1M7KA

Solution structure of the sodd bag domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Silencer of Death Domains
publication title The solution structure of the SODD BAG domain reveals additional electrostatic interactions in the HSP70 complexes of SODD subfamily BAG domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m7kA00
1UGOA 3LDQB 5AQIB 5AQGB 5AQKB 1T7SA 5AQMB 5AQFB 5AQNB 5AQPB 5AQHB 1UK5A 5AQQB 1M7KA 1M62A 4HWDA 4HWHA 3FZMB 5AQJB 1I6ZA 4HWFA 5AQUB 5AQVB 2D9DA 3FZHB 4HWIB 4HWCA 3M3ZB 5AQSB 5AQLB 5AQTB 1HX1B 5AQRB 3FZLB 3FZKB 5AQOB 3FZFB 3A8YC
chains in the Genus database with same CATH superfamily
2LRLA 4JI8T 4OYJA 4UVAB 3JCFA 4ILCA 2CBJA 2YN6A 3IF8B 2QVAA 1M62A 3EVYA 2KNDA 4Z91A 4HGAA 5ABFA 3IHRA 2XQ3A 4H9PC 2YEVC 3C98B 2C0SA 2HN2A 2MTQA 4UV8B 4EZ4A 2BKNA 2PFVA 3UUXB 5ABFB 5LJMA 5AQHB 2KZ7B 4XZCA 3VR9A 3Q5EA 5J1GA 2XAFB 4GIWA 2UXCT 3N9LA 3RQWA 1N34T 2WDRA 4YTPA 5C3JA 2YKSA 4LF8T 2XHEB 3ETVA 3NBXX 2CHNA 3CX8B 4KI0F 1OEDC 4AQYT 4LFCT 2D5UA 4LF7T 4DR6T 2MBGA 1HNZT 1VCSA 3KV6A 3AEDA 4PW8A 2C5KT 2N1GA 2IAKA 2IDOB 2G0UA 3RPUA 2W66A 3B13A 4P0AA 1KFYA 4F8HA 1WCRA 3ZT6A 5FL1A 3AEAA 3H37A 2CXDA 4YTNA 1U4QA 5JDMA 3TLWA 4KUMB 1I6ZA 2QYWA 3JAFA 2XASB 2RPAA 4G63A 2X67A 1YD8G 2XQ4A 3GMIA 1KEYA 3HL6A 3OKQA 4ZI7E 2VKHA 3PTRB 4PFOA 4YJ3E 1J5ET 5ABGA 2RP4A 4U2YA 3KDSE 2YOEA 2A3DA 2XQ6A 2KLQA 2M6BA 4U3CA 2BG9C 3LK3B 4QH5A 3ZMVB 3RGLA 4F6RC 4CN6A 1FMWA 3N9NA 4DUYT 3F2EA 4PNIA 2BDEA 2JIWA 5LMUT 2LKGA 2FBWA 2K48A 2NW8A 4Q25A 3AE6A 1MIYA 2WU2A 3KV4A 3RIUA 3UU6A 2M6IA 5JR9A 4DR7T 4IDPA 3N2GE 3PV0F 3FB2A 3ZYLA 2PTFA 2MPKA 2ZMAA 2V5DA 2XQYA 2XAJB 2LRKA 2XAQB 4K0KT 4I43B 2DWKA 3KVAA 4IL9A 3SOLA 1N33T 3RI5A 3PUZF 2KXPB 3RHWA 5DJQC 3H3MA 4DR4T 2XAHB 3MKDA 5L3CB 3TLTA 2XQ5A 4IE0A 1BR1A 3K8PC 2WQYA 3R6NA 2ES0A 2CXLA 3OPCA 2GK9A 2LM2A 1S35A 1X79A 2JQQA 4PFPA 4XBFB 3ESLA 3SS1A 2DHRA 3PU3A 4O4IE 3V5SA 4Z8XA 1WR0A 4TWDA 4A5XA 2KT9A 4X1YE 2QA7A 2VB6A 4PJNA 2HH7A 3C50A 4H63V 2NW7A 2B1EA 3OYZA 4OHFA 4IREA 3ZN1B 2V5CA 4C90A 3DJBA 3LK42 4H63H 2HN1A 1WYCA 4ZI3C 3CK6A 1KF6A 1W0BA 1WR6A 4MFRA 1SE7A 2WZHA 2KMFA 2IUBA 4HWDA 4OYKA 2UUAT 4MBQA 1E2AA 3AAAB 4KBMB 3ZMZB 2V7KA 2Q9QA 3RYIE 4WNKA 3SRZA 4EZHA 4DV2T 4TZ4C 3IBPA 3Q5WA 4UIGA 2WB5A 4ZZBA 2XJ7A 2Q9QB 2E9XD 5M4YA 3O1IA 4HFBA 1ZOYA 4CI1B 2XM2A 3UUNA 5AQOB 3I0OA 3NKZA 2WZIA 4IDOA 4QH4A 3N5LA 4LFAT 4CXWA 4AXPA 4JI2T 3ZMTB 3T1HT 4WW0A 2CWYA 4COFA 3PJAJ 3P4SA 3CPZA 2MAWA 1Y64B 2H89A 3PUVF 4UVCB 5L3EB 4JI0T 2W61A 5AQFB 5L3FB 4C91A 3L09A 5HEOA 3OTOT 4IDNA 4J2CA 2NWBA 3RIUC 3QB5A 4EB6E 1S94A 4YY3T 4AQFA 3FBZA 4YSYA 3ETUA 5AQIB 1MMGA 5LHHB 5JDGA 1XNQT 3L39A 1W09A 2KINB 3Q5XA 3RC3A 4DNDA 4BA9A 1MNEA 5EZYE 1OEDA 3LSVA 5FXXA 3WAJA 1G8XA 4DR1T 4H9RC 2IW5B 4GKKT 3LDQB 5CA1E 5FXWA 1MIVA 3I0QA 3VRAA 4JI4T 1XZYA 2LOSA 