4OYJA

Structure of the apo hoip pub domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 60
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oyjA00
4OYKA 2CCQA 4OYJA 4JUYA 4P09A 4P0AA 5LJMA 2HPLA 2CM0A 4P0BA 5LJNA 2D5UA 2HPJA
chains in the Genus database with same CATH superfamily
2N1GA 4OX9T 3RRWA 5L3CB 5CFBA 1IJ6A 3L09A 2KSRA 1O3XA 3A8YC 3NRXA 3LK2B 4CI1B 3EHZA 4YT0A 2BS3A 4PK6A 1YXRA 2XZEA 2BS4A 5HWYA 4Q25A 4ZS2A 2LRKA 3N2KE 2BG9E 2CLYB 4WNKA 1ZOYA 5KDMC 3Q9DA 4YJ2E 2BVLA 5JR9B 2AE9A 2XQ6A 3I9WA 3I9YA 4IE5A 3PJAJ 4ZI2D 3EI0A 3AEAA 3N5LA 4CN6A 2BKOA 4LFBT 4AXPA 3LBXB 2HPJA 4WW0A 5EK3A 2QVAA 5AQSB 1KNRA 1LKXA 4ASKA 4O4JE 3OBVE 4EEDA 3GA8A 4O2BE 3X1DA 2W63A 3KBUA 4QH1A 5LGTB 4Z8XA 2XAJB 2HHHT 3NZPA 4FJOA 2K5BB 3AAEB 3B13A 4E7SA 4H9SE 5IWAT 4JI5T 1D0YA 1YQ4A 4CZZB 2AXDS 4PFOA 2HPLA 3C4WA 5HEGA 3QB5A 2XSBA 3VU7H 4IL9A 3FZMB 1U4QA 2VKDA 2WB5A 3NBXX 4ILUA 4IDPA 3ETUA 4ISTA 3L39A 3AE8A 2ZM8A 3OPCA 2J4GA 4JI1T 5TAOA 2N9DA 4O4HE 3PUVF 2V6XA 3I0OA 5AQRB 5JR9A 3LG7A 5AFUL 2UXXB 1XMQT 4EB6E 3FBLA 3L8RA 3ESLA 4ZI7E 5FXWA 2XM2A 4UVAB 5LCYA 2VWAA 3FZLB 5ETWA 4JEHB 2EHOB 2XQYA 5L3EB 4LF6T 3HL6A 5ABEA 3OTOT 4F6RC 2XSAA 2QA7A 4UF0A 3E22E 4PW8A 4ILBA 2B1EA 3GN5B 4CXWA 3AAAB 3AVRA 4PNIA 3M65A 3LJCA 3PDYA 4PK4A 3KVAA 5FXXA 4HFEA 2MPKA 5BR8T 1QLBA 3PU3A 2IUBA 4ZZBA 4U7IA 4PFPA 4O8SA 4TX5A 2C0SA 1Y64B 4LF9T 3TKLB 5JQGE 3PV0F 5LBMA 2NTYA 4DR7T 3ZCJA 3NVOA 2UXDT 2WMNA 2WY2A 3P4PA 1L0VA 3ZT6A 2W62A 3ANWB 2BDEA 1W9RA 2UUBT 4UELA 3ONXA 3ZYMA 2FJDA 5ADXL 2X9YA 1MMGA 3A5XA 2RP4A 4DVDA 3MACA 4IIJE 2W2UA 2J62A 3C51A 2JQQA 4HWIB 5HWXA 2X66A 2QGSA 2XM1A 2CBIA 2WQYA 3H37A 1EZ3A 4HEAA 4EIWA 4A98A 4U33A 1NWMX 3MK7C 2LSYA 2CRBA 4EAHA 1WYCA 1LVKA 4MLKA 3N9MA 3NKZA 1IZNB 2VKOA 2ODVA 2W67A 3PURA 4QX8B 3U78A 1T72A 2XQ8A 2BKNA 3UUNA 3N2OA 2JJ9A 5AQIB 4LF7T 1UUSA 5JDLA 3MA9A 1CUNA 5HXCA 3UU4A 5LP6E 2K24A 2VQET 1D1CA 2C5KT 3SFEA 3RYHE 2WS3A 5CB4E 3OYZA 2OV9A 1D1AA 4IE6A 3ZKRA 3ZJ1A 3T1HT 3RHWA 1E7PA 4DNDA 3RIUC 4AI6A 3CVRA 