKA 1WCRA 3P4SA 2XZEA 3D0TA 5ABGA 3FBZA 3AA0B 4NUUA 5HYAA 1BR4A 1E2AA 3C98B 3RKGA 4ASKA 4H63V 4PFPA 2WBLA 2V8SV 1WFDA 3SFDA 2YN6A 3UU3A 4FI5A 2NTYA 4TWFA 5JQGE 2K9AA 2MTQA 1ZP0A 4JI8T 3HA4A 3FZLB 4ILBA 2PBIA 2QVAA 4IDNA 2VVSA 1LKXA 2E2AA 1H7CA 1VRBA 3H3AA 5IWAT 2JQHA 2XAQB 5JDNA 5KXJA 2VWAA 3PUXF 1OEDE 1FIOA 2K24A 1V9DA 4X1KE 3CWZB 1YQ4A 3KV4A 3BK9A 3RF1A 2X9HA 2OV9A 4TV9E 1B7TA 2ACXA 3CVRA 3RPUA 2XQ7A 2CEAA 3LJCA 4TZ4C 2K5BB 2BBHA 2LRKA 5A1LA 2J4GA 1XNQT 1FJGT 2FJBA 3BQKA 4IE7A 3OYZA 4PFOA 3TLTA 2QGSA 2VKHA 2JQQA 1CHUA 2YU1A 4E7SA 3SFEA 2E9XB 2Y48B 3IF8B 3AE9A 2FJEA 2M67A 2CHOA 3LBXA 4JLEA 1MNDA 3H37A 4YTPA 4ZZBA 1BR2A 2LLYA 2WAUA 4QH5A 5C8YE 4OFZA 1HF8A 2V6XA 1MMDA 2KINB 3LK3B 4WYVA 2VL8A 2LSJA 3UULA 3T1YT 1IJ5A 4J2CA 4L0RA 2Q9QB 5KX5E 2CLYB 1X79A 2MPKA 4IREA 2NWBA 3KV9A 2RPAA 4ZOLE 3E0ZA 4KUMB 4HFBA 5HEJA 5CGMA 4IDPA 3VR9A 4QXCB 4PK4A 5AQNB 2WZIA 4TNVA 4DV4T 1VCSA 2CXDA 2UXNB 4UELA 2IC6A 4WBOA 3V5SA 2W63A 5HAXA 3N5LA 2BS2A 4YY3T 5FY0A 2L8KA 4YJ3E 1I6ZA 3QK6A 3TLWA 4KBMB 2V7IA 5HWXA 2XQ3A 4H9QC 4IL9A 2K3WA 2YKSA 4IT4A 4LFAT 3EDVA 3ZMVB 2VKDA 3WI3A 4X5TA 4AKIA 5FXZA 5LXTE 3UUXB 4B3MT 5L3GB 1YKHB 3AE4A 3NVOA 2LHRA 2PG8A 4DV6T 4OK0A 1SUMB 1WYBA 5AQUB 4Z91A 4ZI3D 1KK7A 4ZXLA 2BG9C 4CN6A 2Y6XA 1UX4A 4EEDA 1MMAA 2W00A 3TLVA 1YKEB 3SRZA 1U5PA 4KMCA 3ZCJA 5EZYE 3JC6C 1W9RA 4JEUB 4AIUA 4P09A 4YTNA 4IIJE 2LJLA 2EHOC 3LSVA 2DCFA 1M62A 4ADZA 2UUBT 4TN7B 3ZMTB 4H9OC 1VOMA 3B13A 3C4WA 4DV7T 4P0BA 2W62A 2CBIA 3ZT7A 2VASA 2BS3A 3UQ7A 4Z90A 1VCTA 2ES0A 3AEFA 5KMGP 1HG5A 4JYAT 3LDQB 3AE6A 1WRDA 4TX5A 3UFGA 2VURA 1MIYA 4N78D 4EYYR 3FZFB 1ZV4X 2L9QA 3ZSSA 2ZM6T 4QH1A 3PJAJ 4DR2T 1N32T 2Y8DA 1E7PA 1OEDB 3PUZF 1FMVA 4Q25A 2ZLYA 3JC6D 2CLYC 3P4QA 4X1YE 1FEWA 2BG9A 3ETVA 3QUJA 4C90A 2L3LA 3K1SA 5CA1E 5AQQB 4U7YA 1T98A 2IHR1 1W0AA 5LA6E 2A72A 4AQYT 4DO0A 3P4RA 4AI6A 3IBPA 2D0UA 3QB5A 3ABVA 2NTXA 4DR3T 4ZI2C 1XNRT 2ODVA 4B3ST 2EHOA 4AQGA 3N9NA 5JREA 5LGUB 2WZHA 3ANWB 4PAGA 4LMKA 4ZHQE 5CA0E 1WR6A 3P50A 4IDOA 2VKJA 2E9XD 3I0OA 5LCYA 2KT9A 4HWCA 2NP9A 3E08A 3OBVE 3Q5EA 4ILCA 2ZM0A 2UUAT 5J2UE 3KDSE 3FXDB 4IDQA
