4OYJA

Structure of the apo hoip pub domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oyjA00
4OYKA 4P0BA 5LJMA 2HPLA 4OYJA 2HPJA 4P09A 4P0AA 2CM0A 2CCQA 4JUYA 2D5UA 5LJNA
chains in the Genus database with same CATH superfamily
2BDEA 3RRCA 2D9DA 2YINA 4TV8E 3UFEA 2RA1A 4IHJE 5LCYA 5KX5E 2EHOD 3O1JA 2WDVA 2H88A 2KT9A 1HNWT 4IDQA 4CN4A 1XNRT 4HEAA 3Q5WA 4O4HE 4PAGA 4DNDA 4B3ST 2LJLA 2HN1A 3ZMZB 3ZLIA 5AQSB 3AE4A 3E0ZA 2EHOA 3AAEB 4QH5A 1G8XA 4YY3T 4YXDA 5ABFB 3AXJB 2LRKA 1E2AA 4QWNB 5LHIB 1KNRA 4HKAA 2C0SA 2X0HA 4OYJA 2XQYA 4IE4A 1NEKA 2WU2A 1T8BA 3VU7H 2X51A 4DV2T 1OEDA 2UU9T 1D1CA 4HWHA 3NRXA 4ILCA 5DABA 5LB7B 2Y48B 1HNXT 2HHHT 4AQGA 4CQIA 3KVAA 4KMCA 2Y6XA 4KX6A 4QXCB 4UVAB 5DJQC 1VOMA 2CWYA 3A5XA 2XY8B 4HFCA 2MYSA 5LA6E 2L8KA 1KNZA 3NZPA 3P4PA 4EYYR 3HKDE 3WAKA 5JQGE 5FYMA 4XZCA 3A7MA 4JV5T 1YKHB 3TKLB 2XM1A 2YDRA 5HEHA 5ABEA 4EB6E 2K3WA 3TLSA 3I0QA 2WZIA 3AVSA 5LOVE 2MTQA 4FI5A 5HXSA 3P7IA 3BQLA 1M7KA 4UF0A 4TWFA 1HTJF 1OXZA 3CVRA 3ZN0B 2Y8DA 3PV0F 4ILBA 4FJOA 5JDMA 3N9OA 4ZHQE 3UU6A 2RPAA 3V5SA 2W67A 3UQ4A 2K48A 2V5DA 3RF1A 3NBXX 5L3BB 2YU1A 2XSAA 3I0OA 4WBOA 3AE8A 3AE7A 1CUNA 3NKZA 3O4XE 1XMOT 4JEUB 3R6NA 4K0KT 4I55E 5F5WA 2EHOC 3ZMVB 1NAFA 1ZKEA 2XTLA 1HX8A 3PUVF 4LMJA 1XDPA 4ISTA 3PU3A 2FJBA 1MIWA 3TLUA 5FY7A 4DO0A 3ANWB 3KINB 4PNIA 2LHRA 4I43B 3L09A 2GK9A 3AEDA 3KFWX 2YK0A 4P09A 3GN5B 1JNZA 1LVKA 4KP3C 5HCJA 2DWGA 3SFDA 4IL4A 2CE7A 4X62T 5JDHA 1YQ3A 4EXTA 4CXYA 2CHOA 3TLWA 2ZM6T 4BJNA 3N9NA 4JI1T 5AQGB 1MMNA 5C8YE 4YFSA 1UX4A 1D1AA 5LYJE 2NTXA 3RYIE 3RKGA 2YOEA 3U3IA 5AQUB 2CLYB 3RIAA 4HFIA 4B6XA 2W66A 2W2UA 4DR3T 4U3CA 5JTGA 3VRBA 4WYVA 3QC9A 4A98A 2Z6EA 2ZLYA 3OBVE 4L5GA 4HFEA 4H9NC 4KHZF 4IE5A 2XAHB 4UIGA 2VKDA 2OA5A 5FY1A 3RQWA 5KDMC 1MMGA 3NRYA 2ZM0A 2VL8A 4GYRA 4TNVA 3JC6C 3ZC0A 4QHOA 3ZT6A 3AA0B 3RI5A 3QB5A 4ZZBA 4AQFC 1D0ZA 4WBNE 5FXVA 3HA4A 4LMKA 2PBIA 2I59A 2XQ8A 3RLFF 2IUBA 2H89A 3UU4A 2CBJA 3HKCE 2BZBA 2ACXA 2FBWA 2WZHA 3E08A 3N5LA 3OPCA 4X66T 1XWMA 1US7B 3G06A 1LKXA 3UU3A 1UUSA 2XAGB 4ERRA 2X9WA 2YEVC 4DMVA 2CXDA 4YSYA 2UUBT 1UCUA 4DR4T 4LFBT 4YTPA 1Y64B 1KK7A 4ZXLA 3AEGA 1YXRA 1YD8G 1HCIA 4DV0T 5JREA 5CFBA 5LHGB 4TWHA 1Z8UA 4QKNA 1SHZC 4H63H 1VCSA 1FJGT 5FP3A 4PJJA 3CX7B 4HFHA 4DV7T 2H7VC 3AA1B 3CQGB 1BR2A 2WM9A 3K3NA 2AXDS 3LBXA 3VHLA 4ADZA 3NVOA 4BAYB 5HXCA 1MNDA 4G2AA 1XDOA 5AQJB 1KEYA 3DP7A 2K5BB 2V6YB 4DVDA 5AQPB 2J4GA 2PTFA 1ZV4X 3RRWA 2VURA 5FXZA 3ZMUB 2X67A 4UELA 2W4XA 2D2SA 5L47A 2WWVA 3SOLA 3PURA 4JBWF 2IIUA 5H6QB 2G0UA 1YKEB 2E9XD 4UXNB 3H3MA 3RGLA 2ZM8A 2QYWA 1IBKT 2NW9A 3EDUA 1HFAA 3RYFE 3CPZA 4HFBA 2FJAA 2VVNA 4LF7T 1WR6A 3HR0A 2X68A 4TNWA 1IJ6A 4ZS2A 2JQHA 3CMLA 2E9XA 2LRLA 2XQ7A 2MBGA 2LT3A 5JVDE 1KFYA 2YDSA 4PFPA 2VB6A 3S4UA 4DIDB 4CZZB 4AKIA 4X1YE 4MBQA 4UR9A 3ONLC 3RIUC 3P4WA 4KUMB 3TLVA 4DR5T 4BJMA 3ZYKA 3K1SA 2B1EA 5L4EA 4GKKT 3BK9A 4IT4A 4UV9B 2P9BA 3KV9A 3W15B 2XQ3A 3H37A 2UUCT 3PTRB 1HS7A 3AEBA 4ZZCA 4CXXA 4OHFA 3PJAA 3RYCE 3ESLA 3P4QA 5A1LA 4JI0T 2X0LB 2JMHA 5FVLA 2XQ9A 3FZHB 2IC6A 4F8HA 3VKHA 2V7MA 1SA0E 2XQ4A 4TWDA 3RC3A 4Z90A 3DTOA 3PUAA 2A3DA 3RC8A 5JDNA 1WRDA 4ZI3C 1YW0A 2K9AA 1G73A 2LSGA 1U5PA 2FJEA 4GYSA 4I4TE 5KMGP 5LGUB 2LOPA 4PK5A 4O4LE 5AQFB 1FEWA 3WAJA 4NUUA 3RKOA 4HWFA 3O1HA 5AQOB 3IA3A 3ZC1A 2H3RA 4EAHA 3EDVA 2CA5A 2FUPA 3AE6A 4JI7T 5F8PA 2KWHA 4I50E 5JDQA 5F3JA 3PDYA 5HXRA 5JRCB 2KSRA 3FHNA 1IJ5A 1QSDA 3K8PC 3VRAA 4O2AE 3ZT7A 2CRBA 4JUYA 2X0YA 3ZMTB 5JR9A 4P0BA 2IMLA 3UT5E 3RPUA 3ETUA 2BG9B 2WDRA 4M1PA 3IHRA 4XAXB 2LE8A 2VASA 3C64A 4YLHA 2XAJB 4DUZT 3VR8A 3LG7A 3FZFB 1ZHCA 4EEBA 5J0ZA 3SWHA 4UEMA 2BS4A 3FZKB 2LKGA 4KHPT 4LF4T 2Q9QB 2C5KT 2CHNA 5DQWA 4K0UA 4JI5T 1HG5A 2V6XA 3UUBA 4HWDA 4UV8B 2JQKA 1XZYA 3O1IA 2C5JA 4NXNT 1ZEEA 4H9PC 4CN6A 5ABHA 3FXDB 4YSZA 3B57A 2L9QA 2BG9E 2XQ5A 4O4IE 2D0UA 4E7SA 1WR0A 3PU8A 3UUNA 2MPKA 2LSIA 5BMVE 2KLQA 2WY2A 2FJDA 5LG4A 1W09A 5LJNA 2WCAA 2RP4A 2E5LT 3LDQB 5AQIB 1M62A 5M4YA 2YKSA 2NW8A 2KINB 2MOZA 4C91A 1X79A 1U4QA 4DUYT 2OV9A 4IDNA 4G63A 4TX5A 4B3MT 4B3RT 5ABFA 4L9IA 4UVCB 4UVBB 5L3DB 3AXJA 5FL1A 4O2BE 4V1Av 1DU2A 2WS3A 5JH7E 3EI0A 3UU8A 1UGOA 3HI2A 3QK6A 2HH7A 2V7LA 1UK5A 4CI1B 4LF5T 5AQRB 5JR9C 3UU5A 2JQ9A 1IZNB 1OEDC 1VRBA 2VKJA 3I9YA 