4JEHB 4X5TA 2OV9A 2F4VT 2FJAA 5HEUA 3SWHA 3AA0B 2CBIA 2MOZA 4ILAA 1ZKEA 4U7YA 5C8YE 2YINA 2WCAA 1UK5A 5JDNA 3B57A 2LE8A 3CX7B 4UR9A 2LOPA 4NIQA 2AXDS 5AQTB 4JI1T 3T8OA 1HX1B 4ZS2A 3DTOA 4O2BE 3KV5A 2QRXA 4WYVA 2IC9A 5IYZE 3RKOA 1KNPA 2VKOA 4BAYB 2NOXA 4UF0A 3HKEE 2XAGB 2BVLA 2K9AA 4DMVA 3EUHA 3UT5E 2BG9A 3RKGA 5LGTB 4IE6A 5LGUB 1UGOA 4CQIA 3AA6B 4AKIA 1JNRA 2UU9T 2BG9B 2L8KA 4DVDA 2DL1A 2QGSA 5FVLA 4UELA 1MMDA 2V7IA 3K1SA 2Q9QC 4DBRA 4KHPT 4IIJE 3LBXA 2CHOA 3UU3A 1G73A 3QB5K 3AVSA 1N32T 4JI5T 4LMKA 3E22E 2VURA 2DNXA 3UFGA 3LBXB 4AISA 3VHLA 3FZLB 2E2AA 4HKAA 5H6QB 4AKHA 5EK3A 3CIRA 5L3GB 1HG2A 1VRBA 2WBLA 2V1DB 4KMCA 3JAEA 5KDMC 3NVOA 2DWGA 1IBLT 5BMVE 2V6YB 4IDZA 5JH7E 5LG3A 3UULA 1MIWA 2X9XA 2L3LA 2XPKA 4CZZB 3LG7A 3LK2B 4LF9T 3PUWF 3DP7A 5AQUB 4DR3T 3AE2A 5HWYA 4AQFC 3PURA 4YJ2E 3UFEA 3RX6A 2C5IT 5L47A 4TX5A 3P4RA 3ZSTA 3VU7H 4DV1T 1LRZA 4NXNT 3AB3B 4ASKA 3P7IA 2UXBT 1KNZA 3KFWX 4DV7T 1XMQT 4P0BA 4HFCA 4BJMA 1OWAA 3O1HA 1WFDA 4KP3C 4FJOA 2DCFA 1ZHCA 3UQ7A 2VWAA 3JC6D 4UEMA 2WM9A 4L9IA 5LB7B 2J1DG 4CI3B 3AE4A 2WAUA 4HEAA 1N36T 4B3TT 2VL8A 3AE8A 1T7SA 3AA7B 3G06A 3CKDA 3AA1B 4UV9B 2OLTA 5H6RB 5ETWA 3RIAA 3U78A 1D0YA 3ONXA 3FXDB 3SFDA 2KSRA 2ZM2A 4U2ZA 4CXYA 2XQAA 3CVRA 4LMJA 3UQ4A 1ZP0A 2D0UA 2YDRA 3C4XA 3L3PA 2LSKA 5HAXA 5FKYA 3CMLA 2JQKA 4E7SA 5L4HA 3RLFF 3M65A 5FYMA 4PJMA 3EDVA 5HXHA 5AQKB 1ZV4X 2LHRA 3S4UA 2X9WA 4YSXA 5A1LA 1VCTA 4QX7B 3P4PA 4WZXA 4B3RT 4ERRA 3PUQA 3NZQA 2LLYA 1GQEA 3AEGA 4V1Av 4E7ZA 2Y8DA 4YLHA 3N2KE 3EAMA 2JPFA 1CHUA 2JRKA 2X0HA 3EDUA 3ZT5A 2HPJA 1MMNA 2X68A 1IZNB 3FZHB 3HKDE 3ZYKA 2UXNB 3MA9A 3ZSSA 2W67A 2FJBA 4A97A 3EI0A 3CWZB 3N9MA 4NUVA 4DMWA 3ZN0B 4B6XA 3HKCE 2J62A 3TLUA 4CXXA 4HWHA 4O8SA 2CPTA 2KWHA 3P4WA 1QLBA 2VKDA 4OFZA 3UU4A 3JC6C 2BS3A 2LSJA 3RH3A 3OVUA 4H9NC 3CQCB 2LT3A 5AQNB 3B5MA 5HXCA 2V6XA 3J7Yq 4HTEA 4JI7T 4QH1A 3UU5A 4I50E 3ZYMA 4U31A 3C4WA 2E5VA 3BQKA 3O1JA 3AEBA 2LKHA 2E9XA 1FJGT 2MYSA 3NWIA 1LVFA 1ZEEA 4P09A 1NAFA 5IUXA 2E9XB 5ADXL 5DQWA 3VKHA 2VKJA 4IDQA 2LSYA 5KX5E 4ZZCA 2VQET 5LOVE 3JADA 2WWUA 2X66A 3ZLIA 1LVKA 4U74A 1WLXA 2E5LT 4HWFA 2J47A 2D9DA 5LCYA 2A72A 4ISTA 2JQ9A 2ACZA 1MNDA 1HS7A 4H9OC 3CQXC 3FZFB 2CA5A 5JDQA 1H7CA 2W62A 3EHZA 1CUNA 4EOZB 1KNRA 1OEDE 5JTGA 2CWOA 3R84B 5DABA 5DQVA 5FMNA 2PBIA 2V7MA 2IHR1 2X9HA 4YTMA 3AE1A 5LG4A 2EHOD 4I55E 2ACXA 4EAHA 3K3OA 2CXFA 2YU2A 4HE8A 2AE9A 3HI2A 2WU5A 4A98A 3EABA 2NW9A 4XAXB 3FXEB 2RA1A 3D0TA 5LNKA 3PUSA 4HFIA 1WRDA 2WSSV 5AQGB 3AE9A 1W9RA 5LBQB 5FY0A 1IBKT 1VOMA 3P50A 1V9DA 1KK7A 4TV9E 4ZHQE 1D0XA 3SFEA 1FEWA 2H88A 5CGMA 2YK0A 4X20E 2M67A 1YXRA 3ZMUB 4B3ST 5LGNB 3ZJ2A 3ABVA 3KVBA 5L2LA 2BG9E 3OJAA 4IGUA 4ILUA 1NWMX 2XY8B 2PG8A 5JDHA 4PJJA 3M3ZB 4YFSA 1R8IA 1T72A 2YDSA 2XQ9A 1JNZA 1MMAA 4ISSA 1AJ3A 5HEGA 3AVRA 2WDVA 3E08A 4FI5A 4O4HE 