1T7SA

Structural genomics of caenorhabditis elegans: structure of bag-1 protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
129
structure length
129
Chain Sequence
DKIIVMGGKNALVDDAGFKMLMQYEKHNLSNLQKAYDLNLRDVADLERGFLEKPKQVEMGKKLEKKVKYFNEEAERHLETLDGMNIITETTPENQAKRNREKRKTLVNGIQTLLNQNDALLRRLQEYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of Caenorhabditis elegans: structure of the BAG domain.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
molecule keywords BAG-1 cochaperone
total genus 42
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1t7sA00
3LDQB 5AQRB 3FZFB 1UK5A 5AQGB 3FZMB 5AQKB 5AQFB 2D9DA 1M62A 3FZKB 3FZHB 5AQPB 4HWDA 3M3ZB 4HWIB 5AQOB 5AQSB 1HX1B 4HWFA 3A8YC 4HWCA 5AQLB 5AQMB 1T7SA 5AQTB 5AQNB 1I6ZA 5AQHB 5AQIB 5AQUB 3FZLB 5AQVB 1M7KA 4HWHA 1UGOA 5AQJB 5AQQB
chains in the Genus database with same CATH superfamily
4NIQA 2WQYA 1FMWA 4U33A 4AQGA 3ZT6A 4UV8B 2CHNA 2ZMAA 1HTJF 2WZHA 3OTOT 4PAGA 1UK5A 3O4XE 4QXHB 5ABGA 4PK4A 2DL1A 4DV1T 2BVMA 3C4WA 4CZZB 5FY1A 2YDSA 4QHOA 2IDOB 5LJNA 3E22E 4IDQA 3AECA 1LRZA 3RGLA 2Y6XA 3ZYKA 2C0SA 4HWIB 5J0ZA 2N2NA 1XZYA 3RYHE 4AKRB 3EUHA 1Z8UA 4IE4A 1CUNA 4NUUA 3KDSE 2H3RA 4H9SE 2BDEA 2W0GA 3ZCJA 4C90A 2OLTA 3W15B 3PUSA 4OYJA 4YSXA 3AXJA 4IGUA 4DV5T 2RPAA 1WYBA 5LB7B 5JREA 5JDGA 2CLYB 2DI4A 5LCYA 3BQLA 1NAFA 4ZI3D 1T98A 2WSSV 3AAAB 2BG9B 3ZLIA 5HYAA 4B3ST 4EB6E 4ZOLE 3ETVA 4X66T 1U5PA 2VKDA 2YINA 1ZV4X 3N9NA 1MNDA 4JEHB 3TLVA 4L9IA 4IDZA 5HEUA 5JR9A 5J2UE 1FIOA 3L3PA 3AVRA 4P09A 3S4UA 3AE3A 1L0VA 4PNIA 3RC3A 3ETUA 1QSDA 2H88A 5LBQB 4A98A 4KHPT 4MBQA 4TWHA 3RF1A 3Q5EA 2ODUA 2YU2A 4G63A 3E0ZA 4H9OC 3L39A 2LM2A 3EVYA 3RPUA 3HI2A 3AE8A 5ADXL 1XWMA 1I94T 1XDOA 3JCFA 3LK2B 4YLHA 4TV9E 2A3DA 4E7ZA 2RA1A 5F3JA 3JC6C 2M67A 1HX8A 4JUYA 1HG5A 2NW7A 3WAKA 2X0LB 2YDRA 2LOSA 3NZQA 3DP7A 2CRBA 3IA3A 4IDNA 3CWZB 4PW8A 4UR9A 3BK9A 2HPJA 4DR7T 3ZMZB 3EAMA 2D0UA 2CPTA 5J1GA 3C4ZA 1YXRA 2XQAA 2JJ9A 4ZZBA 4CI2B 4IL4A 4U74A 1VCTA 2FJBA 2ZM2A 4X64T 1W9RA 3EDVA 3HA4A 2KMFA 3FZFB 3IF8B 3PUQA 3V5SA 5ABEA 4DV7T 5FL1A 5BR8T 3AA1B 1E7PA 2XQ5A 3RC8A 3CQCB 3AXJB 5ABHA 3B5MA 5LHIB 4DUYT 3LJCA 4AXPA 1B7TA 2D0TA 3AE4A 4L0RA 3PJAJ 5FXWA 4HKAA 5LHHB 1VCSA 5AQOB 3KVAA 4I4TE 3ZMSB 1HNZT 1YKEB 3VR8A 1HR0T 1XNRT 4YTMA 2DNXA 2CXLA 3CIRA 2PFVA 1D0YA 4PK6A 2IMLA 5M4YA 2C5IT 2OA5A 3CPZA 4YTPA 4HWHA 4XZCA 2MOZA 3IEEA 4MHCA 3MZKB 2XAGB 4TN7B 5C3JA 2CE7A 5KX5E 4X1IE 1MMDA 3AE9A 1W09A 3LDQB 3RKOA 5HEJA 4O2BE 4M1PA 2B76A 4QWNB 5DABA 5LJMA 4ISTA 1XMQT 4HFCA 4JV5T 1HNWT 3RQWA 2XTLA 2YN6A 2KWHA 1IBMT 5CA1E 2F4VT 2XAQB 3UFGA 5AQFB 5IHYA 3PJAA 3R84B 3K3NA 4EEBA 2H7VC 1OEDE 4P0AA 2EHOB 2UUBT 4LMLA 2NW9A 1UX5A 4UVBB 4TUYE 5LBMA 4H9NC 1H7CA 1YKHB 4HFIA 3QUJA 2LEHA 2WWVA 4EYYR 3I0QA 1ZHCA 4DV0T 5EK4A 5LXTE 2X9WA 3SWHA 4CI1B 2N9DA 3GN5B 2I6HA 1GQEA 4DR5T 