2MOZA

Structure of the membrane protein merf, a bacterial mercury transporter, improved by the inclusion of chemical shift anisotropy constraints
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'MKDPKTLLRVSIIGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASSTPKFNGVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
publication title Structure of the membrane protein MerF, a bacterial mercury transporter, improved by the inclusion of chemical shift anisotropy constraints.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Membrane protein
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2mozA00
2M67A 2MOZA
chains in the Genus database with same CATH superfamily
2CWOA 4UVAB 4OFZA 5CB4E 1BR2A 4V1Av 2E9XA 2YDQA 2IUBA 2MYSA 4JI1T 5JDLA 5LGNB 3V5SA 3A8YC 4DR2T 4TNVA 2XAQB 3O9XA 5JR9C 3O1HA 5JH7E 3BK9A 3ZT5A 2WU5A 2X68A 4JUYA 3PUYF 2KXPB 2HH7A 2CXLA 1OWAA 2DHRA 4B3TT 4O2AE 2X66A 2XQ5A 4TN7B 4HKAA 4AQYT 3BQIA 2Y48B 2YN6A 4TV9E 4JI8T 3P50A 3J9X1 1N32T 4N78D 3KVAA 5HYAA 3RGLA 3H3AA 4B6XA 5A1LA 2WWVA 1IBKT 4ILCA 4HGAA 5LYJE 1S35A 1EZ3A 3OYZA 3PJAJ 2LSIA 2PFVA 4JI2T 5LG3A 3PDYA 4ILBA 1UURA 3TLTA 4QH1A 4U31A 3NWIA 2QVAA 4EXTA 2VKOA 3ZMZB 3K3QC 4L9IA 3TLSA 3RI5A 2EHOD 4YSXA 4XZCA 3EVYA 2JQQA 3PUGA 3OPCA 3HKEE 5CJ5A 4ISTA 3AE5A 2I59A 2V26A 4GK5E 4O4LE 2KMFA 5AQMB 3PUZF 5EZYE 2LSYA 5ETWA 1OEDE 3N5LA 4F8HA 5J2UE 2XAHB 4HWDA 3Q5DA 4AISA 2D9DA 4OYKA 2WS3A 4U7IA 3Q5XA 2WDRA 1JNZA 5L3GB 1T7SA 4GK0E 2WZIA 5JDNA 3JAEA 2YOEA 1MMDA 3AE8A 5AQNB 3LK2B 1ZHCA 5AQPB 2NTXA 3UQ4A 3ANWA 1OEDB 3FBLA 2JRKA 5FXXA 2ZM0A 2OLTA 2N2NA 4AQGA 5LJNA 5FXZA 4TUYE 2Q9QD 3C4XA 4P09A 1UUSA 2LSKA 1HNWT 2IW5B 5ABFB 5ABEA 3C50A 3PJAA 2NW7A 3Q5EA 4ZS2A 1VCTA 1LKXA 5C3JA 3KDSE 2H88A 1LVFA 4WYVA 3EDUA 1M62A 3FB2A 3CVRA 4PJJA 5HXHA 5HXEA 2FBWA 3ABVA 3ZYLA 4J2CA 4E7ZA 3FZKB 4BAYB 2LRLA 1ZP0A 2N9DA 5L3EB 2ES0A 4KHPT 3ZEFB 4AQFA 2YKSA 3UUBA 4A97A 1MMAA 4LF6T 2ZM2A 2XQ6A 5LA6E 4NUVA 3RYCE 2W00A 3AA1B 2YDRA 4X1IE 2WB5A 3H3MA 5LP6E 1J5WA 2BG9C 4MALA 3IBPA 4H9RC 3ZLIA 3MK7C 2QRXA 4AKGA 3RIAA 5JR9B 4PW8A 3KV6A 5KMGP 2CLYC 2LSGA 1G73A 2V7KA 2VL8A 5L47A 4B3ST 1HNXT 2XZEA 2WDVA 2LT3A 5E0OA 2RA1A 2BS2A 3NRYA 2IC9A 3RHWA 3UUXB 4A98A 5LBMA 5AQOB 2BS3A 4CQIA 4YT0A 1I6ZA 4U2ZA 2K9AA 3QC9A 4EZ4A 1NENA 2XQYA 5FY7A 3RPUA 2A3DA 1FMWA 4ILAA 4P1NA 2FJEA 5LHGB 1IBLT 5F3JA 3JC6D 4HEAA 3ONLC 2YK0A 2LEHA 2FJBA 2LJLA 4YTPA 2BKNA 2V6YA 1FEWA 1E1HB 2BG9A 3ZPOA 4WNKA 5HCMA 1XZYA 3BQLA 2J4GA 1HR0T 2G0UA 4X62T 4JI5T 3FBZA 3QB5A 5KXJA 4PNIA 4LF7T 4ZI2D 4LF4T 4KBMB 2EHOB 3AE3A 3O1JA 5DQVA 3RYHE 3I0OA 5CFBA 4UIGA 4CXYA 4EGWA 2HPLA 3UU6A 2DNXA 5LGTB 3VKHA 2PG8A 2QYWA 2IMLA 3QNUA 4DV4T 1XNRT 4UELA 5LOVE 2W66A 1YQ4A 5AQGB 5EK4A 4FJOA 2XPKA 4WBOA 3SFDA 5L3FB 2LKHA 5FY0A 1BR1A 4Q25A 2RP4A 2WMOA 4X65T 3UTKA 4Z8XA 5IHYA 3NKZA 2H7VC 4G2AA 2E9XC 3RYFE 2ODUA 2CXFA 4DUYT 5FXWA 4YLHA 3K3OA 2XQ7A 3OJAA 3OYXA 5JVDE 1W9RA 3HKDE 2C5JA 2XUEA 3Q9DA 2BDEA 4DNDA 1OXZA 4LMLA 2L8KA 3AVSA 4DV2T 2NW9A 2BVMA 4X20E 3RLFF 3FHNA 4HN9A 2F4VT 2LOSA 5EK2A 2LRKA 2VK9A 3P7IA 2HN1A 4YHJA 5HXCA 4OYJA 2WDQA 3AEGA 3HI2A 2BBJA 1HF8A 3ZYKA 2Q9QB 2K24A 3PUWF 1ZV4X 3VRBA 1WRDA 1XDPA 5FL0A 5HCJA 3ZCJA 2L3LA 5KX5E 3QB5K 2JQ9A 1YKEB 2WMNA 3C98B 5JDGA 2D2SA 2MPKA 3HR0A 4X1YE 4JEUB 3QK6A 1ZEEA 5AQSB 2BS4A 2KWHA 2VQFT 1VCSA 2ODVA 3B57A 2LSJA 5HXRA 4UF0B 1N33T 3AVRA 3VR8A 1M7KA 2CCQA 2VQET 3N2OA 2XM1A 2ACXA 3FXEB 4KMCA 5AQQB 2RPAA 3CIRA 5L3CB 4H63H 3SFEA 3AEAA 1GQEA 3VKGA 3GA8A 1HG2A 3A5XA 3UU3A 1WR6A 3I1AA 3ZMSB 5IYZE 3OVUA 3TKLB 2V5DA 1WYCA 1U4QA 3PUVF 1VRBA 2X0LB 3RQUA 2Y8DA 4DMWA 2IAKA 3MXZA 5HEGA 2V7IA 4X66T 4HFCA 1NWMX 3P4PA 2WSSV 3LFMA 3T1HT 5FVLA 1E7PA 4XBFB 3GMIA 3ZYMA 4TWFA 4YY3T 5AQUB 4DV1T 5HXSA 5FP3A 1BR0A 3MA9A 1WLXA 4H9PC 2XQ9A 1NEKA 4AIUA 2BBHA 1I94T 2HHHT 4CN6A 4P0AA 3NRXA 3MZKB 2NR4A 1G8XA 2NP9A 3PURA 3OKQA 3RRWA 3P4SA 1XWMA 2H89A 4I55E 3R84B 2KINB 3AXJA 2XJ7A 2A2FX 2WWUA 5HEJA 2UXXB 5J1GA 3NVOA 2XTLA 4B3MT 4COFA 5JDQA 2CEAA 2KT9A 3FZLB 3P4WA 4NIQA 3PUXF 2CHOA 3N9PA 4G63A 2VVNA 3TLWA 3AEFA 3RIUA 3ZN1B 1ZOYA 2XY8B 2NTYA 1D1BA 3AB3B 3RX6A 3LBXA 4HWHA 4IDOA 2LOPA 3GN5A 3VHLA 3SS1A 4AQFC 2UUAT 3KV9A 4DMVA 4AKLA 4ZHQE 5F5WA 5L2LA 3AEDA 2C5IT 5FL1A 3MKDA 1LRZA 3ZSTA 2CM0A 4O4IE 4EIWA 