1M7KA

Solution structure of the sodd bag domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
b'TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Silencer of Death Domains
molecule tags Chaperone
source organism Homo sapiens
publication title The solution structure of the SODD BAG domain reveals additional electrostatic interactions in the HSP70 complexes of SODD subfamily BAG domains
pubmed doi rcsb
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m7kA00
5AQHB 1I6ZA 5AQVB 5AQQB 4HWDA 5AQJB 5AQUB 5AQGB 5AQTB 3M3ZB 3FZHB 5AQNB 5AQRB 1T7SA 3FZLB 1UK5A 4HWHA 3A8YC 5AQIB 2D9DA 5AQKB 3FZMB 5AQMB 3FZKB 5AQFB 5AQOB 3LDQB 4HWFA 5AQPB 3FZFB 1M62A 1UGOA 1M7KA 4HWCA 4HWIB 5AQSB 1HX1B 5AQLB
chains in the Genus database with same CATH superfamily
2WDQA 4IDNA 5LNKA 1OWAA 5DABA 2BBJA 3LK2B 3N9NA 5F5WA 2KWHA 3M65A 3UQ7A 2BKPA 2PTFA 4G2AA 3O1IA 3ONXA 4O4IE 4Q25A 3VR9A 3N9QA 1BR2A 3OTOT 2CLYB 4EOZB 3EHZA 4DV4T 1E7PA 4IDPA 1IBMT 5FMNA 2VKHA 4IREA 4EGWA 3PUGA 3GWHA 4LMJA 3KV6A 4H63V 2NW9A 2NWBA 3A5XA 4I55E 5CGMA 2M67A 3ZSSA 1LVKA 5HCJA 3CMLA 4EZ4A 2XQ5A 4ZS3A 2KMFA 2H88A 1CHUA 1D1BA 2X51A 3IA3A 2IDOB 3W15B 2X9HA 3C98B 3EI0A 2CHNA 2UXBT 4HFBA 2WBLA 3Q2MA 5L3DB 5FKYA 5HEHA 3ZMZB 4JI0T 4NXNT 1XNRT 2CWYA 3CX6B 3ZPOA 1MNDA 2X67A 2XUEA 2IW5B 3UU4A 1SE7A 5AQHB 2UXCT 3EVYA 4YT0A 1VCTA 4CI1B 2YEVC 2E8IA 3AA6B 4Z90A 1IJ5A 3KFWX 4XBFB 5AQUB 3ZKRA 1NWMX 3ZYMA 4F6RC 2WMNA 5C2TA 2E5VA 4GK0E 1QUUA 2BS3A 4PFOA 3RYFE 2BS4A 4O2BE 3UUMA 2FJAA 1NAFA 4I4TE 2CA5A 3ZMSB 5HWXA 4QHOA 3RIAA 1ZHCA 3AEFA 4MFRA 5HAXA 4UEMA 4EYUA 4CN4A 2GK9A 3LJCA 5LBMA 5LG4A 4H9RC 2ACZA 3PDYA 2KXPB 4COFA 2LRKA 3EUHA 3RGLA 2ZM8A 2XASB 2B1EA 2XSAA 2JMHA 5J2UE 1LVFA 3C51A 5ABFA 2WP9A 3L8RA 4UV8B 3VRBA 5JH7E 3RHWA 5JR9C 3K3NA 5JDGA 4JI5T 5HXHA 4MBQA 1BR0A 1XNQT 3UFGA 2XAQB 1T72A 5AQVB 1WRDA 2CXDA 3SFEA 2LSIA 3AE4A 4X20E 1HFAA 4DBRA 4TUYE 4ILAA 5HEJA 2IC9A 4BJMA 1XWMA 3AECA 4TNVA 4ASKA 2P9BA 4ANJA 4ISSA 2NP9A 3AE7A 2ZM2A 2D0UA 2MOZA 3PUSA 2F4VT 5C3JA 3ZMTB 4A56A 4N78D 3K3OA 2VVNA 4BA9A 4X66T 2WAUA 3UTKA 4FJOA 3QB5A 3MXZA 1ZV4X 1E1HB 4U74A 5EK2A 3VU7H 5C8YE 2ACXA 3CQCB 2XY8B 2VKDA 3Q5DA 2NW8A 2NW7A 3P4QA 4ZI2C 1KK7A 2KNDA 5HYAA 5AQPB 3FZFB 4HE8A 5L3FB 4ERRA 5LGNB 1MMGA 4PJMA 3AE5A 2EHOC 2JJ9A 3Q5XA 3KV4A 2DL1A 3VKGA 4LFBT 1FMVA 4EYYR 2DWKA 2RPAA 3AXJA 4X1IE 1L0VA 5HXEA 2V7JA 4DR5T 2FJEA 3LFMA 4AKGA 2QYWA 3KVAA 4OYJA 5AQQB 2K9AA 1SA0E 4U3CA 2JQHA 2LSYA 2XPKA 3ZT6A 1ZP0A 2I6HA 2A3DA 2W61A 5JDNA 1HNWT 2G0UA 3L09A 3N2OA 2BBHA 2VQET 5IUXA 3VKHA 1OXZA 1UK5A 5JVDE 1UX4A 5LOVE 3PUWF 1B7TA 4EB6E 3SS1A 2QGSA 5KXJA 4U33A 1T98A 4ILBA 3HR0A 4AXPA 2WU2A 4OHFA 3O1HA 2HPJA 5F8PA 1GQEA 2WSSV 2XAFB 3CWZB 3NVOA 4C90A 4CN1A 3P4WA 2E9XC 2V5CA 3K8PC 5LP6E 2VB6A 4IHJE 3AA1B 1WYCA 4GK5E 1MIVA 4EIWA 1H7CA 1Z0PA 4KP3C 3U3IA 4O4LE 