chains in the Genus database with same CATH topology
3M3ZB 5AQKB 5AQVB 4HWFA 3A8YC 4HWCA 2D9DA 3FZLB 1T7SA 5AQTB 5AQFB 1HX1B 1UK5A 5AQPB 1I6ZA 3FZHB 5AQNB 1UGOA 5AQQB 5AQJB 1M62A 5AQGB 5AQHB 3FZKB 3LDQB 4HWDA 5AQMB 1M7KA 5AQLB 5AQOB 4HWHA 4HWIB 5AQUB 5AQSB 5AQIB 3FZMB 5AQRB 3FZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Z B;  5AQK B;  5AQV B;  4HWF A;  3A8Y C;  4HWC A;  2D9D A;  3FZL B;  1T7S A;  5AQT B;  5AQF B;  1HX1 B;  1UK5 A;  5AQP B;  1I6Z A;  3FZH B;  5AQN B;  1UGO A;  5AQQ B;  5AQJ B;  1M62 A;  5AQG B;  5AQH B;  3FZK B;  3LDQ B;  4HWD A;  5AQM B;  1M7K A;  5AQL B;  5AQO B;  4HWH A;  4HWI B;  5AQU B;  5AQS B;  5AQI B;  3FZM B;  5AQR B;  3FZF B; 
#chains in the Genus database with same CATH topology
 2BVL A;  2Q9Q D;  3PU8 A;  1HG2 A;  4DV3 T;  2PJQ A;  2UXX B;  2HH7 A;  4YXD A;  3HR0 A;  3GN5 B;  5LJN A;  1SE7 A;  2PFV A;  5F5W A;  4IDZ A;  3PUW F;  5HXR A;  2LSG A;  2JJ9 A;  4PJL A;  2BBJ A;  2XUE A;  5LB7 B;  5AQF B;  3AEA A;  5LNK A;  5L2L A;  3T1H T;  4ISS A;  1XMQ T;  2SPC A;  3KVB A;  3CQX C;  3ZYK A;  4PJM A;  4L9I A;  4PK5 A;  4U72 A;  2CXL A;  3ZLI A;  5HCJ A;  3AAE B;  3CX8 B;  5L3D B;  3HI2 A;  4CXX A;  1KFY A;  2CCQ A;  2KSR A;  2XAS B;  3K8P C;  3VHL A;  3ETU A;  4U31 A;  1YW0 A;  3C64 A;  2ODU A;  2WB5 A;  3NKZ A;  3CK6 A;  5ABE A;  4DV0 T;  3KBU A;  4DR1 T;  4QHO A;  4HFE A;  1T8B A;  3HL6 A;  3PTR B;  4ILA A;  4K0K T;  5IUX A;  1LRZ A;  3ONX A;  4CI1 B;  1YQ3 A;  4U33 A;  5L4H A;  2BKN A;  5FL0 A;  2WWU A;  3A7M A;  4EXT A;  3EVY A;  4IE5 A;  3RKO A;  1HR0 T;  2ZMA A;  2X68 A;  2WWV A;  3Q2M A;  2DLR A;  3RC8 A;  4AKH A;  3ZKR A;  5ADX L;  4O2A E;  3ZST A;  1OED C;  4H9P C;  3J9X 1;  4XBF B;  3ZMZ B;  3Q5D A;  2X51 A;  4HFH A;  3UT5 E;  3AA6 B;  2YIN A;  1UK5 