4PAGA 4PK6A 2WMNA 1HF8A 4DBQA 5AQRB 3P4QA 4DV6T 4IHJE 2I0MA 2E8IA 1YKEB 3UU8A 2X0LB 4AKLA 3AE7A 5F8PA 3NRYA 2WY2A 4QWNB 4WBNE 2A2FX 4DR2T 1NEKA 3GWHA 3ZKRA 3J9X1 2LSGA 3KBTA 2H7OA 4HN9A 4LMLA 4CN1A 3X1DA 3AAEB 5KXJA 3GA8A 2E9XC 3ZCJA 3RYCE 2LM9A 5FXVA 3NZPA 3V5UA 3K3QC 3ZMSB 4PJLA 3PUAA 2NP9A 4EYUA 5AQJB 3HKBE 5ABHA 2UXXB 3I1AA 3MXZA 3Q5DA 5FL0A 5LXTE 2KWIB 1T98A 4YHJA 1D1BA 2CM0A 2WP9A 3GN5B 3N2OA 2IC6A 4TNWA 1EZ3A 3TLSA 5HXSA 1UURA 4A56A 2CE7A 2DLRA 3RQUA 2N2NA 2VL0A 4HFVA 3K3NA 5FY7A 3FZKB 1FMVA 3UTKA 4MLKA 2V6YA 5ABEA 4DV5T 2BBJA 3PUGA 1BR4A 5FVKA 1HR0T 3QK6A 4YHHT 3AEFA 5FY1A 3PUYF 4GYSA 5JDFA 3ZC0A 3HR0A 2CCQA 3C51A 4I4TE 2W0GA 4TNVA 4Z90A 2SPCA 3QUJA 3VRBA 2VVSA 3UUMA 4G2AA 5AQVB 4PK5A 1U5PA 3PU8A 4TUYE 1HNXT 4OX9T 2W63A 5AQLB 2Z6EA 5CB4E 1LKXA 3TKLB 5HEHA 2ZM8A 3H3AA 5J0ZA 4AKGA 2ZLYA 5AQQB 3ANWA 4ZOLE 3MJXA 4O4LE 3A5XA 3RRCA 4EEBA 5EK4A 3ZC1A 4QX8B 5JVDE 4X65T 4LF4T 2LEHA 2XTLA 3ANWB 3ZCIA 4U33A 2YU1A 1Y01A 3RYFE 4TWHA 4HFHA 2CMRA 2L9QA 3P8CD 4EIWA 4DV4T 2H3RA 3MACA 2Y6XA 5KMGP 1UX5A 1SUMB 4ILBA 2H7VC 3PE0A 4HFDA 2XQ7A 4ZI2D 3F57A 1SHZC 3AEEA 2P9BA 4TWFA 5FNVE 3I9WA 4IE4A 5HWXA 5AQPB 2FJDA 4U7IA 4ZI3D 2K3WA 2JQHA 3FZMB 2JMHA 2I6HA 4X1IE 2CLYB 4I0UA 3ZEFB 2PJQA 5E0OA 3FBLA 5HXEA 3KBUA 2DI4A 1B7TA 2V7JA 2W4XA 4PK4A 2I59A 4U72A 4CI2B 3BQIA 1O3XA 2XUEA 3IA3A 5JREA 3W15B 1YKHB 1D0ZA 4L0RA 5F3JA 3AAIA 1BR2A 2IMLA 3Q2MA 3MK7C 5HYAA 1IAPA 3LJCA 5FP3A 1HTJF 4AKRB 4O2AE 4ZXLA 4BJNA 2Y48B 4X64T 2BKPA 5LBMA 1XDOA 5LA6E 2J4GA 2BBHA 5LP6E 2XQ8A 2C5JA 1XWMA 2LSIA 5JR9B 4WBOA 5L3DB 4LF6T 5EK2A 4YXDA 4GYRA 1W0AA 4HWCA 1D1CA 5L4EA 3AE5A 4AIUA 3E0ZA 3ZT7A 4GKJT 1FIOA 4TN7B 3TLVA 4ZEYA 1J5WA 4AQGA 2X0YA 5LHIB 1WYBA 4MALA 3Q9DA 1X9BA 3WAKA 1QUUA 2D0TA 1QSDA 1IBMT 3FHNA 1I94T 2VK9A 3U3IA 3C64A 3OYXA 4M1PA 3AECA 5TAOA 3O4XE 2UXDT 1IJ6A 3PJAA 1T8BA 4ANJA 5HXRA 4EXTA 2NTYA 3RF1A 5BR8T 4ZI2C 2BS4A 5AQMB 3AE3A 1US7B 3RYHE 4TV8E 2HHHT 3PDYA 4GK0E 1Z0PA 4UXNB 4HWIB 1YQ4A 4CN4A 4NXMT 4ZS3A 2VQFT 2JMKA 4P1NA 2W2UA 3N9OA 2FUPA 2VASA 3L8RA 3VR8A 1E7PA 1HNWT 4DUZT 2W00A 4JUYA 4KX6A 4EYYR 2EHOA 3LFMA 4NUUA 4DR5T 3AXJA 4NPPA 2V8SV 3N9QA 2K24A 1YQ3A 3BK9A 2CLYC 2EHOB 4JV5T 3AXJB 2V26A 2LJLA 1NENA 1XDPA 2HPLA 1Z8UA 2V7LA 4ADZA 3MZKB 5IWAT 4N78D 3C4ZA 4H9QC 4DV3T 4O4JE 3UUBA 2NR4A 4DV0T 1XNRT 3RRWA 1OXZA 3KINB 2WWVA 4KHZF 4IE5A 2Q9QD 2ZM6T 4DIDB 5F5WA 2VVNA 1SA0E 3CX6B 4EV6A 1UUSA 5HCMA 1BR0A 4X62T 4EGWA 5LYJE 4AI6A 2X51A 1HFAA 3F31A 5HCJA 5JDLA 2D2SA 5L3BB 1M7KA 2NTXA 5LMNT 4QXBB 4IE7A 4X1KE 2FJEA 3QOFA 5JR9C 3QC9A 4DO0A 2LHNA 4QXHB 3HA4A 5CFBA 4K0UA 4IT4A 2BS2A 5AFUL 1DU2A 2A9UA 5LJNA 4B3MT 3IEEA 5FXZA 4EEDA 4QXCB 3I9YA 3A7MA 2X9YA 4UVBB 2ZM0A 3OBVE 4JEUB 3VKGA 4QKNA 5LHGB 4JYAT 1OEDB 4X66T 3ONLC 2YDQA 3PUXF 2B76A 4L5GA 1E1HB 1D1AA 3RIFA 2UUBT 5J2TE 3NRXA 