1M7KA

Solution structure of the sodd bag domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the SODD BAG domain reveals additional electrostatic interactions in the HSP70 complexes of SODD subfamily BAG domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Silencer of Death Domains
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m7kA00
1I6ZA 1UK5A 5AQTB 3LDQB 5AQFB 2D9DA 3A8YC 4HWHA 5AQSB 4HWFA 3FZFB 5AQOB 3FZMB 3M3ZB 4HWCA 5AQRB 5AQVB 5AQIB 5AQLB 5AQGB 5AQUB 3FZLB 1UGOA 1M7KA 5AQNB 5AQJB 5AQKB 4HWIB 1T7SA 4HWDA 5AQPB 3FZHB 1HX1B 3FZKB 1M62A 5AQMB 5AQHB 5AQQB
chains in the Genus database with same CATH superfamily
4IDQA 3GN5A 5L3GB 4DR1T 2A2FX 3R6NA 1IAPA 3RRCA 1E7PA 2LSIA 3RYHE 2CCQA 2QGSA 1HTJF 3P4QA 4JI7T 4EYYR 1E2AA 4EXTA 5LYJE 4MHCA 1MMDA 3PUSA 3KDSE 3JAEA 2BZBA 3P4WA 4U72A 3ZPOA 4EV6A 3RKGA 4ADZA 4JI6T 1XDOA 5CGMA 2BG9B 3TLTA 4CXWA 1HX8A 2LE8A 4NIQA 1HCIA 2QYWA 2Z6EA 2CMRA 4EB6E 3NBXX 3TLSA 4CN1A 2HN2A 4H9QC 1VRBA 2BKNA 2WU2A 2X9WA 4ILCA 4ZOLE 3VR9A 2R6GF 2V7IA 5FY0A 4B6XA 4CZZB 4EIWA 1J5ET 2IIUA 4EOZB 2FJAA 2W0GA 5AFUL 5HXHA 4YY3T 5EZYE 1HX1B 3LBXB 2L3LA 3FZKB 2KINB 1IJ6A 3G06A 4O8SA 2E5VA 4X20E 2WMNA 4PW8A 4UR9A 3PJAJ 3ZMTB 5FL1A 5J2UE 2RPAA 1KK7A 1UK5A 4DR5T 2LT3A 1XMOT 4LFBT 4X1KE 2UXBT 1YQ4A 1MNDA 3QB5K 5LCYA 4YSZA 4ZEYA 5LHIB 2X67A 4L0RA 4LF8T 2XTLA 5L3CB 4ZI7E 3UULA 2D2SA 1T8BA 4L5GA 3AXJB 4K0UA 3ZCJA 4HKAA 5FY7A 5JDLA 2XM2A 4O2AE 2XQ9A 3SRZA 3L39A 4ISSA 3CPZA 4JI3T 4HTEA 3AA6B 3H3MA 2ODUA 3I9WA 2UXNB 2H7OA 4QH5A 2CM0A 2CWYA 4A5XA 5JQGE 1OEDC 2HPJA 3AECA 4QXBB 4F6RC 4DV3T 4YSXA 3RQWA 2HHHT 3AVSA 5JDMA 4HWDA 2MBGA 4GK0E 4ASKA 1SE7A 4DMVA 4O4IE 3NZQA 2WWVA 1N34T 4DBRA 3BQLA 3PUGA 1ZKEA 3ZT6A 1FEWA 3MXZA 4OX9T 2Q9QB 2V8SV 4YFSA 3OVUA 4ILUA 3RPUA 4COFA 2CLYC 3ZMSB 5IWAT 1YXRA 2VVSA 4DV0T 3K8PC 2MYSA 3ZN0B 3GWHA 5HEJA 4UV8B 2XAHB 4AI6A 2V5DA 4PJLA 3EHZA 4CI1B 2J47A 5L2LA 2XQ8A 4IE7A 2V26A 4JBWF 4PAGA 3TLWA 4PK4A 4ZI2D 1HNXT 3QC9A 3T8OA 5HCJA 5AQIB 4OYJA 5LBMA 2IUBA 3DTOA 1ZOYA 2EHOC 3HR0A 4JI1T 1U4QA 3RH3A 5AQJB 4A98A 5BR8T 4OYKA 4PFOA 3SOLA 1SHZC 2C0SA 1HNZT 1UCUA 1VCTA 3KINB 3RC8A 3J9X1 2A72A 1E1HB 2KZ7B 1M62A 3EI0A 4H9SE 3PUZF 3JCFA 4I43B 4AIUA 4IE5A 3ZMVB 4AQFC 4CI2B 5LP6E 2IHR1 3BK9A 3QK6A 3ZMUB 2CXFA 3N5LA 2XAQB 1NENA 2YN6A 4KBMB 5FY1A 3CX6B 4DVDA 2IMLA 2V6YA 3E08A 3JC6C 4PJMA 2XQYA 1UURA 3P8CD 4XAXB 1L0VA 4TWFA 2CBJA 3N2OA 2WB5A 3AE3A 1GQEA 2XAJB 2X9YA 2XQ5A 3T1YT 2YEVC 4DV5T 2JPFA 4DV1T 4QXHB 5C3JA 5HYAA 3UU4A 4NXMT 4TX5A 1M7KA 4C91A 5H6RB 4LFAT 1OEDA 3WAKA 2W62A 3CWZB 3CIRA 3VRAA 4TV8E 4E7SA 5JDHA 5KXJA 4LF7T 5JRCB 1IJ5A 3O1HA 5F8PA 3U3IA 3IBPA 1D1AA 3CQXC 4DV7T 4JI0T 3A7MA 5CB4E 4U33A 4L9IA 2W66A 5LHHB 2BVLA 1YKHB 4JLEA 4KUMB 2WBLA 3AA1B 5FMNA 4JI2T 4AQYT 4GIWA 1LVKA 2JRKA 3ETVA 3M65A 5AQTB 2LM2A 2Q9QD 4H9RC 5LMNT 3N9PA 3AE8A 4WBNE 2XQ3A 5ABFA 2ZM6T 1HF8A 5FYMA 2D9DA 3H3AA 1MIWA 5JR9B 3ZC0A 1Z0PA 3UU5A 1OWAA 3FBLA 4HGAA 2G0UA 5L3DB 2JJ9A 4O4LE 3I9YA 4AKHA 4HWCA 4KX6A 2JMHA 4AXPA 2J4GA 4JUYA 1FMVA 1MIVA 1CHUA 2VK9A 1WR0A 2X0HA 2ES0A 4H9NC 2B1EA 3FXDB 4KHZF 4U2YA 4UV9B 4QKNA 5AQUB 2VKHA 3J7Yq 5HEGA 3FXEB 1WYCA 1G73A 5AQPB 4A97A 4U3CA 2PTFA 2MAWA 2K5BB 1Y64B 1KNPA 2VWAA 5J2TE 2VASA 3JADA 3K1SA 2MTQA 4IREA 5JDNA 3RRWA 2KSRA 2LKGA 3PU8A 4HFIA 4B3TT 4A56A 4JI4T 4I50E 3KV5A 2DWGA 1MIYA 2X0YA 1OEDE 3O1IA 1NWMX 4IHJE 3AE1A 3EDUA 1NAFA 2VKJA 4IE0A 5L3EB 4LF6T 3KVBA 2L8KA 5BMVE 3KBUA 2YDSA 1FMWA 1NEKA 4ERRA 5CA0E 4MFRA 4TV9E 1XZYA 2WP9A 3QNUA 2D0UA 1N32T 5ETWA 4QXCB 2E9XB 2LHNA 3ESLA 3UUMA 3ZC1A 2XQ4A 2VL0A 2ZLYA 2B76A 2E9XD 2BVMA 2P9BA 2X9HA 2N9DA 3N2KE 2WAUA 3OKQA 1IBKT 2M6IA 2LHRA 3BQKA 4X1IE 5L3BB 4DV2T 4NXNT 3CMLA 4HN9A 5AQKB 2BS4A 2OLTA 3PUAA 2KXPB 3KFWX 3PUQA 3CQGB 4ZXLA 3ZJ1A 4UF0B 2F4VT 5JH7E 3T1HT 1XMQT 4IE4A 2DNXA 2JQQA 2OA5A 2XZEA 2NP9A 3HI2A 3P4RA 3VR8A 4AKRB 1XNRT 4G2AA 3ONLC 4YLHA 1DU2A 4TWDA 4NUUA 4LF9T 2CXLA 3EVYA 4YHHT 4O2BE 4O4HE 3C4ZA 4BA9A 5IYZE 3S4UA 2BKOA 4HFBA 1HFAA 2L9QA 3RX6A 4ZHQE 2CPTA 2E5LT 1WR6A 2KWIB 3FBZA 3UQ4A 4IE6A 3N9NA 4H63H 2C5IT 4JEUB 4EEDA 4U31A 5HAXA 2VKOA 3RGLA 5CJ5A 2DL1A 4LMLA 5AQVB 4YTNA 1SUMB 4TN7B 4JEHB 5C2TA 3KV9A 3LSVA 4WBOA 3FZLB 2HH7A 2V7LA 2XHEB 3RKOA 3TLUA 2V1DB 3ZT7A 4LFCT 2N1GA 1J1JA 2V7MA 2WDRA 2VQET 1HG2A 1QLBA 2WZIA 2NOXA 3UUXB 4DO0A 1KNZA 2WU5A 2XJ7A 3VKHA 4UVBB 2YDRA 1QSDA 4V1Av 2CE7A 1ZV4X 5AQQB 4EAHA 4EZ4A 2MOZA 4NPPA 4PJJA 5HEUA 4DV4T 3MK7C 4HE8A 2IW5B 3ZKRA 5DQVA 4EZHA 4YT0A 5AQFB 2LJLA 3K3QC 3F2EA 5C8YE 2JMKA 1KNRA 2VURA 3AXJA 3ZYMA 3U78A 5FKYA 3PURA 3UU8A 4H9OC 1T98A 4HWFA 3AE2A 4P0BA 5GONE 3MA9A 3FZFB 3CVRA 4X1YE 3FZMB 2YK0A 4U7YA 4P1NA 3L8RA 4YTMA 2BDEA 2XSAA 2E2AA 2JQ9A 2KT9A 5AQRB 4ZZBA 3AE5A 3FB2A 5FXXA 2DHRA 4BJNA 3AA0B 4ZI3D 3WAJA 5AQLB 4LF4T 2J1DG 2DLRA 2BG9C 4CN4A 4TWHA 3VKGA 2EHOA 3O9XA 2Y6XA 3EDVA 5JDQA 3SFDA 3UFEA 3ZSTA 1Z8UA 2AE9A 2WDVA 1T7SA 1N36T 1R8IA 4H9PC 4LF5T 3O1JA 4KI0F 2H3RA 2Q9QC 3GA8A 5AQHB 4QH4A 2CXDA 2KNDA 3I1AA 3SS1A 1BR4A 3UUBA 5FXWA 3NZPA 3ZJ2A 5JTGA 2UUAT 3PV0F 4FJOA 4CN6A 3KV6A 4IGUA 4IT4A 2NW7A 3LK42 2LEHA 2LLYA 2PJQA 3H37A 4U74A 4AISA 1FIOA 4HFEA 2X0LB 5HCMA 5DABA 5LOVE 3C51A 5ADXL 4LMKA 3ETUA 2NW9A 2OV9A 4G63A 5LHGB 2BG9A 3UU3A 2A3DA 2K48A 2ZM8A 3A5XA 4TNWA 2JQKA 2XY8B 3QOFA 2CEAA 3AEAA 1W0AA 5EK2A 1UUSA 2X9XA 3RIUC 3UFGA 4XBFB 4MALA 5JDFA 4X62T 3E22E 2XPKA 4GYRA 5FVLA 4UVCB 1LVFA 4ILAA 2WDQA 1YW0A 2CWOA 4GKJT 1KF6A 5F5WA 2BG9E 3HL6A 1FJGT 5FVKA 4ZS3A 3B5MA 4HFCA 3P50A 3AEBA 1N33T 5EK3A 3N9QA 4ZS2A 3LDQB 2W61A 3RI5A 1HR0T 1W09A 5L4HA 3DJBA 3FHNA 4IIJE 2LSJA 2NR4A 3HKBE 4Z91A 2LSYA 2FJEA 2WM9A 3ANWB 3LFMA 1BR1A 2W67A 4NUVA 3K3OA 4X5TA 4ZI3C 