A;  3FHN A;  3RI5 A;  1ZOY A;  4X20 E;  4E7Z A;  4FJO A;  2RA1 A;  2X0L B;  3AAI A;  3S4U A;  4BJM A;  5JDG A;  4JUY A;  5LOV E;  2BG9 B;  4G2A A;  5LHG B;  5JRC A;  1D1B A;  3AA1 B;  4TWH A;  4JV5 T;  4KHP T;  3MJX A;  5HXC A;  1J1J A;  4GK0 E;  1D1C A;  4LFB T;  2UXB T;  2CM0 A;  2NW8 A;  3NZQ A;  5LMN T;  2EHO B;  3RIU C;  2XQ5 A;  1IZN B;  4EB6 E;  4JI0 T;  3N2O A;  3LK2 B;  4COF A;  2CRB A;  4P0A A;  1W0B A;  3UQ4 A;  2H88 A;  4U2Y A;  3U78 A;  4ANJ A;  5CB4 E;  2JQ9 A;  5HEO A;  3RYH E;  1OED A;  3CX7 B;  5H6R B;  2XM2 A;  5E0O A;  1ZHC A;  1SHZ C;  5JVD E;  2WY2 A;  2WU2 A;  5LBM A;  4H9R C;  2LSI A;  2UUC T;  4GIW A;  2WQY A;  3I9Y A;  4ZS2 A;  4AKR B;  1UX5 A;  2WP9 A;  5L3F B;  2X0Y A;  2DL1 A;  4BJN A;  4DR6 T;  3R84 B;  3AA7 B;  5J1G A;  3FZH B;  4CXW A;  5ABF A;  3VRB A;  1GQE A;  3UU8 A;  3FZK B;  1XZY A;  3L3P A;  1KEY A;  4OHF A;  3ANW A;  3EI0 A;  2VVN A;  4DUZ T;  4YFS A;  5LG4 A;  4HFC A;  3SS1 A;  4AIS A;  4UVC B;  4WZX A;  4PJJ A;  3OJA A;  5ETW A;  4LF9 T;  3EUH A;  3RIU A;  3ZMU B;  4EEB A;  4QXB B;  3OVU A;  5AQI B;  5IHY A;  3FZM B;  1NEK A;  2VL0 A;  5J0Z A;  5HXE A;  3A5X A;  1IBM T;  4NUV A;  5DQV A;  2Z6E A;  2A9U A;  2H3R A;  4JI5 T;  5JDM A;  3AAA B;  3BQI A;  3GN5 A;  3RC3 A;  3K3N A;  3CQC B;  4A98 A;  4QH4 A;  3ESL A;  2GK9 A;  2UU9 T;  2I6H A;  2NR4 A;  3VKH A;  1T72 A;  4IE4 A;  3UU5 A;  5HWY A;  4TUY E;  2YK0 A;  3KVA A;  2LOS A;  3N9M A;  4CZZ B;  3TLS A;  5JH7 E;  3OPC A;  3C4X A;  3AE3 A;  3ZC1 A;  3I1A A;  4BAY B;  2VB6 A;  2V5D A;  5LMU T;  2LM2 A;  1XWM A;  3HKE E;  4DBR A;  3A8Y C;  2E5V A;  2JMH A;  4H9N C;  2W4X A;  3N9Q A;  1YD8 G;  4LML A;  2JPF A;  4L5G A;  3PUR A;  4CQI A;  5J2T E;  3ZN1 B;  2DI4 A;  3ZYM A;  2V5C A;  2JMK A;  2B1E A;  4X62 T;  2IDO B;  1G73 A;  4NIQ A;  2WM9 A;  2YEV C;  5JRC B;  2W2U A;  3MKD A;  1DU2 A;  1WR0 A;  1IAP A;  3UU6 A;  1D1A A;  4NXN T;  2KND A;  4EAH A;  5L4E