1T7SA

Structural genomics of caenorhabditis elegans: structure of bag-1 protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
129
structure length
129
Chain Sequence
b'DKIIVMGGKNALVDDAGFKMLMQYEKHNLSNLQKAYDLNLRDVADLERGFLEKPKQVEMGKKLEKKVKYFNEEAERHLETLDGMNIITETTPENQAKRNREKRKTLVNGIQTLLNQNDALLRRLQEYQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG-1 cochaperone
publication title Structural genomics of Caenorhabditis elegans: structure of the BAG domain.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 42
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1t7sA00
3FZFB 4HWHA 5AQPB 5AQGB 3FZMB 1I6ZA 4HWFA 5AQFB 3LDQB 2D9DA 3A8YC 1M62A 3FZKB 5AQLB 5AQKB 4HWCA 5AQSB 1M7KA 5AQRB 1HX1B 4HWDA 1UGOA 5AQHB 3FZLB 3M3ZB 5AQUB 1T7SA 4HWIB 1UK5A 5AQJB 5AQNB 5AQVB 5AQQB 5AQIB 5AQMB 5AQTB 3FZHB 5AQOB
chains in the Genus database with same CATH superfamily
4GKKT 2E9XB 2LHRA 3ANWB 1IAPA 3MACA 4HKAA 2PG8A 3LSVA 4V1Av 1D1AA 4H63V 4LF6T 2CEAA 2WY2A 2XZEA 1UCUA 4E7SA 3RH3A 3P4QA 2V6YB 1LVFA 4QHOA 1DU2A 3CVRA 4GYSA 2BKPA 4YJ2E 2XAHB 2MTQA 1WLXA 1W9RA 2M6IA 3ZN1B 3UUXB 4LFAT 4ASKA 2C5JA 2D0UA 3EABA 2X9HA 3F2EA 3LFMA 3Q5XA 4H9RC 5JTGA 3CQXC 1D1CA 3RF1A 5LG4A 3HI2A 3ZMTB 2AXDS 3R84B 5CGMA 3EVYA 4LF7T 3PJAJ 3AEFA 5LJNA 1KK7A 1T7SA 1IBKT 2WZHA 4DR6T 1LRZA 3PUAA 4LF4T 4OHFA 4TWHA 2CHNA 4KHZF 1HX8A 2C0SA 4PJMA 5AQHB 4O4HE 2D5UA 3E0ZA 4EEDA 2VB6A 4ILBA 1HCIA 2NR4A 2XSBA 1X9BA 1MIYA 3AXJA 3RIAA 4OFZA 2J62A 2X68A 3N9NA 3OJAA 5LXTE 4M1PA 2EHOA 3C50A 2KINB 3F31A 2NW9A 4NUUA 3VR9A 2UUAT 3ETVA 2CXDA 4YSYA 1YW0A 3CQGB 3PV0F 5L2LA 1FEWA 2WDRA 2JJ9A 1IZNB 3ONLC 2I0MA 2BKOA 2HH7A 1U5PA 5AQGB 2B76A 1MIWA 5AQFB 4IL9A 5LMNT 2BVMA 3O1JA 3OVUA 4QKNA 1E1HB 1HR0T 4ZI7E 2VWAA 2VL8A 3PUWF 5HEUA 3ABVA 2K3WA 1J5ET 4KX6A 3ZMVB 3FHNA 1UURA 3N9LA 4QX7B 1YKEB 4KMCA 5C2TA 2XQ4A 3K3NA 5HXCA 2V7LA 5FVLA 4AISA 3GMIA 4X64T 2EHOB 2CXFA 3KBTA 5LHHB 1VOMA 3QOFA 5AQPB 4GK0E 2CHOA 4U7IA 2VL0A 1KEYA 3ESLA 5ABFA 2HN1A 3RIUA 4YFSA 1UX4A 3ZYMA 3UULA 3P50A 4AI6A 1L0VA 4UIGA 4AKGA 1UGOA 3ZCJA 3BQLA 4CN6A 2DLRA 2OV9A 4TV8E 4QXCB 1IJ5A 5FL0A 5AQTB 4JYAT 2VQFT 3B13A 1JNZA 3PDYA 2H3RA 2VKDA 2E8IA 2IIUA 2UXNB 2OLTA 5JQGE 4DUZT 3JAEA 4WW0A 2WP9A 3OYZA 2A2FX 4H9NC 3V5SA 5KDMC 4H9QC 2XTLA 5L3EB 4DMWA 3I0OA 2UXCT 1D0ZA 5IWAT 4IREA 1G8XA 4PAGA 4LF5T 3KV9A 4LFCT 4U31A 2ES0A 4P09A 5HXSA 5AQRB 3PUQA 2BG9C 2MAWA 4PK6A 2XAGB 4PK5A 3Q5WA 5AQJB 2GK9A 1MNDA 5ABFB 2LRLA 2H7OA 4ILCA 5J2UE 2K9AA 4DMVA 3V5UA 3PU3A 1Y64B 2IAKA 5LMUT 3P4RA 4CXXA 5C3JA 5GONE 4WYVA 5CA1E 2Y8DA 5KMGP 4I0UA 5LHGB 2JIWA 2H7VC 1V9DA 2FJBA 1WCRA 3RYCE 4IDQA 4ZS3A 3RHWA 5HEJA 5JR9A 2VKJA 5JVDE 5AQLB 1ZP0A 4DV7T 3BQIA 2LE8A 3UFGA 4DR3T 4P0AA 2F4VT 5L3GB 4A56A 4KI0F 2FJDA 3UU5A 4YHHT 3N5LA 4ANJA 2X51A 4CXWA 3ZKRA 4DR2T 4L5GA 3N9PA 4LFBT 5AFUL 3L8RA 4IT4A 4DV4T 4DV1T 