1M7KA

Solution structure of the sodd bag domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Silencer of Death Domains
publication title The solution structure of the SODD BAG domain reveals additional electrostatic interactions in the HSP70 complexes of SODD subfamily BAG domains
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m7kA00
3FZHB 5AQPB 5AQSB 5AQKB 4HWHA 5AQTB 5AQQB 4HWCA 4HWDA 1UK5A 1UGOA 5AQGB 4HWFA 5AQMB 3FZMB 5AQFB 5AQJB 5AQOB 1HX1B 2D9DA 3FZKB 3FZLB 3LDQB 3M3ZB 5AQIB 1M62A 3A8YC 5AQNB 5AQUB 1M7KA 5AQVB 5AQRB 4HWIB 5AQHB 1T7SA 3FZFB 5AQLB 1I6ZA
chains in the Genus database with same CATH superfamily
1YQ4A 4ASKA 5A1LA 1NWMX 3RIUA 2UXCT 2WDVA 3M65A 3NWIA 2BBJA 4ILCA 2ACZA 1YKEB 2M6IA 1SE7A 5AQHB 4ILAA 4IGUA 5IYZE 2JMHA 4MFRA 4C90A 1UCUA 4DR2T 5HEGA 3AE9A 3Q9DA 4U7YA 4KHZF 4ZI2D 4LF7T 5AFUL 3P4SA 2NTYA 4IDQA 4DV6T 4U2ZA 3HKEE 5JRCB 4EIWA 3PUAA 1ZV4X 2LOSA 4A97A 4DUZT 1JNRA 2L9QA 3LG7A 5AQOB 3ZMVB 5ABGA 5JDMA 2C5JA 3UFEA 2CPTA 3UU6A 4YLHA 4COFA 3F31A 1FJGT 3N2KE 2H7OA 4DV4T 4JUYA 4NXMT 3HL6A 2C0SA 2K5BB 5JTGA 3K8PC 4CN6A 2IC9A 4GKKT 2QGSA 4UVCB 3UUBA 3RRWA 4YSXA 1CHUA 4O4JE 4ZXLA 4H9RC 2ODUA 2XQ8A 4HFIA 2V7IA 4AQFA 3BQLA 5FL1A 4BA9A 5JH7E 2NP9A 2FJEA 5TAOA 4AQGA 5AQJB 4JV5T 1B7TA 4EZ4A 4EOZB 4EEBA 3AEDA 4AQYT 1E2AA 2X9WA 4CI3B 4K0UA 3S4UA 4HFHA 1WYBA 1IZNB 3UQ7A 2LSKA 3HKCE 3AAAB 3B13A 4TV8E 2BKOA 2YOEA 2JQKA 4JEHB 5EK4A 2K3WA 3FZMB 2XQ3A 3QOFA 3KV9A 3VRAA 1WR0A 1OEDE 5LNKA 4ZS2A 2WZIA 1YD8G 3LFMA 2N1GA 2BVMA 4O4IE 2UXBT 4X20E 4AXPA 2VURA 1KK7A 4OYKA 4IHJE 3PUGA 3PU8A 2VQFT 2YDRA 1HX1B 2CXLA 3RYHE 2UXNB 2WDRA 5JDLA 2BS3A 2E5LT 3AECA 3I0QA 5AQGB 3RH3A 3ZC1A 4LF9T 4ANJA 2L3LA 4JI5T 1T8BA 3PUSA 5HWYA 3RYCE 3EHZA 2VKDA 4CZZB 1VRBA 2QVAA 4OFZA 5DABA 4AKIA 3ZT6A 4DV0T 2FJDA 3RGLA 4YTPA 2WSSV 3EDUA 3KBTA 3P50A 5HEUA 2CE7A 2XQ6A 3ANWB 3SFDA 2XUEA 1QUUA 5FXWA 1G8XA 4EYYR 3NBXX 3AAIA 3CX7B 3HKDE 2YK0A 5LYJE 2CEAA 2IAKA 3PUVF 3VRBA 3JC6D 1IAPA 3UU5A 3N9OA 4AKRB 4EXTA 3MJXA 2ACXA 4CI2B 4UVAB 4JI2T 1ZP0A 5AQQB 4H63H 1WYCA 1WFDA 3ETVA 4YHJA 3L3PA 3K3NA 4O8SA 4NUVA 1HNXT 2NWBA 2JRKA 2HPLA 1ZOYA 3P4WA 2JPFA 2W00A 1J1JA 5L4EA 2W4XA 4XBFB 4J2CA 2BG9C 2VKJA 1SUMB 5JRCA 2IW5B 5FVKA 1M7KA 1HF8A 3AA7B 2OA5A 2H3RA 4PFOA 4MBQA 2X51A 5KDMC 1DU2A 4DR4T 4TX5A 2HHHT 1W9RA 2YDQA 3CQGB 3QC9A 2MTQA 5FXZA 1XNRT 3H3MA 2DWGA 2CHOA 3UULA 3H37A 4JI4T 2H89A 2HN2A 3CX6B 2NW8A 3IEEA 3AE4A 5LMNT 3C4WA 3AE5A 3GWHA 2J4GA 3CPZA 3AA6B 4YY3T 4OYJA 3AE8A 4QHOA 3TLWA 5CJ5A 2IMLA 1Z0PA 5CGMA 2V26A 2XY8B 3RIFA 4ZI7E 2Z6EA 5J2TE 4KMCA 4EGWA 3RRCA 5AQIB 4A98A 3N9LA 4ZI2C 5L3GB 4JI6T 2XHEB 2IDOB 4KUMB 2I59A 3PUWF 3QB5A 4DR3T 4IE7A 4DR6T 4TWDA 1H7CA 2K48A 4DO0A 4WNKA 5IWAT 3AB3B 4B6XA 1NAFA 1I94T 2DHRA 4OHFA 1IBMT 5L3EB 2MBGA 2XQ7A 1LVFA 3MA9A 1KNZA 2XSBA 2UUBT 