2V1DB 3EUHA 2E9XB 4ZXLA 4ZEYA 5LNKA 5AQKB 1H7CA 4ZI7E 4JI6T 2GK9A 1JNRA 3RKOA 3DTOA 3U78A 2M67A 4DV0T 3CX7B 4U2YA 1D0XA 2V7MA 3PU8A 1QUUA 1QLBA 3LJCA 1WCRA 4M1PA 1MNDA 2WAUA 4EB6E 4BJMA 3UFGA 3N9NA 4OHFA 2KZ7B 4EOZB 3E0ZA 3ZN0B 1X79A 2MBGA 1VOMA 1KF6A 2IC6A 5FNVE 2KSRA 3IA3A 2K48A 4ADZA 2X51A 4TX5A 4ZS3A 2X67A 4KP3C 2UUCT 5FXVA 2KWIB 4HTEA 5JRCA 2MTQA 1T98A 1AJ3A 2EHOA 2YU2A 4TWHA 2X9YA 1WR0A 3A7MA 4HE8A 3S4UA 1UK5A 2N1GA 1KNRA 3NZQA 3AA0B 2B1EA 2KNDA 2WP9A 3N9QA 3ETVA 5J0ZA 1UX4A 4H9SE 1MMNA 4EYYR 3FZFB 5ADXL 2W61A 2FJAA 1U5PA 2XQ4A 3LG7A 2DWGA 1CHUA 1V9DA 4EYUA 4B3RT 5LJMA 2XM2A 4IE6A 1HTJF 3RQWA 5DQWA 2VKJA 5BR8T 3AE9A 4YJ3E 2UXBT 5LMUT 1US7B 5AQTB 5AQLB 3AE1A 4IE7A 2XASB 3B13A 4PJLA 1FIOA 2YDSA 5LG4A 3AA6B 3IEEA 1Z8UA 4LF8T 2CWYA 4QH4A 5AQVB 1WYBA 4F6RC 1E2AA 3O4XE 3EDVA 3KFWX 3HL6A 2W63A 2BKPA 4LFAT 3AEBA 4TZ4C 1T72A 2BVLA 4BJNA 3ANWB 5DJQC 3VU7H 2HN2A 3ZC0A 2WBLA 2Q9QA 4UVCB 3LK42 3AE7A 2ZMAA 4DR4T 5TAOA 1HNZT 4H9OC 2LHNA 4FI5A 2M6IA 4X5TA 4YTMA 4DR7T 3WI3A 4Z91A 4EV6A 2CHNA 4LMKA 2NWBA 5JTGA 3ZMUB 4C90A 2X9HA 4PFPA 4IT4A 2CBIA 4EZHA 5DABA 3PUSA 4CN1A 3N9LA 3QUJA 4PFOA 2XAFB 3CK6A 4LFBT 4CI3B 2MOZA 2W67A 4U72A 2E9XD 4YFSA 1HCIA 1R8IA 3L8RA 4GIWA 2VKHA 3Q2MA 3CQGB 3I9YA 3TLUA 4AKHA 3NBXX 5KDMC 1SE7A 1NAFA 3CQXC 3CQCB 4CN4A 2QGSA 1D1AA 3ZC1A 1IBMT 2X0HA 5AQRB 4AXPA 4LFCT 3DJBA 3O1IA 1XNQT 4NXNT 1SUMB 3RKGA 1UX5A 3CWZB 5ABGA 4IDZA 3AECA 2UXNB 2E2AA 3RRCA 4YJ2E 5GONE 2D0TA 4KUMB 3T1YT 3SRZA 5ABHA 3KBUA 2IDOB 1IJ5A 4CXXA 4MBQA 4UR9A 3F57A 1KNZA 4PJNA 3J7Yq 3SWHA 4I43B 4HFDA 3TLVA 4HWIB 3RH3A 5HEHA 1SA0E 3W15B 3C4ZA 2WCAA 4JLEA 1YQ3A 2BG9E 2FJDA 5FVKA 4H63V 3KINB 4JBWF 1IJ6A 2J1DG 1Z0PA 2OV9A 3UU5A 4LF5T 4YSZA 3N9MA 4UV9B 4UXNB 1X9BA 1LVKA 2L9QA 4PK5A 4H9QC 4JYAT 2IHR1 3SOLA 3U3IA 4QWNB 1XMOT 3T8OA 5LHHB 5L3DB 2SPCA 2V6YB 4JV5T 4QH5A 3AAIA 3IHRA 1N36T 5C2TA 1MNEA 2CBJA 2WY2A 1SHZC 2BG9B 3LK3B 2VASA 3VR9A 5M4YA 3UUMA 3AE2A 1KNPA 2I6HA 4CZZB 5L4HA 2DI4A 2CLYB 4ZI3C 3AAEB 5FMNA 4DR5T 5LCYA 4A56A 4IIJE 4LF9T 3WAKA 2BKOA 5JDHA 5FKYA 2VB6A 1OEDA 3JADA 1W0AA 2C5KT 4CI2B 3CPZA 2VURA 4ZZCA 4AKRB 5IUXA 3ONXA 3ZKRA 3V5UA 1YKHB 4ERRA 4GKJT 4DV6T 4YTNA 4HFVA 4EEDA 3N2KE 5ABFA 4CXWA 4MLKA 2X9XA 3RIUC 4ISSA 4CI1B 1W09A 2HPJA 4E7SA 3N9OA 4DBRA 4MHCA 3HKBE 2ZM8A 3KV5A 1UGOA 2MAWA 5CGMA 2P9BA 3ONJA 2W4XA 3PTRB 5IWAT 1W0BA 4O8SA 4DV7T 4U7YA 4TNWA 4JEHB 1WFDA 2B76A 3OTOT 2A9UA 3I0QA 4O2BE 1CUNA 2AE9A 1L0VA 4DR3T 4QXCB 5JDMA 2H7OA 2WM9A 2FUPA 3L3PA 4C91A 1Y64B 1YXRA 4ASKA 3DP7A 4JI4T 3BQKA 3UULA 1IZNB 4HFBA 4TWDA 4HWCA 5LMNT 4L0RA 3RC8A 2W2UA 1KFYA 5JR9A 1T8BA 2JQKA 3C64A 2J47A 3F31A 2E8IA 3MACA 3Q5WA 4U74A 5JREA 3EAMA 1BR4A 5HAXA 4K0KT 2I0MA 3D0TA 3H37A 2EHOC 3UT5E 3K8PC 1D1CA 2XSAA 4I50E 5HWYA 2LM2A 3ZCIA 4NUUA 4WW0A 4AKIA 3E22E 3UQ7A 2V5CA 2D5UA 2CXDA 1MIWA 5L4EA 2CPTA 3P4RA 1UCUA 4HWFA 2ACZA 5FYMA 2XAJB 3UFEA 1XDOA 2K5BB 1YW0A 5AQFB 4OK0A 4KI0F 2VKDA 3RC3A 5JDFA 3X1DA 4K0UA 2UXDT 2UU9T 2JIWA 1S94A 4PAGA 3FXDB 4JI3T 3B5MA 4IE5A 2H3RA 3HA4A 4QXHB 4GKKT 2JPFA 2VVSA 2OA5A 2UXCT 3I9WA 5EK3A 2W0GA 4YHHT 1ZKEA 4KHZF 3ETUA 2V6XA 2PBIA 3JAFA 4IL4A 4I0UA 4ILUA 4ANJA 2JMHA 2A72A 4YSYA 1HX1B 4U33A 2Q9QC 4MFRA 1MMGA 3CMLA 3ZMVB 1XMQT 4PJMA 1J1JA 2X0YA 4QHOA 1KK7A 2IIUA 2CE7A 2XSBA 3AXJB 3WAJA 5LB7B 3N2GE 1YD8G 3NZPA 4UV8B 2W62A 3ZSSA 4IL9A 3PUAA 2K3WA 5L3BB 2QA7A 5HWXA 4JI0T 1HX8A 2R6GF 5LBQB 2M6BA 4DR6T 2DL1A 3CKDA 3L09A 1KEYA 2WQYA 2LM9A 1O3XA 4EEBA 3M65A 4X1KE 2PTFA 4OX9T 2LHRA 2XQ8A 3LBXB 1QSDA 4NPPA 5JQGE 3GN5B 4DV5T 4YXDA 2WZHA 3RF1A 2AXDS 4PK6A 3PV0F 2YU1A 3PUQA 4U3CA 2V7JA 3RIFA 2BZBA 2XHEB 4IHJE 4IDPA 2DCFA 4IDQA 3AA7B 3P8CD 2LLYA 3HKCE 5LHIB 4DIDB 4QXBB 5F8PA 3ZT7A 3UU8A 3E08A 2J62A 5AFUL 4ZZBA 2JMKA 1J5ET 3JCFA 2XQ3A 3K1SA 2DLRA 3RYIE 1MIYA 2E5VA 2NW8A 4UF0A 2UUBT 2X9WA 1DU2A 1FMVA 3EABA 5AQHB 1D0YA 4IE0A 4P0BA 1D0ZA 2VWAA 2CA5A 3AAAB 2ZM6T 3AE6A 3C4WA 5BMVE 3M3ZB 4ZOLE 2YEVC 4GYRA 2Y6XA 4DVDA 3LDQB 5LXTE 4LMJA 5AQIB 3R6NA 3JC6C 1IAPA 4IDNA 5H6QB 4UEMA 5LGUB 3KV4A 3ZJ1A 5JRCB 3CX6B 4WZXA 4JI7T 4QKNA 3L39A 4DUZT 5CA1E 4EAHA 3FZHB 4GYSA 5J2TE 4TV8E 3KVBA 1B7TA 5FY1A 2WU2A 1HS7A 3ZJ2A 2XQAA 4PK4A 2D0UA 5HEUA 4NXMT 3EHZA 1FJGT 4IREA 2E5LT 2JJ9A 2LE8A 4DR1T 4I4TE 2LKGA 2C0SA 3FZMB 4ZI2C 4IE4A 4UVBB 3K3NA 4HFIA 4KX6A 1OEDC 3G06A 3UU4A 3OBVE 3PU3A 4BA9A 2VL0A 5CA0E 3IF8B 1HG5A 3ZMTB 4XAXB 2CMRA 3KBTA 5H6RB 3QOFA 4QX7B 5HEOA 4DO0A 3MJXA 3AEEA 4A5XA 2YINA 3GWHA 2XAGB 4HFHA 3C51A 3UUNA 3EI0A 5C8YE 3F2EA 4ZI3D 5AQJB 4IGUA 4H9NC 4GOUA 4O4HE 2DWKA 2PJQA 1N34T 3CX8B 4AI6A 3ESLA 4X64T 4Z90A 3AE4A 4DBQA 2V8SV 3LSVA 4HFEA 4O4JE 3ZT6A 1MIVA 1Y01A 4L5GA 3P4QA 3VRAA 2Z6EA 4QX8B 2CRBA 4WBNE 2V7LA 2JQHA 2NOXA 1HFAA 4DV3T 2ZLYA 3PE0A 2KLQA