3EHZA 3UFEA 3L09A 4HN9A 3IHRA 3RIUC 2HH7A 2EHOA 2OV9A 2V5DA 2E9XD 2W63A 4MLKA 5HCMA 2X51A 3TLWA 3UQ4A 4AISA 3AEAA 2QVAA 4ZZCA 2JQKA 3B13A 3LBXB 2J4GA 2LOPA 4DR2T 4AQYT 2X66A 2UUCT 1KNZA 1YQ4A 3UU6A 3HL6A 4QXCB 2PJQA 4JI3T 2UXBT 2XQ8A 4TWDA 4IL9A 1KNPA 2XY8B 3CX6B 3Q5XA 1HG2A 2X0YA 2MBGA 3ZMVB 1XMOT 4KX6A 5TAOA 5HXCA 3C4XA 3RRCA 2P9BA 1OEDB 1IJ5A 1KK7A 2IC9A 3HKDE 2E5LT 4GK5E 3AE2A 2HN1A 2X9HA 1BR0A 3NRYA 1JNZA 4WYVA 4JLEA 3OYXA 2G0UA 4IDOA 2KSRA 3RQUA 2Z6EA 4FJOA 4EZ4A 2V26A 2Q9QD 3AEBA 3KFWX 2VQET 1I6ZA 3AEEA 2JMHA 2WU2A 4U2ZA 2YU1A 3LSVA 4HE8A 1MIWA 2LHRA 1MMAA 4IE0A 4QKNA 4LMJA 4ZI3C 3ZN1B 1KNRA 3O1IA 3LG7A 3O1HA 3PUYF 5AQJB 4WW0A 3SS1A 4NXNT 2XHEB 4A5XA 2YKSA 2ES0A 3LFMA 3HKCE 4JI0T 4ERRA 1WLXA 3N9LA 4IE6A 4WBOA 4UEMA 4TNVA 4UXNB 5AQKB 4QH1A 2LHNA 2C5JA 5JRCA 5LOVE 5FP3A 3B57A 2XZEA 5LHGB 1IBKT 3PUXF 3RKGA 1XNQT 2V7KA 4CI3B 1OWAA 3PU8A 2WY2A 1BR4A 1X9BA 5C2TA 2WCAA 2UXXB 3A8YC 3LBXA 5LA6E 2DHRA 5AQTB 2BKNA 4OYKA 5L3GB 5DQWA 2X0HA 1US7B 2CLYC 4JI2T 3K1SA 5H6QB 2BS4A 3R6NA 2LSJA 3ZMTB 2CBIA 3HKBE 5L3FB 2V1DB 2KLQA 2LSYA 2NP9A 2V8SV 2VKHA 3AE5A 4TNWA 5ETWA 3G06A 3RRWA 1S35A 2BBHA 3JAEA 1OXZA 3U78A 3ESLA 1ZOYA 3ZYMA 2W61A 2BG9C 4CXXA 1N36T 1NEKA 4H9RC 4U7YA 4JI6T 4YXDA 3KV4A 5FVLA 1HF8A 2N1GA 5HXSA 4HFVA 3N2KE 5L3BB 4QH5A 2EHOD 2E9XA 2JQ9A 3AEDA 4IHJE 3ZSSA 5KXJA 3JAFA 2JIWA 4CN1A 3QK6A 4QXBB 3BQIA 2H7OA 4EEDA 5AQPB 5E0OA 4X65T 4HFDA 1W0AA 4HWDA 4ASKA 2VB6A 4QH4A 4EXTA 4JI5T 1E1HB 5JQGE 5AQSB 2W00A 5JH7E 2IC6A 4G2AA 2CBJA 2W66A 4X1YE 4Q25A 5AQLB 4OX9T 1KFYA 4CN6A 4ANJA 2J1DG 4O4HE 1XDPA 4AKGA 2XQ6A 5LGTB 2UXDT 1KF6A 4HFHA 4AKHA 2Y48B 4UF0B 3X1DA 2XASB 3VKGA 1E2AA 3P4RA 1YQ3A 3CVRA 2LM9A 2WP9A 3ZEFB 5L47A 4YJ3E 4ZXLA 1N32T 1EZ3A 2BS3A 4ZI2D 2M6BA 1O3XA 3HR0A 5FNVE 3AA6B 4L5GA 3C98B 3FZMB 3L8RA 4O4LE 4AQFA 4DUZT 4XBFB 2ODVA 3TLUA 2BG9A 5LGNB 2DCFA 2WDQA 4H9QC 4U3CA 4V1Av 5F8PA 3ZJ1A 2K24A 2WS3A 2NTYA 3CX8B 4UV9B 5HEGA 3AA0B 4DV6T 4E7SA 3P4SA 4EYUA 2B1EA 3FHNA 3IBPA 4ZHQE 4B3MT 2VKOA 2UXCT 2SPCA 5HWXA 3ZYLA 5AQNB 4DBQA 3PURA 4IE7A 1VRBA 2BVLA 2XQYA 2VQFT 3PUGA 3HKEE 4MFRA 1UUSA 4OK0A 2NOXA 4O4JE 4NUVA 5AQVB 3T8OA 4CXYA 2E9XB 5L3DB 2JRKA 2LJLA 4DBRA 2MPKA 3F2EA 3FXDB 3T1YT 2KNDA 2WDVA 1QUUA 3CX7B 4PK5A 4NXMT 2LLYA 5LGUB 4YY3T 4GKKT 2QA7A 3KV9A 4WZXA 5FYMA 2LRLA 4LFCT 4DIDB 2GK9A 5AQGB 4NPPA 2W62A 2WMNA 2WZIA 3PUWF 1UCUA 3SFDA 5LMUT 4AI6A 3A5XA 5JDMA 2FJAA 3AAEB 4EV6A 4DR3T 1HFAA 2LE8A 5F5WA 4HEAA 4K0UA 4CQIA 3RIAA 5JR9B 2IIUA 3MA9A 4P0BA 3OKQA 4ILUA 2K3WA 5AQMB 2UU9T 4KUMB 4U7IA 4ZEYA 2E5VA 3PUAA 4U31A 5AQIB 4DR6T 2V7IA 4ZI7E 2LKGA 3QB5K 2V6YB 2W67A 1OEDA 5JDNA 2QRXA 3EDUA 5HWYA 1N34T 2YEVC 3N9OA 1J5WA 2QGSA 4ILAA 2CHOA 3WAJA 3I1AA 2K5BB 1Y01A 3H37A 2J47A 2HN2A 2L8KA 1WYCA 3AE1A 4UIGA 1MMNA 4MALA 3F57A 1UX4A 2VURA 2A2FX 3OBVE 3N9MA 4GK0E 4H9PC 3N2OA 1BR1A 4JI4T 