1J5WA 3RQUA 3AA0B 2D0TA 4ZS3A 1I6ZA 3NRYA 3UUXB 3C64A 4IDZA 3ZCJA 4P0BA 2VWAA 3B5MA 4ZZBA 2XQ9A 1XZYA 5JDFA 2V6YA 4JI0T 2LRLA 3RX6A 4CN1A 2BZBA 1FMVA 1R8IA 3RC8A 1MNEA 4PK4A 3PJAA 3ZJ2A 3UU8A 4ZI3C 3AVSA 2BG9E 5J0ZA 2Q9QA 5FVLA 1HR0T 3UQ4A 3X1DA 5JDNA 2KINB 1AJ3A 3OJAA 2WMNA 3BK9A 3HR0A 4WBOA 3RIUC 3OYZA 4AKGA 3I9WA 2ZM2A 2KWHA 5JQGE 4X1KE 3KDSE 1NEKA 2E2AA 4YSZA 4JYAT 3PJAJ 3EVYA 3RF1A 4DV5T 5M4YA 2E9XD 5FL0A 2W61A 4CI1B 4PJJA 5LG3A 3EDVA 1S35A 4UVBB 3CIRA 3NVOA 4XZCA 3ZYLA 4X1YE 4U2YA 4I50E 2WB5A 5AQVB 5LHIB 2K24A 5EK2A 4X1IE 2CLYB 2VKOA 3JCFA 4QX7B 3AEFA 3N2OA 4CN4A 2GK9A 3BQIA 4U74A 2Y8DA 3ONXA 2QA7A 1D0XA 2BVLA 3O1IA 4IIJE 5JR9B 2KWIB 1D0ZA 5FYMA 4O2AE 5J1GA 2MAWA 2LJLA 3SRZA 3AE7A 1MMAA 1QLBA 3RQWA 3CK6A 4DV3T 5GONE 2KXPB 5LHGB 4AQFC 3UTKA 3IHRA 1WLXA 4IE5A 3HA4A 4JEUB 3CKDA 5KXJA 2LE8A 3EUHA 4A56A 5CA1E 3AEAA 3AAEB 4E7SA 3AE2A 2WU2A 4IREA 2FJBA 5L3DB 2W66A 3PV0F 2PG8A 4NUUA 1W09A 3FZFB 2PJQA 3K3QC 3ZJ1A 2B1EA 2XJ7A 5FNVE 3U3IA 4AKLA 4DIDB 3K1SA 2Q9QD 2ZLYA 4HE8A 4X65T 3RI5A 2ZM0A 2Y48B 2VQET 2V5DA 2EHOC 1YW0A 2IC6A 4B3RT 1N32T 3B57A 5LHHB 5DJQC 4YFSA 2QRXA 4UELA 4CQIA 4N78D 2KSRA 4K0KT 2D9DA 2CXDA 5KX5E 2E8IA 4ERRA 3AVRA 3IBPA 4FJOA 4GK0E 1WR6A 4UEMA 5J2UE 4EB6E 4NPPA 3T1YT 4Z90A 4L5GA 1WCRA 2JMKA 2W63A 4O2BE 5LOVE 2X66A 1T98A 2C5IT 4U3CA 1BR0A 3ZSTA 2XM1A 3I9YA 2E5VA 4U33A 4LF4T 5ABFA 5ABEA 2XAQB 2J62A 5LGNB 1X9BA 2VKHA 3EI0A 4KBMB 4F6RC 3HKBE 3ZKRA 1MIVA 3OBVE 2V6YB 4H63V 4GOUA 3PURA 1YQ3A 5AQSB 2VVNA 4Z8XA 4HFBA 1HFAA 3QUJA 2RA1A 3M3ZB 2UXXB 2UU9T 4H9OC 2LSYA 4LFAT 2WWVA 1XDPA 2JQHA 2NR4A 4DNDA 5EK3A 2Q9QB 2XQAA 5FKYA 3R6NA 1L0VA 2XTLA 2BKNA 1YXRA 3P7IA 4DVDA 3Q5XA 2XAHB 2XAJB 4QXCB 4HWHA 2V5CA 1FIOA 2YKSA 2BKPA 2ZMAA 4TNVA 4PK6A 2WS3A 2L8KA 2DI4A 3ZPOA 2XAGB 3NZQA 4TWHA 2HPJA 4DUYT 4LMKA 4HFEA 2UXDT 2PTFA 2X0HA 4AI6A 5JR9A 5AQRB 4PW8A 4EEDA 4LF6T 2MYSA 2D5UA 4TZ4C 2FBWA 4IL9A 5LP6E 4HKAA 4QKNA 4UV8B 2X0YA 3SS1A 2DWKA 2IIUA 3TLVA 3KFWX 4QH5A 3VU7H 3RKOA 4WYVA 4AIUA 4X5TA 2WDQA 2DCFA 2W2UA 5FXXA 2DNXA 5LJNA 3KV4A 3MK7C 3O9XA 3RIAA 2CA5A 2KLQA 5HXRA 4ZZCA 4H9PC 2JJ9A 2LKGA 4WBNE 4C91A 3VR8A 1BR4A 2D2SA 2LM2A 3FB2A 4MALA 3KV5A 2AXDS 4LMLA 1MIWA 3WAJA 2UUCT 2JIWA 3ONLC 2A72A 4OX9T 1T7SA 4HFDA 3KINB 1HX8A 4EZHA 2J1DG 2WCAA 3CQCB 1UX4A 5C8YE 4EV6A 2E9XA 4B3MT 3Q2MA 5BMVE 1KFYA 3CMLA 1ZHCA 3NKZA 4MLKA 2WAUA 2CBIA 3WI3A 4V1Av 2BDEA 4YTMA 5C2TA 3ESLA 1KEYA 5LJMA 5JDQA 2CMRA 1XDOA 4CXXA 3P4QA 2D0UA 4JI3T 5ABHA 3JAFA 4ZHQE 5AQTB 5EZYE 4JI7T 2XM2A 1XNQT 5L2LA 2LM9A 4LF5T 3N9PA 1HNWT 3QB5K 1S94A 1SA0E 2DL1A 2IHR1 2CXFA 1ZKEA 3OVUA 4X64T 3GN5A 5AQLB 3ABVA 4HFVA 3SFEA 5C3JA 1W0BA 4WW0A 2CWYA 3AEBA 4BJMA 3ZT7A 2JQQA 3R84B 4DR1T 1T72A 2ODVA 4PJLA 3H3AA 5E0OA 3AEEA 4LF8T 1KF6A 3RKGA 3TKLB 5IUXA 3RYFE 4G2AA 2CWOA 5AQKB 4EAHA 3RLFF 5LCYA 