1M7KA

Solution structure of the sodd bag domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Silencer of Death Domains
publication title The solution structure of the SODD BAG domain reveals additional electrostatic interactions in the HSP70 complexes of SODD subfamily BAG domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m7kA00
1UGOA 5AQGB 5AQLB 5AQIB 5AQVB 5AQOB 5AQQB 3FZFB 3FZLB 3LDQB 5AQJB 5AQUB 4HWIB 4HWHA 3FZHB 2D9DA 4HWFA 1UK5A 1HX1B 5AQHB 4HWCA 3M3ZB 3FZKB 3A8YC 1M7KA 5AQTB 1M62A 1I6ZA 1T7SA 5AQPB 4HWDA 5AQFB 3FZMB 5AQMB 5AQKB 5AQSB 5AQRB 5AQNB
chains in the Genus database with same CATH superfamily
1NAFA 4ZI3C 2QA7A 3ZMSB 5LB7B 5C3JA 2NOXA 2EHOD 1L0VA 1HCIA 4PW8A 3Q9DA 2E5LT 3NKZA 5LGTB 2YK0A 2WU2A 1D0YA 2ACXA 2HN2A 3AE3A 2A3DA 1YQ3A 2YEVC 3FZLB 1WYCA 3FXEB 5LHGB 3CQXC 2KINB 2XZEA 5ETWA 5LBQB 2MPKA 1FIOA 3RI5A 2B76A 2VWAA 5CA1E 3TLWA 3NVOA 3VKHA 3IEEA 1T72A 2IHR1 1UX5A 3ZMTB 2MBGA 1N33T 1KF6A 3X1DA 5F3JA 3AE9A 4QH5A 3NWIA 1ZKEA 3E22E 3FXDB 4ZI3D 3C51A 1OWAA 5LG3A 5LHIB 3GN5A 3PUYF 2MAWA 2FBWA 2V6YB 3Q5DA 2VKHA 2PBIA 2ZM6T 5LCYA 3GA8A 2V1DB 4ADZA 3ZJ1A 3P4WA 4QH4A 4JI2T 3H37A 3AE7A 3FBLA 3RGLA 4LFAT 4IE6A 5JR9B 2LRKA 3R6NA 2PG8A 1Z8UA 4OYJA 4B6XA 3PUZF 1FMWA 3VR9A 4DV0T 5LYJE 4CXYA 5HEOA 3V5SA 1XWMA 3UUMA 3RX6A 3VU7H 5JDHA 4PK4A 2VVNA 3AAAB 5A1LA 3KINB 1SHZC 5HCJA 4DMVA 4AQFA 4HKAA 3IBPA 5FKYA 4KUMB 2W62A 5FY1A 4GYRA 3J9X1 5ABEA 4CXWA 3AAIA 2VKJA 3M3ZB 5BR8T 2XUEA 2BS4A 3RIAA 2CBJA 2JIWA 3RQUA 2BBHA 2XJ7A 4TNVA 3I1AA 2LRLA 4PAGA 2BKPA 2YINA 2NP9A 4DIDB 3N9QA 2CA5A 3AE1A 3ZLIA 2QGSA 2XHEB 3KVBA 2WZIA 2RP4A 3MK7C 1MMNA 4YJ3E 5KX5E 2C5JA 4OYKA 2XM1A 4HWFA 4BJNA 3LSVA 4X1KE 5F8PA 4JI5T 1T7SA 2VKOA 3LK42 2FJAA 4HFBA 2SPCA 2L3LA 3GWHA 4HGAA 4ILAA 3PUXF 3N9OA 2EHOA 1WR0A 3JADA 4UV8B 2WDVA 2WY2A 2V7LA 4LMKA 1SA0E 1G73A 2CXFA 2CE7A 3UU4A 1XMQT 2QVAA 5FVLA 2OV9A 3NRXA 4JI0T 5FY0A 5E0OA 4X5TA 5IUXA 5L3FB 4COFA 1KNRA 2VKDA 4K0KT 1DU2A 3C50A 2X0LB 2CM0A 5AQGB 1JNRA 4QHOA 5FXZA 4I0UA 3NRYA 2VASA 2QYWA 5HXCA 2KNDA 2CCQA 4H9RC 1D1BA 5FXXA 3PUSA 3FB2A 4YTPA 3VR8A 1SUMB 4IDPA 5LNKA 2LT3A 2J1DG 2Q9QC 2WWUA 3IF8B 4P09A 5LG4A 1ZOYA 4M1PA 2WDRA 2BVLA 2LM9A 1D1CA 2CWOA 3KV4A 5AQKB 4BA9A 3KBUA 3CKDA 2IAKA 3EDVA 4TV8E 4K0UA 4YLHA 1N32T 1IBMT 2N9DA 5LP6E 2V5CA 4TUYE 4YT0A 2CPTA 4DV7T 5JREA 3TLUA 5AFUL 5AQLB 3RIFA 3Q5WA 3LDQB 2XM2A 4DV6T 4WZXA 4EEBA 1M7KA 2UXXB 3KBTA 3I9YA 2RPAA 2M67A 3BQKA 2Z6EA 2E9XC 3QNUA 2J62A 3IA3A 3N5LA 4IDZA 3N9LA 3O9XA 2LOSA 2Q9QD 2XPKA 4U74A 4UVBB 3N9MA 3GN5B 4IDQA 2XASB 1MIWA 3JAFA 5HYAA 4LF7T 1IJ5A 4HFVA 4E7SA 4X1YE 4DR2T 4EZHA 1HNXT 3I0QA 3UUXB 3RC3A 2LEHA 2NTXA 3BQLA 5JDNA 1OEDC 1HNWT 4U72A 3K3OA 4I55E 4Z91A 2K9AA 1BR1A 5AQVB 4A56A 4HFEA 1Z0PA 4UVAB 4EEDA 4YFSA 3AEGA 1WLXA 2YN6A 4BJMA 4TZ4C 4DR1T 4TNWA 2XSAA 