2BBHA 2HPLA 1IBLT 1EZ3A 4MLKA 3UTKA 2QVAA 5L47A 1KEYA 4CI3B 3B13A 2LM9A 4X64T 3V5UA 4ZZCA 5JVDE 3RIAA 2LOSA 4P0AA 1WFDA 2V5CA 1T72A 4GYSA 2EHOB 4DNDA 3PE0A 4YJ3E 5L3FB 3RC3A 4DUZT 2UUBT 2DWKA 2XAFB 3C4WA 3QUJA 3PUWF 3ZYKA 3LK3B 4X66T 2LRKA 2JIWA 1XDPA 5J0ZA 4DR7T 1ZP0A 4ILBA 2FUPA 4B3MT 3MKDA 3KV4A 4AKLA 5L4EA 3UQ7A 4HFVA 4IDZA 3HKEE 3RYIE 2BKPA 1U5PA 2X66A 4X65T 3L09A 2N2NA 1VOMA 4IDOA 4YHJA 5FP3A 3W15B 3X1DA 5AQSB 5ABFB 4TNVA 1XNQT 2LRLA 3IHRA 1UX5A 2DCFA 4M1PA 5AQOB 5JR9A 1MMNA 3RIFA 4CXXA 1BR0A 3I0QA 2ZM2A 2PBIA 5HWYA 2YDQA 1QUUA 4WYVA 4FI5A 3ONXA 2XSBA 5JREA 3VRBA 2SPCA 1YD8G 5JDGA 4U7IA 2WQYA 5HEOA 5HEHA 4HWIB 2UXDT 1MMAA 2XUEA 3IA3A 3ABVA 4IDNA 4OHFA 1HG5A 2HN1A 2WCAA 1I94T 2C5JA 3RF1A 1WRDA 3AEGA 5E0OA 1H7CA 5LNKA 2CLYB 4UELA 3RHWA 1W9RA 4WZXA 5LGUB 4DR3T 4JYAT 4AKGA 2A9UA 4QX7B 1HNWT 3NKZA 2UXCT 1IZNB 3AAEB 3BQIA 4DR4T 3CKDA 4GKKT 2I59A 2WWUA 3ANWA 3PJAA 3Q5XA 3R84B 2VB6A 5FNVE 4DIDB 3N9OA 4E7ZA 4PK6A 4YXDA 2E9XC 2I0MA 2VQFT 4KP3C 3AA7B 2W4XA 2WS3A 2UU9T 2V6XA 4AQGA 2J62A 3CQCB 3ZLIA 2NW8A 2ACZA 2FJBA 1O3XA 3EABA 2DI4A 5AQNB 5CA1E 1ZEEA 2XQAA 2RA1A 1KFYA 1OEDB 4I55E 1JNRA 5FXVA 3OTOT 3FZHB 4AKIA 2LKHA 4F8HA 5LMUT 2D0TA 1AJ3A 2XQ7A 2Q9QA 2NTXA 4B3ST 3OPCA 2H88A 3UT5E 4QH1A 5IUXA 4DUYT 5ABEA 2WZHA 5IHYA 1CUNA 2QRXA 2D5UA 3RYCE 4GOUA 4QHOA 1BR2A 3GN5B 4TUYE 2Y8DA 5HXSA 3QB5A 4EYUA 1VCSA 3DP7A 3PUVF 4PFPA 4DMWA 1MMGA 1UX4A 2WSSV 1ZHCA 3NWIA 4HWHA 4ANJA 5KDMC 1JNZA 2LOPA 3L3PA 5LB7B 2IDOB 3WI3A 3PU3A 5KX5E 1D0XA 4N78D 4GK5E 1IBMT 3HKCE 4UXNB 2ACXA 2K24A 3KBTA 4O4JE 4BAYB 3AE7A 2XM1A 4UIGA 5AQGB 5LG3A 3N2GE 5HWXA 5LG4A 3EUHA 3UU6A 2C5KT 3ZMZB 3C50A 5ABHA 2WY2A 3RIUA 5FXZA 4H63V 2CHOA 3OYZA 3P7IA 3RYFE 3NVOA 3LJCA 5M4YA 2XQ6A 3D0TA 2MPKA 3E0ZA 5LA6E 5DJQC 2I6HA 2YOEA 4YJ2E 1X9BA 5LJNA 2FBWA 5AQMB 3MACA 4Q25A 4AQFA 3AE6A 2WMOA 2UUCT 5CFBA 1I6ZA 4IDPA 3N9MA 2NWBA 5HXCA 3IF8B 3K3NA 3OBVE 1J5WA 1S94A 2AXDS 2GK9A 2VVNA 2ZMAA 3AEEA 4YTPA 2KMFA 5LJMA 3TKLB 4JV5T 3EAMA 5LBQB 3ZT5A 5LGNB 1WCRA 2E9XA 2IC9A 3CK6A 3CX8B 2IC6A 3Q2MA 3SWHA 3ZYLA 2M6BA 3Q5DA 5DQWA 2YINA 3MZKB 3P4PA 2K3WA 1W0BA 2BBJA 2XASB 3PUYF 1WLXA 5ABGA 3IEEA 2W2UA 3Q5EA 2V7JA 1HS7A 3LG7A 1MNEA 4WNKA 4K0KT 3F57A 3GMIA 3N9LA 2YU2A 3VU7H 2QA7A 4KMCA 4CXYA 4HFHA 3AE9A 3LK2B 1YKEB 4ISTA 2YU1A 3C4XA 3AAIA 1G8XA 1X79A 3Q5WA 3O4XE 3UUNA 3MJXA 3TLVA 4IL9A 4PNIA 4QWNB 3ZCIA 4JI5T 1D1BA 3HA4A 2W63A 3OJAA 4QX8B 5LGTB 3CX7B 1Y01A 4EEBA 5TAOA 2EHOD 5LXTE 3SFEA 4ZI2C 3AEFA 2NTYA 3I0OA 4Z8XA 2ODVA 3C64A 4UVAB 5JR9C 5A1LA 3OYXA 3RQUA 3AB3B 1LRZA 4C90A 4DBQA 2IAKA 3VHLA 4TZ4C 5KMGP 2M67A 3AVRA 4IL4A 2X68A 4PK5A 5EK4A 2K9AA 2PFVA 2VKDA 1LKXA 2VL8A 3ONJA 4MBQA 1B7TA 1SA0E 2H89A 3JC6D 3Q9DA 5H6QB 3B57A 4DR6T 4OFZA 2KWHA 3LBXA 3PDYA 2FJDA 2ZM0A 3C98B 1YQ3A 4PJNA 3NRXA 4Z90A 4EGWA 1V9DA 4WW0A 