2MOZA

Structure of the membrane protein merf, a bacterial mercury transporter, improved by the inclusion of chemical shift anisotropy constraints
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
MKDPKTLLRVSIIGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASSTPKFNGVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
publication title Structure of the membrane protein MerF, a bacterial mercury transporter, improved by the inclusion of chemical shift anisotropy constraints.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Membrane protein
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2mozA00
2MOZA 2M67A
chains in the Genus database with same CATH superfamily
4MHCA 2QVAA 1CUNA 3ZMSB 2V1DB 5IWAT 3KBUA 4ZI3D 4A5XA 5ABFA 4B3ST 3OKQA 2CLYC 3AA1B 3MJXA 1X79A 2FJDA 2H7OA 5CB4E 1W9RA 5M4YA 4JV5T 2CPTA 5HEJA 4X1YE 1YKEB 5FYMA 3ZC1A 2IDOB 1I6ZA 3MXZA 4UVBB 4KP3C 4YLHA 5F5WA 3EVYA 2JQKA 3O4XE 3I0QA 3P7IA 2NWBA 3JCFA 4DV4T 2QYWA 2E8IA 4O4LE 1YQ4A 1OXZA 2V6YB 5AQJB 3EABA 1T72A 4XAXB 4DO0A 1DU2A 2CWYA 3RRCA 2KWIB 2DLRA 2M6BA 3O1IA 2Q9QD 4G63A 4H9NC 3NZPA 2YEVC 4GIWA 3C4XA 2K5BB 3R6NA 5AQKB 5JDFA 3H37A 3SWHA 1BR4A 2LJLA 3PUSA 5JR9C 5HWYA 4IGUA 2MPKA 3PJAJ 4U2ZA 4TNWA 4NUUA 3K3QC 3GN5B 4K0UA 1U5PA 4DVDA 2BVMA 1G8XA 1EZ3A 1VCTA 2ODVA 3EHZA 4WZXA 4B3RT 4QXCB 2XAJB 3LG7A 3AA0B 1UK5A 3ZSTA 3ZLIA 5L4EA 4HWCA 3RKGA 4CZZB 2K48A 2WMNA 5BMVE 3GN5A 2ZM8A 1J5WA 1QSDA 3I9WA 3KDSE 1LVKA 2BZBA 2DWGA 2XQYA 4YTMA 4JI4T 3OTOT 2WCAA 4EB6E 4IDPA 2XSBA 2LRLA 3ONJA 4DR3T 2VQFT 1J1JA 3TLSA 4AISA 2CBIA 3QOFA 4AKGA 1D0XA 1X9BA 3AE6A 3AEDA 4WBOA 2YU1A 5AQQB 3KV9A 1XDOA 5LXTE 4ZHQE 4X62T 1YXRA 2Y6XA 2BG9A 4IE0A 5J2TE 4E7ZA 3BQLA 4YSYA 1FIOA 2MYSA 3RYCE 2LSIA 5JDHA 2BKPA 3PU8A 4O4IE 3NKZA 4NPPA 4ZI2D 1U4QA 2G0UA 2V5CA 4AQYT 3AEFA 5JH7E 4CI2B 4LFCT 2EHOD 3N9OA 3L8RA 4F6RC 4DR5T 3AEAA 2X67A 2MBGA 3N9LA 4HTEA 4B3TT 4YXDA 4U7IA 5AQHB 3P50A 4WYVA 4GYSA 2VVSA 2C5JA 4NXNT 4NXMT 3RQWA 1XMQT 5EK4A 4HFVA 4JEHB 4L9IA 2LSYA 1WLXA 2WWVA 3QB5K 2FJEA 4IE5A 3OBVE 2IW5B 3CVRA 2LOPA 4CXXA 4J2CA 3Q5XA 1MIVA 1WR0A 1W0BA 4QH4A 3VRAA 3P4RA 3T8OA 4CN6A 1BR2A 5LBMA 3CX6B 4DBRA 4HFHA 5CGMA 3AEGA 1D1AA 2B1EA 3ZC0A 4YT0A 2VKHA 5AQFB 3C50A 3I1AA 5JDQA 4JI6T 3AAAB 4EZ4A 2ACZA 3ZMZB 1QUUA 3PJAA 4OK0A 4HKAA 2XQ5A 3ZYKA 3JAEA 4GKKT 5AQLB 2Q9QB 3ZPOA 2ZMAA 4ZI7E 4MLKA 4MBQA 3UU5A 2H89A 2V8SV 5EK2A 2BBHA 4EEDA 2WM9A 3BK9A 2YDRA 4KMCA 1Z0PA 2OV9A 4NUVA 4XZCA 2A72A 3FXEB 2UXDT 4AIUA 2HH7A 1HFAA 2NW8A 2PTFA 3L39A 2KNDA 3UTKA 4ERRA 4CN1A 4DUYT 4Z90A 3N2KE 1HTJF 2X0YA 1ZP0A 5JDMA 5DJQC 2X68A 2A3DA 5HXHA 5JVDE 4EGWA 2ZM0A 2QGSA 4JEUB 5CFBA 1YW0A 2V26A 4GKJT 3AEBA 3RRWA 4DR7T 1O3XA 4JBWF 5H6QB 2K3WA 4CQIA 2PFVA 2RPAA 1IJ6A 2E5VA 3AXJB 4YJ3E 2P9BA 1NENA 5IYZE 1IBKT 2LM2A 4JI3T 1MIYA 2KMFA 4IL9A 3KVAA 5HEUA 3TLTA 2HPJA 1Y01A 2LKHA 3CIRA 4I4TE 2HN1A 1MMNA 2LM9A 3K3NA 3LDQB 1E2AA 3ZMTB 4DV2T 5C8YE 2YDQA 4O2BE 5HEOA 3SFDA 4EEBA 4U72A 3N9PA 2V7LA 4QXHB 4HWIB 3X1DA 3AXJA 3OJAA 2JQHA 3KINB 2A2FX 3A5XA 1ZHCA 4O4HE 1XZYA 4LMLA 2VB6A 3F31A 1BR0A 2WBLA 4DR6T 2D0TA 3HKEE 2VQET 5KMGP 2XJ7A 4X64T 2VURA 4A56A 2DWKA 4IE6A 2Y48B 1N32T 3V5UA 4H9PC 2CXDA 2MOZA 1JNZA 5FY7A 3T1YT 4FI5A 5LHGB 2EHOB 4DMVA 2ACXA 2X0LB 1VRBA 3AE9A 2M67A 2LT3A 4GYRA 3CQCB 4ZI3C 2LOSA 4HWHA 3W15B 3LK3B 2VKJA 3N2GE 2XQ9A 2WZIA 4LF5T 1L0VA 3E08A 4OYKA 4F8HA 3ZT5A 2KWHA 4UV9B 3Q2MA 3RF1A 4EIWA 5AFUL 3PDYA 4DIDB 1WYCA 3N2OA 4UIGA 3M3ZB 1HX1B 2CXLA 3RKOA 1IJ5A 4AKIA 2NW9A 3LBXA 2JJ9A 4ZS2A 3J9X1 3FBZA 1N34T 1OEDB 2I59A 4YHHT 1HR0T 4UF0A 5ABHA 3FZKB 2CBJA 4Z91A 1MNEA 2VASA 2NW7A 2XHEB 4DV0T 4ILBA 2LSJA 2Q9QC 5HXEA 2WQYA 1UGOA 2DHRA 3UQ7A 1E7PA 5LCYA 1T7SA 5L47A 3AAEB 2R6GF 3BQIA 4KX6A 3HI2A 3Q5EA 5FXXA 2KZ7B 1OEDA 4HEAA 4C91A 3Q5WA 2CCQA 2CRBA 4YY3T 3FXDB 4NIQA 4UVCB 2UU9T 3ANWB 2X9WA 3AE7A 4H9QC 3FZLB 1XNQT 4Z8XA 2J62A 3EAMA 4JI8T 1D1CA 2WZHA 5F3JA 2LSGA 1NWMX 3ZT7A 4JI7T 4YHJA 4YTNA 1UUSA 3ESLA 4H9OC 3AEEA 3ANWA 4AKLA 2D0UA 1OWAA 3P4WA 5AQTB 1SHZC 3A7MA 2L3LA 3QUJA 2B76A 2XQ3A 4LF6T 4ZXLA 4PK6A 3ZCIA 4U74A 4QH1A 1VOMA 4TWFA 4UEMA 4GOUA 1T8BA 4CXYA 2CA5A 3HA4A 3RYIE 5HCMA 3QK6A 4JI5T 4PFPA 4HFIA 3F57A 2WDQA 3RIFA 2CM0A 4PFOA 2BG9B 2A9UA 4DBQA 4ILCA 1ZEEA 2RP4A 4O8SA 1HS7A 2VKOA 3L3PA 1FJGT 