3T1YT 4DV7T 2JQKA 5JR9A 4M1PA 2LLYA 2WMOA 2A9UA 3AEEA 3GMIA 3JAFA 1KEYA 2X9WA 3CK6A 4UV9B 3FHNA 2DWGA 1YW0A 2JQQA 2JRKA 4FI5A 4H9NC 3RIFA 4ZZBA 4JI7T 5HEOA 2YN6A 1US7B 5FXXA 2XAGB 5J1GA 2WWUA 5IYZE 1T7SA 4H9SE 4KHZF 3A8YC 2WS3A 5ETWA 1YQ4A 4U7YA 1HG2A 2ZLYA 5H6QB 3DTOA 3Q5EA 3UUXB 1D0XA 1W09A 2UUAT 4EAHA 3B57A 4MALA 3AEDA 5FXZA 4KHPT 4DV1T 2VWAA 2LE8A 3C64A 3T8OA 4PFPA 3F2EA 3RYCE 3IF8B 3JAEA 5FL0A 4HWFA 3O4XE 3A7MA 3ZYKA 3RC8A 4HFEA 5ABEA 5LGTB 5DJQC 1D0ZA 2EHOD 1S35A 4DV3T 1KFYA 1M7KA 5LYJE 1AJ3A 2MAWA 4HTEA 4TWHA 2CHOA 2WY2A 1KNPA 4LF5T 4Z91A 5JREA 2V8SV 4A5XA 2XQAA 2XM2A 3N2GE 2DCFA 3KBUA 3PJAA 3PUVF 1LRZA 4HWDA 5AQJB 1OEDA 4X65T 1MIYA 4JYAT 5KMGP 4DV5T 3ONLC 1IJ6A 2QA7A 4J2CA 4PNIA 4JI1T 4B3RT 2ZM6T 4YJ2E 2V5DA 4HWHA 1IZNB 1KNRA 4IDQA 3RC3A 4OYKA 1W0BA 4DBQA 3J7Yq 1KF6A 1JNZA 2HPLA 3ZJ1A 3RYIE 3RRWA 5J2TE 4LF9T 2FUPA 3OYZA 5HCMA 5FVLA 4DV6T 2LM2A 2LT3A 1HTJF 5FXVA 2J1DG 4WW0A 4HEAA 5FY1A 1IBLT 2WCAA 3ABVA 4JLEA 1KNZA 1UGOA 1Y01A 1N34T 3D0TA 4MLKA 3P7IA 2QRXA 5AQSB 3U78A 2VL0A 2BDEA 3UULA 5JDHA 5M4YA 4DNDA 3QOFA 3NZQA 2PG8A 2Z6EA 3UQ4A 1MMDA 5EZYE 4F8HA 3AVRA 5KX5E 4ZS2A 4I0UA 2ODVA 2K5BB 2W62A 3FZHB 2I0MA 4JEHB 1VOMA 4QH1A 3AE9A 2KLQA 4IDZA 1ZEEA 5AQNB 4HFDA 1FEWA 2H89A 2UUBT 2D9DA 2H7VC 4PJJA 4NUVA 4WBOA 5AQKB 5JDQA 4U72A 4UVCB 5HEUA 3MZKB 4YSYA 1N33T 4XZCA 3N9LA 2JPFA 4XAXB 2Q9QC 5ADXL 1QSDA 2D2SA 3QNUA 3RQWA 2L3LA 3JC6C 5LGUB 2PJQA 1WCRA 2MBGA 5IWAT 4YHHT 2NTXA 4HWCA 4ILCA 3NKZA 3QB5K 3GN5A 5L2LA 4JI3T 4AKHA 3LSVA 5IHYA 4IE6A 3UU3A 1D1AA 3E22E 4UR9A 3FB2A 1D0YA 2W00A 3ANWA 2W63A 3I1AA 4IIJE 5AQGB 2YINA 2BKOA 5LBQB 2RP4A 2J62A 3FZLB 3HKDE 3ZC0A 4BJNA 3AVSA 1MNEA 4DO0A 3DP7A 4YTNA 2VKOA 3QK6A 2JQ9A 3N9MA 3AA0B 1G73A 3ONJA 4KMCA 1ZOYA 2DLRA 2NTYA 3AE2A 4PK4A 3VR8A 3FBLA 2CE7A 4YSZA 3PUYF 2CWOA 3NBXX 3PUAA 3HI2A 3ZLIA 3RLFF 4YTMA 5A1LA 3RIUC 3RRCA 3G06A 3ZN1B 1YD8G 2CPTA 2EHOB 2LSJA 3HKBE 4KI0F 3ZT5A 2C5IT 2V1DB 1S94A 4PW8A 2HN2A 4JI4T 5JRCB 2LRLA 3AE3A 2PBIA 1T8BA 4O4HE 3KBTA 5HWYA 1CUNA 2W67A 2BZBA 3UU5A 5LJMA 2C5JA 3MJXA 3TLUA 3P50A 5EK4A 3KV9A 2YDSA 4K0KT 2IMLA 4GYRA 4UIGA 2UU9T 4LF4T 3M3ZB 2LOSA 3LBXA 2E9XD 4IE5A 4WBNE 4QX8B 1O3XA 2DHRA 4HFCA 1J5ET 2DI4A 4JI2T 4DIDB 2FJBA 3FZMB 3MKDA 3CVRA 4OX9T 2D5UA 4EEBA 3P4SA 4DR4T 4YY3T 3DJBA 3NWIA 2NOXA 3PE0A 3UUBA 4K0UA 2X68A 3PURA 1VCSA 2XZEA 3RH3A 2YK0A 3KV5A 2JMKA 4ZI3C 4DMVA 4IDOA 5FP3A 4YFSA 4AQFC 4ZI2D 3BQIA 1IBKT 1WFDA 3S4UA 4OK0A 4DR2T 4DUYT 5HXRA 5L3BB 4G63A 3AXJB 4E7ZA 2LSGA 3ETVA 3F31A 4NUUA 1QLBA 3PU8A 5FVKA 2YDQA 3ZJ2A 2CEAA 4WYVA 4ZOLE 4AQGA 3AAEB 3AAIA 3SRZA 2K3WA 4H63H 2BG9B 4IT4A 5CFBA 1W9RA 2BVLA 2V6YB 3AAAB 3OPCA 4JBWF 3EAMA 3KVBA 2A2FX 2OA5A 5JTGA 3V5UA 5LHGB 5AFUL 5JRCA 3R6NA 2IUBA 4TNWA 2LKGA 3FZKB 4AI6A 2XQ3A 3CX7B 4PAGA 4U2YA 3RKOA 3IEEA 2YU2A 3PV0F 5FL1A 2K48A 5L3GB 4AIUA 