3Q5EA 2DWGA 1HG2A 2MAWA 2BG9A 5CGMA 2WSSV 3C64A 2OA5A 2YOEA 2H88A 2F4VT 2IC6A 3CQCB 1VRBA 3EVYA 2E9XC 3RKOA 2Y6XA 4TNWA 1D1BA 5JDNA 4YTMA 2L3LA 4AQFC 2LEHA 3RI5A 2ZLYA 3HKCE 4HKAA 4IREA 3MJXA 4UV9B 4C91A 3AXJB 3W15B 3JAFA 2WBLA 4IL4A 2YU2A 3B5MA 1UCUA 2LHRA 4BJMA 4LMKA 4H9RC 3RF1A 2CWOA 4F8HA 3ZSSA 4TNVA 3RYIE 3KINB 5JDHA 3IF8B 4MALA 3ZN0B 1BR1A 5HCJA 3P4WA 1U5PA 5HEHA 4U72A 1BR0A 2CEAA 5H6QB 4UR9A 5AQHB 5GONE 1XWMA 3RC3A 4C90A 4GOUA 4WBNE 4UVCB 5CJ5A 1MIYA 2D9DA 2FJAA 2LE8A 3AECA 4NXNT 4KHPT 1G8XA 3B57A 3N9PA 4JI6T 4LF5T 5HEUA 2WZIA 5LJNA 2DL1A 2IW5B 1IBLT 4GYRA 3ZYLA 4QXCB 3S4UA 3UU6A 3AA0B 4A97A 1KFYA 3RQWA 2E9XD 3I0QA 3UT5E 4U31A 3AXJA 5CA1E 4HFVA 2M6BA 4H9OC 3P50A 4NUUA 5FNVE 2LOSA 1HS7A 1NEKA 1ZEEA 3UU3A 2WCAA 2VKJA 3K8PC 4H63V 3SOLA 3DTOA 1MIWA 3AE9A 1WCRA 2PTFA 2JMKA 3R6NA 5AQNB 2I6HA 5AQOB 3UTKA 2DHRA 3RQUA 3AE7A 5A1LA 3FBZA 1E2AA 5LB7B 3ONJA 3ONLC 4DV7T 3Q5XA 1T8BA 1V9DA 5L3BB 3I1AA 1OEDC 2LRLA 1M7KA 4BJNA 4EYUA 3VRAA 3PUXF 4EGWA 5KXJA 5HEJA 4BA9A 4HWCA 4L9IA 4QH5A 4IE7A 1D0ZA 4NXMT 5LNKA 2X0LB 2JMHA 5FY7A 5LHGB 3RGLA 5HYAA 2CHOA 3P4SA 2PG8A 4X65T 2VB6A 2X68A 4KUMB 5LOVE 3PU8A 1YKHB 2A3DA 3A7MA 4GK5E 1W0BA 1UGOA 3QNUA 4GKJT 3SS1A 3CQGB 4WYVA 3J7Yq 2CXLA 2WDQA 4YY3T 4E7ZA 2YDRA 2VQFT 5DQWA 3EABA 4I55E 1R8IA 5LBQB 4YJ3E 3QK6A 3F31A 3IA3A 5LYJE 2Y48B 4EYYR 2E5LT 1XDOA 4ZXLA 2YU1A 1JNRA 2ODUA 4EV6A 3TLUA 2CM0A 4YHHT 2V8SV 3OJAA 2NWBA 2V26A 4O2AE 4JI3T 5HAXA 2X0YA 4CI2B 4DV1T 4WZXA 4DV5T 2FJEA 2WWVA 3PJAA 4DUYT 3RIAA 3ZYKA 3P7IA 4EOZB 4AKRB 2IMLA 5LG3A 3BQIA 2VASA 1HNXT 4U3CA 2DNXA 3LDQB 5FL0A 2WDVA 3KBTA 3RYFE 4HTEA 5AQKB 4UIGA 3PUQA 2IC9A 2H7OA 3LBXA 2LM9A 3AEEA 2J1DG 1MNEA 3KV9A 1WRDA 2WWUA 3UUMA 4DIDB 3IEEA 5EZYE 3CIRA 3NRYA 2KINB 3O1HA 5JDQA 2Q9QC 3RRCA 4EZ4A 2MYSA 2VURA 4NPPA 1KEYA 3FZFB 5ABFB 5JDFA 2P9BA 1YKEB 4HN9A 4YSYA 2E9XB 3NZQA 5FL1A 1JNZA 3QB5K 3Q5WA 1OXZA 1VCSA 4HWFA 2X0HA 3VR9A 2HN1A 3AA1B 2D0UA 3EDUA 2X9XA 4P09A 1Y01A 2JIWA 1J1JA 5LHHB 3K3NA 3AEBA 3CWZB 2PBIA 2OLTA 5BMVE 