4HWDA 5L4HA 3AXJB 4Q25A 3OYZA 4OX9T 1R8IA 3MJXA 5AQOB 3CIRA 3QK6A 2E9XD 2Y8DA 3F2EA 4CQIA 3H3MA 3A7MA 2BKOA 4H9PC 5LBMA 3ZC1A 3Q5EA 3RHWA 2NW7A 3U78A 3BQIA 2XQ4A 2CXDA 4O4IE 5FL0A 1YQ4A 4YY3T 3HKBE 1W0AA 4KHPT 4AKLA 3K1SA 3ZCIA 1FMVA 1FJGT 4IE0A 3MA9A 4AIUA 4DR6T 4EIWA 1W9RA 4LF9T 2GK9A 4DUYT 1S94A 4YSZA 2DI4A 2RA1A 1ZHCA 4H9QC 3NZPA 5HXEA 3ZC0A 3FZHB 3O1HA 1KFYA 2WB5A 5L3BB 2YDQA 3HKEE 2NW8A 1J5WA 2D0TA 2NW9A 5HEGA 2DLRA 2HH7A 3UQ7A 1W09A 2X9WA 3CQCB 5HEUA 2A9UA 4HFIA 2V5DA 5FXWA 1HS7A 2EHOB 4Z90A 4YTNA 3UU3A 2XQ8A 2LM2A 5LJMA 4BAYB 4JI7T 2CWYA 5IYZE 5AQMB 2DCFA 4X64T 5LXTE 2IMLA 5JDGA 4AKRB 2WS3A 5EZYE 3EUHA 4CN1A 3C98B 2DNXA 3PJAA 2PJQA 2FUPA 5DQVA 4AISA 1GQEA 3L3PA 3HA4A 3C4ZA 2JMHA 2X67A 3AVRA 2UXCT 5JR9C 2HPLA 4QXHB 4HTEA 2K24A 5CA0E 2LKHA 1LKXA 2I0MA 4IIJE 2VL0A 2LKGA 4ZI7E 4V1Av 3D0TA 3LG7A 4N78D 2ES0A 3LJCA 2XAGB 3CK6A 2Q9QA 4IL4A 4LMJA 2XAQB 2P9BA 1Y01A 2BZBA 3SFDA 1XNQT 4GKKT 1QSDA 3PUWF 4IDOA 4ASKA 2N1GA 1I6ZA 2KSRA 3KDSE 4EYYR 3PUAA 2BVMA 2WAUA 5AQIB 5JQGE 1IJ6A 4QX7B 3L8RA 2BDEA 2BG9A 2CLYB 3SOLA 1T8BA 4X1IE 2WU5A 2M6BA 5FNVE 4DV4T 4O4HE 4XAXB 2YDSA 4H63V 4UF0A 3AA1B 4GYSA 3H3AA 2YKSA 5FXVA 1O3XA 4AI6A 4IE4A 2R6GF 3K3NA 1IAPA 1HX8A 1JNZA 3RYIE 5AQPB 3E0ZA 5JDFA 2DWKA 4HFDA 3ANWA 3L39A 4AKGA 3RKGA 2E9XA 5AQUB 3QUJA 3RIUA 4IL9A 2WM9A 1U4QA 2BS2A 2WCAA 4P1NA 1MIVA 4GKJT 4DR3T 4YHJA 2LLYA 4OFZA 2D0UA 2CBIA 4XZCA 2IW5B 4OHFA 3KV9A 3F57A 5AQQB 3T1YT 3UFGA 3KVAA 1Y64B 4U2ZA 2C0SA 5DQWA 3UUBA 4L5GA 5HWXA 2XAFB 5IWAT 4LF5T 1OEDA 3V5UA 4YSYA 3B57A 3DTOA 3PU8A 2W67A 3SRZA 4PJJA 4ZHQE 3N9PA 4EV6A 4ZZBA 4HWIB 3OVUA 2W00A 2HN1A 3P4RA 1QLBA 4P0AA 2KZ7B 3FBZA 4O2AE 2NR4A 3DP7A 3ZMVB 5CJ5A 3AECA 2XY8B 3SWHA 3UTKA 2OLTA 2WP9A 4EAHA 4I43B 4CXXA 2XQ9A 2J4GA 3VKGA 4JYAT 2AE9A 2BG9E 1YW0A 4NIQA 3MXZA 3ZT5A 4U7YA 3JCFA 3QC9A 3PTRB 4PFPA 4ZS2A 1LVFA 5HEJA 4X65T 5HXHA 2A72A 1LRZA 3WAKA 1QUUA 3RRCA 4ANJA 2W63A 1S35A 2NTYA 4B3ST 3CX6B 2H7OA 3N2KE 4CN4A 5AQJB 3OJAA 1HFAA 4ISSA 5LGUB 2QRXA 3FHNA 3BK9A 5JDQA 4A98A 2X9HA 3P50A 3ZT6A 4ZS3A 5IHYA 2BBJA 4YTMA 5KDMC 1IBLT 5CB4E 4H63H 4ZXLA 3SFEA 1E2AA 2V7MA 1HTJF 2W2UA 5LOVE 2UXDT 2KXPB 4WNKA 3P4SA 5AQHB 4MFRA 4X20E 2JQKA 2C5IT 4I4TE 4UVCB 3HR0A 3JC6C 3ETUA 2CHNA 3ZMZB 2YOEA 4TX5A 4U2YA 3G06A 4CZZB 4UXNB 1UURA 4EYUA 1KNPA 2MYSA 2WMNA 4HWCA 2XAHB 2FJDA 4HFHA 1YD8G 2ZM2A 2UXBT 2ZM8A 5L4EA 5JRCA 2W61A 4ZOLE 4U31A 2JRKA 3ZPOA 2CXLA 2JQ9A 3AEEA 2IC6A 1US7B 4EOZB 3TLVA 3ZYLA 1H7CA 2D9DA 4TWDA 3I9WA 2CHOA 3ZYKA 2WZHA 3HKCE 2K48A 3ZT7A 3AEAA 4LF6T 3EDUA 5AQTB 3C4WA 4TV9E 3UT5E 5C8YE 3LFMA 4QKNA 1YKEB 5FMNA 4UEMA 4B3TT 2Q9QB 4HWHA 4AQFC 1HX1B 4DV1T 3RYCE 3AE2A 3FZKB 1BR0A 2LSJA 4EGWA 2ZLYA 3AE6A 2VB6A 2M6IA 4KMCA 2JPFA 1IBKT 1HF8A 5L3GB 1EZ3A 5ABGA 4NUVA 2N2NA 1LVKA 5ADXL 5CFBA 1MMAA 2BG9B 5L47A 2IDOB 1YXRA 