2R6GF 5JQGE 4GOUA 2WDQA 3O9XA 4MHCA 2XZEA 1HG5A 2XSAA 2XSBA 2ODUA 2WMOA 4YSZA 3ZPOA 4H9SE 4JI3T 4YT0A 3N9PA 4QHOA 2UUCT 1L0VA 2CEAA 3BQLA 2ODVA 4JI6T 4HFEA 2BZBA 2BVMA 2OA5A 5GONE 5CA0E 3ONJA 3WI3A 2JJ9A 1HX8A 4UF0B 5AQSB 3GN5A 5JRCA 1UCUA 1YW0A 4OK0A 4IL4A 4JLEA 4GK5E 4JBWF 5HEJA 1HCIA 2CRBA 2XM1A 2EHOC 5JRCB 5CJ5A 4LFBT 3T1YT 4LF5T 3RC8A 5C2TA 5J2UE 5IHYA 3A8YC 3ZJ1A 2IIUA 3CQGB 3KV9A 1IJ5A 1UX4A 2BKOA 1J1JA 3QNUA 2K5BB 2N9DA 1XMOT 2WS3A
chains in the Genus database with same CATH topology
1UGOA 3LDQB 5AQIB 5AQGB 5AQKB 1T7SA 5AQMB 5AQFB 5AQNB 5AQPB 5AQHB 1UK5A 5AQQB 1M7KA 1M62A 4HWDA 4HWHA 3FZMB 5AQJB 1I6ZA 4HWFA 5AQUB 5AQVB 2D9DA 3FZHB 4HWIB 4HWCA 3M3ZB 5AQSB 5AQLB 5AQTB 1HX1B 5AQRB 3FZLB 3FZKB 5AQOB 3FZFB 3A8YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGO A;  3LDQ B;  5AQI B;  5AQG B;  5AQK B;  1T7S A;  5AQM B;  5AQF B;  5AQN B;  5AQP B;  5AQH B;  1UK5 A;  5AQQ B;  1M7K A;  1M62 A;  4HWD A;  4HWH A;  3FZM B;  5AQJ B;  1I6Z A;  4HWF A;  5AQU B;  5AQV B;  2D9D A;  3FZH B;  4HWI B;  4HWC A;  3M3Z B;  5AQS B;  5AQL B;  5AQT B;  1HX1 B;  5AQR B;  3FZL B;  3FZK B;  5AQO B;  3FZF B;  3A8Y C; 
#chains in the Genus database with same CATH topology
 2LRL A;  4JI8 T;  4OYJ A;  4UVA B;  3JCF A;  4ILC A;  2CBJ A;  2YN6 A;  3IF8 B;  2QVA A;  1M62 A;  3EVY A;  2KND A;  4Z91 A;  4HGA A;  5ABF A;  3IHR A;  2XQ3 A;  4H9P C;  2YEV C;  3C98 B;  2C0S A;  2HN2 A;  2MTQ A;  4UV8 B;  4EZ4 A;  2BKN A;  2PFV A;  3UUX B;  5ABF B;  5LJM A;  5AQH B;  2KZ7 B;  4XZC A;  3VR9 A;  3Q5E A;  5J1G A;  2XAF B;  4GIW A;  2UXC T;  3N9L A;  3RQW A;  1N34 T;  2WDR A;  4YTP A;  5C3J A;  2YKS A;  4LF8 T;  2XHE B;  3ETV A;  3NBX X;  2CHN A;  3CX8 B;  4KI0 F;  1OED C;  4AQY T;  4LFC T;  2D5U A;  4LF7 T;  4DR6 T;  2MBG A;  1HNZ T;  1VCS A;  3KV6 A;  3AED A;  4PW8 A;  2C5K T;  2N1G A;  2IAK A;  2IDO B;  2G0U A;  3RPU A;  2W66 A;  3B13 A;  4P0A A;  1KFY A;  4F8H A;  1WCR A;  3ZT6 A;  5FL1 A;  3AEA A;  3H37 A;  2CXD A;  4YTN A;  1U4Q A;  5JDM A;  3TLW A;  4KUM B;  1I6Z A;  2QYW A;  3JAF A;  2XAS B;  2RPA A;  4G63 A;  2X67 A;  1YD8 G;  2XQ4 A;  3GMI A;  1KEY A;  3HL6 A;  3OKQ A;  4ZI7 E;  2VKH A;  3PTR B;  4PFO A;  4YJ3 E;  1J5E T;  5ABG A;  2RP4 A;  4U2Y A;  3KDS E;  2YOE A;  2A3D A;  2XQ6 A;  2KLQ A;  2M6B A;  4U3C A;  2BG9 C;  3LK3 B;  4QH5 A;  3ZMV B;  3RGL A;  4F6R C;  4CN6 A;  1FMW A;  3N9N A;  4DUY T;  3F2E A;  4PNI A;  2BDE A;  2JIW A;  5LMU T;  2LKG A;  2FBW A;  2K48 A;  2NW8 A;  4Q25 A;  3AE6 A;  1MIY A;  2WU2 A;  3KV4 A;  3RIU A;  3UU6 A;  2M6I A;  5JR9 A;  4DR7 T;  4IDP A;  3N2G E;  3PV0 F;  3FB2 A;  3ZYL A;  2PTF A;  2MPK A;  2ZMA A;  2V5D A;  2XQY A;  2XAJ B;  2LRK A;  2XAQ B;  4K0K T;  4I43 B;  2DWK A;  3KVA A;  4IL9 A;  3SOL A;  1N33 T;  3RI5 A;  3PUZ F;  2KXP B;  3RHW A;  5DJQ C;  3H3M A;  4DR4 T;  2XAH B;  3MKD A;  5L3C B;  3TLT A;  2XQ5 A;  4IE0 A;  1BR1 A;  3K8P C;  2WQY A;  3R6N A;  2ES0 A;  2CXL A;  3OPC A;  2GK9 A;  2LM2 A;  1S35 A;  1X79 A;  2JQQ A;  4PFP A;  4XBF B;  3ESL A;  3SS1 A;  2DHR A;  3PU3 A;  4O4I E;  3V5S A;  4Z8X A;  1WR0 A;  4TWD A;  4A5X A;  2KT9 A;  4X1Y E;  2QA7 A;  2VB6 A;  4PJN A;  2HH7 A;  3C50 A;  4H63 V;  2NW7 A;  2B1E A;  3OYZ A;  4OHF A;  4IRE A;  3ZN1 B;  2V5C A;  4C90 A;  3DJB A;  3LK4 2;  4H63 H;  2HN1 A;  1WYC A;  4ZI3 C;  3CK6 A;  1KF6 A;  1W0B A;  1WR6 A;  4MFR A;  1SE7 A;  2WZH A;  2KMF A;  2IUB A;  4HWD A;  4OYK A;  2UUA T;  4MBQ A;  1E2A A;  3AAA B;  4KBM B;  3ZMZ B;  2V7K A;  2Q9Q A;  3RYI E;  4WNK A;  3SRZ A;  4EZH A;  4DV2 T;  4TZ4 C;  3IBP A;  3Q5W A;  4UIG A;  2WB5 A;  4ZZB A;  2XJ7 A;  2Q9Q B;  2E9X D;  5M4Y A;  3O1I A;  4HFB A;  1ZOY A;  4CI1 B;  2XM2 A;  3UUN A;  5AQO B;  3I0O A;  3NKZ A;  2WZI A;  4IDO A;  4QH4 A;  3N5L A;  4LFA T;  4CXW A;  4AXP A;  4JI2 T;  3ZMT B;  3T1H T;  4WW0 A;  2CWY A;  4COF A;  3PJA J;  3P4S A;  3CPZ A;  2MAW A;  1Y64 B;  2H89 A;  3PUV F;  4UVC B;  5L3E B;  4JI0 T;  2W61 A;  5AQF B;  5L3F B;  4C91 A;  3L09 A;  5HEO A;  3OTO T;  4IDN A;  4J2C A;  2NWB A;  3RIU C;  3QB5 A;  4EB6 E;  1S94 A;  4YY3 T;  4AQF A;  3FBZ A;  4YSY A;  3ETU A;  5AQI B;  1MMG A;  5LHH B;  5JDG A;  1XNQ T;  3L39 A;  1W09 A;  2KIN B;  3Q5X A;  3RC3 A;  4DND A;  4BA9 A;  1MNE A;  5EZY E;  1OED A;  3LSV A;  5FXX A;  3WAJ A;  1G8X A;  4DR1 T;  4H9R C;  2IW5 B;  4GKK T;  3LDQ B;  5CA1 E;  5FXW A;  1MIV A;  3I0Q A;  3VRA A;  4JI4 T;  1XZY A;  2LOS A;  4JEH B;  4X5T A;  2OV9 A;  2F4V T;  2FJA A;  5HEU A;  3SWH A;  3AA0 B;  2CBI A;  2MOZ A;  4ILA A;  1ZKE A;  4U7Y A;  5C8Y E;  2YIN A;  2WCA A;  1UK5 A;  5JDN A;  3B57 A;  2LE8 A;  3CX7 B;  4UR9 A;  2LOP A;  4NIQ A;  2AXD S;  5AQT B;  4JI1 T;  3T8O A;  1HX1 B;  4ZS2 A;  3DTO A;  4O2B E;  3KV5 A;  2QRX A;  4WYV A;  2IC9 A;  5IYZ E;  3RKO A;  1KNP A;  2VKO A;  4BAY B;  2NOX A;  4UF0 A;  3HKE E;  2XAG B;  2BVL A;  2K9A A;  4DMV A;  3EUH A;  3UT5 E;  2BG9 A;  3RKG A;  5LGT B;  4IE6 A;  5LGU B;  1UGO A;  4CQI A;  3AA6 B;  4AKI A;  1JNR A;  2UU9 T;  2BG9 B;  2L8K A;  4DVD A;  2DL1 A;  2QGS A;  5FVL A;  4UEL A;  1MMD A;  2V7I A;  3K1S A;  2Q9Q C;  4DBR A;  4KHP T;  4IIJ E;  3LBX A;  2CHO A;  3UU3 A;  1G73 A;  3QB5 K;  3AVS A;  1N32 T;  4JI5 T;  4LMK A;  3E22 E;  2VUR A;  2DNX A;  3UFG A;  3LBX B;  4AIS A;  3VHL A;  3FZL B;  2E2A A;  4HKA A;  5H6Q B;  4AKH A;  5EK3 A;  3CIR A;  5L3G B;  1HG2 A;  1VRB A;  2WBL A;  2V1D B;  4KMC A;  3JAE A;  5KDM C;  3NVO A;  2DWG A;  1IBL T;  5BMV E;  2V6Y B;  4IDZ A;  5JH7 E;  5LG3 A;  3UUL A;  1MIW A;  2X9X A;  2L3L A;  2XPK A;  4CZZ B;  3LG7 A;  3LK2 B;  4LF9 T;  