1D0YA 3K3OA 3VHLA 5ABFB 3EAMA 3L8RA 3E0ZA 3P4RA 4YJ3E 4ILUA 2KMFA 4IL4A 5L3CB 3JADA 3A8YC 1MNDA 2I6HA 2FUPA 3DTOA 4B3TT 4QXHB 2OV9A 3PE0A 3F2EA 2YDSA 4YT0A 3FZKB 1Y64B 3J9X1 3KBUA 1LRZA 2WQYA 3O1JA 4JLEA 2XZEA 1U5PA 3ZEFB 4Z91A 3AEGA 4YXDA 1JNZA 3UUNA 3N5LA 3LBXA 5HAXA 3VR9A 4TV9E 3GA8A 4QWNB 4NIQA 2JQ9A 1MMGA 5F8PA 4QH1A 4UV9B 2A2FX 2WP9A 2YU2A 3G06A 4DR5T 3AE6A 1U4QA 1OEDA 4UF0A 3CWZB 4IDOA 3CX8B 4O4LE 2WZHA 5LBMA 3ZT5A 2I0MA 3LSVA 5JDHA 2V8SV 3F57A 4X66T 3ZMZB 4HFCA 4E7ZA 4M1PA 4B3ST 1N36T 3O1HA 5JVDE 4TUYE 3FZLB 2AE9A 5JREA 3UU3A 2LLYA 3ZN0B 2RPAA 4QH4A 3JC6C 1X79A 2H7VC 2DLRA 2YEVC 3AA1B 5HEHA 2XAFB 1LVKA 4LFCT 2LHNA 2CRBA 4DV7T 2X9XA 1G73A 4KHPT 3ZLIA 4UIGA 5FY1A 2X9HA 4IDNA 5HEJA 2BS4A 2CBJA 4YJ2E 1D1BA 2V7MA 1Y01A 4DBRA 3N9MA 1VCSA 2FJAA 3RC3A 3WAKA 1BR1A 4GYRA 1HCIA 1IBKT 3PTRB 3LK2B 5AQFB 1WRDA 1NENA 4DR7T 2WWUA 3TLTA 1VOMA 1UUSA 2A9UA 2BG9B 3C4ZA 3PUXF 3ZYKA 3EABA 1N33T 5HCMA 4L0RA 2LRKA 4P1NA 3C4XA 1UK5A 3IA3A 3L39A 3P4PA 3N2GE 4I55E 4IE4A 4EYUA 4LFBT 3FBLA 2VB6A 1FEWA 5AQNB 4L9IA 2P9BA 2LSGA 2NTXA 3PDYA 1Z8UA 2E9XB 4HN9A 5CA0E 2CCQA 3ZYMA 4X62T 2A3DA 4HWDA 3O4XE 4JI1T 4HGAA 3VKHA 4DV1T 3P8CD 2G0UA 5LGUB 3UU4A 3IF8B 4U7IA 2VL0A 2WU5A 4I43B 3ZSSA 2YINA 4I4TE 2V6XA 1KNPA 3QK6A 5HXCA 5CFBA 1KNRA 3UT5E 3FHNA 4H9NC 3T1HT 4ZI3D 3UFGA 3NRXA 5AQUB 2LHRA 4P09A 2VK9A 2CHNA 4JI8T 2XQ4A 5HWXA 3GN5B 2MPKA 2EHOA 2RP4A 5LG4A 5IHYA 4GK5E 3UUMA 1XMQT 3Q5EA 3OKQA 1HG2A 4DMWA 3AE3A 3ETUA 4JBWF 1OWAA 4CXYA 3C50A 2NW9A 3AE1A 4ILBA 3V5SA 1HG5A 3Q5WA 2XPKA 2H88A 3J7Yq 3V5UA 3ONJA 2V7LA 2BS2A 5FY7A 5FMNA 2CM0A 4U72A 4IE6A 3RPUA 3LK42 4ADZA 3W15B 4YSYA 4YTNA 2WY2A 2BBHA 2KT9A 3DP7A 3E08A 3KVAA 3QNUA 4G63A 2W62A 1ZEEA 4PK5A 4H9SE 4UR9A 2CLYC 4BJNA 5LGTB 3MACA 4DMVA 3ZMTB 1E1HB 5L4HA 4QX8B 3LBXB 5JR9C 1IBLT 4XAXB 3PUYF 4I0UA 1M62A 4HWIB 2N2NA 5LMUT 4H9QC 3AXJB 2SPCA 4KI0F 3T8OA 5AQPB 5HCJA 2X68A 2X9YA 1UURA 3LJCA 4UXNB 2C5KT 4WZXA 4HTEA 1OEDB 4UF0B 2ES0A 3CQXC 3JAEA 2HN1A 2OLTA 1IJ6A 1W0AA 3FXDB 2LEHA 1SHZC 5FXVA 5LBQB 5BR8T 1VCTA 5H6RB 4PJMA 4LMJA 2NW7A 5HEOA 3PUZF 2X67A 4KX6A 3LK3B 4ZOLE 1MMDA 5F3JA 2QYWA 2M6BA 3A7MA 3I0OA 2MOZA 2KNDA 5HYAA 2LSIA 1UX5A 4BAYB 4YHHT 3N9NA 2E9XC 5KMGP 3ZMUB 5LB7B 4IT4A 4PAGA 4NXNT 2EHOD 4F8HA 2BG9A 2XASB 3U78A 3FXEB 2ZM8A 4MHCA 4TN7B 2XQ5A 2UUAT 4AISA 2IUBA 1OXZA 1MMNA 2ZM6T 2WM9A 1US7B 4A5XA 2LT3A 3ZC0A 1CUNA 1MIYA 2X0LB 3E22E 1D1CA 2R6GF 3DJBA 1N34T 5FP3A 3OTOT 3Q5DA 2V7JA 2LSJA 2VASA 1O3XA 1XWMA 5L3BB 3MXZA 2PFVA 2HH7A 3SOLA 4IDPA 2VL8A 1E7PA 4P0AA 5ADXL 3HI2A 1HTJF 3FZHB 3PUQA 1HS7A 4HWCA 1UGOA 5LXTE 5AQMB 2WBLA 5L47A 1HNZT 4DBQA 5LA6E 1QSDA 3NZPA 2K9AA 1IJ5A 5DQWA 2V1DB 3RYIE 4ISTA 3KV6A 3ZMSB 2LKHA 2Y6XA 3N9QA 3TLUA 4U31A 3D0TA 2N9DA 1J5ET 4AKHA 2YN6A 2J47A 1GQEA 4ISSA 4GIWA 1V9DA 5ETWA 2Q9QC 3A5XA 3MKDA 5DQVA 