A;  5FY1 A;  2CMR A;  2A2F X;  5JDL A;  4A5X A;  2D5U A;  4IE6 A;  5FMN A;  4DR7 T;  4XZC A;  2HN1 A;  2QA7 A;  4MAL A;  4A56 A;  4LF5 T;  2LOP A;  5AQL B;  2WU5 A;  4CXY A;  4YSZ A;  2UXC T;  4X64 T;  2C5K T;  5AQR B;  2XPK A;  3RYC E;  2BVM A;  3AEB A;  4O8S A;  4EIW A;  4AKL A;  3G06 A;  2AXD S;  4HE8 A;  5LG3 A;  3DJB A;  3RH3 A;  3AE1 A;  3NRX A;  1M7K A;  3NBX X;  3EAB A;  2XSB A;  1US7 B;  2C5J A;  2KWH A;  4GYR A;  4A97 A;  2G0U A;  2X66 A;  1BR0 A;  2P9B A;  2XQY A;  5LP6 E;  2EHO D;  1KF6 A;  4IE0 A;  3C51 A;  4ZS3 A;  2BKP A;  2BKO A;  4EGW A;  3UU4 A;  1R8I A;  3O1H A;  4DVD A;  3L09 A;  5ABF B;  4K0U A;  2XQA A;  1HNW T;  5LBQ B;  5AQP B;  1Z8U A;  5KDM C;  2BS4 A;  4PW8 A;  2H7O A;  4YJ2 E;  3AEE A;  4BA9 A;  2A3D A;  4P1N A;  2HPJ A;  2X9X A;  4WW0 A;  3VR8 A;  2WMO A;  4UEM A;  3M65 A;  1NEN A;  4GK5 E;  5CFB A;  3I0Q A;  5L3C B;  3NRY A;  1S35 A;  1IJ6 A;  3U3I A;  3B5M A;  3OKQ A;  3HKD E;  3PUQ A;  4JI7 T;  2KLQ A;  2KMF A;  3AXJ A;  3ZT5 A;  1XDP A;  3EDU A;  5EK3 A;  2X9W A;  4OYJ A;  5L3B B;  4ZI7 E;  2YDQ A;  5AQO B;  3BQL A;  4UIG A;  3ONL C;  1J5W A;  1QSD A;  3MK7 C;  3RYF E;  1ZEE A;  4WBN E;  3PUS A;  4DID B;  3RX6 A;  4B3T T;  4ZI2 D;  1HCI A;  1Y64 B;  2LSK A;  2J62 A;  4JI2 T;  4IGU A;  5FXX A;  4PNI A;  5FP3 A;  3LG7 A;  1HTJ F;  4X65 T;  4XAX B;  5FNV E;  3L39 A;  2LE8 A;  2CBJ A;  5LYJ E;  3DTO A;  1OWA A;  3FB2 A;  4I0U A;  5JR9 B;  4U2Z A;  2OA5 A;  5H6Q B;  4DMV A;  4I50 E;  2IAK A;  3ONJ A;  2I0M A;  3O1J A;  5FKY A;  3ZT6 A;  4F8H A;  4DR4 T;  2JIW A;  2WDQ A;  5FVK A;  2WDV A;  5LGN B;  1G8X A;  4YSX A;  2K48 A;  3ZYL A;  2DWG A;  4WNK A;  4HWI B;  4O4H E;  3AEC A;  4TNW A;  3GWH A;  2QRX A;  3PDY A;  2XTL A;  3RLF F;  4EZH A;  4H9S E;  3F31 A;  3MAC A;  3MA9 A;  2V6Y B;  3JCF A;  1D0X A;  3MXZ A;  4JI1 T;  4YT0 A;  2N1G A;  2FJA A;  1KNR A;  3AE7 A;  2XQ9 A;  5FXW A;  5LJM A;  1N33 T;  4JBW F;  2IC9 