1M7KA

Solution structure of the sodd bag domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the SODD BAG domain reveals additional electrostatic interactions in the HSP70 complexes of SODD subfamily BAG domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Silencer of Death Domains
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m7kA00
1HX1B 1UGOA 4HWCA 1M62A 5AQKB 5AQGB 3FZHB 3FZLB 5AQPB 4HWDA 4HWIB 5AQOB 5AQUB 1I6ZA 4HWHA 3LDQB 5AQRB 5AQLB 3A8YC 5AQJB 3FZFB 5AQSB 5AQQB 5AQIB 5AQVB 1M7KA 3M3ZB 3FZMB 5AQHB 2D9DA 4HWFA 5AQTB 5AQFB 5AQMB 3FZKB 5AQNB 1T7SA 1UK5A
chains in the Genus database with same CATH superfamily
4KP3C 1HX1B 2E5LT 2V7JA 1WR0A 1ZP0A 1QUUA 5L4EA 3ZT7A 2CXDA 2C5IT 4UVCB 3WI3A 4ILAA 3EABA 3O1IA 3BK9A 3Q5DA 2M6IA 3TKLB 2YOEA 3VKGA 2CWYA 5LHHB 1KK7A 1OWAA 4IHJE 5AQLB 1T72A 2PTFA 2NR4A 4XZCA 1HX8A 3PUQA 4B6XA 2WMOA 3ZEFB 4DV0T 5CFBA 4PK5A 4IE0A 4PK4A 2JMHA 2C5KT 2ZM6T 2XQ5A 2LHRA 3AA7B 3K3NA 3N9OA 5HCJA 2W4XA 2NOXA 2Y48B 5LOVE 4UELA 5HYAA 1S35A 5HCMA 1J1JA 1NEKA 2FJBA 3P4SA 4ZXLA 3AAIA 2ZM2A 4I43B 1J5WA 2IW5B 3PUYF 4BA9A 3WAKA 4LF4T 2V6YB 4DO0A 3KBTA 3F31A 3FZKB 3RYHE 4AKRB 3NZPA 4UVAB 2CWOA 2XAHB 1WRDA 4O2BE 3KV4A 3EAMA 1M62A 1J5ET 3T1HT 2WCAA 1UCUA 4A97A 1WR6A 3OKQA 3L09A 1W0BA 4V1Av 3H3AA 2DCFA 4PAGA 2E2AA 3HA4A 1V9DA 2WS3A 4NPPA 3U78A 3AEDA 5LG4A 3T8OA 4X5TA 3ZSTA 1W9RA 3CPZA 4ZS2A 5LB7B 3RQWA 1ZHCA 3ZCJA 4YTNA 3TLUA 4JI7T 4AKHA 1VCTA 1N36T 4BJMA 3B57A 4ZI3D 4CQIA 5CJ5A 1D0YA 2LJLA 3AE6A 1M7KA 2HN2A 3ANWA 3CQCB 4L5GA 3RIUC 4YSXA 2MAWA 5HEJA 1E7PA 2V8SV 2X0YA 3AE2A 5IYZE 2UUBT 3RKOA 2J62A 3N2KE 3Q9DA 2XUEA 4G2AA 4C91A 5C3JA 4AQGA 5FYMA 4DR6T 5JRCA 1KF6A 3JC6C 3KDSE 5LGTB 3CKDA 3IEEA 4AI6A 1T7SA 3UU8A 5LJMA 1O3XA 2XZEA 1XZYA 5ABFA 5FY1A 5AQKB 2XQ8A 2CRBA 4CN6A 3KFWX 2C5JA 2FJAA 3ZMSB 4BJNA 3O4XE 3QB5A 4ZI3C 4JI1T 3KV5A 3RGLA 1ZOYA 2BBJA 4OYJA 1YXRA 2BG9C 2XAJB 3HL6A 3BQKA 3EDVA 4KBMB 4PK6A 4ZZBA 1W09A 2WM9A 2XTLA 4N78D 3U3IA 4LMLA 4DUZT 3JCFA 1IBKT 4HN9A 4WZXA 5L4HA 3UUBA 2A72A 2VKJA 2GK9A 3CWZB 2BKNA 2KT9A 4OK0A 2B76A 4P1NA 4CXYA 4B3MT 2V1DB 3AE5A 4LFCT 2XY8B 3C50A 3ZMZB 3LSVA 3AE4A 2ACZA 3O1JA 5L3FB 2NWBA 4U7YA 4NXNT 2V26A 4I55E 1WFDA 2V5DA 3AEGA 5HAXA 4DV6T 4EB6E 3UFGA 2ZMAA 2BVLA 4O4HE 5LA6E 4QX7B 4LMJA 2A3DA 4B3TT 3UUNA 5KDMC 1XMQT 3N2OA 1FEWA 2EHOA 1ZEEA 2KINB 4Z91A 4LF7T 3F2EA 4C90A 4ADZA 2ES0A 2AE9A 1WYCA 5HEGA 4GKKT 3AECA 3K8PC 1BR4A 2A2FX 3PJAA 5F8PA 2XQAA 3ZMVB 3ONJA 4GIWA 2WDQA 2ZM8A 1HG5A 4IE7A 1UUSA 4QH4A 4I0UA 1IJ5A 2E8IA 2X66A 4JEUB 5EK4A 3RRCA 3QK6A 2NW8A 4IDPA 1XMOT 3RYCE 3SOLA 2UXDT 3N9MA 2BDEA 4H63V 2XQ6A 2VVNA 1OEDE 1IAPA 2DI4A 2YEVC 3G06A 3K3OA 2CHNA 3I9WA 1ZV4X 4IREA 4TNVA 3HKBE 5JDMA 3FXDB 4P0AA 5CA1E 3VKHA 3UU4A 3VR9A 2WDVA 2BS4A 1WYBA 5JDNA 2QYWA 2IHR1 3H3MA 1UX5A 2ACXA 2BG9E 