5CA1E 3AE4A 2OLTA 2LSKA 4Q25A 2F4VT 4ANJA 2J1DG 4L5GA 2WB5A 2W0GA 2YU2A 3O9XA 3UT5E 4DMWA 4ZI2C 3ZT6A 4PK5A 3C64A 3UU6A 3ZKRA 4HFBA 2EHOC 1Y64B 2JIWA 1UURA 4WW0A 2ZM6T 3C98B 4ZZBA 2X9XA 2W4XA 4YSZA 2IUBA 5F8PA 1YQ3A 3P4PA 1FEWA 4OHFA 4TX5A 3OYZA 4EYYR 3K1SA 5H6RB 4P09A 2VL8A 3QNUA 3I0OA 5ADXL 4BJNA 3WAJA 4EOZB 3PUXF 4L0RA 5LG4A 3AAIA 2XAGB 2KSRA 3JC6D 3TKLB 5C3JA 5HXCA 5KXJA 2LHRA 5LGUB 1KNPA 4LF9T 2I0MA 1XDPA 5DABA 3UUMA 3VR9A 4IREA 4UELA 5DQVA 2BS3A 4DR1T 4TV9E 3CK6A 5J2UE 3AE8A 5AQMB 2AE9A 4V1Av 2XUEA 3EUHA 3NBXX 5J0ZA 2I6HA 2HPLA 3LK2B 5L3EB 4G2AA 3TLWA 1N33T 4N78D 4YSXA 3OPCA 4ZEYA 1SA0E 4EAHA 2XY8B 5HEHA 4AQFA 2XTLA 2UXXB 1IZNB 4JYAT 2E9XA 5LNKA 3UU3A 5EK3A 3RC3A 4P0AA 4CI1B 5L3CB 5JRCA 1XMOT 3ETVA 4I50E 3BQKA 4IDOA 3M65A 2CLYB 4QXBB 4TV8E 2N2NA 5LA6E 5LHIB 3RGLA 5CA0E 2J4GA 3RC8A 2XPKA 4DV5T 2LE8A 4KHZF 5LGTB 5EZYE 3PV0F 3HR0A 3DTOA 2QA7A 4AKRB 4H63H 4IL4A 2YINA 3C4ZA 3GA8A 2K9AA 3PUVF 2NP9A 2HHHT 4HGAA 3RYHE 4ZS3A 5AQNB 5IHYA 3TLUA 4TWHA 1FMWA 2J47A 3N5LA 3VRBA 4EZHA 1G73A 2BKNA 2XM2A 4UXNB 2L9QA 5AQSB 1D0ZA 1US7B 2XZEA 2XAHB 4K0KT 5FXWA 2BS4A 4DNDA 4MFRA 3ZN1B 1ZKEA 4HN9A 1KNZA 1ZV4X 1NEKA 3CPZA 4AXPA 5LMNT 5IUXA 2RA1A 3AE2A 3FZFB 4DV7T 4TWDA 4XBFB 3RLFF 5LOVE 1MIWA 5FY1A 2DNXA 4JLEA 2XQ6A 3ZJ2A 2SPCA 4E7SA 4DUZT 5FY0A 2BG9C 4QX8B 5L3BB 1Z8UA 5HWXA 2LHNA 4X1KE 2VK9A 3VKGA 2KT9A 4P0BA 2DCFA 5HXRA 1MMAA 1FMVA 3P4QA 2C5IT 5JR9A 3SRZA 5HXSA 3OYXA 2NR4A 3NRYA 2L8KA 5A1LA 2VVNA 4PJMA 1ZOYA 5ETWA 3RQUA 5HAXA 3E22E 2MTQA 2D5UA 2VL0A 5C2TA 5L4HA 4IHJE 2H3RA 4HFCA 4I55E 3HKCE 2V7IA 2W61A 3T1HT 5LJMA 3UUBA 3ZEFB 2CHNA 2CXFA 3LK42 4PJLA 3ETUA 4ILUA 5L2LA 4EXTA 3LFMA 3PUYF 5E0OA 5FL0A 4I0UA 3NRXA 1HNXT 5FVKA 5HEGA 2MAWA 3O1JA 5AQGB 3Q5DA 3LBXB 2D9DA 2W67A 2WS3A 4OFZA 5HCJA 3S4UA 3KV5A 5BR8T 1HNWT 4ISTA 2YK0A 5L3DB 5LG3A 2E9XD 3RIAA 2VWAA 4YFSA 4LFBT 2UXCT 3ZSSA 3J7Yq 4UF0B 3N9MA 3AA7B 3SFEA 3VHLA 1MMDA 3RH3A 3ONLC 3UU8A 4BAYB 3KV4A 1YD8G 3ABVA 2LLYA 5GONE 3HL6A 3AE1A 3HKBE 4A98A 1QLBA 1I94T 4IE7A 3PUZF 2JQ9A 5LP6E 1BR1A 2IHR1 5JTGA 3UFEA 3LSVA 2LKGA 1UX5A 5ABEA 3ZYMA 4FJOA 4EV6A 4AKHA 5AQPB 3NZQA 4C90A 3FHNA 2IIUA 4CN4A 4KI0F 3AVRA 3R84B 4PW8A 5L3FB 3PURA 3FBLA 3AVSA 3ZJ1A 5DQWA 3MZKB 2WDRA 4JI0T 3B13A 2CEAA 3GMIA 2X66A 4DV3T 1KK7A 2W66A 2JMHA 1WFDA 4HFDA 4TN7B 3RHWA 5LHHB 5LYJE 3IA3A 3CQXC 5LMUT 4YTPA 3CWZB 5AQVB 2V6YA 4LF8T 3DJBA 3FZMB 3ZMVB 5AQIB 2KXPB 3FB2A 3EI0A 2JMKA 4ZOLE 1T98A 4O4JE 1KFYA 1WCRA 2UUAT 4O2AE 4TZ4C 4DV6T 1XWMA 2OA5A 1MMGA 2Z6EA 2IC9A 5J1GA 3UQ4A 2YOEA 4U7YA 4AQGA 3QB5A 4CXWA 1KEYA 5JDLA 3MK7C 2XM1A 2XQ4A 4IIJE 5FXVA 4JI2T 1YKHB 2XAFB 4UVAB 2W62A 5LGNB 4DV1T 3N9QA 3KBTA 2WU2A 2ZM2A 3L09A 4U3CA 2JRKA 2NTYA 4IT4A 1AJ3A 4PNIA 3NWIA 4LF4T 5AQRB 2WU5A 2PBIA 1WR6A 3RIUC 2XQAA 4WBNE 1LVFA 2WWUA 4X20E 5FP3A 4KBMB 3FZHB 3UU4A 1D1BA 1D0YA 4UR9A 2H88A 3IF8B 4ADZA 3NVOA 4TUYE 2X9YA 2IC6A 3QC9A 4H63V 1CHUA 2UXBT 4UV8B 2X9HA 1LKXA 4TNVA 4HWFA 2BVLA 1N36T 4YJ2E 2JQQA 3JC6C 2ODUA 3ZYLA 2UXNB 1W0AA 2V6XA 3UULA 2BS2A 1SE7A 2GK9A 3HKDE 3C4WA 5FNVE 3C51A 3AE3A 2M6IA 2IMLA 2V7MA 1WYBA 2AXDS 3UUNA 3RYFE 1WRDA 4HWDA 3VKHA 4LMJA 3RPUA 2JPFA 4DR2T 5JDNA 3EDVA 4KHPT 3CMLA 2E9XB 2KINB 4X1IE 2N9DA 4I43B 3A8YC 5JRCB 3IEEA 2KLQA 3PUAA 2C5KT 4ZZCA 1HCIA 2VKDA 3F2EA 4B3MT 2CMRA 5FXZA 1OEDC 4BA9A 2N1GA 1R8IA 2D2SA 1HG5A 2WSSV 3KVBA 4IE4A 1J5ET 2V7KA 1HG2A 4U2YA 4X5TA 4PJNA 5FKYA 4IDNA 2XAQB 4A97A 3IBPA 1UX4A 2E2AA 2CE7A 1H7CA 2WDVA 5ABGA 3SS1A 3P4SA 2WMOA 3RI5A 3DP7A 3PUGA 3U3IA 2X0HA 3N9NA 2X51A 4JUYA 2QRXA 4LMKA 1IAPA 2W2UA 3CX8B 3PTRB 3WAKA 5LBQB 2YN6A 2WP9A 2CWOA 1HX8A 2WAUA 5LJNA 1KF6A 2WY2A 1S94A 2DL1A 3ZN0B 3CQGB 4HE8A 3TLVA 3UUXB 1GQEA 4ASKA 2FUPA 2ZLYA 4CI3B 4B6XA 5LB7B 3VR8A 2YKSA 3H3MA 4P1NA 3G06A 2K24A 2E5LT 1IBLT 3IHRA 5AQUB 5CJ5A 1XNRT 4OX9T 3KFWX 3AB3B 3SOLA 4PAGA 3B5MA 5JDGA 2Q9QA 2UUBT 4PK4A 4AI6A 1S35A 3WI3A 5JR9B 2XASB 3GWHA 5FL1A 3ONXA 3PUQA 2FJBA 3AA6B 2HN2A 1OEDE 1UCUA 2PG8A 2CHOA 5KDMC 2BKOA 4QHOA 4H9RC 2XQ8A 2LEHA 3VU7H 4KUMB 2W63A 1V9DA 1SUMB 2BDEA 2NTXA 3Q9DA 2H7VC 4QWNB 2IAKA 5JREA 3H3AA 4X66T 1JNRA 5FVLA 5HYAA 4COFA 2LRKA 3E0ZA 3V5SA 4QH5A 3MKDA 2XQ7A 2Y8DA 2DI4A 1KNRA 5KX5E 2PJQA 4M1PA 1NAFA 4IDZA 4EYUA 3ZMUB 3D0TA 2ES0A 3B57A 4DR4T 2FJAA 4LFAT 4OYJA 4U33A 3MACA 1HF8A 3UFGA 2V5DA 3K3OA 5L3GB 3PE0A 4JI1T 4PJJA 3ZCJA 1MNDA 3CKDA 5FMNA 5TAOA 3JADA 3P8CD 3K8PC 1E1HB 2UUCT 4AQFC 2V7JA 2NOXA 3PUWF 2FBWA 1IBMT 4ILAA 5JQGE 2E9XC 2YDSA 3CX7B 3I9YA 2W00A 4WNKA 1B7TA 4GK0E 3LJCA 3PU3A 3MA9A 3AE5A 4H9SE 3KV6A 2XSAA 5ABFB 3JAFA 2C0SA 1VCSA 3RIUA 4HFEA 3RX6A 3AECA 1HNZT 1M7KA 4LF7T 4QX7B 3U78A 4IDQA 3EDUA 1W09A 4MALA 5AQOB 4BJMA 3O1HA 2BBJA 4U31A 1LRZA 4GK5E 2BG9E 4X65T 1M62A 3OVUA 4ISSA 2EHOA 4QKNA