3O1JA 3C64A 3PUVF 1MMGA 5M4YA 3RKOA 4UF0B 3VRAA 2UUAT 4NUUA 2ACZA 4ILCA 4GK5E 3LK3B 4QWNB 2G0UA 4LMLA 1E7PA 2YDRA 3CVRA 2F4VT 3MZKB 2UXNB 2D2SA 5JTGA 3J7Yq 1WCRA 1WRDA 3CMLA 4WW0A 4CI1B 2HHHT 1UCUA 4O2BE 5L3DB 1NWMX 2VL8A 2WQYA 1T98A 1N36T 5HEHA 5AQFB 1X9BA 5AQSB 4QH1A 2X68A 2X9XA 2EHOC 1HG5A 4DVDA 3PURA 1KEYA 3AA0B 1OEDB 2CMRA 1XNRT 2Y48B 4U7IA 5FP3A 2PFVA 2LSYA 2W0GA 2K5BB 5H6QB 5J2TE 3RC8A 3CQGB 1BR4A 3UU8A 4ZZCA 5FVKA 2AXDS 2NWBA 3T1HT 3Q5XA 1J1JA 4DV3T 4CI2B 5DABA 1VRBA 3AA6B 4PK6A 1YKHB 3CX8B 2LOPA 4AQGA 4MBQA 4F6RC 2FJEA 1ZV4X 4ZI2C 4C90A 4TWHA 3ZMUB 2MOZA 3ZEFB 1MMDA 3L09A 3RLFF 2V7KA 3PDYA 4PJMA 4CI3B 4MHCA 2JQHA 1WYBA 4H9SE 3ETVA 4H9NC 1NENA 5LMNT 1WR6A 3NZQA 3EAMA 5CGMA 2JMKA 3OYXA 1ZP0A 3VHLA 2C5KT 4P0BA 3ZJ2A 2CLYC 3AVSA 4TWFA 5DJQC 2VVSA 4WBOA 2UUBT 5J1GA 2J47A 2CEAA 2KLQA 3DJBA 5AQNB 3NBXX 2V7IA 5L3EB 1I94T 2A2FX 3ZCJA 2LE8A 4UIGA 2H88A 2E2AA 2LSKA 3SS1A 3ZN1B 4O4LE 4ZI2D 3PJAJ 2VURA 4YJ2E 2UUCT 5J0ZA 2H3RA 4WYVA 4JI3T 2WMOA 4LFCT 1V9DA 4J2CA 2JJ9A 5FYMA 3UQ4A 2Y6XA 4GIWA 2KT9A 5JRCB 1UGOA 3E08A 3KV6A 1MNDA 2MTQA 2IIUA 1KNZA 4DNDA 5H6RB 3O4XE 4U3CA 1UK5A 2KMFA 5ABFA 4JI4T 3ESLA 2W4XA 3UUNA 4B3RT 4AXPA 4LF8T 5GONE 4KBMB 1ZEEA 1FEWA 4UV9B 4IDNA 3Q2MA 1B7TA 4GK0E 1HG2A 3AXJA 4NXNT 5EK3A 4L0RA 3P7IA 4LF4T 4IE7A 5C2TA 1UUSA 3C4XA 4HFCA 1W0BA 2HPJA 2XQ5A 4HN9A 4GOUA 1XZYA 3PUQA 3OKQA 3TKLB 4O4JE 5HCMA 4U33A 3LBXA 4ISTA 4E7ZA 1WFDA 4LFBT 5FY7A 3UU6A 3W15B 2LSIA 2LHNA 1VOMA 3EI0A 3K3QC 3EABA 4KP3C 5JDLA 4EZ4A 3FZFB 4F8HA 3CWZB 4AKHA 1VCSA 1XDOA 3RPUA 3F31A 4QXCB 2I6HA 4IGUA 4WBNE 5FL1A 3HL6A 3EHZA 4X62T 5L2LA 3AE5A 4PNIA 1HNZT 3N2OA 4JI6T 4DBRA 3RYFE 3P4PA 4NXMT 4PFOA 4MLKA 1M62A 4L9IA 4YSXA 2K3WA 5EK2A 3ZYMA 3AAEB 5EK4A 3ZSTA 3N2GE 3HI2A 4ILBA 2VQFT 5J2UE 2DHRA 4DV2T 4O8SA 4B3MT 1HR0T 2X66A 1XDPA 3ZN0B 5F5WA 4DMWA 2B1EA 2DL1A 4A97A 1UX4A 3AEDA 1VCTA 4HEAA 3T8OA 2W66A 3CX7B 3MKDA 3TLTA 3PU3A 3S4UA 1IZNB 2WDQA 3AE4A 3A5XA 2XQYA 3QB5K 1D0ZA 4IE5A 1CHUA 5LGNB 5BMVE 3QB5A 2H7VC 3ONXA 4AQYT 3OTOT 2L8KA 1OEDE 2X9YA 3ONLC 3UU5A 5LJNA 2X0HA 5ABHA 4XBFB 4ILUA 3IHRA 3I0OA 5LHHB 3VRBA 1BR2A 3AE8A 2JQQA 4MALA 1D0XA 3GMIA 4HE8A 2V6YA 4NPPA 1XMOT 2VK9A 3FZMB 4QX8B 2XQAA 2X0YA 3TLSA 4IREA 1NEKA 2IUBA 3RQWA 2L9QA 2V6XA 4DBQA 2ODVA 4JLEA 4Z8XA 5HWYA 2BG9C 5KXJA 3ONJA 2XQ6A 5JR9A 1E1HB 2YU2A 3U3IA 2E5VA 2PTFA 4UR9A 2KWHA 3OPCA 4FJOA 4DR4T 4PJLA 3HKDE 1OXZA 2V7JA 1N34T 3RYHE 3P4QA 2D5UA 4H9OC 2BKNA 4YXDA 3R84B 2ZMAA 4EB6E 3UFEA 2LJLA 2YU1A 4UELA 5JDMA 4AKIA 4TN7B 4DR7T 5KMGP 5LA6E 2ODUA 4JUYA 3RIUC 5JVDE 4G2AA 3KV5A 2E8IA 3JC6D 3ZKRA 2IC9A 4IHJE 4PK5A 2VQET 3PV0F 2KWIB 3A8YC 3CPZA 3JAEA 4CN6A 3WAJA 1U5PA 5LMUT 3QOFA 1MIYA 3AB3B 1KK7A 3OBVE 2V8SV 3AEFA 4PJNA 1AJ3A 5ABFB 2ZM0A 4OK0A 4QXBB 2I59A 1SE7A 4KX6A 2XAJB 3ANWB 3K8PC 3EVYA 3P8CD 3O1IA 