1S35A 2J62A 3M3ZB 1XMQT 1WCRA 5TAOA 3ZKRA 3J7Yq 3P8CD 3L39A 4QH1A 3L8RA 2XAFB 5IHYA 3N9MA 4TZ4C 4H63V 4QH4A 1LVFA 5LJMA 4LFAT 2I6HA 4PK6A 2BS2A 5FVKA 3D0TA 3NZQA 2I0MA 3RQUA 2CPTA 2JQQA 5AQTB 4ZI2D 3GA8A 1I6ZA 5FMNA 3V5UA 2W00A 3T1YT 3AAAB 4AISA 2CBIA 4DV1T 4MALA 2X9HA 2VVSA 3ZMSB 3ZJ1A 2WP9A 1I94T 3EABA 3PUQA 4PJMA 4HWIB 5KXJA 4U7IA 3UQ7A 1MMDA 1CHUA 1W0AA 3HKBE 3AEEA 2B76A 5JDLA 2MAWA 4X65T 1H7CA 5JDFA 2KZ7B 3B13A 4YTMA 5HXEA 5LHHB 3P50A 4CI3B 5L3FB 3C4WA 5BR8T 2HPLA 2QGSA 2KXPB 2CXFA 5FXWA 3PUZF 4U72A 3R84B 4DV3T 4PJLA 1O3XA 3OYZA 4X1KE 3RX6A 3ANWA 3FZMB 3OTOT 3UUMA 3MK7C 2H7OA 1SE7A 1ZP0A 2VKOA 3GN5A 5LP6E 3PUYF 4WNKA 5L3GB 5LG3A 3NWIA 1MMAA 2OLTA 1T7SA 4OFZA 2UXBT 2CWOA 3KBTA 1FMWA 1NWMX 5J2TE 2WWUA 2D0TA 3FXEB 3AE1A 5CJ5A 3KVBA 3AB3B 1JNRA 3WI3A 1HG2A 4IDOA 3ZCIA 2WU5A 2VQET 2QRXA 3UULA 4KI0F 1W0BA 3MACA 3UTKA 4EYUA 4CI2B 2WQYA 2M67A 2VQFT 2SPCA 3BQKA 4DV6T 4YHJA 4ZI2C 5FY0A 3AVRA 3IF8B 3AE9A 3MKDA 1E1HB 2LEHA 4GKJT 2JIWA 2NOXA 5L2LA 5ADXL 5FXXA 4A5XA 3ONJA 4DV4T 3BQIA 2K24A 4NIQA 4HFDA 2XQ6A 1HR0T 4O4JE 2X9XA 2EHOB 2LHNA 2WAUA 4IE6A 2KMFA 4ANJA 1EZ3A 3CQCB 5L4HA 1MNEA 4PFOA 1X9BA 1Y01A 1OEDB 3AEAA 2PG8A 2ODUA 1D0XA 4IDPA 5HAXA 3AEFA 4ZOLE 4JI3T 3P4RA 5AFUL 4HN9A 4JI4T 4EZHA 3Q5XA 2LLYA 3Q9DA 5FNVE 2W63A 4AIUA 1T98A 3GMIA 5AQLB 4EIWA 4DR7T 3CX6B 2WMNA 3OVUA 3LK3B 1NENA 3CKDA 2IC9A 2XASB 3LK2B 4B3TT 2IW5B 2E5VA 2V6YA 1OEDE 4GOUA 1WFDA 2CLYC 2YU2A 4AXPA 2V1DB 5LGNB 3CX8B 4LFCT 5C3JA 4UF0B 3AECA 2CXLA 4JI6T 2VL0A 1N34T 5ABGA 4LF8T 5CA1E 4ISSA 2BVLA 5EK3A 3AA7B 3A8YC 3T1HT 3EVYA 4DV5T 2V7IA 1N36T 4A97A 2KWIB 1QUUA 4IE0A 4OX9T 2WDQA 2ODVA 4P1NA 1UX5A 4DR2T 5AQMB 2WBLA 2A9UA 4L0RA 3E22E 2E9XC 1N33T 2CMRA 3MXZA 5ETWA 4MFRA 5AQNB 4X1IE 2BKOA 3ONXA 3LSVA 5IWAT 2YDQA 4U2YA 1J1JA 4PK4A 2KNDA 3ZSSA 5HEJA 3C50A 1BR4A 4H9OC 3PUXF 1MIVA 3N9QA 5HCMA 2V26A 4COFA 4DBQA 4YT0A 4YJ2E 1HX1B 1QLBA 3Q2MA 3N2GE 4HFVA 3J9X1 2ACZA 4O8SA 2DNXA 1IBMT 5IYZE 2BBJA 2DWKA 2WSSV 4DBRA 2V7KA 4YJ3E 5EK4A 4HGAA 1T72A 4N78D 3RH3A 2LSYA 4AKGA 4IREA 4BA9A 3LJCA 3P4SA 4EV6A 2PFVA 4PW8A 2HN2A 1W9RA 5HEOA 4Z91A 2NWBA 3PUSA 3RIFA 2UXXB 3AE5A 2D5UA 3Q5EA 3Q5DA 5FKYA 3LFMA 2UUAT 1HF8A 1FMVA 3JC6D 2NW7A 5AQHB 3SS1A 4F6RC 2DI4A 4QXHB 2JJ9A 3JADA 3M65A 4HWCA 4EGWA 3SRZA 4JLEA 2V8SV 4Q25A 3T8OA 3VKGA 2A72A 1SUMB 4U31A 3IEEA 3PUGA 5AQKB 1UURA 2CEAA 4ZS3A 1MIYA 3ZSTA 5LGTB 3AE3A 5FL0A 5AQQB 4H9RC 3F31A 4DR6T 3ZPOA 4U7YA 1WYCA 4AKLA 2E8IA 5JRCA 4AQFA 4DR1T 5L3CB 3CQXC 2QVAA 2WB5A 4JI8T 4ILAA 2UXCT 3JAFA 5EZYE 2V5CA 3KV6A 4TV9E 2NR4A 2BG9A 4OK0A 3FBZA 2BKPA 1J5ET 2UXDT 4YHHT 3EAMA 2Q9QD 3LK42 3HL6A 1HNZT 2J47A 4E7ZA 2BS3A 4JYAT 1BR0A 4QXBB 4WW0A 3UFGA 3JAEA 1E7PA 4LF9T 4EEDA 4NPPA 2JRKA 2DCFA 3FBLA 5J1GA 4AKHA 3OYXA 1IBLT 2Q9QA 2A2FX 4PJNA 4YTNA 3IBPA 5LMUT 4HTEA 2XHEB 3TLTA 3UUXB 2BVMA 3CWZB 1AJ3A 2IHR1 2V7JA 4HE8A 4YSXA 5J2UE 2M6BA 4AQYT 3LBXB 1BR1A 2X66A 3ZN1B 3FB2A 1VCTA 2LOSA 2XSBA 3CIRA 2DLRA 4IL9A 1LRZA 3PUWF 4EOZB 3OKQA 1XNQT 3MJXA 4AI6A 2AE9A 3X1DA 2PJQA 2NTYA 2UXNB 1WLXA 2ZM2A 2JMKA 5HWYA 3SFEA 2M6IA 3ABVA 2YN6A 5JDGA 3N2KE 3ETVA 4IIJE 2VK9A 2J1DG 1OWAA 3KBUA 4JEHB 2X9YA 3GWHA 2LSJA 2L3LA 4DMWA 1ZOYA 5C2TA 2N2NA 2E9XB 2C5IT 2N1GA 4IGUA 3ZYMA 1V9DA 3C51A 5CA0E 5L3EB 4TUYE 2BG9C 3PE0A 2LKHA 5LNKA 1N32T 5DQVA 3RIUA 4EZ4A 2XM2A 3FZLB 2DHRA 1D1BA 1S94A 2R6GF 1IAPA 5LBMA 5GONE 3I1AA 4C90A 2XQAA 3ZYLA 5H6RB 4MLKA 4A56A 3QNUA 2ZMAA 5AQVB 3N2OA 2W62A 4MHCA 3K3OA 4ZI3D 2Q9QC 2DL1A 3HKEE 1FIOA 5HEGA 4X5TA 1J5WA 4U2ZA 3DJBA 1KF6A 3B5MA 4CXWA 4KBMB 5E0OA 5LXTE 3O9XA 3VR9A 1R8IA 4IDZA 3KDSE 4XBFB 4ZEYA 2XAQB 5HEUA 3N9PA 3JCFA 4U74A 2N9DA 5EK2A 3OJAA 5CGMA 4I0UA 2E2AA 3QOFA 5HYAA 3ZJ2A 3MA9A 3EUHA 2IDOB 4GK5E 5LMNT 2ES0A 4IE7A 4H9QC 4ILUA 4AKRB 5HWXA 2W0GA 3C4XA 3F57A 3KV4A 4U33A 4LF6T 3AAIA 4NXMT 1L0VA 1Z0PA 2HPJA 4ASKA 2XJ7A 3F2EA 4OYKA 3EHZA 4NUVA 5IUXA 1WYBA 4WZXA 5JR9B 3ZEFB 4GK0E 3C98B 3AA6B 2JPFA 2XPKA 4TN7B 5CB4E 4GIWA 3ZT5A 3MZKB 2LM2A 3C4ZA 2WMOA 2NP9A 2BBHA 4QX7B 2CM0A 2W61A 3U78A 3QB5K 1B7TA 3CK6A 5LBQB 4P0AA 1GQEA 2XUEA 2VKHA 2XZEA 3H3AA 2IAKA 4J2CA 3RHWA 4QX8B 2LM9A 3K3QC 3RYHE 4Z8XA 1D0YA 3PJAJ 4X20E 3KV5A 2QA7A 4JI2T 3ZCJA 1YQ4A 3I9WA 3AE2A 4LMLA 2LSKA 4X64T 1KNPA 2BKNA 3N9LA 2F4VT 4ZI7E 3L3PA 2CCQA 5HXHA 3QUJA 4CN1A 4H9SE 2VWAA
