1T7SA

Structural genomics of caenorhabditis elegans: structure of bag-1 protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
129
structure length
129
Chain Sequence
DKIIVMGGKNALVDDAGFKMLMQYEKHNLSNLQKAYDLNLRDVADLERGFLEKPKQVEMGKKLEKKVKYFNEEAERHLETLDGMNIITETTPENQAKRNREKRKTLVNGIQTLLNQNDALLRRLQEYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords BAG-1 cochaperone
publication title Structural genomics of Caenorhabditis elegans: structure of the BAG domain.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 42
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1t7sA00
3FZFB 5AQOB 1UK5A 5AQRB 5AQKB 5AQNB 4HWDA 5AQQB 5AQMB 3FZKB 5AQTB 5AQUB 1UGOA 5AQSB 5AQFB 1M62A 4HWIB 3FZMB 1T7SA 5AQHB 3M3ZB 4HWCA 5AQJB 5AQVB 5AQLB 2D9DA 1I6ZA 1HX1B 5AQGB 5AQPB 3LDQB 4HWFA 3A8YC 4HWHA 3FZLB 3FZHB 5AQIB 1M7KA
chains in the Genus database with same CATH superfamily
1YQ3A 5C3JA 2PFVA 4YY3T 4LMJA 5FVKA 4U3CA 4IDOA 3ZYKA 4HWCA 3SRZA 4N78D 1N33T 3J9X1 4UVBB 5DABA 3RC3A 1E2AA 3B5MA 4H63H 1LRZA 4ZS3A 4AKGA 2VASA 1ZP0A 4ZHQE 2V5DA 2CWOA 5ABGA 1XMQT 1J5WA 2JMHA 4IE0A 2DNXA 4IL4A 4ASKA 5LHIB 4HFEA 3ETUA 2VWAA 2DHRA 2ZLYA 4YHJA 4QHOA 2IIUA 2LOSA 2KT9A 3CKDA 1OEDE 2I6HA 1HNXT 5AQUB 1MMAA 2ACXA 4KI0F 4TWHA 4L0RA 2UXCT 2KZ7B 2HPLA 1WYBA 2X0LB 1HS7A 3AEBA 2LM9A 3CWZB 5AQMB 2BS4A 4PK5A 4KUMB 2WWUA 3AE1A 3R6NA 3VKHA 2WDVA 2BBJA 2WQYA 3L8RA 2H7VC 3PUYF 4P1NA 3UFEA 3FZHB 2D0UA 1LVFA 2XQ3A 3RX6A 2IC9A 2YINA 5AQHB 3WAKA 4EB6E 2WDRA 2CM0A 3KV5A 3RI5A 2WM9A 5ABFA 3EDVA 2BS2A 2L8KA 3N2OA 2W00A 1E7PA 2B1EA 5LA6E 3UT5E 4DR3T 2YK0A 3AXJA 4U33A 4AKLA 1R8IA 1T72A 2UU9T 2X9YA 2N9DA 3AA1B 4ADZA 4BA9A 3FZMB 1SA0E 2IDOB 4QWNB 5LGNB 3OBVE 1BR0A 4AISA 2D9DA 1WFDA 3P50A 4QXBB 3LG7A 5ABFB 2CE7A 5CJ5A 1IJ5A 3AXJB 2E8IA 2NW8A 4B3MT 3N9PA 3OYXA 2W63A 4P09A 4DR7T 4PJMA 4YT0A 2XSBA 5EK4A 2HPJA 4YTPA 4F8HA 2J1DG 3ZPOA 1XNRT 3IHRA 1ZEEA 2XAJB 4GK0E 1BR1A 3I9YA 4JI2T 3KVAA 4TUYE 1VOMA 4PFPA 1OXZA 3LDQB 5DJQC 5LMUT 4CI1B 1X9BA 4EEDA 4O2AE 3UU4A 2VL0A 5HXSA 3NBXX 4KBMB 3L3PA 5BMVE 4PK6A 2FUPA 3PUVF 4EXTA 4UV9B 3Q5DA 1D1BA 3E22E 3KBUA 4HFBA 4QX8B 2NP9A 3UUXB 5LXTE 3NVOA 4QXCB 3E0ZA 3QK6A 5HEUA 1VRBA 4GYSA 4DV2T 3JAFA 3RPUA 3AEEA 2V5CA 4LF6T 5C2TA 4PJNA 5HWXA 1NAFA 3AECA 4X65T 2WZHA 2D0TA 4NIQA 2RA1A 3PURA 1XWMA 4UV8B 3P4QA 2XTLA 3RRWA 4AQFA 5FP3A 4CN6A 4ILUA 3HKDE 2XQAA 4CI2B 1OWAA 3UFGA 3AEDA 3KBTA 4AIUA 2H89A 4F6RC 1OEDC 2VQET 1X79A 4HWIB 1LVKA 3KDSE 2A3DA 4HFDA 5HXCA 5JREA 2QVAA 1YQ4A 3LK42 3Q5XA 3EI0A 1IBLT 1UGOA 4ISTA 3LJCA 2DCFA 1MMDA 3ZJ2A 2IHR1 1T98A 4MLKA 3AAAB 3RQWA 3LK2B 2VURA 4WZXA 3ZYLA 2X9XA 2DLRA 3CQGB 2ZM0A 1HNWT 4DO0A 2KSRA 1N34T 3EDUA 4DR2T 2V6YA 3P4SA 2XUEA 2YEVC 1NENA 2JPFA 1BR2A 4KHZF 2UUBT 4DMVA 2CLYC 2W0GA 2ES0A 3O1JA 1W0AA 4IIJE 4AQGA 2I0MA 3WAJA 2CPTA 3TLWA 4XZCA 2V6YB 2K24A 4JEHB 4ZZCA 