2WSSV 3RH3A 2E9XB 3UULA 3AA7B 3KFWX 2CRBA 1MNEA 5JH7E 3ABVA 4DV5T 1X79A 2XSBA 2XTLA 4YHHT 3B13A 1J5ET 4ZEYA 4ERRA 1CUNA 4X66T 2WBLA 2WWVA 4JEHB 2DWGA 4JI1T 3LBXB 3AEBA 4KHZF 4I50E 4C91A 2XQ7A 4JEUB 5HAXA 3PE0A 4A5XA 2OA5A 4IT4A 3B5MA 4JV5T 2V26A 2X51A 2XQ3A 3N9NA 5HXRA 2BS3A 5HXSA 2H89A 1G8XA 3RF1A 3PUGA 4DO0A 4DR5T 4G63A 3WI3A 3LK2B 4JI8T 4EXTA 3M65A 4JBWF 3ZSSA 4DUZT 3RRWA 2LSGA 4FI5A 1D1AA 4KI0F 5TAOA 2LHRA 2UU9T 3MACA 5L3CB 2FJBA 5AQRB
chains in the Genus database with same CATH topology
1UGOA 5AQGB 5AQLB 5AQIB 5AQVB 5AQOB 5AQQB 3FZFB 3FZLB 3LDQB 5AQJB 5AQUB 4HWIB 4HWHA 3FZHB 2D9DA 4HWFA 1UK5A 1HX1B 5AQHB 4HWCA 3M3ZB 3FZKB 3A8YC 1M7KA 5AQTB 1M62A 1I6ZA 1T7SA 5AQPB 4HWDA 5AQFB 3FZMB 5AQMB 5AQKB 5AQSB 5AQRB 5AQNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGO A;  5AQG B;  5AQL B;  5AQI B;  5AQV B;  5AQO B;  5AQQ B;  3FZF B;  3FZL B;  3LDQ B;  5AQJ B;  5AQU B;  4HWI B;  4HWH A;  3FZH B;  2D9D A;  4HWF A;  1UK5 A;  1HX1 B;  5AQH B;  4HWC A;  3M3Z B;  3FZK B;  3A8Y C;  1M7K A;  5AQT B;  1M62 A;  1I6Z A;  1T7S A;  5AQP B;  4HWD A;  5AQF B;  3FZM B;  5AQM B;  5AQK B;  5AQS B;  5AQR B;  5AQN B; 
#chains in the Genus database with same CATH topology
 1NAF A;  4ZI3 C;  2QA7 A;  3ZMS B;  5LB7 B;  5C3J A;  2NOX A;  2EHO D;  1L0V A;  1HCI A;  4PW8 A;  3Q9D A;  2E5L T;  3NKZ A;  5LGT B;  2YK0 A;  2WU2 A;  1D0Y A;  2ACX A;  2HN2 A;  3AE3 A;  2A3D A;  1YQ3 A;  2YEV C;  3FZL B;  1WYC A;  3FXE B;  5LHG B;  3CQX C;  2KIN B;  2XZE A;  5ETW A;  5LBQ B;  2MPK A;  1FIO A;  3RI5 A;  2B76 A;  2VWA A;  5CA1 E;  3TLW A;  3NVO A;  3VKH A;  3IEE A;  1T72 A;  2IHR 1;  1UX5 A;  3ZMT B;  2MBG A;  1N33 T;  1KF6 A;  3X1D A;  5F3J A;  3AE9 A;  4QH5 A;  3NWI A;  1ZKE A;  3E22 E;  3FXD B;  4ZI3 D;  3C51 A;  1OWA A;  5LG3 A;  5LHI B;  3GN5 A;  3PUY F;  2MAW A;  2FBW A;  2V6Y B;  3Q5D A;  2VKH A;  2PBI A;  2ZM6 T;  5LCY A;  3GA8 A;  2V1D B;  4ADZ A;  3ZJ1 A;  3P4W A;  4QH4 A;  4JI2 T;  3H37 A;  3AE7 A;  3FBL A;  3RGL A;  4LFA T;  4IE6 A;  5JR9 B;  2LRK A;  3R6N A;  2PG8 A;  1Z8U A;  4OYJ A;  4B6X A;  3PUZ F;  1FMW A;  3VR9 A;  4DV0 T;  5LYJ E;  4CXY A;  5HEO A;  3V5S A;  1XWM A;  3UUM A;  3RX6 A;  3VU7 H;  5JDH A;  4PK4 A;  2VVN A;  3AAA B;  5A1L A;  3KIN B;  1SHZ C;  5HCJ A;  4DMV A;  4AQF A;  4HKA A;  3IBP A;  5FKY A;  4KUM B;  2W62 A;  5FY1 A;  4GYR A;  3J9X 1;  5ABE A;  4CXW A;  3AAI A;  2VKJ A;  3M3Z B;  5BR8 T;  2XUE A;  2BS4 A;  3RIA A;  2CBJ A;  2JIW A;  3RQU A;  2BBH A;  2XJ7 A;  4TNV A;  3I1A A;  2LRL A;  4PAG A;  2BKP A;  2YIN A;  2NP9 A;  4DID B;  3N9Q A;  2CA5 A;  3AE1 A;  3ZLI A;  2QGS A;  2XHE B;  3KVB A;  2WZI A;  2RP4 A;  3MK7 C;  1MMN A;  4YJ3 E;  5KX5 E;  2C5J A;  4OYK A;  2XM1 A;  4HWF A;  4BJN A;  3LSV A;  4X1K E;  5F8P A;  4JI5 T;  1T7S