2M67A 1U5PA 3MXZA 3MJXA 1R8IA 2UXCT 1MIYA 3FZHB 5JREA 3NVOA 2J4GA 4ZI2D 3ANWB 2JPFA 4Q25A 3R84B 3ZJ2A 3ZYLA 2CCQA 3AXJB 2HPLA 3A5XA 2X0LB 1X79A 3OBVE 4DIDB 2KLQA 2KZ7B 4XAXB 4YTPA 4YTMA 2R6GF 1SE7A 2HH7A 4ILCA 4DV1T 4QH1A 5LMNT 1MNEA 3AVRA 3PDYA 1OEDC 4YSZA 5FL1A 3ZT5A 5L3GB 5HXHA 5LHIB 3ZYMA 5FNVE 4Z8XA 2W66A 2V7LA 3EI0A 2LE8A 1MIVA 2XAGB 3E22E 2RPAA 2UUAT 2BZBA 2FJDA 1N32T 3PUWF 5AQMB 2WMNA 1UK5A 3RIFA 3C51A 3DJBA 1UGOA 4DV2T 1ZKEA 4MBQA 3P4PA 1MIWA 4EXTA 3PTRB 4Z90A 2X9HA 3QNUA 3N2GE 3NZQA 4HWDA 4HWIB 3AB3B 2XSAA 1HF8A 2VB6A 4KX6A 3KV6A 2MOZA 2H89A 1FMWA 2LEHA 2XM1A 5IHYA 4OYKA 3KINB 4EYUA 1IBLT 3L3PA 3IBPA 4DR5T 4YSYA 3P8CD 2E5VA 2LRKA 4AKIA 1D0XA 4IIJE 4FJOA 5EK2A 1UX4A 2LM2A 3JC6D 3PUZF 4DR7T 2H88A 4JI2T 3KBUA 5IUXA 4XBFB 2BG9A 3CX6B 3JADA 4IDOA 4DUYT 3I9YA 2L8KA 5JTGA 3CK6A 4I50E 4LF9T 2Q9QD 4E7ZA 4AKLA 4G63A 3UU3A 1OEDA 3UT5E 2WZHA 3UFEA 4ASKA 2J47A 2KMFA 3O1HA 2E9XB 5HEHA 2XQ9A 3N9QA 3OTOT 2JQ9A 5FXWA 4ZHQE 3UULA 4O4LE 3LDQB 2XQ7A 4TWHA 4PFOA 3N5LA 3D0TA 3GA8A 3SRZA 2DL1A 3DTOA 1VCSA 3PE0A 4UF0B 4YXDA 5JR9C 1B7TA 4DBRA 1UURA 2B1EA 3Q2MA 5F5WA 3VHLA 4KHPT 1YQ3A 5H6QB 3P4QA 2W00A 4PW8A 3UUMA 5AQIB 3TLTA 5IWAT 2LKGA 2X9XA 4H9PC 5LXTE 1CUNA 4TN7B 4A5XA 4AQFC 5LP6E 3FZMB 3Q5EA 4QXHB 3TLWA 3FXEB 3GWHA 4NXMT 2V5CA 2VL8A 1L0VA 3HKCE 5F3JA 2JRKA 3CIRA 1FMVA 5JQGE 5ABEA 2KXPB 1CHUA 3FZLB 2MBGA 4QXCB 4CXXA 1OXZA 1MMNA 3NBXX 5AQUB 2M6BA 5FMNA 1LVFA 1YKHB 2Q9QA 5AQRB 1I6ZA 4ZI2C 1IJ6A 4H63H 2CLYC 4IGUA 5FVLA 5L47A 2I6HA 1G73A 4HEAA 3ZSSA 5C8YE 4WBOA 4DMVA 3RHWA 1HTJF 3AEEA 2BG9B 5HEOA 2NP9A 4KMCA 2ZM0A 3HI2A 4ILBA 4IT4A 4IE6A 4CI2B 5JR9B 2JJ9A 5AQHB 1KNPA 3K3QC 3LK2B 3EUHA 3SS1A 2PFVA 3SWHA 1KNZA 1T98A 3V5UA 2N1GA 1D0ZA 2W63A 2WAUA 2LSKA 2WDRA 3PUVF 4B3ST 4GOUA 4HFCA 4JYAT 4IE4A 4ISSA 2D5UA 2LSYA 2ZLYA 3I0OA 2WWUA 2N2NA 3MACA 1Z8UA 4IL4A 4L9IA 2N9DA 5AQGB 4JI6T 1MNDA 2QA7A 1E2AA 3NWIA 3PU8A 4MLKA 5LBQB 2XAQB 3Q5WA 4QWNB 4QXBB 3PUXF 3PJAJ 4TWDA 5FL0A 3OYXA 3ZKRA 3ZT6A 1HNXT 2K9AA 1LRZA 2LSGA 3Q5XA 4HKAA 5BMVE 4WYVA 4EEDA 4DR1T 5ABHA 2LOSA 3O9XA 2C0SA 2KNDA 3LBXB 4TZ4C 2CA5A 2CM0A 3C4WA 2KSRA 5ETWA 2VWAA 3QOFA 4IDNA 3N9PA 2YU2A 5LGNB 4NUUA 4NUVA 2V7MA 2BVMA 3RRWA 4PJMA 4ERRA 2Y6XA 1US7B 4TNWA 2LSIA 4UEMA 2LT3A 3AE3A 1WLXA 3B13A 3AAEB 3QUJA 4UV8B 5DABA 5EZYE 5J1GA 4CI3B 5FY0A 5LGUB 3AE7A 3AEBA 3RX6A 2W62A 1Z0PA 2WU5A 2YU1A 3RQUA 2H7VC 1XDOA 1MMAA 3T1YT 4EEBA 4EAHA 5J0ZA 2CMRA 3IA3A 2J1DG 4ISTA 4CZZB 4WBNE 4E7SA 4YFSA 3ETVA 1NENA 4CXWA 1VRBA 3C98B 4K0UA 3RC3A 3ABVA 3VRBA 1NAFA 4PJNA 4ZZCA 1QLBA 2DLRA 3N9LA 2UXXB 2WY2A 3OYZA 2LSJA 2WQYA 3B5MA 3CX7B 4UV9B 4AISA 4EGWA 5HXEA 2CEAA 5EK3A 2MPKA 1D1AA 1JNRA 2XAFB 3ZMTB 2UUCT 4H9NC 1YQ4A 4AQFA 1HS7A 1HNWT 2E9XC 2VURA 4MALA 3H37A 3N9NA 4PFPA 1BR0A 1D1CA 3M65A 3UU5A 2W0GA 3GN5B 1N34T 5LG3A 2IAKA 4HWFA 