chains in the Genus database with same CATH topology
4MHCA 5FXVA 1CUNA 1YKHB 2XAFB 4UVAB 3ZMSB 2W62A 2V1DB 5LGNB 3KBUA 1SA0E 4ZI3D 4EAHA 1MIYA 2KMFA 3N9QA 4AQFA 3KVAA 2XTLA 2HPJA 2UXXB 3KBTA 3OKQA 1IZNB 2CLYC 3AA1B 4I4TE 2E9XA 3MJXA 5LNKA 2ZM2A 1X79A 2H7OA 5EK3A 3RC3A 1MMNA 2LM9A 3K3NA 5CB4E 4P0AA 3L09A 2JRKA 3ZMTB 5M4YA 2NTYA 4X1YE 5C8YE 4CI1B 4O2BE 1YKEB 5L3CB 5FYMA 1AJ3A 3ZC1A 5JRCA 4U72A 3N9PA 4PNIA 3MXZA 2V7LA 3ETVA 4UVBB 4QXHB 4I50E 3BQKA 4KP3C 3OJAA 3M65A 4YLHA 2PBIA 2CLYB 4QXBB 1WR6A 3KINB 3EVYA 2A2FX 4TV8E 3O4XE 3I0QA 3P7IA 3A5XA 2N2NA 4WBNE 5LA6E 5LHIB 1LVFA 1ZHCA 2WWUA 4X20E 5CA0E 4O4HE 3RC8A 5FP3A 4KBMB 2NWBA 2VB6A 3F31A 1D1BA 2E8IA 2LE8A 4O4LE 1OXZA 1BR0A 1D0YA 2WBLA 3IF8B 2D0TA 4ADZA 4TUYE 2X9YA 5LGTB 2IC6A 3QC9A 3HKEE 4H63V 4UV8B 5EZYE 5KMGP 2X9HA 3HR0A 1LKXA 3DTOA 2QA7A 4AKRB 2BVLA 4XAXB 4YJ2E 2JQQA 3JC6C 4A56A 4H63H 2ODUA 2DWKA 3ZYLA 4DO0A 2UXNB 2YINA 3C4ZA 3UULA 4IE6A 2Y48B 3GA8A 2CWYA 2GK9A 2K9AA 3RRCA 2KWIB 2DLRA 3HKDE 3C4WA 3O1IA 2NP9A 5FNVE 3C51A 2Q9QD 3V5UA 4H9PC 2CXDA 4G63A 2MOZA 4H9NC 2V7MA 3NZPA 1WYBA 5FY7A 4HGAA 3RYHE 4ZS3A 2YEVC 4GIWA 5IHYA 3UUNA 4FI5A 3C4XA 5LHGB 1FMWA 2K5BB 3R6NA 3RYFE 1WRDA 3N5LA 2EHOB 5JDFA 4EZHA 1G73A 3VKHA 3H37A 4DMVA 3RPUA 3SWHA 2JPFA 2ACXA 1BR4A 2X0LB 4UXNB 2L9QA 2LJLA 3PUSA 5JDNA 5JR9C 1VRBA 3EDVA 5HWYA 1D0ZA 4IGUA 1US7B 2M67A 2XAHB 3CMLA 2LT3A 5FXWA 4GYRA 2E9XB 2KINB 4X1IE 4DNDA 4MFRA 4NUUA 3K3QC 3GN5B 4K0UA 3CQCB 1U5PA 4ZI3C 2LOSA 3ZN1B 3W15B 4DVDA 1ZKEA 4HN9A 3LK3B 2VKJA 2BVMA 1G8XA 3N2GE 1KNZA 1ZV4X 1EZ3A 2N9DA 4I43B 2ODVA 3CPZA 5JRCB 4AXPA 2RA1A 2KLQA 3IEEA 3PUAA 2C5KT 4XBFB 3E08A 1HCIA 2XAJB 3LG7A 3AA0B 4QXCB 5LOVE 1MIWA 4OYKA 2VKDA 3ZLIA 5FY1A 2DNXA 4JLEA 2KWHA 4UV9B 3ZJ2A 3Q2MA 3F2EA 4EIWA 5AFUL 3PDYA 2CMRA 5FXZA 2SPCA 4E7SA 1WYCA 3N2OA 4BA9A 2N1GA 4UIGA 2D2SA 2CXLA 5FY0A 1HG5A 2WSSV 4QX8B 5L3BB 3KVBA 4CZZB 3RKOA 1IJ5A 2K48A 2WMNA 5BMVE 4IE4A 3GN5A 4AKIA 2ZM8A 2NW9A 2V7KA 1QSDA 1HG2A 3LBXA 2JJ9A 5HWXA 3I9WA 3KDSE 2LHNA 4X1KE 1LVKA 2BZBA 2VK9A 4PJNA 4ZS2A 3VKGA 2KT9A 3J9X1 4P0BA 2DCFA 2DWGA 1MMAA 2XQYA 5HXRA 2XAQB 1FMVA 3FBZA 2C5IT 5JR9A 3SRZA 2I59A 3IBPA 5HXSA 1UX4A 3OYXA 4UF0A 2CE7A 3NRYA 1H7CA 2L8KA 5A1LA 3SS1A 4EB6E 2WMOA 3DP7A 4PJMA 3PUGA 1MNEA 2VASA 5ETWA 3U3IA 2NW7A 2XHEB 5HAXA 2LSJA 3E22E 2Q9QC 2MTQA 3N9NA 2X51A 4JUYA 2D5UA 5HXEA 4AKGA 2DHRA 1D0XA 5LCYA 1IAPA 4WBOA 3CX8B 4IHJE 2YU1A 3PTRB 2H3RA 3WAKA 5LBQB 3AAEB 2CWOA 3KV9A 1HX8A 3BQIA 4I55E 3HKCE 2V7IA 2WAUA 2W61A 5LXTE 5LJNA 5LJMA 4ZHQE 3HI2A 5FXXA 2KZ7B 4HEAA 1S94A 4C91A 3ZN0B 3CQGB 3Q5WA 2CCQA 3ZEFB 2Y6XA 3FXDB 4HE8A 4IE0A 4UVCB 5J2TE 2CXFA 3LK42 3ANWB 4PJLA 4E7ZA 3BQLA 2X9WA 3ETUA 3UUXB 4H9QC 4ASKA 4ILUA 2ZLYA 4CI3B 4Z8XA 4B6XA 1FIOA 2MYSA 3RYCE 5L2LA 2LSIA 5JDHA 4EXTA 1D1CA 2K24A 3PU8A 5F3JA 3LFMA 2LSGA 4O4IE 5E0OA 4ZI2D 1U4QA 2G0UA 1NWMX 3IHRA 3NRXA 5JH7E 4CI2B 4YHJA 2EHOD 3KFWX 3AB3B 3N9OA 3SOLA 4PAGA 3O1JA 4F6RC 3LBXB 3ESLA 4H9OC 5JDGA 2Q9QA 4OFZA 2X67A 3ANWA 4PK4A 3S4UA 3KV5A 2MBGA 4AKLA 1S35A 4AI6A 2D0UA 3N9LA 1OWAA 4HTEA 4ISTA 3WI3A 2YK0A 1SHZC 5JR9B 5L3DB 2E9XD 2VWAA 2XASB 3GWHA 4YFSA 3ONXA 4GYSA 3J7Yq 3PUQA 4UF0B 3N9MA 3AA7B 2L3LA 3AA6B 3QUJA 1UCUA 2PG8A 2C5JA 5KDMC 3VHLA 1MMDA 4QHOA 4H9RC 2LEHA 4PK6A 3RH3A 5EK4A 3ZCIA 4U74A 3VU7H 4KUMB 1VOMA 4HFVA 2W63A 4JEHB 1V9DA 4L9IA 4UEMA 2LSYA 4GOUA 1WLXA 2BDEA 4BAYB 3KV4A 4IE5A 1YD8G 2NTXA 3Q9DA 2H7VC 3OBVE 2IW5B 4CXYA 4QWNB 2IAKA 3CVRA 2LOPA 5JREA 2CA5A 4CXXA 3HA4A 3RYIE 3H3AA 4J2CA 3QK6A 3Q5XA 5GONE 5HYAA 1MIVA 4PFPA 3F57A 3HL6A 2CM0A 4PFOA 3E0ZA 3V5SA 3MKDA 4DBQA 3HKBE 3T8OA 1BR2A 4IE7A 2Y8DA 1ZEEA 2RP4A 5LBMA 2DI4A 5KX5E 3CX6B 4DBRA 4O8SA 2PJQA 5LP6E 1D1AA 2B1EA 4M1PA 1HS7A 1BR1A 3ZC0A 1NAFA 4IDZA 2VKOA 2VKHA 3L3PA 3UFEA 3ZMUB 4EYUA 3D0TA 2ES0A 3B57A 3C50A 3I1AA 5JDQA 5CA1E 1UX5A 3AAAB 4OYJA 