A;  2VKO A;  3LK4 2;  2FJA A;  4HFB A;  2SPC A;  2L3L A;  3GWH A;  4HGA A;  4ILA A;  3PUX F;  3N9O A;  2EHO A;  1WR0 A;  3JAD A;  4UV8 B;  2WDV A;  2WY2 A;  2V7L A;  4LMK A;  1SA0 E;  1G73 A;  2CXF A;  2CE7 A;  3UU4 A;  1XMQ T;  2QVA A;  5FVL A;  2OV9 A;  3NRX A;  4JI0 T;  5FY0 A;  5E0O A;  4X5T A;  5IUX A;  5L3F B;  4COF A;  1KNR A;  2VKD A;  4K0K T;  1DU2 A;  3C50 A;  2X0L B;  2CM0 A;  5AQG B;  1JNR A;  4QHO A;  5FXZ A;  4I0U A;  3NRY A;  2VAS A;  2QYW A;  5HXC A;  2KND A;  2CCQ A;  4H9R C;  1D1B A;  5FXX A;  3PUS A;  3FB2 A;  4YTP A;  3VR8 A;  1SUM B;  4IDP A;  5LNK A;  2LT3 A;  2J1D G;  2Q9Q C;  2WWU A;  3IF8 B;  4P09 A;  5LG4 A;  1ZOY A;  4M1P A;  2WDR A;  2BVL A;  2LM9 A;  1D1C A;  2CWO A;  3KV4 A;  5AQK B;  4BA9 A;  3KBU A;  3CKD A;  2IAK A;  3EDV A;  4TV8 E;  4K0U A;  4YLH A;  1N32 T;  1IBM T;  2N9D A;  5LP6 E;  2V5C A;  4TUY E;  4YT0 A;  2CPT A;  4DV7 T;  5JRE A;  3TLU A;  5AFU L;  5AQL B;  3RIF A;  3Q5W A;  3LDQ B;  2XM2 A;  4DV6 T;  4WZX A;  4EEB A;  1M7K A;  2UXX B;  3KBT A;  3I9Y A;  2RPA A;  2M67 A;  3BQK A;  2Z6E A;  2E9X C;  3QNU A;  2J62 A;  3IA3 A;  3N5L A;  4IDZ A;  3N9L A;  3O9X A;  2LOS A;  2Q9Q D;  2XPK A;  4U74 A;  4UVB B;  3N9M A;  3GN5 B;  4IDQ A;  2XAS B;  1MIW A;  3JAF A;  5HYA A;  4LF7 T;  1IJ5 A;  4HFV A;  4E7S A;  4X1Y E;  4DR2 T;  4EZH A;  1HNX T;  3I0Q A;  3UUX B;  3RC3 A;  2LEH A;  2NTX A;  3BQL A;  5JDN A;  1OED C;  1HNW T;  4U72 A;  3K3O A;  4I55 E;  4Z91 A;  2K9A A;  1BR1 A;  5AQV B;  4A56 A;  4HFE A;  1Z0P A;  4UVA B;  4EED A;  4YFS A;  3AEG A;  1WLX A;  2YN6 A;  4BJM A;  4TZ4 C;  4DR1 T;  4TNW A;  2XSA A;  4HWD A;  5L4H A;  3AXJ B;  4Q25 A;  3OYZ A;  4OX9 T;  1R8I A;  3MJX A;  5AQO B;  3CIR A;  3QK6 A;  2E9X D;  2Y8D A;  3F2E A;  4CQI A;  3H3M A;  3A7M A;  2BKO A;  4H9P C;  5LBM A;  3ZC1 A;  3Q5E A;  3RHW A;  2NW7 A;  3U78 A;  3BQI A;  2XQ4 A;  2CXD A;  4O4I E;  5FL0 A;  1YQ4 A;  4YY3 T;  3HKB E;  1W0A A;  4KHP T;  4AKL A;  3K1S A;  3ZCI A;  1FMV A;  1FJG T;  4IE0 A;  3MA9 A;  4AIU A;  4DR6 T;  4EIW A;  1W9R A;  4LF9 T;  2GK9 A;  4DUY T;  1S94 A;  4YSZ A;  2DI4 A;  2RA1 A;  1ZHC A;  4H9Q C;  3NZP A;  5HXE A;  3ZC0 A;  3FZH B;  3O1H A;  1KFY A;  2WB5 A;  5L3B B;  2YDQ A;  3HKE E;  2NW8 A;  1J5W A;  2D0T A;  2NW9 A;  5HEG A;  2DLR A;  2HH7 A;  3UQ7 A;  1W09 A;  2X9W A;  3CQC B;  5HEU A;  2A9U A;  4HFI A;  2V5D A;  5FXW A;  1HS7 A;  2EHO B;  4Z90 A;  4YTN A;  3UU3 A;  2XQ8 A;  2LM2 A;  5LJM A;  4BAY B;  4JI7 T;  2CWY A;  5IYZ E;  5AQM B;  2DCF A;  4X64 T;  5LXT E;  2IML A;  5JDG A;  4AKR B;  2WS3 A;  5EZY E;  3EUH A;  4CN1 A;  3C98 B;  2DNX A;  3PJA A;  2PJQ A;  2FUP A;  5DQV A;  4AIS A;  1GQE A;  3L3P A;  3HA4 A;  3C4Z A;  2JMH A;  2X67 A;  3AVR A;  2UXC T;  5JR9 C;  2HPL A;  4QXH B;  4HTE A;  