3PUW F;  3DP7 A;  5AQU B;  4DR3 T;  3AE2 A;  5HWY A;  4AQF C;  3PUR A;  4YJ2 E;  3UFE A;  3RX6 A;  2C5I T;  5L47 A;  4TX5 A;  3P4R A;  3ZST A;  3VU7 H;  4DV1 T;  1LRZ A;  4NXN T;  3AB3 B;  4ASK A;  3P7I A;  2UXB T;  1KNZ A;  3KFW X;  4DV7 T;  1XMQ T;  4P0B A;  4HFC A;  4BJM A;  1OWA A;  3O1H A;  1WFD A;  4KP3 C;  4FJO A;  2DCF A;  1ZHC A;  3UQ7 A;  2VWA A;  3JC6 D;  4UEM A;  2WM9 A;  4L9I A;  5LB7 B;  2J1D G;  4CI3 B;  3AE4 A;  2WAU A;  4HEA A;  1N36 T;  4B3T T;  2VL8 A;  3AE8 A;  1T7S A;  3AA7 B;  3G06 A;  3CKD A;  3AA1 B;  4UV9 B;  2OLT A;  5H6R B;  5ETW A;  3RIA A;  3U78 A;  1D0Y A;  3ONX A;  3FXD B;  3SFD A;  2KSR A;  2ZM2 A;  4U2Z A;  4CXY A;  2XQA A;  3CVR A;  4LMJ A;  3UQ4 A;  1ZP0 A;  2D0U A;  2YDR A;  3C4X A;  3L3P A;  2LSK A;  5HAX A;  5FKY A;  3CML A;  2JQK A;  4E7S A;  5L4H A;  3RLF F;  3M65 A;  5FYM A;  4PJM A;  3EDV A;  5HXH A;  5AQK B;  1ZV4 X;  2LHR A;  3S4U A;  2X9W A;  4YSX A;  5A1L A;  1VCT A;  4QX7 B;  3P4P A;  4WZX A;  4B3R T;  4ERR A;  3PUQ A;  3NZQ A;  2LLY A;  1GQE A;  3AEG A;  4V1A v;  4E7Z A;  2Y8D A;  4YLH A;  3N2K E;  3EAM A;  2JPF A;  1CHU A;  2JRK A;  2X0H A;  3EDU A;  3ZT5 A;  2HPJ A;  1MMN A;  2X68 A;  1IZN B;  3FZH B;  3HKD E;  3ZYK A;  2UXN B;  3MA9 A;  3ZSS A;  2W67 A;  2FJB A;  4A97 A;  3EI0 A;  3CWZ B;  3N9M A;  4NUV A;  4DMW A;  3ZN0 B;  4B6X A;  3HKC E;  2J62 A;  3TLU A;  4CXX A;  4HWH A;  4O8S A;  2CPT A;  2KWH A;  3P4W A;  1QLB A;  2VKD A;  4OFZ A;  3UU4 A;  3JC6 C;  2BS3 A;  2LSJ A;  3RH3 A;  3OVU A;  4H9N C;  3CQC B;  2LT3 A;  5AQN B;  3B5M A;  5HXC A;  2V6X A;  3J7Y q;  4HTE A;  4JI7 T;  4QH1 A;  3UU5 A;  4I50 E;  3ZYM A;  4U31 A;  3C4W A;  2E5V A;  3BQK A;  3O1J A;  3AEB A;  2LKH A;  2E9X A;  1FJG T;  2MYS A;  3NWI A;  1LVF A;  1ZEE A;  4P09 A;  1NAF A;  5IUX A;  2E9X B;  5ADX L;  5DQW A;  3VKH A;  2VKJ A;  4IDQ A;  2LSY A;  5KX5 E;  4ZZC A;  2VQE T;  5LOV E;  3JAD A;  2WWU A;  2X66 A;  3ZLI A;  1LVK A;  4U74 A;  1WLX A;  2E5L T;  4HWF A;  2J47 A;  2D9D A;  5LCY A;  2A72 A;  4IST A;  2JQ9 A;  2ACZ A;  1MND A;  1HS7 A;  4H9O C;  3CQX C;  3FZF B;  2CA5 A;  5JDQ A;  1H7C A;  2W62 A;  3EHZ A;  1CUN A;  4EOZ B;  1KNR A;  1OED E;  5JTG A;  2CWO A;  3R84 B;  5DAB A;  5DQV A;  5FMN A;  2PBI A;  2V7M A;  2IHR 1;  2X9H A;  4YTM A;  3AE1 A;  5LG4 A;  2EHO D;  4I55 E;  2ACX A;  4EAH A;  3K3O A;  2CXF A;  2YU2 A;  4HE8 A;  2AE9 A;  3HI2 A;  2WU5 A;  4A98 A;  3EAB A;  2NW9 A;  4XAX B;  3FXE B;  2RA1 A;  3D0T A;  5LNK A;  3PUS A;  4HFI A;  1WRD A;  2WSS V;  5AQG B;  3AE9 A;  1W9R A;  5LBQ B;  5FY0 A;  1IBK T;  1VOM A;  3P50 A;  1V9D A;  1KK7 A;  4TV9 E;  4ZHQ E;  1D0X A;  3SFE A;  1FEW A;  2H88 A;  5CGM A;  2YK0 A;  4X20 E;  2M67 A;  1YXR A;  3ZMU B;  4B3S T;  5LGN B;  3ZJ2 A;  3ABV A;  3KVB A;  5L2L