1M7KA

Solution structure of the sodd bag domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
b'TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Silencer of Death Domains
publication title The solution structure of the SODD BAG domain reveals additional electrostatic interactions in the HSP70 complexes of SODD subfamily BAG domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m7kA00
1M7KA 5AQIB 5AQGB 5AQJB 5AQUB 5AQFB 3M3ZB 4HWIB 1I6ZA 5AQVB 3A8YC 5AQNB 1UK5A 5AQRB 3LDQB 1HX1B 5AQHB 5AQSB 4HWHA 1UGOA 2D9DA 4HWFA 1M62A 4HWDA 5AQPB 1T7SA 3FZHB 3FZLB 5AQMB 5AQKB 3FZFB 4HWCA 5AQQB 5AQOB 5AQLB 3FZKB 5AQTB 3FZMB
chains in the Genus database with same CATH superfamily
4IDOA 1XMQT 3UU4A 3SWHA 2WSSV 4P0AA 4QX8B 3RRWA 4C91A 3ZEFB 1GQEA 2IDOB 5LCYA 2VK9A 5JVDE 3RH3A 2YN6A 3N9PA 3QK6A 5HEJA 4AQFC 4O8SA 2BG9C 2MTQA 3D0TA 2LOPA 3N9MA 4O4IE 4YJ2E 2CXFA 3ANWB 5JDMA 1OEDA 4DR5T 3HKEE 2E5LT 4JLEA 5BMVE 3ABVA 3C50A 4IHJE 4TWDA 1IJ5A 4H9RC 1WYBA 5FXXA 2YK0A 4N78D 1IBLT 5L2LA 3SFEA 3T1YT 3FXDB 4H9OC 4GK0E 5EZYE 1WR0A 4B3ST 4HN9A 5HAXA 2XQ9A 4P0BA 4DV5T 2V7MA 2FUPA 1X9BA 4YXDA 2LJLA 2NWBA 3A8YC 2BVLA 3I1AA 3ANWA 3AEFA 4GKKT 2CPTA 2MAWA 3RLFF 2E9XC 5L3CB 3HA4A 2VQFT 1G73A 5ABEA 4B3MT 2V6YB 2BKOA 5ABFA 4WBOA 3TLSA 3T8OA 5FY0A 1X79A 3ZCJA 4AKHA 2NOXA 3UUNA 2UXCT 2KSRA 5CA1E 1VOMA 3LFMA 3PUSA 1ZKEA 2VVNA 4X5TA 4OK0A 4ILAA 5L3EB 1T72A 2KLQA 3CK6A 2EHOA 2X0HA 4O4JE 2CMRA 4UVAB 1BR2A 4X65T 5J2UE 3P4QA 3CX7B 2D0UA 2J4GA 4HEAA 2V6YA 2V7LA 2CXLA 4UEMA 5FMNA 3U78A 3F2EA 2Q9QA 3ETUA 4UXNB 2GK9A 3B13A 3UQ4A 5CFBA 5F8PA 3ZSSA 5JR9B 4ZI2C 3AB3B 3B5MA 1QSDA 3P50A 2WCAA 5FXVA 2W67A 2PBIA 2VL0A 3OTOT 4JI0T 2J62A 2HH7A 4GKJT 3AA6B 3P4RA 4UVCB 2FJBA 5EK2A 4AQYT 2CA5A 3QC9A 4U2YA 4LFAT 3Q5EA 5IUXA 3KBTA 3FZHB 2VB6A 4GOUA 4YSXA 2LE8A 5LOVE 4AXPA 4O4LE 3K3OA 2NW7A 4P09A 4DMVA 5LHHB 4X66T 1XMOT 2XPKA 2AXDS 1G8XA 1YKHB 4QX7B 4ZS2A 5DABA 4HWFA 2FBWA 3T1HT 5IHYA 5FXWA 5AQLB 3OJAA 3AEGA 2JJ9A 2WMNA 4DV1T 4L0RA 5HYAA 5AQUB 2W66A 3BQLA 3M3ZB 2H7OA 4ZOLE 2W0GA 4CN4A 2XQ6A 5AQKB 3NBXX 2JPFA 3CVRA 3MACA 3K3NA 4ISTA 1R8IA 2E5VA 1AJ3A 4YHJA 3ZMTB 1HX8A 5HXCA 2CE7A 4AKGA 1OEDE 1J5WA 2M67A 3AE5A 3RYHE 2D5UA 4E7ZA 2V6XA 3ZMZB 2BZBA 2NTXA 3MZKB 3BQIA 2XJ7A 4QXBB 4IGUA 2I59A 2CM0A 2K48A 1YKEB 3TLUA 2KZ7B 1LVFA 4HFBA 2XQ7A 3AE9A 3KV5A 4IDPA 1JNZA 3AA1B 4X1YE 5CJ5A 2WU2A 5C3JA 4GIWA 4IE5A 2VASA 3C4WA 2WU5A 3A5XA 3UU5A 4JYAT 3ONJA 3EDVA 4PJMA 1LRZA 3BK9A 4EAHA 3OYZA 2WB5A 3LDQB 4MHCA 4QXCB 5LG3A 3V5UA 4ILBA 2BG9B 3JADA 2LRKA 4ERRA 2WDQA 2DL1A 5JR9C 5CA0E 3P4PA 3PUVF 4O4HE 2ACXA 4EOZB 3FBZA 5FL0A 4A56A 1WCRA 4TV8E 5LGNB 5JDLA 2IC6A 1FMWA 2MPKA 4AKRB 3H37A 5EK4A 4IE4A 2BBHA 2X9HA 3Q2MA 4DV4T 3OYXA 4PJLA 4DVDA 2D2SA 2K3WA 2XY8B 5FY1A 5L4HA 2XAQB 2UU9T 4JEUB 3HR0A 4DR2T 4ZS3A 3EAMA 3MXZA 2XQ3A 