2K24 A;  5CA0 E;  2LKH A;  1LKX A;  2I0M A;  4IIJ E;  2VL0 A;  2LKG A;  4ZI7 E;  4V1A v;  3D0T A;  3LG7 A;  4N78 D;  2ES0 A;  3LJC A;  2XAG B;  3CK6 A;  2Q9Q A;  4IL4 A;  4LMJ A;  2XAQ B;  2P9B A;  1Y01 A;  2BZB A;  3SFD A;  1XNQ T;  4GKK T;  1QSD A;  3PUW F;  4IDO A;  4ASK A;  2N1G A;  1I6Z A;  2KSR A;  3KDS E;  4EYY R;  3PUA A;  2BVM A;  2WAU A;  5AQI B;  5JQG E;  1IJ6 A;  4QX7 B;  3L8R A;  2BDE A;  2BG9 A;  2CLY B;  3SOL A;  1T8B A;  4X1I E;  2WU5 A;  2M6B A;  5FNV E;  4DV4 T;  4O4H E;  4XAX B;  2YDS A;  4H63 V;  4UF0 A;  3AA1 B;  4GYS A;  3H3A A;  2YKS A;  5FXV A;  1O3X A;  4AI6 A;  4IE4 A;  2R6G F;  3K3N A;  1IAP A;  1HX8 A;  1JNZ A;  3RYI E;  5AQP B;  3E0Z A;  5JDF A;  2DWK A;  4HFD A;  3ANW A;  3L39 A;  4AKG A;  3RKG A;  2E9X A;  5AQU B;  3QUJ A;  3RIU A;  4IL9 A;  2WM9 A;  1U4Q A;  2BS2 A;  2WCA A;  4P1N A;  1MIV A;  4GKJ T;  4DR3 T;  4YHJ A;  2LLY A;  4OFZ A;  2D0U A;  2CBI A;  4XZC A;  2IW5 B;  4OHF A;  3KV9 A;  3F57 A;  5AQQ B;  3T1Y T;  3UFG A;  3KVA A;  1Y64 B;  4U2Z A;  2C0S A;  5DQW A;  3UUB A;  4L5G A;  5HWX A;  2XAF B;  5IWA T;  4LF5 T;  1OED A;  3V5U A;  4YSY A;  3B57 A;  3DTO A;  3PU8 A;  2W67 A;  3SRZ A;  4PJJ A;  4ZHQ E;  3N9P A;  4EV6 A;  4ZZB A;  4HWI B;  3OVU A;  2W00 A;  2HN1 A;  3P4R A;  1QLB A;  4P0A A;  2KZ7 B;  3FBZ A;  4O2A E;  2NR4 A;  3DP7 A;  3ZMV B;  5CJ5 A;  3AEC A;  2XY8 B;  3SWH A;  3UTK A;  2OLT A;  2WP9 A;  4EAH A;  4I43 B;  4CXX A;  2XQ9 A;  2J4G A;  3VKG A;  4JYA T;  2AE9 A;  2BG9 E;  1YW0 A;  4NIQ A;  3MXZ A;  3ZT5 A;  4U7Y A;  3JCF A;  3QC9 A;  3PTR B;  4PFP A;  4ZS2 A;  1LVF A;  5HEJ A;  4X65 T;  5HXH A;  2A72 A;  1LRZ A;  3WAK A;  1QUU A;  3RRC A;  4ANJ A;  2W63 A;  1S35 A;  2NTY A;  4B3S T;  3CX6 B;  2H7O A;  3N2K E;  4CN4 A;  5AQJ B;  3OJA A;  1HFA A;  4ISS A;  5LGU B;  2QRX A;  3FHN A;  3BK9 A;  5JDQ A;  4A98 A;  2X9H A;  3P50 A;  3ZT6 A;  4ZS3 A;  5IHY A;  2BBJ A;  4YTM A;  5KDM C;  1IBL T;  5CB4 E;  4H63 H;  4ZXL A;  3SFE A;  1E2A A;  2V7M A;  1HTJ F;  2W2U A;  5LOV E;  2UXD T;  2KXP B;  4WNK A;  3P4S A;  5AQH B;  4MFR A;  4X20 E;  2JQK A;  2C5I T;  4I4T E;  4UVC B;  3HR0 A;  3JC6 C;  3ETU A;  2CHN A;  3ZMZ B;  2YOE A;  4TX5 A;  4U2Y A;  3G06 A;  4CZZ B;  4UXN B;  1UUR A;  4EYU A;  1KNP A;  2MYS A;  2WMN A;  4HWC A;  2XAH B;  2FJD A;  4HFH A;  1YD8 G;  2ZM2 A;  2UXB T;  2ZM8 A;  5L4E A;  5JRC A;  2W61 A;  4ZOL E;  4U31 A;  2JRK A;  3ZPO A;  2CXL A;  2JQ9 A;  3AEE A;  2IC6 A;  1US7 B;  4EOZ B;  3TLV A;  3ZYL A;  1H7C A;  2D9D A;  4TWD A;  3I9W A;  2CHO A;  3ZYK A;  2WZH A;  3HKC E;  2K48 A;  3ZT7 A;  3AEA A;  4LF6 T;  3EDU A;  5AQT B;  3C4W A;  4TV9 E;  3UT5 E;  5C8Y E;  3LFM A;  4QKN A;  1YKE B;  5FMN A;  4UEM A;  4B3T T;  2Q9Q B;  4HWH A;  4AQF C;  1HX1 B;  4DV1 T;  3RYC E;  3AE2 