1NWMX 2H89A 3QB5A 4KBMB 3RIFA 2KZ7B 2QYWA 3RH3A 4DV2T 4HFBA 4F6RC 2LSKA 4BJMA 5JTGA 2CMRA 4EIWA 1R8IA 4PJLA 1V9DA 3M3ZB 1D1CA 1MIVA 1ZKEA 2DLRA 5IWAT 5L3EB 2NWBA 2V6XA 1HX1B 4F8HA 4X20E 2KXPB 5IYZE 5C8YE 2IHR1 2BBJA 2VL8A 3SFEA 3U3IA 5AQHB 3NRXA 4WBNE 5H6RB 5EK2A 5EZYE 5LG3A 2Y8DA 4GOUA 1CHUA 3UTKA 2XSBA 2HHHT 1WR0A 2C5KT 3MJXA 3P4WA 3GMIA 4X5TA 4JI7T 1SUMB 1Z0PA 3H3AA 3T1HT 3TKLB 2BKOA 3AVSA 3H3MA 2ZM0A 4X62T 1KEYA 1LKXA 3LK3B 2UXNB 3N5LA 4BAYB 4EOZB 4YSYA 1HNXT 2CA5A 2WBLA 2WMOA 3LK42 3ZMUB 3QC9A 4I50E 3N2GE 5JVDE 5CFBA 3Q5WA 4Z91A 1OEDC 2V6YA 4GYSA 2W2UA 1YW0A 4LF7T 3MK7C 4IIJE 3UUMA 2LKHA 3P8CD 4GIWA 4CN4A 4HWFA 4UELA 2XAJB 4IDPA 3Q2MA 5FXXA 4U2YA 2CEAA 1LVFA 4IREA 4YFSA 3SOLA 4B6XA 2PG8A 2CXFA 3KVBA 3Q9DA 2A9UA 4H63H 3ANWB 5A1LA 3NVOA 5DJQC 4ILBA 4X1KE 2YK0A 4AQFC 3MXZA 5FY0A 4JI8T 4LF9T 3N9PA 1FJGT 2BZBA 1VOMA 2XQ9A 2MAWA 4ISSA 3RLFF 2J62A 3UUBA 2VK9A 3UT5E 5IUXA 5FVKA 3C64A 3A7MA 3AEFA 3P7IA 5KMGP 2K48A 3AAIA 4AKIA 3VKHA 2NW8A 3QNUA 4GYRA 2CCQA 3WI3A 2XQ7A 2V7LA 3VRBA 4TX5A 4YTNA 1G8XA 1WFDA 1YD8G 3CMLA 2JQQA 2WDRA 3K3QC 3KINB 4TV8E 3I0OA 2E2AA 3FZKB 3UU8A 3ABVA 4YJ2E 3ZC0A 3FBLA 3UUXB 3N9QA 2IAKA 1WCRA 2FJEA 3KBTA 1T72A 1MNEA 3CKDA 1IZNB 2LRKA 3GWHA 4UF0A 4Z90A 5HCJA 2D5UA 5LP6E 3P50A 4IE5A 3EI0A 1FEWA 4QX8B 5JRCB 4JBWF 4C91A 3UQ7A 3K8PC 4KHZF 5FXVA 1G73A 3PU3A 2VKJA 1J1JA 2ACZA 2WB5A 2YDQA 3VRAA 4ADZA 4ZS3A 3NBXX 4J2CA 3ZT5A 1ZEEA 3OPCA 1AJ3A 3FXEB 3RYFE 3ONJA 4DR4T 2D2SA 4KI0F 4LMKA 2X9XA 3CQXC 4TZ4C 2A72A 3I9YA 5JR9C 3AE7A 2RP4A 3KBUA 3P4QA 4OFZA 3CQGB 5L4EA 3PE0A 3KV6A 3RYCE 4N78D 5FKYA 3EABA 3M65A 2V7JA 2VVSA 2WWUA 3NKZA 5FXZA 1DU2A 3AEGA 2AXDS 2VASA 3PDYA 2V5CA 4FI5A 2M6IA 4YSZA 5CB4E 3BQKA 4KP3C 2AE9A 2WU5A 3UU5A 3D0TA 2MYSA 1HCIA 2KWIB 2XM1A 4P1NA 2CWYA 3OYZA 2ZM6T 4B3RT 2XAFB 5AQUB 4DNDA 4TWFA 5L4HA 5BMVE 3FZLB 4KMCA 5JDHA 1M7KA 4JYAT 1S94A 3PUZF 2K9AA 4YT0A 5AFUL 3PUVF 4EZHA 5JDQA 5AQQB 2HPLA 3TLTA 5FL0A 2EHOC 2NR4A 3ZJ2A 3J7Yq 3TLSA 1U4QA 3FB2A 3GN5A 3O1JA 5GONE 4DO0A 4O2AE 1T8BA 1MMGA 2WM9A 4DR1T 4EAHA 2JMKA 3DJBA 1IAPA 4I55E 4YHJA 3NWIA 1D0ZA 2NTXA 3UU3A 1W0BA 2CXDA 5HXEA 2L3LA 3E08A 3FZHB 3ANWA 4ILCA 3ZPOA 4DMVA 2LT3A 2Q9QC 2Q9QB 3C50A 2V7MA 3OVUA 3J9X1 4YHHT 3P4PA 2L9QA 5JDLA 2JPFA 4HWCA 3JADA 4UVCB 2ZM8A 4Z8XA 1T7SA 2PBIA 3PV0F 2I0MA 5L2LA 2W4XA 5KDMC 3PTRB 4PFOA 3C51A 4DVDA 2IUBA 5CJ5A 4LFAT 4LF5T 5HEHA 2XSAA 3DTOA 2XJ7A 4LF4T 3NZPA 2XQ4A 2XM2A 3CK6A 2FJDA 3RX6A 3JC6D 3MACA 3VR9A 3UUNA 4A56A 2CWOA 2JQHA 5LMNT 2KT9A 4B3TT 3I9WA 2XUEA 2DWGA 2MTQA 3OJAA 4XAXB 4I43B 1WRDA 3KV5A 4ZS2A 2UUAT 1QLBA 5J2TE 1LVKA 5ABFB 5HAXA 3AE6A 2LSIA 2XQ3A 3K3OA 3V5UA 5HXHA 2E9XC 3RIUA 4HGAA 2D9DA 1M62A 1J5ET 4IT4A 1IJ6A 1X79A 2CM0A 4A97A 5DQVA 3VU7H 3ZT7A 4CXWA 2VL0A 2X68A 4UVAB 2ZLYA 2YOEA 5FMNA 5HXRA 2BKPA 3ZN0B 4AKLA 4COFA 4HTEA 3ZC1A 4O8SA 4ZI2C 2PTFA 4GKJT 