3RHWA 5H6QB 1LKXA 3OYXA 3L09A 4HEAA 3CVRA 2W0GA 2EHOB 3C98B 4PNIA 3PU3A 3LDQB 4ZEYA 2V7KA 2XSAA 4CXWA 4GYSA 2M67A 4QXBB 2VVSA 4TWFA 3TLSA 5FY0A 4OK0A 3GMIA 2YU1A 4HWFA 3VKGA 3KVBA 3ANWA 1YKHB 3ZN1B 2KZ7B 5HXHA 2NOXA 5F5WA 2F4VT 5HXSA 4DV2T 3SWHA 3I1AA 2PBIA 1OEDC 4KP3C 4PFPA 4GKJT 1EZ3A 1D1AA 2B76A 3MZKB 1FMWA 4IE0A 3AXJA 4O4HE 3BQKA 4FI5A 3C51A 5JDGA 3OPCA 2W67A 5L3FB 4PJNA 1XMOT 4Q25A 1BR2A 2LOPA 5CB4E 2XQYA 4TNWA 3ZCIA 3FBZA 5HXEA 2WMOA
chains in the Genus database with same CATH topology
3FZHB 5AQPB 5AQSB 5AQKB 4HWHA 5AQTB 5AQQB 4HWCA 4HWDA 1UK5A 1UGOA 5AQGB 4HWFA 5AQMB 3FZMB 5AQFB 5AQJB 5AQOB 1HX1B 2D9DA 3FZKB 3FZLB 3LDQB 3M3ZB 5AQIB 1M62A 3A8YC 5AQNB 5AQUB 1M7KA 5AQVB 5AQRB 4HWIB 5AQHB 1T7SA 3FZFB 5AQLB 1I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZH B;  5AQP B;  5AQS B;  5AQK B;  4HWH A;  5AQT B;  5AQQ B;  4HWC A;  4HWD A;  1UK5 A;  1UGO A;  5AQG B;  4HWF A;  5AQM B;  3FZM B;  5AQF B;  5AQJ B;  5AQO B;  1HX1 B;  2D9D A;  3FZK B;  3FZL B;  3LDQ B;  3M3Z B;  5AQI B;  1M62 A;  3A8Y C;  5AQN B;  5AQU B;  1M7K A;  5AQV B;  5AQR B;  4HWI B;  5AQH B;  1T7S A;  3FZF B;  5AQL B;  1I6Z A; 
#chains in the Genus database with same CATH topology
 1YQ4 A;  4ASK A;  5A1L A;  1NWM X;  3RIU A;  2UXC T;  2WDV A;  3M65 A;  3NWI A;  2BBJ A;  4ILC A;  2ACZ A;  1YKE B;  2M6I A;  1SE7 A;  5AQH B;  4ILA A;  4IGU A;  5IYZ E;  2JMH A;  4MFR A;  4C90 A;  1UCU A;  4DR2 T;  5HEG A;  3AE9 A;  3Q9D A;  4U7Y A;  4KHZ F;  4ZI2 D;  4LF7 T;  5AFU L;  3P4S A;  2NTY A;  4IDQ A;  4DV6 T;  4U2Z A;  3HKE E;  5JRC B;  4EIW A;  3PUA A;  1ZV4 X;  2LOS A;  4A97 A;  4DUZ T;  1JNR A;  2L9Q A;  3LG7 A;  5AQO B;  3ZMV B;  5ABG A;  5JDM A;  2C5J A;  3UFE A;  2CPT A;  3UU6 A;  4YLH A;  4COF A;  3F31 A;  1FJG T;  3N2K E;  2H7O A;  4DV4 T;  4JUY A;  4NXM T;  3HL6 A;  2C0S A;  2K5B B;  5JTG A;  3K8P C;  4CN6 A;  2IC9 A;  4GKK T;  2QGS A;  4UVC B;  3UUB A;  3RRW A;  4YSX A;  1CHU A;  4O4J E;  4ZXL A;  4H9R C;  2ODU A;  2XQ8 A;  4HFI A;  2V7I A;  4AQF A;  3BQL A;  5FL1 A;  4BA9 A;  5JH7 E;  2NP9 A;  2FJE A;  5TAO A;  4AQG A;  5AQJ B;  4JV5 T;  1B7T A;  4EZ4 A;  4EOZ B;  4EEB A;  3AED A;  4AQY T;  1E2A A;  2X9W A;  4CI3 B;  4K0U A;  3S4U A;  4HFH A;  1WYB A;  1IZN B;  3UQ7 A;  2LSK A;  3HKC E;  3AAA B;  3B13 A;  4TV8 E;  2BKO A;  2YOE A;  2JQK A;  4JEH B;  5EK4 A;  2K3W A;  3FZM B;  2XQ3 A;  3QOF A;  3KV9 A;  3VRA A;  1WR0 A;  1OED E;  5LNK A;  4ZS2 A;  2WZI A;  1YD8 G;  3LFM A;  2N1G A;  2BVM A;  4O4I E;  2UXB T;  4X20 E;  4AXP A;  2VUR A;  1KK7 A;  4OYK A;  4IHJ E;  3PUG A;  3PU8 A;  2VQF T;  2YDR A;  1HX1 B;  2CXL A;  3RYH E;  2UXN B;  2WDR A;  5JDL A;  2BS3 A;  2E5L T;  3AEC A;  3I0Q A;  5AQG B;  3RH3 A;  3ZC1 A;  4LF9 T;  4ANJ A;  2L3L A;  4JI5 T;  1T8B A;  3PUS