4HN9A 5EK3A 3ZN1B 5FMNA 1DU2A 2K48A 4U7YA 2NW9A 5JR9C 4ZI3D 2V26A 5HXRA 4IT4A 3IF8B 3FXDB 3IA3A 4DV7T 3PJAJ 3RH3A 2IMLA 4DR5T 2DWKA 5FNVE 3FZLB 3ANWA 2UXDT 2JIWA 5HAXA 3RYCE 4O2BE 2XAQB 4DV6T 1M62A 4H9PC 4X20E 4JBWF 3L09A 3ZCIA 3LBXA 4A5XA 4O4HE 1WRDA 4WYVA 3PU3A 4TV9E 1D0XA 3ANWB 3P4RA 3AB3B 2BVMA 3GA8A 2V1DB 4JLEA 2C5IT 4P0AA 3ZSTA 3EVYA 3RIFA 1VCSA 3LBXB 2QYWA 4WNKA 4X5TA 5CA0E 5HEGA 2LSJA 3ZMVB 3N9MA 3PUXF 3KINB 3C51A 1WR0A 2BKPA 5LHGB 3AE3A 3CPZA 5J1GA 2C5JA 2K3WA 2IAKA 3CX8B 5L4HA 2A9UA 5KDMC 4G2AA 2P9BA 2ZM2A 2CLYB 4L9IA 2W2UA 3OJAA 3P4WA 4LF5T 2CXLA 2WU2A 5ETWA 4ANJA 1AJ3A 2UUAT 3CX6B 3K3NA 1MNEA 3QOFA 4DV5T 2G0UA 3I0QA 4Z90A 1J5ET 4CQIA 5L3DB 4JI4T 2KWHA 2CHNA 1UURA 3TKLB 3VR8A 2EHOD 4HTEA 5LP6E 3T1HT 3ONXA 3RC8A 2V7IA 5A1LA 3I0OA 2OA5A 1NWMX 2ZM8A 4EYUA 4AKHA 2HN2A 4DNDA 4DMWA 5FXWA 4MHCA 5L3CB 4YSZA 3RQUA 5GONE 2WS3A 1MMGA 2W62A 4Z91A 3KFWX 2JJ9A 2ACZA 5FYMA 5LHHB 3P4PA 3RRCA 3RYIE 3BQLA 1HCIA 2CEAA 4JUYA 2KNDA 1L0VA 1H7CA 3ZMTB 3MKDA 4AKRB 2HN1A 2UXBT 4X66T 3CK6A 3V5UA 2E5LT 2LKHA 2N2NA 5AQFB 3QUJA 4EIWA 2W66A 3AE9A 3N9NA 4CXWA 3JAEA 4ERRA 2YOEA 3MZKB 3ZT6A 4ZI3C 4FJOA 4NXNT 2YDQA 2J4GA 2SPCA 4EYYR 2L3LA 2VKHA 4O4JE 4JI7T 4LF7T 5J0ZA 5AQJB 3UULA 2BS3A 1ZHCA 4P0BA 2YN6A 1MIWA 3AE8A 3FXEB 2CA5A 3O4XE 4MALA 2BG9A 5AQKB 3RF1A 2BBHA 2MTQA 5FL0A 4DUYT 4H63V 3HI2A 4A98A 3PJAA 2DL1A 2LSGA 3H37A 3ZMUB 1JNZA 4YLHA 3CMLA 3A8YC 3GMIA 3HA4A 3IEEA 3M65A 4I4TE 5FVLA 1W0BA 4JI5T 1XDPA 4HFVA 4TWDA 3NRXA 3MA9A 2BG9B 2OLTA 1ZKEA 2XQ7A 4TNVA 4K0KT 2QGSA 4YFSA 3R84B 5TAOA 4IE4A 2V7LA 2XAGB 4ZXLA 5CA1E 2ODVA 2LE8A 1QUUA 3VKGA 2VK9A 4LMLA 3UU3A 2H3RA 5L47A 3ZMZB 5FKYA 5IUXA 4B3ST 4QX7B 4HFIA 4AQFC 5LB7B 4BAYB 4CN1A 1IZNB 4LFBT 1QSDA 3BK9A 5L3GB 2CBIA 2PTFA 1HFAA 3U78A 3B13A 4IDNA 2XQ5A 4KX6A 2CRBA 3ZKRA 2MYSA 3NZPA 2V8SV 4TV8E 3ZC0A 1XNQT 4NUUA 4CI3B 4X62T 4DV3T 2M67A 4AI6A 4UF0A 1US7B 3N2GE 2NWBA 4PJJA 5HYAA 5JQGE 1QLBA 4NUVA 3M3ZB 4ILBA 4DR4T 1Y64B 2J47A 2EHOC 3QB5K 1UX5A 4HGAA 4UF0B 5JDQA 3JC6D 2KLQA 2JQHA 3N9LA 4BJNA 5IWAT 1NEKA 3L39A 4K0UA 2LHRA 3OKQA 3C50A 2XY8B 3SFEA 2F4VT 3C4XA 4PNIA 2XPKA 1D0ZA 3HR0A 1FIOA 1KF6A 5JH7E 4JI3T 4ILCA 5M4YA 2L9QA 3RYFE 2FJBA 4AKIA 3GN5A 2CXDA 3PUAA 5IYZE 2W4XA 3D0TA 5LMNT 2E5VA 5FY0A 2NTYA 5F3JA 1T7SA 1FMVA 2V6XA 3OYZA 2BG9E 4JEUB 1GQEA 3ZJ1A 3MXZA 1ZOYA 1WR6A 3CQXC 2WMNA 4TNWA 4E7ZA 4ISSA 3GN5B 4LFCT 3VR9A 3AVRA 3K3OA 4AXPA 4YXDA 4TWFA 5JVDE 2D5UA 3ZN0B 4KP3C 5AQPB 1U4QA 4WBNE 4EZ4A 1HG2A 2Y48B 3PDYA 4ZI2D 4KHPT 2C5KT 2BKNA 2YKSA 3AEGA 2EHOA 4UVAB 5DQWA 3B57A 1CHUA 4CXYA 4PAGA 5KX5E 2PBIA 2VB6A 2XM2A 5CB4E 4YTNA 2V7MA 5FL1A 3FBLA 2EHOB 3BQKA 4O4IE 2R6GF 2UXXB 3BQIA 4GK5E 5LCYA 4CN4A 1ZV4X 2XJ7A 2LOPA 4JI8T 4TZ4C 4I0UA 2LSYA 2VVNA 2LRKA 3PUWF 2BKOA 3I9WA 1BR4A 4IE7A 4GKKT 2LKGA 2XASB 2PG8A 3PU8A 2A72A 3PE0A 1WLXA 2RP4A 3Q5EA 5JDNA 1HNZT 