2YINA 1ZKEA 4GIWA 3UTKA 1WR0A 1MMDA 3C4WA 1E2AA 1J1JA 3ZSTA 4WBNE 1VCSA 2LHNA 4Z8XA 3KV4A 5J0ZA 2XM2A 2PJQA 2JQQA 1KNRA 2YU2A 3VR8A 2JQKA 1U4QA 3SWHA 4DV3T 2X0YA 4PFPA 3TLVA 2UUBT 2LKGA 3QB5A 4EGWA 4MBQA 4A97A 3RRCA 4EYUA 2UUCT 2CWYA 4HFVA 3OPCA 3RPUA 2E9XD 4GOUA 5HCMA 1KF6A 3O4XE 4OYKA 4GK5E 5EK3A 3KVAA 4I50E 1WRDA 2UXBT 2DI4A 2LSJA 3MA9A 4ILAA 1QLBA 3J9X1 3T1HT 2VVSA 2CM0A 3PU8A 3P4SA 3AAIA 4DBRA 4FJOA 3IA3A 2V6YA 3GN5A 2BS3A 2N9DA 3RYFE 4TNVA 3FZFB 5JDNA 5AQKB 1MIVA 1B7TA 1OEDC 1QSDA 5FXZA 4WNKA 1T98A 4JI8T 5AQUB 4ISSA 3ZJ2A 5LHIB 4TZ4C 5H6QB 1WYCA 4ZOLE 2WCAA 5AQSB 4YSZA 2LKHA 5LYJE 4UEMA 5IHYA 2YDSA 3R6NA 2DL1A 4YTNA 2KT9A 3Q5DA 1I6ZA 3FBLA 1BR2A 4ERRA 4AKHA 4HWCA 3O1HA 3GN5B 3PJAA 4JEHB 3IHRA 3P4WA 2NW8A 4QH4A 2JQ9A 3ZN0B 2WM9A 2L9QA 2KSRA 3CMLA 2D9DA 4DR1T 1KNPA 2LSYA 2Q9QC 2YKSA 1D0YA 3AE5A 2R6GF 1NAFA 2V8SV 2M6BA 2BG9E 3QNUA 2P9BA 2KWIB 4UVCB 4ZI3C 2XQ9A 4Q25A 4QWNB 1XDOA 4HEAA 2V7JA 5LBMA 2XY8B 4CI2B 4AQYT 3CX6B 2DWKA 4UV8B 5FYMA 1HG2A 4AQFC 2BG9A 3HKEE 2XQ6A 1BR1A 2LOSA 2IHR1 1WR6A 4X1YE 3PTRB 3ZLIA 5JDGA 1US7B 2DHRA 2CE7A 3H3MA 2RA1A 3HKCE 4O4JE 4F6RC 4ZEYA 5C8YE 3KDSE 2JMHA 2XQYA 4B3ST 3BQKA 3PUVF 4CN4A 2WSSV 1FMWA 1MMGA 1O3XA 5AQIB 3CPZA 3CWZB 3MK7C 4DV5T 4XAXB 2Y6XA 3N2OA 2VK9A 1IBLT 5DJQC 4NIQA 5HXHA 2JMKA 4U3CA 3ZMUB 1I94T 1T8BA 2EHOD 4QX8B 3A7MA 4IL4A 3M3ZB 4CN1A 4I43B 3P7IA 2Z6EA 2VASA 3RIFA 4TV9E 4OX9T 4B6XA 2L3LA 4EYYR 1QUUA 3AE7A 2K24A 5HEGA 5A1LA 4CI1B 3RI5A 4YSXA 1OWAA 4C91A 4EV6A 2BG9B 3FBZA 2KZ7B 4PK4A 2RP4A 1Y01A 2K5BB 2WU5A 1G73A 5J2TE 3UUNA 3N9QA 4IDPA 2CLYC 2DWGA 2WS3A 3VKHA 2XQAA 4PFOA 3UUBA 3ZCIA 4LMKA 5M4YA 3EUHA 3JC6C 4F8HA 1CUNA 2NWBA 5JDMA 4TX5A 1D0XA 4X62T 2YN6A 4FI5A 2XAFB 2CPTA 3OYXA 3WAJA 4IDOA 5FNVE 4DV2T 2X67A 3CIRA 2LM2A 2X0LB 2NW7A 2KNDA 3LDQB 4AKLA 2BBJA 3PUXF 4TWFA 3NRYA 1LKXA 4Z90A 2VKHA 1ZV4X 2KXPB 3U78A 3DJBA 4X1IE 5HEHA 4BA9A 2V26A 2H88A 1N36T 3ZYKA 3FXDB 4HGAA 5LGNB 5JDLA 4JUYA 3L39A 4YJ3E 4P0BA 5FY1A 5LNKA 4ZHQE 4TWDA 4JI2T 2W63A 3SRZA 1YQ4A 2LLYA 4TUYE 4ZS2A 2LSKA 3T8OA 5CFBA 2PBIA 2HHHT 1S35A 3KVBA 1D1BA 3O9XA 1HS7A 4IE4A 2QRXA 3UU8A 2M67A 4ZI2D 3PUZF 4PJLA 2WMNA 5AQVB 2L8KA 4J2CA 2HN2A 2BKNA 3PUYF 5EK4A 2PFVA 4HWDA 3ZYLA 3AAAB 1FMVA 4PJNA 2BDEA 2W0GA 3CX7B 5ABGA 3HKDE 2A72A 2YOEA 4U72A 2X66A 1BR4A 2W67A 1W0BA 2BBHA 5BR8T 4XBFB 2XASB 4AKRB 2FJEA 2X9XA 3Q2MA 4DR5T 2CXLA 2VKOA 5L3BB 2V7KA 2JQHA 3GWHA 4QXBB 1HNXT 1HTJF 5HEOA 1X79A 1XWMA 3QUJA 1MMNA 3UU6A 4JI5T 3AE8A 3U3IA 3K3QC 3N2KE 1HG5A 1XDPA 4PW8A 4IIJE 3RQUA 1E7PA 3DTOA 2Q9QA 1OEDB 3PURA 1NWMX 3HL6A 4CI3B 3CQCB 1S94A 3J7Yq 4B3MT 2W4XA 3X1DA 1EZ3A 2ZM8A 2DCFA 1YXRA 3P8CD 2N2NA 3O1IA 4DO0A 2W00A 4MLKA 3RQWA 5ADXL 4WBOA 3MJXA 2ACXA 3AEGA 4KHPT 5L4EA 2QA7A 2AE9A 3VHLA 1KFYA 2W61A 4O4IE 4XZCA 3K3OA 3RRWA 4UF0B 2I59A 4NPPA 5JDHA 5AQMB 4YLHA 1GQEA 4UVAB 2X0HA 