A;  5HWY A;  3RYC E;  3EHZ A;  2VKD A;  4CZZ B;  1VRB A;  2QVA A;  4OFZ A;  5DAB A;  4AKI A;  3ZT6 A;  4DV0 T;  2FJD A;  3RGL A;  4YTP A;  2WSS V;  3EDU A;  3KBT A;  3P50 A;  5HEU A;  2CE7 A;  2XQ6 A;  3ANW B;  3SFD A;  2XUE A;  1QUU A;  5FXW A;  1G8X A;  4EYY R;  3NBX X;  3AAI A;  3CX7 B;  3HKD E;  2YK0 A;  5LYJ E;  2CEA A;  2IAK A;  3PUV F;  3VRB A;  3JC6 D;  1IAP A;  3UU5 A;  3N9O A;  4AKR B;  4EXT A;  3MJX A;  2ACX A;  4CI2 B;  4UVA B;  4JI2 T;  1ZP0 A;  5AQQ B;  4H63 H;  1WYC A;  1WFD A;  3ETV A;  4YHJ A;  3L3P A;  3K3N A;  4O8S A;  4NUV A;  1HNX T;  2NWB A;  2JRK A;  2HPL A;  1ZOY A;  3P4W A;  2JPF A;  2W00 A;  1J1J A;  5L4E A;  2W4X A;  4XBF B;  4J2C A;  2BG9 C;  2VKJ A;  1SUM B;  5JRC A;  2IW5 B;  5FVK A;  1M7K A;  1HF8 A;  3AA7 B;  2OA5 A;  2H3R A;  4PFO A;  4MBQ A;  2X51 A;  5KDM C;  1DU2 A;  4DR4 T;  4TX5 A;  2HHH T;  1W9R A;  2YDQ A;  3CQG B;  3QC9 A;  2MTQ A;  5FXZ A;  1XNR T;  3H3M A;  2DWG A;  2CHO A;  3UUL A;  3H37 A;  4JI4 T;  2H89 A;  2HN2 A;  3CX6 B;  2NW8 A;  3IEE A;  3AE4 A;  5LMN T;  3C4W A;  3AE5 A;  3GWH A;  2J4G A;  3CPZ A;  3AA6 B;  4YY3 T;  4OYJ A;  3AE8 A;  4QHO A;  3TLW A;  5CJ5 A;  2IML A;  1Z0P A;  5CGM A;  2V26 A;  2XY8 B;  3RIF A;  4ZI7 E;  2Z6E A;  5J2T E;  4KMC A;  4EGW A;  3RRC A;  5AQI B;  4A98 A;  3N9L A;  4ZI2 C;  5L3G B;  4JI6 T;  2XHE B;  2IDO B;  4KUM B;  2I59 A;  3PUW F;  3QB5 A;  4DR3 T;  4IE7 A;  4DR6 T;  4TWD A;  1H7C A;  2K48 A;  4DO0 A;  4WNK A;  5IWA T;  3AB3 B;  4B6X A;  1NAF A;  1I94 T;  2DHR A;  4OHF A;  1IBM T;  5L3E B;  2MBG A;  2XQ7 A;  1LVF A;  3MA9 A;  1KNZ A;  2XSB A;  2UUB T;  1J5W A;  3RQU A;  3AA0 B;  2D0T A;  4ZS3 A;  1I6Z A;  3NRY A;  3UUX B;  3C64 A;  4IDZ A;  3ZCJ A;  4P0B A;  2VWA A;  3B5M A;  4ZZB A;  2XQ9 A;  1XZY A;  5JDF A;  2V6Y A;  4JI0 T;  2LRL A;  3RX6 A;  4CN1 A;  2BZB A;  1FMV A;  1R8I A;  3RC8 A;  1MNE A;  4PK4 A;  3PJA A;  3ZJ2 A;  3UU8 A;  4ZI3 C;  3AVS A;  2BG9 E;  5J0Z A;  2Q9Q A;  5FVL A;  1HR0 T;  3UQ4 A;  3X1D A;  5JDN A;  2KIN B;  1AJ3 A;  3OJA A;  2WMN A;  3BK9 A;  3HR0 A;  4WBO A;  3RIU C;  3OYZ A;  4AKG A;  3I9W A;  2ZM2 A;  2KWH A;  5JQG E;  4X1K E;  3KDS E;  1NEK A;  2E2A A;  4YSZ A;  4JYA T;  3PJA J;  3EVY A;  3RF1 A;  4DV5 T;  5M4Y A;  2E9X D;  5FL0 A;  2W61 A;  4CI1 B;  4PJJ A;  5LG3 A;  3EDV A;  1S35 A;  4UVB B;  3CIR A;  3NVO A;  4XZC A;  3ZYL A;  4X1Y E;  4U2Y A;  4I50 E;  2WB5 A;  5AQV B;  5LHI B;  2K24 A;  5EK2 A;  4X1I E;  2CLY B;  2VKO A;  3JCF A;  4QX7 B;  3AEF A;  3N2O A;  4CN4 A;  2GK9 A;  3BQI A;  4U74 A;  2Y8D A;  3ONX A;  2QA7 A;  1D0X A;  2BVL A;  3O1I A;  4IIJ E;  5JR9 B;  2KWI B;  1D0Z A;  5FYM A;  4O2A E;  5J1G A;  2MAW A;  2LJL A;  3SRZ A;  3AE7 A;  1MMA A;  1QLB A;  3RQW A;  3CK6 A;  4DV3 T;  5GON E;  2KXP B;  5LHG B;  