2FJEA 2J62A 5JDLA 2B76A 4LFAT 2GK9A 5FXXA 4I50E 3DJBA 5EK2A 3Q9DA 1D1AA 3DP7A 4H9QC 3UU6A 2ZM6T 2Y6XA 3P7IA 5J2UE 2Q9QD 3ZYMA 5AQQB 3VHLA 4JYAT 1KNRA 1MIVA 3ZT5A 1CUNA 1N32T 2KXPB 1HF8A 5ABHA 2XQ9A 5CGMA 1Y01A 2XAHB 4X1KE 3C4ZA 1FEWA 1I94T 3O1IA 2VKDA 1VCTA 3JC6C 1YKHB 4OFZA 4X1YE 5EZYE 2JQQA 5AFUL 4Q25A 2X66A 4ZZBA 3SFDA 5FY1A 2VKOA 5LGTB 1KEYA 2WB5A 2NW7A 3QC9A 2MOZA 1Z8UA 5JTGA 3ZT7A 5AQOB 2A2FX 3K1SA 2ODUA 2WCAA 4U74A 3OTOT 4ZI7E 1IJ6A 4DBQA 4MFRA 3UQ4A 3QB5A 5L4EA 3HL6A 2WP9A 3U3IA 3ABVA 4IL9A 3MK7C 3AA6B 4IREA 3GWHA 2WDQA 3CVRA 4H9OC 2DWGA 1XZYA 3CIRA 2W61A 2MBGA 2QRXA 3MJXA 3RKGA 1FMWA 5HEOA 4OX9T 2BG9C 3UU8A 4GKJT 1W09A 4EGWA 4YHHT 3G06A 5J2TE 5JRCA 4A97A 1J1JA 3X1DA 4WBOA 4L5GA 1D0YA 2WU5A 1HR0T 5F8PA 4G63A 2LLYA 1B7TA 3QNUA 1G8XA 4MBQA 4ZI2C 2K9AA 4UELA 2XSAA 3SWHA 5LGUB 2X9HA 4EV6A 3K8PC 3PUGA 5JRCB 5LBMA 2PJQA 3RIAA 4B6XA 3JCFA 5C8YE 2M6BA 4X64T 2UUCT 4JI6T 3F57A 4BJMA 5L3BB 4IE5A 2E9XD 3KV6A 1HTJF 3H3MA 3P8CD 5JDFA 2WWVA 3RGLA 3TLTA 1XMOT 1S94A 2HHHT 1EZ3A 4UR9A 5HCJA 5HEHA 2IUBA 3EUHA 5KMGP 1SHZC 4KMCA 5AQIB 4C90A 4LMKA 3ZC1A 4OYJA 1KK7A 4U72A 4HKAA 2WAUA 2YU2A 1Z0PA 1V9DA 1D1CA 3MACA 4DV0T 5CFBA 2MPKA 3UUMA 4IGUA 2CBJA 1JNRA 4IHJE 1UCUA 4PK4A 4QH4A 2JMKA 4YJ2E 2MAWA 2LRLA 5IHYA 1M7KA 3AA7B 4U31A 5HWYA 2FJDA 4DV1T 2BVLA 2WZIA 3LK3B 3IBPA 5JDHA 2X0HA 2Z6EA 4UXNB 3FHNA 2Q9QC 3RIUC 4GYRA 4DVDA 1YD8G 3RYHE 2JRKA 2NTXA 3O9XA 3OPCA 2LSIA 3T8OA 4AQYT 2X0YA 5E0OA 1U5PA 4ZS2A 4HWFA 1WCRA 3UUBA 1HG5A 3EABA 3ONJA 3DTOA 4V1Av 4LF8T 3AE5A 3RHWA 3N9QA 3I1AA 2QA7A 2IW5B 2AXDS 3C98B 2C0SA 2LT3A 3LFMA 4H9NC 1LKXA 2BDEA 3PV0F 2K5BB 5KXJA 4CZZB 2FJAA 4ILAA 3ZLIA 2WY2A 2X9WA 1O3XA 3FZFB 5ADXL 4GIWA 3OVUA 3EHZA 1KNZA 4QXHB 2W67A 2VVSA 2X51A 3ZSSA 2LSKA 2H88A 5HEJA 3UU5A 4WW0A 2XZEA 5AQRB 2NOXA 3O1HA 4M1PA 1YW0A 3NRYA 5AQTB 2LEHA 2Q9QA 3RIUA 1KFYA 5LJNA 5LNKA 4B3TT 5LYJE 3F2EA 3JADA 2CCQA 5LG4A 4GOUA 4U7IA 2KINB 4JI0T 5ABEA 2CHOA 4COFA 4EZHA 4OYKA 2X67A 1UX4A 1W9RA 4DR6T 2Q9QB 2CXFA 5L3FB 2WBLA 1YKEB 5HXHA 3V5SA 3ZMSB 3LSVA 2E9XC 3RLFF 2N1GA 1N36T 4OK0A 3N9OA 3ONLC 4DBRA 3HKBE 2LJLA 4HFHA 2RPAA 2VL8A 2XAFB 4PFOA 4DV4T 5JDGA 4H9RC 4Z8XA 4YSYA 1IBMT 3SS1A 3H3AA 1S35A 2XQ8A 3AE4A 4H9SE 2CMRA 4JI1T 3VU7H 1G73A 2VKJA 3TLSA 4I43B 3C64A 4DR1T 2CWYA 2KWIB 3AVSA 4HWHA 4LF4T 3F31A 4ZOLE 3C4WA 4E7SA 2UXNB 2JQKA 3J7Yq 4B3RT 3RKOA 5HCMA 3S4UA 4TX5A 3KVBA 1SUMB 1YXRA 5H6QB 2YU1A 2M6IA 4UVCB 4PJLA 2WMOA 3AE2A 3TLUA 2BZBA 2ZMAA 3W15B 4IDPA 2D2SA 3NWIA 1UUSA 2AE9A 3CX7B 3FBZA 5LOVE 3UTKA 1MIYA 4HFCA 2XM1A 1MMNA 4HWDA 4JV5T 3FZKB 3PUZF 3AE7A 3VRAA 3AAEB 2V7KA 2E9XA 2JQ9A 2XHEB 2I59A 4TN7B 2IC6A 2XQYA 3E08A 4LF9T 1SE7A 2KMFA 5BR8T 4YSXA 3PTRB 1KNPA 4U2YA 3K3QC 5HXEA 4DUZT 3NKZA 1T8BA 3AE6A 3A7MA 4X1IE 3Q5WA 1XDOA 2H7OA 5AQVB 5FXVA 1IBKT 2E9XB 3AEFA 1HX1B 1OEDA 4U2ZA 4IDZA 3EAMA 4J2CA 