chains in the Genus database with same CATH topology
2CWOA 3I0OA 1U5PA 4UVAB 4UIGA 1BR4A 5HAXA 3LG7A 2DWGA 4OFZA 5CB4E 1BR2A 4CXYA 4V1Av 2E9XA 2MYSA 3D0TA 3H37A 2HPLA 2DNXA 1V9DA 4EYUA 5JDLA 2EHOC 5LGNB 3UT5E 3V5SA 5LGTB 3VKHA 2PG8A 5LJMA 3K8PC 1D1CA 4I50E 4UELA 4IE6A 5HWYA 1HTJF 5LOVE 5DQWA 2VKJA 3ZCIA 2XAQB 4YJ3E 4NUUA 3O9XA 5JR9C 4WW0A 4AKIA 3O1HA 1US7B 5JH7E 5EK4A 3E22E 3BK9A 4FJOA 4IE7A 2XASB 3B13A 4PJLA 1FIOA 2D5UA 2X68A 4WBOA 4JUYA 5LG4A 5L3FB 2CXDA 3AA6B 3IEEA 2KXPB 1MIWA 2HH7A 5FY0A 1BR1A 1OWAA 2CXLA 2DHRA 2RP4A 2WMOA 1UCUA 2CWYA 4O2AE 3UTKA 4Z8XA 5FYMA 2X66A 2XAJB 5IHYA 4TN7B 2H7VC 4G2AA 2E9XC 4HKAA 1WYBA 3UFEA 3RYFE 2ODUA 4F6RC 2CXFA 2K5BB 1YW0A 3BQIA 5FXWA 2Y48B 4YLHA 3O4XE 3EDVA 3KFWX 4TV9E 3HL6A 2W63A 3K3OA 4OK0A 3OJAA 3OYXA 5JVDE 2VKDA 3RC3A 3HKDE 5JDFA 2C5JA 4TZ4C 3J9X1 2XUEA 4K0UA 4N78D 2BVLA 3Q9DA 1S94A 3KVAA 2BDEA 4PAGA 4BJNA 5HYAA 3H3AA 3FXDB 3ANWB 4B6XA 4DNDA 5DJQC 5A1LA 3VU7H 1OXZA 4IE5A 2L8KA 2H3RA 3AVSA 4HGAA 5LYJE 2NW9A 2BVMA 3HA4A 4QXHB 4X20E 2WBLA 2Q9QA 4UVCB 3FHNA 3ZC0A 1S35A 1EZ3A 3OYZA 3LK42 2LSIA 2PFVA 4HN9A 2LOSA 2ZMAA 2JPFA 5EK2A 2VK9A 3P7IA 5TAOA 2OA5A 4YHJA 3I9WA 4OYJA 5HXCA 3PDYA 5EK3A 4H9OC 2LHNA 4FI5A 2W0GA 3HI2A 4EXTA 1ZKEA 3WI3A 1HF8A 3ZYKA 2Q9QB 2VKOA 2K24A 3ETUA 2NWBA 3K3QC 3ZMZB 1ZV4X 2PBIA 4L9IA 1WRDA 2EHOD 4XZCA 3ZMUB 3ZCJA 2L3LA 5KX5E 4C90A 4ILUA 4ANJA 2X9HA 2JMHA 2A72A 3EVYA 4PFPA 4EZHA 1YKEB 2WMNA 3C98B 2JQQA 5DABA 2Q9QC 3PUGA 3PUSA 4MFRA 3HKEE 1MMGA 5JDGA 3CMLA 2D2SA 3HR0A 4X1YE 3ZMVB 4PJMA 3N9LA 4JEUB 3QK6A 1ZEEA 3QUJA 4ISTA 4QHOA 1KK7A 4PFOA 2KWHA 2I59A 2ODVA 3B57A 2CE7A 2XAFB 2LSJA 5HXRA 4UF0B 4CI3B 3WAJA 2MOZA 2V26A 3AVRA 4GK5E 4O4LE 4U72A 3N2GE 2KMFA 2E9XD 2CCQA 1YD8G 3NZPA 3N2OA 4YFSA 1HCIA 5EZYE 2LSYA 5ETWA 4UV8B 3N5LA 2ACXA 3FXEB 4KMCA 2W62A 5J2UE 2XAHB 4GIWA 3PUAA 2VKHA 5L3CB 4H63H 3Q2MA 5L3BB 2QA7A 3CQGB 3VKGA 3I9YA 5HWXA 3GA8A 1HX8A 1HG2A 3A5XA 4OYKA 4AKHA 3NBXX 5KDMC 3Q5XA 5LBQB 1NAFA 3CQXC 3CQCB 2QGSA 5L3GB 1D1AA 3ZC1A 1WR6A 3I1AA 4GK0E 3CKDA 5IYZE 3ZMSB 3L09A 5JDNA 2LM9A 1O3XA 3M65A 3TKLB 4AXPA 4X1KE 1WYCA 1U4QA 3DJBA 1MMDA 3O1IA 1VRBA 2X0LB 2Y8DA 3LK2B 4DMWA 2IAKA 3MXZA 1ZHCA 2LHRA 2NTXA 3LBXB 1QSDA 5JQGE 1UX5A 2V7IA 3GN5B 3CWZB 3ANWA 4IDZA 3FBLA 2JRKA 1NWMX 2UXNB 5FXXA 2ZM0A 3RRCA 4PK6A 4YJ2E 2YU1A 5GONE 3PUQA 2N2NA 2D0TA 4KUMB 4AQGA 3SRZA 5LJNA 2WSSV 3LFMA 3KBUA 5FXZA 2V7JA 1IJ5A 4TUYE 4CXXA 4MBQA 2Q9QD 2BZBA 3C4XA 3F57A 2XHEB 1KNZA 4P09A 4PJNA 3J7Yq 4XBFB 2LSKA 3GMIA 3ZYMA 4IHJE 3SWHA 2IW5B 4I43B 2DCFA 3C50A 3AA7B 3P8CD 3RH3A 5HXSA 1SA0E 2NW7A 3HKCE 5FP3A 5LHIB 4QXBB 4ZS2A 1LKXA 1BR0A 5F8PA 3C4ZA 3W15B 3KDSE 3MA9A 1WLXA 4H9PC 3E08A 1LVFA 3EDUA 5AFUL 4JLEA 3FB2A 4H63V 3CVRA 3KINB 1IJ6A 4PJJA 2JMKA 2J1DG 5HXHA 5HXEA 1Z0PA 4P0AA 3NRXA 3MZKB 1G8XA 2NP9A 3PURA 3ZYLA 3OKQA 2DLRA 3N9MA 4J2CA 1MIYA 4UV9B 4UXNB 3RRWA 3RYIE 1LVKA 2L9QA 4PK5A 4E7ZA 4H9QC 4I55E 3R84B 2KINB 4BAYB 2NW8A 4UF0A 2A2FX 2WWUA 3SOLA 2X9WA 3U3IA 4QWNB 1FMVA 2UXXB 3T8OA 5LHHB 1D0YA 2N9DA 5J1GA 5L3EB 5L3DB 2SPCA 2XTLA 4IE0A 4P0BA 2ES0A 1D0ZA 3ZEFB 2VWAA 4AQFA 5JDQA 2CA5A 3AAAB 2CEAA 1MMAA 3AAIA 3IHRA 2ZM2A 3C4WA 2KT9A 5BMVE 1MNEA 4ZOLE 2YEVC 5LA6E 4NUVA 4GYRA 1SHZC 3LK3B 2Y6XA 4DVDA 3RYCE 5LXTE 2VASA 5M4YA 3R6NA 3UUMA 3JC6C 1IAPA 2W00A 3AA1B 5H6QB 4X1IE 4CZZB 3N9PA 4G63A 4UEMA 2DI4A 2CLYB 3KV4A 4ZI3C 3AAEB 3ZJ1A 3CX6B 5LGUB 5LP6E 5JRCB 5FMNA 3ZN1B 4MALA 5LCYA 4A56A 4IIJE 3IBPA 2NTYA 4H9RC 1D1BA 3ZLIA 4QKNA 3AB3B 3MK7C 3LBXA 3RX6A 3WAKA 2LOPA 3GN5A 5CA1E 4EAHA 5JDHA 4AKGA 3VHLA 3SS1A 2VB6A 4GYSA 4AQFC 5J2TE 5JR9B 4PW8A 3KV9A 4DMVA 4TV8E 3KV6A 4AKLA 4ZHQE 5KMGP 3KVBA 5L2LA 1B7TA 5FY1A 2C5IT 2CLYC 2LSGA 1G73A 2C5KT 2V7KA 3CPZA 4CI2B 2VL8A 3MKDA 4AKRB 1HS7A 1LRZA 3ZJ2A 3ONXA 2CM0A 3V5UA 1YKHB 4ERRA 4O4IE 4PK4A 2D0UA 4EIWA 2V1DB 3EUHA 4HFVA 2LT3A 