3L8RA 3DJBA 2CEAA 1NEKA 2Y8DA 2BG9A 4HFIA 3RQUA 2M6IA 3RIUC 4CN6A 3LJCA 3GWHA 4PJNA 1U4QA 2XAHB 3JC6D 2Y6XA 4H9QC 4H9PC 2YKSA 3RKGA 4UV8B 2LSJA 3UFEA 1UURA 3CQXC 1S94A 2XHEB 2XQ4A 2VKJA 3L3PA 1HX1B 2XZEA 5HWXA 3ZKRA 3NZPA 4JI1T 4KI0F 4EEBA 4ZZBA 1MIYA 4EV6A 1KEYA 2YU1A 3AE1A 1IJ6A 3RC8A 1ZEEA 4CXXA 2UUAT 2QVAA 4PK5A 3R84B 4EZ4A 3MKDA 1BR1A 3EVYA 3W15B 5AQIB 2E9XA 3CQCB 5A1LA 3ZCIA 5HXHA 2NR4A 5JDGA 4HWDA 5FY7A 2LSGA 1MMGA 4P1NA 4Z91A 3TLVA 4G2AA 4ILCA 2KWIB 3Q5XA 3ZN0B 4BJNA 3SS1A 4HFDA 2V7IA 3O1JA 1MNEA 5AQHB 1E7PA 2ZM8A 5AQOB 1Z8UA 1OWAA 5HXEA 3AEEA 4JEHB 3JC6C 4UF0B 2DWGA 4B3RT 2MOZA 2H88A 3TLWA 2VQET 2CWYA 5FNVE 5JDHA 1XDOA 2G0UA 3EDUA 3N2GE 3AE8A 4TZ4C 1L0VA 3UU3A 3F57A 3SRZA 4DV3T 5M4YA 2XM2A 5KDMC 3QUJA 3WAKA 4YTMA 3PU3A 1IBMT 3RIAA 2V8SV 2MBGA 2PJQA 3VR9A 5JREA 4LF7T 2A72A 3N9NA 2BVMA 2NTYA 2LT3A 5LBQB 3I0OA 2ZM2A 3HKBE 2LM2A 4UF0A 3LK2B 3K1SA 4AISA 2XSAA 5LBMA 3V5SA 4U33A 5EK3A 2UXXB 3OBVE 4I55E 1KNPA 1T98A 3MJXA 5GONE 2W61A 5DQVA 2UXNB 1D0XA 3UULA 5JH7E 2IMLA 4UR9A 3J7Yq 2LOSA 4QXHB 4LMLA 2X9YA 2C5IT 3VRBA 3VKGA 4DBRA 5HCMA 2V7JA 1EZ3A 1H7CA 4Z90A 4TUYE 3ZMUB 3N9LA 2LRLA 2ODUA 2WS3A 3AEAA 3PTRB 2YDQA 4U3CA 3CIRA 3DP7A 5BR8T 1MNDA 3C4ZA 3UUMA 4TN7B 1HTJF 4X1KE 3EHZA 2IC9A 5LHIB 2ACZA 2KT9A 2JQQA 1HNWT 4LMKA 2E8IA 1HR0T 3I9YA 3ZMSB 4WZXA 4GYSA 3B57A 3PUGA 4KHPT 1HFAA 2CBJA 4UV9B 2WBLA 4TX5A 4O2BE 3AEDA 1UX4A 2BG9E 5ADXL 2EHOD 4HTEA 4M1PA 5LP6E 1HNXT 1ZOYA 4WYVA 5FYMA 4YTPA 1HNZT 4CXYA 2LLYA 1B7TA 3AVSA 3HL6A 4YSZA 3NRXA 4OYKA 2Q9QD 2X0YA 2HPJA 4PW8A 1JNRA 5HEGA 2RPAA 2VURA 4A97A 4K0UA 1FIOA 2JQHA 2WDVA 2WP9A 4DV6T 4KHZF 3MK7C 1I6ZA 4JI4T 3CX6B 5JRCB 3AVRA 4TNVA 4COFA 4UIGA 3KV9A 4BA9A 2XSBA 3UQ7A 4YY3T 2H7VC 2F4VT 2LHRA 2CRBA 2OV9A 3VU7H 4OX9T 1W09A 5JR9A 2IIUA 3O4XE 2DNXA 3EABA 2X67A 4DIDB 3GN5B 4FJOA 3C4XA 5AQSB 1BR4A 5KMGP 4WNKA 3H3MA 3NWIA 5LYJE 4CI3B 5HEUA 2LKGA 1J1JA 3NVOA 4OHFA 4DUZT 2KNDA 4C90A 3KVBA 2BKNA 5HXRA 3M65A 4HWIB 3RGLA 3ONXA 3H3AA 1HF8A 4YSYA 1US7B 1MIWA 1QUUA 3IHRA 4IT4A 1NAFA 2UXBT 4ZI3D 2ZMAA 3SFDA 4JI7T 4CZZB 5AQGB 2IAKA 2KWHA 1D0YA 5H6QB 4KBMB 2X66A 3ZT5A 3ZJ2A 5L3DB 3OKQA 3RIUA 5ABGA 2A2FX 4JI5T 3ZC0A 2L3LA 4PFPA 3GN5A 4X62T 3RKOA 3AE7A 4L5GA 3IEEA 5LGTB 4H9NC 4KX6A 5LHGB 3VHLA 1BR0A 4OYJA 2XM1A 5LB7B 3KBUA 4IL4A 4AKLA 1QLBA 2WAUA 4DV0T 1FEWA 1IZNB 4QWNB 1SHZC 2JQ9A 2J47A 3OPCA 3UFGA 4PJJA 4CQIA 3PJAA 3ZYMA 1XWMA 2IHR1 1KK7A 1WFDA 1XNQT 3DTOA 3RC3A 4IDQA 5LGUB 4QHOA 4H9SE 2KMFA 2YDRA 4PAGA 3ZT6A 4IE7A 3S4UA 5LJMA 4H63V 2XUEA 3RYFE 5HCJA 1ZP0A 2I6HA 1KNRA 4YLHA 2NP9A 3ZPOA 3VR8A 5KX5E 2BS2A 4I43B 2ZM0A 2N9DA 2C5JA 3N2KE 1W0BA 4ZHQE 3QOFA 4DUYT 1M7KA 2C5KT 2WDRA 1U5PA 2WMOA 2JQKA 4HFCA 4IE0A 5JDFA 3CMLA 4NUVA 1HCIA 4F6RC 4L9IA 3C51A 4B3TT 2NW9A 2N1GA 3P4SA 3QB5K 2LSYA 2HN1A 2W4XA 2DI4A 2VKHA 3P8CD 2LSKA 