4UIGA 4ZEYA 1WYCA 5LJMA 2LM2A 2LHNA 3KV9A 4QKNA 4EOZB 4A56A 2YDSA 5FY7A 1E1HB 3PUQA 3AEAA 1MNDA 2NR4A 4EEBA 5LG3A 3ETVA 2YDRA 4QH1A 1OEDB 3Q2MA 2XQ6A 1IAPA 4DIDB 4QH5A 5LBQB 4UEMA 3UQ7A 4PW8A 2OV9A 5AQSB 2FBWA 4O4LE 3WI3A 5H6RB 2DI4A 2X68A 4O8SA 5AQLB 4NPPA 3VRBA 4YTMA 3HKCE 4FI5A 2VQFT 5L3EB 5DQVA 3AA0B 2WSSV 3N5LA 1FJGT 2Y8DA 5L2LA 4XBFB 2HH7A 2XQ4A 3N2KE 3AAIA 3TLVA 3ESLA 1HX8A 3A5XA 3ZCJA 1UK5A 5AQNB 4OHFA 4IE6A 3ZEFB 5JR9A 3HKEE 5JDMA 4EAHA 5F5WA 5AQGB 4YJ3E 3FB2A 3NZQA 3SOLA 2V7JA 4C91A 3KV4A 2E2AA 3PUSA 3UUNA 4HEAA 4CXXA 3T1YT 5FXZA 4I55E 5JR9B 1I6ZA 4IDQA 4NXMT 4XAXB 3CQCB 4HE8A
chains in the Genus database with same CATH topology
3FZFB 5AQOB 1UK5A 5AQRB 5AQKB 5AQNB 4HWDA 5AQQB 5AQMB 3FZKB 5AQTB 5AQUB 1UGOA 5AQSB 5AQFB 1M62A 4HWIB 3FZMB 1T7SA 5AQHB 3M3ZB 4HWCA 5AQJB 5AQVB 5AQLB 2D9DA 1I6ZA 1HX1B 5AQGB 5AQPB 3LDQB 4HWFA 3A8YC 4HWHA 3FZLB 3FZHB 5AQIB 1M7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZF B;  5AQO B;  1UK5 A;  5AQR B;  5AQK B;  5AQN B;  4HWD A;  5AQQ B;  5AQM B;  3FZK B;  5AQT B;  5AQU B;  1UGO A;  5AQS B;  5AQF B;  1M62 A;  4HWI B;  3FZM B;  1T7S A;  5AQH B;  3M3Z B;  4HWC A;  5AQJ B;  5AQV B;  5AQL B;  2D9D A;  1I6Z A;  1HX1 B;  5AQG B;  5AQP B;  3LDQ B;  4HWF A;  3A8Y C;  4HWH A;  3FZL B;  3FZH B;  5AQI B;  1M7K A; 
#chains in the Genus database with same CATH topology
 1YQ3 A;  5C3J A;  2PFV A;  4YY3 T;  4LMJ A;  5FVK A;  4U3C A;  4IDO A;  3ZYK A;  4HWC A;  3SRZ A;  4N78 D;  1N33 T;  3J9X 1;  4UVB B;  5DAB A;  3RC3 A;  1E2A A;  3B5M A;  4H63 H;  1LRZ A;  4ZS3 A;  4AKG A;  2VAS A;  1ZP0 A;  4ZHQ E;  2V5D A;  2CWO A;  5ABG A;  1XMQ T;  1J5W A;  2JMH A;  4IE0 A;  2DNX A;  4IL4 A;  4ASK A;  5LHI B;  4HFE A;  3ETU A;  2VWA A;  2DHR A;  2ZLY A;  4YHJ A;  4QHO A;  2IIU A;  2LOS A;  2KT9 A;  3CKD A;  1OED E;  2I6H A;  1HNX T;  5AQU B;  1MMA A;  2ACX A;  4KI0 F;  4TWH A;  4L0R A;  2UXC T;  2KZ7 B;  2HPL A;  1WYB A;  2X0L B;  1HS7 A;  3AEB A;  2LM9 A;  3CWZ B;  5AQM B;  2BS4 A;  4PK5 A;  4KUM B;  2WWU A;  3AE1 A;  3R6N A;  3VKH A;  2WDV A;  2BBJ A;  2WQY A;  3L8R A;  2H7V C;  3PUY F;  4P1N A;  3UFE A;  3FZH B;  2D0U A;  1LVF A;  2XQ3 A;  3RX6 A;  2IC9 A;  2YIN A;  5AQH B;  3WAK A;  4EB6 E;  2WDR A;  2CM0 A;  3KV5 A;  3RI5 A;  2WM9 A;  5ABF A;  3EDV A;  2BS2 A;  2L8K A;  3N2O A;  2W00 A;  1E7P A;  2B1E A;  5LA6 E;  3UT5 E;  4DR3 T;  2YK0 A;  3AXJ A;  4U33 A;  4AKL A;  1R8I A;  1T72 A;  2UU9 T;  2X9Y A;  2N9D A;  3AA1 B;  4ADZ A;  4BA9 A;  3FZM B;  1SA0 E;  2IDO B;  4QWN B;  5LGN B;  3OBV E;  1BR0 A;  4AIS A;  2D9D A;  1WFD A;  3P50 A;  4QXB B;  3LG7 A;  5ABF B;  2CE7 A;  5CJ5 A;  1IJ5 A;  3AXJ B;  2E8I A;  2NW8 A;  4B3M T;  3N9P A;  3OYX A;  2W63 A;  4P09 A;  4DR7 T;  4PJM A;  4YT0 A;  2XSB A;  5EK4 A;  2HPJ A;  4YTP A;  4F8H A;  2J1D G;  