5ABFB 1KNRA 3JAFA 4X62T 5HEUA 3AE8A 4U74A 3ESLA 2HN1A 2EHOC 3TLSA 5FXXA 2IMLA 2DHRA 3AEFA 4ZOLE 2L9QA 2EHOD 2D2SA 2P9BA 2JQQA 2XQ3A 4HFHA 4PJJA 3A7MA 3ETUA 3MKDA 4DVDA 4DV7T 2CXLA 5FY7A 4GKJT 5FVKA 3RC8A 1LVKA 5HXCA 3HR0A 4H9QC 4U2YA 4A56A 4AKGA 2G0UA 4U2ZA 1DU2A 2IC6A 2XHEB 5LYJE 5HXSA 2E9XD 4X20E 4X1YE 2XQYA 3FBLA 2ODVA 2YDQA 4P09A 5J2TE 2NW7A 3HKDE 3PV0F 3AA1B 4TWFA 2Q9QB 5M4YA 1XNQT 2Z6EA 2X51A 2WU2A 3FHNA 4HFDA 2D0TA 4ILUA 2D0UA 4JBWF 2HPJA 2XPKA 4DMWA 4JLEA 5KMGP 1YW0A 3K1SA 2NTYA 5KXJA 3PU3A 4YLHA 4QH5A 1W0AA 2SPCA 5FXZA 4ZS3A 4X65T 2YDSA 3F57A 5CGMA 4LFBT 3AVSA 1LKXA 3C64A 1VOMA 3ZCIA 4HWCA 5HWYA 3ZMUB 4BAYB 2FJEA 4QX8B 2Y8DA 2KWHA 4O4JE 2JMKA 4P0BA 5AQPB 3ZN0B 4ZEYA 4YT0A 3AA6B 3AXJA 2BS2A 2L3LA 5KX5E 4EZHA 1MMDA 2VL0A 3ZYKA 5C2TA 4JI5T 5ABGA 3ZJ1A 3KVAA 1XNRT 4JEHB 4U3CA 3FZFB 1BR1A 5GONE 4COFA 2OV9A 4GYRA 2UU9T 4JI0T 3VU7H 2K3WA 4ANJA 3AA0B 3SFEA 3MZKB 2YDRA 4FI5A 5JH7E 3W15B 2E9XA 1E1HB 1SHZC 1HFAA 3OJAA 2LOPA 1YKEB 4M1PA 5HXRA 5L3DB 1IZNB 3J7Yq 4DR2T 4U72A 2QRXA 3V5SA 2VKDA 4F6RC 3PUSA 3BQIA 5JDQA 4IDQA 4YY3T 3CX8B 3RF1A 4AIUA 4ZI7E 4F8HA 2MYSA 2CLYB 4PJLA 5JDHA 4OHFA 3RYFE 4GK0E 4QKNA 3RH3A 3MA9A 3UUXB 3BQLA 5L3BB 2XSBA 2LRLA 2CBIA 2V6XA 4O2AE 2PJQA 1KEYA 2W2UA 2WB5A 2RA1A 5L3EB 4K0KT 1HCIA 5LMUT 2W67A 1WCRA 3P4WA 2DNXA 1FIOA 5HWXA 3LK42 2VKHA 2UXBT 2I59A 2WSSV 3UU6A 4HE8A 3PUAA 5AQJB 2IIUA 3E08A 1S94A 2JIWA 4UR9A 2PG8A 3L8RA 3PURA 3FBZA 4GK5E 4UIGA 4X1IE 4DV3T 4IDZA 2K48A 4U31A 4JI3T 2H7OA 2DWKA 3CVRA 4O4IE 4U7IA 5A1LA 4DNDA 4X66T 2OLTA 2JQKA 5DQVA 2IC9A 2H3RA 4AQYT 4OX9T 4DBQA 4H9RC 1NWMX 2D9DA 5LJNA 3HKEE 3L39A 3ZC0A 3IF8B 1GQEA 2NW9A 1QSDA 4NIQA 3R6NA 3RKGA 2VQET 3RI5A 4JI4T 5AQFB 2CE7A 4JUYA 1MMGA 3C4ZA 1HG2A 4JV5T 2YN6A 5L2LA 3X1DA 2NTXA 4YHJA 3E0ZA 3I1AA 4HTEA 4WW0A 3S4UA 1HR0T 2UXNB 2LM9A 1U4QA 1X9BA 5AQOB 3J9X1 4EZ4A 5JDFA 2XM2A 1IBMT 2HHHT 1XWMA 4DR4T 2OA5A 3EHZA 3LBXA 1FJGT 3LJCA 4L0RA 5LCYA 2F4VT 2V7KA 4H9OC 3A8YC 4DR3T 2QGSA 3RIAA 5ADXL 5L3CB 4X1KE 5AQSB 1H7CA 3NRXA 3QC9A 2XASB 2I0MA 2X9YA 4YJ2E 3FB2A 3ONXA 5LBMA 4A98A 3M3ZB 3RPUA 3VR8A 2KWIB 4CN1A 2PBIA 3GMIA 4GYSA 5H6RB 3SFDA 2WBLA 5E0OA 2BS3A 5AQTB 2X68A 5JR9A 3JAEA 2Q9QC 3I0QA 3AEAA 3RIUA 1EZ3A 2IDOB 2K24A 2VVSA 3AE9A 3UQ4A 3PUGA 4CN4A 4EYYR 4X64T 5DJQC 3ZC1A 3ZLIA 2X67A 5DQWA 3LK3B 5FKYA 1KFYA 3C4XA 5TAOA 2RP4A 2W61A 3P4RA 3OVUA 4KUMB 4EOZB 1SA0E 4TUYE 4IL9A 5J2UE 4EIWA 3UQ7A 4HFVA 4HFIA 3KV9A 5CA0E 1G8XA 5JDLA 5JDGA 2VQFT 2LHNA 2YKSA 1XDPA 2EHOB 2FUPA 5AQQB 3WAJA 5LNKA 4PNIA 1HNZT 3NKZA 5AQVB 4DV4T 3CQGB 2QVAA 2VASA 4TX5A 4LFAT 2YINA 4UVBB 4LF8T 1SUMB 4QHOA 4EV6A 4I4TE 1Y64B 4HFBA 2CPTA 4TV8E 2AXDS 4MHCA 1N33T 1AJ3A 2A9UA 1D1BA 3AAAB 4HFEA 2K5BB 3LG7A 4J2CA 1BR2A 3CQXC 4OFZA 2CHOA 5FXVA 4LF5T 1Y01A 4HGAA 3AE1A 3RYIE 3UTKA 2V6YA 3NRYA 3OPCA 3TLVA 