4YSXA 3ZT7A 4H9OC 1WLXA 3ZMUB 1XDOA 4L9IA 3RKGA 1XZYA 3ZCIA 2W2UA 4JI6T 4TV9E 1J5WA 1MMAA 2CXFA 2XTLA 2XQ8A 1HF8A 2YKSA 5AQLB 5HXSA 2AXDS 2V6XA 5L4HA 2V7LA 4B3TT 4DR1T 4A98A 1G8XA 3C4ZA 2CMRA 3L39A 3PUZF 4HFIA 4HFVA 1X9BA 4NIQA 1D1CA 2FBWA 4QXBB 1U4QA 3VRAA 3HKCE 3ZC1A 4ADZA 4EXTA 4UVAB 4P1NA 2VVSA 4QH4A 4CXWA 4KUMB 4ZI3D 2SPCA 4Z8XA 4TWFA 4CZZB 2ZM0A 4E7SA 1YXRA 1UX5A 3P4PA 2Q9QD 2UXXB 1UCUA 5JDLA 5JQGE 3L3PA 1LKXA 5L3EB 4LF7T 2YDRA 2OLTA 2YOEA 2I59A 3HKEE 3P8CD 4TV8E 1VRBA 2LJLA 2XQ9A 4X1KE 3TLTA 2WB5A 2DNXA 2K24A 3AE8A 4HKAA 3C4XA 4QX7B 2W0GA 3AA7B 5CB4E 4DV2T 3ZEFB 4IL4A 1NEKA 2CXLA 2XQYA 4JUYA 3ZMVB 4DV0T 4JI8T 3TLVA 2V26A 3BQLA 3SOLA 4X62T 4NXMT 2CBJA 4QXHB 4B3MT 1HS7A 4V1Av 4AQYT 3CIRA 3UUNA 3RPUA 4IE4A 4CXXA 3K1SA 4CI2B 5LMUT 5AQTB 2X9YA 2H7OA 3ZN0B 1BR1A 1R8IA 4HN9A 2VQFT 4WNKA 2KWIB 3LBXB 2XHEB 3RF1A 1W0AA 3RYHE 3SWHA 5AQIB 3SFDA 3JC6D 3TLWA 2HHHT 3O1JA 2WWVA 4AISA 3EDVA 4YXDA 3MA9A 5LJNA 2Q9QB 1YQ3A 2XM1A 3AE1A 5AQFB 3WAKA 1HR0T 4TN7B 5L47A 3TLSA 3V5SA 4DR7T 3IHRA 3B13A 2WZHA 5EK3A 4TZ4C 2BS2A 2ES0A 2W66A 5J0ZA 3AB3B 5FNVE 2V7KA 4LFCT 2M6BA 2W4XA 3CQGB 2L9QA 3JCFA 3AEBA 4O8SA 2M6IA 4C91A 2MTQA 5BR8T 3CPZA 1XMOT 5ABGA 2N1GA 4L0RA 4GOUA 2LEHA 4O2AE 1MMNA 3NZPA 3C4WA 3CKDA 3I0OA 2XJ7A 4QWNB 4ZZCA 1OEDB 5LG3A 5LXTE 1EZ3A 1JNRA 3H3MA 3OVUA 3NRXA 4B6XA 4HFHA 4YLHA 1XMQT 1J1JA 3VHLA 1I94T 4U7IA 2FJDA 2CCQA 3GA8A 4DVDA 3I0QA 1MIWA 5FYMA 4ZI7E 1HCIA 2XQ7A 3MK7C 4AQFA 2X0HA 5KDMC 2N2NA 4P0BA 1BR4A 4P0AA 4H9PC 2BKNA 4CN6A 2C0SA 2KSRA 3MACA 3NRYA 5LHHB 2IC6A 5ABHA 2UUCT 1Z8UA 2X9XA 4I50E 4OFZA 4UVBB 3OYXA 3ZCJA 1E2AA 1M62A 3J9X1 2KT9A 1NENA 3AE6A 4ILUA 2BVMA 5BMVE 1UUSA 2ZMAA 1ZKEA 3ETUA 5FXWA 2WU5A 4EZHA 2QVAA 1SUMB 3OKQA 1FIOA 3GN5B 4X64T 2MYSA 2YU1A 3I9YA 3F57A 4QXCB 2Q9QA 1Y64B 3BQKA 3LG7A 3N2KE 3RQUA 5LMNT 4PJNA 4TX5A 4UF0B 4U31A 5DQVA 4JEUB 4LMLA 1OEDE 2MPKA 3UFEA 4DMWA 3B5MA 3EDUA 5CA1E 4AKLA 4IGUA 4AKRB 4UXNB 3N9OA 3I9WA 4IL9A 2B76A 2KZ7B 2J4GA 5FY7A 2D0TA 2E2AA 3TKLB 5HEGA 4EV6A 2E9XA 2V7IA 3T1HT 5LB7B 4CI3B 2X0YA 3LK3B 4CXYA 2HH7A 5AQOB 4ISTA 2XQ6A 2WZIA 3E0ZA 3X1DA 2C5KT 3PU3A 3RX6A 4DUZT 3R84B 1SHZC 5E0OA 5DQWA 2VURA 2R6GF 2EHOA 3EABA 4O4JE 2LOPA 5CA0E 2VKJA 2VL8A 4GIWA 2CLYC 4X1YE 3WI3A 3AEGA 5CJ5A 4HWIB 1V9DA 2CM0A 3BK9A 4EEDA 2X66A 2Y48B 2L8KA 4AKIA 4P09A 4A97A 2BG9C 2WDVA 3LK42 1HNZT 3KINB 3E08A 4YJ3E 4GKJT 3KDSE 4GKKT 1N36T 1N32T 3Q5WA 1HX8A 2UXNB 3H37A 1HNXT 3FXDB 1UURA 2E5LT 2X0LB 4HGAA 3OJAA 1FMWA 2Y8DA 3PJAJ 5AQRB 1U5PA 2LKHA 4ZXLA 3ZYLA 4LFAT 2VK9A 3FBZA 3QUJA 4IE7A 3WAJA 4GYSA 3ZSTA 4KX6A 5AQMB 2ODUA 3UU8A 3Q9DA 4U2ZA 2BG9E 1OEDC 4YTPA 3IBPA 3FXEB 3CQXC 2A72A 2LSKA 2H3RA 4MHCA 2LHRA 2BG9A 2Y6XA 3PTRB 3P4RA 4UF0A 4LF8T 5L3CB 1HG5A 2XQ4A 4KBMB 1X79A 2WM9A 5ABFB 5F3JA 2XAHB 5GONE 4NPPA 4LF6T 3HL6A 3C50A 4QKNA 5LCYA 2HN1A 2RA1A 