2A3DA 3KV4A 4WBNE 2FJEA 1WR6A 1NWMX 2Y48B 2DWKA 3TKLB 3CPZA 3FBLA 3LBXB 5LMNT 4OFZA 3Q5WA 4A5XA 2V5DA 4ISSA 3ZYLA 4O2AE 4AI6A 5FVKA 4K0KT 2D9DA 3PUAA 4U7YA 3FZLB 4HWCA 2WZIA 5HWYA 5J2TE 2N2NA 2X68A 3AXJB 5AQJB 1T8BA 3PV0F 2DCFA 2C0SA 3NZQA 4LF8T 2CLYB 4EEDA 2YDSA 5CGMA 3KV6A 4MBQA 2ODVA 1FJGT 2LEHA 3E08A 5LA6E 5ETWA 3AAAB 3Q9DA 3WI3A 4X1IE 3ZSTA 5J1GA 3PUWF 4KMCA 1LVKA 3HKCE 1VRBA 5JDQA 1SA0E 1N36T 4QH1A 3PURA 4AQGA 5J0ZA 4EYYR 1OEDB 2NW8A 4ZZCA 3KDSE 3RRCA 4MALA 3RYIE 2W63A 3KINB 2E9XD 1KNZA 1W9RA 1YW0A 4TWFA 2XASB 2AE9A 4I0UA 3R6NA 5L4EA 3FZKB 1YQ3A 4KP3C 5LG4A 3K8PC 2WZHA 5C8YE 3O1HA 1SUMB 3AAIA 3HKDE 2WM9A 4AIUA 1IAPA 2PG8A 2UUCT 4AKIA 2B76A 3J9X1 5TAOA 2LHNA 3AA7B 4WW0A 4U74A 1E1HB 4F8HA 1T7SA 2LSIA 3JCFA 3VKHA 5LXTE 4E7SA 5IYZE 3X1DA 1CHUA 2W00A 1XDPA 4ZEYA 2QGSA 3MA9A 3PE0A 4QH5A 2SPCA 1Z0PA 2Z6EA 4Z8XA 2XQ5A 4JI6T 4QKNA 5FXZA 2CXDA 2ES0A 5L3GB 2JMHA 2V26A 4ANJA 3RI5A 5ABFB 4JI3T 3AE2A 3C64A 1KF6A 4LFBT 3PJAJ 3SOLA 5JTGA 5FVLA 1Y01A 2OA5A 3GA8A 3L39A 4DBQA 1VCTA 2PFVA 4LMJA 3AE3A 1YQ4A 3AEBA 3O9XA 4I4TE 3P4WA 4ZI2D 3QNUA 5AQPB 2YEVC 2EHOB 4EXTA 5FL1A 5HXSA 2BDEA 4IE6A 5CB4E 2K5BB 3N9QA 4DV2T 2VVSA 4I50E 5AQNB 3N5LA 3RX6A 2CLYC 4HFEA 2CHOA 1S35A 2BBJA 4ZI7E 2K9AA 2VL8A 4HFHA 3JAEA 2Q9QB 3OVUA 2OLTA 1N32T 3RHWA 2YU2A 5DJQC 3RYCE 2I0MA 5AFUL 4YHHT 2VKOA 4UELA 1J5ET 5KXJA 3FHNA 3ZT7A 1ZHCA 3JAFA 2R6GF 1OEDC 4NXNT 2D0TA 2W2UA 2X9WA 3ZMVB 4ADZA 2CWOA 4DV7T 3UU6A 1KFYA 1NENA 1YD8G 4MLKA 3EUHA 1VCSA 2JRKA 1UUSA 2YOEA 3LK3B 1UK5A 2WY2A 5FP3A 5C2TA 5IWAT 5F3JA 3AAEB 4DMWA 1LKXA 2HPLA 2M6BA 3E0ZA 2V5CA 1Y64B 5HEHA 1XZYA 2V1DB 2JIWA 3UUXB 3KVAA 3PUZF 4PNIA 2ZLYA 2KINB 3ZYKA 4U7IA 1WRDA 3PU8A 4PFOA 1OXZA 4U2ZA 4NPPA 1I94T 4LF5T 2XAJB 5AQVB 1WYCA 2BS4A 3ONLC 4YTNA 1XNRT 3AE6A 4DNDA 1FMVA 5LMUT 3I9WA 5L3BB 3P7IA 4LF6T 1N33T 2WWVA 4IREA 4JI2T 1D1CA 4LF4T 3PDYA 3PUQA 4ASKA 4DR6T 4B6XA 1UX5A 3QB5A 3ZN1B 3CQGB 3UTKA 3FZMB 5JRCA 2EHOC 1YXRA 3RQWA 4JUYA 3ZC1A 1N34T 4PK4A 4BJMA 4HE8A 4YT0A 1DU2A 2JMKA 2BS3A 1WLXA 4A98A 4CI2B 4NXMT 2PTFA 4CI1B 3WAJA 3LSVA 3A7MA 2FJAA 2Q9QC 2YINA 2H89A 4IIJE 2E2AA 2XQYA 3LK42 3IBPA 4HWHA 4DO0A 1M62A 4BAYB 3U3IA 4U31A 5JQGE 3L09A 2W62A 2L8KA 3RIFA 3LG7A 4GK5E 5DQWA 4CXWA 2VWAA 4DR3T 3EI0A 1D1AA 2BKPA 2CCQA 2X9XA 4X20E 1HG5A 2XQ8A 3FB2A 4H63H 4YJ3E 4YFSA 3UUBA 4V1Av 4EGWA 2UUBT 3CX8B 1O3XA 4NUUA 2XQAA 4Q25A 5H6RB 4FI5A 4GYRA 5HEOA 2P9BA 5F5WA 5AQFB 3N9OA 2K24A 4J2CA 2A9UA 5LNKA 1E2AA 4XZCA 5JDNA 2X51A 3G06A 3KFWX 2XAFB 2IUBA 1MMDA 4DR7T 1W0AA 4UVBB 4MFRA 3PUYF 4XAXB 3RPUA 3NKZA 4JBWF 4DR4T 3CKDA 3C98B 4KUMB 4HKAA 4ZI3C 5L47A 2VKDA 2B1EA 3ESLA 5AQMB 3ZLIA 4ZXLA 2IW5B 1IBKT 3FXEB 2CBIA 2J1DG 5FKYA 4G63A 4EIWA 4JI8T 3IF8B 3Q5DA 3IA3A 4PK6A 2MYSA 1UCUA 2FJDA 2QA7A 4EZHA 3UU8A 1HS7A 5AQTB 2DLRA 2WQYA 4TNWA 4AQFA 2HN2A 3NRYA 4NIQA 