3IF8B 2Q9QB 4JEUB 4EIWA 3EHZA 2B1EA 4I55E 1ZOYA 4JV5T 2RPAA 1W09A 5HAXA 5LCYA 2XPKA 2C5IT 2ZLYA 2XJ7A 1H7CA 3B57A 2D2SA 4H9SE 5L3CB 2FBWA 4MHCA 4CQIA 3AE3A 1T72A 4YHJA 3H37A 2WU2A 5FXXA 2WAUA 5L47A 1W0AA 3RC3A 3L3PA 5HXRA 4JI6T 3AA6B 2A3DA 3LK2B 4BAYB 3ZMSB 3PUGA 5AQQB 2CA5A 2HPJA 2QYWA 3RIUC 4IDZA 3NZPA 5FXWA 5CA0E 3VRAA 2XQ5A 2UXXB 5JDQA 5LGUB 4ZZBA 4X20E 5HCJA 1HX1B 1XMQT 5JREA 4PNIA 2V5DA 3AE9A 3PE0A 5EZYE 1MMAA 3PUSA 1KNZA 3N2GE 2BS4A 3AE4A 5DQVA 3ONJA 2LM9A 4GYRA 5F8PA 2JRKA 1SHZC 4A5XA 2J1DG 2LSGA 3TLSA 1YKHB 5LG3A 3UUMA 4IE0A 5FXVA 2XAJB 5DABA 2IC6A 4C90A 4PJJA 2LSIA 3A8YC 3RLFF 2BS2A 3SFDA 5LOVE 3UT5E 3ETUA 1J5WA 1ZHCA 2J47A 3F57A 4X5TA 4E7ZA 3NVOA 2XM1A 2CLYB 4JI0T 2WDQA 2YK0A 3RKGA 4P1NA 4U2ZA 2YU1A 2WWUA 3ZEFB 2V6XA 3ZJ1A 1CHUA 4DV6T 4L0RA 5F5WA 3HR0A 3VU7H 4IE6A 4YY3T 2WWVA 3AVRA 2KMFA 3Q9DA 3TKLB 4HFEA 5H6RB 2E5VA 2MYSA 3AE1A 4JI7T 3EI0A 3MKDA 4K0KT 5JR9C 4U33A 3JADA 3RKOA 1UX5A 2LRKA 3KINB 4U74A 1BR0A 1AJ3A 1VCTA 3AA0B 2WBLA 3VRBA 1UK5A 4QXHB 5FMNA 2FUPA 3ZMZB 3ONXA 2QGSA 2NOXA 2JPFA 4DNDA 1N34T 4KP3C 2CMRA 2ZM6T 4DUYT 3JAFA 3RGLA 4AIUA 2FJAA 2ODUA 4AQGA 4HWHA 2VURA 5HWXA 4JI1T 2ACZA 5FY7A 2OA5A 5LJMA 4X66T 2A9UA 3I9YA 2V1DB 1IJ6A 3EAMA 3T1YT 1Z0PA 4UR9A 3AA1B 4HFDA 3HA4A 5LP6E 2PTFA 3FZMB 4LF9T 1HNZT 3LK42 3AEAA 3OKQA 3RYIE 3A5XA 2V7IA 2ODVA 4EZHA 3FXEB 3GA8A 5KXJA 1WFDA 1MNEA 3C4XA 2XQ3A 3M65A 4HFIA 3LBXA 4IDNA 3OBVE 3AB3B 3TLTA 4HFBA 2E9XC 2E2AA 4EZ4A 5FP3A 4HTEA 4YXDA 1SE7A 5L4HA 2G0UA 4K0UA 3EDVA 4HN9A 4H9OC 4AXPA 5IUXA 2IDOB 4NXMT 4A98A 3WAKA 2WDVA 3L09A 3AVSA 3E08A 1XNQT 1HFAA 5LGTB 2J4GA 2BZBA 3IEEA 4Z91A 3UU4A 4YTPA 3QC9A 3AAEB 4TN7B 3FZHB 4U2YA 5ABHA 1ZEEA 3MXZA 3KV6A 3AXJB 5LA6E 5KX5E 1IBMT 4B3RT 3UFEA 1XNRT 4O4LE 3ZSSA 4TNWA 2V7MA 5F3JA 4COFA 2IMLA 3LBXB 2YDRA 5ABEA 3UU3A 3D0TA 4UV9B 4LMJA 3B5MA 4IGUA 5FY0A 4YTMA 5CJ5A 5J1GA 3CK6A 2D0TA 1OEDE 5JH7E 1FIOA 5FVKA 1JNRA 5AQNB 2LOPA 1NEKA 1YQ3A 2WMOA 2XQ7A 2CCQA 3KFWX 2MBGA 3SOLA 5HXEA 4LMLA 2YEVC 3FZKB 4ADZA 3TLWA 1OEDA 2UU9T 3NWIA 3P4PA 4NUVA 3WI3A 2IUBA 4EB6E 4OYJA 4H9PC 4ILUA 3LG7A 2MOZA 1VRBA 3C4ZA 2DNXA 2UXDT 5LB7B 5L3FB 4ISTA 2LT3A 4AKIA 4X1KE 5FL1A 3SFEA 3SS1A 4IE7A 1SUMB 4HFCA 4JBWF 1SA0E 4UVBB 3RYHE 3ZC0A 4G63A 4JI4T 2KWHA 3NZQA 2XUEA 4UELA 2V5CA 3Q5EA 3LK3B 3ZT7A 3ZPOA 5CB4E 4UF0A 2HPLA 4X65T 2XSAA 4L9IA 4DIDB 5DQWA 5HWYA 4JI3T 2NTYA 2H89A 2NP9A 3G06A 4BJMA 2Q9QD 2LEHA 4MALA 1M7KA 5JRCA 2ZM2A 1N32T 1UUSA 3AEEA 3FZLB 4YT0A 3DP7A 4HWIB 3KBUA 4ZI3D 2W2UA 4QH1A 3KV5A 1XZYA 3N9MA 3I0QA 5TAOA 2WZIA 4UXNB 3AA7B 5HYAA 4ZXLA 4CXYA 5ETWA 3LJCA 3CKDA 4EXTA 2EHOC 3S4UA 2CRBA 3CX8B 4AQFA 4N78D 4O8SA 3AE6A 2WB5A 4EEBA 3W15B 2NTXA 2LJLA 3E22E 2XHEB 3FB2A 2XQ8A 2ZMAA 3NRXA 4U7YA 2E5LT 5BMVE 4ZZCA 3K8PC 2MPKA 4IE5A 3AEBA 5LBQB 2C5KT 4DR7T 1WYBA 3NKZA 1LVKA 3H3AA 3C98B 4I4TE 3AE2A 4IHJE 4LF8T 1N33T 