2XAJB 4LMKA 1HX1B 2KINB 4QH5A 3O9XA 3K3QC 2E9XB 3N5LA 2IIUA 2AE9A 4WZXA 1DU2A 1I6ZA 4ZHQE 1IAPA 4CQIA 1YKEB 3PUQA 4TWDA 4DR6T 4DR3T 2NR4A 2WDRA 4IE0A 4L5GA 4UELA 3RI5A 2CRBA 5FY0A 3N9PA 2V6YA 4PJLA 4PK6A 3CX8B 4YHJA 3ESLA 3AEAA 5LA6E 3UU6A 4B3ST 4H9QC 2LHNA 4I43B 2WQYA 5L4EA 3UT5E 1YKHB 5LHIB 2PFVA 5JR9B 2OV9A 2XSBA 1FJGT 3OBVE 1WR0A 2IHR1 5H6RB 3RIUA 3LDQB 2VASA 3H3AA 4X5TA 5TAOA 3ANWB 4BAYB 2JIWA 2LM9A 3QC9A 4PK5A 4ZEYA 1WYBA 4JV5T 2UXDT 2J47A 5JDFA 2IAKA 3JADA 3PUXF 2N9DA 1WR6A 5HXCA 2V7MA 5JDMA 3HA4A 2CBIA 1XDPA
chains in the Genus database with same CATH topology
5AQHB 1I6ZA 5AQVB 5AQQB 4HWDA 5AQJB 5AQUB 5AQGB 5AQTB 3M3ZB 3FZHB 5AQNB 5AQRB 1T7SA 3FZLB 1UK5A 4HWHA 3A8YC 5AQIB 2D9DA 5AQKB 3FZMB 5AQMB 3FZKB 5AQFB 5AQOB 3LDQB 4HWFA 5AQPB 3FZFB 1M62A 1UGOA 1M7KA 4HWCA 4HWIB 5AQSB 1HX1B 5AQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQH B;  1I6Z A;  5AQV B;  5AQQ B;  4HWD A;  5AQJ B;  5AQU B;  5AQG B;  5AQT B;  3M3Z B;  3FZH B;  5AQN B;  5AQR B;  1T7S A;  3FZL B;  1UK5 A;  4HWH A;  3A8Y C;  5AQI B;  2D9D A;  5AQK B;  3FZM B;  5AQM B;  3FZK B;  5AQF B;  5AQO B;  3LDQ B;  4HWF A;  5AQP B;  3FZF B;  1M62 A;  1UGO A;  1M7K A;  4HWC A;  4HWI B;  5AQS B;  1HX1 B;  5AQL B; 
#chains in the Genus database with same CATH topology
 2WDQ A;  4IDN A;  5LNK A;  1OWA A;  5DAB A;  2BBJ A;  3LK2 B;  3N9N A;  5F5W A;  2KWH A;  3M65 A;  3UQ7 A;  2BKP A;  2PTF A;  4G2A A;  3O1I A;  3ONX A;  4O4I E;  4Q25 A;  3VR9 A;  3N9Q A;  1BR2 A;  3OTO T;  2CLY B;  4EOZ B;  3EHZ A;  4DV4 T;  1E7P A;  4IDP A;  1IBM T;  5FMN A;  2VKH A;  4IRE A;  4EGW A;  3PUG A;  3GWH A;  4LMJ A;  3KV6 A;  4H63 V;  2NW9 A;  2NWB A;  3A5X A;  4I55 E;  5CGM A;  2M67 A;  3ZSS A;  1LVK A;  5HCJ A;  3CML A;  4EZ4 A;  2XQ5 A;  4ZS3 A;  2KMF A;  2H88 A;  1CHU A;  1D1B A;  2X51 A;  3IA3 A;  2IDO B;  3W15 B;  2X9H A;  3C98 B;  3EI0 A;  2CHN A;  2UXB T;  4HFB A;  2WBL A;  3Q2M A;  5L3D B;  5FKY A;  5HEH A;  3ZMZ B;  4JI0 T;  4NXN T;  1XNR T;  2CWY A;  3CX6 B;  3ZPO A;  1MND A;  2X67 A;  2XUE A;  2IW5 B;  3UU4 A;  1SE7 A;  5AQH B;  2UXC T;  3EVY A;  4YT0 A;  1VCT A;  4CI1 B;  2YEV C;  2E8I A;  3AA6 B;  4Z90 A;  1IJ5 A;  3KFW X;  4XBF B;  5AQU B;  3ZKR A;  1NWM X;  3ZYM A;  4F6R C;  2WMN A;  5C2T A;  2E5V A;  4GK0 E;  1QUU A;  2BS3 A;  4PFO A;  3RYF E;  2BS4 A;  4O2B E;  3UUM A;  2FJA A;  1NAF A;  4I4T E;  2CA5 A;  3ZMS B;  5HWX A;  4QHO A;  3RIA A;  1ZHC A;  3AEF A;  4MFR A;  5HAX A;  4UEM A;  4EYU A;  4CN4 A;  2GK9 A;  3LJC A;  5LBM A;  5LG4 A;  4H9R C;  2ACZ A;  3PDY A;  2KXP B;  4COF A;  2LRK A;  3EUH A;  3RGL A;  2ZM8 A;  2XAS B;  2B1E A;  2XSA A;  2JMH A;  5J2U E;  1LVF A;  3C51 A;  5ABF A;  2WP9 A;  3L8R A;  4UV8 B;  3VRB A;  5JH7 E;  3RHW A;  5JR9 C;  3K3N A;  5JDG A;  4JI5 T;  5HXH A;  4MBQ A;  1BR0 A;  1XNQ T;  3UFG A;  2XAQ B;  1T72 A;  5AQV B;  1WRD A;  2CXD A;  3SFE A;  2LSI A;  3AE4 A;  4X20 E;  1HFA A;  4DBR A;  4TUY E;  4ILA A;  5HEJ A;  2IC9 A;  4BJM A;  1XWM A;  3AEC A;  4TNV A;  4ASK A;  2P9B A;  4ANJ A;  4ISS A;  2NP9 A;  3AE7 A;  2ZM2 A;  2D0U A;  2MOZ A;  3PUS A;  2F4V T;  5C3J A;  3ZMT B;  4A56 A;  4N78 D;  3K3O A;  2VVN A;  4BA9 A;  4X66 T;  2WAU A;  3UTK A;  4FJO A;  3QB5 A;  3MXZ A;  1ZV4 X;  1E1H B;  4U74 A;  5EK2 A;  3VU7 H;  5C8Y E;  2ACX A;  3CQC B;  2XY8 B;  2VKD A;  3Q5D A;  2NW8 A;  2NW7 A;  3P4Q A;  4ZI2 C;  1KK7 A;  2KND A;  5HYA A;  5AQP B;  3FZF B;  4HE8 A;  5L3F B;  4ERR A;  5LGN B;  1MMG A;  4PJM A;  3AE5 A;  2EHO C;  2JJ9 A;  3Q5X A;  3KV4 A;  2DL1 A;  3VKG A;  4LFB T;  1FMV A;  4EYY R;  2DWK A;  2RPA A;  3AXJ A;  4X1I E;  1L0V A;  5HXE A;  2V7J A;  4DR5 T;  2FJE A;  3LFM A;  4AKG A;  2QYW A;  3KVA A;  4OYJ A;  5AQQ B;  2K9A A;  1SA0 E;  4U3C A;  2JQH A;  2LSY A;  2XPK A;  3ZT6 A;  1ZP0 A;  2I6H A;  2A3D A;  2W61 A;  5JDN A;  1HNW T;  2G0U A;  3L09 A;  3N2O A;  2BBH A;  2VQE T;  5IUX A;  3VKH A;  1OXZ A;  1UK5 A;  5JVD E;  1UX4 A;  5LOV E;  3PUW F;  1B7T A;  4EB6 E;  3SS1 A;  2QGS A;  5KXJ A;  4U33 A;  1T98 A;  4ILB A;  3HR0 A;  4AXP A;  2WU2 A;  4OHF A;  3O1H A;  2HPJ A;  5F8P A;  1GQE A;  2WSS V;  2XAF B;  3CWZ B;  3NVO A;  4C90 A;  4CN1 A;  3P4W A;  2E9X C;  2V5C A;  3K8P C;  5LP6 E;  2VB6 A;  4IHJ E;  3AA1 B;  1WYC A;  4GK5 E;  1MIV A;  4EIW A;  1H7C A;  1Z0P A;  4KP3 C;  3U3I A;  4O4L E;  3T1Y T;  4DV7 T;  2JQK A;  5JR9 A;  4M1P A;  2LLY A;  2WMO A;  2A9U A;  3AEE A;  3GMI A;  3JAF A;  1KEY A;  2X9W A;  3CK6 A;  4UV9 B;  3FHN A;  2DWG A;  1YW0 A;  2JQQ A;  2JRK A;  4FI5 A;  4H9N C;  3RIF A;  4ZZB A;  4JI7 T;  5HEO A;  2YN6 A;  1US7 B;  5FXX A;  2XAG B;  5J1G A;  2WWU A;  5IYZ E;  1T7S A;  4H9S E;  4KHZ F;  3A8Y C;  2WS3 A;  5ETW A;  1YQ4 A;  4U7Y A;  1HG2 A;  2ZLY A;  5H6Q B;  3DTO A;  3Q5E A;  3UUX B;  1D0X A;  1W09 A;  2UUA T;  4EAH A;  3B57 A;  4MAL A;  3AED A;  5FXZ A;  4KHP T;  4DV1 T;  2VWA A;  2LE8 A;  3C64 A;  3T8O A;  4PFP A;  3F2E A;  3RYC E;  3IF8 B;  3JAE A;  5FL0 A;  4HWF A;  3O4X E;  3A7M A;  3ZYK A;  3RC8 A;  4HFE A;  5ABE A;  5LGT B;  5DJQ C;  1D0Z A;  2EHO D;  1S35 A;  4DV3 T;  1KFY A;  1M7K A;  5LYJ E;  1AJ3 A;  2MAW A;  4HTE A;  4TWH A;  2CHO A;  2WY2 A;  1KNP A;  4LF5 T;  4Z91 A;  5JRE A;  2V8S V;  4A5X A;  2XQA A;  2XM2 A;  3N2G E;  2DCF A;  3KBU A;  3PJA A;  3PUV F;  1LRZ A;  4HWD A;  5AQJ B;  1OED A;  4X65 T;  1MIY A;  4JYA T;  5KMG P;  4DV5 T;  3ONL C;  1IJ6 A;  2QA7 A;  4J2C A;  4PNI A;  4JI1 T;  4B3R T;  2ZM6 T;  4YJ2 E;  2V5D A;  4HWH A;  1IZN B;  1KNR A;  4IDQ A;  3RC3 A;  4OYK A;  1W0B A;  4DBQ A;  3J7Y q;  1KF6 A;  1JNZ A;  2HPL A;  3ZJ1 A;  3RYI E;  3RRW A;  5J2T