4WNKA 4B3RT 2ODUA 2JQHA 2X9WA 4CI1B 5JVDE 5LHGB 4TV9E 3RLFF 3LFMA 3P7IA 2DWGA 2MTQA 2IUBA 2YK0A 5FP3A 4UXNB 3ONLC 5BR8T 2CXFA 2LLYA 2LKHA 4HWHA 3EVYA 4H9SE 4O8SA 4YJ3E 3ZN1B 2VKOA 2WP9A 3ZPOA 3MK7C 5AFUL 5CB4E 3EDUA 2WWVA 2V7IA 4UF0A 4U33A 1T8BA 3CMLA 4KI0F 4YHHT 1JNZA 2XQ4A 3DP7A 4JI8T 4LF6T 2WZIA 1I94T 3VRAA 2X0HA 3QB5K 4DV5T 2BKOA 3KVBA 2CBJA 1YD8G 3P50A 4IE5A 2BBHA 2XJ7A 3GN5A 3IHRA 4KHZF 4LMKA 4MFRA 1OEDB 2FBWA 5AQNB 4AXPA 2BKPA 2VK9A 5JRCB
chains in the Genus database with same CATH topology
1HX1B 1UGOA 4HWCA 1M62A 5AQKB 5AQGB 3FZHB 3FZLB 5AQPB 4HWDA 4HWIB 5AQOB 5AQUB 1I6ZA 4HWHA 3LDQB 5AQRB 5AQLB 3A8YC 5AQJB 3FZFB 5AQSB 5AQQB 5AQIB 5AQVB 1M7KA 3M3ZB 3FZMB 5AQHB 2D9DA 4HWFA 5AQTB 5AQFB 5AQMB 3FZKB 5AQNB 1T7SA 1UK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  1UGO A;  4HWC A;  1M62 A;  5AQK B;  5AQG B;  3FZH B;  3FZL B;  5AQP B;  4HWD A;  4HWI B;  5AQO B;  5AQU B;  1I6Z A;  4HWH A;  3LDQ B;  5AQR B;  5AQL B;  3A8Y C;  5AQJ B;  3FZF B;  5AQS B;  5AQQ B;  5AQI B;  5AQV B;  1M7K A;  3M3Z B;  3FZM B;  5AQH B;  2D9D A;  4HWF A;  5AQT B;  5AQF B;  5AQM B;  3FZK B;  5AQN B;  1T7S A;  1UK5 A; 
#chains in the Genus database with same CATH topology
 4KP3 C;  1HX1 B;  2E5L T;  2V7J A;  1WR0 A;  1ZP0 A;  1QUU A;  5L4E A;  3ZT7 A;  2CXD A;  2C5I T;  4UVC B;  3WI3 A;  4ILA A;  3EAB A;  3O1I A;  3BK9 A;  3Q5D A;  2M6I A;  3TKL B;  2YOE A;  3VKG A;  2CWY A;  5LHH B;  1KK7 A;  1OWA A;  4IHJ E;  5AQL B;  1T72 A;  2PTF A;  2NR4 A;  4XZC A;  1HX8 A;  3PUQ A;  4B6X A;  2WMO A;  3ZEF B;  4DV0 T;  5CFB A;  4PK5 A;  4IE0 A;  4PK4 A;  2JMH A;  2C5K T;  2ZM6 T;  2XQ5 A;  2LHR A;  3AA7 B;  3K3N A;  3N9O A;  5HCJ A;  2W4X A;  2NOX A;  2Y48 B;  5LOV E;  4UEL A;  5HYA A;  1S35 A;  5HCM A;  1J1J A;  1NEK A;  2FJB A;  3P4S A;  4ZXL A;  3AAI A;  2ZM2 A;  4I43 B;  1J5W A;  2IW5 B;  3PUY F;  4BA9 A;  3WAK A;  4LF4 T;  2V6Y B;  4DO0 A;  3KBT A;  3F31 A;  3FZK B;  3RYH E;  4AKR B;  3NZP A;  4UVA B;  2CWO A;  2XAH B;  1WRD A;  4O2B E;  3KV4 A;  3EAM A;  1M62 A;  1J5E T;  3T1H T;  2WCA A;  1UCU A;  4A97 A;  1WR6 A;  3OKQ A;  3L09 A;  1W0B A;  4V1A v;  3H3A A;  2DCF A;  4PAG A;  2E2A A;  3HA4 A;  1V9D A;  2WS3 A;  4NPP A;  3U78 A;  3AED A;  5LG4 A;  3T8O A;  4X5T A;  3ZST A;  1W9R A;  3CPZ A;  4ZS2 A;  5LB7 B;  3RQW A;  1ZHC A;  3ZCJ A;  4YTN A;  3TLU A;  4JI7 T;  4AKH A;  1VCT A;  1N36 T;  4BJM A;  3B57 A;  4ZI3 D;  4CQI A;  5CJ5 A;  1D0Y A;  2LJL A;  3AE6 A;  1M7K A;  2HN2 A;  3ANW A;  3CQC B;  4L5G A;  3RIU C;  4YSX A;  2MAW A;  5HEJ A;  1E7P A;  2V8S V;  2X0Y A;  3AE2 A;  5IYZ E;  2UUB T;  3RKO A;  2J62 A;  3N2K E;  3Q9D A;  2XUE A;  4G2A A;  4C91 A;  5C3J A;  4AQG A;  5FYM A;  4DR6 T;  5JRC A;  1KF6 A;  3JC6 C;  3KDS E;  5LGT B;  3CKD A;  3IEE A;  4AI6 