1HNWT 3HKBE 1R8IA 5JRCB 2VQET 3BK9A 3C64A 3ZT5A 3I1AA 2W66A 4OK0A 3K1SA 1HF8A 2VVNA 4O2AE 3UQ7A 4WZXA 3RX6A 2CBIA 5AQOB 4O2BE 5E0OA 4EOZB 4HWFA 4NXNT 5JR9B 2K48A 3IBPA 3QK6A 4GKJT 2IW5B 3VKGA 4BJNA 3UQ4A 2XAQB 2WQYA 1XMOT 4EAHA 3NBXX 3ZT6A 3TLUA 1Z8UA 3RC8A 2E9XA 4DR4T 3ANWA 2BVLA 2X9YA 3EDUA 2I6HA 5IYZE 3C51A 2X9WA 2CWOA 2IC9A 5JDFA 5FKYA 4HE8A 4KUMB 4JLEA 3JC6D 5EK2A 3ZC1A 4HFHA 2ZM0A 2YDQA 4DBQA 3AEDA 4H63H 4MFRA 2SPCA 4G2AA 1NENA 4KBMB 3MZKB 3QB5K 4DVDA 5L3DB 1YD8G 3N9OA 1OXZA 1M62A 2N1GA 2KLQA 2W62A 2Y48B 3JCFA 2QVAA 4QH5A 3OTOT 4B3TT 4CZZB 3AECA 1FJGT 4ZI2C 2CBJA 3I9WA 4DV0T
chains in the Genus database with same CATH topology
3FZFB 4HWHA 5AQPB 5AQGB 3FZMB 1I6ZA 4HWFA 5AQFB 3LDQB 2D9DA 3A8YC 1M62A 3FZKB 5AQLB 5AQKB 4HWCA 5AQSB 1M7KA 5AQRB 1HX1B 4HWDA 1UGOA 5AQHB 3FZLB 3M3ZB 5AQUB 1T7SA 4HWIB 1UK5A 5AQJB 5AQNB 5AQVB 5AQQB 5AQIB 5AQMB 5AQTB 3FZHB 5AQOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZF B;  4HWH A;  5AQP B;  5AQG B;  3FZM B;  1I6Z A;  4HWF A;  5AQF B;  3LDQ B;  2D9D A;  3A8Y C;  1M62 A;  3FZK B;  5AQL B;  5AQK B;  4HWC A;  5AQS B;  1M7K A;  5AQR B;  1HX1 B;  4HWD A;  1UGO A;  5AQH B;  3FZL B;  3M3Z B;  5AQU B;  1T7S A;  4HWI B;  1UK5 A;  5AQJ B;  5AQN B;  5AQV B;  5AQQ B;  5AQI B;  5AQM B;  5AQT B;  3FZH B;  5AQO B; 
#chains in the Genus database with same CATH topology
 4GKK T;  2E9X B;  2LHR A;  3ANW B;  1IAP A;  3MAC A;  4HKA A;  2PG8 A;  3LSV A;  4V1A v;  1D1A A;  4H63 V;  4LF6 T;  2CEA A;  2WY2 A;  2XZE A;  1UCU A;  4E7S A;  3RH3 A;  3P4Q A;  2V6Y B;  1LVF A;  4QHO A;  1DU2 A;  3CVR A;  4GYS A;  2BKP A;  4YJ2 E;  2XAH B;  2MTQ A;  1WLX A;  1W9R A;  2M6I A;  3ZN1 B;  3UUX B;  4LFA T;  4ASK A;  2C5J A;  2D0U A;  3EAB A;  2X9H A;  3F2E A;  3LFM A;  3Q5X A;  4H9R C;  5JTG A;  3CQX C;  1D1C A;  3RF1 A;  5LG4 A;  3HI2 A;  3ZMT B;  2AXD S;  3R84 B;  5CGM A;  3EVY A;  4LF7 T;  3PJA J;  3AEF A;  5LJN A;  1KK7 A;  1T7S A;  1IBK T;  2WZH A;  4DR6 T;  1LRZ A;  3PUA A;  4LF4 T;  4OHF A;  4TWH A;  2CHN A;  4KHZ F;  1HX8 A;  2C0S A;  4PJM A;  5AQH B;  4O4H E;  2D5U A;  3E0Z A;  4EED A;  2VB6 A;  4ILB A;  1HCI A;  2NR4 A;  2XSB A;  1X9B A;  1MIY A;  3AXJ A;  3RIA A;  4OFZ A;  2J62 A;  2X68 A;  3N9N A;  3OJA A;  5LXT E;  4M1P A;  2EHO A;  3C50 A;  2KIN B;  3F31 A;  2NW9 A;  4NUU A;  3VR9 A;  2UUA T;  3ETV A;  2CXD A;  4YSY A;  1YW0 A;  3CQG B;  3PV0 F;  5L2L A;  1FEW A;  2WDR A;  2JJ9 A;  1IZN B;  3ONL C;  2I0M A;  2BKO A;  2HH7 A;  1U5P A;  5AQG B;  2B76 A;  1MIW A;  5AQF B;  4IL9 A;  5LMN T;  2BVM A;  3O1J A;  3OVU A;  4QKN A;  1E1H B;  1HR0 T;  4ZI7 E;  2VWA A;  2VL8 A;  3PUW F;  5HEU A;  3ABV A;  2K3W A;  1J5E T;  4KX6 A;  3ZMV B;  3FHN A;  1UUR A;  3N9L A;  4QX7 B;  1YKE B;  4KMC A;  5C2T A;  2XQ4 A;  3K3N A;  5HXC A;  2V7L A;  5FVL A;  4AIS