2XTLA 3GMIA 1V9DA 3BQKA 3RF1A 2CHNA 2LM9A 4EYUA 4LF9T 2KXPB 5AQQB 3K3QC 3FZFB 2E9XB 1MIVA 2UXDT 4IDZA 3E22E 4ILUA 2L9QA 2LKHA 4JV5T 4DR1T 5L3FB 3F31A 4IDNA 1CUNA 1D0ZA 3TLTA 2WWUA 4X64T 3I0QA 1SE7A 2HHHT 2RP4A 2XAGB 5E0OA 4HFVA 4CN1A 2H3RA 2RA1A 2QYWA 4U72A 4HGAA 2V7KA 1D1BA 3LBXA 5LJNA 3ZJ1A 3N2OA 1ZV4X 4LFCT 4IL9A 5ABHA 3ETVA 4EB6E 2QRXA 3AA0B 1MMNA 2X0LB 1HG2A 2DHRA 3CWZB 3PUXF 5AQRB 3AE4A 3AXJA 3AECA 4TV9E 3UT5E 2ZM6T 4QH4A 3VRAA 4XBFB 1MMAA 1UGOA 4TWHA 3O1IA 3HI2A
chains in the Genus database with same CATH topology
1M7KA 5AQIB 5AQGB 5AQJB 5AQUB 5AQFB 3M3ZB 4HWIB 1I6ZA 5AQVB 3A8YC 5AQNB 1UK5A 5AQRB 3LDQB 1HX1B 5AQHB 5AQSB 4HWHA 1UGOA 2D9DA 4HWFA 1M62A 4HWDA 5AQPB 1T7SA 3FZHB 3FZLB 5AQMB 5AQKB 3FZFB 4HWCA 5AQQB 5AQOB 5AQLB 3FZKB 5AQTB 3FZMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7K A;  5AQI B;  5AQG B;  5AQJ B;  5AQU B;  5AQF B;  3M3Z B;  4HWI B;  1I6Z A;  5AQV B;  3A8Y C;  5AQN B;  1UK5 A;  5AQR B;  3LDQ B;  1HX1 B;  5AQH B;  5AQS B;  4HWH A;  1UGO A;  2D9D A;  4HWF A;  1M62 A;  4HWD A;  5AQP B;  1T7S A;  3FZH B;  3FZL B;  5AQM B;  5AQK B;  3FZF B;  4HWC A;  5AQQ B;  5AQO B;  5AQL B;  3FZK B;  5AQT B;  3FZM B; 
#chains in the Genus database with same CATH topology
 4IDO A;  1XMQ T;  3UU4 A;  3SWH A;  2WSS V;  4P0A A;  4QX8 B;  3RRW A;  4C91 A;  3ZEF B;  1GQE A;  2IDO B;  5LCY A;  2VK9 A;  5JVD E;  3RH3 A;  2YN6 A;  3N9P A;  3QK6 A;  5HEJ A;  4AQF C;  4O8S A;  2BG9 C;  2MTQ A;  3D0T A;  2LOP A;  3N9M A;  4O4I E;  4YJ2 E;  2CXF A;  3ANW B;  5JDM A;  1OED A;  4DR5 T;  3HKE E;  2E5L T;  4JLE A;  5BMV E;  3ABV A;  3C50 A;  4IHJ E;  4TWD A;  1IJ5 A;  4H9R C;  1WYB A;  5FXX A;  2YK0 A;  4N78 D;  1IBL T;  5L2L A;  3SFE A;  3T1Y T;  3FXD B;  4H9O C;  4GK0 E;  5EZY E;  1WR0 A;  4B3S T;  4HN9 A;  5HAX A;  2XQ9 A;  4P0B A;  4DV5 T;  2V7M A;  2FUP A;  1X9B A;  4YXD A;  2LJL A;  2NWB A;  3A8Y C;  2BVL A;  3I1A A;  3ANW A;  3AEF A;  4GKK T;  2CPT A;  2MAW A;  3RLF F;  2E9X C;  5L3C B;  3HA4 A;  2VQF T;  1G73 A;  5ABE A;  4B3M T;  2V6Y B;  2BKO A;  5ABF A;  4WBO A;  3TLS A;  3T8O A;  5FY0 A;  1X79 A;  3ZCJ A;  4AKH A;  2NOX A;  3UUN A;  2UXC T;  2KSR A;  5CA1 E;  1VOM A;  3LFM A;  3PUS A;  1ZKE A;  2VVN A;  4X5T A;  4OK0 A;  4ILA A;  5L3E B;  1T72 A;  2KLQ A;  3CK6 A;  2EHO A;  2X0H A;  4O4J E;  2CMR A;  4UVA B;  1BR2 A;  4X65 T;  5J2U E;  3P4Q A;  3CX7 B;  2D0U A;  2J4G A;  4HEA A;  2V6Y A;  2V7L A;  2CXL A;  4UEM A;  5FMN A;  3U78 A;  3F2E A;  2Q9Q A;  3ETU A;  4UXN B;  2GK9 A;  3B13 A;  3UQ4 A;  5CFB A;  5F8P A;  3ZSS A;  5JR9 B;  4ZI2 C;  3AB3 B;  3B5M A;  1QSD A;  3P50 A;  2WCA A;  5FXV A;  2W67 A;  2PBI A;  2VL0 A;  3OTO T;  4JI0 T;  2J62 A;  2HH7 A;  4GKJ T;  3AA6 B;  3P4R A;  4UVC B;  2FJB A;  5EK2 A;  4AQY T;  2CA5 A;  3QC9 