3N2KE 2JJ9A 5E0OA 4CXWA 2RA1A 2E9XB 3NRYA 2LE8A 5LNKA 2IC9A 4MLKA 2X9XA 1H7CA 4I4TE 4ISSA 3UUXB 4ZI7E 2C0SA 5LBMA 4ZI2C 2GK9A 4CI1B 4IE4A 4UVBB 3RKOA 3DTOA 2HPJA 3K3NA 2M67A 3U78A 4E7SA 3N9OA 3CX7B 4DBRA 4CQIA 4MHCA 3OBVE 1D0XA 3PU3A 2K9AA 3QC9A 4BA9A 4EZ4A 2XQYA 5CA0E 2V7MA 5FY7A 3PU8A 3IF8B 1HG5A 1QUUA 3HKBE 4XAXB 2ZM8A 3ZMTB 3KV5A 2CMRA 3LJCA 3RPUA 3KBTA 2A3DA 1FMWA 4M1PA 5H6RB 4QX7B 1MNDA 2P9BA 2WAUA 4EB6E 5LHGB 4BJMA 3MJXA 4DO0A 3PTRB 5F3JA 2YINA 3GWHA 2XAGB 3N9NA 3JC6D 4HEAA 3C51A 4O8SA 4OHFA 3UUNA 2YK0A 2KZ7B 2LEHA 2LJLA 5C8YE 4EOZB 3F2EA 4ZI3D 4IGUA 1FEWA 4H9NC 4GOUA 3E0ZA 4JEHB 4O4HE 2DWKA 3ZN0B 2PJQA 1X79A 3CX8B 2MBGA 4AI6A 3ESLA 3I0QA 1VOMA 1E1HB 4O2BE 1CUNA 2IC6A 5FNVE 4QXCB 3ZPOA 5JDMA 2H7OA 2WM9A 3L3PA 4WNKA 2K48A 4C91A 4DBQA 1Y64B 4ADZA 3BQLA 3DP7A 4ASKA 3BQKA 3UULA 2X51A 1IZNB 4TX5A 4O4JE 4ZS3A 2X67A 4KP3C 1MIVA 5FXVA 2KWIB 4HTEA 4L5GA 5JRCA 2MTQA 2G0UA 1T98A 1AJ3A 2EHOA 2YU2A 2Z6EA 4L0RA 4QX8B 3FBZA 2X9YA 3RC8A 4HE8A 4WBNE 2V7LA 3S4UA 2N1GA 3NZQA 3AA0B 2B1EA 2KNDA 4PNIA 5JR9A 2NOXA 1HFAA 3N9QA 2ZLYA 4ZI2D 3ETVA 1UX4A 3C64A 2EHOB 4H9SE 4KBMB 1MMNA 3PE0A 3F31A 3O1JA 2E8IA 3MACA 5DQVA 3Q5WA 3RYHE 4EYYR 5ADXL 4U74A 2KLQA 5JREA 2W61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M67 A;  2MOZ A; 
#chains in the Genus database with same CATH topology
 2CWO A;  4UVA B;  4OFZ A;  5CB4 E;  1BR2 A;  4V1A v;  2E9X A;  2YDQ A;  2IUB A;  2MYS A;  4JI1 T;  5JDL A;  5LGN B;  3V5S A;  3A8Y C;  4DR2 T;  4TNV A;  2XAQ B;  3O9X A;  5JR9 C;  3O1H A;  5JH7 E;  3BK9 A;  3ZT5 A;  2WU5 A;  2X68 A;  4JUY A;  3PUY F;  2KXP B;  2HH7 A;  2CXL A;  1OWA A;  2DHR A;  4B3T T;  4O2A E;  2X66 A;  2XQ5 A;  4TN7 B;  4HKA A;  4AQY T;  3BQI A;  2Y48 B;  2YN6 A;  4TV9 E;  4JI8 T;  3P50 A;  3J9X 1;  1N32 T;  4N78 D;  3KVA A;  5HYA A;  3RGL A;  3H3A A;  4B6X A;  5A1L A;  2WWV A;  1IBK T;  4ILC A;  4HGA A;  5LYJ E;  1S35 A;  1EZ3 A;  3OYZ A;  3PJA J;  2LSI A;  2PFV A;  4JI2 T;  5LG3 A;  3PDY A;  4ILB A;  1UUR A;  3TLT A;  4QH1 A;  4U31 A;  3NWI A;  2QVA A;  4EXT A;  2VKO A;  3ZMZ B;  3K3Q C;  4L9I A;  3TLS A;  3RI5 A;  2EHO D;  4YSX A;  4XZC A;  3EVY A;  2JQQ A;  3PUG A;  3OPC A;  3HKE E;  5CJ5 A;  4IST A;  3AE5 A;  2I59 A;  2V26 A;  4GK5 E;  4O4L E;  2KMF A;  5AQM B;  3PUZ F;  5EZY E;  2LSY A;  5ETW A;  1OED E;  3N5L A;  4F8H A;  5J2U E;  2XAH B;  4HWD A;  3Q5D A;  4AIS A;  2D9D A;  4OYK A;  2WS3 A;  4U7I A;  3Q5X A;  2WDR A;  1JNZ A;  5L3G B;  1T7S A;  4GK0 E;  2WZI A;  5JDN A;  3JAE A;  2YOE A;  1MMD A;  3AE8 A;  5AQN B;  3LK2 B;  1ZHC A;  5AQP B;  2NTX A;  3UQ4 A;  3ANW A;  1OED B;  3FBL A;  2JRK A;  5FXX A;  2ZM0 A;  2OLT A;  2N2N A;  4AQG A;  5LJN A;  5FXZ A;  4TUY E;  2Q9Q D;  3C4X A;  4P09 A;  1UUS A;  2LSK A;  1HNW T;  2IW5 B;  5ABF B;  5ABE A;  3C50 A;  3PJA A;  2NW7 A;  3Q5E A;  4ZS2 A;  1VCT A;  1LKX A;  5C3J A;  3KDS E;  2H88 A;  1LVF A;  4WYV A;  3EDU A;  1M62 A;  3FB2 A;  3CVR A;  4PJJ A;  5HXH A;  5HXE A;  2FBW A;  3ABV A;  3ZYL A;  4J2C A;  4E7Z A;  3FZK B;  4BAY B;  2LRL A;  1ZP0 A;  2N9D A;  5L3E B;  2ES0 A;  4KHP T;  3ZEF B;  4AQF A;  2YKS A;  3UUB A;  4A97 A;  1MMA A;  4LF6 T;  2ZM2 A;  2XQ6 A;  5LA6 E;  4NUV A;  3RYC E;  2W00 A;  3AA1 B;  2YDR A;  4X1I E;  2WB5 A;  3H3M A;  5LP6 E;  1J5W A;  2BG9 C;  4MAL A;  3IBP A;  4H9R C;  3ZLI A;  3MK7 C;  2QRX A;  4AKG A;  3RIA A;  5JR9 B;  4PW8 A;  3KV6 A;  5KMG P;  2CLY C;  2LSG A;  1G73 A;  2V7K A;  2VL8 A;  5L47 A;  4B3S T;  1HNX T;  2XZE A;  2WDV A;  2LT3 A;  5E0O A;  2RA1 A;  2BS2 A;  3NRY A;  2IC9 A;  3RHW A;  3UUX B;  4A98 A;  5LBM A;  5AQO B;  2BS3 A;  4CQI A;  4YT0 A;  1I6Z A;  4U2Z A;  2K9A A;  3QC9 A;  4EZ4 A;  1NEN A;  2XQY A;  5FY7 A;  3RPU A;  2A3D A;  1FMW A;  4ILA A;  4P1N A;  2FJE A;  5LHG B;  1IBL T;  5F3J A;  3JC6 D;  4HEA A;  3ONL C;  2YK0 A;  2LEH A;  2FJB A;  2LJL A;  4YTP A;  2BKN A;  2V6Y A;  1FEW A;  1E1H B;  2BG9 A;  3ZPO A;  4WNK A;  5HCM A;  1XZY A;  3BQL A;  2J4G A;  1HR0 T;  2G0U A;  4X62 T;  4JI5 T;  3FBZ A;  3QB5 A;  5KXJ A;  4PNI A;  4LF7 T;  4ZI2 D;  4LF4 T;  4KBM B;  2EHO B;  3AE3 A;  3O1J A;  5DQV A;  3RYH E;  3I0O A;  5CFB A;  4UIG A;  4CXY A;  4EGW A;  2HPL A;  3UU6 A;  2DNX A;  5LGT B;  3VKH A;  2PG8 