A;  3GMI A;  4X64 T;  2EHO B;  2CXF A;  3KBT A;  5LHH B;  1VOM A;  3QOF A;  5AQP B;  4GK0 E;  2CHO A;  4U7I A;  2VL0 A;  1KEY A;  3ESL A;  5ABF A;  2HN1 A;  3RIU A;  4YFS A;  1UX4 A;  3ZYM A;  3UUL A;  3P50 A;  4AI6 A;  1L0V A;  4UIG A;  4AKG A;  1UGO A;  3ZCJ A;  3BQL A;  4CN6 A;  2DLR A;  2OV9 A;  4TV8 E;  4QXC B;  1IJ5 A;  5FL0 A;  5AQT B;  4JYA T;  2VQF T;  3B13 A;  1JNZ A;  3PDY A;  2H3R A;  2VKD A;  2E8I A;  2IIU A;  2UXN B;  2OLT A;  5JQG E;  4DUZ T;  3JAE A;  4WW0 A;  2WP9 A;  3OYZ A;  2A2F X;  4H9N C;  3V5S A;  5KDM C;  4H9Q C;  2XTL A;  5L3E B;  4DMW A;  3I0O A;  2UXC T;  1D0Z A;  5IWA T;  4IRE A;  1G8X A;  4PAG A;  4LF5 T;  3KV9 A;  4LFC T;  4U31 A;  2ES0 A;  4P09 A;  5HXS A;  5AQR B;  3PUQ A;  2BG9 C;  2MAW A;  4PK6 A;  2XAG B;  4PK5 A;  3Q5W A;  5AQJ B;  2GK9 A;  1MND A;  5ABF B;  2LRL A;  2H7O A;  4ILC A;  5J2U E;  2K9A A;  4DMV A;  3V5U A;  3PU3 A;  1Y64 B;  2IAK A;  5LMU T;  3P4R A;  4CXX A;  5C3J A;  5GON E;  4WYV A;  5CA1 E;  2Y8D A;  5KMG P;  4I0U A;  5LHG B;  2JIW A;  2H7V C;  1V9D A;  2FJB A;  1WCR A;  3RYC E;  4IDQ A;  4ZS3 A;  3RHW A;  5HEJ A;  5JR9 A;  2VKJ A;  5JVD E;  5AQL B;  1ZP0 A;  4DV7 T;  3BQI A;  2LE8 A;  3UFG A;  4DR3 T;  4P0A A;  2F4V T;  5L3G B;  4A56 A;  4KI0 F;  2FJD A;  3UU5 A;  4YHH T;  3N5L A;  4ANJ A;  2X51 A;  4CXW A;  3ZKR A;  4DR2 T;  4L5G A;  3N9P A;  4LFB T;  5AFU L;  3L8R A;  4IT4 A;  4DV4 T;  4DV1 T;  2YIN A;  1ZKE A;  4GIW A;  3UTK A;  1WR0 A;  1MMD A;  3C4W A;  1E2A A;  1J1J A;  3ZST A;  4WBN E;  1VCS A;  2LHN A;  4Z8X A;  3KV4 A;  5J0Z A;  2XM2 A;  2PJQ A;  2JQQ A;  1KNR A;  2YU2 A;  3VR8 A;  2JQK A;  1U4Q A;  3SWH A;  4DV3 T;  2X0Y A;  4PFP A;  3TLV A;  2UUB T;  2LKG A;  3QB5 A;  4EGW A;  4MBQ A;  4A97 A;  3RRC A;  4EYU A;  2UUC T;  2CWY A;  4HFV A;  3OPC A;  3RPU A;  2E9X D;  4GOU A;  5HCM A;  1KF6 A;  3O4X E;  4OYK A;  4GK5 E;  5EK3 A;  3KVA A;  4I50 E;  1WRD A;  2UXB T;  2DI4 A;  2LSJ A;  3MA9 A;  4ILA A;  1QLB A;  3J9X 1;  3T1H T;  2VVS A;  2CM0 A;  3PU8 A;  3P4S A;  3AAI A;  4DBR A;  4FJO A;  3IA3 A;  2V6Y A;  3GN5 A;  2BS3 A;  2N9D A;  3RYF E;  4TNV A;  3FZF B;  5JDN A;  5AQK B;  1MIV A;  1B7T A;  1OED C;  1QSD A;  5FXZ A;  4WNK A;  1T98 A;  4JI8 T;  5AQU B;  4ISS A;  3ZJ2 A;  5LHI B;  4TZ4 C;  5H6Q B;  1WYC A;  4ZOL E;  2WCA A;  5AQS B;  4YSZ A;  2LKH A;  5LYJ E;  4UEM A;  5IHY A;  2YDS A;  3R6N A;  2DL1 A;  4YTN A;  2KT9 A;  3Q5D A;  1I6Z A;  3FBL A;  1BR2 A;  4ERR A;  4AKH A;  4HWC A;  3O1H A;  3GN5 B;  3PJA A;  4JEH B;  3IHR A;  3P4W A;  2NW8 A;  4QH4 A;  2JQ9 A;  3ZN0 B;  2WM9 A;  2L9Q A;  2KSR A;  3CML A;  2D9D A;  4DR1 T;  1KNP A;  2LSY A;  2Q9Q C;  2YKS A;  1D0Y A;  3AE5 A;  2R6G F;  1NAF A;  2V8S V;  2M6B A;  2BG9 E;  3QNU A;  2P9B A;  2KWI B;  4UVC B;  4ZI3 C;  2XQ9 A;  4Q25 A;  4QWN B;  