A;  2BG9 E;  3OJA A;  4IGU A;  4ILU A;  1NWM X;  2XY8 B;  2PG8 A;  5JDH A;  4PJJ A;  3M3Z B;  4YFS A;  1R8I A;  1T72 A;  2YDS A;  2XQ9 A;  1JNZ A;  1MMA A;  4ISS A;  1AJ3 A;  5HEG A;  3AVR A;  2WDV A;  3E08 A;  4FI5 A;  4O4H E;  4PAG A;  4PK6 A;  2WMN A;  1HF8 A;  4DBQ A;  5AQR B;  3P4Q A;  4DV6 T;  4IHJ E;  2I0M A;  2E8I A;  1YKE B;  3UU8 A;  2X0L B;  4AKL A;  3AE7 A;  5F8P A;  3NRY A;  2WY2 A;  4QWN B;  4WBN E;  2A2F X;  4DR2 T;  1NEK A;  3GWH A;  3ZKR A;  3J9X 1;  2LSG A;  3KBT A;  2H7O A;  4HN9 A;  4LML A;  4CN1 A;  3X1D A;  3AAE B;  5KXJ A;  3GA8 A;  2E9X C;  3ZCJ A;  3RYC E;  2LM9 A;  5FXV A;  3NZP A;  3V5U A;  3K3Q C;  3ZMS B;  4PJL A;  3PUA A;  2NP9 A;  4EYU A;  5AQJ B;  3HKB E;  5ABH A;  2UXX B;  3I1A A;  3MXZ A;  3Q5D A;  5FL0 A;  5LXT E;  2KWI B;  1T98 A;  4YHJ A;  1D1B A;  2CM0 A;  2WP9 A;  3GN5 B;  3N2O A;  2IC6 A;  4TNW A;  1EZ3 A;  3TLS A;  5HXS A;  1UUR A;  4A56 A;  2CE7 A;  2DLR A;  3RQU A;  2N2N A;  2VL0 A;  4HFV A;  3K3N A;  5FY7 A;  3FZK B;  1FMV A;  3UTK A;  4MLK A;  2V6Y A;  5ABE A;  4DV5 T;  2BBJ A;  3PUG A;  1BR4 A;  5FVK A;  1HR0 T;  3QK6 A;  4YHH T;  3AEF A;  5FY1 A;  3PUY F;  4GYS A;  5JDF A;  3ZC0 A;  3HR0 A;  2CCQ A;  3C51 A;  4I4T E;  2W0G A;  4TNV A;  4Z90 A;  2SPC A;  3QUJ A;  3VRB A;  2VVS A;  3UUM A;  4G2A A;  5AQV B;  4PK5 A;  1U5P A;  3PU8 A;  4TUY E;  1HNX T;  4OX9 T;  2W63 A;  5AQL B;  2Z6E A;  5CB4 E;  1LKX A;  3TKL B;  5HEH A;  2ZM8 A;  3H3A A;  5J0Z A;  4AKG A;  2ZLY A;  5AQQ B;  3ANW A;  4ZOL E;  3MJX A;  4O4L E;  3A5X A;  3RRC A;  4EEB A;  5EK4 A;  3ZC1 A;  4QX8 B;  5JVD E;  4X65 T;  4LF4 T;  2LEH A;  2XTL A;  3ANW B;  3ZCI A;  4U33 A;  2YU1 A;  1Y01 A;  3RYF E;  4TWH A;  4HFH A;  2CMR A;  2L9Q A;  3P8C D;  4EIW A;  4DV4 T;  2H3R A;  3MAC A;  2Y6X A;  5KMG P;  1UX5 A;  1SUM B;  4ILB A;  2H7V C;  3PE0 A;  4HFD A;  2XQ7 A;  4ZI2 D;  3F57 A;  1SHZ C;  3AEE A;  2P9B A;  4TWF A;  5FNV E;  3I9W A;  4IE4 A;  5HWX A;  5AQP B;  2FJD A;  4U7I A;  4ZI3 D;  2K3W A;  2JQH A;  3FZM B;  2JMH A;  2I6H A;  4X1I E;  2CLY B;  4I0U A;  3ZEF B;  2PJQ A;  5E0O A;  3FBL A;  5HXE A;  3KBU A;  2DI4 A;  1B7T A;  2V7J A;  2W4X A;  4PK4 A;  2I59 A;  4U72 A;  4CI2 B;  3BQI A;  1O3X A;  2XUE A;  3IA3 A;  5JRE A;  3W15 B;  1YKH B;  1D0Z A;  4L0R A;  5F3J A;  3AAI A;  1BR2 A;  2IML A;  3Q2M A;  3MK7 C;  5HYA A;  1IAP A;  3LJC A;  5FP3 A;  1HTJ F;  4AKR B;  4O2A E;  4ZXL A;  4BJN A;  2Y48 B;  4X64 T;  2BKP A;  5LBM A;  1XDO A;  5LA6 E;  2J4G A;  2BBH A;  5LP6 E;  2XQ8 A;  2C5J A;  1XWM A;  2LSI A;  5JR9 B;  4WBO A;  5L3D B;  4LF6 T;  5EK2 A;  4YXD A;  4GYR A;  1W0A A;  4HWC A;  1D1C A;  5L4E A;  3AE5 A;  4AIU A;  3E0Z A;  3ZT7 A;  4GKJ T;  1FIO A;  4TN7 B;  3TLV A;  4ZEY A;  1J5W A;  4AQG A;  2X0Y A;  5LHI B;  1WYB A;  