A;  1T7S A;  3UU8 A;  5LJM A;  1O3X A;  2XZE A;  1XZY A;  5ABF A;  5FY1 A;  5AQK B;  2XQ8 A;  2CRB A;  4CN6 A;  3KFW X;  2C5J A;  2FJA A;  3ZMS B;  4BJN A;  3O4X E;  3QB5 A;  4ZI3 C;  4JI1 T;  3KV5 A;  3RGL A;  1ZOY A;  2BBJ A;  4OYJ A;  1YXR A;  2BG9 C;  2XAJ B;  3HL6 A;  3BQK A;  3EDV A;  4KBM B;  4PK6 A;  4ZZB A;  1W09 A;  2WM9 A;  2XTL A;  4N78 D;  3U3I A;  4LML A;  4DUZ T;  3JCF A;  1IBK T;  4HN9 A;  4WZX A;  5L4H A;  3UUB A;  2A72 A;  2VKJ A;  2GK9 A;  3CWZ B;  2BKN A;  2KT9 A;  4OK0 A;  2B76 A;  4P1N A;  4CXY A;  4B3M T;  2V1D B;  3AE5 A;  4LFC T;  2XY8 B;  3C50 A;  3ZMZ B;  3LSV A;  3AE4 A;  2ACZ A;  3O1J A;  5L3F B;  2NWB A;  4U7Y A;  4NXN T;  2V26 A;  4I55 E;  1WFD A;  2V5D A;  3AEG A;  5HAX A;  4DV6 T;  4EB6 E;  3UFG A;  2ZMA A;  2BVL A;  4O4H E;  5LA6 E;  4QX7 B;  4LMJ A;  2A3D A;  4B3T T;  3UUN A;  5KDM C;  1XMQ T;  3N2O A;  1FEW A;  2EHO A;  1ZEE A;  2KIN B;  4Z91 A;  4LF7 T;  3F2E A;  4C90 A;  4ADZ A;  2ES0 A;  2AE9 A;  1WYC A;  5HEG A;  4GKK T;  3AEC A;  3K8P C;  1BR4 A;  2A2F X;  3PJA A;  5F8P A;  2XQA A;  3ZMV B;  3ONJ A;  4GIW A;  2WDQ A;  2ZM8 A;  1HG5 A;  4IE7 A;  1UUS A;  4QH4 A;  4I0U A;  1IJ5 A;  2E8I A;  2X66 A;  4JEU B;  5EK4 A;  3RRC A;  3QK6 A;  2NW8 A;  4IDP A;  1XMO T;  3RYC E;  3SOL A;  2UXD T;  3N9M A;  2BDE A;  4H63 V;  2XQ6 A;  2VVN A;  1OED E;  1IAP A;  2DI4 A;  2YEV C;  3G06 A;  3K3O A;  2CHN A;  3I9W A;  1ZV4 X;  4IRE A;  4TNV A;  3HKB E;  5JDM A;  3FXD B;  4P0A A;  5CA1 E;  3VKH A;  3UU4 A;  3VR9 A;  2WDV A;  2BS4 A;  1WYB A;  5JDN A;  2QYW A;  2IHR 1;  3H3M A;  1UX5 A;  2ACX A;  2BG9 E;  2M67 A;  1U5P A;  3MXZ A;  3MJX A;  1R8I A;  2UXC T;  1MIY A;  3FZH B;  5JRE A;  3NVO A;  2J4G A;  4ZI2 D;  3ANW B;  2JPF A;  4Q25 A;  3R84 B;  3ZJ2 A;  3ZYL A;  2CCQ A;  3AXJ B;  2HPL A;  3A5X A;  2X0L B;  1X79 A;  3OBV E;  4DID B;  2KLQ A;  2KZ7 B;  4XAX B;  4YTP A;  4YTM A;  2R6G F;  1SE7 A;  2HH7 A;  4ILC A;  4DV1 T;  4QH1 A;  5LMN T;  1MNE A;  3AVR A;  3PDY A;  1OED C;  4YSZ A;  5FL1 A;  3ZT5 A;  5L3G B;  5HXH A;  5LHI B;  3ZYM A;  5FNV E;  4Z8X A;  2W66 A;  2V7L A;  3EI0 A;  2LE8 A;  1MIV A;  2XAG B;  3E22 E;  2RPA A;  2UUA T;  2BZB A;  2FJD A;  1N32 T;  3PUW F;  5AQM B;  2WMN A;  1UK5 A;  3RIF A;  3C51 A;  3DJB A;  1UGO A;  4DV2 T;  1ZKE A;  4MBQ A;  3P4P A;  1MIW A;  4EXT A;  3PTR B;  4Z90 A;  2X9H A;  3QNU A;  3N2G E;  3NZQ A;  4HWD A;  4HWI B;  3AB3 B;  2XSA A;  1HF8 A;  2VB6 A;  4KX6 A;  3KV6 A;  2MOZ A;  2H89 A;  1FMW A;  2LEH A;  2XM1 A;  5IHY A;  4OYK A;  3KIN B;  4EYU A;  1IBL T;  3L3P A;  3IBP A;  4DR5 T;  4YSY A;  3P8C D;  2E5V A;  2LRK A;  4AKI A;  1D0X A;  4IIJ E;  4FJO A;  5EK2 A;  1UX4 A;  2LM2 A;  3JC6 D;  3PUZ F;  4DR7 T;  2H88 A;  4JI2 T;  3KBU A;  5IUX A;  4XBF B;  2BG9 A;  3CX6 B;  