3AB3B 3RYIE 5HEOA 1JNRA 3RHWA 1D1BA 4I0UA 3RI5A 2R6GF 4HFEA 1SE7A 1SA0E 2WAUA 5ABFA 1Y64B 3ONLC 4OHFA 1UGOA 5CGMA 3GA8A 4DV4T 2BG9E 1NENA 4LFBT 1UURA 5AQRB 5L3CB 2KINB 4BA9A 2LSGA 3FBZA 4JEUB 4H63V 1FMVA 4PJJA 3VHLA 1WR6A 2E8IA 2FBWA 4U72A 1N33T 5CA0E 4PJMA 1BR2A 3QOFA 1HS7A 4O4IE 2X9YA 4DV3T 3UU4A 5JDFA 2ACXA 4AIUA 3F31A 2VWAA 5LG4A 1ZP0A 5LNKA 3AA7B 2DWKA 3UULA 3O9XA 2FUPA 2X67A 3ZCIA 5EK3A 4EGWA 5FY7A 3SRZA 2BS2A 4BJNA 3Q5DA 4PFPA 4JI1T 4K0KT 5LYJE 3ZKRA 1MIYA 2XPKA 2IW5B 2Q9QA 3ZSTA 4LF8T 2VVNA 1D0XA 3ONXA 4PJNA 1D1AA 2XAHB 4QX7B 1SHZC 4DMWA 1IBLT 4LF6T 2I59A 3MKDA 4WNKA
chains in the Genus database with same CATH topology
3LDQB 5AQRB 3FZFB 1UK5A 5AQGB 3FZMB 5AQKB 5AQFB 2D9DA 1M62A 3FZKB 3FZHB 5AQPB 4HWDA 3M3ZB 4HWIB 5AQOB 5AQSB 1HX1B 4HWFA 3A8YC 4HWCA 5AQLB 5AQMB 1T7SA 5AQTB 5AQNB 1I6ZA 5AQHB 5AQIB 5AQUB 3FZLB 5AQVB 1M7KA 4HWHA 1UGOA 5AQJB 5AQQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDQ B;  5AQR B;  3FZF B;  1UK5 A;  5AQG B;  3FZM B;  5AQK B;  5AQF B;  2D9D A;  1M62 A;  3FZK B;  3FZH B;  5AQP B;  4HWD A;  3M3Z B;  4HWI B;  5AQO B;  5AQS B;  1HX1 B;  4HWF A;  3A8Y C;  4HWC A;  5AQL B;  5AQM B;  1T7S A;  5AQT B;  5AQN B;  1I6Z A;  5AQH B;  5AQI B;  5AQU B;  3FZL B;  5AQV B;  1M7K A;  4HWH A;  1UGO A;  5AQJ B;  5AQQ B; 
#chains in the Genus database with same CATH topology
 4NIQ A;  2WQY A;  1FMW A;  4U33 A;  4AQG A;  3ZT6 A;  4UV8 B;  2CHN A;  2ZMA A;  1HTJ F;  2WZH A;  3OTO T;  4PAG A;  1UK5 A;  3O4X E;  4QXH B;  5ABG A;  4PK4 A;  2DL1 A;  4DV1 T;  2BVM A;  3C4W A;  4CZZ B;  5FY1 A;  2YDS A;  4QHO A;  2IDO B;  5LJN A;  3E22 E;  4IDQ A;  3AEC A;  1LRZ A;  3RGL A;  2Y6X A;  3ZYK A;  2C0S A;  4HWI B;  5J0Z A;  2N2N A;  1XZY A;  3RYH E;  4AKR B;  3EUH A;  1Z8U A;  4IE4 A;  1CUN A;  4NUU A;  3KDS E;  2H3R A;  4H9S E;  2BDE A;  2W0G A;  3ZCJ A;  4C90 A;  2OLT A;  3W15 B;  3PUS A;  4OYJ A;  4YSX A;  3AXJ A;  4IGU A;  4DV5 T;  2RPA A;  1WYB A;  5LB7 B;  5JRE A;  5JDG A;  2CLY B;  2DI4 A;  5LCY A;  3BQL A;  1NAF A;  4ZI3 D;  1T98 A;  2WSS V;  3AAA B;  2BG9 B;  3ZLI A;  5HYA A;  4B3S T;  4EB6 E;  4ZOL E;  3ETV A;  4X66 T;  1U5P A;  2VKD A;  2YIN A;  1ZV4 X;  3N9N A;  1MND A;  4JEH B;  3TLV A;  4L9I A;  4IDZ A;  5HEU A;  5JR9 A;  5J2U E;  1FIO A;  3L3P A;  3AVR A;  4P09 A;  3S4U A;  3AE3 A;  1L0V A;  4PNI A;  3RC3 A;  3ETU A;  1QSD A;  2H88 A;  5LBQ B;  4A98 A;  4KHP T;  4MBQ A;  4TWH A;  3RF1 A;  3Q5E A;  2ODU A;  2YU2 A;  4G63 A;  3E0Z A;  4H9O C;  3L39 A;  2LM2 A;  3EVY A;  3RPU A;  3HI2 A;  3AE8 A;  5ADX L;  1XWM A;  1I94 T;  1XDO A;  3JCF A;  3LK2 B;  4YLH A;  4TV9 E;  2A3D A;  4E7Z A;  2RA1 A;  5F3J A;  3JC6 C;  2M67 A;  1HX8 A;  4JUY A;  1HG5 A;  2NW7 A;  3WAK A;  2X0L B;  2YDR A;  2LOS A;  3NZQ A;  3DP7 A;  2CRB A;  3IA3 A;  4IDN A;  3CWZ B;  