3ZEFB 2JQHA 3AEDA 5F3JA 4LMJA 3RLFF 4DV6T 3PTRB 5J1GA 1OXZA 2PG8A 4HEAA 4CQIA 3JAFA 3A8YC 1S35A 3AE4A 2E8IA 2V6YB 4I4TE 4P09A 4XZCA 5HXRA 2CRBA 2UXXB 2BS3A 2CA5A 4HFDA 2RP4A 4J2CA 3M3ZB 4U2ZA 2Y48B 1XWMA 1D1CA 3ZSSA 5FL0A 4BJMA 2YKSA 2LSGA 3KVAA 1US7B 1WYBA 4YSYA 3ZN1B 1UGOA 2CBIA 1D0ZA 3PUXF 1D0YA 3V5SA 5HXEA 4DR2T 2KLQA 4UF0A 2H7VC 3F31A 4JI8T 2XAGB 4KHPT 5JRCA 2W00A 2V7KA 3HKDE 2LSKA 3AAAB 3P4SA 4OK0A 4UEMA 4B3RT 4I0UA 2BS2A 2X51A 2CHNA 3NRYA
chains in the Genus database with same CATH topology
1I6ZA 1UK5A 5AQTB 3LDQB 5AQFB 2D9DA 3A8YC 4HWHA 5AQSB 4HWFA 3FZFB 5AQOB 3FZMB 3M3ZB 4HWCA 5AQRB 5AQVB 5AQIB 5AQLB 5AQGB 5AQUB 3FZLB 1UGOA 1M7KA 5AQNB 5AQJB 5AQKB 4HWIB 1T7SA 4HWDA 5AQPB 3FZHB 1HX1B 3FZKB 1M62A 5AQMB 5AQHB 5AQQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  1UK5 A;  5AQT B;  3LDQ B;  5AQF B;  2D9D A;  3A8Y C;  4HWH A;  5AQS B;  4HWF A;  3FZF B;  5AQO B;  3FZM B;  3M3Z B;  4HWC A;  5AQR B;  5AQV B;  5AQI B;  5AQL B;  5AQG B;  5AQU B;  3FZL B;  1UGO A;  1M7K A;  5AQN B;  5AQJ B;  5AQK B;  4HWI B;  1T7S A;  4HWD A;  5AQP B;  3FZH B;  1HX1 B;  3FZK B;  1M62 A;  5AQM B;  5AQH B;  5AQQ B; 
#chains in the Genus database with same CATH topology
 4IDQ A;  3GN5 A;  5L3G B;  4DR1 T;  2A2F X;  3R6N A;  1IAP A;  3RRC A;  1E7P A;  2LSI A;  3RYH E;  2CCQ A;  2QGS A;  1HTJ F;  3P4Q A;  4JI7 T;  4EYY R;  1E2A A;  4EXT A;  5LYJ E;  4MHC A;  1MMD A;  3PUS A;  3KDS E;  3JAE A;  2BZB A;  3P4W A;  4U72 A;  3ZPO A;  4EV6 A;  3RKG A;  4ADZ A;  4JI6 T;  1XDO A;  5CGM A;  2BG9 B;  3TLT A;  4CXW A;  1HX8 A;  2LE8 A;  4NIQ A;  1HCI A;  2QYW A;  2Z6E A;  2CMR A;  4EB6 E;  3NBX X;  3TLS A;  4CN1 A;  2HN2 A;  4H9Q C;  1VRB A;  2BKN A;  2WU2 A;  2X9W A;  4ILC A;  4ZOL E;  3VR9 A;  2R6G F;  2V7I A;  5FY0 A;  4B6X A;  4CZZ B;  4EIW A;  1J5E T;  2IIU A;  4EOZ B;  2FJA A;  2W0G A;  5AFU L;  5HXH A;  4YY3 T;  5EZY E;  1HX1 B;  3LBX B;  2L3L A;  3FZK B;  2KIN B;  1IJ6 A;  3G06 A;  4O8S A;  2E5V A;  4X20 E;  2WMN A;  4PW8 A;  4UR9 A;  3PJA J;  3ZMT B;  5FL1 A;  5J2U E;  2RPA A;  1KK7 A;  1UK5 A;  4DR5 T;  2LT3 A;  1XMO T;  4LFB T;  4X1K E;  2UXB T;  1YQ4 A;  1MND A;  3QB5 K;  5LCY A;  4YSZ A;  4ZEY A;  5LHI B;  2X67 A;  4L0R A;  4LF8 T;  2XTL A;  5L3C B;  4ZI7 E;  3UUL A;  2D2S A;  1T8B A;  4L5G A;  3AXJ B;  4K0U A;  3ZCJ A;  4HKA A;  5FY7 A;  5JDL A;  2XM2 A;  4O2A E;  2XQ9 A;  3SRZ A;  3L39 A;  4ISS A;  3CPZ A;  4JI3 T;  4HTE A;  3AA6 B;  3H3M A;  2ODU A;  3I9W A;  2UXN B;  2H7O A;  4QH5 A;  2CM0 A;  2CWY A;  4A5X A;  5JQG E;  1OED C;  2HPJ A;  3AEC A;  4QXB B;  4F6R C;  4DV3 T;  4YSX A;  3RQW A;  2HHH T;  3AVS A;  5JDM A;  4HWD A;  2MBG A;  4GK0 E;  4ASK A;  1SE7 A;  4DMV A;  4O4I E;  3NZQ A;  2WWV A;  1N34 T;  4DBR A;  3BQL A;  3PUG A;  1ZKE A;  3ZT6 