3ZPO A;  1XNR T;  3IHR A;  1ZEE A;  2XAJ B;  4GK0 E;  1BR1 A;  3I9Y A;  4JI2 T;  3KVA A;  4TUY E;  1VOM A;  4PFP A;  1OXZ A;  3LDQ B;  5DJQ C;  5LMU T;  4CI1 B;  1X9B A;  4EED A;  4O2A E;  3UU4 A;  2VL0 A;  5HXS A;  3NBX X;  4KBM B;  3L3P A;  5BMV E;  4PK6 A;  2FUP A;  3PUV F;  4EXT A;  4UV9 B;  3Q5D A;  1D1B A;  3E22 E;  3KBU A;  4HFB A;  4QX8 B;  2NP9 A;  3UUX B;  5LXT E;  3NVO A;  4QXC B;  3E0Z A;  3QK6 A;  5HEU A;  1VRB A;  4GYS A;  4DV2 T;  3JAF A;  3RPU A;  3AEE A;  2V5C A;  4LF6 T;  5C2T A;  4PJN A;  5HWX A;  1NAF A;  3AEC A;  4X65 T;  2WZH A;  2D0T A;  4NIQ A;  2RA1 A;  3PUR A;  1XWM A;  4UV8 B;  3P4Q A;  2XTL A;  3RRW A;  4AQF A;  5FP3 A;  4CN6 A;  4ILU A;  3HKD E;  2XQA A;  4CI2 B;  1OWA A;  3UFG A;  3AED A;  3KBT A;  4AIU A;  2H89 A;  4F6R C;  1OED C;  2VQE T;  1X79 A;  4HWI B;  1LVK A;  3KDS E;  2A3D A;  4HFD A;  5HXC A;  5JRE A;  2QVA A;  1YQ4 A;  3LK4 2;  3Q5X A;  3EI0 A;  1IBL T;  1UGO A;  4IST A;  3LJC A;  2DCF A;  1MMD A;  3ZJ2 A;  2IHR 1;  1T98 A;  4MLK A;  3AAA B;  3RQW A;  3LK2 B;  2VUR A;  4WZX A;  3ZYL A;  2X9X A;  2DLR A;  3CQG B;  2ZM0 A;  1HNW T;  4DO0 A;  2KSR A;  1N34 T;  3EDU A;  4DR2 T;  2V6Y A;  3P4S A;  2XUE A;  2YEV C;  1NEN A;  2JPF A;  1BR2 A;  4KHZ F;  2UUB T;  4DMV A;  2CLY C;  2W0G A;  2ES0 A;  3O1J A;  1W0A A;  4IIJ E;  4AQG A;  2I0M A;  3WAJ A;  2CPT A;  3TLW A;  4XZC A;  2V6Y B;  2K24 A;  4JEH B;  4ZZC A;  4HN9 A;  5EK3 A;  3ZN1 B;  5FMN A;  1DU2 A;  2K48 A;  4U7Y A;  2NW9 A;  5JR9 C;  4ZI3 D;  2V26 A;  5HXR A;  4IT4 A;  3IF8 B;  3FXD B;  3IA3 A;  4DV7 T;  3PJA J;  3RH3 A;  2IML A;  4DR5 T;  2DWK A;  5FNV E;  3FZL B;  3ANW A;  2UXD T;  2JIW A;  5HAX A;  3RYC E;  4O2B E;  2XAQ B;  4DV6 T;  1M62 A;  4H9P C;  4X20 E;  4JBW F;  3L09 A;  3ZCI A;  3LBX A;  4A5X A;  4O4H E;  1WRD A;  4WYV A;  3PU3 A;  4TV9 E;  1D0X A;  3ANW B;  3P4R A;  3AB3 B;  2BVM A;  3GA8 A;  2V1D B;  4JLE A;  2C5I T;  4P0A A;  3ZST A;  3EVY A;  3RIF A;  1VCS A;  3LBX B;  2QYW A;  4WNK A;  4X5T A;  5CA0 E;  5HEG A;  2LSJ A;  3ZMV B;  3N9M A;  3PUX F;  3KIN B;  3C51 A;  1WR0 A;  2BKP A;  5LHG B;  3AE3 A;  3CPZ A;  5J1G A;  2C5J A;  2K3W A;  2IAK A;  3CX8 B;  5L4H A;  2A9U A;  5KDM C;  4G2A A;  2P9B A;  2ZM2 A;  2CLY B;  4L9I A;  2W2U A;  3OJA A;  3P4W A;  4LF5 T;  2CXL A;  2WU2 A;  5ETW A;  4ANJ A;  1AJ3 A;  2UUA T;  3CX6 B;  3K3N A;  1MNE A;  3QOF A;  4DV5 T;  2G0U A;  3I0Q A;  4Z90 A;  1J5E T;  4CQI A;  5L3D B;  4JI4 T;  2KWH A;  2CHN A;  1UUR A;  3TKL B;  3VR8 A;  2EHO D;  4HTE A;  5LP6 E;  3T1H T;  3ONX A;  3RC8 A;  2V7I A;  5A1L A;  3I0O A;  2OA5 A;  1NWM X;  2ZM8 A;  4EYU A;  4AKH A;  2HN2 A;  4DND A;  4DMW A;  5FXW A;  4MHC A;  5L3C B;  4YSZ A;  3RQU A;  5GON E;  2WS3 A;  1MMG A;  2W62 A;  4Z91 A;  3KFW X;  2JJ9 A;  2ACZ A;  5FYM A;  5LHH B;  3P4P A;  