4PW8 A;  4UR9 A;  3BK9 A;  2HPJ A;  4DR7 T;  3ZMZ B;  3EAM A;  2D0U A;  2CPT A;  5J1G A;  3C4Z A;  1YXR A;  2XQA A;  2JJ9 A;  4ZZB A;  4CI2 B;  4IL4 A;  4U74 A;  1VCT A;  2FJB A;  2ZM2 A;  4X64 T;  1W9R A;  3EDV A;  3HA4 A;  2KMF A;  3FZF B;  3IF8 B;  3PUQ A;  3V5S A;  5ABE A;  4DV7 T;  5FL1 A;  5BR8 T;  3AA1 B;  1E7P A;  2XQ5 A;  3RC8 A;  3CQC B;  3AXJ B;  5ABH A;  3B5M A;  5LHI B;  4DUY T;  3LJC A;  4AXP A;  1B7T A;  2D0T A;  3AE4 A;  4L0R A;  3PJA J;  5FXW A;  4HKA A;  5LHH B;  1VCS A;  5AQO B;  3KVA A;  4I4T E;  3ZMS B;  1HNZ T;  1YKE B;  3VR8 A;  1HR0 T;  1XNR T;  4YTM A;  2DNX A;  2CXL A;  3CIR A;  2PFV A;  1D0Y A;  4PK6 A;  2IML A;  5M4Y A;  2C5I T;  2OA5 A;  3CPZ A;  4YTP A;  4HWH A;  4XZC A;  2MOZ A;  3IEE A;  4MHC A;  3MZK B;  2XAG B;  4TN7 B;  5C3J A;  2CE7 A;  5KX5 E;  4X1I E;  1MMD A;  3AE9 A;  1W09 A;  3LDQ B;  3RKO A;  5HEJ A;  4O2B E;  4M1P A;  2B76 A;  4QWN B;  5DAB A;  5LJM A;  4IST A;  1XMQ T;  4HFC A;  4JV5 T;  1HNW T;  3RQW A;  2XTL A;  2YN6 A;  2KWH A;  1IBM T;  5CA1 E;  2F4V T;  2XAQ B;  3UFG A;  5AQF B;  5IHY A;  3PJA A;  3R84 B;  3K3N A;  4EEB A;  2H7V C;  1OED E;  4P0A A;  2EHO B;  2UUB T;  4LML A;  2NW9 A;  1UX5 A;  4UVB B;  4TUY E;  5LBM A;  4H9N C;  1H7C A;  1YKH B;  4HFI A;  3QUJ A;  2LEH A;  2WWV A;  4EYY R;  3I0Q A;  1ZHC A;  4DV0 T;  5EK4 A;  5LXT E;  2X9W A;  3SWH A;  4CI1 B;  2N9D A;  3GN5 B;  2I6H A;  1GQE A;  4DR5 T;  3EHZ A;  3UFE A;  3L09 A;  4HN9 A;  3IHR A;  3RIU C;  2HH7 A;  2EHO A;  2OV9 A;  2V5D A;  2E9X D;  2W63 A;  4MLK A;  5HCM A;  2X51 A;  3TLW A;  3UQ4 A;  4AIS A;  3AEA A;  2QVA A;  4ZZC A;  2JQK A;  3B13 A;  3LBX B;  2J4G A;  2LOP A;  4DR2 T;  4AQY T;  2X66 A;  2UUC T;  1KNZ A;  1YQ4 A;  3UU6 A;  3HL6 A;  4QXC B;  2PJQ A;  4JI3 T;  2UXB T;  2XQ8 A;  4TWD A;  4IL9 A;  1KNP A;  2XY8 B;  3CX6 B;  3Q5X A;  1HG2 A;  2X0Y A;  2MBG A;  3ZMV B;  1XMO T;  4KX6 A;  5TAO A;  5HXC A;  3C4X A;  3RRC A;  2P9B A;  1OED B;  1IJ5 A;  1KK7 A;  2IC9 A;  3HKD E;  2E5L T;  4GK5 E;  3AE2 A;  2HN1 A;  2X9H A;  1BR0 A;  3NRY A;  1JNZ A;  4WYV A;  4JLE A;  3OYX A;  2G0U A;  4IDO A;  2KSR A;  3RQU A;  2Z6E A;  4FJO A;  4EZ4 A;  2V26 A;  2Q9Q D;  3AEB A;  3KFW X;  2VQE T;  1I6Z A;  3AEE A;  2JMH A;  2WU2 A;  4U2Z A;  2YU1 A;  3LSV A;  4HE8 A;  1MIW A;  2LHR A;  1MMA A;  4IE0 A;  4QKN A;  4LMJ A;  4ZI3 C;  3ZN1 B;  1KNR A;  3O1I A;  3LG7 A;  3O1H A;  3PUY F;  5AQJ B;  4WW0 A;  3SS1 A;  4NXN T;  2XHE B;  4A5X A;  2YKS A;  2ES0 A;  3LFM A;  3HKC E;  4JI0 T;  4ERR A;  1WLX A;  3N9L A;  4IE6 A;  4WBO A;  4UEM A;  4TNV A;  4UXN B;  5AQK B;  4QH1 A;  2LHN A;  2C5J A;  5JRC A;  5LOV E;  5FP3 A;  3B57 A;  2XZE A;  5LHG B;  1IBK T;  3PUX F;  3RKG A;  1XNQ T;  2V7K A;  4CI3 B;  1OWA A;  3PU8 A;  2WY2 A;  1BR4 A;  1X9B A;  5C2T A;  2WCA A;  2UXX