2LSKA 3MACA 3ZYMA 4EZ4A 4FJOA 1HF8A 4ANJA 3ZMZB 4AKHA 1QUUA 2J1DG 4L5GA 2W0GA 3K3OA 4HKAA 4OK0A 3NZQA 4C90A 2YU2A 3FHNA 3O9XA 3ZYKA 5L3GB 3AVRA 3R84B 3UT5E 4DMWA 4ZI2C 3PE0A 2Q9QB 4PW8A 4PJJA 5L3FB 4PK5A 3C64A 3ZPOA 3ZCJA 3PURA 3FBLA 2ZMAA 3AVSA 3ZJ1A 1MNDA 5DQWA 2EHOC 1Y64B 3CKDA 4ZI7E 4MLKA 4WW0A 3C98B 5FMNA 3MZKB 5TAOA 4MBQA 2X9XA 3P8CD 3K8PC 3B13A 2CEAA 3GMIA 2X66A 1E1HB 5EK2A 4AQFC 3BK9A 2V7JA 2WM9A 2NOXA 5F8PA 1KK7A 1FEWA 4OHFA 4TX5A 2JMHA 4KMCA 5JQGE 2E9XC 1Z0PA 3OYZA 3CX7B 3I9YA 2W00A 4NUVA 4XZCA 5H6RB 4EYYR 4P09A 4TN7B 2VL8A 3I0OA 2A72A 3FXEB 5ADXL 5LHHB 5LYJE 4BJNA 4WNKA 3WAJA 4EOZB 3CQXC 4L0RA 5LG4A 3CWZB 2HH7A 2XAGB 3AAIA 1HFAA 1B7TA 4GK0E 3JC6D 3TKLB 3LJCA 3PU3A 3DJBA 3MA9A 3ZMVB 2NW8A 5HXCA 4H9SE 2KNDA 3KV6A 2KXPB 3FB2A 3UTKA 4ERRA 2LHRA 3N2KE 5LGUB 1HTJF 2C0SA 2JMKA 4ZOLE 5DABA 1T98A 4O4JE 5DJQC 3RX6A 2X68A 5JDMA 3UUMA 2A3DA 4QX7B 3U78A 4UELA 5HXHA 5DQVA 5JVDE 3EDUA 2ZM0A 4TV9E 5J2UE 4O2AE 2QGSA 4JEUB 4MALA 4TZ4C 4BJMA 1YW0A 3O1HA 2OA5A 1LRZA 2V26A 4V1Av 4GK5E 3RRWA 2XUEA 3EUHA 3NBXX 1O3XA 1MMGA 2HPLA 2Z6EA 2IC9A 5J1GA 5H6QB 3LK2B 5L3EB 4G2AA 4AQGA 4CQIA 4ISSA 4N78D 2PFVA 4CXWA 5JDLA 1IJ6A 2EHOA 4YJ3E 3MK7C 2P9BA 4QKNA 4IIJE 5IYZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOZ A;  2M67 A; 
#chains in the Genus database with same CATH topology
 4MHC A;  2QVA A;  1CUN A;  3ZMS B;  2V1D B;  5IWA T;  3KBU A;  4ZI3 D;  4A5X A;  5ABF A;  4B3S T;  3OKQ A;  2CLY C;  3AA1 B;  3MJX A;  1X79 A;  2FJD A;  2H7O A;  5CB4 E;  1W9R A;  5M4Y A;  4JV5 T;  2CPT A;  5HEJ A;  4X1Y E;  1YKE B;  5FYM A;  3ZC1 A;  2IDO B;  1I6Z A;  3MXZ A;  4UVB B;  4KP3 C;  4YLH A;  5F5W A;  3EVY A;  2JQK A;  3O4X E;  3I0Q A;  3P7I A;  2NWB A;  3JCF A;  4DV4 T;  2QYW A;  2E8I A;  4O4L E;  1YQ4 A;  1OXZ A;  2V6Y B;  5AQJ B;  3EAB A;  1T72 A;  4XAX B;  4DO0 A;  1DU2 A;  2CWY A;  3RRC A;  2KWI B;  2DLR A;  2M6B A;  3O1I A;  2Q9Q D;  4G63 A;  4H9N C;  3NZP A;  2YEV C;  4GIW A;  3C4X A;  2K5B B;  3R6N A;  5AQK B;  5JDF A;  3H37 A;  3SWH A;  1BR4 A;  2LJL A;  3PUS A;  5JR9 C;  5HWY A;  4IGU A;  2MPK A;  3PJA J;  4U2Z A;  4TNW A;  4NUU A;  3K3Q C;  3GN5 B;  4K0U A;  1U5P A;  4DVD A;  2BVM A;  1G8X A;  1EZ3 A;  1VCT A;  2ODV A;  3EHZ A;  4WZX A;  4B3R T;  4QXC B;  2XAJ B;  3LG7 A;  3AA0 B;  1UK5 A;  3ZST A;  3ZLI A;  5L4E A;  4HWC A;  3RKG A;  4CZZ B;  2K48 A;  2WMN A;  5BMV E;  3GN5 A;  2ZM8 A;  1J5W A;  1QSD A;  3I9W A;  3KDS E;  1LVK A;  2BZB A;  2DWG A;  2XQY A;  4YTM A;  4JI4 T;  3OTO T;  2WCA A;  4EB6 E;  4IDP A;  2XSB A;  2LRL A;  3ONJ A;  4DR3 T;  2VQF T;  1J1J A;  3TLS A;  4AIS A;  2CBI A;  3QOF A;  4AKG A;  1D0X A;  1X9B A;  3AE6 A;  3AED A;  4WBO A;  2YU1 A;  5AQQ B;  3KV9 A;  1XDO A;  5LXT E;  4ZHQ E;  4X62 T;  1YXR A;  2Y6X A;  2BG9 A;  4IE0 A;  5J2T E;  4E7Z A;  3BQL A;  4YSY A;  1FIO A;  2MYS A;  3RYC E;  2LSI A;  5JDH A;  2BKP A;  3PU8 A;  4O4I E;  3NKZ A;  4NPP A;  4ZI2 D;  1U4Q A;  2G0U A;  2V5C A;  4AQY T;  3AEF A;  5JH7 E;  4CI2 B;  4LFC T;  2EHO D;  3N9O A;  3L8R A;  4F6R C;  4DR5 T;  3AEA A;  2X67 A;  2MBG A;  3N9L A;  4HTE A;  4B3T T;  4YXD A;  4U7I A;  5AQH B;  3P50 A;  4WYV A;  4GYS A;  2VVS A;  2C5J A;  4NXN T;  4NXM T;  3RQW A;  1XMQ T;  5EK4 A;  4HFV A;  4JEH B;  4L9I A;  2LSY A;  1WLX A;  2WWV A;  3QB5 K;  2FJE A;  4IE5 A;  3OBV E;  2IW5 B;  3CVR A;  2LOP A;  4CXX A;  4J2C A;  3Q5X A;  1MIV A;  1WR0 A;  1W0B A;  4QH4 A;  3VRA A;  3P4R A;  3T8O A;  4CN6 A;  1BR2 A;  5LBM A;  3CX6 B;  4DBR A;  4HFH A;  5CGM A;  3AEG A;  1D1A A;  2B1E A;  3ZC0 A;  4YT0 A;  2VKH A;  5AQF B;  3C50 A;  3I1A A;  5JDQ A;  4JI6 T;  3AAA B;  4EZ4 A;  2ACZ A;  3ZMZ B;  1QUU A;  3PJA A;  4OK0 A;  4HKA A;  2XQ5 A;  3ZYK A;  3JAE A;  4GKK T;  5AQL B;  2Q9Q B;  3ZPO A;  2ZMA A;  4ZI7 E;  4MLK A;  4MBQ A;  3UU5 A;  2H89 A;  2V8S V;  5EK2 A;  2BBH A;  4EED A;  2WM9 A;  3BK9 A;  2YDR A;  4KMC A;  1Z0P A;  2OV9 A;  4NUV A;  4XZC A;  2A72 A;  3FXE B;  2UXD T;  4AIU A;  2HH7 A;  1HFA A;  2NW8 A;  2PTF A;  3L39 A;  2KND A;  3UTK A;  4ERR A;  4CN1 A;  4DUY T;  4Z90 A;  3N2K E;  1HTJ F;  2X0Y A;  1ZP0 A;  5JDM A;  5DJQ C;  2X68 A;  2A3D A;  5HXH A;  5JVD E;  4EGW A;  2ZM0 A;  2QGS A;  4JEU B;  5CFB A;  1YW0 A;  2V26 