A;  3F2E A;  3AVR A;  4DV5 T;  3OTO T;  2W67 A;  3KIN B;  4DND A;  5LHH B;  2HHH T;  2WMN A;  2FJD A;  1NAF A;  2RP4 A;  5EK4 A;  5AQK B;  2MAW A;  3RQU A;  3N2G E;  4UF0 A;  5LHI B;  2D0T A;  4AQF C;  3AE2 A;  3VU7 H;  3UUM A;  3SWH A;  4ZZC A;  4IST A;  4U7I A;  3ZJ2 A;  2M6B A;  1HFA A;  2V7M A;  4HWD A;  5L47 A;  1N34 T;  3ZC0 A;  3PUG A;  5JTG A;  3FBL A;  5FY7 A;  3RRC A;  2F4V T;  1KNP A;  3EAM A;  3O1I A;  3CML A;  3ZEF B;  2DWK A;  3V5U A;  5JDF A;  4PJN A;  4EZ4 A;  5CJ5 A;  4IL4 A;  2ACZ A;  3RQW A;  4LF6 T;  3P7I A;  4B3R T;  3JAE A;  2MOZ A;  3J7Y q;  2H7V C;  4H63 H;  4O4I E;  1E1H B;  1HX1 B;  3FXE B;  2PTF A;  4DMW A;  4UV8 B;  5F3J A;  4PK6 A;  4YLH A;  1BR1 A;  4MHC A;  1WYC A;  2QYW A;  4UVA B;  2CPT A;  3E22 E;  2XHE B;  5AQV B;  3QB5 K;  1HS7 A;  1QUU A;  3LK4 2;  3AXJ B;  4CI3 B;  3R6N A;  4QKN A;  1T7S A;  1J5E T;  1MMN A;  1L0V A;  2M6I A;  3KV6 A;  4TV8 E;  2V26 A;  4CN4 A;  1UUS A;  4ERR A;  2W66 A;  4O4L E;  4HFI A;  3NWI A;  2MBG A;  2WDR A;  2YDS A;  3LFM A;  2E8I A;  5L3E B;  3PJA A;  2CHN A;  4LF7 T;  4HFD A;  2CWY A;  4AQF A;  2CWO A;  2C0S A;  5JR9 C;  4LF8 T;  1SA0 E;  4HGA A;  4LFC T;  4DV2 T;  5TAO A;  3ZJ1 A;  4EYU A;  4V1A v;  3N9P A;  2LM9 A;  5JDH A;  3CPZ A;  2XAJ B;  3K3O A;  3AED A;  3HKB E;  2WSS V;  5AQJ B;  5ABH A;  4ZI3 C;  4C91 A;  2LSY A;  3UUB A;  4JI6 T;  5HCM A;  5BR8 T;  3TLU A;  2CXF A;  4MBQ A;  1OXZ A;  3VRA A;  4DUY T;  2LRL A;  4M1P A;  2HPL A;  1S94 A;  2D9D A;  3UFE A;  1MIV A;  3GMI A;  4KP3 C;  4QWN B;  5FYM A;  3UUN A;  4JEH B;  2KZ7 B;  2FBW A;  3P8C D;  3EHZ A;  5GON E;  2YU2 A;  1UCU A;  4I4T E;  2LT3 A;  3WAJ A;  4UR9 A;  5FL1 A;  2LKH A;  3Q9D A;  2HN2 A;  2IML A;  3N9L A;  4EOZ B;  4YHH T;  4GOU A;  4O2B E;  1ZKE A;  5AQM B;  3T8O A;  2NOX A;  4MFR A;  2VQF T;  1IBK T;  1NWM X;  3OYX A;  1XMO T;  2IW5 B;  2CE7 A;  2JQK A;  2R6G F;  5HEG A;  3KBT A;  1QLB A;  2XSA A;  