B;  3A8Y C;  3LBX A;  5LA6 E;  2DHR A;  5AQT B;  2BKN A;  4OYK A;  5L3G B;  5DQW A;  2X0H A;  1US7 B;  2CLY C;  4JI2 T;  3K1S A;  5H6Q B;  2BS4 A;  3R6N A;  2LSJ A;  3ZMT B;  2CBI A;  3HKB E;  5L3F B;  2V1D B;  2KLQ A;  2LSY A;  2NP9 A;  2V8S V;  2VKH A;  3AE5 A;  4TNW A;  5ETW A;  3G06 A;  3RRW A;  1S35 A;  2BBH A;  3JAE A;  1OXZ A;  3U78 A;  3ESL A;  1ZOY A;  3ZYM A;  2W61 A;  2BG9 C;  4CXX A;  1N36 T;  1NEK A;  4H9R C;  4U7Y A;  4JI6 T;  4YXD A;  3KV4 A;  5FVL A;  1HF8 A;  2N1G A;  5HXS A;  4HFV A;  3N2K E;  5L3B B;  4QH5 A;  2EHO D;  2E9X A;  2JQ9 A;  3AED A;  4IHJ E;  3ZSS A;  5KXJ A;  3JAF A;  2JIW A;  4CN1 A;  3QK6 A;  4QXB B;  3BQI A;  2H7O A;  4EED A;  5AQP B;  5E0O A;  4X65 T;  4HFD A;  1W0A A;  4HWD A;  4ASK A;  2VB6 A;  4QH4 A;  4EXT A;  4JI5 T;  1E1H B;  5JQG E;  5AQS B;  2W00 A;  5JH7 E;  2IC6 A;  4G2A A;  2CBJ A;  2W66 A;  4X1Y E;  4Q25 A;  5AQL B;  4OX9 T;  1KFY A;  4CN6 A;  4ANJ A;  2J1D G;  4O4H E;  1XDP A;  4AKG A;  2XQ6 A;  5LGT B;  2UXD T;  1KF6 A;  4HFH A;  4AKH A;  2Y48 B;  4UF0 B;  3X1D A;  2XAS B;  3VKG A;  1E2A A;  3P4R A;  1YQ3 A;  3CVR A;  2LM9 A;  2WP9 A;  3ZEF B;  5L47 A;  4YJ3 E;  4ZXL A;  1N32 T;  1EZ3 A;  2BS3 A;  4ZI2 D;  2M6B A;  1O3X A;  3HR0 A;  5FNV E;  3AA6 B;  4L5G A;  3C98 B;  3FZM B;  3L8R A;  4O4L E;  4AQF A;  4DUZ T;  4XBF B;  2ODV A;  3TLU A;  2BG9 A;  5LGN B;  2DCF A;  2WDQ A;  4H9Q C;  4U3C A;  4V1A v;  5F8P A;  3ZJ1 A;  2K24 A;  2WS3 A;  2NTY A;  3CX8 B;  4UV9 B;  5HEG A;  3AA0 B;  4DV6 T;  4E7S A;  3P4S A;  4EYU A;  2B1E A;  3FHN A;  3IBP A;  4ZHQ E;  4B3M T;  2VKO A;  2UXC T;  2SPC A;  5HWX A;  3ZYL A;  5AQN B;  4DBQ A;  3PUR A;  4IE7 A;  1VRB A;  2BVL A;  2XQY A;  2VQF T;  3PUG A;  3HKE E;  4MFR A;  1UUS A;  4OK0 A;  2NOX A;  4O4J E;  4NUV A;  5AQV B;  3T8O A;  4CXY A;  2E9X B;  5L3D B;  2JRK A;  2LJL A;  4DBR A;  2MPK A;  3F2E A;  3FXD B;  3T1Y T;  2KND A;  2WDV A;  1QUU A;  3CX7 B;  4PK5 A;  4NXM T;  2LLY A;  5LGU B;  4YY3 T;  4GKK T;  2QA7 A;  3KV9 A;  4WZX A;  5FYM A;  2LRL A;  4LFC T;  4DID B;  2GK9 A;  5AQG B;  4NPP A;  2W62 A;  2WMN A;  2WZI A;  3PUW F;  1UCU A;  3SFD A;  5LMU T;  4AI6 A;  3A5X A;  5JDM A;  2FJA A;  3AAE B;  4EV6 A;  4DR3 T;  1HFA A;  2LE8 A;  5F5W A;  4HEA A;  4K0U A;  4CQI A;  3RIA A;  5JR9 B;  2IIU A;  3MA9 A;  4P0B A;  3OKQ A;  4ILU A;  2K3W A;  5AQM B;  2UU9 T;  4KUM B;  4U7I A;  4ZEY A;  2E5V A;  3PUA A;  4U31 A;  5AQI B;  4DR6 T;  2V7I A;  4ZI7 E;  2LKG A;  3QB5 K;  2V6Y B;  2W67 A;  1OED A;  5JDN A;  2QRX A;  3EDU A;  5HWY A;  1N34 T;  2YEV C;  3N9O A;  1J5W A;  2QGS A;  4ILA A;  2CHO A;  3WAJ A;  3I1A A;  2K5B B;  1Y01 A;  3H37 A;  2J47 A;  2HN2 A;  2L8K A;  1WYC A;  3AE1 A;  4UIG A;  1MMN A;  4MAL A;  3F57 A;  1UX4 A;  2VUR A;  2A2F X;  3OBV E;  3N9M A;  4GK0 E;  4H9P C;  3N2O