A;  4GKJ T;  3AEB A;  3RRW A;  4DR7 T;  1O3X A;  4JBW F;  5H6Q B;  2K3W A;  4CQI A;  2PFV A;  2RPA A;  1IJ6 A;  2E5V A;  3AXJ B;  4YJ3 E;  2P9B A;  1NEN A;  5IYZ E;  1IBK T;  2LM2 A;  4JI3 T;  1MIY A;  2KMF A;  4IL9 A;  3KVA A;  5HEU A;  3TLT A;  2HPJ A;  1Y01 A;  2LKH A;  3CIR A;  4I4T E;  2HN1 A;  1MMN A;  2LM9 A;  3K3N A;  3LDQ B;  1E2A A;  3ZMT B;  4DV2 T;  5C8Y E;  2YDQ A;  4O2B E;  5HEO A;  3SFD A;  4EEB A;  4U72 A;  3N9P A;  2V7L A;  4QXH B;  4HWI B;  3X1D A;  3AXJ A;  3OJA A;  2JQH A;  3KIN B;  2A2F X;  3A5X A;  1ZHC A;  4O4H E;  1XZY A;  4LML A;  2VB6 A;  3F31 A;  1BR0 A;  2WBL A;  4DR6 T;  2D0T A;  3HKE E;  2VQE T;  5KMG P;  2XJ7 A;  4X64 T;  2VUR A;  4A56 A;  2DWK A;  4IE6 A;  2Y48 B;  1N32 T;  3V5U A;  4H9P C;  2CXD A;  2MOZ A;  1JNZ A;  5FY7 A;  3T1Y T;  4FI5 A;  5LHG B;  2EHO B;  4DMV A;  2ACX A;  2X0L B;  1VRB A;  3AE9 A;  2M67 A;  2LT3 A;  4GYR A;  3CQC B;  4ZI3 C;  2LOS A;  4HWH A;  3W15 B;  3LK3 B;  2VKJ A;  3N2G E;  2XQ9 A;  2WZI A;  4LF5 T;  1L0V A;  3E08 A;  4OYK A;  4F8H A;  3ZT5 A;  2KWH A;  4UV9 B;  3Q2M A;  3RF1 A;  4EIW A;  5AFU L;  3PDY A;  4DID B;  1WYC A;  3N2O A;  4UIG A;  3M3Z B;  1HX1 B;  2CXL A;  3RKO A;  1IJ5 A;  4AKI A;  2NW9 A;  3LBX A;  2JJ9 A;  4ZS2 A;  3J9X 1;  3FBZ A;  1N34 T;  1OED B;  2I59 A;  4YHH T;  1HR0 T;  4UF0 A;  5ABH A;  3FZK B;  2CBJ A;  4Z91 A;  1MNE A;  2VAS A;  2NW7 A;  2XHE B;  4DV0 T;  4ILB A;  2LSJ A;  2Q9Q C;  5HXE A;  2WQY A;  1UGO A;  2DHR A;  3UQ7 A;  1E7P A;  5LCY A;  1T7S A;  5L47 A;  3AAE B;  2R6G F;  3BQI A;  4KX6 A;  3HI2 A;  3Q5E A;  5FXX A;  2KZ7 B;  1OED A;  4HEA A;  4C91 A;  3Q5W A;  2CCQ A;  2CRB A;  4YY3 T;  3FXD B;  4NIQ A;  4UVC B;  2UU9 T;  3ANW B;  2X9W A;  3AE7 A;  4H9Q C;  3FZL B;  1XNQ T;  4Z8X A;  2J62 A;  3EAM A;  4JI8 T;  1D1C A;  2WZH A;  5F3J A;  2LSG A;  1NWM X;  3ZT7 A;  4JI7 T;  4YHJ A;  4YTN A;  1UUS A;  3ESL A;  4H9O C;  3AEE A;  3ANW A;  4AKL A;  2D0U A;  1OWA A;  3P4W A;  5AQT B;  1SHZ C;  3A7M A;  2L3L A;  3QUJ A;  2B76 A;  2XQ3 A;  4LF6 T;  4ZXL A;  4PK6 A;  3ZCI A;  4U74 A;  4QH1 A;  1VOM A;  4TWF A;  4UEM A;  4GOU A;  1T8B A;  4CXY A;  2CA5 A;  3HA4 A;  3RYI E;  5HCM A;  3QK6 A;  4JI5 T;  4PFP A;  4HFI A;  3F57 A;  2WDQ A;  3RIF A;  2CM0 A;  4PFO A;  2BG9 B;  2A9U A;  4DBQ A;  4ILC A;  1ZEE A;  2RP4 A;  4O8S A;  1HS7 A;  2VKO A;  3L3P A;  1FJG T;  5CA1 E;  3AE4 A;  2OLT A;  2LSK A;  4Q25 A;  2F4V T;  4ANJ A;  2J1D G;  4L5G A;  2WB5 A;  2W0G A;  2YU2 A;  3O9X A;  3UT5 E;  4DMW A;  4ZI2 C;  3ZT6 A;  4PK5 A;  3C64 A;  3UU6 A;  3ZKR A;  4HFB A;  2EHO C;  1Y64 B;  2JIW A;  1UUR A;  4WW0 A;  2ZM6 T;  3C98 B;  4ZZB A;  2X9X A;  2W4X A;  4YSZ A;  2IUB A;  5F8P A;  1YQ3 A;  3P4P A;  1FEW A;  4OHF A;  4TX5 A;  3OYZ A;  4EYY R;  3K1S A;  5H6R B;  4P09 A;  2VL8 A;  3QNU A;  3I0O A;  5ADX L;  4BJN A;  3WAJ A;  4EOZ B;  3PUX F;  4L0R A;  5LG4 A;  3AAI A;  2XAG B;  2KSR A;  3JC6 D;  3TKL B;  5C3J A;  5HXC A;  5KXJ A;  2LHR A;  5LGU B;  1KNP A;  4LF9 T;  2I0M A;  1XDP A;  5DAB A;  3UUM A;  3VR9 A;  4IRE A;  4UEL A;  5DQV A;  2BS3 A;  4DR1 T;  4TV9 E;  3CK6 A;  5J2U E;  3AE8 A;  5AQM B;  2AE9 A;  4V1A v;  2XUE A;  3EUH A;  3NBX X;  5J0Z A;  2I6H A;  2HPL A;  3LK2 B;  5L3E B;  4G2A A;  3TLW A;  1N33 T;  4N78 D;  4YSX A;  3OPC A;  4ZEY A;  1SA0 E;  4EAH A;  2XY8 B;  5HEH A;  4AQF A;  2XTL A;  2UXX B;  1IZN B;  4JYA T;  2E9X A;  5LNK A;  3UU3 A;  5EK3 A;  3RC3 A;  4P0A A;  4CI1 B;  5L3C B;  5JRC A;  1XMO T;  3ETV A;  4I50 E;  3BQK A;  4IDO A;  3M65 A;  2CLY B;  4QXB B;  4TV8 E;  2N2N A;  5LA6 E;  5LHI B;  3RGL A;  5CA0 E;  2J4G A;  3RC8 A;  2XPK A;  4DV5 T;  2LE8 A;  4KHZ F;  5LGT B;  5EZY E;  3PV0 F;  3HR0 A;  3DTO A;  2QA7 A;  4AKR B;  4H63 H;  4IL4 A;  2YIN A;  3C4Z A;  3GA8 A;  2K9A A;  3PUV F;  2NP9 A;  2HHH T;  4HGA A;  3RYH E;  4ZS3 A;  5AQN B;  5IHY A;  3TLU A;  4TWH A;  1FMW A;  2J47 A;  3N5L A;  3VRB A;  4EZH A;  1G73 A;  2BKN A;  2XM2 A;  4UXN B;  2L9Q A;  5AQS B;  1D0Z A;  1US7 B;  2XZE A;  2XAH B;  4K0K T;  5FXW A;  2BS4 A;  4DND A;  4MFR A;  3ZN1 B;  1ZKE A;  4HN9 A;  1KNZ A;  1ZV4 X;  1NEK A;  3CPZ A;  4AXP A;  5LMN T;  5IUX A;  2RA1 A;  3AE2 A;  3FZF B;  4DV7 T;  4TWD A;  4XBF B;  3RLF F;  5LOV