A;  1FEW A;  3MXZ A;  4OX9 T;  2Q9Q B;  2V8S V;  4YFS A;  3OVU A;  4ILU A;  3RPU A;  4COF A;  2CLY C;  3ZMS B;  5IWA T;  1YXR A;  2VVS A;  4DV0 T;  3K8P C;  2MYS A;  3ZN0 B;  3GWH A;  5HEJ A;  4UV8 B;  2XAH B;  4AI6 A;  2V5D A;  4PJL A;  3EHZ A;  4CI1 B;  2J47 A;  5L2L A;  2XQ8 A;  4IE7 A;  2V26 A;  4JBW F;  4PAG A;  3TLW A;  4PK4 A;  4ZI2 D;  1HNX T;  3QC9 A;  3T8O A;  5HCJ A;  5AQI B;  4OYJ A;  5LBM A;  2IUB A;  3DTO A;  1ZOY A;  2EHO C;  3HR0 A;  4JI1 T;  1U4Q A;  3RH3 A;  5AQJ B;  4A98 A;  5BR8 T;  4OYK A;  4PFO A;  3SOL A;  1SHZ C;  2C0S A;  1HNZ T;  1UCU A;  1VCT A;  3KIN B;  3RC8 A;  3J9X 1;  2A72 A;  1E1H B;  2KZ7 B;  1M62 A;  3EI0 A;  4H9S E;  3PUZ F;  3JCF A;  4I43 B;  4AIU A;  4IE5 A;  3ZMV B;  4AQF C;  4CI2 B;  5LP6 E;  2IHR 1;  3BK9 A;  3QK6 A;  3ZMU B;  2CXF A;  3N5L A;  2XAQ B;  1NEN A;  2YN6 A;  4KBM B;  5FY1 A;  3CX6 B;  4DVD A;  2IML A;  2V6Y A;  3E08 A;  3JC6 C;  4PJM A;  2XQY A;  1UUR A;  3P8C D;  4XAX B;  1L0V A;  4TWF A;  2CBJ A;  3N2O A;  2WB5 A;  3AE3 A;  1GQE A;  2XAJ B;  2X9Y A;  2XQ5 A;  3T1Y T;  2YEV C;  4DV5 T;  2JPF A;  4DV1 T;  4QXH B;  5C3J A;  5HYA A;  3UU4 A;  4NXM T;  4TX5 A;  1M7K A;  4C91 A;  5H6R B;  4LFA T;  1OED A;  3WAK A;  2W62 A;  3CWZ B;  3CIR A;  3VRA A;  4TV8 E;  4E7S A;  5JDH A;  5KXJ A;  4LF7 T;  5JRC B;  1IJ5 A;  3O1H A;  5F8P A;  3U3I A;  3IBP A;  1D1A A;  3CQX C;  4DV7 T;  4JI0 T;  3A7M A;  5CB4 E;  4U33 A;  4L9I A;  2W66 A;  5LHH B;  2BVL A;  1YKH B;  4JLE A;  4KUM B;  2WBL A;  3AA1 B;  5FMN A;  4JI2 T;  4AQY T;  4GIW A;  1LVK A;  2JRK A;  3ETV A;  3M65 A;  5AQT B;  2LM2 A;  2Q9Q D;  4H9R C;  5LMN T;  3N9P A;  3AE8 A;  4WBN E;  2XQ3 A;  5ABF A;  2ZM6 T;  1HF8 A;  5FYM A;  2D9D A;  3H3A A;  1MIW A;  5JR9 B;  3ZC0 A;  1Z0P A;  3UU5 A;  1OWA A;  3FBL A;  4HGA A;  2G0U A;  5L3D B;  2JJ9 A;  4O4L E;  3I9Y A;  4AKH A;  4HWC A;  4KX6 A;  2JMH A;  4AXP A;  2J4G A;  4JUY A;  1FMV A;  1MIV A;  1CHU A;  2VK9 A;  1WR0 A;  2X0H A;  2ES0 A;  4H9N C;  2B1E A;  3FXD B;  4KHZ F;  4U2Y A;  4UV9 B;  4QKN A;  5AQU B;  2VKH A;  3J7Y q;  5HEG A;  3FXE B;  1WYC A;  1G73 A;  5AQP B;  4A97 A;  4U3C A;  2PTF A;  2MAW A;  2K5B B;  1Y64 B;  1KNP A;  2VWA A;  5J2T E;  2VAS A;  3JAD A;  3K1S A;  2MTQ A;  4IRE A;  5JDN A;  3RRW A;  2KSR A;  2LKG A;  3PU8 A;  4HFI A;  4B3T T;  4A56 A;  4JI4 T;  4I50 E;  3KV5 A;  2DWG A;  1MIY A;  2X0Y A;  1OED E;  3O1I A;  1NWM X;  4IHJ E;  3AE1 A;  3EDU A;  1NAF A;  2VKJ A;  4IE0 A;  5L3E B;  4LF6 T;  3KVB A;  2L8K A;  5BMV E;  3KBU A;  2YDS A;  1FMW A;  1NEK A;  4ERR A;  5CA0 E;  4MFR A;  4TV9 E;  1XZY A;  2WP9 A;  3QNU A;  2D0U A;  1N32 T;  5ETW A;  4QXC B;  2E9X B;  2LHN A;  3ESL A;  3UUM A;  3ZC1 A;  2XQ4 A;  2VL0 A;  2ZLY A;  2B76 A;  2E9X D;  2BVM A;  2P9B A;  2X9H A;  