A;  2QYW A;  2IML A;  3QNU A;  4DV4 T;  1XNR T;  4UEL A;  5LOV E;  2W66 A;  1YQ4 A;  5AQG B;  5EK4 A;  4FJO A;  2XPK A;  4WBO A;  3SFD A;  5L3F B;  2LKH A;  5FY0 A;  1BR1 A;  4Q25 A;  2RP4 A;  2WMO A;  4X65 T;  3UTK A;  4Z8X A;  5IHY A;  3NKZ A;  2H7V C;  4G2A A;  2E9X C;  3RYF E;  2ODU A;  2CXF A;  4DUY T;  5FXW A;  4YLH A;  3K3O A;  2XQ7 A;  3OJA A;  3OYX A;  5JVD E;  1W9R A;  3HKD E;  2C5J A;  2XUE A;  3Q9D A;  2BDE A;  4DND A;  1OXZ A;  4LML A;  2L8K A;  3AVS A;  4DV2 T;  2NW9 A;  2BVM A;  4X20 E;  3RLF F;  3FHN A;  4HN9 A;  2F4V T;  2LOS A;  5EK2 A;  2LRK A;  2VK9 A;  3P7I A;  2HN1 A;  4YHJ A;  5HXC A;  4OYJ A;  2WDQ A;  3AEG A;  3HI2 A;  2BBJ A;  1HF8 A;  3ZYK A;  2Q9Q B;  2K24 A;  3PUW F;  1ZV4 X;  3VRB A;  1WRD A;  1XDP A;  5FL0 A;  5HCJ A;  3ZCJ A;  2L3L A;  5KX5 E;  3QB5 K;  2JQ9 A;  1YKE B;  2WMN A;  3C98 B;  5JDG A;  2D2S A;  2MPK A;  3HR0 A;  4X1Y E;  4JEU B;  3QK6 A;  1ZEE A;  5AQS B;  2BS4 A;  2KWH A;  2VQF T;  1VCS A;  2ODV A;  3B57 A;  2LSJ A;  5HXR A;  4UF0 B;  1N33 T;  3AVR A;  3VR8 A;  1M7K A;  2CCQ A;  2VQE T;  3N2O A;  2XM1 A;  2ACX A;  3FXE B;  4KMC A;  5AQQ B;  2RPA A;  3CIR A;  5L3C B;  4H63 H;  3SFE A;  3AEA A;  1GQE A;  3VKG A;  3GA8 A;  1HG2 A;  3A5X A;  3UU3 A;  1WR6 A;  3I1A A;  3ZMS B;  5IYZ E;  3OVU A;  3TKL B;  2V5D A;  1WYC A;  1U4Q A;  3PUV F;  1VRB A;  2X0L B;  3RQU A;  2Y8D A;  4DMW A;  2IAK A;  3MXZ A;  5HEG A;  2V7I A;  4X66 T;  4HFC A;  1NWM X;  3P4P A;  2WSS V;  3LFM A;  3T1H T;  5FVL A;  1E7P A;  4XBF B;  3GMI A;  3ZYM A;  4TWF A;  4YY3 T;  5AQU B;  4DV1 T;  5HXS A;  5FP3 A;  1BR0 A;  3MA9 A;  1WLX A;  4H9P C;  2XQ9 A;  1NEK A;  4AIU A;  2BBH A;  1I94 T;  2HHH T;  4CN6 A;  4P0A A;  3NRX A;  3MZK B;  2NR4 A;  1G8X A;  2NP9 A;  3PUR A;  3OKQ A;  3RRW A;  3P4S A;  1XWM A;  2H89 A;  4I55 E;  3R84 B;  2KIN B;  3AXJ A;  2XJ7 A;  2A2F X;  2WWU A;  5HEJ A;  2UXX B;  5J1G A;  3NVO A;  2XTL A;  4B3M T;  4COF A;  5JDQ A;  2CEA A;  2KT9 A;  3FZL B;  3P4W A;  4NIQ A;  3PUX F;  2CHO A;  3N9P A;  4G63 A;  2VVN A;  3TLW A;  3AEF A;  3RIU A;  3ZN1 B;  1ZOY A;  2XY8 B;  2NTY A;  1D1B A;  3AB3 B;  3RX6 A;  3LBX A;  4HWH A;  4IDO A;  2LOP A;  3GN5 A;  3VHL A;  3SS1 A;  4AQF C;  2UUA T;  3KV9 A;  4DMV A;  4AKL A;  4ZHQ E;  5F5W A;  5L2L A;  3AED A;  2C5I T;  5FL1 A;  3MKD A;  1LRZ A;  3ZST A;  2CM0 A;  4O4I E;  4EIW A;  2V1D B;  3EUH A;  2E9X B;  4ZXL A;  4ZEY A;  5LNK A;  5AQK B;  1H7C A;  4ZI7 E;  4JI6 T;  2GK9 A;  1JNR A;  3RKO A;  3DTO A;  3U78 A;  2M67 A;  4DV0 T;  3CX7 B;  4U2Y A;  1D0X A;  2V7M A;  3PU8 A;  1QUU A;  1QLB A;  3LJC A;  1WCR A;  4M1P A;  1MND A;  2WAU A;  4EB6 E;  4BJM A;  3UFG A;  3N9N A;  4OHF A;  2KZ7 B;  4EOZ B;  3E0Z A;  3ZN0 B;  1X79 A;  2MBG A;  1VOM A;  1KF6 A;  2IC6 A;  5FNV E;  2KSR A;  3IA3 A;  2K48 A;  4ADZ A;  2X51 A;  4TX5 A;  4ZS3 A;  2X67 A;  4KP3 C;  2UUC T;  5FXV A;  2KWI B;  4HTE A;  5JRC A;  2MTQ A;  1T98 A;  1AJ3 A;  2EHO A;  2YU2 A;  4TWH A;  2X9Y A;  1WR0 A;  3A7M A;  4HE8 A;  3S4U A;  1UK5 A;  2N1G A;  1KNR A;  3NZQ A;  3AA0 B;  2B1E A;  2KND A;  2WP9 A;  3N9Q A;  3ETV A;  5J0Z A;  1UX4 A;  4H9S E;  1MMN A;  4EYY R;  3FZF B;  5ADX L;  2W61 A;  2FJA A;  1U5P A;  2XQ4 A;  3LG7 A;  2DWG A;  1CHU A;  1V9D A;  4EYU A;  4B3R T;  5LJM A;  2XM2 A;  4IE6 A;  1HTJ F;  3RQW A;  5DQW A;  2VKJ A;  5BR8 T;  3AE9 A;  4YJ3 E;  2UXB T;  5LMU T;  1US7 B;  5AQT B;  5AQL B;  3AE1 A;  4IE7 A;  2XAS B;  3B13 A;  4PJL A;  1FIO A;  2YDS A;  5LG4 A;  3AA6 B;  3IEE A;  1Z8U A;  4LF8 T;  2CWY A;  4QH4 A;  5AQV B;  1WYB A;  4F6R C;  1E2A A;  3O4X E;  3EDV A;  3KFW X;  3HL6 A;  2W63 A;  2BKP A;  4LFA T;  3AEB A;  4TZ4 C;  1T72 A;  2BVL A;  4BJN A;  3ANW B;  5DJQ C;  3VU7 H;  2HN2 A;  3ZC0 A;  2WBL A;  2Q9Q A;  4UVC B;  3LK4 2;  3AE7 A;  2ZMA A;  4DR4 T;  5TAO A;  1HNZ T;  4H9O C;  2LHN A;  4FI5 A;  2M6I A;  4X5T A;  4YTM A;  4DR7 T;  3WI3 A;  4Z91 A;  4EV6 A;  2CHN A;  4LMK A;  2NWB A;  5JTG A;  3ZMU B;  4C90 A;  2X9H A;  4PFP A;  4IT4 A;  2CBI A;  4EZH A;  5DAB A;  3PUS A;  4CN1 A;  3N9L A;  3QUJ A;  4PFO A;  2XAF B;  3CK6 A;  4LFB T;  4CI3 B;  2MOZ A;  2W67 A;  4U72 A;  2E9X D;  4YFS A;  1HCI A;  1R8I A;  3L8R A;  4GIW A;  2VKH A;  3Q2M A;  3CQG