1YXR A;  2UXD T;  1FMW A;  2N2N A;  2WCA A;  3KFW X;  3PUA A;  4F6R C;  2LKG A;  4IHJ E;  4YSY A;  4DBQ A;  5JR9 A;  1LVF A;  4JI3 T;  4UF0 B;  3M3Z B;  4OX9 T;  3H3M A;  3Q5X A;  4I43 B;  5FXV A;  2X0H A;  4YTM A;  5AQT B;  5BMV E;  5HXS A;  4KI0 F;  3O9X A;  3IHR A;  3ZN0 B;  1X9B A;  4MLK A;  3ZCI A;  1U4Q A;  3PV0 F;  4DV1 T;  2XQ8 A;  2XQ6 A;  4OYK A;  3Q5W A;  5F8P A;  1Y01 A;  2BG9 E;  3PE0 A;  4UVB B;  4QX8 B;  2V1D B;  1HNX T;  4ILU A;  3VKG A;  3CX6 B;  4KX6 A;  2V6Y A;  2V7J A;  4O4J E;  4QXH B;  1HNZ T;  2XAH B;  3P4W A;  3JAD A;  1D0Z A;  4JI4 T;  4YHJ A;  3RIA A;  3X1D A;  2E5L T;  1IBL T;  4UXN B;  1Z0P A;  3PU3 A;  2E9X C;  2IIU A;  4KHZ F;  3C4Z A;  4HKA A;  2VQE T;  2C5I T;  1UGO A;  2W0G A;  1MMG A;  3DP7 A;  1JNR A;  4HFV A;  4CI2 B;  2BDE A;  1O3X A;  2Q9Q C;  2W61 A;  3LBX B;  2D2S A;  5IYZ E;  3PUY F;  4AKG A;  1D0Y A;  3AE5 A;  3W15 B;  4HEA A;  2CA5 A;  1MNE A;  4DR5 T;  4CN1 A;  3RHW A;  2XAF B;  2NW9 A;  2I59 A;  5HXH A;  5AQH B;  3O4X E;  2H89 A;  3PUV F;  5C3J A;  3RGL A;  5M4Y A;  4U74 A;  2ZM2 A;  2V7K A;  1XDO A;  4TWD A;  5AQS B;  3CIR A;  4B6X A;  3AB3 B;  3QOF A;  5HEH A;  1MIW A;  3CKD A;  1JNZ A;  3GA8 A;  2XQ4 A;  1I94 T;  3N9O A;  3RYI E;  3RIF A;  3L8R A;  3C50 A;  5AFU L;  3SOL A;  5C2T A;  4QX7 B;  4AXP A;  2X9Y A;  2V7L A;  3TKL B;  2J1D G;  3JAF A;  2JRK A;  5EK2 A;  4HWH A;  2XAG B;  2XM1 A;  2YDR A;  3AVS A;  2DHR A;  2ZM8 A;  1KNZ A;  2E9X A;  2DNX A;  5JDQ A;  3CQG B;  3ZPO A;  4HWF A;  3MZK B;  1EZ3 A;  4X1I E;  3AEG A;  4X66 T;  1W09 A;  3KV5 A;  2VKO A;  5AQG B;  1WLX A;  3QC9 A;  3QNU A;  2Q9Q A;  2XY8 B;  3RRW A;  2LEH A;  3K3Q C;  4NPP A;  2XJ7 A;  4U3C A;  2NW7 A;  1CUN A;  2X67 A;  3UTK A;  4HN9 A;  2FUP A;  3IEE A;  3HKC E;  3IA3 A;  2KXP B;  2LHN A;  2BZB A;  3I9W A;  4HTE A;  4LMJ A;  2OLT A;  3WAK A;  4LF4 T;  2AE9 A;  4GKK T;  5DJQ C;  1HX8 A;  2J47 A;  5HEU A;  2B76 A;  3NZP A;  