A;  1BR1 A;  4JI4 T;  1NWM X;  2H89 A;  3QB5 A;  4KBM B;  3RIF A;  2KZ7 B;  2QYW A;  3RH3 A;  4DV2 T;  4HFB A;  4F6R C;  2LSK A;  4BJM A;  5JTG A;  2CMR A;  4EIW A;  1R8I A;  4PJL A;  1V9D A;  3M3Z B;  1D1C A;  1MIV A;  1ZKE A;  2DLR A;  5IWA T;  5L3E B;  2NWB A;  2V6X A;  1HX1 B;  4F8H A;  4X20 E;  2KXP B;  5IYZ E;  5C8Y E;  2IHR 1;  2BBJ A;  2VL8 A;  3SFE A;  3U3I A;  5AQH B;  3NRX A;  4WBN E;  5H6R B;  5EK2 A;  5EZY E;  5LG3 A;  2Y8D A;  4GOU A;  1CHU A;  3UTK A;  2XSB A;  2HHH T;  1WR0 A;  2C5K T;  3MJX A;  3P4W A;  3GMI A;  4X5T A;  4JI7 T;  1SUM B;  1Z0P A;  3H3A A;  3T1H T;  3TKL B;  2BKO A;  3AVS A;  3H3M A;  2ZM0 A;  4X62 T;  1KEY A;  1LKX A;  3LK3 B;  2UXN B;  3N5L A;  4BAY B;  4EOZ B;  4YSY A;  1HNX T;  2CA5 A;  2WBL A;  2WMO A;  3LK4 2;  3ZMU B;  3QC9 A;  4I50 E;  3N2G E;  5JVD E;  5CFB A;  3Q5W A;  4Z91 A;  1OED C;  2V6Y A;  4GYS A;  2W2U A;  1YW0 A;  4LF7 T;  3MK7 C;  4IIJ E;  3UUM A;  2LKH A;  3P8C D;  4GIW A;  4CN4 A;  4HWF A;  4UEL A;  2XAJ B;  4IDP A;  3Q2M A;  5FXX A;  4U2Y A;  2CEA A;  1LVF A;  4IRE A;  4YFS A;  3SOL A;  4B6X A;  2PG8 A;  2CXF A;  3KVB A;  3Q9D A;  2A9U A;  4H63 H;  3ANW B;  5A1L A;  3NVO A;  5DJQ C;  4ILB A;  4X1K E;  2YK0 A;  4AQF C;  3MXZ A;  5FY0 A;  4JI8 T;  4LF9 T;  3N9P A;  1FJG T;  2BZB A;  1VOM A;  2XQ9 A;  2MAW A;  4ISS A;  3RLF F;  2J62 A;  3UUB A;  2VK9 A;  3UT5 E;  5IUX A;  5FVK A;  3C64 A;  3A7M A;  3AEF A;  3P7I A;  5KMG P;  2K48 A;  3AAI A;  4AKI A;  3VKH A;  2NW8 A;  3QNU A;  4GYR A;  2CCQ A;  3WI3 A;  2XQ7 A;  2V7L A;  3VRB A;  4TX5 A;  4YTN A;  1G8X A;  1WFD A;  1YD8 G;  3CML A;  2JQQ A;  2WDR A;  3K3Q C;  3KIN B;  4TV8 E;  3I0O A;  2E2A A;  3FZK B;  3UU8 A;  3ABV A;  4YJ2 E;  3ZC0 A;  3FBL A;  3UUX B;  3N9Q A;  2IAK A;  1WCR A;  2FJE A;  3KBT A;  1T72 A;  1MNE A;  3CKD A;  1IZN B;  2LRK A;  3GWH A;  4UF0 A;  4Z90 A;  5HCJ A;  2D5U A;  5LP6 E;  3P50 A;  4IE5 A;  3EI0 A;  1FEW A;  4QX8 B;  5JRC B;  4JBW F;  4C91 A;  3UQ7 A;  3K8P C;  4KHZ F;  5FXV A;  1G73 A;  3PU3 A;  2VKJ A;  1J1J A;  2ACZ A;  2WB5 A;  2YDQ A;  3VRA A;  4ADZ A;  4ZS3 A;  3NBX X;  4J2C A;  3ZT5 A;  1ZEE A;  3OPC A;  1AJ3 A;  3FXE B;  3RYF E;  3ONJ A;  4DR4 T;  2D2S A;  4KI0 F;  4LMK A;  2X9X A;  3CQX C;  4TZ4 C;  2A72 A;  3I9Y A;  5JR9 C;  3AE7 A;  2RP4 A;  3KBU A;  3P4Q A;  4OFZ A;  3CQG B;  5L4E A;  3PE0 A;  3KV6 A;  3RYC E;  4N78 D;  5FKY A;  3EAB A;  3M65 A;  2V7J A;  2VVS A;  2WWU A;  3NKZ A;  5FXZ A;  1DU2 A;  3AEG A;  2AXD S;  2VAS A;  3PDY A;  2V5C A;  4FI5 A;  2M6I A;  4YSZ A;  5CB4 E;  3BQK A;  4KP3 C;  2AE9 A;  2WU5 A;  3UU5 A;  3D0T A;  2MYS A;  1HCI A;  2KWI B;  2XM1 A;  4P1N A;  2CWY A;  3OYZ A;  2ZM6 T;  4B3R T;  2XAF B;  5AQU B;  4DND A;  4TWF A;  5L4H A;  5BMV E;  3FZL B;  4KMC A;  5JDH A;  1M7K A;  4JYA T;  1S94 A;  