3RRC A;  3RYI E;  3BQL A;  1HCI A;  2CEA A;  4JUY A;  2KND A;  1L0V A;  1H7C A;  3ZMT B;  3MKD A;  4AKR B;  2HN1 A;  2UXB T;  4X66 T;  3CK6 A;  3V5U A;  2E5L T;  2LKH A;  2N2N A;  5AQF B;  3QUJ A;  4EIW A;  2W66 A;  3AE9 A;  3N9N A;  4CXW A;  3JAE A;  4ERR A;  2YOE A;  3MZK B;  3ZT6 A;  4ZI3 C;  4FJO A;  4NXN T;  2YDQ A;  2J4G A;  2SPC A;  4EYY R;  2L3L A;  2VKH A;  4O4J E;  4JI7 T;  4LF7 T;  5J0Z A;  5AQJ B;  3UUL A;  2BS3 A;  1ZHC A;  4P0B A;  2YN6 A;  1MIW A;  3AE8 A;  3FXE B;  2CA5 A;  3O4X E;  4MAL A;  2BG9 A;  5AQK B;  3RF1 A;  2BBH A;  2MTQ A;  5FL0 A;  4DUY T;  4H63 V;  3HI2 A;  4A98 A;  3PJA A;  2DL1 A;  2LSG A;  3H37 A;  3ZMU B;  1JNZ A;  4YLH A;  3CML A;  3A8Y C;  3GMI A;  3HA4 A;  3IEE A;  3M65 A;  4I4T E;  5FVL A;  1W0B A;  4JI5 T;  1XDP A;  4HFV A;  4TWD A;  3NRX A;  3MA9 A;  2BG9 B;  2OLT A;  1ZKE A;  2XQ7 A;  4TNV A;  4K0K T;  2QGS A;  4YFS A;  3R84 B;  5TAO A;  4IE4 A;  2V7L A;  2XAG B;  4ZXL A;  5CA1 E;  2ODV A;  2LE8 A;  1QUU A;  3VKG A;  2VK9 A;  4LML A;  3UU3 A;  2H3R A;  5L47 A;  3ZMZ B;  5FKY A;  5IUX A;  4B3S T;  4QX7 B;  4HFI A;  4AQF C;  5LB7 B;  4BAY B;  4CN1 A;  1IZN B;  4LFB T;  1QSD A;  3BK9 A;  5L3G B;  2CBI A;  2PTF A;  1HFA A;  3U78 A;  3B13 A;  4IDN A;  2XQ5 A;  4KX6 A;  2CRB A;  3ZKR A;  2MYS A;  3NZP A;  2V8S V;  4TV8 E;  3ZC0 A;  1XNQ T;  4NUU A;  4CI3 B;  4X62 T;  4DV3 T;  2M67 A;  4AI6 A;  4UF0 A;  1US7 B;  3N2G E;  2NWB A;  4PJJ A;  5HYA A;  5JQG E;  1QLB A;  4NUV A;  3M3Z B;  4ILB A;  4DR4 T;  1Y64 B;  2J47 A;  2EHO C;  3QB5 K;  1UX5 A;  4HGA A;  4UF0 B;  5JDQ A;  3JC6 D;  2KLQ A;  2JQH A;  3N9L A;  4BJN A;  5IWA T;  1NEK A;  3L39 A;  4K0U A;  2LHR A;  3OKQ A;  3C50 A;  2XY8 B;  3SFE A;  2F4V T;  3C4X A;  4PNI A;  2XPK A;  1D0Z A;  3HR0 A;  1FIO A;  1KF6 A;  5JH7 E;  4JI3 T;  4ILC A;  5M4Y A;  2L9Q A;  3RYF E;  2FJB A;  4AKI A;  3GN5 A;  2CXD A;  3PUA A;  5IYZ E;  2W4X A;  3D0T A;  5LMN T;  2E5V A;  5FY0 A;  2NTY A;  5F3J A;  1T7S A;  1FMV A;  2V6X A;  3OYZ A;  2BG9 E;  4JEU B;  1GQE A;  3ZJ1 A;  3MXZ A;  1ZOY A;  1WR6 A;  3CQX C;  2WMN A;  4TNW A;  4E7Z A;  4ISS A;  3GN5 B;  4LFC T;  3VR9 A;  3AVR A;  3K3O A;  4AXP A;  4YXD A;  4TWF A;  5JVD E;  2D5U A;  3ZN0 B;  4KP3 C;  5AQP B;  1U4Q A;  4WBN E;  4EZ4 A;  1HG2 A;  2Y48 B;  3PDY A;  4ZI2 D;  4KHP T;  2C5K T;  2BKN A;  2YKS A;  3AEG A;  2EHO A;  4UVA B;  5DQW A;  3B57 A;  1CHU A;  4CXY A;  4PAG A;  5KX5 E;  2PBI A;  2VB6 A;  2XM2 A;  5CB4 E;  4YTN A;  2V7M A;  5FL1 A;  3FBL A;  2EHO B;  3BQK A;  4O4I E;  2R6G F;  2UXX B;  3BQI A;  4GK5 E;  5LCY A;  4CN4 A;  1ZV4 X;  2XJ7 A;  2LOP A;  4JI8 T;  4TZ4 C;  4I0U A;  2LSY A;  2VVN A;  2LRK A;  3PUW F;  2BKO A;  3I9W A;  1BR4 A;  4IE7 A;  4GKK T;  2LKG A;  2XAS B;  2PG8 A;  3PU8 A;  2A72 A;  3PE0 A;  1WLX A;  2RP4 A;  3Q5E A;  