3JAD A;  4IDO A;  4DUY T;  3I9Y A;  2L8K A;  5JTG A;  3CK6 A;  4I50 E;  4LF9 T;  2Q9Q D;  4E7Z A;  4AKL A;  4G63 A;  3UU3 A;  1OED A;  3UT5 E;  2WZH A;  3UFE A;  4ASK A;  2J47 A;  2KMF A;  3O1H A;  2E9X B;  5HEH A;  2XQ9 A;  3N9Q A;  3OTO T;  2JQ9 A;  5FXW A;  4ZHQ E;  3UUL A;  4O4L E;  3LDQ B;  2XQ7 A;  4TWH A;  4PFO A;  3N5L A;  3D0T A;  3GA8 A;  3SRZ A;  2DL1 A;  3DTO A;  1VCS A;  3PE0 A;  4UF0 B;  4YXD A;  5JR9 C;  1B7T A;  4DBR A;  1UUR A;  2B1E A;  3Q2M A;  5F5W A;  3VHL A;  4KHP T;  1YQ3 A;  5H6Q B;  3P4Q A;  2W00 A;  4PW8 A;  3UUM A;  5AQI B;  3TLT A;  5IWA T;  2LKG A;  2X9X A;  4H9P C;  5LXT E;  1CUN A;  4TN7 B;  4A5X A;  4AQF C;  5LP6 E;  3FZM B;  3Q5E A;  4QXH B;  3TLW A;  3FXE B;  3GWH A;  4NXM T;  2V5C A;  2VL8 A;  1L0V A;  3HKC E;  5F3J A;  2JRK A;  3CIR A;  1FMV A;  5JQG E;  5ABE A;  2KXP B;  1CHU A;  3FZL B;  2MBG A;  4QXC B;  4CXX A;  1OXZ A;  1MMN A;  3NBX X;  5AQU B;  2M6B A;  5FMN A;  1LVF A;  1YKH B;  2Q9Q A;  5AQR B;  1I6Z A;  4ZI2 C;  1IJ6 A;  4H63 H;  2CLY C;  4IGU A;  5FVL A;  5L47 A;  2I6H A;  1G73 A;  4HEA A;  3ZSS A;  5C8Y E;  4WBO A;  4DMV A;  3RHW A;  1HTJ F;  3AEE A;  2BG9 B;  5HEO A;  2NP9 A;  4KMC A;  2ZM0 A;  3HI2 A;  4ILB A;  4IT4 A;  4IE6 A;  4CI2 B;  5JR9 B;  2JJ9 A;  5AQH B;  1KNP A;  3K3Q C;  3LK2 B;  3EUH A;  3SS1 A;  2PFV A;  3SWH A;  1KNZ A;  1T98 A;  3V5U A;  2N1G A;  1D0Z A;  2W63 A;  2WAU A;  2LSK A;  2WDR A;  3PUV F;  4B3S T;  4GOU A;  4HFC A;  4JYA T;  4IE4 A;  4ISS A;  2D5U A;  2LSY A;  2ZLY A;  3I0O A;  2WWU A;  2N2N A;  3MAC A;  1Z8U A;  4IL4 A;  4L9I A;  2N9D A;  5AQG B;  4JI6 T;  1MND A;  2QA7 A;  1E2A A;  3NWI A;  3PU8 A;  4MLK A;  5LBQ B;  2XAQ B;  3Q5W A;  4QWN B;  4QXB B;  3PUX F;  3PJA J;  4TWD A;  5FL0 A;  3OYX A;  3ZKR A;  3ZT6 A;  1HNX T;  2K9A A;  1LRZ A;  2LSG A;  3Q5X A;  4HKA A;  5BMV E;  4WYV A;  4EED A;  4DR1 T;  5ABH A;  2LOS A;  3O9X A;  2C0S A;  2KND A;  3LBX B;  4TZ4 C;  2CA5 A;  2CM0 A;  3C4W A;  2KSR A;  5ETW A;  2VWA A;  3QOF A;  4IDN A;  3N9P A;  2YU2 A;  5LGN B;  4NUU A;  4NUV A;  2V7M A;  2BVM A;  3RRW A;  4PJM A;  4ERR A;  2Y6X A;  1US7 B;  4TNW A;  2LSI A;  4UEM A;  2LT3 A;  3AE3 A;  1WLX A;  3B13 A;  3AAE B;  3QUJ A;  4UV8 B;  5DAB A;  5EZY E;  5J1G A;  4CI3 B;  5FY0 A;  5LGU B;  3AE7 A;  3AEB A;  3RX6 A;  2W62 A;  1Z0P A;  2WU5 A;  2YU1 A;  3RQU A;  2H7V C;  1XDO A;  1MMA A;  3T1Y T;  4EEB A;  4EAH A;  5J0Z A;  2CMR A;  3IA3 A;  2J1D G;  4IST A;  4CZZ B;  4WBN E;  4E7S A;  4YFS A;  3ETV A;  1NEN A;  4CXW A;  1VRB A;  3C98 B;  4K0U A;  3RC3 A;  3ABV A;  3VRB A;  1NAF A;  4PJN A;  4ZZC A;  1QLB A;  2DLR A;  3N9L A;  2UXX B;  2WY2 A;  3OYZ A;  2LSJ A;  2WQY A;  3B5M A;  3CX7 B;  4UV9 B;  4AIS A;  4EGW A;  5HXE A;  2CEA A;  5EK3 A;  2MPK A;  1D1A A;  1JNR