4AQF C;  3UTK A;  3IHR A;  1WLX A;  4IE5 A;  3HA4 A;  4JEU B;  3CKD A;  5KXJ A;  2LE8 A;  3EUH A;  4A56 A;  5CA1 E;  3AEA A;  3AAE B;  4E7S A;  3AE2 A;  2WU2 A;  4IRE A;  2FJB A;  5L3D B;  2W66 A;  3PV0 F;  2PG8 A;  4NUU A;  1W09 A;  3FZF B;  2PJQ A;  3K3Q C;  3ZJ1 A;  2B1E A;  2XJ7 A;  5FNV E;  3U3I A;  4AKL A;  4DID B;  3K1S A;  2Q9Q D;  2ZLY A;  4HE8 A;  4X65 T;  3RI5 A;  2ZM0 A;  2Y48 B;  2VQE T;  2V5D A;  2EHO C;  1YW0 A;  2IC6 A;  4B3R T;  1N32 T;  3B57 A;  5LHH B;  5DJQ C;  4YFS A;  2QRX A;  4UEL A;  4CQI A;  4N78 D;  2KSR A;  4K0K T;  2D9D A;  2CXD A;  5KX5 E;  2E8I A;  4ERR A;  3AVR A;  3IBP A;  4FJO A;  4GK0 E;  1WR6 A;  4UEM A;  5J2U E;  4EB6 E;  4NPP A;  3T1Y T;  4Z90 A;  4L5G A;  1WCR A;  2JMK A;  2W63 A;  4O2B E;  5LOV E;  2X66 A;  1T98 A;  2C5I T;  4U3C A;  1BR0 A;  3ZST A;  2XM1 A;  3I9Y A;  2E5V A;  4U33 A;  4LF4 T;  5ABF A;  5ABE A;  2XAQ B;  2J62 A;  5LGN B;  1X9B A;  2VKH A;  3EI0 A;  4KBM B;  4F6R C;  3HKB E;  3ZKR A;  1MIV A;  3OBV E;  2V6Y B;  4H63 V;  4GOU A;  3PUR A;  1YQ3 A;  5AQS B;  2VVN A;  4Z8X A;  4HFB A;  1HFA A;  3QUJ A;  2RA1 A;  3M3Z B;  2UXX B;  2UU9 T;  4H9O C;  2LSY A;  4LFA T;  2WWV A;  1XDP A;  2JQH A;  2NR4 A;  4DND A;  5EK3 A;  2Q9Q B;  2XQA A;  5FKY A;  3R6N A;  1L0V A;  2XTL A;  2BKN A;  1YXR A;  3P7I A;  4DVD A;  3Q5X A;  2XAH B;  2XAJ B;  4QXC B;  4HWH A;  2V5C A;  1FIO A;  2YKS A;  2BKP A;  2ZMA A;  4TNV A;  4PK6 A;  2WS3 A;  2L8K A;  2DI4 A;  3ZPO A;  2XAG B;  3NZQ A;  4TWH A;  2HPJ A;  4DUY T;  4LMK A;  4HFE A;  2UXD T;  2PTF A;  2X0H A;  4AI6 A;  5JR9 A;  5AQR B;  4PW8 A;  4EED A;  4LF6 T;  2MYS A;  2D5U A;  4TZ4 C;  2FBW A;  4IL9 A;  5LP6 E;  4HKA A;  4QKN A;  4UV8 B;  2X0Y A;  3SS1 A;  2DWK A;  2IIU A;  3TLV A;  3KFW X;  4QH5 A;  3VU7 H;  3RKO A;  4WYV A;  4AIU A;  4X5T A;  2WDQ A;  2DCF A;  2W2U A;  5FXX A;  2DNX A;  5LJN A;  3KV4 A;  3MK7 C;  3O9X A;  3RIA A;  2CA5 A;  2KLQ A;  5HXR A;  4ZZC A;  4H9P C;  2JJ9 A;  2LKG A;  4WBN E;  4C91 A;  3VR8 A;  1BR4 A;  2D2S A;  2LM2 A;  3FB2 A;  4MAL A;  3KV5 A;  2AXD S;  4LML A;  1MIW A;  3WAJ A;  2UUC T;  2JIW A;  3ONL C;  2A72 A;  4OX9 T;  1T7S A;  4HFD A;  3KIN B;  1HX8 A;  4EZH A;  2J1D G;  2WCA A;  3CQC B;  1UX4 A;  5C8Y E;  4EV6 A;  2E9X A;  4B3M T;  3Q2M A;  5BMV E;  1KFY A;  3CML A;  1ZHC A;  3NKZ A;  4MLK A;  2WAU A;  2CBI A;  3WI3 A;  4V1A v;  2BDE A;  4YTM A;  5C2T A;  3ESL A;  1KEY A;  5LJM A;  5JDQ A;  2CMR A;  1XDO A;  4CXX A;  3P4Q A;  2D0U A;  4JI3 T;  5ABH A;  3JAF A;  4ZHQ E;  5AQT B;  5EZY E;  4JI7 T;  2XM2 A;  1XNQ T;  5L2L A;  2LM9 A;  4LF5 T;  3N9P A;  1HNW T;  3QB5 K;  1S94 A;  1SA0 E;  2DL1 A;  2IHR 1;  2CXF A;  1ZKE A;  3OVU A;  4X64 T;  3GN5 A;  5AQL B;  3ABV A;  4HFV A;  3SFE A;  5C3J A;  1W0B A;  4WW0 A;  2CWY