E;  1MIW A;  5FY1 A;  2DNX A;  4JLE A;  2XQ6 A;  3ZJ2 A;  2SPC A;  4E7S A;  4DUZ T;  5FY0 A;  2BG9 C;  4QX8 B;  5L3B B;  1Z8U A;  5HWX A;  2LHN A;  4X1K E;  2VK9 A;  3VKG A;  2KT9 A;  4P0B A;  2DCF A;  5HXR A;  1MMA A;  1FMV A;  3P4Q A;  2C5I T;  5JR9 A;  3SRZ A;  5HXS A;  3OYX A;  2NR4 A;  3NRY A;  2L8K A;  5A1L A;  2VVN A;  4PJM A;  1ZOY A;  5ETW A;  3RQU A;  5HAX A;  3E22 E;  2MTQ A;  2D5U A;  2VL0 A;  5C2T A;  5L4H A;  4IHJ E;  2H3R A;  4HFC A;  4I55 E;  3HKC E;  2V7I A;  2W61 A;  3T1H T;  5LJM A;  3UUB A;  3ZEF B;  2CHN A;  2CXF A;  3LK4 2;  4PJL A;  3ETU A;  4ILU A;  5L2L A;  4EXT A;  3LFM A;  3PUY F;  5E0O A;  5FL0 A;  4I0U A;  3NRX A;  1HNX T;  5FVK A;  5HEG A;  2MAW A;  3O1J A;  5AQG B;  3Q5D A;  3LBX B;  2D9D A;  2W67 A;  2WS3 A;  4OFZ A;  5HCJ A;  3S4U A;  3KV5 A;  5BR8 T;  1HNW T;  4IST A;  2YK0 A;  5L3D B;  5LG3 A;  2E9X D;  3RIA A;  2VWA A;  4YFS A;  4LFB T;  2UXC T;  3ZSS A;  3J7Y q;  4UF0 B;  3N9M A;  3AA7 B;  3SFE A;  3VHL A;  1MMD A;  3RH3 A;  3ONL C;  3UU8 A;  4BAY B;  3KV4 A;  1YD8 G;  3ABV A;  2LLY A;  5GON E;  3HL6 A;  3AE1 A;  3HKB E;  4A98 A;  1QLB A;  1I94 T;  4IE7 A;  3PUZ F;  2JQ9 A;  5LP6 E;  1BR1 A;  2IHR 1;  5JTG A;  3UFE A;  3LSV A;  2LKG A;  1UX5 A;  5ABE A;  3ZYM A;  4FJO A;  4EV6 A;  4AKH A;  5AQP B;  3NZQ A;  4C90 A;  3FHN A;  2IIU A;  4CN4 A;  4KI0 F;  3AVR A;  3R84 B;  4PW8 A;  5L3F B;  3PUR A;  3FBL A;  3AVS A;  3ZJ1 A;  5DQW A;  3MZK B;  2WDR A;  4JI0 T;  3B13 A;  2CEA A;  3GMI A;  2X66 A;  4DV3 T;  1KK7 A;  2W66 A;  2JMH A;  1WFD A;  4HFD A;  4TN7 B;  3RHW A;  5LHH B;  5LYJ E;  3IA3 A;  3CQX C;  5LMU T;  4YTP A;  3CWZ B;  5AQV B;  2V6Y A;  4LF8 T;  3DJB A;  3FZM B;  3ZMV B;  5AQI B;  2KXP B;  3FB2 A;  3EI0 A;  2JMK A;  4ZOL E;  1T98 A;  4O4J E;  1KFY A;  1WCR A;  2UUA T;  4O2A E;  4TZ4 C;  4DV6 T;  1XWM A;  2OA5 A;  1MMG A;  2Z6E A;  2IC9 A;  5J1G A;  3UQ4 A;  2YOE A;  4U7Y A;  4AQG A;  3QB5 A;  4CXW A;  1KEY A;  5JDL A;  3MK7 C;  2XM1 A;  2XQ4 A;  4IIJ E;  5FXV A;  4JI2 T;  1YKH B;  2XAF B;  4UVA B;  2W62 A;  5LGN B;  4DV1 T;  3N9Q A;  3KBT A;  2WU2 A;  2ZM2 A;  3L09 A;  4U3C A;  2JRK A;  2NTY A;  4IT4 A;  1AJ3 A;  4PNI A;  3NWI A;  4LF4 T;  5AQR B;  2WU5 A;  2PBI A;  1WR6 A;  3RIU C;  2XQA A;  4WBN E;  1LVF A;  2WWU A;  4X20 E;  5FP3 A;  4KBM B;  3FZH B;  3UU4 A;  1D1B A;  1D0Y A;  4UR9 A;  2H88 A;  3IF8 B;  4ADZ A;  3NVO A;  4TUY E;  2X9Y A;  2IC6 A;  3QC9 A;  4H63 V;  1CHU A;  2UXB T;  4UV8 B;  2X9H A;  1LKX A;  4TNV A;  4HWF A;  2BVL A;  1N36 T;  4YJ2 E;  2JQQ A;  3JC6 C;  2ODU A;  3ZYL A;  2UXN B;  1W0A A;  2V6X A;  3UUL A;  2BS2 A;  1SE7 A;  2GK9 A;  3HKD E;  3C4W A;  5FNV E;  3C51 A;  3AE3 A;  2M6I A;  2IML A;  2V7M A;  1WYB A;  2AXD S;  3UUN A;  3RYF E;  1WRD A;  4HWD A;  3VKH A;  4LMJ A;  3RPU A;  2JPF A;  4DR2 T;  5JDN A;  3EDV A;  4KHP T;  3CML A;  2E9X B;  2KIN B;  4X1I E;  2N9D A;  4I43 B;  3A8Y C;  5JRC B;  3IEE A;  2KLQ A;  3PUA A;  2C5K T;  4ZZC A;  1HCI A;  2VKD A;  3F2E A;  4B3M T;  2CMR A;  5FXZ A;  1OED C;  4BA9 A;  2N1G A;  1R8I A;  2D2S A;  1HG5 A;  2WSS V;  3KVB A;  4IE4 A;  1J5E T;  2V7K A;  1HG2 A;  4U2Y A;  4X5T A;  4PJN A;  5FKY A;  4IDN A;  2XAQ B;  4A97 A;  3IBP A;  1UX4 A;  2E2A A;  2CE7 A;  1H7C A;  2WDV A;  5ABG A;  3SS1 A;  3P4S A;  2WMO A;  3RI5 A;  3DP7 A;  3PUG A;  3U3I A;  2X0H A;  3N9N A;  2X51 A;  4JUY A;  2QRX A;  4LMK A;  1IAP A;  2W2U A;  3CX8 B;  3PTR B;  3WAK A;  5LBQ B;  2YN6 A;  2WP9 A;  2CWO A;  1HX8 A;  2WAU A;  5LJN A;  1KF6 A;  2WY2 A;  1S94 A;  2DL1 A;  3ZN0 B;  3CQG B;  4HE8 A;  3TLV A;  3UUX B;  1GQE A;  4ASK A;  2FUP A;  2ZLY A;  4CI3 B;  4B6X A;  5LB7 B;  3VR8 A;  2YKS A;  3H3M A;  4P1N A;  3G06 A;  2K24 A;  2E5L T;  1IBL T;  3IHR A;  5AQU B;  5CJ5 A;  1XNR T;  4OX9 T;  3KFW X;  3AB3 B;  3SOL A;  4PAG A;  3B5M A;  5JDG A;  2Q9Q A;  2UUB T;  4PK4 A;  4AI6 A;  1S35 A;  3WI3 A;  5JR9 B;  2XAS B;  3GWH A;  5FL1 A;  3ONX A;  3PUQ A;  2FJB A;  3AA6 B;  2HN2 A;  1OED E;  1UCU A;  2PG8 A;  2CHO A;  5KDM C;  2BKO A;  4QHO A;  4H9R C;  2XQ8 A;  2LEH A;  3VU7 H;  4KUM B;  2W63 A;  1V9D A;  1SUM B;  2BDE A;  2NTX A;  3Q9D A;  2H7V C;  4QWN B;  2IAK A;  5JRE A;  3H3A A;  4X66 T;  1JNR A;  5FVL A;  