3PUZ F;  2K9A A;  4YT0 A;  5AFU L;  3PUV F;  4EZH A;  5JDQ A;  5AQQ B;  2HPL A;  3TLT A;  5FL0 A;  2EHO C;  2NR4 A;  3ZJ2 A;  3J7Y q;  3TLS A;  1U4Q A;  3FB2 A;  3GN5 A;  3O1J A;  5GON E;  4DO0 A;  4O2A E;  1T8B A;  1MMG A;  2WM9 A;  4DR1 T;  4EAH A;  2JMK A;  3DJB A;  1IAP A;  4I55 E;  4YHJ A;  3NWI A;  1D0Z A;  2NTX A;  3UU3 A;  1W0B A;  2CXD A;  5HXE A;  2L3L A;  3E08 A;  3FZH B;  3ANW A;  4ILC A;  3ZPO A;  4DMV A;  2LT3 A;  2Q9Q C;  2Q9Q B;  3C50 A;  2V7M A;  3OVU A;  3J9X 1;  4YHH T;  3P4P A;  2L9Q A;  5JDL A;  2JPF A;  4HWC A;  3JAD A;  4UVC B;  2ZM8 A;  4Z8X A;  1T7S A;  2PBI A;  3PV0 F;  2I0M A;  5L2L A;  2W4X A;  5KDM C;  3PTR B;  4PFO A;  3C51 A;  4DVD A;  2IUB A;  5CJ5 A;  4LFA T;  4LF5 T;  5HEH A;  2XSA A;  3DTO A;  2XJ7 A;  4LF4 T;  3NZP A;  2XQ4 A;  2XM2 A;  3CK6 A;  2FJD A;  3RX6 A;  3JC6 D;  3MAC A;  3VR9 A;  3UUN A;  4A56 A;  2CWO A;  2JQH A;  5LMN T;  2KT9 A;  4B3T T;  3I9W A;  2XUE A;  2DWG A;  2MTQ A;  3OJA A;  4XAX B;  4I43 B;  1WRD A;  3KV5 A;  4ZS2 A;  2UUA T;  1QLB A;  5J2T E;  1LVK A;  5ABF B;  5HAX A;  3AE6 A;  2LSI A;  2XQ3 A;  3K3O A;  3V5U A;  5HXH A;  2E9X C;  3RIU A;  4HGA A;  2D9D A;  1M62 A;  1J5E T;  4IT4 A;  1IJ6 A;  1X79 A;  2CM0 A;  4A97 A;  5DQV A;  3VU7 H;  3ZT7 A;  4CXW A;  2VL0 A;  2X68 A;  4UVA B;  2ZLY A;  2YOE A;  5FMN A;  5HXR A;  2BKP A;  3ZN0 B;  4AKL A;  4COF A;  4HTE A;  3ZC1 A;  4O8S A;  4ZI2 C;  2PTF A;  4GKJ T;  3AB3 B;  3RYI E;  5HEO A;  1JNR A;  3RHW A;  1D1B A;  4I0U A;  3RI5 A;  2R6G F;  4HFE A;  1SE7 A;  1SA0 E;  2WAU A;  5ABF A;  1Y64 B;  3ONL C;  4OHF A;  1UGO A;  5CGM A;  3GA8 A;  4DV4 T;  2BG9 E;  1NEN A;  4LFB T;  1UUR A;  5AQR B;  5L3C B;  2KIN B;  4BA9 A;  2LSG A;  3FBZ A;  4JEU B;  4H63 V;  1FMV A;  4PJJ A;  3VHL A;  1WR6 A;  2E8I A;  2FBW A;  4U72 A;  1N33 T;  5CA0 E;  4PJM A;  1BR2 A;  3QOF A;  1HS7 A;  4O4I E;  2X9Y A;  4DV3 T;  3UU4 A;  5JDF A;  2ACX A;  4AIU A;  3F31 A;  2VWA A;  5LG4 A;  1ZP0 A;  5LNK A;  3AA7 B;  2DWK A;  3UUL A;  3O9X A;  2FUP A;  2X67 A;  3ZCI A;  5EK3 A;  4EGW A;  5FY7 A;  3SRZ A;  2BS2 A;  4BJN A;  3Q5D A;  4PFP A;  4JI1 T;  4K0K T;  5LYJ E;  3ZKR A;  1MIY A;  2XPK A;  2IW5 B;  2Q9Q A;  3ZST A;  4LF8 T;  2VVN A;  1D0X A;  3ONX A;  4PJN A;  1D1A A;  2XAH B;  4QX7 B;  1SHZ C;  4DMW A;  1IBL T;  4LF6 T;  2I59 A;  3MKD A;  4WNK A; 
#chains in the Genus database with same CATH homology
 3LDQ B;  5AQR B;  3FZF B;  1UK5 A;  5AQG B;  3FZM B;  5AQK B;  5AQF B;  2D9D A;  1M62 A;  3FZK B;  3FZH B;  5AQP B;  4HWD A;  3M3Z B;  4HWI B;  5AQO B;  5AQS B;  1HX1 B;  4HWF A;  3A8Y C;  4HWC A;  5AQL B;  5AQM B;  1T7S A;  5AQT B;  5AQN B;  1I6Z A;  5AQH B;  5AQI B;  5AQU B;  3FZL B;  5AQV B;  1M7K A;  4HWH A;  1UGO A;  5AQJ B;  5AQQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...