A;  4U2Y A;  4LFA T;  3Q5E A;  5IUX A;  3KBT A;  3FZH B;  2VB6 A;  4GOU A;  4YSX A;  2LE8 A;  5LOV E;  4AXP A;  4O4L E;  3K3O A;  2NW7 A;  4P09 A;  4DMV A;  5LHH B;  4X66 T;  1XMO T;  2XPK A;  2AXD S;  1G8X A;  1YKH B;  4QX7 B;  4ZS2 A;  5DAB A;  4HWF A;  2FBW A;  3T1H T;  5IHY A;  5FXW A;  5AQL B;  3OJA A;  3AEG A;  2JJ9 A;  2WMN A;  4DV1 T;  4L0R A;  5HYA A;  5AQU B;  2W66 A;  3BQL A;  3M3Z B;  2H7O A;  4ZOL E;  2W0G A;  4CN4 A;  2XQ6 A;  5AQK B;  3NBX X;  2JPF A;  3CVR A;  3MAC A;  3K3N A;  4IST A;  1R8I A;  2E5V A;  1AJ3 A;  4YHJ A;  3ZMT B;  1HX8 A;  5HXC A;  2CE7 A;  4AKG A;  1OED E;  1J5W A;  2M67 A;  3AE5 A;  3RYH E;  2D5U A;  4E7Z A;  2V6X A;  3ZMZ B;  2BZB A;  2NTX A;  3MZK B;  3BQI A;  2XJ7 A;  4QXB B;  4IGU A;  2I59 A;  2CM0 A;  2K48 A;  1YKE B;  3TLU A;  2KZ7 B;  1LVF A;  4HFB A;  2XQ7 A;  3AE9 A;  3KV5 A;  4IDP A;  1JNZ A;  3AA1 B;  4X1Y E;  5CJ5 A;  2WU2 A;  5C3J A;  4GIW A;  4IE5 A;  2VAS A;  3C4W A;  2WU5 A;  3A5X A;  3UU5 A;  4JYA T;  3ONJ A;  3EDV A;  4PJM A;  1LRZ A;  3BK9 A;  4EAH A;  3OYZ A;  2WB5 A;  3LDQ B;  4MHC A;  4QXC B;  5LG3 A;  3V5U A;  4ILB A;  2BG9 B;  3JAD A;  2LRK A;  4ERR A;  2WDQ A;  2DL1 A;  5JR9 C;  5CA0 E;  3P4P A;  3PUV F;  4O4H E;  2ACX A;  4EOZ B;  3FBZ A;  5FL0 A;  4A56 A;  1WCR A;  4TV8 E;  5LGN B;  5JDL A;  2IC6 A;  1FMW A;  2MPK A;  4AKR B;  3H37 A;  5EK4 A;  4IE4 A;  2BBH A;  2X9H A;  3Q2M A;  4DV4 T;  3OYX A;  4PJL A;  4DVD A;  2D2S A;  2K3W A;  2XY8 B;  5FY1 A;  5L4H A;  2XAQ B;  2UU9 T;  4JEU B;  3HR0 A;  4DR2 T;  4ZS3 A;  3EAM A;  3MXZ A;  2XQ3 A;  3L8R A;  3DJB A;  2CEA A;  1NEK A;  2Y8D A;  2BG9 A;  4HFI A;  3RQU A;  2M6I A;  3RIU C;  4CN6 A;  3LJC A;  3GWH A;  4PJN A;  1U4Q A;  2XAH B;  3JC6 D;  2Y6X A;  4H9Q C;  4H9P C;  2YKS A;  3RKG A;  4UV8 B;  2LSJ A;  3UFE A;  1UUR A;  3CQX C;  1S94 A;  2XHE B;  2XQ4 A;  2VKJ A;  3L3P A;  1HX1 B;  2XZE A;  5HWX A;  3ZKR A;  3NZP A;  4JI1 T;  4KI0 F;  4EEB A;  4ZZB A;  1MIY A;  4EV6 A;  1KEY A;  2YU1 A;  3AE1 A;  1IJ6 A;  3RC8 A;  1ZEE A;  4CXX A;  2UUA T;  2QVA A;  4PK5 A;  3R84 B;  4EZ4 A;  3MKD A;  1BR1 A;  3EVY A;  3W15 B;  5AQI B;  2E9X A;  3CQC B;  5A1L A;  3ZCI A;  5HXH A;  2NR4 A;  5JDG A;  4HWD A;  5FY7 A;  2LSG A;  1MMG A;  4P1N A;  4Z91 A;  3TLV A;  4G2A A;  4ILC A;  2KWI B;  3Q5X A;  3ZN0 B;  4BJN A;  3SS1 A;  4HFD A;  2V7I A;  3O1J A;  1MNE A;  5AQH B;  1E7P A;  2ZM8 A;  5AQO B;  1Z8U A;  1OWA A;  5HXE A;  3AEE A;  4JEH B;  3JC6 C;  4UF0 B;  2DWG A;  4B3R T;  2MOZ A;  2H88 A;  3TLW A;  2VQE T;  2CWY A;  5FNV E;  5JDH A;  1XDO A;  2G0U A;  3EDU A;  3N2G E;  3AE8 A;  4TZ4 C;  1L0V A;  3UU3 A;  3F57 A;  3SRZ A;  4DV3 T;  5M4Y A;  2XM2 A;  5KDM C;  3QUJ A;  3WAK A;  4YTM A;  3PU3 A;  1IBM T;  3RIA A;  2V8S V;  2MBG A;  2PJQ A;  3VR9 A;  