B;  3I9Y A;  3TLU A;  4AKH A;  3NBX X;  5KDM C;  1SE7 A;  1NAF A;  3CQX C;  3CQC B;  4CN4 A;  2QGS A;  1D1A A;  3ZC1 A;  1IBM T;  2X0H A;  5AQR B;  4AXP A;  4LFC T;  3DJB A;  3O1I A;  1XNQ T;  4NXN T;  1SUM B;  3RKG A;  1UX5 A;  3CWZ B;  5ABG A;  4IDZ A;  3AEC A;  2UXN B;  2E2A A;  3RRC A;  4YJ2 E;  5GON E;  2D0T A;  4KUM B;  3T1Y T;  3SRZ A;  5ABH A;  3KBU A;  2IDO B;  1IJ5 A;  4CXX A;  4MBQ A;  4UR9 A;  3F57 A;  1KNZ A;  4PJN A;  3J7Y q;  3SWH A;  4I43 B;  4HFD A;  3TLV A;  4HWI B;  3RH3 A;  5HEH A;  1SA0 E;  3W15 B;  3C4Z A;  2WCA A;  4JLE A;  1YQ3 A;  2BG9 E;  2FJD A;  5FVK A;  4H63 V;  3KIN B;  4JBW F;  1IJ6 A;  2J1D G;  1Z0P A;  2OV9 A;  3UU5 A;  4LF5 T;  4YSZ A;  3N9M A;  4UV9 B;  4UXN B;  1X9B A;  1LVK A;  2L9Q A;  4PK5 A;  4H9Q C;  4JYA T;  2IHR 1;  3SOL A;  3U3I A;  4QWN B;  1XMO T;  3T8O A;  5LHH B;  5L3D B;  2SPC A;  2V6Y B;  4JV5 T;  4QH5 A;  3AAI A;  3IHR A;  1N36 T;  5C2T A;  1MNE A;  2CBJ A;  2WY2 A;  1SHZ C;  2BG9 B;  3LK3 B;  2VAS A;  3VR9 A;  5M4Y A;  3UUM A;  3AE2 A;  1KNP A;  2I6H A;  4CZZ B;  5L4H A;  2DI4 A;  2CLY B;  4ZI3 C;  3AAE B;  5FMN A;  4DR5 T;  5LCY A;  4A56 A;  4IIJ E;  4LF9 T;  3WAK A;  2BKO A;  5JDH A;  5FKY A;  2VB6 A;  1OED A;  3JAD A;  1W0A A;  2C5K T;  4CI2 B;  3CPZ A;  2VUR A;  4ZZC A;  4AKR B;  5IUX A;  3ONX A;  3ZKR A;  3V5U A;  1YKH B;  4ERR A;  4GKJ T;  4DV6 T;  4YTN A;  4HFV A;  4EED A;  3N2K E;  5ABF A;  4CXW A;  4MLK A;  2X9X A;  3RIU C;  4ISS A;  4CI1 B;  1W09 A;  2HPJ A;  4E7S A;  3N9O A;  4DBR A;  4MHC A;  3HKB E;  2ZM8 A;  3KV5 A;  1UGO A;  2MAW A;  5CGM A;  2P9B A;  3ONJ A;  2W4X A;  3PTR B;  5IWA T;  1W0B A;  4O8S A;  4DV7 T;  4U7Y A;  4TNW A;  4JEH B;  1WFD A;  2B76 A;  3OTO T;  2A9U A;  3I0Q A;  4O2B E;  1CUN A;  2AE9 A;  1L0V A;  4DR3 T;  4QXC B;  5JDM A;  2H7O A;  2WM9 A;  2FUP A;  3L3P A;  4C91 A;  1Y64 B;  1YXR A;  4ASK A;  3DP7 A;  4JI4 T;  3BQK A;  3UUL A;  1IZN B;  4HFB A;  4TWD A;  4HWC A;  5LMN T;  4L0R A;  3RC8 A;  2W2U A;  1KFY A;  5JR9 A;  1T8B A;  2JQK A;  3C64 A;  2J47 A;  3F31 A;  2E8I A;  3MAC A;  3Q5W A;  4U74 A;  5JRE A;  3EAM A;  1BR4 A;  5HAX A;  4K0K T;  2I0M A;  3D0T A;  3H37 A;  2EHO C;  3UT5 E;  3K8P C;  1D1C A;  2XSA A;  4I50 E;  5HWY A;  2LM2 A;  3ZCI A;  4NUU A;  4WW0 A;  4AKI A;  3E22 E;  3UQ7 A;  2V5C A;  2D5U A;  2CXD A;  1MIW A;  5L4E A;  2CPT A;  3P4R A;  1UCU A;  4HWF A;  2ACZ A;  5FYM A;  2XAJ B;  3UFE A;  1XDO A;  2K5B B;  1YW0 A;  5AQF B;  4OK0 A;  4KI0 F;  2VKD A;  3RC3 A;  5JDF A;  3X1D A;  4K0U A;  2UXD T;  2UU9 T;  2JIW A;  1S94 A;  4PAG A;  3FXD B;  4JI3 T;  3B5M A;  4IE5 A;  2H3R A;  3HA4 A;  4QXH B;  4GKK T;  2JPF A;  2VVS A;  2OA5 A;  2UXC T;  3I9W A;  5EK3 A;  2W0G A;  4YHH T;  1ZKE A;  4KHZ F;  3ETU A;  2V6X A;  2PBI A;  3JAF A;  4IL4 A;  4I0U A;  4ILU A;  4ANJ A;  2JMH A;  2A72 A;  4YSY A;  1HX1 B;  4U33 A;  2Q9Q C;  4MFR A;  1MMG A;  3CML A;  3ZMV B;  1XMQ T;  4PJM A;  1J1J A;  2X0Y A;  4QHO A;  1KK7 A;  2IIU A;  2CE7 A;  2XSB A;  3AXJ B;  3WAJ A;  5LB7 B;  3N2G E;  1YD8 G;  3NZP A;  4UV8 B;  2W62 A;  3ZSS A;  4IL9 A;  3PUA A;  2K3W A;  5L3B B;  2QA7 A;  5HWX A;  4JI0 T;  1HX8 A;  2R6G F;  5LBQ B;  2M6B A;  4DR6 T;  2DL1 A;  3CKD A;  3L09 A;  1KEY A;  2WQY A;  2LM9 A;  1O3X A;  4EEB A;  3M65 A;  4X1K E;  2PTF A;  4OX9 T;  2LHR A;  2XQ8 A;  3LBX B;  1QSD A;  4NPP A;  5JQG E;  3GN5 B;  4DV5 T;  4YXD A;  2WZH A;  3RF1 A;  2AXD S;  4PK6 A;  3PV0 F;  2YU1 A;  3PUQ A;  4U3C A;  2V7J A;  3RIF A;  2BZB A;  2XHE B;  4IHJ E;  4IDP A;  2DCF A;  4IDQ A;  3AA7 B;  3P8C D;  2LLY A;  3HKC E;  5LHI B;  4DID B;  4QXB B;  5F8P A;  3ZT7 A;  3UU8 A;  3E08 A;  2J62 A;  5AFU L;  4ZZB A;  2JMK A;  1J5E T;  3JCF A;  2XQ3 A;  3K1S A;  2DLR A;  3RYI E;  1MIY A;  2E5V A;  2NW8 A;  4UF0 A;  2UUB T;  2X9W A;  1DU2 A;  1FMV A;  3EAB A;  5AQH B;  1D0Y A;  4IE0 A;  4P0B A;  1D0Z A;  2VWA A;  2CA5 A;  3AAA B;  2ZM6 T;  3AE6 A;  3C4W A;  5BMV E;  3M3Z B;  4ZOL E;  2YEV C;  4GYR A;  2Y6X A;  4DVD A;  3LDQ B;  5LXT E;  4LMJ A;  5AQI B;  3R6N A;  3JC6 C;  1IAP A;  4IDN A;  5H6Q B;  4UEM A;  5LGU B;  3KV4 A;  3ZJ1 A;  5JRC B;  3CX6 B;  4WZX A;  4JI7 T;  4QKN A;  3L39 A;  4DUZ T;  5CA1 E;  4EAH A;  3FZH B;  4GYS A;  