1XDO A;  4HEA A;  2V7J A;  5LBM A;  2XY8 B;  4CI2 B;  4AQY T;  3CX6 B;  2DWK A;  4UV8 B;  5FYM A;  1HG2 A;  4AQF C;  2BG9 A;  3HKE E;  2XQ6 A;  1BR1 A;  2LOS A;  2IHR 1;  1WR6 A;  4X1Y E;  3PTR B;  3ZLI A;  5JDG A;  1US7 B;  2DHR A;  2CE7 A;  3H3M A;  2RA1 A;  3HKC E;  4O4J E;  4F6R C;  4ZEY A;  5C8Y E;  3KDS E;  2JMH A;  2XQY A;  4B3S T;  3BQK A;  3PUV F;  4CN4 A;  2WSS V;  1FMW A;  1MMG A;  1O3X A;  5AQI B;  3CPZ A;  3CWZ B;  3MK7 C;  4DV5 T;  4XAX B;  2Y6X A;  3N2O A;  2VK9 A;  1IBL T;  5DJQ C;  4NIQ A;  5HXH A;  2JMK A;  4U3C A;  3ZMU B;  1I94 T;  1T8B A;  2EHO D;  4QX8 B;  3A7M A;  4IL4 A;  3M3Z B;  4CN1 A;  4I43 B;  3P7I A;  2Z6E A;  2VAS A;  3RIF A;  4TV9 E;  4OX9 T;  4B6X A;  2L3L A;  4EYY R;  1QUU A;  3AE7 A;  2K24 A;  5HEG A;  5A1L A;  4CI1 B;  3RI5 A;  4YSX A;  1OWA A;  4C91 A;  4EV6 A;  2BG9 B;  3FBZ A;  2KZ7 B;  4PK4 A;  2RP4 A;  1Y01 A;  2K5B B;  2WU5 A;  1G73 A;  5J2T E;  3UUN A;  3N9Q A;  4IDP A;  2CLY C;  2DWG A;  2WS3 A;  3VKH A;  2XQA A;  4PFO A;  3UUB A;  3ZCI A;  4LMK A;  5M4Y A;  3EUH A;  3JC6 C;  4F8H A;  1CUN A;  2NWB A;  5JDM A;  4TX5 A;  1D0X A;  4X62 T;  2YN6 A;  4FI5 A;  2XAF B;  2CPT A;  3OYX A;  3WAJ A;  4IDO A;  5FNV E;  4DV2 T;  2X67 A;  3CIR A;  2LM2 A;  2X0L B;  2NW7 A;  2KND A;  3LDQ B;  4AKL A;  2BBJ A;  3PUX F;  4TWF A;  3NRY A;  1LKX A;  4Z90 A;  2VKH A;  1ZV4 X;  2KXP B;  3U78 A;  3DJB A;  4X1I E;  5HEH A;  4BA9 A;  2V26 A;  2H88 A;  1N36 T;  3ZYK A;  3FXD B;  4HGA A;  5LGN B;  5JDL A;  4JUY A;  3L39 A;  4YJ3 E;  4P0B A;  5FY1 A;  5LNK A;  4ZHQ E;  4TWD A;  4JI2 T;  2W63 A;  3SRZ A;  1YQ4 A;  2LLY A;  4TUY E;  4ZS2 A;  2LSK A;  3T8O A;  5CFB A;  2PBI A;  2HHH T;  1S35 A;  3KVB A;  1D1B A;  3O9X A;  1HS7 A;  4IE4 A;  2QRX A;  3UU8 A;  2M67 A;  4ZI2 D;  3PUZ F;  4PJL A;  2WMN A;  5AQV B;  2L8K A;  4J2C A;  2HN2 A;  2BKN A;  3PUY F;  5EK4 A;  2PFV A;  4HWD A;  3ZYL A;  3AAA B;  1FMV A;  4PJN A;  2BDE A;  2W0G A;  3CX7 B;  5ABG A;  3HKD E;  2A72 A;  2YOE A;  4U72 A;  2X66 A;  1BR4 A;  2W67 A;  1W0B A;  2BBH A;  5BR8 T;  4XBF B;  2XAS B;  4AKR B;  2FJE A;  2X9X A;  3Q2M A;  4DR5 T;  2CXL A;  2VKO A;  5L3B B;  2V7K A;  2JQH A;  3GWH A;  4QXB B;  1HNX T;  1HTJ F;  5HEO A;  1X79 A;  1XWM A;  3QUJ A;  1MMN A;  3UU6 A;  4JI5 T;  3AE8 A;  3U3I A;  3K3Q C;  3N2K E;  1HG5 A;  1XDP A;  4PW8 A;  4IIJ E;  3RQU A;  1E7P A;  3DTO A;  2Q9Q A;  1OED B;  3PUR A;  1NWM X;  3HL6 A;  4CI3 B;  3CQC B;  1S94 A;  3J7Y q;  4B3M T;  2W4X A;  3X1D A;  1EZ3 A;  2ZM8 A;  2DCF A;  1YXR A;  3P8C D;  2N2N A;  3O1I A;  4DO0 A;  2W00 A;  4MLK A;  3RQW A;  5ADX L;  4WBO A;  3MJX A;  2ACX A;  3AEG A;  4KHP T;  5L4E A;  2QA7 A;  2AE9 A;  3VHL A;  1KFY A;  2W61 A;  4O4I E;  4XZC A;  3K3O A;  3RRW A;  4UF0 B;  2I59 A;  4NPP A;  5JDH A;  5AQM B;  4YLH A;  1GQE A;  