5JRE A;  4LF7 T;  2A72 A;  3N9N A;  2BVM A;  2NTY A;  2LT3 A;  5LBQ B;  3I0O A;  2ZM2 A;  3HKB E;  2LM2 A;  4UF0 A;  3LK2 B;  3K1S A;  4AIS A;  2XSA A;  5LBM A;  3V5S A;  4U33 A;  5EK3 A;  2UXX B;  3OBV E;  4I55 E;  1KNP A;  1T98 A;  3MJX A;  5GON E;  2W61 A;  5DQV A;  2UXN B;  1D0X A;  3UUL A;  5JH7 E;  2IML A;  4UR9 A;  3J7Y q;  2LOS A;  4QXH B;  4LML A;  2X9Y A;  2C5I T;  3VRB A;  3VKG A;  4DBR A;  5HCM A;  2V7J A;  1EZ3 A;  1H7C A;  4Z90 A;  4TUY E;  3ZMU B;  3N9L A;  2LRL A;  2ODU A;  2WS3 A;  3AEA A;  3PTR B;  2YDQ A;  4U3C A;  3CIR A;  3DP7 A;  5BR8 T;  1MND A;  3C4Z A;  3UUM A;  4TN7 B;  1HTJ F;  4X1K E;  3EHZ A;  2IC9 A;  5LHI B;  2ACZ A;  2KT9 A;  2JQQ A;  1HNW T;  4LMK A;  2E8I A;  1HR0 T;  3I9Y A;  3ZMS B;  4WZX A;  4GYS A;  3B57 A;  3PUG A;  4KHP T;  1HFA A;  2CBJ A;  4UV9 B;  2WBL A;  4TX5 A;  4O2B E;  3AED A;  1UX4 A;  2BG9 E;  5ADX L;  2EHO D;  4HTE A;  4M1P A;  5LP6 E;  1HNX T;  1ZOY A;  4WYV A;  5FYM A;  4YTP A;  1HNZ T;  4CXY A;  2LLY A;  1B7T A;  3AVS A;  3HL6 A;  4YSZ A;  3NRX A;  4OYK A;  2Q9Q D;  2X0Y A;  2HPJ A;  4PW8 A;  1JNR A;  5HEG A;  2RPA A;  2VUR A;  4A97 A;  4K0U A;  1FIO A;  2JQH A;  2WDV A;  2WP9 A;  4DV6 T;  4KHZ F;  3MK7 C;  1I6Z A;  4JI4 T;  3CX6 B;  5JRC B;  3AVR A;  4TNV A;  4COF A;  4UIG A;  3KV9 A;  4BA9 A;  2XSB A;  3UQ7 A;  4YY3 T;  2H7V C;  2F4V T;  2LHR A;  2CRB A;  2OV9 A;  3VU7 H;  4OX9 T;  1W09 A;  5JR9 A;  2IIU A;  3O4X E;  2DNX A;  3EAB A;  2X67 A;  4DID B;  3GN5 B;  4FJO A;  3C4X A;  5AQS B;  1BR4 A;  5KMG P;  4WNK A;  3H3M A;  3NWI A;  5LYJ E;  4CI3 B;  5HEU A;  2LKG A;  1J1J A;  3NVO A;  4OHF A;  4DUZ T;  2KND A;  4C90 A;  3KVB A;  2BKN A;  5HXR A;  3M65 A;  4HWI B;  3RGL A;  3ONX A;  3H3A A;  1HF8 A;  4YSY A;  1US7 B;  1MIW A;  1QUU A;  3IHR A;  4IT4 A;  1NAF A;  2UXB T;  4ZI3 D;  2ZMA A;  3SFD A;  4JI7 T;  4CZZ B;  5AQG B;  2IAK A;  2KWH A;  1D0Y A;  5H6Q B;  4KBM B;  2X66 A;  3ZT5 A;  3ZJ2 A;  5L3D B;  3OKQ A;  3RIU A;  5ABG A;  2A2F X;  4JI5 T;  3ZC0 A;  2L3L A;  4PFP A;  3GN5 A;  4X62 T;  3RKO A;  3AE7 A;  4L5G A;  3IEE A;  5LGT B;  4H9N C;  4KX6 A;  5LHG B;  3VHL A;  1BR0 A;  4OYJ A;  2XM1 A;  5LB7 B;  3KBU A;  4IL4 A;  4AKL A;  1QLB A;  2WAU A;  4DV0 T;  1FEW A;  1IZN B;  4QWN B;  1SHZ C;  2JQ9 A;  2J47 A;  3OPC A;  3UFG A;  4PJJ A;  4CQI A;  3PJA A;  3ZYM A;  1XWM A;  2IHR 1;  1KK7 A;  1WFD A;  1XNQ T;  3DTO A;  3RC3 A;  4IDQ A;  5LGU B;  4QHO A;  4H9S E;  2KMF A;  2YDR A;  4PAG A;  3ZT6 A;  4IE7 A;  3S4U A;  5LJM A;  4H63 V;  2XUE A;  3RYF E;  5HCJ A;  1ZP0 A;  2I6H A;  1KNR A;  4YLH A;  2NP9 A;  3ZPO A;  3VR8 A;  5KX5 E;  2BS2 A;  4I43 B;  2ZM0 A;  2N9D A;  2C5J A;  3N2K E;  1W0B A;  4ZHQ E;  3QOF A;  4DUY T;  1M7K A;  2C5K T;  2WDR A;  1U5P A;  2WMO A;  2JQK A;  4HFC A;  