2N9D A;  3N2K E;  2WAU A;  3OKQ A;  1IBK T;  2M6I A;  2LHR A;  3BQK A;  4X1I E;  5L3B B;  4DV2 T;  4NXN T;  3CML A;  4HN9 A;  5AQK B;  2BS4 A;  2OLT A;  3PUA A;  2KXP B;  3KFW X;  3PUQ A;  3CQG B;  4ZXL A;  3ZJ1 A;  4UF0 B;  2F4V T;  5JH7 E;  3T1H T;  1XMQ T;  4IE4 A;  2DNX A;  2JQQ A;  2OA5 A;  2XZE A;  2NP9 A;  3HI2 A;  3P4R A;  3VR8 A;  4AKR B;  1XNR T;  4G2A A;  3ONL C;  4YLH A;  1DU2 A;  4TWD A;  4NUU A;  4LF9 T;  2CXL A;  3EVY A;  4YHH T;  4O2B E;  4O4H E;  3C4Z A;  4BA9 A;  5IYZ E;  3S4U A;  2BKO A;  4HFB A;  1HFA A;  2L9Q A;  3RX6 A;  4ZHQ E;  2CPT A;  2E5L T;  1WR6 A;  2KWI B;  3FBZ A;  3UQ4 A;  4IE6 A;  3N9N A;  4H63 H;  2C5I T;  4JEU B;  4EED A;  4U31 A;  5HAX A;  2VKO A;  3RGL A;  5CJ5 A;  2DL1 A;  4LML A;  5AQV B;  4YTN A;  1SUM B;  4TN7 B;  4JEH B;  5C2T A;  3KV9 A;  3LSV A;  4WBO A;  3FZL B;  2HH7 A;  2V7L A;  2XHE B;  3RKO A;  3TLU A;  2V1D B;  3ZT7 A;  4LFC T;  2N1G A;  1J1J A;  2V7M A;  2WDR A;  2VQE T;  1HG2 A;  1QLB A;  2WZI A;  2NOX A;  3UUX B;  4DO0 A;  1KNZ A;  2WU5 A;  2XJ7 A;  3VKH A;  4UVB B;  2YDR A;  1QSD A;  4V1A v;  2CE7 A;  1ZV4 X;  5AQQ B;  4EAH A;  4EZ4 A;  2MOZ A;  4NPP A;  4PJJ A;  5HEU A;  4DV4 T;  3MK7 C;  4HE8 A;  2IW5 B;  3ZKR A;  5DQV A;  4EZH A;  4YT0 A;  5AQF B;  2LJL A;  3K3Q C;  3F2E A;  5C8Y E;  2JMK A;  1KNR A;  2VUR A;  3AXJ A;  3ZYM A;  3U78 A;  5FKY A;  3PUR A;  3UU8 A;  4H9O C;  1T98 A;  4HWF A;  3AE2 A;  4P0B A;  5GON E;  3MA9 A;  3FZF B;  3CVR A;  4X1Y E;  3FZM B;  2YK0 A;  4U7Y A;  4P1N A;  3L8R A;  4YTM A;  2BDE A;  2XSA A;  2E2A A;  2JQ9 A;  2KT9 A;  5AQR B;  4ZZB A;  3AE5 A;  3FB2 A;  5FXX A;  2DHR A;  4BJN A;  3AA0 B;  4ZI3 D;  3WAJ A;  5AQL B;  4LF4 T;  2J1D G;  2DLR A;  2BG9 C;  4CN4 A;  4TWH A;  3VKG A;  2EHO A;  3O9X A;  2Y6X A;  3EDV A;  5JDQ A;  3SFD A;  3UFE A;  3ZST A;  1Z8U A;  2AE9 A;  2WDV A;  1T7S A;  1N36 T;  1R8I A;  4H9P C;  4LF5 T;  3O1J A;  4KI0 F;  2H3R A;  2Q9Q C;  3GA8 A;  5AQH B;  4QH4 A;  2CXD A;  2KND A;  3I1A A;  3SS1 A;  1BR4 A;  3UUB A;  5FXW A;  3NZP A;  3ZJ2 A;  5JTG A;  2UUA T;  3PV0 F;  4FJO A;  4CN6 A;  3KV6 A;  4IGU A;  4IT4 A;  2NW7 A;  3LK4 2;  2LEH A;  2LLY A;  2PJQ A;  3H37 A;  4U74 A;  4AIS A;  1FIO A;  4HFE A;  2X0L B;  5HCM A;  5DAB A;  5LOV E;  3C51 A;  5ADX L;  4LMK A;  3ETU A;  2NW9 A;  2OV9 A;  4G63 A;  5LHG B;  2BG9 A;  3UU3 A;  2A3D A;  2K48 A;  2ZM8 A;  3A5X A;  4TNW A;  2JQK A;  2XY8 B;  3QOF A;  2CEA A;  3AEA A;  1W0A A;  5EK2 A;  1UUS A;  2X9X A;  3RIU C;  3UFG A;  4XBF B;  4MAL A;  5JDF A;  4X62 T;  3E22 E;  2XPK A;  4GYR A;  5FVL A;  4UVC B;  1LVF A;  4ILA A;  2WDQ A;  1YW0 A;  2CWO A;  4GKJ T;  1KF6 A;  5F5W A;  2BG9 E;  3HL6 A;  1FJG T;  5FVK A;  4ZS3 A;  3B5M A;  4HFC A;  3P50 A;  3AEB A;  1N33 T;  5EK3 A;  3N9Q A;  4ZS2 