4UVA B;  2X0H A;  3IF8 B;  2Q9Q B;  4JEU B;  4EIW A;  3EHZ A;  2B1E A;  4I55 E;  1ZOY A;  4JV5 T;  2RPA A;  1W09 A;  5HAX A;  5LCY A;  2XPK A;  2C5I T;  2ZLY A;  2XJ7 A;  1H7C A;  3B57 A;  2D2S A;  4H9S E;  5L3C B;  2FBW A;  4MHC A;  4CQI A;  3AE3 A;  1T72 A;  4YHJ A;  3H37 A;  2WU2 A;  5FXX A;  2WAU A;  5L47 A;  1W0A A;  3RC3 A;  3L3P A;  5HXR A;  4JI6 T;  3AA6 B;  2A3D A;  3LK2 B;  4BAY B;  3ZMS B;  3PUG A;  5AQQ B;  2CA5 A;  2HPJ A;  2QYW A;  3RIU C;  4IDZ A;  3NZP A;  5FXW A;  5CA0 E;  3VRA A;  2XQ5 A;  2UXX B;  5JDQ A;  5LGU B;  4ZZB A;  4X20 E;  5HCJ A;  1HX1 B;  1XMQ T;  5JRE A;  4PNI A;  2V5D A;  3AE9 A;  3PE0 A;  5EZY E;  1MMA A;  3PUS A;  1KNZ A;  3N2G E;  2BS4 A;  3AE4 A;  5DQV A;  3ONJ A;  2LM9 A;  4GYR A;  5F8P A;  2JRK A;  1SHZ C;  4A5X A;  2J1D G;  2LSG A;  3TLS A;  1YKH B;  5LG3 A;  3UUM A;  4IE0 A;  5FXV A;  2XAJ B;  5DAB A;  2IC6 A;  4C90 A;  4PJJ A;  2LSI A;  3A8Y C;  3RLF F;  2BS2 A;  3SFD A;  5LOV E;  3UT5 E;  3ETU A;  1J5W A;  1ZHC A;  2J47 A;  3F57 A;  4X5T A;  4E7Z A;  3NVO A;  2XM1 A;  2CLY B;  4JI0 T;  2WDQ A;  2YK0 A;  3RKG A;  4P1N A;  4U2Z A;  2YU1 A;  2WWU A;  3ZEF B;  2V6X A;  3ZJ1 A;  1CHU A;  4DV6 T;  4L0R A;  5F5W A;  3HR0 A;  3VU7 H;  4IE6 A;  4YY3 T;  2WWV A;  3AVR A;  2KMF A;  3Q9D A;  3TKL B;  4HFE A;  5H6R B;  2E5V A;  2MYS A;  3AE1 A;  4JI7 T;  3EI0 A;  3MKD A;  4K0K T;  5JR9 C;  4U33 A;  3JAD A;  3RKO A;  1UX5 A;  2LRK A;  3KIN B;  4U74 A;  1BR0 A;  1AJ3 A;  1VCT A;  3AA0 B;  2WBL A;  3VRB A;  1UK5 A;  4QXH B;  5FMN A;  2FUP A;  3ZMZ B;  3ONX A;  2QGS A;  2NOX A;  2JPF A;  4DND A;  1N34 T;  4KP3 C;  2CMR A;  2ZM6 T;  4DUY T;  3JAF A;  3RGL A;  4AIU A;  2FJA A;  2ODU A;  4AQG A;  4HWH A;  2VUR A;  5HWX A;  4JI1 T;  2ACZ A;  5FY7 A;  2OA5 A;  5LJM A;  4X66 T;  2A9U A;  3I9Y A;  2V1D B;  1IJ6 A;  3EAM A;  3T1Y T;  1Z0P A;  4UR9 A;  3AA1 B;  4HFD A;  3HA4 A;  5LP6 E;  2PTF A;  3FZM B;  4LF9 T;  1HNZ T;  3LK4 2;  3AEA A;  3OKQ A;  3RYI E;  3A5X A;  2V7I A;  2ODV A;  4EZH A;  3FXE B;  3GA8 A;  5KXJ A;  1WFD A;  1MNE A;  3C4X A;  2XQ3 A;  3M65 A;  4HFI A;  3LBX A;  4IDN A;  3OBV E;  3AB3 B;  3TLT A;  4HFB A;  2E9X C;  2E2A A;  4EZ4 A;  5FP3 A;  4HTE A;  4YXD A;  1SE7 A;  5L4H A;  2G0U A;  4K0U A;  3EDV A;  4HN9 A;  4H9O C;  4AXP A;  5IUX A;  2IDO B;  4NXM T;  4A98 A;  3WAK A;  2WDV A;  3L09 A;  3AVS A;  3E08 A;  1XNQ T;  1HFA A;  5LGT B;  2J4G A;  2BZB A;  3IEE A;  4Z91 A;  3UU4 A;  4YTP A;  3QC9 A;  3AAE B;  4TN7 B;  3FZH B;  4U2Y A;  5ABH A;  1ZEE A;  3MXZ A;  3KV6 A;  3AXJ B;  5LA6 E;  5KX5 E;  1IBM T;  4B3R T;  3UFE A;  1XNR T;  4O4L E;  3ZSS A;  4TNW A;  2V7M A;  5F3J A;  4COF A;  2IML A;  3LBX B;  2YDR A;  5ABE A;  3UU3 A;  3D0T A;  4UV9 B;  4LMJ A;  3B5M A;  4IGU A;  5FY0 A;  4YTM A;  5CJ5 A;  5J1G A;  3CK6 A;  2D0T A;  