A;  2XAF B;  3ZMT B;  2UUC T;  4H9N C;  1YQ4 A;  4AQF A;  1HS7 A;  1HNW T;  2E9X C;  2VUR A;  4MAL A;  3H37 A;  3N9N A;  4PFP A;  1BR0 A;  1D1C A;  3M65 A;  3UU5 A;  2W0G A;  3GN5 B;  1N34 T;  5LG3 A;  2IAK A;  4HWF A;  5ABF B;  1KNR A;  3JAF A;  4X62 T;  5HEU A;  3AE8 A;  4U74 A;  3ESL A;  2HN1 A;  2EHO C;  3TLS A;  5FXX A;  2IML A;  2DHR A;  3AEF A;  4ZOL E;  2L9Q A;  2EHO D;  2D2S A;  2P9B A;  2JQQ A;  2XQ3 A;  4HFH A;  4PJJ A;  3A7M A;  3ETU A;  3MKD A;  4DVD A;  4DV7 T;  2CXL A;  5FY7 A;  4GKJ T;  5FVK A;  3RC8 A;  1LVK A;  5HXC A;  3HR0 A;  4H9Q C;  4U2Y A;  4A56 A;  4AKG A;  2G0U A;  4U2Z A;  1DU2 A;  2IC6 A;  2XHE B;  5LYJ E;  5HXS A;  2E9X D;  4X20 E;  4X1Y E;  2XQY A;  3FBL A;  2ODV A;  2YDQ A;  4P09 A;  5J2T E;  2NW7 A;  3HKD E;  3PV0 F;  3AA1 B;  4TWF A;  2Q9Q B;  5M4Y A;  1XNQ T;  2Z6E A;  2X51 A;  2WU2 A;  3FHN A;  4HFD A;  2D0T A;  4ILU A;  2D0U A;  4JBW F;  2HPJ A;  2XPK A;  4DMW A;  4JLE A;  5KMG P;  1YW0 A;  3K1S A;  2NTY A;  5KXJ A;  3PU3 A;  4YLH A;  4QH5 A;  1W0A A;  2SPC A;  5FXZ A;  4ZS3 A;  4X65 T;  2YDS A;  3F57 A;  5CGM A;  4LFB T;  3AVS A;  1LKX A;  3C64 A;  1VOM A;  3ZCI A;  4HWC A;  5HWY A;  3ZMU B;  4BAY B;  2FJE A;  4QX8 B;  2Y8D A;  2KWH A;  4O4J E;  2JMK A;  4P0B A;  5AQP B;  3ZN0 B;  4ZEY A;  4YT0 A;  3AA6 B;  3AXJ A;  2BS2 A;  2L3L A;  5KX5 E;  4EZH A;  1MMD A;  2VL0 A;  3ZYK A;  5C2T A;  4JI5 T;  5ABG A;  3ZJ1 A;  3KVA A;  1XNR T;  4JEH B;  4U3C A;  3FZF B;  1BR1 A;  5GON E;  4COF A;  2OV9 A;  4GYR A;  2UU9 T;  4JI0 T;  3VU7 H;  2K3W A;  4ANJ A;  3AA0 B;  3SFE A;  3MZK B;  2YDR A;  4FI5 A;  5JH7 E;  3W15 B;  2E9X A;  1E1H B;  1SHZ C;  1HFA A;  3OJA A;  2LOP A;  1YKE B;  4M1P A;  5HXR A;  5L3D B;  1IZN B;  3J7Y q;  4DR2 T;  4U72 A;  2QRX A;  3V5S A;  2VKD A;  4F6R C;  3PUS A;  3BQI A;  5JDQ A;  4IDQ A;  4YY3 T;  3CX8 B;  3RF1 A;  4AIU A;  4ZI7 E;  4F8H A;  2MYS A;  2CLY B;  4PJL A;  5JDH A;  4OHF A;  3RYF E;  4GK0 E;  4QKN A;  3RH3 A;  3MA9 A;  3UUX B;  3BQL A;  5L3B B;  2XSB A;  2LRL A;  2CBI A;  2V6X A;  4O2A E;  2PJQ A;  1KEY A;  2W2U A;  2WB5 A;  2RA1 A;  5L3E B;  4K0K T;  1HCI A;  5LMU T;  2W67 A;  1WCR A;  3P4W A;  2DNX A;  1FIO A;  5HWX A;  3LK4 2;  2VKH A;  2UXB T;  2I59 A;  2WSS V;  3UU6 A;  4HE8 A;  3PUA A;  5AQJ B;  2IIU A;  3E08 A;  1S94 A;  2JIW A;  4UR9 A;  2PG8 A;  3L8R A;  3PUR A;  3FBZ A;  4GK5 E;  4UIG A;  4X1I E;  4DV3 T;  4IDZ A;  2K48 A;  4U31 A;  4JI3 T;  2H7O A;  2DWK A;  3CVR A;  4O4I E;  4U7I A;  5A1L A;  4DND A;  4X66 T;  2OLT A;  2JQK A;  5DQV A;  2IC9 A;  2H3R A;  4AQY T;  4OX9 T;  4DBQ A;  4H9R C;  1NWM X;  2D9D A;  5LJN A;  3HKE E;  3L39 A;  3ZC0 A;  3IF8 B;  1GQE A;  2NW9 A;  1QSD A;  4NIQ A;  3R6N A;  3RKG A;  2VQE T;  3RI5 A;  4JI4 T;  5AQF B;  2CE7 A;  4JUY A;  