2VK9 A;  4G63 A;  3N2K E;  3P4P A;  3ZMS B;  4ZEY A;  2N9D A;  3B57 A;  2MYS A;  4UV9 B;  5DQW A;  4EV6 A;  5LGT B;  2KWI B;  1N36 T;  3AE8 A;  2IUB A;  2YOE A;  1UUR A;  4I55 E;  4NXM T;  4Z8X A;  2WS3 A;  5DAB A;  5FVL A;  3F57 A;  4GKJ T;  1AJ3 A;  4GYS A;  1LVK A;  1WCR A;  3P4S A;  2XZE A;  3D0T A;  5ABG A;  3FBZ A;  3AA0 B;  4NUU A;  5HYA A;  1BR4 A;  1E2A A;  3C98 B;  3RKG A;  4ASK A;  4H63 V;  4PFP A;  2WBL A;  2V8S V;  1WFD A;  3SFD A;  2YN6 A;  3UU3 A;  4FI5 A;  2NTY A;  4TWF A;  5JQG E;  2K9A A;  2MTQ A;  1ZP0 A;  4JI8 T;  3HA4 A;  3FZL B;  4ILB A;  2PBI A;  2QVA A;  4IDN A;  2VVS A;  1LKX A;  2E2A A;  1H7C A;  1VRB A;  3H3A A;  5IWA T;  2JQH A;  2XAQ B;  5JDN A;  5KXJ A;  2VWA A;  3PUX F;  1OED E;  1FIO A;  2K24 A;  1V9D A;  4X1K E;  3CWZ B;  1YQ4 A;  3KV4 A;  3BK9 A;  3RF1 A;  2X9H A;  2OV9 A;  4TV9 E;  1B7T A;  2ACX A;  3CVR A;  3RPU A;  2XQ7 A;  2CEA A;  3LJC A;  4TZ4 C;  2K5B B;  2BBH A;  2LRK A;  5A1L A;  2J4G A;  1XNQ T;  1FJG T;  2FJB A;  3BQK A;  4IE7 A;  3OYZ A;  4PFO A;  3TLT A;  2QGS A;  2VKH A;  2JQQ A;  1CHU A;  2YU1 A;  4E7S A;  3SFE A;  2E9X B;  2Y48 B;  3IF8 B;  3AE9 A;  2FJE A;  2M67 A;  2CHO A;  3LBX A;  4JLE A;  1MND A;  3H37 A;  4YTP A;  4ZZB A;  1BR2 A;  2LLY A;  2WAU A;  4QH5 A;  5C8Y E;  4OFZ A;  1HF8 A;  2V6X A;  1MMD A;  2KIN B;  3LK3 B;  4WYV A;  2VL8 A;  2LSJ A;  3UUL A;  3T1Y T;  1IJ5 A;  4J2C A;  4L0R A;  2Q9Q B;  5KX5 E;  2CLY B;  1X79 A;  2MPK A;  4IRE A;  2NWB A;  3KV9 A;  2RPA A;  4ZOL E;  3E0Z A;  4KUM B;  4HFB A;  5HEJ A;  5CGM A;  4IDP A;  3VR9 A;  4QXC B;  4PK4 A;  5AQN B;  2WZI A;  4TNV A;  4DV4 T;  1VCS A;  2CXD A;  2UXN B;  4UEL A;  2IC6 A;  4WBO A;  3V5S A;  2W63 A;  5HAX A;  3N5L A;  2BS2 A;  4YY3 T;  5FY0 A;  2L8K A;  4YJ3 E;  1I6Z A;  3QK6 A;  3TLW A;  4KBM B;  2V7I A;  5HWX A;  2XQ3 A;  4H9Q C;  4IL9 A;  2K3W A;  2YKS A;  4IT4 A;  4LFA T;  3EDV A;  3ZMV B;  2VKD A;  3WI3 A;  4X5T A;  