E;  4LF9 T;  2FUP A;  3OYZ A;  5HCM A;  5FVL A;  4DV6 T;  2LM2 A;  2LT3 A;  1HTJ F;  5FXV A;  2J1D G;  4WW0 A;  4HEA A;  5FY1 A;  1IBL T;  2WCA A;  3ABV A;  4JLE A;  1KNZ A;  1UGO A;  1Y01 A;  1N34 T;  3D0T A;  4MLK A;  3P7I A;  2QRX A;  5AQS B;  3U78 A;  2VL0 A;  2BDE A;  3UUL A;  5JDH A;  5M4Y A;  4DND A;  3QOF A;  3NZQ A;  2PG8 A;  2Z6E A;  3UQ4 A;  1MMD A;  5EZY E;  4F8H A;  3AVR A;  5KX5 E;  4ZS2 A;  4I0U A;  2ODV A;  2K5B B;  2W62 A;  3FZH B;  2I0M A;  4JEH B;  1VOM A;  4QH1 A;  3AE9 A;  2KLQ A;  4IDZ A;  1ZEE A;  5AQN B;  4HFD A;  1FEW A;  2H89 A;  2UUB T;  2D9D A;  2H7V C;  4PJJ A;  4NUV A;  4WBO A;  5AQK B;  5JDQ A;  4U72 A;  4UVC B;  5HEU A;  3MZK B;  4YSY A;  1N33 T;  4XZC A;  3N9L A;  2JPF A;  4XAX B;  2Q9Q C;  5ADX L;  1QSD A;  2D2S A;  3QNU A;  3RQW A;  2L3L A;  3JC6 C;  5LGU B;  2PJQ A;  1WCR A;  2MBG A;  5IWA T;  4YHH T;  2NTX A;  4HWC A;  4ILC A;  3NKZ A;  3QB5 K;  3GN5 A;  5L2L A;  4JI3 T;  4AKH A;  3LSV A;  5IHY A;  4IE6 A;  3UU3 A;  1D1A A;  3E22 E;  4UR9 A;  3FB2 A;  1D0Y A;  2W00 A;  3ANW A;  2W63 A;  3I1A A;  4IIJ E;  5AQG B;  2YIN A;  2BKO A;  5LBQ B;  2RP4 A;  2J62 A;  3FZL B;  3HKD E;  3ZC0 A;  4BJN A;  3AVS A;  1MNE A;  4DO0 A;  3DP7 A;  4YTN A;  2VKO A;  3QK6 A;  2JQ9 A;  3N9M A;  3AA0 B;  1G73 A;  3ONJ A;  4KMC A;  1ZOY A;  2DLR A;  2NTY A;  3AE2 A;  4PK4 A;  3VR8 A;  3FBL A;  2CE7 A;  4YSZ A;  3PUY F;  2CWO A;  3NBX X;  3PUA A;  3HI2 A;  3ZLI A;  3RLF F;  4YTM A;  5A1L A;  3RIU C;  3RRC A;  3G06 A;  3ZN1 B;  1YD8 G;  2CPT A;  2EHO B;  2LSJ A;  3HKB E;  4KI0 F;  3ZT5 A;  2C5I T;  2V1D B;  1S94 A;  4PW8 A;  2HN2 A;  4JI4 T;  5JRC B;  2LRL A;  3AE3 A;  2PBI A;  1T8B A;  4O4H E;  3KBT A;  5HWY A;  1CUN A;  2W67 A;  2BZB A;  3UU5 A;  5LJM A;  2C5J A;  3MJX A;  3TLU A;  3P50 A;  5EK4 A;  3KV9 A;  2YDS A;  4K0K T;  2IML A;  4GYR A;  4UIG A;  2UU9 T;  4LF4 T;  3M3Z B;  2LOS A;  3LBX A;  2E9X D;  4IE5 A;  4WBN E;  4QX8 B;  1O3X A;  2DHR A;  4HFC A;  1J5E T;  2DI4 A;  4JI2 T;  4DID B;  2FJB A;  3FZM B;  3MKD A;  3CVR A;  4OX9 T;  2D5U A;  4EEB A;  3P4S A;  4DR4 T;  4YY3 T;  3DJB A;  3NWI A;  2NOX A;  3PE0 A;  3UUB A;  4K0U A;  2X68 A;  3PUR A;  1VCS A;  2XZE A;  3RH3 A;  2YK0 A;  3KV5 A;  2JMK A;  4ZI3 C;  4DMV A;  4IDO A;  5FP3 A;  4YFS A;  4AQF C;  4ZI2 D;  3BQI A;  1IBK T;  1WFD A;  3S4U A;  4OK0 A;  4DR2 T;  4DUY T;  5HXR A;  5L3B B;  4G63 A;  3AXJ B;  4E7Z A;  2LSG A;  3ETV A;  3F31 A;  4NUU A;  1QLB A;  3PU8 A;  5FVK A;  2YDQ A;  3ZJ2 A;  2CEA A;  4WYV A;  4ZOL E;  4AQG A;  3AAE B;  3AAI A;  3SRZ A;  2K3W A;  4H63 H;  2BG9 B;  4IT4 A;  5CFB A;  1W9R A;  2BVL A;  2V6Y B;  3AAA B;  3OPC A;  4JBW F;  3EAM A;  3KVB A;  2A2F X;  2OA5 A;  5JTG A;  3V5U A;  5LHG B;  5AFU L;  5JRC A;  3R6N A;  2IUB A;  4TNW A;  2LKG A;  3FZK B;  