chains in the Genus database with same CATH topology
3RRWA 2BDEA 5FXZA 2DI4A 4QXHB 2JJ9A 3RRCA 3ZMSB 3M65A 3ZJ1A 2YINA 4TV8E 3SRZA 4JLEA 2X67A 2RA1A 3UFEA 3ZMUB 4UELA 3PUQA 3T8OA 4IHJE 5LCYA 3VKGA 5KX5E 2A72A 4PJMA 2EHOD 3O1JA 2D2SA 3IEEA 3SOLA 3PURA 3PUGA 1MMDA 2KT9A 2CEAA 4ZS3A 1MIYA 5LGTB 3HKBE 5H6QB 4HEAA 2G0UA 1YKEB 2E9XD 3Q5WA 5JDLA 4UXNB 4O4HE 4PAGA 4DNDA 2ZM8A 4H9RC 3F31A 2LJLA 2NW9A 3ZPOA 1H7CA 1WYCA 3EDUA 5JDFA 3ZMZB 1HFAA 3ZLIA 4AKLA 2E8IA 5JRCA 3RYFE 2KZ7B 3CPZA 4AQFA 3B13A 3E0ZA 2EHOA 5L3CB 3CQXC 3AAEB 1G8XA 5HXEA 5LHHB 4CI3B 1WR6A 3HR0A 2X68A 5L3FB 1IJ6A 3C4WA 4ZS2A 2HPLA 2QGSA 3CMLA 2E9XA 2KXPB 4QWNB 5LHIB 5EZYE 2MBGA 2CXFA 3KV6A 4HKAA 2C0SA 2LT3A 4TV9E 5FXWA 4OYJA 5JVDE 2XQYA 4OK0A 4U72A 4IE4A 3FBZA 3R84B 4PFPA 2VB6A 3VU7H 3S4UA 2X51A 4PJLA 4CZZB 1O3XA 3OYZA 4X1KE 1D1CA 4AKIA 2Q9QD 3LK42 3HL6A 4X1YE 3NRXA 4MBQA 3RX6A 5DABA 3ANWA 4E7ZA 2Y48B 3UUMA 3MK7C 2H7OA 1BR0A 4QXBB 4WW0A 4AQGA 4KUMB 4CQIA 4BJMA 3KVAA 3ZYKA 4KMCA 2B1EA 2Y6XA 2VKOA 4QXCB 2JRKA 2DCFA 3JC6D 3FBLA 3GN5A 5LP6E 5J1GA 4AKHA 4UVAB 3OYXA 3BK9A 4WNKA 5L3GB 2Q9QA 4UV9B 2A2FX 2P9BA 4PJNA 3IBPA 1MMAA 5DJQC 3KV9A 1VOMA 3W15B 2CWYA 3H37A 3A5XA 4HTEA 3PTRB 4OFZA 2MYSA 2XHEB 2CWOA 5LA6E 1HS7A 3UUXB 2L8KA 3KBTA 1KNZA 2BVMA 3CWZB 4CXXA 1AJ3A 3NZPA 4OHFA 4EYYR 3HKDE 3WAKA 1FMWA 5JQGE 1NWMX 3RYCE 5J2TE 3ESLA 2WWUA 2V7JA 5A1LA 5FYMA 2D0TA 3FXEB 2X0LB 2JMHA 4HE8A 4XZCA 2IC6A 5J2UE 3VKHA 1YKHB 2V7MA 1SA0E 3KVBA 3AB3B 3TKLB 3RC3A 3LBXB 1BR1A 2X66A 3ZN1B 3DTOA 3FB2A 2LOSA 3PUAA 4EB6E 3WI3A 2DLRA 3I0QA 1HG2A 2A3DA 3RC8A 1LRZA 3ZCIA 5JDNA 1WRDA 4ZI3C 1YW0A 3AVSA 2K9AA 1G73A 5LOVE 4EOZB 3UULA 3OKQA 2LSGA 2MTQA 1U5PA 4FI5A 5HXSA 4GYSA 3P7IA 4I4TE 5KMGP 3SS1A 3MACA 3UTKA 5LGUB 3BQLA 4EYUA 4CI2B 2LOPA 4UF0A 4PK5A 1HTJF 1OXZA 4O4LE 2M67A 3CVRA 3MJXA 3ZN0B 2Y8DA 2SPCA 3BQKA 4AI6A 1FEWA 4YHJA 4ZI2C 3WAJA 4NUUA 5FY0A 3AVRA 3RKOA 4FJOA 4ZHQE 3IF8B 3N9OA 3O1HA 2PJQA 5JDMA 3MKDA 1E1HB 2LEHA 2NTYA 2UXNB 3ZC1A 1WLXA 2H3RA 4EAHA 2ZM2A 3V5SA 2NOXA 3EDVA 5L2LA 2CA5A 2JMKA 5HWYA 5ADXL 5FXXA 2K48A 3NBXX 5JDGA 5L3BB 5F8PA 2KWHA 3BQIA 2K24A 3N2KE 4I50E 5JDQA 2YU1A 3ETVA 5F3JA 3I0OA 4IIJE 4WBOA 2VK9A 3PDYA 2J1DG 5HXRA 1OWAA 4O4JE 5JRCB 3KBUA 2X9XA 3FHNA 4JEHB 1IJ5A 1CUNA 1QSDA 3K8PC 4O2AE 2EHOB 2X9YA 3GWHA 3O4XE 2LSJA 4JUYA 2LHNA 4JEUB 2L3LA 2WAUA 3R6NA 3ZMTB 4DMWA 2N2NA 4I55E 2E9XB 2C5IT 5JR9A 4P0BA 2EHOC 4IE6A 2KMFA 3ZMVB 1NAFA 1ZKEA 2N1GA 4ANJA 3UT5E 4IGUA 4F6RC 3RPUA 1EZ3A 3ETUA 2XTLA 1HX8A 4M1PA 3ZYMA 3IHRA 3CQCB 1V9DA 3C51A 4ISTA 5CA0E 1MNEA 3PU3A 4XAXB 4PFOA 5L3EB 1MIWA 2LE8A 2VASA 3C64A 4TUYE 4YLHA 2XAJB 5FY7A 2PG8A 3PE0A 5LNKA 2ODUA 4DO0A 1D0XA 3LG7A 5DQVA 4EZ4A 3ANWB 5HAXA 1ZHCA 3KINB 2DHRA 4PNIA 1D1BA 1S94A 4ZOLE 2LHRA 1IAPA 3SWHA 4UEMA 4I43B 5LBMA 5GONE 3L09A 3I1AA 5AFUL 4HN9A 2GK9A 4C90A 3KFWX 2YK0A 4P09A 3GN5B 1LVKA 4EZHA 4KP3C 2DWGA 3ZYLA 2Q9QB 3Q5XA 2C5KT 5H6RB 2CE7A 3Q9DA 5FNVE 5JDHA 4MLKA 4A56A 5DQWA 2W63A 4K0UA 4EXTA 4CXYA 1HG5A 2ZMAA 3N2OA 2W62A 4MHCA 3K3OA 4ZI3D 2Q9QC 3HKEE 1T98A 4BJNA 4UV8B 3N9NA 1FIOA 1MMNA 3GMIA 5C8YE 4YFSA 3O1IA 4EIWA 2C5JA 1UX4A 1D1AA 5LYJE 1ZEEA 2NTXA 3DJBA 3RYIE 3CX6B 2WMNA 4H9PC 3FXDB 3LK3B 3U3IA 4CXWA 3CKDA 3B57A 2L9QA 2IC9A 4KBMB 2CLYB 5E0OA 5LXTE 2XASB 3LK2B 4O4IE 2IW5B 2D0UA 3O9XA 4B6XA 4E7SA 4IDZA 4GOUA 3KDSE 2CLYC 4XBFB 2YU2A 3PU8A 3UUNA 2XAQB 4AXPA 2V1DB 3N9PA 5LGNB 3CX8B 2LSIA 4U74A 5BMVE 2KLQA 2N9DA 5EK2A 3OJAA 5LG4A 4UF0B 5LJNA 3QC9A 2CXLA 2Z6EA 2ZLYA 3OBVE 4L5GA 4H9NC 2RP4A 5HYAA 4IE5A 3ZJ2A 3MA9A 2XAHB 3EUHA 4ISSA 5CA1E 4UIGA 4GK5E 2BVLA 5EK3A 2VKDA 2OA5A 5M4YA 3AA7B 5FY1A 2NW8A 2ES0A 5KDMC 1MMGA 3NRYA 4IE7A 3EVYA 2ZM0A 2VL8A 2KINB 4GYRA 3JC6C 3ZC0A 2MOZA 2V7IA 4C91A 2KWIB 4QHOA 1X79A 4H9QC 1U4QA 3AA0B 1QUUA 4IE0A 4ILUA 4AKRB 5HWXA 2W0GA 3C4XA 3F57A 3KV4A 4G63A 4TX5A 3AAIA 2ODVA 4AQFC 1Z0PA 2HPJA 4ASKA 1D0ZA 4L9IA 4UVCB 3F2EA 1UX5A 4UVBB 5L3DB 4OYKA 4O2BE 4V1Av 4NUVA 4WBNE 5FXVA 1WYBA 5JH7E 2WBLA 5JR9B 3HI2A 3HA4A 3QK6A 3E22E 4L0RA 3ZEFB 2E9XC 4GK0E 2HH7A 2PBIA 2CMRA 2V7LA 3MXZA 2I59A 5ETWA 4CI1B 3C98B 3AA6B 4MFRA 2JPFA 4TN7B 5CB4E 4GIWA 5JR9C 3MZKB 3HKCE 4X1IE 2BZBA 3C4ZA 3ONXA 2WMOA 1IZNB 2ACXA 3E08A 3N5LA 2NP9A 1VRBA 2VKJA 3I9YA 1US7B 2CM0A 2W61A 1S35A 4QX7B 1LKXA 3U78A 4PK4A 5TAOA 1B7TA 2KNDA 2XAGB 4ERRA 3C50A 3J7Yq 1BR4A 2X9WA 2YEVC 3P8CD 4H9OC 4DMVA 5LBQB 1MIVA 2CXDA 4P0AA 1UCUA 3N9QA 2V26A 4DBQA 2XAFB 5IHYA 4YJ2E 1Y64B 3N9MA 3Q2MA 4TZ4C 3N2GE 4H63V 2XUEA 4HFVA 2VKHA 3J9X1 1KK7A 4O8SA 2DNXA 1YD8G 5IYZE 1HCIA 1LVFA 3H3AA 2IAKA 4J2CA 5LJMA 5JREA 2DWKA 4QX8B 5LHGB 2LM9A 2WSSV 3K3QC 4Z8XA 1D0YA 2V7KA 4PK6A 3RYHE 4DBRA 3D0TA 4YJ3E 4QKNA 3NZQA 1SHZC 5EK4A 4H63H 4HGAA 4N78D 3RH3A 2LSYA 5FP3A 2JQQA 4AKGA 4PJJA 3CX7B 4ZI2D 4X20E 3GA8A 2H7VC 3AA1B 2QA7A 3CQGB 3KV5A 4BA9A 1BR2A 3LJCA 5FMNA 3ZCJA 2PFVA 3V5UA 3I9WA 2WM9A 2W00A 3K3NA 3LBXA 4PW8A 2LSKA 3AAAB 3VHLA 4ADZA 2NWBA 3N9LA 4BAYB 3PUSA 5HXCA 1MNDA 4G2AA 4ZI7E 3L3PA 2UXXB 3DP7A 2CCQA 2D5UA 2K5BB 4DVDA 5HXHA 3LFMA 3QUJA 4MALA 1HF8A 1ZV4X 2X9HA 1FMVA 2NW7A 4H9SE 2VWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYK A;  4P0B A;  5LJM A;  2HPL A;  4OYJ A;  2HPJ A;  4P09 A;  4P0A A;  2CM0 A;  2CCQ A;  4JUY A;  2D5U A;  5LJN A; 
#chains in the Genus database with same CATH topology
 2BDE A;  3RRC A;  2D9D A;  2YIN A;  4TV8 E;  3UFE A;  2RA1 A;  4IHJ E;  5LCY A;  5KX5 E;  2EHO D;  3O1J A;  2WDV A;  2H88 A;  2KT9 A;  1HNW T;  4IDQ A;  4CN4 A;  1XNR T;  4HEA A;  3Q5W A;  4O4H E;  4PAG A;  4DND A;  4B3S T;  2LJL A;  2HN1 A;  3ZMZ B;  3ZLI A;  5AQS B;  3AE4 A;  3E0Z A;  2EHO A;  3AAE B;  4QH5 A;  1G8X A;  4YY3 T;  4YXD A;  5ABF B;  3AXJ B;  2LRK A;  1E2A A;  4QWN B;  5LHI B;  1KNR A;  4HKA A;  2C0S A;  2X0H A;  4OYJ A;  2XQY A;  4IE4 A;  1NEK A;  2WU2 A;  1T8B A;  3VU7 H;  2X51 A;  4DV2 T;  1OED A;  2UU9 T;  1D1C A;  4HWH A;  3NRX A;  4ILC A;  5DAB A;  5LB7 B;  2Y48 B;  1HNX T;  2HHH T;  4AQG A;  4CQI A;  3KVA A;  4KMC A;  2Y6X A;  4KX6 A;  4QXC B;  4UVA B;  5DJQ C;  1VOM A;  2CWY A;  3A5X A;  2XY8 B;  4HFC A;  2MYS A;  5LA6 E;  2L8K A;  1KNZ A;  3NZP A;  3P4P A;  4EYY R;  3HKD E;  3WAK A;  5JQG E;  5FYM A;  4XZC A;  3A7M A;  4JV5 T;  1YKH B;  3TKL B;  2XM1 A;  2YDR A;  5HEH A;  5ABE A;  4EB6 E;  2K3W A;  3TLS A;  3I0Q A;  2WZI A;  3AVS A;  5LOV E;  2MTQ A;  4FI5 A;  5HXS A;  3P7I A;  3BQL A;  1M7K A;  4UF0 A;  4TWF A;  1HTJ F;  1OXZ A;  3CVR A;  3ZN0 B;  2Y8D A;  3PV0 F;  4ILB A;  4FJO A;  5JDM A;  3N9O A;  4ZHQ E;  3UU6 A;  2RPA A;  3V5S A;  2W67 A;  3UQ4 A;  2K48 A;  2V5D A;  3RF1 A;  3NBX X;  5L3B B;  2YU1 A;  2XSA A;  3I0O A;  4WBO A;  3AE8 A;  3AE7 A;  1CUN A;  3NKZ A;  3O4X E;  1XMO T;  4JEU B;  3R6N A;  4K0K T;  4I55 E;  5F5W A;  2EHO C;  3ZMV B;  1NAF A;  1ZKE A;  2XTL A;  1HX8 A;  3PUV F;  4LMJ A;  1XDP A;  4IST A;  3PU3 A;  2FJB A;  1MIW A;  3TLU A;  5FY7 A;  4DO0 A;  3ANW B;  3KIN B;  4PNI A;  2LHR A;  4I43 B;  3L09 A;  2GK9 A;  3AED A;  3KFW X;  2YK0 A;  4P09 A;  3GN5 B;  1JNZ A;  1LVK A;  4KP3 C;  5HCJ A;  2DWG A;  3SFD A;  4IL4 A;  2CE7 A;  4X62 T;  5JDH A;  1YQ3 A;  4EXT A;  4CXY A;  2CHO A;  3TLW A;  2ZM6 T;  4BJN A;  3N9N A;  4JI1 T;  5AQG B;  1MMN A;  5C8Y E;  4YFS A;  1UX4 A;  1D1A A;  5LYJ E;  2NTX A;  3RYI E;  3RKG A;  2YOE A;  3U3I A;  5AQU B;  2CLY B;  3RIA A;  4HFI A;  4B6X A;  2W66 A;  2W2U A;  4DR3 T;  4U3C A;  5JTG A;  3VRB A;  4WYV A;  3QC9 A;  4A98 A;  2Z6E A;  2ZLY A;  3OBV E;  4L5G A;  4HFE A;  4H9N C;  4KHZ F;  4IE5 A;  2XAH B;  4UIG A;  2VKD A;  2OA5 A;  5FY1 A;  3RQW A;  5KDM C;  1MMG A;  3NRY A;  2ZM0 A;  2VL8 A;  4GYR A;  4TNV A;  3JC6 C;  3ZC0 A;  4QHO A;  3ZT6 A;  3AA0 B;  3RI5 A;  3QB5 A;  4ZZB A;  4AQF C;  1D0Z A;  4WBN E;  5FXV A;  3HA4 A;  4LMK A;  2PBI A;  2I59 A;  2XQ8 A;  3RLF F;  2IUB A;  2H89 A;  3UU4 A;  2CBJ A;  3HKC E;  2BZB A;  2ACX A;  2FBW A;  2WZH A;  3E08 A;  3N5L A;  3OPC A;  4X66 T;  1XWM A;  1US7 B;  3G06 A;  1LKX A;  3UU3 A;  1UUS A;  2XAG B;  4ERR A;  2X9W A;  2YEV C;  4DMV A;  2CXD A;  4YSY A;  2UUB T;  1UCU A;  4DR4 T;  4LFB T;  4YTP A;  1Y64 B;  1KK7 A;  4ZXL A;  3AEG A;  1YXR A;  1YD8 G;  1HCI A;  4DV0 T;  5JRE A;  5CFB A;  5LHG B;  4TWH A;  1Z8U A;  4QKN A;  1SHZ C;  4H63 H;  1VCS A;  1FJG T;  5FP3 A;  4PJJ A;  3CX7 B;  4HFH A;  4DV7 T;  2H7V C;  3AA1 B;  3CQG B;  1BR2 A;  2WM9 A;  3K3N A;  2AXD S;  3LBX A;  3VHL