A;  3AEB A;  4BJM A;  3ZT7 A;  2JQQ A;  3R84 B;  4DR1 T;  1T72 A;  2ODV A;  4PJL A;  3H3A A;  5E0O A;  3AEE A;  4LF8 T;  1KF6 A;  3RKG A;  3TKL B;  5IUX A;  3RYF E;  4G2A A;  2CWO A;  5AQK B;  4EAH A;  3RLF F;  5LCY A;  1D0Y A;  3K3O A;  3VHL A;  5ABF B;  3EAM A;  3L8R A;  3E0Z A;  3P4R A;  4YJ3 E;  4ILU A;  2KMF A;  4IL4 A;  5L3C B;  3JAD A;  3A8Y C;  1MND A;  2I6H A;  2FUP A;  3DTO A;  4B3T T;  4QXH B;  2OV9 A;  3PE0 A;  3F2E A;  2YDS A;  4YT0 A;  3FZK B;  1Y64 B;  3J9X 1;  3KBU A;  1LRZ A;  2WQY A;  3O1J A;  4JLE A;  2XZE A;  1U5P A;  3ZEF B;  4Z91 A;  3AEG A;  4YXD A;  1JNZ A;  3UUN A;  3N5L A;  3LBX A;  5HAX A;  3VR9 A;  4TV9 E;  3GA8 A;  4QWN B;  4NIQ A;  2JQ9 A;  1MMG A;  5F8P A;  4QH1 A;  4UV9 B;  2A2F X;  2WP9 A;  2YU2 A;  3G06 A;  4DR5 T;  3AE6 A;  1U4Q A;  1OED A;  4UF0 A;  3CWZ B;  4IDO A;  3CX8 B;  4O4L E;  2WZH A;  5LBM A;  3ZT5 A;  2I0M A;  3LSV A;  5JDH A;  2V8S V;  3F57 A;  4X66 T;  3ZMZ B;  4HFC A;  4E7Z A;  4M1P A;  4B3S T;  1N36 T;  3O1H A;  5JVD E;  4TUY E;  3FZL B;  2AE9 A;  5JRE A;  3UU3 A;  2LLY A;  3ZN0 B;  2RPA A;  4QH4 A;  3JC6 C;  1X79 A;  2H7V C;  2DLR A;  2YEV C;  3AA1 B;  5HEH A;  2XAF B;  1LVK A;  4LFC T;  2LHN A;  2CRB A;  4DV7 T;  2X9X A;  1G73 A;  4KHP T;  3ZLI A;  4UIG A;  5FY1 A;  2X9H A;  4IDN A;  5HEJ A;  2BS4 A;  2CBJ A;  4YJ2 E;  1D1B A;  2V7M A;  1Y01 A;  4DBR A;  3N9M A;  1VCS A;  2FJA A;  3RC3 A;  3WAK A;  1BR1 A;  4GYR A;  1HCI A;  1IBK T;  3PTR B;  3LK2 B;  5AQF B;  1WRD A;  1NEN A;  4DR7 T;  2WWU A;  3TLT A;  1VOM A;  1UUS A;  2A9U A;  2BG9 B;  3C4Z A;  3PUX F;  3ZYK A;  3EAB A;  1N33 T;  5HCM A;  4L0R A;  2LRK A;  4P1N A;  3C4X A;  1UK5 A;  3IA3 A;  3L39 A;  3P4P A;  3N2G E;  4I55 E;  4IE4 A;  4EYU A;  4LFB T;  3FBL A;  2VB6 A;  1FEW A;  5AQN B;  4L9I A;  2P9B A;  2LSG A;  2NTX A;  3PDY A;  1Z8U A;  2E9X B;  4HN9 A;  5CA0 E;  2CCQ A;  3ZYM A;  4X62 T;  2A3D A;  4HWD A;  3O4X E;  4JI1 T;  4HGA A;  3VKH A;  4DV1 T;  3P8C D;  2G0U A;  5LGU B;  3UU4 A;  3IF8 B;  4U7I A;  2VL0 A;  2WU5 A;  4I43 B;  3ZSS A;  2YIN A;  4I4T E;  2V6X A;  1KNP A;  3QK6 A;  5HXC A;  5CFB A;  1KNR A;  3UT5 E;  3FHN A;  4H9N C;  3T1H T;  4ZI3 D;  3UFG A;  3NRX A;  5AQU B;  2LHR A;  4P09 A;  2VK9 A;  2CHN A;  4JI8 T;  2XQ4 A;  5HWX A;  3GN5 B;  2MPK A;  2EHO A;  2RP4 A;  5LG4 A;  5IHY A;  4GK5 E;  3UUM A;  1XMQ T;  3Q5E A;  3OKQ A;  1HG2 A;  4DMW A;  3AE3 A;  3ETU A;  4JBW F;  1OWA A;  4CXY A;  3C50 A;  2NW9 A;  3AE1 A;  4ILB A;  3V5S A;  1HG5 A;  3Q5W A;  2XPK A;  2H88 A;  3J7Y q;  3V5U A;  3ONJ A;  2V7L A;  2BS2 A;  5FY7 A;  5FMN A;  2CM0 A;  4U72 A;  4IE6 A;  3RPU A;  3LK4 2;  4ADZ A;  3W15 B;  4YSY A;  4YTN A;  2WY2 A;  2BBH A;  2KT9 A;  3DP7 A;  3E08 A;  3KVA A;  3QNU A;  4G63 A;  2W62 A;  1ZEE A;  4PK5 A;  