4AKI A;  5FXZ A;  5LXT E;  3UUX B;  4B3M T;  5L3G B;  1YKH B;  3AE4 A;  3NVO A;  2LHR A;  2PG8 A;  4DV6 T;  4OK0 A;  1SUM B;  1WYB A;  5AQU B;  4Z91 A;  4ZI3 D;  1KK7 A;  4ZXL A;  2BG9 C;  4CN6 A;  2Y6X A;  1UX4 A;  4EED A;  1MMA A;  2W00 A;  3TLV A;  1YKE B;  3SRZ A;  1U5P A;  4KMC A;  3ZCJ A;  5EZY E;  3JC6 C;  1W9R A;  4JEU B;  4AIU A;  4P09 A;  4YTN A;  4IIJ E;  2LJL A;  2EHO C;  3LSV A;  2DCF A;  1M62 A;  4ADZ A;  2UUB T;  4TN7 B;  3ZMT B;  4H9O C;  1VOM A;  3B13 A;  3C4W A;  4DV7 T;  4P0B A;  2W62 A;  2CBI A;  3ZT7 A;  2VAS A;  2BS3 A;  3UQ7 A;  4Z90 A;  1VCT A;  2ES0 A;  3AEF A;  5KMG P;  1HG5 A;  4JYA T;  3LDQ B;  3AE6 A;  1WRD A;  4TX5 A;  3UFG A;  2VUR A;  1MIY A;  4N78 D;  4EYY R;  3FZF B;  1ZV4 X;  2L9Q A;  3ZSS A;  2ZM6 T;  4QH1 A;  3PJA J;  4DR2 T;  1N32 T;  2Y8D A;  1E7P A;  1OED B;  3PUZ F;  1FMV A;  4Q25 A;  2ZLY A;  3JC6 D;  2CLY C;  3P4Q A;  4X1Y E;  1FEW A;  2BG9 A;  3ETV A;  3QUJ A;  4C90 A;  2L3L A;  3K1S A;  5CA1 E;  5AQQ B;  4U7Y A;  1T98 A;  2IHR 1;  1W0A A;  5LA6 E;  2A72 A;  4AQY T;  4DO0 A;  3P4R A;  4AI6 A;  3IBP A;  2D0U A;  3QB5 A;  3ABV A;  2NTX A;  4DR3 T;  4ZI2 C;  1XNR T;  2ODV A;  4B3S T;  2EHO A;  4AQG A;  3N9N A;  5JRE A;  5LGU B;  2WZH A;  3ANW B;  4PAG A;  4LMK A;  4ZHQ E;  5CA0 E;  1WR6 A;  3P50 A;  4IDO A;  2VKJ A;  2E9X D;  3I0O A;  5LCY A;  2KT9 A;  4HWC A;  2NP9 A;  3E08 A;  3OBV E;  3Q5E A;  4ILC A;  2ZM0 A;  2UUA T;  5J2U E;  3KDS E;  3FXD B;  4IDQ A; 
#chains in the Genus database with same CATH homology
 3M3Z B;  5AQK B;  5AQV B;  4HWF A;  3A8Y C;  4HWC A;  2D9D A;  3FZL B;  1T7S A;  5AQT B;  5AQF B;  1HX1 B;  1UK5 A;  5AQP B;  1I6Z A;  3FZH B;  5AQN B;  1UGO A;  5AQQ B;  5AQJ B;  1M62 A;  5AQG B;  5AQH B;  3FZK B;  3LDQ B;  4HWD A;  5AQM B;  1M7K A;  5AQL B;  5AQO B;  4HWH A;  4HWI B;  5AQU B;  5AQS B;  5AQI B;  3FZM B;  5AQR B;  3FZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...