A;  4ADZ A;  3NVO A;  4BAY B;  5HXC A;  1MND A;  4G2A A;  1XDO A;  5AQJ B;  1KEY A;  3DP7 A;  2K5B B;  2V6Y B;  4DVD A;  5AQP B;  2J4G A;  2PTF A;  1ZV4 X;  3RRW A;  2VUR A;  5FXZ A;  3ZMU B;  2X67 A;  4UEL A;  2W4X A;  2D2S A;  5L47 A;  2WWV A;  3SOL A;  3PUR A;  4JBW F;  2IIU A;  5H6Q B;  2G0U A;  1YKE B;  2E9X D;  4UXN B;  3H3M A;  3RGL A;  2ZM8 A;  2QYW A;  1IBK T;  2NW9 A;  3EDU A;  1HFA A;  3RYF E;  3CPZ A;  4HFB A;  2FJA A;  2VVN A;  4LF7 T;  1WR6 A;  3HR0 A;  2X68 A;  4TNW A;  1IJ6 A;  4ZS2 A;  2JQH A;  3CML A;  2E9X A;  2LRL A;  2XQ7 A;  2MBG A;  2LT3 A;  5JVD E;  1KFY A;  2YDS A;  4PFP A;  2VB6 A;  3S4U A;  4DID B;  4CZZ B;  4AKI A;  4X1Y E;  4MBQ A;  4UR9 A;  3ONL C;  3RIU C;  3P4W A;  4KUM B;  3TLV A;  4DR5 T;  4BJM A;  3ZYK A;  3K1S A;  2B1E A;  5L4E A;  4GKK T;  3BK9 A;  4IT4 A;  4UV9 B;  2P9B A;  3KV9 A;  3W15 B;  2XQ3 A;  3H37 A;  2UUC T;  3PTR B;  1HS7 A;  3AEB A;  4ZZC A;  4CXX A;  4OHF A;  3PJA A;  3RYC E;  3ESL A;  3P4Q A;  5A1L A;  4JI0 T;  2X0L B;  2JMH A;  5FVL A;  2XQ9 A;  3FZH B;  2IC6 A;  4F8H A;  3VKH A;  2V7M A;  1SA0 E;  2XQ4 A;  4TWD A;  3RC3 A;  4Z90 A;  3DTO A;  3PUA A;  2A3D A;  3RC8 A;  5JDN A;  1WRD A;  4ZI3 C;  1YW0 A;  2K9A A;  1G73 A;  2LSG A;  1U5P A;  2FJE A;  4GYS A;  4I4T E;  5KMG P;  5LGU B;  2LOP A;  4PK5 A;  4O4L E;  5AQF B;  1FEW A;  3WAJ A;  4NUU A;  3RKO A;  4HWF A;  3O1H A;  5AQO B;  3IA3 A;  3ZC1 A;  2H3R A;  4EAH A;  3EDV A;  2CA5 A;  2FUP A;  3AE6 A;  4JI7 T;  5F8P A;  2KWH A;  4I50 E;  5JDQ A;  5F3J A;  3PDY A;  5HXR A;  5JRC B;  2KSR A;  3FHN A;  1IJ5 A;  1QSD A;  3K8P C;  3VRA A;  4O2A E;  3ZT7 A;  2CRB A;  4JUY A;  2X0Y A;  3ZMT B;  5JR9 A;  4P0B A;  2IML A;  3UT5 E;  3RPU A;  3ETU A;  2BG9 B;  2WDR A;  4M1P A;  3IHR A;  4XAX B;  2LE8 A;  2VAS A;  3C64 A;  4YLH A;  2XAJ B;  4DUZ T;  3VR8 A;  3LG7 A;  3FZF B;  1ZHC A;  4EEB A;  5J0Z A;  3SWH A;  4UEM A;  2BS4 A;  3FZK B;  2LKG A;  4KHP T;  4LF4 T;  2Q9Q B;  2C5K T;  2CHN A;  5DQW A;  4K0U A;  4JI5 T;  1HG5 A;  2V6X A;  3UUB A;  4HWD A;  4UV8 B;  2JQK A;  1XZY A;  3O1I A;  2C5J A;  4NXN T;  1ZEE A;  4H9P C;  4CN6 A;  5ABH A;  3FXD B;  4YSZ A;  3B57 A;  2L9Q A;  2BG9 E;  2XQ5 A;  4O4I E;  2D0U A;  4E7S A;  1WR0 A;  3PU8 A;  3UUN A;  2MPK A;  2LSI A;  5BMV E;  2KLQ A;  2WY2 A;  2FJD A;  5LG4 A;  1W09 A;  5LJN A;  2WCA A;  2RP4 A;  2E5L T;  3LDQ B;  5AQI B;  1M62 A;  5M4Y A;  2YKS A;  2NW8 A;  2KIN B;  2MOZ A;  4C91 A;  1X79 A;  1U4Q A;  4DUY T;  2OV9 A;  4IDN A;  4G63 A;  4TX5 A;  4B3M T;  4B3R T;  5ABF A;  4L9I A;  4UVC B;  4UVB B;  5L3D B;  3AXJ A;  5FL1 A;  4O2B E;  4V1A v;  1DU2 A;  2WS3 A;  5JH7 E;  3EI0 A;  3UU8 A;  1UGO A;  3HI2 A;  3QK6 A;  2HH7 A;  2V7L A;  1UK5 A;  4CI1 B;  4LF5 T;  5AQR B;  5JR9 C;  3UU5 A;  2JQ9 A;  1IZN B;  1OED C;  1VRB A;  2VKJ A;  3I9Y A;  1S35 A;  2J62 A;  3M3Z B;  1XMQ T;  1WCR A;  5TAO A;  3ZKR A;  3J7Y q;  3P8C D;  3L39 A;  4QH1 A;  3L8R A;  2XAF B;  5IHY A;  3N9M A;  4TZ4 C;  4H63 V;  4QH4 A;  1LVF A;  5LJM A;  4LFA T;  2I6H A;  4PK6 A;  2BS2 A;  5FVK A;  3D0T A;  3NZQ A;  2I0M A;  3RQU A;  2CPT A;  2JQQ A;  5AQT B;  4ZI2 D;  3GA8 A;  1I6Z A;  5FMN A;  3V5U A;  2W00 A;  3T1Y T;  3AAA B;  4AIS A;  2CBI A;  4DV1 T;  4MAL A;  2X9H A;  2VVS A;  3ZMS B;  3ZJ1 A;  2WP9 A;  1I94 T;  3EAB A;  3PUQ A;  4PJM A;  4HWI B;  5KXJ A;  4U7I A;  3UQ7 A;  1MMD A;  1CHU A;  1W0A A;  3HKB E;  3AEE A;  2B76 A;  5JDL A;  2MAW A;  4X65 T;  1H7C A;  5JDF A;  2KZ7 B;  3B13 A;  4YTM A;  5HXE A;  5LHH B;  3P50 A;  4CI3 B;  5L3F B;  3C4W A;  5BR8 T;  2HPL A;  2QGS A;  2KXP B;  2CXF A;  5FXW A;  3PUZ F;  4U72 A;  3R84 B;  4DV3 T;  4PJL A;  1O3X A;  3OYZ A;  4X1K E;  3RX6 A;  3ANW A;  3FZM B;  3OTO T;  3UUM A;  3MK7 C;  2H7O A;  1SE7 A;  1ZP0 A;  2VKO A;  3GN5 A;  5LP6 E;  3PUY F;  4WNK A;  5L3G B;  5LG3 A;  3NWI A;  1MMA A;  2OLT A;  1T7S A;  4OFZ A;  2UXB T;  2CWO A;  3KBT A;  1FMW A;  1NWM X;  5J2T E;  2WWU A;  2D0T A;  3FXE B;  3AE1 A;  5CJ5 A;  3KVB A;  3AB3 B;  1JNR A;  3WI3 A;  1HG2 A;  4IDO A;  3ZCI A;  2WU5 A;  2VQE T;  2QRX A;  3UUL A;  4KI0 F;  1W0B A;  3MAC A;  3UTK A;  4EYU A;  4CI2 B;  2WQY A;  2M67 A;  2VQF T;  2SPC