5HYA A;  4COF A;  2LRK A;  3E0Z A;  3V5S A;  4QH5 A;  3MKD A;  2XQ7 A;  2Y8D A;  2DI4 A;  1KNR A;  5KX5 E;  2PJQ A;  4M1P A;  1NAF A;  4IDZ A;  4EYU A;  3ZMU B;  3D0T A;  2ES0 A;  3B57 A;  4DR4 T;  2FJA A;  4LFA T;  4OYJ A;  4U33 A;  3MAC A;  1HF8 A;  3UFG A;  2V5D A;  3K3O A;  5L3G B;  3PE0 A;  4JI1 T;  4PJJ A;  3ZCJ A;  1MND A;  3CKD A;  5FMN A;  5TAO A;  3JAD A;  3P8C D;  3K8P C;  1E1H B;  2UUC T;  4AQF C;  2V7J A;  2NOX A;  3PUW F;  2FBW A;  1IBM T;  4ILA A;  5JQG E;  2E9X C;  2YDS A;  3CX7 B;  3I9Y A;  2W00 A;  4WNK A;  1B7T A;  4GK0 E;  3LJC A;  3PU3 A;  3MA9 A;  3AE5 A;  4H9S E;  3KV6 A;  2XSA A;  5ABF B;  3JAF A;  2C0S A;  1VCS A;  3RIU A;  4HFE A;  3RX6 A;  3AEC A;  1HNZ T;  1M7K A;  4LF7 T;  4QX7 B;  3U78 A;  4IDQ A;  3EDU A;  1W09 A;  4MAL A;  5AQO B;  4BJM A;  3O1H A;  2BBJ A;  4U31 A;  1LRZ A;  4GK5 E;  2BG9 E;  4X65 T;  1M62 A;  3OVU A;  4ISS A;  2EHO A;  4QKN A; 
#chains in the Genus database with same CATH homology
 4MHC A;  5FXV A;  1CUN A;  1YKH B;  2XAF B;  4UVA B;  3ZMS B;  2W62 A;  2V1D B;  5LGN B;  3KBU A;  1SA0 E;  4ZI3 D;  4EAH A;  1MIY A;  2KMF A;  3N9Q A;  4AQF A;  3KVA A;  2XTL A;  2HPJ A;  2UXX B;  3KBT A;  3OKQ A;  1IZN B;  2CLY C;  3AA1 B;  4I4T E;  2E9X A;  3MJX A;  5LNK A;  2ZM2 A;  1X79 A;  2H7O A;  5EK3 A;  3RC3 A;  1MMN A;  2LM9 A;  3K3N A;  5CB4 E;  4P0A A;  3L09 A;  2JRK A;  3ZMT B;  5M4Y A;  2NTY A;  4X1Y E;  5C8Y E;  4CI1 B;  4O2B E;  1YKE B;  5L3C B;  5FYM A;  1AJ3 A;  3ZC1 A;  5JRC A;  4U72 A;  3N9P A;  4PNI A;  3MXZ A;  2V7L A;  3ETV A;  4UVB B;  4QXH B;  4I50 E;  3BQK A;  4KP3 C;  3OJA A;  3M65 A;  4YLH A;  2PBI A;  2CLY B;  4QXB B;  1WR6 A;  3KIN B;  3EVY A;  2A2F X;  4TV8 E;  3O4X E;  3I0Q A;  3P7I A;  3A5X A;  2N2N A;  4WBN E;  5LA6 E;  5LHI B;  1LVF A;  1ZHC A;  2WWU A;  4X20 E;  5CA0 E;  4O4H E;  3RC8 A;  5FP3 A;  4KBM B;  2NWB A;  2VB6 A;  3F31 A;  1D1B A;  2E8I A;  2LE8 A;  4O4L E;  1OXZ A;  1BR0 A;  1D0Y A;  2WBL A;  3IF8 B;  2D0T A;  4ADZ A;  4TUY E;  2X9Y A;  5LGT B;  2IC6 A;  3QC9 A;  3HKE E;  4H63 V;  4UV8 B;  5EZY E;  5KMG P;  2X9H A;  3HR0 A;  1LKX A;  3DTO A;  2QA7 A;  4AKR B;  2BVL A;  4XAX B;  4YJ2 E;  2JQQ A;  3JC6 C;  4A56 A;  4H63 H;  2ODU A;  2DWK A;  3ZYL A;  4DO0 A;  2UXN B;  2YIN A;  3C4Z A;  3UUL A;  4IE6 A;  2Y48 B;  3GA8 A;  2CWY A;  2GK9 A;  2K9A A;  3RRC A;  2KWI B;  2DLR A;  3HKD E;  3C4W A;  3O1I A;  2NP9 A;  5FNV E;  3C51 A;  2Q9Q D;  3V5U A;  4H9P C;  2CXD A;  4G63 A;  2MOZ A;  4H9N C;  2V7M A;  3NZP A;  1WYB A;  5FY7 A;  4HGA A;  3RYH E;  4ZS3 A;  2YEV C;  4GIW A;  5IHY A;  3UUN A;  4FI5 A;  3C4X A;  5LHG B;  1FMW A;  2K5B B;  3R6N A;  3RYF E;  1WRD A;  3N5L A;  2EHO B;  5JDF A;  4EZH A;  1G73 A;  3VKH A;  3H37 A;  4DMV A;  3RPU A;  3SWH A;  2JPF A;  2ACX A;  1BR4 A;  2X0L B;  4UXN B;  2L9Q A;  2LJL A;  3PUS A;  5JDN A;  5JR9 C;  1VRB A;  3EDV A;  5HWY A;  1D0Z A;  4IGU A;  1US7 B;  2M67 A;  2XAH B;  3CML A;  2LT3 A;  5FXW A;  4GYR A;  2E9X B;  2KIN B;  4X1I E;  4DND A;  4MFR A;  4NUU A;  3K3Q C;  3GN5 B;  4K0U A;  3CQC B;  1U5P A;  4ZI3 C;  2LOS A;  3ZN1 B;  3W15 B;  4DVD A;  1ZKE A;  4HN9 A;  3LK3 B;  2VKJ A;  2BVM A;  1G8X A;  3N2G E;  1KNZ A;  1ZV4 X;  1EZ3 A;  2N9D A;  4I43 B;  2ODV A;  3CPZ A;  5JRC B;  4AXP A;  2RA1 A;  2KLQ A;  3IEE A;  3PUA A;  2C5K T;  4XBF B;  3E08 A;  1HCI A;  2XAJ B;  3LG7 A;  3AA0 B;  4QXC B;  5LOV E;  1MIW A;  4OYK A;  2VKD A;  3ZLI A;  5FY1 A;  2DNX A;  4JLE A;  2KWH A;  4UV9 B;  3ZJ2 A;  3Q2M A;  3F2E A;  4EIW A;  5AFU L;  3PDY A;  2CMR A;  5FXZ A;  2SPC A;  4E7S A;  1WYC A;  3N2O A;  4BA9 A;  2N1G A;  4UIG A;  2D2S A;  2CXL A;  5FY0 A;  1HG5 A;  2WSS V;  4QX8 B;  5L3B B;  3KVB A;  4CZZ B;  3RKO A;  1IJ5 A;  2K48 A;  2WMN A;  5BMV E;  4IE4 A;  3GN5 A;  4AKI A;  2ZM8 A;  2NW9 A;  2V7K A;  1QSD A;  1HG2 A;  3LBX A;  2JJ9 A;  5HWX A;  3I9W A;  3KDS E;  2LHN A;  4X1K E;  1LVK A;  2BZB A;  2VK9 A;  4PJN A;  4ZS2 A;  3VKG A;  2KT9 A;  3J9X 1;  4P0B A;  2DCF A;  2DWG A;  1MMA A;  2XQY A;  5HXR A;  2XAQ B;  1FMV A;  3FBZ A;  2C5I T;  5JR9 A;  3SRZ A;  2I59 A;  3IBP A;  5HXS A;  1UX4 A;  3OYX A;  4UF0 A;  2CE7 A;  3NRY A;  1H7C A;  2L8K A;  5A1L A;  3SS1 A;  4EB6 E;  2WMO A;  3DP7 A;  