5JDN A;  1HNZ T;  2FJE A;  2J62 A;  5JDL A;  2B76 A;  4LFA T;  2GK9 A;  5FXX A;  4I50 E;  3DJB A;  5EK2 A;  3Q9D A;  1D1A A;  3DP7 A;  4H9Q C;  3UU6 A;  2ZM6 T;  2Y6X A;  3P7I A;  5J2U E;  2Q9Q D;  3ZYM A;  5AQQ B;  3VHL A;  4JYA T;  1KNR A;  1MIV A;  3ZT5 A;  1CUN A;  1N32 T;  2KXP B;  1HF8 A;  5ABH A;  2XQ9 A;  5CGM A;  1Y01 A;  2XAH B;  4X1K E;  3C4Z A;  1FEW A;  1I94 T;  3O1I A;  2VKD A;  1VCT A;  3JC6 C;  1YKH B;  4OFZ A;  4X1Y E;  5EZY E;  2JQQ A;  5AFU L;  4Q25 A;  2X66 A;  4ZZB A;  3SFD A;  5FY1 A;  2VKO A;  5LGT B;  1KEY A;  2WB5 A;  2NW7 A;  3QC9 A;  2MOZ A;  1Z8U A;  5JTG A;  3ZT7 A;  5AQO B;  2A2F X;  3K1S A;  2ODU A;  2WCA A;  4U74 A;  3OTO T;  4ZI7 E;  1IJ6 A;  4DBQ A;  4MFR A;  3UQ4 A;  3QB5 A;  5L4E A;  3HL6 A;  2WP9 A;  3U3I A;  3ABV A;  4IL9 A;  3MK7 C;  3AA6 B;  4IRE A;  3GWH A;  2WDQ A;  3CVR A;  4H9O C;  2DWG A;  1XZY A;  3CIR A;  2W61 A;  2MBG A;  2QRX A;  3MJX A;  3RKG A;  1FMW A;  5HEO A;  4OX9 T;  2BG9 C;  3UU8 A;  4GKJ T;  1W09 A;  4EGW A;  4YHH T;  3G06 A;  5J2T E;  5JRC A;  4A97 A;  1J1J A;  3X1D A;  4WBO A;  4L5G A;  1D0Y A;  2WU5 A;  1HR0 T;  5F8P A;  4G63 A;  2LLY A;  1B7T A;  3QNU A;  1G8X A;  4MBQ A;  4ZI2 C;  2K9A A;  4UEL A;  2XSA A;  3SWH A;  5LGU B;  2X9H A;  4EV6 A;  3K8P C;  3PUG A;  5JRC B;  5LBM A;  2PJQ A;  3RIA A;  4B6X A;  3JCF A;  5C8Y E;  2M6B A;  4X64 T;  2UUC T;  4JI6 T;  3F57 A;  4BJM A;  5L3B B;  4IE5 A;  2E9X D;  3KV6 A;  1HTJ F;  3H3M A;  3P8C D;  5JDF A;  2WWV A;  3RGL A;  3TLT A;  1XMO T;  1S94 A;  2HHH T;  1EZ3 A;  4UR9 A;  5HCJ A;  5HEH A;  2IUB A;  3EUH A;  5KMG P;  1SHZ C;  4KMC A;  5AQI B;  4C90 A;  4LMK A;  3ZC1 A;  4OYJ A;  1KK7 A;  4U72 A;  4HKA A;  2WAU A;  2YU2 A;  1Z0P A;  1V9D A;  1D1C A;  3MAC A;  4DV0 T;  5CFB A;  2MPK A;  3UUM A;  4IGU A;  2CBJ A;  1JNR A;  4IHJ E;  1UCU A;  4PK4 A;  4QH4 A;  2JMK A;  4YJ2 E;  2MAW A;  2LRL A;  5IHY A;  1M7K A;  3AA7 B;  4U31 A;  5HWY A;  2FJD A;  4DV1 T;  2BVL A;  2WZI A;  3LK3 B;  3IBP A;  5JDH A;  2X0H A;  2Z6E A;  4UXN B;  3FHN A;  2Q9Q C;  3RIU C;  4GYR A;  4DVD A;  1YD8 G;  3RYH E;  2JRK A;  2NTX A;  3O9X A;  3OPC A;  2LSI A;  3T8O A;  4AQY T;  2X0Y A;  5E0O A;  1U5P A;  4ZS2 A;  4HWF A;  1WCR A;  3UUB A;  1HG5 A;  3EAB A;  3ONJ A;  3DTO A;  4V1A v;  4LF8 T;  3AE5 A;  3RHW A;  3N9Q A;  3I1A A;  2QA7 A;  2IW5 B;  2AXD S;  3C98 B;  2C0S A;  2LT3 A;  3LFM A;  4H9N C;  1LKX A;  2BDE A;  3PV0 F;  2K5B B;  5KXJ A;  4CZZ B;  2FJA A;  4ILA A;  3ZLI A;  2WY2 A;  2X9W A;  1O3X A;  3FZF B;  5ADX L;  4GIW A;  3OVU A;  3EHZ A;  1KNZ A;  4QXH B;  2W67 A;  2VVS A;  2X51 A;  3ZSS A;  2LSK A;  2H88 A;  5HEJ A;  3UU5 A;  4WW0 A;  2XZE A;  5AQR B;  2NOX A;  3O1H A;  4M1P A;  1YW0 A;  3NRY A;  5AQT B;  2LEH A;  2Q9Q A;  3RIU A;  1KFY A;  5LJN A;  5LNK A;  4B3T T;  5LYJ E;  