1MMG A;  3C4Z A;  1HG2 A;  4JV5 T;  2YN6 A;  5L2L A;  3X1D A;  2NTX A;  4YHJ A;  3E0Z A;  3I1A A;  4HTE A;  4WW0 A;  3S4U A;  1HR0 T;  2UXN B;  2LM9 A;  1U4Q A;  1X9B A;  5AQO B;  3J9X 1;  4EZ4 A;  5JDF A;  2XM2 A;  1IBM T;  2HHH T;  1XWM A;  4DR4 T;  2OA5 A;  3EHZ A;  3LBX A;  1FJG T;  3LJC A;  4L0R A;  5LCY A;  2F4V T;  2V7K A;  4H9O C;  3A8Y C;  4DR3 T;  2QGS A;  3RIA A;  5ADX L;  5L3C B;  4X1K E;  5AQS B;  1H7C A;  3NRX A;  3QC9 A;  2XAS B;  2I0M A;  2X9Y A;  4YJ2 E;  3FB2 A;  3ONX A;  5LBM A;  4A98 A;  3M3Z B;  3RPU A;  3VR8 A;  2KWI B;  4CN1 A;  2PBI A;  3GMI A;  4GYS A;  5H6R B;  3SFD A;  2WBL A;  5E0O A;  2BS3 A;  5AQT B;  2X68 A;  5JR9 A;  3JAE A;  2Q9Q C;  3I0Q A;  3AEA A;  3RIU A;  1EZ3 A;  2IDO B;  2K24 A;  2VVS A;  3AE9 A;  3UQ4 A;  3PUG A;  4CN4 A;  4EYY R;  4X64 T;  5DJQ C;  3ZC1 A;  3ZLI A;  2X67 A;  5DQW A;  3LK3 B;  5FKY A;  1KFY A;  3C4X A;  5TAO A;  2RP4 A;  2W61 A;  3P4R A;  3OVU A;  4KUM B;  4EOZ B;  1SA0 E;  4TUY E;  4IL9 A;  5J2U E;  4EIW A;  3UQ7 A;  4HFV A;  4HFI A;  3KV9 A;  5CA0 E;  1G8X A;  5JDL A;  5JDG A;  2VQF T;  2LHN A;  2YKS A;  1XDP A;  2EHO B;  2FUP A;  5AQQ B;  3WAJ A;  5LNK A;  4PNI A;  1HNZ T;  3NKZ A;  5AQV B;  4DV4 T;  3CQG B;  2QVA A;  2VAS A;  4TX5 A;  4LFA T;  2YIN A;  4UVB B;  4LF8 T;  1SUM B;  4QHO A;  4EV6 A;  4I4T E;  1Y64 B;  4HFB A;  2CPT A;  4TV8 E;  2AXD S;  4MHC A;  1N33 T;  1AJ3 A;  2A9U A;  1D1B A;  3AAA B;  4HFE A;  2K5B B;  3LG7 A;  4J2C A;  1BR2 A;  3CQX C;  4OFZ A;  2CHO A;  5FXV A;  4LF5 T;  1Y01 A;  4HGA A;  3AE1 A;  3RYI E;  3UTK A;  2V6Y A;  3NRY A;  3OPC A;  3TLV A;  4WNK A;  4B3R T;  2ODU A;  2JQH A;  2X9W A;  4CI1 B;  5JVD E;  5LHG B;  4TV9 E;  3RLF F;  3LFM A;  3P7I A;  2DWG A;  2MTQ A;  2IUB A;  2YK0 A;  5FP3 A;  4UXN B;  3ONL C;  5BR8 T;  2CXF A;  2LLY A;  2LKH A;  4HWH A;  3EVY A;  4H9S E;  4O8S A;  4YJ3 E;  3ZN1 B;  2VKO A;  2WP9 A;  3ZPO A;  3MK7 C;  5AFU L;  5CB4 E;  3EDU A;  2WWV A;  2V7I A;  4UF0 A;  4U33 A;  1T8B A;  3CML A;  4KI0 F;  4YHH T;  1JNZ A;  2XQ4 A;  3DP7 A;  4JI8 T;  4LF6 T;  2WZI A;  1I94 T;  3VRA A;  2X0H A;  3QB5 K;  4DV5 T;  2BKO A;  3KVB A;  2CBJ A;  1YD8 G;  3P50 A;  4IE5 A;  2BBH A;  2XJ7 A;  3GN5 A;  3IHR A;  4KHZ F;  4LMK A;  4MFR A;  1OED B;  2FBW A;  5AQN B;  4AXP A;  2BKP A;  2VK9 A;  5JRC B; 
#chains in the Genus database with same CATH homology
 1HX1 B;  1UGO A;  4HWC A;  1M62 A;  5AQK B;  5AQG B;  3FZH B;  3FZL B;  5AQP B;  4HWD A;  4HWI B;  5AQO B;  5AQU B;  1I6Z A;  4HWH A;  3LDQ B;  5AQR B;  5AQL B;  3A8Y C;  5AQJ B;  3FZF B;  5AQS B;  5AQQ B;  5AQI B;  5AQV B;  1M7K A;  3M3Z B;  3FZM B;  5AQH B;  2D9D A;  4HWF A;  5AQT B;  5AQF B;  5AQM B;  3FZK B;  5AQN B;  1T7S A;  1UK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...