4AI6 A;  2XQ3 A;  3CX7 B;  4PAG A;  4U2Y A;  3RKO A;  3IEE A;  2YU2 A;  3PV0 F;  5FL1 A;  2K48 A;  5L3G B;  4AIU A;  4YSX A;  3ZT7 A;  4H9O C;  1WLX A;  3ZMU B;  1XDO A;  4L9I A;  3RKG A;  1XZY A;  3ZCI A;  2W2U A;  4JI6 T;  4TV9 E;  1J5W A;  1MMA A;  2CXF A;  2XTL A;  2XQ8 A;  1HF8 A;  2YKS A;  5AQL B;  5HXS A;  2AXD S;  2V6X A;  5L4H A;  2V7L A;  4B3T T;  4DR1 T;  4A98 A;  1G8X A;  3C4Z A;  2CMR A;  3L39 A;  3PUZ F;  4HFI A;  4HFV A;  1X9B A;  4NIQ A;  1D1C A;  2FBW A;  4QXB B;  1U4Q A;  3VRA A;  3HKC E;  3ZC1 A;  4ADZ A;  4EXT A;  4UVA B;  4P1N A;  2VVS A;  4QH4 A;  4CXW A;  4KUM B;  4ZI3 D;  2SPC A;  4Z8X A;  4TWF A;  4CZZ B;  2ZM0 A;  4E7S A;  1YXR A;  1UX5 A;  3P4P A;  2Q9Q D;  2UXX B;  1UCU A;  5JDL A;  5JQG E;  3L3P A;  1LKX A;  5L3E B;  4LF7 T;  2YDR A;  2OLT A;  2YOE A;  2I59 A;  3HKE E;  3P8C D;  4TV8 E;  1VRB A;  2LJL A;  2XQ9 A;  4X1K E;  3TLT A;  2WB5 A;  2DNX A;  2K24 A;  3AE8 A;  4HKA A;  3C4X A;  4QX7 B;  2W0G A;  3AA7 B;  5CB4 E;  4DV2 T;  3ZEF B;  4IL4 A;  1NEK A;  2CXL A;  2XQY A;  4JUY A;  3ZMV B;  4DV0 T;  4JI8 T;  3TLV A;  2V26 A;  3BQL A;  3SOL A;  4X62 T;  4NXM T;  2CBJ A;  4QXH B;  4B3M T;  1HS7 A;  4V1A v;  4AQY T;  3CIR A;  3UUN A;  3RPU A;  4IE4 A;  4CXX A;  3K1S A;  4CI2 B;  5LMU T;  5AQT B;  2X9Y A;  2H7O A;  3ZN0 B;  1BR1 A;  1R8I A;  4HN9 A;  2VQF T;  4WNK A;  2KWI B;  3LBX B;  2XHE B;  3RF1 A;  1W0A A;  3RYH E;  3SWH A;  5AQI B;  3SFD A;  3JC6 D;  3TLW A;  2HHH T;  3O1J A;  2WWV A;  4AIS A;  3EDV A;  4YXD A;  3MA9 A;  5LJN A;  2Q9Q B;  1YQ3 A;  2XM1 A;  3AE1 A;  5AQF B;  3WAK A;  1HR0 T;  4TN7 B;  5L47 A;  3TLS A;  3V5S A;  4DR7 T;  3IHR A;  3B13 A;  2WZH A;  5EK3 A;  4TZ4 C;  2BS2 A;  2ES0 A;  2W66 A;  5J0Z A;  3AB3 B;  5FNV E;  2V7K A;  4LFC T;  2M6B A;  2W4X A;  3CQG B;  2L9Q A;  3JCF A;  3AEB A;  4O8S A;  2M6I A;  4C91 A;  2MTQ A;  5BR8 T;  3CPZ A;  1XMO T;  5ABG A;  2N1G A;  4L0R A;  4GOU A;  2LEH A;  4O2A E;  1MMN A;  3NZP A;  3C4W A;  3CKD A;  3I0O A;  2XJ7 A;  4QWN B;  4ZZC A;  1OED B;  5LG3 A;  5LXT E;  1EZ3 A;  1JNR A;  3H3M A;  3OVU A;  3NRX A;  4B6X A;  4HFH A;  4YLH A;  1XMQ T;  1J1J A;  3VHL A;  1I94 T;  4U7I A;  2FJD A;  2CCQ A;  3GA8 A;  4DVD A;  3I0Q A;  1MIW A;  5FYM A;  4ZI7 E;  1HCI A;  2XQ7 A;  3MK7 C;  4AQF A;  2X0H A;  5KDM C;  2N2N A;  4P0B A;  1BR4 A;  4P0A A;  4H9P C;  2BKN A;  4CN6 A;  2C0S A;  2KSR A;  3MAC A;  3NRY A;  5LHH B;  2IC6 A;  5ABH A;  2UUC T;  1Z8U A;  2X9X A;  4I50 E;  4OFZ A;  4UVB B;  3OYX A;  3ZCJ A;  1E2A A;  1M62 A;  3J9X 1;  2KT9 A;  1NEN A;  3AE6 A;  4ILU A;  2BVM A;  5BMV E;  1UUS A;  2ZMA A;  1ZKE A;  3ETU A;  5FXW A;  2WU5 A;  4EZH A;  2QVA A;  1SUM B;  3OKQ A;  1FIO A;  3GN5 B;  4X64 T;  2MYS A;  2YU1 A;  3I9Y A;  3F57 A;  4QXC B;  2Q9Q A;  1Y64 B;  3BQK A;  3LG7 