4H9S E;  4UR9 A;  2CLY C;  4BJN A;  5LGT B;  3MAC A;  4DMV A;  3ZMT B;  1E1H B;  5L4H A;  4QX8 B;  3LBX B;  5JR9 C;  1IBL T;  4XAX B;  3PUY F;  4I0U A;  1M62 A;  4HWI B;  2N2N A;  5LMU T;  4H9Q C;  3AXJ B;  2SPC A;  4KI0 F;  3T8O A;  5AQP B;  5HCJ A;  2X68 A;  2X9Y A;  1UUR A;  3LJC A;  4UXN B;  2C5K T;  4WZX A;  4HTE A;  1OED B;  4UF0 B;  2ES0 A;  3CQX C;  3JAE A;  2HN1 A;  2OLT A;  1IJ6 A;  1W0A A;  3FXD B;  2LEH A;  1SHZ C;  5FXV A;  5LBQ B;  5BR8 T;  1VCT A;  5H6R B;  4PJM A;  4LMJ A;  2NW7 A;  5HEO A;  3PUZ F;  2X67 A;  4KX6 A;  3LK3 B;  4ZOL E;  1MMD A;  5F3J A;  2QYW A;  2M6B A;  3A7M A;  3I0O A;  2MOZ A;  2KND A;  5HYA A;  2LSI A;  1UX5 A;  4BAY B;  4YHH T;  3N9N A;  2E9X C;  5KMG P;  3ZMU B;  5LB7 B;  4IT4 A;  4PAG A;  4NXN T;  2EHO D;  4F8H A;  2BG9 A;  2XAS B;  3U78 A;  3FXE B;  2ZM8 A;  4MHC A;  4TN7 B;  2XQ5 A;  2UUA T;  4AIS A;  2IUB A;  1OXZ A;  1MMN A;  2ZM6 T;  2WM9 A;  1US7 B;  4A5X A;  2LT3 A;  3ZC0 A;  1CUN A;  1MIY A;  2X0L B;  3E22 E;  1D1C A;  2R6G F;  3DJB A;  1N34 T;  5FP3 A;  3OTO T;  3Q5D A;  2V7J A;  2LSJ A;  2VAS A;  1O3X A;  1XWM A;  5L3B B;  3MXZ A;  2PFV A;  2HH7 A;  3SOL A;  4IDP A;  2VL8 A;  1E7P A;  4P0A A;  5ADX L;  3HI2 A;  1HTJ F;  3FZH B;  3PUQ A;  1HS7 A;  4HWC A;  1UGO A;  5LXT E;  5AQM B;  2WBL A;  5L47 A;  1HNZ T;  4DBQ A;  5LA6 E;  1QSD A;  3NZP A;  2K9A A;  1IJ5 A;  5DQW A;  2V1D B;  3RYI E;  4IST A;  3KV6 A;  3ZMS B;  2LKH A;  2Y6X A;  3N9Q A;  3TLU A;  4U31 A;  3D0T A;  2N9D A;  1J5E T;  4AKH A;  2YN6 A;  2J47 A;  1GQE A;  4ISS A;  4GIW A;  1V9D A;  5ETW A;  2Q9Q C;  3A5X A;  3MKD A;  5DQV A;  3RHW A;  5H6Q B;  1LKX A;  3OYX A;  3L09 A;  4HEA A;  3CVR A;  2W0G A;  2EHO B;  3C98 B;  4PNI A;  3PU3 A;  3LDQ B;  4ZEY A;  2V7K A;  2XSA A;  4CXW A;  4GYS A;  2M67 A;  4QXB B;  2VVS A;  4TWF A;  3TLS A;  5FY0 A;  4OK0 A;  3GMI A;  2YU1 A;  4HWF A;  3VKG A;  3KVB A;  3ANW A;  1YKH B;  3ZN1 B;  2KZ7 B;  5HXH A;  2NOX A;  5F5W A;  2F4V T;  5HXS A;  4DV2 T;  3SWH A;  3I1A A;  2PBI A;  1OED C;  4KP3 C;  4PFP A;  4GKJ T;  1EZ3 A;  1D1A A;  2B76 A;  3MZK B;  1FMW A;  4IE0 A;  3AXJ A;  4O4H E;  3BQK A;  4FI5 A;  3C51 A;  5JDG A;  3OPC A;  2W67 A;  5L3F B;  4PJN A;  1XMO T;  4Q25 A;  1BR2 A;  2LOP A;  5CB4 E;  2XQY A;  4TNW A;  3ZCI A;  3FBZ A;  5HXE A;  2WMO A; 
#chains in the Genus database with same CATH homology
 3FZH B;  5AQP B;  5AQS B;  5AQK B;  4HWH A;  5AQT B;  5AQQ B;  4HWC A;  4HWD A;  1UK5 A;  1UGO A;  5AQG B;  4HWF A;  5AQM B;  3FZM B;  5AQF B;  5AQJ B;  5AQO B;  1HX1 B;  2D9D A;  3FZK B;  3FZL B;  3LDQ B;  3M3Z B;  5AQI B;  1M62 A;  3A8Y C;  5AQN B;  5AQU B;  1M7K A;  5AQV B;  5AQR B;  4HWI B;  5AQH B;  1T7S A;  3FZF B;  5AQL B;  1I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...