5J2T E;  4TV8 E;  3KVB A;  1B7T A;  5FY1 A;  2WU2 A;  1HS7 A;  3ZJ2 A;  2XQA A;  4PK4 A;  2D0U A;  5HEU A;  4NXM T;  3EHZ A;  1FJG T;  4IRE A;  2E5L T;  2JJ9 A;  2LE8 A;  4DR1 T;  4I4T E;  2LKG A;  2C0S A;  3FZM B;  4ZI2 C;  4IE4 A;  4UVB B;  3K3N A;  4HFI A;  4KX6 A;  1OED C;  3G06 A;  3UU4 A;  3OBV E;  3PU3 A;  4BA9 A;  2VL0 A;  5CA0 E;  3IF8 B;  1HG5 A;  3ZMT B;  4XAX B;  2CMR A;  3KBT A;  5H6R B;  3QOF A;  4QX7 B;  5HEO A;  4DO0 A;  3MJX A;  3AEE A;  4A5X A;  2YIN A;  3GWH A;  2XAG B;  4HFH A;  3C51 A;  3UUN A;  3EI0 A;  5C8Y E;  3F2E A;  4ZI3 D;  5AQJ B;  4IGU A;  4H9N C;  4GOU A;  4O4H E;  2DWK A;  2PJQ A;  1N34 T;  3CX8 B;  4AI6 A;  3ESL A;  4X64 T;  4Z90 A;  3AE4 A;  4DBQ A;  2V8S V;  3LSV A;  4HFE A;  4O4J E;  3ZT6 A;  1MIV A;  1Y01 A;  4L5G A;  3P4Q A;  3VRA A;  2Z6E A;  4QX8 B;  2CRB A;  4WBN E;  2V7L A;  2JQH A;  2NOX A;  1HFA A;  4DV3 T;  2ZLY A;  3PE0 A;  2KLQ A; 
#chains in the Genus database with same CATH homology
 2CWO A;  3I0O A;  1U5P A;  4UVA B;  4UIG A;  1BR4 A;  5HAX A;  3LG7 A;  2DWG A;  4OFZ A;  5CB4 E;  1BR2 A;  4CXY A;  4V1A v;  2E9X A;  2MYS A;  3D0T A;  3H37 A;  2HPL A;  2DNX A;  1V9D A;  4EYU A;  5JDL A;  2EHO C;  5LGN B;  3UT5 E;  3V5S A;  5LGT B;  3VKH A;  2PG8 A;  5LJM A;  3K8P C;  1D1C A;  4I50 E;  4UEL A;  4IE6 A;  5HWY A;  1HTJ F;  5LOV E;  5DQW A;  2VKJ A;  3ZCI A;  2XAQ B;  4YJ3 E;  4NUU A;  3O9X A;  5JR9 C;  4WW0 A;  4AKI A;  3O1H A;  1US7 B;  5JH7 E;  5EK4 A;  3E22 E;  3BK9 A;  4FJO A;  4IE7 A;  2XAS B;  3B13 A;  4PJL A;  1FIO A;  2D5U A;  2X68 A;  4WBO A;  4JUY A;  5LG4 A;  5L3F B;  2CXD A;  3AA6 B;  3IEE A;  2KXP B;  1MIW A;  2HH7 A;  5FY0 A;  1BR1 A;  1OWA A;  2CXL A;  2DHR A;  2RP4 A;  2WMO A;  1UCU A;  2CWY A;  4O2A E;  3UTK A;  4Z8X A;  5FYM A;  2X66 A;  2XAJ B;  5IHY A;  4TN7 B;  2H7V C;  4G2A A;  2E9X C;  4HKA A;  1WYB A;  3UFE A;  3RYF E;  2ODU A;  4F6R C;  2CXF A;  2K5B B;  1YW0 A;  3BQI A;  5FXW A;  2Y48 B;  4YLH A;  3O4X E;  3EDV A;  3KFW X;  4TV9 E;  3HL6 A;  2W63 A;  3K3O A;  4OK0 A;  3OJA A;  3OYX A;  5JVD E;  2VKD A;  3RC3 A;  3HKD E;  5JDF A;  2C5J A;  4TZ4 C;  3J9X 1;  2XUE A;  4K0U A;  4N78 D;  2BVL A;  3Q9D A;  1S94 A;  3KVA A;  2BDE A;  4PAG A;  4BJN A;  5HYA A;  3H3A A;  3FXD B;  3ANW B;  4B6X A;  4DND A;  5DJQ C;  5A1L A;  3VU7 H;  1OXZ A;  4IE5 A;  2L8K A;  2H3R A;  3AVS A;  4HGA A;  5LYJ E;  2NW9 A;  2BVM A;  3HA4 A;  4QXH B;  4X20 E;  2WBL A;  2Q9Q A;  4UVC B;  3FHN A;  3ZC0 A;  1S35 A;  1EZ3 A;  3OYZ A;  3LK4 2;  2LSI A;  2PFV A;  4HN9 A;  2LOS A;  2ZMA A;  2JPF A;  5EK2 A;  2VK9 A;  3P7I A;  5TAO A;  2OA5 A;  4YHJ A;  3I9W A;  4OYJ A;  5HXC A;  3PDY A;  5EK3 A;  4H9O C;  2LHN A;  4FI5 A;  2W0G A;  3HI2 A;  4EXT A;  1ZKE A;  3WI3 A;  1HF8 A;  3ZYK A;  2Q9Q B;  2VKO A;  2K24 A;  3ETU A;  2NWB A;  3K3Q C;  3ZMZ B;  1ZV4 X;  2PBI A;  4L9I A;  1WRD A;  2EHO D;  4XZC A;  3ZMU B;  3ZCJ A;  2L3L A;  5KX5 E;  4C90 A;  4ILU A;  4ANJ A;  2X9H A;  2JMH A;  2A72 A;  3EVY A;  4PFP A;  4EZH A;  1YKE B;  2WMN A;  3C98 B;  2JQQ A;  5DAB A;  2Q9Q C;  3PUG A;  3PUS A;  4MFR A;  3HKE E;  1MMG A;  5JDG A;  3CML A;  2D2S A;  3HR0 A;  4X1Y E;  3ZMV B;  4PJM A;  3N9L A;  4JEU B;  3QK6 A;  1ZEE A;  3QUJ A;  4IST A;  4QHO A;  1KK7 A;  4PFO A;  2KWH A;  2I59 A;  2ODV A;  3B57 A;  2CE7 A;  2XAF B;  2LSJ A;  5HXR A;  4UF0 B;  4CI3 B;  3WAJ A;  2MOZ A;  2V26 A;  3AVR A;  4GK5 E;  4O4L E;  4U72 A;  3N2G E;  2KMF A;  2E9X D;  2CCQ A;  1YD8 G;  3NZP A;  3N2O A;  4YFS A;  1HCI A;  5EZY E;  2LSY A;  5ETW A;  4UV8 B;  3N5L A;  2ACX A;  3FXE B;  4KMC A;  2W62 A;  5J2U E;  2XAH B;  4GIW A;  3PUA A;  2VKH A;  5L3C B;  4H63 H;  3Q2M A;  5L3B B;  2QA7 A;  3CQG B;  3VKG A;  3I9Y A;  5HWX A;  3GA8 A;  1HX8 A;  1HG2 A;  3A5X A;  4OYK A;  4AKH A;  3NBX X;  5KDM C;  3Q5X A;  5LBQ B;  1NAF A;  3CQX C;  3CQC B;  2QGS A;  5L3G B;  1D1A A;  3ZC1 A;  1WR6 A;  3I1A A;  4GK0 E;  3CKD A;  5IYZ E;  3ZMS B;  3L09 A;  5JDN A;  2LM9 A;  1O3X A;  3M65 A;  3TKL B;  4AXP A;  4X1K E;  1WYC A;  1U4Q A;  3DJB A;  1MMD A;  3O1I A;  1VRB A;  2X0L B;  2Y8D A;  3LK2 B;  4DMW A;  2IAK A;  3MXZ A;  1ZHC A;  2LHR A;  2NTX A;  3LBX B;  1QSD A;  5JQG E;  1UX5 A;  2V7I A;  3GN5 B;  3CWZ B;  