4IE0 A;  5JDF A;  3CML A;  4NUV A;  1HCI A;  4F6R C;  4L9I A;  3C51 A;  4B3T T;  2NW9 A;  2N1G A;  3P4S A;  3QB5 K;  2LSY A;  2HN1 A;  2W4X A;  2DI4 A;  2VKH A;  3P8C D;  2LSK A;  2A3D A;  3KV4 A;  4WBN E;  2FJE A;  1WR6 A;  1NWM X;  2Y48 B;  2DWK A;  3TKL B;  3CPZ A;  3FBL A;  3LBX B;  5LMN T;  4OFZ A;  3Q5W A;  4A5X A;  2V5D A;  4ISS A;  3ZYL A;  4O2A E;  4AI6 A;  5FVK A;  4K0K T;  2D9D A;  3PUA A;  4U7Y A;  3FZL B;  4HWC A;  2WZI A;  5HWY A;  5J2T E;  2N2N A;  2X68 A;  3AXJ B;  5AQJ B;  1T8B A;  3PV0 F;  2DCF A;  2C0S A;  3NZQ A;  4LF8 T;  2CLY B;  4EED A;  2YDS A;  5CGM A;  3KV6 A;  4MBQ A;  2ODV A;  1FJG T;  2LEH A;  3E08 A;  5LA6 E;  5ETW A;  3AAA B;  3Q9D A;  3WI3 A;  4X1I E;  3ZST A;  5J1G A;  3PUW F;  4KMC A;  1LVK A;  3HKC E;  1VRB A;  5JDQ A;  1SA0 E;  1N36 T;  4QH1 A;  3PUR A;  4AQG A;  5J0Z A;  4EYY R;  1OED B;  2NW8 A;  4ZZC A;  3KDS E;  3RRC A;  4MAL A;  3RYI E;  2W63 A;  3KIN B;  2E9X D;  1KNZ A;  1W9R A;  1YW0 A;  4TWF A;  2XAS B;  2AE9 A;  4I0U A;  3R6N A;  5L4E A;  3FZK B;  1YQ3 A;  4KP3 C;  5LG4 A;  3K8P C;  2WZH A;  5C8Y E;  3O1H A;  1SUM B;  3AAI A;  3HKD E;  2WM9 A;  4AIU A;  1IAP A;  2PG8 A;  2UUC T;  4AKI A;  2B76 A;  3J9X 1;  5TAO A;  2LHN A;  3AA7 B;  4WW0 A;  4U74 A;  1E1H B;  4F8H A;  1T7S A;  2LSI A;  3JCF A;  3VKH A;  5LXT E;  4E7S A;  5IYZ E;  3X1D A;  1CHU A;  2W00 A;  1XDP A;  4ZEY A;  2QGS A;  3MA9 A;  3PE0 A;  4QH5 A;  2SPC A;  1Z0P A;  2Z6E A;  4Z8X A;  2XQ5 A;  4JI6 T;  4QKN A;  5FXZ A;  2CXD A;  2ES0 A;  5L3G B;  2JMH A;  2V26 A;  4ANJ A;  3RI5 A;  5ABF B;  4JI3 T;  3AE2 A;  3C64 A;  1KF6 A;  4LFB T;  3PJA J;  3SOL A;  5JTG A;  5FVL A;  1Y01 A;  2OA5 A;  3GA8 A;  3L39 A;  4DBQ A;  1VCT A;  2PFV A;  4LMJ A;  3AE3 A;  1YQ4 A;  3AEB A;  3O9X A;  4I4T E;  3P4W A;  4ZI2 D;  3QNU A;  5AQP B;  2YEV C;  2EHO B;  4EXT A;  5FL1 A;  5HXS A;  2BDE A;  4IE6 A;  5CB4 E;  2K5B B;  3N9Q A;  4DV2 T;  2VVS A;  4I50 E;  5AQN B;  3N5L A;  3RX6 A;  2CLY C;  4HFE A;  2CHO A;  1S35 A;  2BBJ A;  4ZI7 E;  2K9A A;  2VL8 A;  4HFH A;  3JAE A;  2Q9Q B;  3OVU A;  2OLT A;  1N32 T;  3RHW A;  2YU2 A;  5DJQ C;  3RYC E;  2I0M A;  5AFU L;  4YHH T;  2VKO A;  4UEL A;  1J5E T;  5KXJ A;  3FHN A;  3ZT7 A;  1ZHC A;  3JAF A;  2R6G F;  1OED C;  4NXN T;  2D0T A;  2W2U A;  2X9W A;  3ZMV B;  4ADZ A;  2CWO A;  4DV7 T;  3UU6 A;  1KFY A;  1NEN A;  1YD8 G;  4MLK A;  3EUH A;  1VCS A;  2JRK A;  1UUS A;  2YOE A;  3LK3 B;  1UK5 A;  2WY2 A;  5FP3 A;  5C2T A;  5IWA T;  5F3J A;  3AAE B;  4DMW A;  1LKX A;  2HPL A;  2M6B A;  3E0Z A;  2V5C A;  1Y64 B;  5HEH A;  1XZY A;  2V1D B;  2JIW A;  3UUX B;  3KVA A;  3PUZ F;  4PNI A;  2ZLY A;  2KIN B;  3ZYK A;  4U7I A;  1WRD A;  3PU8 A;  4PFO A;  1OXZ A;  4U2Z A;  4NPP A;  1I94 T;  4LF5 T;  2XAJ B;  5AQV B;  1WYC A;  2BS4 