4MAL A;  3Q9D A;  1X9B A;  3WAK A;  1QUU A;  2D0T A;  1QSD A;  1IBM T;  3FHN A;  1I94 T;  2VK9 A;  3U3I A;  3C64 A;  3OYX A;  4M1P A;  3AEC A;  5TAO A;  3O4X E;  2UXD T;  1IJ6 A;  3PJA A;  1T8B A;  4ANJ A;  5HXR A;  4EXT A;  2NTY A;  3RF1 A;  5BR8 T;  4ZI2 C;  2BS4 A;  5AQM B;  3AE3 A;  1US7 B;  3RYH E;  4TV8 E;  2HHH T;  3PDY A;  4GK0 E;  1Z0P A;  4UXN B;  4HWI B;  1YQ4 A;  4CN4 A;  4NXM T;  4ZS3 A;  2VQF T;  2JMK A;  4P1N A;  2W2U A;  3N9O A;  2FUP A;  2VAS A;  3L8R A;  3VR8 A;  1E7P A;  1HNW T;  4DUZ T;  2W00 A;  4JUY A;  4KX6 A;  4EYY R;  2EHO A;  3LFM A;  4NUU A;  4DR5 T;  3AXJ A;  4NPP A;  2V8S V;  3N9Q A;  2K24 A;  1YQ3 A;  3BK9 A;  2CLY C;  2EHO B;  4JV5 T;  3AXJ B;  2V26 A;  2LJL A;  1NEN A;  1XDP A;  2HPL A;  1Z8U A;  2V7L A;  4ADZ A;  3MZK B;  5IWA T;  4N78 D;  3C4Z A;  4H9Q C;  4DV3 T;  4O4J E;  3UUB A;  2NR4 A;  4DV0 T;  1XNR T;  3RRW A;  1OXZ A;  3KIN B;  2WWV A;  4KHZ F;  4IE5 A;  2Q9Q D;  2ZM6 T;  4DID B;  5F5W A;  2VVN A;  1SA0 E;  3CX6 B;  4EV6 A;  1UUS A;  5HCM A;  1BR0 A;  4X62 T;  4EGW A;  5LYJ E;  4AI6 A;  2X51 A;  1HFA A;  3F31 A;  5HCJ A;  5JDL A;  2D2S A;  5L3B B;  1M7K A;  2NTX A;  5LMN T;  4QXB B;  4IE7 A;  4X1K E;  2FJE A;  3QOF A;  5JR9 C;  3QC9 A;  4DO0 A;  2LHN A;  4QXH B;  3HA4 A;  5CFB A;  4K0U A;  4IT4 A;  2BS2 A;  5AFU L;  1DU2 A;  2A9U A;  5LJN A;  4B3M T;  3IEE A;  5FXZ A;  4EED A;  4QXC B;  3I9Y A;  3A7M A;  2X9Y A;  4UVB B;  2ZM0 A;  3OBV E;  4JEU B;  3VKG A;  4QKN A;  5LHG B;  4JYA T;  1OED B;  4X66 T;  3ONL C;  2YDQ A;  3PUX F;  2B76 A;  4L5G A;  1E1H B;  1D1A A;  3RIF A;  2UUB T;  5J2T E;  3NRX A;  2R6G F;  5JQG E;  4GOU A;  2WDQ A;  3O9X A;  4MHC A;  2XZE A;  1HG5 A;  2XSA A;  2XSB A;  2ODU A;  2WMO A;  4YSZ A;  3ZPO A;  4H9S E;  4JI3 T;  4YT0 A;  3N9P A;  4QHO A;  2UUC T;  1L0V A;  2CEA A;  3BQL A;  2ODV A;  4JI6 T;  4HFE A;  2BZB A;  2BVM A;  2OA5 A;  5GON E;  5CA0 E;  3ONJ A;  3WI3 A;  2JJ9 A;  1HX8 A;  4UF0 B;  5AQS B;  3GN5 A;  5JRC A;  1UCU A;  1YW0 A;  4OK0 A;  4IL4 A;  4JLE A;  4GK5 E;  4JBW F;  5HEJ A;  1HCI A;  2CRB A;  2XM1 A;  2EHO C;  5JRC B;  5CJ5 A;  4LFB T;  3T1Y T;  4LF5 T;  3RC8 A;  5C2T A;  5J2U E;  5IHY A;  3A8Y C;  3ZJ1 A;  2IIU A;  3CQG B;  3KV9 A;  1IJ5 A;  1UX4 A;  2BKO A;  1J1J A;  3QNU A;  2K5B B;  2N9D A;  1XMO T;  2WS3 A; 
#chains in the Genus database with same CATH homology
 1UGO A;  3LDQ B;  5AQI B;  5AQG B;  5AQK B;  1T7S A;  5AQM B;  5AQF B;  5AQN B;  5AQP B;  5AQH B;  1UK5 A;  5AQQ B;  1M7K A;  1M62 A;  4HWD A;  4HWH A;  3FZM B;  5AQJ B;  1I6Z A;  4HWF A;  5AQU B;  5AQV B;  2D9D A;  3FZH B;  4HWI B;  4HWC A;  3M3Z B;  5AQS B;  5AQL B;  5AQT B;  1HX1 B;  5AQR B;  3FZL B;  3FZK B;  5AQO B;  3FZF B;  3A8Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...