2QYWA 3PUZF 3L3PA 4Z91A 4X66T 1SA0E 4BAYB 2UUAT 5AQMB 3C4XA 3DJBA 2XQ9A 3KV5A 3E0ZA 1HG5A 4CN1A 4HWDA 3H3MA 1SUMB 3EAMA 3RPUA 2A9UA 2NW7A 2CBJA 2V6YB 3RIUA 1HCIA 3TLSA 4LF8T 3MZKB 2WU2A 4HE8A 4OK0A 2EHOA 3HKEE 3FB2A 4X62T 2M6IA 3N9OA 5LGNB 4U2ZA 2D5UA 3WAKA 5LA6E 2UXCT 4KBMB 4YSXA 3CX7B 3GWHA 5HEOA 5ABFA 1ZHCA 4HWHA 5L3GB 2XAGB 4HFHA 3TLVA 2Q9QD 4H63H 4HFCA 2WAUA 3AA6B 5FY1A 4JV5T 3GN5A 3UULA 2YINA 3KVBA 3ZCIA 3U3IA 5HXEA 2LHNA 5J2UE 4EEBA 1US7B 3UFGA 3QOFA 2XQ4A 2W61A 3RKGA 5LMNT 2VK9A 3AE2A 3N9NA 3DP7A 3LK3B 2UU9T 2IHR1 5HXRA 4JLEA 2W00A 4LMJA 3UUXB 2KNDA 1SE7A 2I0MA 1ZKEA 1WYBA 2XQ3A 1MMAA 1S94A 5FVKA 3ANWA 2V1DB 4HFBA 4DR6T 2Z6EA 2LSJA 5AQTB 1VOMA 3PUGA 1W0AA 4NIQA 1OEDB 3PUWF 3O9XA 4DR3T 2CE7A 2V7LA 4XAXB 3PUYF 2PJQA 4DV2T 4ZZCA 4XBFB 3UQ4A 2VL0A 5L3FB 2LT3A 1ZV4X 3HKBE 3SFDA 5C8YE 3G06A 3ZT5A 5HXSA 4U7YA 4P1NA 4B6XA 2NW8A 2BKPA 2KMFA 3UFEA 3AEGA 5FXZA 4L0RA 3HKDE 4QHOA 5JRCB 3M3ZB 3UU5A 1FMWA 2X9WA 3UU8A 1B7TA 2BS2A 3FXEB 1S35A 4QX7B 2CHNA 5IHYA 2WP9A 1WR0A 2JQHA 4L5GA 1M62A 1WR6A 3K1SA 2UXBT 2MOZA 4B3TT 4Z90A 4I4TE 3JC6C 2WZHA 4YSZA 4WBOA 3AEFA 2C5IT 2HN2A 2H89A 4PJJA 2BVMA 4X1KE 5DABA 1BR2A 4JEUB 1X79A 4GYSA 2KLQA 2K48A 4JBWF 3UUBA 3PUAA 2UXNB 1W09A 2JQ9A 4KP3C 1DU2A 4K0KT 2I59A 2VL8A 5AQFB 5F5WA 2XASB 2BG9C 2CWYA 3JCFA 3HA4A 3HR0A 3AA7B 4KI0F 3ZMSB 1YW0A 4MFRA 4EXTA 3ETVA 1J5ET 3AE3A 2XJ7A 4HFDA 3AVSA 2NTXA 5AQQB 1HF8A 3UQ7A 2V7IA 5IYZE 2BBHA 2SPCA 4TV8E 2WMOA 4XZCA 2CMRA 4DMVA 3CMLA 4IDNA 4UVBB 1BR4A 2DCFA 3LSVA 1T98A 2Q9QB 3TLTA 2ES0A 4ZI3C 3WI3A 1IJ5A 3VRBA 5EK2A 5J2TE 3F57A 4JI4T 5JTGA 5FP3A 4ILAA 4HFIA 4GK0E 3JC6D 3ZC0A 1UX5A 2ZM2A 1XMOT 2KXPB 2FBWA 5KX5E 3T8OA 4AIUA 3ZT7A 1UX4A 1KNPA 4PK5A 2C5JA 1QUUA 4IE0A 4B3RT 5JDMA 2LKGA 2V7JA 2G0UA 5AQPB 2IDOB 4AKLA 2J47A 1Z8UA 3AE4A 1WLXA 3P4RA 4HGAA 4QXHB 3RH3A 2WDRA 4ANJA 4X1YE 2D2SA 4FI5A 3N9QA 1NENA 3O1JA 1N33T 2YEVC 2GK9A 2KWIB 5L2LA 5E0OA 2MTQA 3BQKA 2KWHA 5ABGA 4DR2T 3AEDA 3FXDB 1LVFA 1HNZT 4X5TA 3LK42 4ILCA 2Q9QA 1I94T 4H9NC 5JVDE 