A;  3FZK B;  1BR0 A;  2LSJ A;  4EGW A;  2ZLY A;  3AE6 A;  2VB6 A;  2M6I A;  4KMC A;  2JPF A;  1IBK T;  1HF8 A;  5L3G B;  1EZ3 A;  5ABG A;  4NUV A;  2N2N A;  1LVK A;  5ADX L;  5CFB A;  1MMA A;  2BG9 B;  5L47 A;  2IDO B;  1YXR A;  3O1J A;  3C64 A;  3PUV F;  1MMG A;  5M4Y A;  3RKO A;  4UF0 B;  3VRA A;  2UUA T;  4NUU A;  2ACZ A;  4ILC A;  4GK5 E;  3LK3 B;  4QWN B;  2G0U A;  4LML A;  1E7P A;  2YDR A;  3CVR A;  2F4V T;  3MZK B;  2UXN B;  2D2S A;  5JTG A;  3J7Y q;  1WCR A;  1WRD A;  3CML A;  4WW0 A;  4CI1 B;  2HHH T;  1UCU A;  4O2B E;  5L3D B;  1NWM X;  2VL8 A;  2WQY A;  1T98 A;  1N36 T;  5HEH A;  5AQF B;  1X9B A;  5AQS B;  4QH1 A;  2X68 A;  2X9X A;  2EHO C;  1HG5 A;  4DVD A;  3PUR A;  1KEY A;  3AA0 B;  1OED B;  2CMR A;  1XNR T;  2Y48 B;  4U7I A;  5FP3 A;  2PFV A;  2LSY A;  2W0G A;  2K5B B;  5H6Q B;  5J2T E;  3RC8 A;  3CQG B;  1BR4 A;  3UU8 A;  4ZZC A;  5FVK A;  2AXD S;  2NWB A;  3T1H T;  3Q5X A;  1J1J A;  4DV3 T;  4CI2 B;  5DAB A;  1VRB A;  3AA6 B;  4PK6 A;  1YKH B;  3CX8 B;  2LOP A;  4AQG A;  4MBQ A;  4F6R C;  2FJE A;  1ZV4 X;  4ZI2 C;  4C90 A;  4TWH A;  3ZMU B;  2MOZ A;  3ZEF B;  1MMD A;  3L09 A;  3RLF F;  2V7K A;  3PDY A;  4PJM A;  4CI3 B;  4MHC A;  2JQH A;  1WYB A;  4H9S E;  3ETV A;  4H9N C;  1NEN A;  5LMN T;  1WR6 A;  3NZQ A;  3EAM A;  5CGM A;  2JMK A;  3OYX A;  1ZP0 A;  3VHL A;  2C5K T;  4P0B A;  3ZJ2 A;  2CLY C;  3AVS A;  4TWF A;  5DJQ C;  2VVS A;  4WBO A;  2UUB T;  5J1G A;  2J47 A;  2CEA A;  2KLQ A;  3DJB A;  5AQN B;  3NBX X;  2V7I A;  5L3E B;  1I94 T;  2A2F X;  3ZCJ A;  2LE8 A;  4UIG A;  2H88 A;  2E2A A;  2LSK A;  3SS1 A;  3ZN1 B;  4O4L E;  4ZI2 D;  3PJA J;  2VUR A;  4YJ2 E;  2UUC T;  5J0Z A;  2H3R A;  4WYV A;  4JI3 T;  2WMO A;  4LFC T;  1V9D A;  4J2C A;  2JJ9 A;  5FYM A;  3UQ4 A;  2Y6X A;  4GIW A;  2KT9 A;  5JRC B;  1UGO A;  3E08 A;  3KV6 A;  1MND A;  2MTQ A;  2IIU A;  1KNZ A;  4DND A;  5H6R B;  3O4X E;  4U3C A;  1UK5 A;  2KMF A;  5ABF A;  4JI4 T;  3ESL A;  2W4X A;  3UUN A;  4B3R T;  4AXP A;  4LF8 T;  5GON E;  4KBM B;  1ZEE A;  1FEW A;  4UV9 B;  4IDN A;  3Q2M A;  1B7T A;  4GK0 E;  1HG2 A;  3AXJ A;  4NXN T;  5EK3 A;  4L0R A;  3P7I A;  4LF4 T;  4IE7 A;  5C2T A;  1UUS A;  3C4X A;  4HFC A;  1W0B A;  2HPJ A;  2XQ5 A;  4HN9 A;  4GOU A;  1XZY A;  3PUQ A;  3OKQ A;  3TKL B;  4O4J E;  5HCM A;  4U33 A;  3LBX A;  4IST A;  4E7Z A;  1WFD A;  4LFB T;  5FY7 A;  3UU6 A;  3W15 B;  2LSI A;  2LHN A;  1VOM A;  3EI0 A;  3K3Q C;  3EAB A;  4KP3 C;  5JDL A;  4EZ4 A;  3FZF B;  4F8H A;  3CWZ B;  4AKH A;  1VCS A;  1XDO A;  3RPU A;  3F31 A;  4QXC B;  2I6H A;  4IGU A;  4WBN E;  5FL1 A;  3HL6 A;  3EHZ A;  4X62 T;  5L2L A;  3AE5 A;  4PNI A;  1HNZ T;  3N2O A;  4JI6 T;  4DBR A;  3RYF E;  3P4P A;  4NXM T;  4PFO A;  4MLK A;  1M62 A;  4L9I A;  4YSX A;  2K3W A;  