A;  3N2K E;  3RQU A;  5LMN T;  4PJN A;  4TX5 A;  4UF0 B;  4U31 A;  5DQV A;  4JEU B;  4LML A;  1OED E;  2MPK A;  3UFE A;  4DMW A;  3B5M A;  3EDU A;  5CA1 E;  4AKL A;  4IGU A;  4AKR B;  4UXN B;  3N9O A;  3I9W A;  4IL9 A;  2B76 A;  2KZ7 B;  2J4G A;  5FY7 A;  2D0T A;  2E2A A;  3TKL B;  5HEG A;  4EV6 A;  2E9X A;  2V7I A;  3T1H T;  5LB7 B;  4CI3 B;  2X0Y A;  3LK3 B;  4CXY A;  2HH7 A;  5AQO B;  4IST A;  2XQ6 A;  2WZI A;  3E0Z A;  3X1D A;  2C5K T;  3PU3 A;  3RX6 A;  4DUZ T;  3R84 B;  1SHZ C;  5E0O A;  5DQW A;  2VUR A;  2R6G F;  2EHO A;  3EAB A;  4O4J E;  2LOP A;  5CA0 E;  2VKJ A;  2VL8 A;  4GIW A;  2CLY C;  4X1Y E;  3WI3 A;  3AEG A;  5CJ5 A;  4HWI B;  1V9D A;  2CM0 A;  3BK9 A;  4EED A;  2X66 A;  2Y48 B;  2L8K A;  4AKI A;  4P09 A;  4A97 A;  2BG9 C;  2WDV A;  3LK4 2;  1HNZ T;  3KIN B;  3E08 A;  4YJ3 E;  4GKJ T;  3KDS E;  4GKK T;  1N36 T;  1N32 T;  3Q5W A;  1HX8 A;  2UXN B;  3H37 A;  1HNX T;  3FXD B;  1UUR A;  2E5L T;  2X0L B;  4HGA A;  3OJA A;  1FMW A;  2Y8D A;  3PJA J;  5AQR B;  1U5P A;  2LKH A;  4ZXL A;  3ZYL A;  4LFA T;  2VK9 A;  3FBZ A;  3QUJ A;  4IE7 A;  3WAJ A;  4GYS A;  3ZST A;  4KX6 A;  5AQM B;  2ODU A;  3UU8 A;  3Q9D A;  4U2Z A;  2BG9 E;  1OED C;  4YTP A;  3IBP A;  3FXE B;  3CQX C;  2A72 A;  2LSK A;  2H3R A;  4MHC A;  2LHR A;  2BG9 A;  2Y6X A;  3PTR B;  3P4R A;  4UF0 A;  4LF8 T;  5L3C B;  1HG5 A;  2XQ4 A;  4KBM B;  1X79 A;  2WM9 A;  5ABF B;  5F3J A;  2XAH B;  5GON E;  4NPP A;  4LF6 T;  3HL6 A;  3C50 A;  4QKN A;  5LCY A;  2HN1 A;  2RA1 A;  2XAJ B;  4LMK A;  1HX1 B;  2KIN B;  4QH5 A;  3O9X A;  3K3Q C;  2E9X B;  3N5L A;  2IIU A;  2AE9 A;  4WZX A;  1DU2 A;  1I6Z A;  4ZHQ E;  1IAP A;  4CQI A;  1YKE B;  3PUQ A;  4TWD A;  4DR6 T;  4DR3 T;  2NR4 A;  2WDR A;  4IE0 A;  4L5G A;  4UEL A;  3RI5 A;  2CRB A;  5FY0 A;  3N9P A;  2V6Y A;  4PJL A;  4PK6 A;  3CX8 B;  4YHJ A;  3ESL A;  3AEA A;  5LA6 E;  3UU6 A;  4B3S T;  4H9Q C;  2LHN A;  4I43 B;  2WQY A;  5L4E A;  3UT5 E;  1YKH B;  5LHI B;  2PFV A;  5JR9 B;  2OV9 A;  2XSB A;  1FJG T;  3OBV E;  1WR0 A;  2IHR 1;  5H6R B;  3RIU A;  3LDQ B;  2VAS A;  3H3A A;  4X5T A;  5TAO A;  3ANW B;  4BAY B;  2JIW A;  2LM9 A;  3QC9 A;  4PK5 A;  4ZEY A;  1WYB A;  4JV5 T;  2UXD T;  2J47 A;  5JDF A;  2IAK A;  3JAD A;  3PUX F;  2N9D A;  1WR6 A;  5HXC A;  2V7M A;  5JDM A;  3HA4 A;  2CBI A;  1XDP A; 
#chains in the Genus database with same CATH homology
 5AQH B;  1I6Z A;  5AQV B;  5AQQ B;  4HWD A;  5AQJ B;  5AQU B;  5AQG B;  5AQT B;  3M3Z B;  3FZH B;  5AQN B;  5AQR B;  1T7S A;  3FZL B;  1UK5 A;  4HWH A;  3A8Y C;  5AQI B;  2D9D A;  5AQK B;  3FZM B;  5AQM B;  3FZK B;  5AQF B;  5AQO B;  3LDQ B;  4HWF A;  5AQP B;  3FZF B;  1M62 A;  1UGO A;  1M7K A;  4HWC A;  4HWI B;  5AQS B;  1HX1 B;  5AQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...