A;  3BQK A;  4DV6 T;  4YHJ A;  4ZI2 C;  5FY0 A;  3AVR A;  3IF8 B;  3AE9 A;  3MKD A;  1E1H B;  2LEH A;  4GKJ T;  2JIW A;  2NOX A;  5L2L A;  5ADX L;  5FXX A;  4A5X A;  3ONJ A;  4DV4 T;  3BQI A;  2K24 A;  4NIQ A;  4HFD A;  2XQ6 A;  1HR0 T;  4O4J E;  2X9X A;  2EHO B;  2LHN A;  2WAU A;  4IE6 A;  2KMF A;  4ANJ A;  1EZ3 A;  3CQC B;  5L4H A;  1MNE A;  4PFO A;  1X9B A;  1Y01 A;  1OED B;  3AEA A;  2PG8 A;  2ODU A;  1D0X A;  4IDP A;  5HAX A;  3AEF A;  4ZOL E;  4JI3 T;  3P4R A;  5AFU L;  4HN9 A;  4JI4 T;  4EZH A;  3Q5X A;  2LLY A;  3Q9D A;  5FNV E;  2W63 A;  4AIU A;  1T98 A;  3GMI A;  5AQL B;  4EIW A;  4DR7 T;  3CX6 B;  2WMN A;  3OVU A;  3LK3 B;  1NEN A;  3CKD A;  2IC9 A;  2XAS B;  3LK2 B;  4B3T T;  2IW5 B;  2E5V A;  2V6Y A;  1OED E;  4GOU A;  1WFD A;  2CLY C;  2YU2 A;  4AXP A;  2V1D B;  5LGN B;  3CX8 B;  4LFC T;  5C3J A;  4UF0 B;  3AEC A;  2CXL A;  4JI6 T;  2VL0 A;  1N34 T;  5ABG A;  4LF8 T;  5CA1 E;  4ISS A;  2BVL A;  5EK3 A;  3AA7 B;  3A8Y C;  3T1H T;  3EVY A;  4DV5 T;  2V7I A;  1N36 T;  4A97 A;  2KWI B;  1QUU A;  4IE0 A;  4OX9 T;  2WDQ A;  2ODV A;  4P1N A;  1UX5 A;  4DR2 T;  5AQM B;  2WBL A;  2A9U A;  4L0R A;  3E22 E;  2E9X C;  1N33 T;  2CMR A;  3MXZ A;  5ETW A;  4MFR A;  5AQN B;  4X1I E;  2BKO A;  3ONX A;  3LSV A;  5IWA T;  2YDQ A;  4U2Y A;  1J1J A;  4PK4 A;  2KND A;  3ZSS A;  5HEJ A;  3C50 A;  1BR4 A;  4H9O C;  3PUX F;  1MIV A;  3N9Q A;  5HCM A;  2V26 A;  4COF A;  4DBQ A;  4YT0 A;  4YJ2 E;  1HX1 B;  1QLB A;  3Q2M A;  3N2G E;  4HFV A;  3J9X 1;  2ACZ A;  4O8S A;  2DNX A;  1IBM T;  5IYZ E;  2BBJ A;  2DWK A;  2WSS V;  4DBR A;  2V7K A;  4YJ3 E;  5EK4 A;  4HGA A;  1T72 A;  4N78 D;  3RH3 A;  2LSY A;  4AKG A;  4IRE A;  4BA9 A;  3LJC A;  3P4S A;  4EV6 A;  2PFV A;  4PW8 A;  2HN2 A;  1W9R A;  5HEO A;  4Z91 A;  2NWB A;  3PUS A;  3RIF A;  2UXX B;  3AE5 A;  2D5U A;  3Q5E A;  3Q5D A;  5FKY A;  3LFM A;  2UUA T;  1HF8 A;  1FMV A;  3JC6 D;  2NW7 A;  5AQH B;  3SS1 A;  4F6R C;  2DI4 A;  4QXH B;  2JJ9 A;  3JAD A;  3M65 A;  4HWC A;  4EGW A;  3SRZ A;  4JLE A;  2V8S V;  4Q25 A;  3T8O A;  3VKG A;  2A72 A;  1SUM B;  4U31 A;  3IEE A;  3PUG A;  5AQK B;  1UUR A;  2CEA A;  4ZS3 A;  1MIY A;  3ZST A;  5LGT B;  3AE3 A;  5FL0 A;  5AQQ B;  4H9R C;  3F31 A;  4DR6 T;  3ZPO A;  4U7Y A;  1WYC A;  4AKL A;  2E8I A;  5JRC A;  4AQF A;  4DR1 T;  5L3C B;  3CQX C;  2QVA A;  2WB5 A;  4JI8 T;  4ILA A;  2UXC T;  3JAF A;  5EZY E;  2V5C A;  3KV6 A;  4TV9 E;  2NR4 A;  2BG9 A;  4OK0 A;  3FBZ A;  2BKP A;  1J5E T;  2UXD T;  4YHH T;  3EAM A;  2Q9Q D;  3LK4 2;  3HL6 A;  1HNZ T;  2J47 A;  4E7Z A;  2BS3 A;  4JYA T;  1BR0 A;  4QXB B;  4WW0 A;  3UFG A;  3JAE A;  1E7P A;  4LF9 T;  4EED A;  4NPP A;  2JRK A;  2DCF A;  3FBL A;  5J1G A;  4AKH A;  3OYX A;  1IBL T;  2Q9Q A;  2A2F X;  4PJN A;  4YTN A;  3IBP A;  5LMU T;  4HTE A;  2XHE B;  3TLT A;  3UUX B;  2BVM A;  3CWZ B;  1AJ3 A;  2IHR 1;  2V7J A;  4HE8 A;  4YSX A;  5J2U E;  2M6B A;  4AQY T;  3LBX B;  1BR1 A;  2X66 A;  3ZN1 B;  3FB2 A;  1VCT A;  2LOS A;  2XSB A;  3CIR A;  2DLR A;  4IL9 A;  1LRZ A;  3PUW F;  4EOZ B;  3OKQ A;  1XNQ T;  3MJX A;  4AI6 A;  2AE9 A;  3X1D A;  2PJQ A;  2NTY A;  2UXN B;  1WLX A;  2ZM2 A;  2JMK A;  5HWY A;  3SFE A;  2M6I A;  3ABV A;  2YN6 A;  5JDG A;  3N2K E;  3ETV A;  4IIJ E;  2VK9 A;  2J1D G;  1OWA A;  3KBU A;  4JEH B;  2X9Y A;  3GWH A;  2LSJ A;  2L3L A;  4DMW A;  1ZOY A;  5C2T A;  2N2N A;  2E9X B;  2C5I T;  2N1G A;  4IGU A;  3ZYM A;  1V9D A;  3C51 A;  5CA0 E;  5L3E B;  4TUY E;  2BG9 C;  3PE0 A;  2LKH A;  5LNK A;  1N32 T;  5DQV A;  3RIU A;  4EZ4 A;  2XM2 A;  3FZL B;  2DHR A;  1D1B A;  1S94 A;  2R6G F;  1IAP A;  5LBM A;  5GON E;  3I1A A;  4C90 A;  2XQA A;  3ZYL A;  5H6R B;  4MLK A;  4A56 A;  3QNU A;  2ZMA A;  5AQV B;  3N2O A;  2W62 A;  4MHC A;  3K3O A;  4ZI3 D;  2Q9Q C;  2DL1 A;  3HKE E;  1FIO A;  5HEG A;  4X5T A;  1J5W A;  4U2Z A;  3DJB A;  1KF6 A;  3B5M A;  4CXW A;  4KBM B;  5E0O A;  5LXT E;  3O9X A;  3VR9 A;  1R8I A;  4IDZ A;  3KDS E;  4XBF B;  4ZEY A;  2XAQ B;  5HEU A;  3N9P A;  3JCF A;  4U74 A;  2N9D A;  5EK2 A;  3OJA A;  5CGM A;  4I0U A;  2E2A A;  3QOF A;  5HYA A;  3ZJ2 A;  3MA9 A;  3EUH A;  2IDO B;  4GK5 E;  5LMN T;  2ES0 A;  