A;  3LDQ B;  2W61 A;  3RI5 A;  1HR0 T;  1W09 A;  5L4H A;  3DJB A;  3FHN A;  4IIJ E;  2LSJ A;  2NR4 A;  3HKB E;  4Z91 A;  2LSY A;  2FJE A;  2WM9 A;  3ANW B;  3LFM A;  1BR1 A;  2W67 A;  4NUV A;  3K3O A;  4X5T A;  4ZI3 C;  2BBH A;  2HPL A;  1IBL T;  1EZ3 A;  4MLK A;  3UTK A;  2QVA A;  5L47 A;  1KEY A;  4CI3 B;  3B13 A;  2LM9 A;  4X64 T;  3V5U A;  4ZZC A;  5JVD E;  3RIA A;  2LOS A;  4P0A A;  1WFD A;  2V5C A;  1T72 A;  4GYS A;  2EHO B;  4DND A;  3PE0 A;  4YJ3 E;  5L3F B;  3RC3 A;  4DUZ T;  2UUB T;  2DWK A;  2XAF B;  3C4W A;  3QUJ A;  3PUW F;  3ZYK A;  3LK3 B;  4X66 T;  2LRK A;  2JIW A;  1XDP A;  5J0Z A;  4DR7 T;  1ZP0 A;  4ILB A;  2FUP A;  4B3M T;  3MKD A;  3KV4 A;  4AKL A;  5L4E A;  3UQ7 A;  4HFV A;  4IDZ A;  3HKE E;  3RYI E;  2BKP A;  1U5P A;  2X66 A;  4X65 T;  3L09 A;  2N2N A;  1VOM A;  4IDO A;  4YHJ A;  5FP3 A;  3W15 B;  3X1D A;  5AQS B;  5ABF B;  4TNV A;  1XNQ T;  2LRL A;  3IHR A;  1UX5 A;  2DCF A;  4M1P A;  5AQO B;  5JR9 A;  1MMN A;  3RIF A;  4CXX A;  1BR0 A;  3I0Q A;  2ZM2 A;  2PBI A;  5HWY A;  2YDQ A;  1QUU A;  4WYV A;  4FI5 A;  3ONX A;  2XSB A;  5JRE A;  3VRB A;  2SPC A;  1YD8 G;  5JDG A;  4U7I A;  2WQY A;  5HEO A;  5HEH A;  4HWI B;  2UXD T;  1MMA A;  2XUE A;  3IA3 A;  3ABV A;  4IDN A;  4OHF A;  1HG5 A;  2HN1 A;  2WCA A;  1I94 T;  2C5J A;  3RF1 A;  1WRD A;  3AEG A;  5E0O A;  1H7C A;  5LNK A;  2CLY B;  4UEL A;  3RHW A;  1W9R A;  4WZX A;  5LGU B;  4DR3 T;  4JYA T;  4AKG A;  2A9U A;  4QX7 B;  1HNW T;  3NKZ A;  2UXC T;  1IZN B;  3AAE B;  3BQI A;  4DR4 T;  3CKD A;  4GKK T;  2I59 A;  2WWU A;  3ANW A;  3PJA A;  3Q5X A;  3R84 B;  2VB6 A;  5FNV E;  4DID B;  3N9O A;  4E7Z A;  4PK6 A;  4YXD A;  2E9X C;  2I0M A;  2VQF T;  4KP3 C;  3AA7 B;  2W4X A;  2WS3 A;  2UU9 T;  2V6X A;  4AQG A;  2J62 A;  3CQC B;  3ZLI A;  2NW8 A;  2ACZ A;  2FJB A;  1O3X A;  3EAB A;  2DI4 A;  5AQN B;  5CA1 E;  1ZEE A;  2XQA A;  2RA1 A;  1KFY A;  1OED B;  4I55 E;  1JNR A;  5FXV A;  3OTO T;  3FZH B;  4AKI A;  2LKH A;  4F8H A;  5LMU T;  2D0T A;  1AJ3 A;  2XQ7 A;  2Q9Q A;  2NTX A;  4B3S T;  3OPC A;  2H88 A;  3UT5 E;  4QH1 A;  5IUX A;  4DUY T;  5ABE A;  2WZH A;  5IHY A;  1CUN A;  2QRX A;  2D5U A;  3RYC E;  4GOU A;  4QHO A;  1BR2 A;  3GN5 B;  4TUY E;  2Y8D A;  5HXS A;  3QB5 A;  4EYU A;  1VCS A;  3DP7 A;  3PUV F;  4PFP A;  4DMW A;  1MMG A;  1UX4 A;  2WSS V;  1ZHC A;  3NWI A;  4HWH A;  4ANJ A;  5KDM C;  1JNZ A;  2LOP A;  3L3P A;  5LB7 B;  2IDO B;  3WI3 A;  3PU3 A;  5KX5 E;  1D0X A;  4N78 D;  4GK5 E;  1IBM T;  3HKC E;  4UXN B;  2ACX A;  2K24 A;  3KBT A;  4O4J E;  4BAY B;  3AE7 A;  2XM1 A;  4UIG A;  5AQG B;  5LG3 A;  3N2G E;  5HWX A;  5LG4 A;  3EUH A;  3UU6 A;  2C5K T;  3ZMZ B;  3C50 A;  5ABH A;  2WY2 A;  3RIU A;  5FXZ A;  4H63 V;  2CHO A;  3OYZ A;  3P7I A;  3RYF E;  3NVO A;  