A;  3ONL C;  4YTN A;  1XNR T;  3AE6 A;  4DND A;  1FMV A;  5LMU T;  3I9W A;  5L3B B;  3P7I A;  4LF6 T;  1N33 T;  2WWV A;  4IRE A;  4JI2 T;  1D1C A;  4LF4 T;  3PDY A;  3PUQ A;  4ASK A;  4DR6 T;  4B6X A;  1UX5 A;  3QB5 A;  3ZN1 B;  3CQG B;  3UTK A;  3FZM B;  5JRC A;  2EHO C;  1YXR A;  3RQW A;  4JUY A;  3ZC1 A;  1N34 T;  4PK4 A;  4BJM A;  4HE8 A;  4YT0 A;  1DU2 A;  2JMK A;  2BS3 A;  1WLX A;  4A98 A;  4CI2 B;  4NXM T;  2PTF A;  4CI1 B;  3WAJ A;  3LSV A;  3A7M A;  2FJA A;  2Q9Q C;  2YIN A;  2H89 A;  4IIJ E;  2E2A A;  2XQY A;  3LK4 2;  3IBP A;  4HWH A;  4DO0 A;  1M62 A;  4BAY B;  3U3I A;  4U31 A;  5JQG E;  3L09 A;  2W62 A;  2L8K A;  3RIF A;  3LG7 A;  4GK5 E;  5DQW A;  4CXW A;  2VWA A;  4DR3 T;  3EI0 A;  1D1A A;  2BKP A;  2CCQ A;  2X9X A;  4X20 E;  1HG5 A;  2XQ8 A;  3FB2 A;  4H63 H;  4YJ3 E;  4YFS A;  3UUB A;  4V1A v;  4EGW A;  2UUB T;  3CX8 B;  1O3X A;  4NUU A;  2XQA A;  4Q25 A;  5H6R B;  4FI5 A;  4GYR A;  5HEO A;  2P9B A;  5F5W A;  5AQF B;  3N9O A;  2K24 A;  4J2C A;  2A9U A;  5LNK A;  1E2A A;  4XZC A;  5JDN A;  2X51 A;  3G06 A;  3KFW X;  2XAF B;  2IUB A;  1MMD A;  4DR7 T;  1W0A A;  4UVB B;  4MFR A;  3PUY F;  4XAX B;  3RPU A;  3NKZ A;  4JBW F;  4DR4 T;  3CKD A;  3C98 B;  4KUM B;  4HKA A;  4ZI3 C;  5L47 A;  2VKD A;  2B1E A;  3ESL A;  5AQM B;  3ZLI A;  4ZXL A;  2IW5 B;  1IBK T;  3FXE B;  2CBI A;  2J1D G;  5FKY A;  4G63 A;  4EIW A;  4JI8 T;  3IF8 B;  3Q5D A;  3IA3 A;  4PK6 A;  2MYS A;  1UCU A;  2FJD A;  2QA7 A;  4EZH A;  3UU8 A;  1HS7 A;  5AQT B;  2DLR A;  2WQY A;  4TNW A;  4AQF A;  2HN2 A;  3NRY A;  4NIQ A;  2XTL A;  3GMI A;  1V9D A;  3BQK A;  3RF1 A;  2CHN A;  2LM9 A;  4EYU A;  4LF9 T;  2KXP B;  5AQQ B;  3K3Q C;  3FZF B;  2E9X B;  1MIV A;  2UXD T;  4IDZ A;  3E22 E;  4ILU A;  2L9Q A;  2LKH A;  4JV5 T;  4DR1 T;  5L3F B;  3F31 A;  4IDN A;  1CUN A;  1D0Z A;  3TLT A;  2WWU A;  4X64 T;  3I0Q A;  1SE7 A;  2HHH T;  2RP4 A;  2XAG B;  5E0O A;  4HFV A;  4CN1 A;  2H3R A;  2RA1 A;  2QYW A;  4U72 A;  4HGA A;  2V7K A;  1D1B A;  3LBX A;  5LJN A;  3ZJ1 A;  3N2O A;  1ZV4 X;  4LFC T;  4IL9 A;  5ABH A;  3ETV A;  4EB6 E;  2QRX A;  3AA0 B;  1MMN A;  2X0L B;  1HG2 A;  2DHR A;  3CWZ B;  3PUX F;  5AQR B;  3AE4 A;  3AXJ A;  3AEC A;  4TV9 E;  3UT5 E;  2ZM6 T;  4QH4 A;  3VRA A;  4XBF B;  1MMA A;  1UGO A;  4TWH A;  3O1I A;  3HI2 A; 
#chains in the Genus database with same CATH homology
 1M7K A;  5AQI B;  5AQG B;  5AQJ B;  5AQU B;  5AQF B;  3M3Z B;  4HWI B;  1I6Z A;  5AQV B;  3A8Y C;  5AQN B;  1UK5 A;  5AQR B;  3LDQ B;  1HX1 B;  5AQH B;  5AQS B;  4HWH A;  1UGO A;  2D9D A;  4HWF A;  1M62 A;  4HWD A;  5AQP B;  1T7S A;  3FZH B;  3FZL B;  5AQM B;  5AQK B;  3FZF B;  4HWC A;  5AQQ B;  5AQO B;  5AQL B;  3FZK B;  5AQT B;  3FZM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...