4IE7 A;  4H9Q C;  4ILU A;  4AKR B;  5HWX A;  2W0G A;  3C4X A;  3F57 A;  3KV4 A;  4U33 A;  4LF6 T;  3AAI A;  4NXM T;  1L0V A;  1Z0P A;  2HPJ A;  4ASK A;  2XJ7 A;  3F2E A;  4OYK A;  3EHZ A;  4NUV A;  5IUX A;  1WYB A;  4WZX A;  5JR9 B;  3ZEF B;  4GK0 E;  3C98 B;  3AA6 B;  2JPF A;  2XPK A;  4TN7 B;  5CB4 E;  4GIW A;  3ZT5 A;  3MZK B;  2LM2 A;  3C4Z A;  2WMO A;  2NP9 A;  2BBH A;  4QX7 B;  2CM0 A;  2W61 A;  3U78 A;  3QB5 K;  1B7T A;  3CK6 A;  5LBQ B;  4P0A A;  1GQE A;  2XUE A;  2VKH A;  2XZE A;  3H3A A;  2IAK A;  4J2C A;  3RHW A;  4QX8 B;  2LM9 A;  3K3Q C;  3RYH E;  4Z8X A;  1D0Y A;  3PJA J;  4X20 E;  3KV5 A;  2QA7 A;  4JI2 T;  3ZCJ A;  1YQ4 A;  3I9W A;  3AE2 A;  4LML A;  2LSK A;  4X64 T;  1KNP A;  2BKN A;  3N9L A;  2F4V T;  4ZI7 E;  3L3P A;  2CCQ A;  5HXH A;  3QUJ A;  4CN1 A;  4H9S E;  2VWA A; 
#chains in the Genus database with same CATH homology
 3RRW A;  2BDE A;  5FXZ A;  2DI4 A;  4QXH B;  2JJ9 A;  3RRC A;  3ZMS B;  3M65 A;  3ZJ1 A;  2YIN A;  4TV8 E;  3SRZ A;  4JLE A;  2X67 A;  2RA1 A;  3UFE A;  3ZMU B;  4UEL A;  3PUQ A;  3T8O A;  4IHJ E;  5LCY A;  3VKG A;  5KX5 E;  2A72 A;  4PJM A;  2EHO D;  3O1J A;  2D2S A;  3IEE A;  3SOL A;  3PUR A;  3PUG A;  1MMD A;  2KT9 A;  2CEA A;  4ZS3 A;  1MIY A;  5LGT B;  3HKB E;  5H6Q B;  4HEA A;  2G0U A;  1YKE B;  2E9X D;  3Q5W A;  5JDL A;  4UXN B;  4O4H E;  4PAG A;  4DND A;  2ZM8 A;  4H9R C;  3F31 A;  2LJL A;  2NW9 A;  3ZPO A;  1H7C A;  1WYC A;  3EDU A;  5JDF A;  3ZMZ B;  1HFA A;  3ZLI A;  4AKL A;  2E8I A;  5JRC A;  3RYF E;  2KZ7 B;  3CPZ A;  4AQF A;  3B13 A;  3E0Z A;  2EHO A;  5L3C B;  3CQX C;  3AAE B;  1G8X A;  5HXE A;  5LHH B;  4CI3 B;  1WR6 A;  3HR0 A;  2X68 A;  5L3F B;  1IJ6 A;  3C4W A;  4ZS2 A;  2HPL A;  2QGS A;  3CML A;  2E9X A;  2KXP B;  4QWN B;  5LHI B;  5EZY E;  2MBG A;  2CXF A;  3KV6 A;  4HKA A;  2C0S A;  2LT3 A;  4TV9 E;  5FXW A;  4OYJ A;  5JVD E;  2XQY A;  4OK0 A;  4U72 A;  4IE4 A;  3FBZ A;  3R84 B;  4PFP A;  2VB6 A;  3VU7 H;  3S4U A;  2X51 A;  4PJL A;  4CZZ B;  1O3X A;  3OYZ A;  4X1K E;  1D1C A;  4AKI A;  2Q9Q D;  3LK4 2;  3HL6 A;  4X1Y E;  3NRX A;  4MBQ A;  3RX6 A;  5DAB A;  3ANW A;  4E7Z A;  2Y48 B;  3UUM A;  3MK7 C;  2H7O A;  1BR0 A;  4QXB B;  4WW0 A;  4AQG A;  4KUM B;  4CQI A;  4BJM A;  3KVA A;  3ZYK A;  4KMC A;  2B1E A;  2Y6X A;  2VKO A;  4QXC B;  2JRK A;  2DCF A;  3JC6 D;  3FBL A;  3GN5 A;  5LP6 E;  5J1G A;  4AKH A;  4UVA B;  3OYX A;  3BK9 A;  4WNK A;  5L3G B;  2Q9Q A;  4UV9 B;  2A2F X;  2P9B A;  4PJN A;  3IBP A;  1MMA A;  5DJQ C;  3KV9 A;  1VOM A;  3W15 B;  2CWY A;  3H37 A;  3A5X A;  4HTE A;  3PTR B;  4OFZ A;  2MYS A;  2XHE B;  2CWO A;  5LA6 E;  1HS7 A;  3UUX B;  2L8K A;  3KBT A;  1KNZ A;  2BVM A;  3CWZ B;  4CXX A;  1AJ3 A;  3NZP A;  4OHF A;  4EYY R;  3HKD E;  3WAK A;  1FMW A;  5JQG E;  1NWM X;  3RYC E;  5J2T E;  3ESL A;  2WWU A;  2V7J A;  5A1L A;  5FYM A;  2D0T A;  3FXE B;  2X0L B;  2JMH A;  4HE8 A;  4XZC A;  2IC6 A;  5J2U E;  3VKH A;  1YKH B;  2V7M A;  1SA0 E;  3KVB A;  3AB3 B;  3TKL B;  3RC3 A;  3LBX B;  1BR1 A;  2X66 A;  3ZN1 B;  3DTO A;  3FB2 A;  2LOS A;  3PUA A;  4EB6 E;  3WI3 A;  2DLR A;  3I0Q A;  1HG2 A;  2A3D A;  3RC8 A;  1LRZ A;  3ZCI A;  5JDN A;  1WRD A;  4ZI3 C;  1YW0 A;  3AVS A;  2K9A A;  1G73 A;  5LOV E;  4EOZ B;  3UUL A;  3OKQ A;  2LSG A;  2MTQ A;  1U5P A;  4FI5 A;  5HXS A;  4GYS A;  3P7I A;  4I4T E;  5KMG P;  3SS1 A;  3MAC A;  3UTK A;  5LGU B;  3BQL A;  4EYU A;  4CI2 B;  2LOP A;  4UF0 A;  4PK5 A;  1HTJ F;  1OXZ A;  4O4L E;  2M67 A;  3CVR A;  3MJX A;  3ZN0 B;  2Y8D A;  2SPC A;  3BQK A;  4AI6 A;  1FEW A;  4YHJ A;  4ZI2 C;  3WAJ A;  4NUU A;  5FY0 A;  3AVR A;  3RKO A;  4FJO A;  4ZHQ E;  3IF8 B;  3N9O A;  3O1H A;  2PJQ A;  5JDM A;  3MKD A;  1E1H B;  2LEH A;  2NTY A;  2UXN B;  3ZC1 A;  1WLX A;  2H3R A;  4EAH A;  2ZM2 A;  3V5S A;  2NOX A;  3EDV A;  5L2L A;  2CA5 A;  2JMK A;  5HWY A;  5ADX L;  5FXX A;  2K48 A;  3NBX X;  5JDG A;  5L3B B;  5F8P A;  2KWH A;  3BQI A;  2K24 A;  3N2K E;  4I50 E;  5JDQ A;  2YU1 A;  3ETV A;  5F3J A;  3I0O A;  4IIJ E;  4WBO A;  2VK9 A;  3PDY A;  2J1D G;  5HXR A;  1OWA A;  4O4J E;  5JRC B;  3KBU A;  2X9X A;  3FHN A;  4JEH B;  1IJ5 A;  1CUN A;  1QSD A;  3K8P