3F2E A;  3JAD A;  2CCQ A;  5LG4 A;  4GOU A;  4U7I A;  2KIN B;  4JI0 T;  5ABE A;  2CHO A;  4COF A;  4EZH A;  4OYK A;  2X67 A;  1UX4 A;  1W9R A;  4DR6 T;  2Q9Q B;  2CXF A;  5L3F B;  2WBL A;  1YKE B;  5HXH A;  3V5S A;  3ZMS B;  3LSV A;  2E9X C;  3RLF F;  2N1G A;  1N36 T;  4OK0 A;  3N9O A;  3ONL C;  4DBR A;  3HKB E;  2LJL A;  4HFH A;  2RPA A;  2VL8 A;  2XAF B;  4PFO A;  4DV4 T;  5JDG A;  4H9R C;  4Z8X A;  4YSY A;  1IBM T;  3SS1 A;  3H3A A;  1S35 A;  2XQ8 A;  3AE4 A;  4H9S E;  2CMR A;  4JI1 T;  3VU7 H;  1G73 A;  2VKJ A;  3TLS A;  4I43 B;  3C64 A;  4DR1 T;  2CWY A;  2KWI B;  3AVS A;  4HWH A;  4LF4 T;  3F31 A;  4ZOL E;  3C4W A;  4E7S A;  2UXN B;  2JQK A;  3J7Y q;  4B3R T;  3RKO A;  5HCM A;  3S4U A;  4TX5 A;  3KVB A;  1SUM B;  1YXR A;  5H6Q B;  2YU1 A;  2M6I A;  4UVC B;  4PJL A;  2WMO A;  3AE2 A;  3TLU A;  2BZB A;  2ZMA A;  3W15 B;  4IDP A;  2D2S A;  3NWI A;  1UUS A;  2AE9 A;  3CX7 B;  3FBZ A;  5LOV E;  3UTK A;  1MIY A;  4HFC A;  2XM1 A;  1MMN A;  4HWD A;  4JV5 T;  3FZK B;  3PUZ F;  3AE7 A;  3VRA A;  3AAE B;  2V7K A;  2E9X A;  2JQ9 A;  2XHE B;  2I59 A;  4TN7 B;  2IC6 A;  2XQY A;  3E08 A;  4LF9 T;  1SE7 A;  2KMF A;  5BR8 T;  4YSX A;  3PTR B;  1KNP A;  4U2Y A;  3K3Q C;  5HXE A;  4DUZ T;  3NKZ A;  1T8B A;  3AE6 A;  3A7M A;  4X1I E;  3Q5W A;  1XDO A;  2H7O A;  5AQV B;  5FXV A;  1IBK T;  2E9X B;  3AEF A;  1HX1 B;  1OED A;  4U2Z A;  4IDZ A;  3EAM A;  4J2C A;  4UIG A;  4ZEY A;  1WYC A;  5LJM A;  2LM2 A;  2LHN A;  3KV9 A;  4QKN A;  4EOZ B;  4A56 A;  2YDS A;  5FY7 A;  1E1H B;  3PUQ A;  3AEA A;  1MND A;  2NR4 A;  4EEB A;  5LG3 A;  3ETV A;  2YDR A;  4QH1 A;  1OED B;  3Q2M A;  2XQ6 A;  1IAP A;  4DID B;  4QH5 A;  5LBQ B;  4UEM A;  3UQ7 A;  4PW8 A;  2OV9 A;  5AQS B;  2FBW A;  4O4L E;  3WI3 A;  5H6R B;  2DI4 A;  2X68 A;  4O8S A;  5AQL B;  4NPP A;  3VRB A;  4YTM A;  3HKC E;  4FI5 A;  2VQF T;  5L3E B;  5DQV A;  3AA0 B;  2WSS V;  3N5L A;  1FJG T;  2Y8D A;  5L2L A;  4XBF B;  2HH7 A;  2XQ4 A;  3N2K E;  3AAI A;  3TLV A;  3ESL A;  1HX8 A;  3A5X A;  3ZCJ A;  1UK5 A;  5AQN B;  4OHF A;  4IE6 A;  3ZEF B;  5JR9 A;  3HKE E;  5JDM A;  4EAH A;  5F5W A;  5AQG B;  4YJ3 E;  3FB2 A;  3NZQ A;  3SOL A;  2V7J A;  4C91 A;  3KV4 A;  2E2A A;  3PUS A;  3UUN A;  4HEA A;  4CXX A;  3T1Y T;  5FXZ A;  4I55 E;  5JR9 B;  1I6Z A;  4IDQ A;  4NXM T;  4XAX B;  3CQC B;  4HE8 A; 
#chains in the Genus database with same CATH homology
 3FZF B;  5AQO B;  1UK5 A;  5AQR B;  5AQK B;  5AQN B;  4HWD A;  5AQQ B;  5AQM B;  3FZK B;  5AQT B;  5AQU B;  1UGO A;  5AQS B;  5AQF B;  1M62 A;  4HWI B;  3FZM B;  1T7S A;  5AQH B;  3M3Z B;  4HWC A;  5AQJ B;  5AQV B;  5AQL B;  2D9D A;  1I6Z A;  1HX1 B;  5AQG B;  5AQP B;  3LDQ B;  4HWF A;  3A8Y C;  4HWH A;  3FZL B;  3FZH B;  5AQI B;  1M7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...