3ANW A;  4IDZ A;  3FBL A;  2JRK A;  1NWM X;  2UXN B;  5FXX A;  2ZM0 A;  3RRC A;  4PK6 A;  4YJ2 E;  2YU1 A;  5GON E;  3PUQ A;  2N2N A;  2D0T A;  4KUM B;  4AQG A;  3SRZ A;  5LJN A;  2WSS V;  3LFM A;  3KBU A;  5FXZ A;  2V7J A;  1IJ5 A;  4TUY E;  4CXX A;  4MBQ A;  2Q9Q D;  2BZB A;  3C4X A;  3F57 A;  2XHE B;  1KNZ A;  4P09 A;  4PJN A;  3J7Y q;  4XBF B;  2LSK A;  3GMI A;  3ZYM A;  4IHJ E;  3SWH A;  2IW5 B;  4I43 B;  2DCF A;  3C50 A;  3AA7 B;  3P8C D;  3RH3 A;  5HXS A;  1SA0 E;  2NW7 A;  3HKC E;  5FP3 A;  5LHI B;  4QXB B;  4ZS2 A;  1LKX A;  1BR0 A;  5F8P A;  3C4Z A;  3W15 B;  3KDS E;  3MA9 A;  1WLX A;  4H9P C;  3E08 A;  1LVF A;  3EDU A;  5AFU L;  4JLE A;  3FB2 A;  4H63 V;  3CVR A;  3KIN B;  1IJ6 A;  4PJJ A;  2JMK A;  2J1D G;  5HXH A;  5HXE A;  1Z0P A;  4P0A A;  3NRX A;  3MZK B;  1G8X A;  2NP9 A;  3PUR A;  3ZYL A;  3OKQ A;  2DLR A;  3N9M A;  4J2C A;  1MIY A;  4UV9 B;  4UXN B;  3RRW A;  3RYI E;  1LVK A;  2L9Q A;  4PK5 A;  4E7Z A;  4H9Q C;  4I55 E;  3R84 B;  2KIN B;  4BAY B;  2NW8 A;  4UF0 A;  2A2F X;  2WWU A;  3SOL A;  2X9W A;  3U3I A;  4QWN B;  1FMV A;  2UXX B;  3T8O A;  5LHH B;  1D0Y A;  2N9D A;  5J1G A;  5L3E B;  5L3D B;  2SPC A;  2XTL A;  4IE0 A;  4P0B A;  2ES0 A;  1D0Z A;  3ZEF B;  2VWA A;  4AQF A;  5JDQ A;  2CA5 A;  3AAA B;  2CEA A;  1MMA A;  3AAI A;  3IHR A;  2ZM2 A;  3C4W A;  2KT9 A;  5BMV E;  1MNE A;  4ZOL E;  2YEV C;  5LA6 E;  4NUV A;  4GYR A;  1SHZ C;  3LK3 B;  2Y6X A;  4DVD A;  3RYC E;  5LXT E;  2VAS A;  5M4Y A;  3R6N A;  3UUM A;  3JC6 C;  1IAP A;  2W00 A;  3AA1 B;  5H6Q B;  4X1I E;  4CZZ B;  3N9P A;  4G63 A;  4UEM A;  2DI4 A;  2CLY B;  3KV4 A;  4ZI3 C;  3AAE B;  3ZJ1 A;  3CX6 B;  5LGU B;  5LP6 E;  5JRC B;  5FMN A;  3ZN1 B;  4MAL A;  5LCY A;  4A56 A;  4IIJ E;  3IBP A;  2NTY A;  4H9R C;  1D1B A;  3ZLI A;  4QKN A;  3AB3 B;  3MK7 C;  3LBX A;  3RX6 A;  3WAK A;  2LOP A;  3GN5 A;  5CA1 E;  4EAH A;  5JDH A;  4AKG A;  3VHL A;  3SS1 A;  2VB6 A;  4GYS A;  4AQF C;  5J2T E;  5JR9 B;  4PW8 A;  3KV9 A;  4DMV A;  4TV8 E;  3KV6 A;  4AKL A;  4ZHQ E;  5KMG P;  3KVB A;  5L2L A;  1B7T A;  5FY1 A;  2C5I T;  2CLY C;  2LSG A;  1G73 A;  2C5K T;  2V7K A;  3CPZ A;  4CI2 B;  2VL8 A;  3MKD A;  4AKR B;  1HS7 A;  1LRZ A;  3ZJ2 A;  3ONX A;  2CM0 A;  3V5U A;  1YKH B;  4ERR A;  4O4I E;  4PK4 A;  2D0U A;  4EIW A;  2V1D B;  3EUH A;  4HFV A;  2LT3 A;  3N2K E;  2JJ9 A;  5E0O A;  4CXW A;  2RA1 A;  2E9X B;  3NRY A;  2LE8 A;  5LNK A;  2IC9 A;  4MLK A;  2X9X A;  1H7C A;  4I4T E;  4ISS A;  3UUX B;  4ZI7 E;  2C0S A;  5LBM A;  4ZI2 C;  2GK9 A;  4CI1 B;  4IE4 A;  4UVB B;  3RKO A;  3DTO A;  2HPJ A;  3K3N A;  2M67 A;  3U78 A;  4E7S A;  3N9O A;  3CX7 B;  4DBR A;  4CQI A;  4MHC A;  3OBV E;  1D0X A;  3PU3 A;  2K9A A;  3QC9 A;  4BA9 A;  4EZ4 A;  2XQY A;  5CA0 E;  2V7M A;  5FY7 A;  3PU8 A;  3IF8 B;  1HG5 A;  1QUU A;  3HKB E;  4XAX B;  2ZM8 A;  3ZMT B;  3KV5 A;  2CMR A;  3LJC A;  3RPU A;  3KBT A;  2A3D A;  1FMW A;  4M1P A;  5H6R B;  4QX7 B;  1MND A;  2P9B A;  2WAU A;  4EB6 E;  5LHG B;  4BJM A;  3MJX A;  4DO0 A;  3PTR B;  5F3J A;  2YIN A;  3GWH A;  2XAG B;  3N9N A;  3JC6 D;  4HEA A;  3C51 A;  4O8S A;  4OHF A;  3UUN A;  2YK0 A;  2KZ7 B;  2LEH A;  2LJL A;  5C8Y E;  4EOZ B;  3F2E A;  4ZI3 D;  4IGU A;  1FEW A;  4H9N C;  4GOU A;  3E0Z A;  4JEH B;  4O4H E;  2DWK A;  3ZN0 B;  2PJQ A;  1X79 A;  3CX8 B;  2MBG A;  4AI6 A;  3ESL A;  3I0Q A;  1VOM A;  1E1H B;  4O2B E;  1CUN A;  2IC6 A;  5FNV E;  4QXC B;  3ZPO A;  5JDM A;  2H7O A;  2WM9 A;  3L3P A;  4WNK A;  2K48 A;  4C91 A;  4DBQ A;  1Y64 B;  4ADZ A;  3BQL A;  3DP7 A;  4ASK A;  3BQK A;  3UUL A;  2X51 A;  1IZN B;  4TX5 A;  4O4J E;  4ZS3 A;  2X67 A;  4KP3 C;  1MIV A;  5FXV A;  2KWI B;  4HTE A;  4L5G A;  5JRC A;  2MTQ A;  2G0U A;  1T98 A;  1AJ3 A;  2EHO A;  2YU2 A;  2Z6E A;  4L0R A;  4QX8 B;  3FBZ A;  2X9Y A;  3RC8 A;  4HE8 A;  4WBN E;  2V7L A;  3S4U A;  2N1G A;  3NZQ A;  3AA0 B;  2B1E A;  2KND A;  4PNI A;  5JR9 A;  2NOX A;  1HFA A;  3N9Q A;  2ZLY A;  4ZI2 D;  3ETV A;  1UX4 A;  3C64 A;  2EHO B;  4H9S E;  4KBM B;  1MMN A;  3PE0 A;  3F31 A;  3O1J A;  2E8I A;  3MAC A;  5DQV A;  3Q5W A;  3RYH E;  4EYY R;  5ADX L;  4U74 A;  2KLQ A;  5JRE A;  2W61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...