1OED E;  5JH7 E;  1FIO A;  5FVK A;  1JNR A;  5AQN B;  2LOP A;  1NEK A;  1YQ3 A;  2WMO A;  2XQ7 A;  2CCQ A;  3KFW X;  2MBG A;  3SOL A;  5HXE A;  4LML A;  2YEV C;  3FZK B;  4ADZ A;  3TLW A;  1OED A;  2UU9 T;  3NWI A;  3P4P A;  4NUV A;  3WI3 A;  2IUB A;  4EB6 E;  4OYJ A;  4H9P C;  4ILU A;  3LG7 A;  2MOZ A;  1VRB A;  3C4Z A;  2DNX A;  2UXD T;  5LB7 B;  5L3F B;  4IST A;  2LT3 A;  4AKI A;  4X1K E;  5FL1 A;  3SFE A;  3SS1 A;  4IE7 A;  1SUM B;  4HFC A;  4JBW F;  1SA0 E;  4UVB B;  3RYH E;  3ZC0 A;  4G63 A;  4JI4 T;  2KWH A;  3NZQ A;  2XUE A;  4UEL A;  2V5C A;  3Q5E A;  3LK3 B;  3ZT7 A;  3ZPO A;  5CB4 E;  4UF0 A;  2HPL A;  4X65 T;  2XSA A;  4L9I A;  4DID B;  5DQW A;  5HWY A;  4JI3 T;  2NTY A;  2H89 A;  2NP9 A;  3G06 A;  4BJM A;  2Q9Q D;  2LEH A;  4MAL A;  1M7K A;  5JRC A;  2ZM2 A;  1N32 T;  1UUS A;  3AEE A;  3FZL B;  4YT0 A;  3DP7 A;  4HWI B;  3KBU A;  4ZI3 D;  2W2U A;  4QH1 A;  3KV5 A;  1XZY A;  3N9M A;  3I0Q A;  5TAO A;  2WZI A;  4UXN B;  3AA7 B;  5HYA A;  4ZXL A;  4CXY A;  5ETW A;  3LJC A;  3CKD A;  4EXT A;  2EHO C;  3S4U A;  2CRB A;  3CX8 B;  4AQF A;  4N78 D;  4O8S A;  3AE6 A;  2WB5 A;  4EEB A;  3W15 B;  2NTX A;  2LJL A;  3E22 E;  2XHE B;  3FB2 A;  2XQ8 A;  2ZMA A;  3NRX A;  4U7Y A;  2E5L T;  5BMV E;  4ZZC A;  3K8P C;  2MPK A;  4IE5 A;  3AEB A;  5LBQ B;  2C5K T;  4DR7 T;  1WYB A;  3NKZ A;  1LVK A;  3H3A A;  3C98 B;  4I4T E;  3AE2 A;  4IHJ E;  4LF8 T;  1N33 T;  1HNW T;  3HKB E;  1R8I A;  5JRC B;  2VQE T;  3BK9 A;  3C64 A;  3ZT5 A;  3I1A A;  2W66 A;  4OK0 A;  3K1S A;  1HF8 A;  2VVN A;  4O2A E;  3UQ7 A;  4WZX A;  3RX6 A;  2CBI A;  5AQO B;  4O2B E;  5E0O A;  4EOZ B;  4HWF A;  4NXN T;  5JR9 B;  2K48 A;  3IBP A;  3QK6 A;  4GKJ T;  2IW5 B;  3VKG A;  4BJN A;  3UQ4 A;  2XAQ B;  2WQY A;  1XMO T;  4EAH A;  3NBX X;  3ZT6 A;  3TLU A;  1Z8U A;  3RC8 A;  2E9X A;  4DR4 T;  3ANW A;  2BVL A;  2X9Y A;  3EDU A;  2I6H A;  5IYZ E;  3C51 A;  2X9W A;  2CWO A;  2IC9 A;  5JDF A;  5FKY A;  4HE8 A;  4KUM B;  4JLE A;  3JC6 D;  5EK2 A;  3ZC1 A;  4HFH A;  2ZM0 A;  2YDQ A;  4DBQ A;  3AED A;  4H63 H;  4MFR A;  2SPC A;  4G2A A;  1NEN A;  4KBM B;  3MZK B;  3QB5 K;  4DVD A;  5L3D B;  1YD8 G;  3N9O A;  1OXZ A;  1M62 A;  2N1G A;  2KLQ A;  2W62 A;  2Y48 B;  3JCF A;  2QVA A;  4QH5 A;  3OTO T;  4B3T T;  4CZZ B;  3AEC A;  1FJG T;  4ZI2 C;  2CBJ A;  3I9W A;  4DV0 T; 
#chains in the Genus database with same CATH homology
 3FZF B;  4HWH A;  5AQP B;  5AQG B;  3FZM B;  1I6Z A;  4HWF A;  5AQF B;  3LDQ B;  2D9D A;  3A8Y C;  1M62 A;  3FZK B;  5AQL B;  5AQK B;  4HWC A;  5AQS B;  1M7K A;  5AQR B;  1HX1 B;  4HWD A;  1UGO A;  5AQH B;  3FZL B;  3M3Z B;  5AQU B;  1T7S A;  4HWI B;  1UK5 A;  5AQJ B;  5AQN B;  5AQV B;  5AQQ B;  5AQI B;  5AQM B;  5AQT B;  3FZH B;  5AQO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...