3LJC A;  5M4Y A;  2XQ6 A;  3D0T A;  2MPK A;  3E0Z A;  5LA6 E;  5DJQ C;  2I6H A;  2YOE A;  4YJ2 E;  1X9B A;  5LJN A;  2FBW A;  5AQM B;  3MAC A;  4Q25 A;  4AQF A;  3AE6 A;  2WMO A;  2UUC T;  5CFB A;  1I6Z A;  4IDP A;  3N9M A;  2NWB A;  5HXC A;  3IF8 B;  3K3N A;  3OBV E;  1J5W A;  1S94 A;  2AXD S;  2GK9 A;  2VVN A;  2ZMA A;  3AEE A;  4YTP A;  2KMF A;  5LJM A;  3TKL B;  4JV5 T;  3EAM A;  5LBQ B;  3ZT5 A;  5LGN B;  1WCR A;  2E9X A;  2IC9 A;  3CK6 A;  3CX8 B;  2IC6 A;  3Q2M A;  3SWH A;  3ZYL A;  2M6B A;  3Q5D A;  5DQW A;  2YIN A;  3MZK B;  3P4P A;  2K3W A;  1W0B A;  2BBJ A;  2XAS B;  3PUY F;  1WLX A;  5ABG A;  3IEE A;  2W2U A;  3Q5E A;  2V7J A;  1HS7 A;  3LG7 A;  1MNE A;  4WNK A;  4K0K T;  3F57 A;  3GMI A;  3N9L A;  2YU2 A;  3VU7 H;  2QA7 A;  4KMC A;  4CXY A;  4HFH A;  3AE9 A;  3LK2 B;  1YKE B;  4IST A;  2YU1 A;  3C4X A;  3AAI A;  1G8X A;  1X79 A;  3Q5W A;  3O4X E;  3UUN A;  3MJX A;  3TLV A;  4IL9 A;  4PNI A;  4QWN B;  3ZCI A;  4JI5 T;  1D1B A;  3HA4 A;  2W63 A;  3OJA A;  4QX8 B;  5LGT B;  3CX7 B;  1Y01 A;  4EEB A;  5TAO A;  2EHO D;  5LXT E;  3SFE A;  4ZI2 C;  3AEF A;  2NTY A;  3I0O A;  4Z8X A;  2ODV A;  3C64 A;  4UVA B;  5JR9 C;  5A1L A;  3OYX A;  3RQU A;  3AB3 B;  1LRZ A;  4C90 A;  4DBQ A;  2IAK A;  3VHL A;  4TZ4 C;  5KMG P;  2M67 A;  3AVR A;  4IL4 A;  2X68 A;  4PK5 A;  5EK4 A;  2K9A A;  2PFV A;  2VKD A;  1LKX A;  2VL8 A;  3ONJ A;  4MBQ A;  1B7T A;  1SA0 E;  2H89 A;  3JC6 D;  3Q9D A;  5H6Q B;  3B57 A;  4DR6 T;  4OFZ A;  2KWH A;  3LBX A;  3PDY A;  2FJD A;  2ZM0 A;  3C98 B;  1YQ3 A;  4PJN A;  3NRX A;  4Z90 A;  4EGW A;  1V9D A;  4WW0 A;  3ZEF B;  2JQH A;  3AED A;  5F3J A;  4LMJ A;  3RLF F;  4DV6 T;  3PTR B;  5J1G A;  1OXZ A;  2PG8 A;  4HEA A;  4CQI A;  3JAF A;  3A8Y C;  1S35 A;  3AE4 A;  2E8I A;  2V6Y B;  4I4T E;  4P09 A;  4XZC A;  5HXR A;  2CRB A;  2UXX B;  2BS3 A;  2CA5 A;  4HFD A;  2RP4 A;  4J2C A;  3M3Z B;  4U2Z A;  2Y48 B;  1XWM A;  1D1C A;  3ZSS A;  5FL0 A;  4BJM A;  2YKS A;  2LSG A;  3KVA A;  1US7 B;  1WYB A;  4YSY A;  3ZN1 B;  1UGO A;  2CBI A;  1D0Z A;  3PUX F;  1D0Y A;  3V5S A;  5HXE A;  4DR2 T;  2KLQ A;  4UF0 A;  2H7V C;  3F31 A;  4JI8 T;  2XAG B;  4KHP T;  5JRC A;  2W00 A;  2V7K A;  3HKD E;  2LSK A;  3AAA B;  3P4S A;  4OK0 A;  4UEM A;  4B3R T;  4I0U A;  2BS2 A;  2X51 A;  2CHN A;  3NRY A; 
#chains in the Genus database with same CATH homology
 1I6Z A;  1UK5 A;  5AQT B;  3LDQ B;  5AQF B;  2D9D A;  3A8Y C;  4HWH A;  5AQS B;  4HWF A;  3FZF B;  5AQO B;  3FZM B;  3M3Z B;  4HWC A;  5AQR B;  5AQV B;  5AQI B;  5AQL B;  5AQG B;  5AQU B;  3FZL B;  1UGO A;  1M7K A;  5AQN B;  5AQJ B;  5AQK B;  4HWI B;  1T7S A;  4HWD A;  5AQP B;  3FZH B;  1HX1 B;  3FZK B;  1M62 A;  5AQM B;  5AQH B;  5AQQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...