C;  4O2A E;  2EHO B;  2X9Y A;  3GWH A;  3O4X E;  2LSJ A;  4JUY A;  2LHN A;  4JEU B;  2L3L A;  2WAU A;  3R6N A;  3ZMT B;  4DMW A;  2N2N A;  4I55 E;  2E9X B;  2C5I T;  5JR9 A;  4P0B A;  2EHO C;  4IE6 A;  2KMF A;  3ZMV B;  1NAF A;  1ZKE A;  2N1G A;  4ANJ A;  3UT5 E;  4IGU A;  4F6R C;  3RPU A;  1EZ3 A;  3ETU A;  2XTL A;  1HX8 A;  4M1P A;  3ZYM A;  3IHR A;  3CQC B;  1V9D A;  3C51 A;  4IST A;  5CA0 E;  1MNE A;  3PU3 A;  4XAX B;  4PFO A;  5L3E B;  1MIW A;  2LE8 A;  2VAS A;  3C64 A;  4TUY E;  4YLH A;  2XAJ B;  5FY7 A;  2PG8 A;  3PE0 A;  5LNK A;  2ODU A;  4DO0 A;  1D0X A;  3LG7 A;  5DQV A;  4EZ4 A;  3ANW B;  5HAX A;  1ZHC A;  3KIN B;  2DHR A;  4PNI A;  1D1B A;  1S94 A;  4ZOL E;  2LHR A;  1IAP A;  3SWH A;  4UEM A;  4I43 B;  5LBM A;  5GON E;  3L09 A;  3I1A A;  5AFU L;  4HN9 A;  2GK9 A;  4C90 A;  3KFW X;  2YK0 A;  4P09 A;  3GN5 B;  1LVK A;  4EZH A;  4KP3 C;  2DWG A;  3ZYL A;  2Q9Q B;  3Q5X A;  2C5K T;  5H6R B;  2CE7 A;  3Q9D A;  5FNV E;  5JDH A;  4MLK A;  4A56 A;  5DQW A;  2W63 A;  4K0U A;  4EXT A;  4CXY A;  1HG5 A;  2ZMA A;  3N2O A;  2W62 A;  4MHC A;  3K3O A;  4ZI3 D;  2Q9Q C;  3HKE E;  1T98 A;  4BJN A;  4UV8 B;  3N9N A;  1FIO A;  1MMN A;  3GMI A;  5C8Y E;  4YFS A;  3O1I A;  4EIW A;  2C5J A;  1UX4 A;  1D1A A;  5LYJ E;  1ZEE A;  2NTX A;  3DJB A;  3RYI E;  3CX6 B;  2WMN A;  4H9P C;  3FXD B;  3LK3 B;  3U3I A;  4CXW A;  3CKD A;  3B57 A;  2L9Q A;  2IC9 A;  4KBM B;  2CLY B;  5E0O A;  5LXT E;  2XAS B;  3LK2 B;  4O4I E;  2IW5 B;  2D0U A;  3O9X A;  4B6X A;  4E7S A;  4IDZ A;  4GOU A;  3KDS E;  2CLY C;  4XBF B;  2YU2 A;  3PU8 A;  3UUN A;  2XAQ B;  4AXP A;  2V1D B;  3N9P A;  5LGN B;  3CX8 B;  2LSI A;  4U74 A;  5BMV E;  2KLQ A;  2N9D A;  5EK2 A;  3OJA A;  5LG4 A;  4UF0 B;  5LJN A;  3QC9 A;  2CXL A;  2Z6E A;  2ZLY A;  3OBV E;  4L5G A;  4H9N C;  2RP4 A;  5HYA A;  4IE5 A;  3ZJ2 A;  3MA9 A;  2XAH B;  3EUH A;  4ISS A;  5CA1 E;  4UIG A;  4GK5 E;  2BVL A;  5EK3 A;  2VKD A;  2OA5 A;  5M4Y A;  3AA7 B;  5FY1 A;  2NW8 A;  2ES0 A;  5KDM C;  1MMG A;  3NRY A;  4IE7 A;  3EVY A;  2ZM0 A;  2VL8 A;  2KIN B;  4GYR A;  3JC6 C;  3ZC0 A;  2MOZ A;  2V7I A;  4C91 A;  2KWI B;  4QHO A;  1X79 A;  4H9Q C;  1U4Q A;  3AA0 B;  1QUU A;  4IE0 A;  4ILU A;  4AKR B;  5HWX A;  2W0G A;  3C4X A;  3F57 A;  3KV4 A;  4G63 A;  4TX5 A;  3AAI A;  2ODV A;  4AQF C;  1Z0P A;  2HPJ A;  4ASK A;  1D0Z A;  4L9I A;  4UVC B;  3F2E A;  1UX5 A;  4UVB B;  5L3D B;  4OYK A;  4O2B E;  4V1A v;  4NUV A;  4WBN E;  5FXV A;  1WYB A;  5JH7 E;  2WBL A;  5JR9 B;  3HI2 A;  3HA4 A;  3QK6 A;  3E22 E;  4L0R A;  3ZEF B;  2E9X C;  4GK0 E;  2HH7 A;  2PBI A;  2CMR A;  2V7L A;  3MXZ A;  2I59 A;  5ETW A;  4CI1 B;  3C98 B;  3AA6 B;  4MFR A;  2JPF A;  4TN7 B;  5CB4 E;  4GIW A;  5JR9 C;  3MZK B;  3HKC E;  4X1I E;  2BZB A;  3C4Z A;  3ONX A;  2WMO A;  1IZN B;  2ACX A;  3E08 A;  3N5L A;  2NP9 A;  1VRB A;  2VKJ A;  3I9Y A;  1US7 B;  2CM0 A;  2W61 A;  1S35 A;  4QX7 B;  1LKX A;  3U78 A;  4PK4 A;  5TAO A;  1B7T A;  2KND A;  2XAG B;  4ERR A;  3C50 A;  3J7Y q;  1BR4 A;  2X9W A;  2YEV C;  3P8C D;  4H9O C;  4DMV A;  5LBQ B;  1MIV A;  2CXD A;  4P0A A;  1UCU A;  3N9Q A;  2V26 A;  4DBQ A;  2XAF B;  5IHY A;  4YJ2 E;  1Y64 B;  3N9M A;  3Q2M A;  4TZ4 C;  3N2G E;  4H63 V;  2XUE A;  4HFV A;  2VKH A;  3J9X 1;  1KK7 A;  4O8S A;  2DNX A;  1YD8 G;  5IYZ E;  1HCI A;  1LVF A;  3H3A A;  2IAK A;  4J2C A;  5LJM A;  5JRE A;  2DWK A;  4QX8 B;  5LHG B;  2LM9 A;  2WSS V;  3K3Q C;  4Z8X A;  1D0Y A;  2V7K A;  4PK6 A;  3RYH E;  4DBR A;  3D0T A;  4YJ3 E;  4QKN A;  3NZQ A;  1SHZ C;  5EK4 A;  4H63 H;  4HGA A;  4N78 D;  3RH3 A;  2LSY A;  5FP3 A;  2JQQ A;  4AKG A;  4PJJ A;  3CX7 B;  4ZI2 D;  4X20 E;  3GA8 A;  2H7V C;  3AA1 B;  2QA7 A;  3CQG B;  3KV5 A;  4BA9 A;  1BR2 A;  3LJC A;  5FMN A;  3ZCJ A;  2PFV A;  3V5U A;  3I9W A;  2WM9 A;  2W00 A;  3K3N A;  3LBX A;  4PW8 A;  2LSK A;  3AAA B;  3VHL A;  4ADZ A;  2NWB A;  3N9L A;  4BAY B;  3PUS A;  5HXC A;  1MND A;  4G2A A;  4ZI7 E;  3L3P A;  2UXX B;  3DP7 A;  2CCQ A;  2D5U A;  2K5B B;  4DVD A;  5HXH A;  3LFM A;  3QUJ A;  4MAL A;  1HF8 A;  1ZV4 X;  2X9H A;  1FMV A;  2NW7 A;  4H9S E;  2VWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...