4PJM A;  3PUG A;  1MNE A;  2VAS A;  5ETW A;  3U3I A;  2NW7 A;  2XHE B;  5HAX A;  2LSJ A;  3E22 E;  2Q9Q C;  2MTQ A;  3N9N A;  2X51 A;  4JUY A;  2D5U A;  5HXE A;  4AKG A;  2DHR A;  1D0X A;  5LCY A;  1IAP A;  4WBO A;  3CX8 B;  4IHJ E;  2YU1 A;  3PTR B;  2H3R A;  3WAK A;  5LBQ B;  3AAE B;  2CWO A;  3KV9 A;  1HX8 A;  3BQI A;  4I55 E;  3HKC E;  2V7I A;  2WAU A;  2W61 A;  5LXT E;  5LJN A;  5LJM A;  4ZHQ E;  3HI2 A;  5FXX A;  2KZ7 B;  4HEA A;  1S94 A;  4C91 A;  3ZN0 B;  3CQG B;  3Q5W A;  2CCQ A;  3ZEF B;  2Y6X A;  3FXD B;  4HE8 A;  4IE0 A;  4UVC B;  5J2T E;  2CXF A;  3LK4 2;  3ANW B;  4PJL A;  4E7Z A;  3BQL A;  2X9W A;  3ETU A;  3UUX B;  4H9Q C;  4ASK A;  4ILU A;  2ZLY A;  4CI3 B;  4Z8X A;  4B6X A;  1FIO A;  2MYS A;  3RYC E;  5L2L A;  2LSI A;  5JDH A;  4EXT A;  1D1C A;  2K24 A;  3PU8 A;  5F3J A;  3LFM A;  2LSG A;  4O4I E;  5E0O A;  4ZI2 D;  1U4Q A;  2G0U A;  1NWM X;  3IHR A;  3NRX A;  5JH7 E;  4CI2 B;  4YHJ A;  2EHO D;  3KFW X;  3AB3 B;  3N9O A;  3SOL A;  4PAG A;  3O1J A;  4F6R C;  3LBX B;  3ESL A;  4H9O C;  5JDG A;  2Q9Q A;  4OFZ A;  2X67 A;  3ANW A;  4PK4 A;  3S4U A;  3KV5 A;  2MBG A;  4AKL A;  1S35 A;  4AI6 A;  2D0U A;  3N9L A;  1OWA A;  4HTE A;  4IST A;  3WI3 A;  2YK0 A;  1SHZ C;  5JR9 B;  5L3D B;  2E9X D;  2VWA A;  2XAS B;  3GWH A;  4YFS A;  3ONX A;  4GYS A;  3J7Y q;  3PUQ A;  4UF0 B;  3N9M A;  3AA7 B;  2L3L A;  3AA6 B;  3QUJ A;  1UCU A;  2PG8 A;  2C5J A;  5KDM C;  3VHL A;  1MMD A;  4QHO A;  4H9R C;  2LEH A;  4PK6 A;  3RH3 A;  5EK4 A;  3ZCI A;  4U74 A;  3VU7 H;  4KUM B;  1VOM A;  4HFV A;  2W63 A;  4JEH B;  1V9D A;  4L9I A;  4UEM A;  2LSY A;  4GOU A;  1WLX A;  2BDE A;  4BAY B;  3KV4 A;  4IE5 A;  1YD8 G;  2NTX A;  3Q9D A;  2H7V C;  3OBV E;  2IW5 B;  4CXY A;  4QWN B;  2IAK A;  3CVR A;  2LOP A;  5JRE A;  2CA5 A;  4CXX A;  3HA4 A;  3RYI E;  3H3A A;  4J2C A;  3QK6 A;  3Q5X A;  5GON E;  5HYA A;  1MIV A;  4PFP A;  3F57 A;  3HL6 A;  2CM0 A;  4PFO A;  3E0Z A;  3V5S A;  3MKD A;  4DBQ A;  3HKB E;  3T8O A;  1BR2 A;  4IE7 A;  2Y8D A;  1ZEE A;  2RP4 A;  5LBM A;  2DI4 A;  5KX5 E;  3CX6 B;  4DBR A;  4O8S A;  2PJQ A;  5LP6 E;  1D1A A;  2B1E A;  4M1P A;  1HS7 A;  1BR1 A;  3ZC0 A;  1NAF A;  4IDZ A;  2VKO A;  2VKH A;  3L3P A;  3UFE A;  3ZMU B;  4EYU A;  3D0T A;  2ES0 A;  3B57 A;  3C50 A;  3I1A A;  5JDQ A;  5CA1 E;  1UX5 A;  3AAA B;  4OYJ A;  2LSK A;  3MAC A;  3ZYM A;  4EZ4 A;  4FJO A;  1HF8 A;  4ANJ A;  3ZMZ B;  4AKH A;  1QUU A;  2J1D G;  4L5G A;  2W0G A;  3K3O A;  4HKA A;  4OK0 A;  3NZQ A;  4C90 A;  2YU2 A;  3FHN A;  3O9X A;  3ZYK A;  5L3G B;  3AVR A;  3R84 B;  3UT5 E;  4DMW A;  4ZI2 C;  3PE0 A;  2Q9Q B;  4PW8 A;  4PJJ A;  5L3F B;  4PK5 A;  3C64 A;  3ZPO A;  3ZCJ A;  3PUR A;  3FBL A;  2ZMA A;  3AVS A;  3ZJ1 A;  1MND A;  5DQW A;  2EHO C;  1Y64 B;  3CKD A;  4ZI7 E;  4MLK A;  4WW0 A;  3C98 B;  5FMN A;  3MZK B;  5TAO A;  4MBQ A;  2X9X A;  3P8C D;  3K8P C;  3B13 A;  2CEA A;  3GMI A;  2X66 A;  1E1H B;  5EK2 A;  4AQF C;  3BK9 A;  2V7J A;  2WM9 A;  2NOX A;  5F8P A;  1KK7 A;  1FEW A;  4OHF A;  4TX5 A;  2JMH A;  4KMC A;  5JQG E;  2E9X C;  1Z0P A;  3OYZ A;  3CX7 B;  3I9Y A;  2W00 A;  4NUV A;  4XZC A;  5H6R B;  4EYY R;  4P09 A;  4TN7 B;  2VL8 A;  3I0O A;  2A72 A;  3FXE B;  5ADX L;  5LHH B;  5LYJ E;  4BJN A;  4WNK A;  3WAJ A;  4EOZ B;  3CQX C;  4L0R A;  5LG4 A;  3CWZ B;  2HH7 A;  2XAG B;  3AAI A;  1HFA A;  1B7T A;  4GK0 E;  3JC6 D;  3TKL B;  3LJC A;  3PU3 A;  3DJB A;  3MA9 A;  3ZMV B;  2NW8 A;  5HXC A;  4H9S E;  2KND A;  3KV6 A;  2KXP B;  3FB2 A;  3UTK A;  4ERR A;  2LHR A;  3N2K E;  5LGU B;  1HTJ F;  2C0S A;  2JMK A;  4ZOL E;  5DAB A;  1T98 A;  4O4J E;  5DJQ C;  3RX6 A;  2X68 A;  5JDM A;  3UUM A;  2A3D A;  4QX7 B;  3U78 A;  4UEL A;  5HXH A;  5DQV A;  5JVD E;  3EDU A;  2ZM0 A;  4TV9 E;  5J2U E;  4O2A E;  2QGS A;  4JEU B;  4MAL A;  4TZ4 C;  4BJM A;  1YW0 A;  3O1H A;  2OA5 A;  1LRZ A;  2V26 A;  4V1A v;  4GK5 E;  3RRW A;  2XUE A;  3EUH A;  3NBX X;  1O3X A;  1MMG A;  2HPL A;  2Z6E A;  2IC9 A;  5J1G A;  5H6Q B;  3LK2 B;  5L3E B;  4G2A A;  4AQG A;  4CQI A;  4ISS A;  4N78 D;  2PFV A;  4CXW A;  5JDL A;  1IJ6 A;  2EHO A;  4YJ3 E;  3MK7 C;  2P9B A;  4QKN A;  4IIJ E;  5IYZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...