5EK2 A;  3ZYM A;  3AAE B;  5EK4 A;  3ZST A;  3N2G E;  3HI2 A;  4ILB A;  2VQF T;  5J2U E;  2DHR A;  4DV2 T;  4O8S A;  4B3M T;  1HR0 T;  2X66 A;  1XDP A;  3ZN0 B;  5F5W A;  4DMW A;  2B1E A;  2DL1 A;  4A97 A;  1UX4 A;  3AED A;  1VCT A;  4HEA A;  3T8O A;  2W66 A;  3CX7 B;  3MKD A;  3TLT A;  3PU3 A;  3S4U A;  1IZN B;  2WDQ A;  3AE4 A;  3A5X A;  2XQY A;  3QB5 K;  1D0Z A;  4IE5 A;  1CHU A;  5LGN B;  5BMV E;  3QB5 A;  2H7V C;  3ONX A;  4AQY T;  3OTO T;  2L8K A;  1OED E;  2X9Y A;  3ONL C;  3UU5 A;  5LJN A;  2X0H A;  5ABH A;  4XBF B;  4ILU A;  3IHR A;  3I0O A;  5LHH B;  3VRB A;  1BR2 A;  3AE8 A;  2JQQ A;  4MAL A;  1D0X A;  3GMI A;  4HE8 A;  2V6Y A;  4NPP A;  1XMO T;  2VK9 A;  3FZM B;  4QX8 B;  2XQA A;  2X0Y A;  3TLS A;  4IRE A;  1NEK A;  2IUB A;  3RQW A;  2L9Q A;  2V6X A;  4DBQ A;  2ODV A;  4JLE A;  4Z8X A;  5HWY A;  2BG9 C;  5KXJ A;  3ONJ A;  2XQ6 A;  5JR9 A;  1E1H B;  2YU2 A;  3U3I A;  2E5V A;  2PTF A;  4UR9 A;  2KWH A;  3OPC A;  4FJO A;  4DR4 T;  4PJL A;  3HKD E;  1OXZ A;  2V7J A;  1N34 T;  3RYH E;  3P4Q A;  2D5U A;  4H9O C;  2BKN A;  4YXD A;  3R84 B;  2ZMA A;  4EB6 E;  3UFE A;  2LJL A;  2YU1 A;  4UEL A;  5JDM A;  4AKI A;  4TN7 B;  4DR7 T;  5KMG P;  5LA6 E;  2ODU A;  4JUY A;  3RIU C;  5JVD E;  4G2A A;  3KV5 A;  2E8I A;  3JC6 D;  3ZKR A;  2IC9 A;  4IHJ E;  4PK5 A;  2VQE T;  3PV0 F;  2KWI B;  3A8Y C;  3CPZ A;  3JAE A;  4CN6 A;  3WAJ A;  1U5P A;  5LMU T;  3QOF A;  1MIY A;  3AB3 B;  1KK7 A;  3OBV E;  2V8S V;  3AEF A;  4PJN A;  1AJ3 A;  5ABF B;  2ZM0 A;  4OK0 A;  4QXB B;  2I59 A;  1SE7 A;  4KX6 A;  2XAJ B;  3ANW B;  3K8P C;  3EVY A;  3P8C D;  3O1I A;  2WSS V;  3RH3 A;  2E9X B;  3UUL A;  3AA7 B;  3KFW X;  2CRB A;  1MNE A;  5JH7 E;  3ABV A;  4DV5 T;  1X79 A;  2XSB A;  2XTL A;  4YHH T;  3B13 A;  1J5E T;  4ZEY A;  4ERR A;  1CUN A;  4X66 T;  2WBL A;  2WWV A;  4JEH B;  2DWG A;  4JI1 T;  3LBX B;  3AEB A;  4KHZ F;  4I50 E;  4C91 A;  2XQ7 A;  4JEU B;  5HAX A;  3PE0 A;  4A5X A;  2OA5 A;  4IT4 A;  3B5M A;  4JV5 T;  2V26 A;  2X51 A;  2XQ3 A;  3N9N A;  5HXR A;  2BS3 A;  5HXS A;  2H89 A;  1G8X A;  3RF1 A;  3PUG A;  4DO0 A;  4DR5 T;  4G63 A;  3WI3 A;  3LK2 B;  4JI8 T;  4EXT A;  3M65 A;  4JBW F;  3ZSS A;  4DUZ T;  3RRW A;  2LSG A;  4FI5 A;  1D1A A;  4KI0 F;  5TAO A;  2LHR A;  2UU9 T;  3MAC A;  5L3C B;  2FJB A;  5AQR B; 
#chains in the Genus database with same CATH homology
 1UGO A;  5AQG B;  5AQL B;  5AQI B;  5AQV B;  5AQO B;  5AQQ B;  3FZF B;  3FZL B;  3LDQ B;  5AQJ B;  5AQU B;  4HWI B;  4HWH A;  3FZH B;  2D9D A;  4HWF A;  1UK5 A;  1HX1 B;  5AQH B;  4HWC A;  3M3Z B;  3FZK B;  3A8Y C;  1M7K A;  5AQT B;  1M62 A;  1I6Z A;  1T7S A;  5AQP B;  4HWD A;  5AQF B;  3FZM B;  5AQM B;  5AQK B;  5AQS B;  5AQR B;  5AQN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...