4AKGA 3JADA 4DV4T 3FZHB 4P0AA 1CHUA 4KHZF 1N32T 5LJMA 5LHIB 2LJLA 3ZMTB 2VKHA 3QC9A 4ZI3D 4OYJA 4JUYA 5LG4A 2K9AA 5ABHA 3RIFA 3NWIA 5AQJB 1KK7A 4UF0B 5L4EA 5IUXA 5LMUT 3AAIA 4H9QC 3V5SA 4ISSA 2LSGA 3OVUA 4TV9E 2LM2A 1E1HB 2A72A 1H7CA 3P8CD 4CN4A 5HCMA 4QKNA 4ERRA 2W0GA 3AE1A 5LXTE 4A56A 3WAJA 2NR4A 2VVNA 3HI2A 1OEDE 2M67A 4ZHQE 4G2AA 3K3OA 1KF6A 2Y8DA 3J9X1 5LGUB 4B3ST 1YQ3A 1I6ZA 3VKHA 1KNZA 5F8PA 1HX1B 4AKHA 4U2YA 5M4YA 1GQEA 4YHJA 1XNQT 4KX6A 3E08A 1FMVA 3BK9A 3ZMVB 4OHFA 4YXDA 2PFVA 4PJLA 3BQLA 2XPKA 4IDQA 2ACXA 2H3RA 4QH4A 2V7MA 1AJ3A 2NOXA 3Q2MA 3CQXC 3Q5DA 3AE5A 4CXYA 4JYAT 4X64T 2ZM0A 2FUPA 1FJGT 4LF4T 3CKDA 4DR4T 3MXZA 2CXDA 4IDOA 2FJBA 4TWDA 3RX6A 1HNWT 3MKDA 1MIVA 2MBGA 3ZLIA 2LOPA 1ZP0A 2E2AA 4ZEYA 4JI8T 4LMLA 1QSDA 2L9QA 1MMNA 2XQAA 1MMDA 1IAPA 1Z0PA 4IE4A 4TWFA 3CK6A 2CLYC 4IGUA 1D0XA 3C98B 5FVLA 5JR9C 3OKQA 4TUYE 4UV8B 3JAEA 4UEMA 5C3JA 2XAQB 2KT9A 5FMNA 1HR0T 3SRZA 1XDPA 1J5WA 2DLRA 3KV6A 4JI2T 2IIUA 4AISA 2BBJA 4ADZA 4AKIA 1X9BA 5L3DB 2YK0A 5AQGB 4TWHA 3FZKB 3P4QA 5KMGP 2E9XA 5J1GA 4DUZT 4TZ4C 3O1IA 4O4IE 5F3JA 3H3AA 4PJMA 4QXBB 1YD8G 2BG9B 4AQFA 3ZMZB 2LSIA 3LFMA 3ZPOA 2DI4A 3PUSA 2XUEA 3ABVA 2LSKA 2YDQA 4PAGA 4DMWA 2JQKA 4DBRA 4KMCA 3F2EA 1LRZA 5DQVA 4JI0T 2BZBA 3ZN1B 5L47A 2W4XA 2NP9A 2R6GF 2V7KA 4B3MT 4CQIA 1G73A 2YN6A 2XQ7A 4LFAT 3PE0A 1IBMT 2X51A 2X9HA 4DV6T 1VCTA 2V6YA 3CX6B 2E8IA 2V5DA 2K3WA 3ZJ2A 1UURA 3GMIA 1N34T 2YKSA 2WM9A 4DO0A 4IDZA 2KZ7B 3ZEFB 3AB3B 4U74A 5AQUB 1HFAA 1XZYA 2D0TA 3CPZA 4K0UA 2EHOC 5FY0A 2X67A 2NW9A 4H9PC 5FKYA 2JRKA 3IHRA 4J2CA 3T1YT 5L4HA 4IHJE 3O4XE 4YTNA 4X1IE 3KDSE 1N36T 4CXXA 1IBKT 3OYXA 5FXVA 1OWAA 4AQGA 2VVSA 4GIWA 3N9LA 2N2NA 1FIOA 1WFDA 3FHNA 4MBQA 5JH7E 5JREA 2ZM6T 3VR8A 2L8KA 2A2FX 3CX8B 4DR5T 3SWHA 5AQVB 2XY8B 4LFCT 2CXFA 2HH7A 2XTLA 4GKKT 2W66A 3ZMUB 4COFA 4O4LE 2ACZA 2UUCT 3V5UA 1UK5A 2CPTA 5EK4A 1HTJF 2CA5A 4DBQA 3QUJA 2JPFA 3ZSTA 1FEWA 5JDGA 1XNRT 5HXHA 1OEDA 2LKHA 5J0ZA 4A5XA 3IBPA 2E5VA 5AQLB 3VHLA 4YLHA 2WU5A 4DV3T 3RC8A 3TLWA 4DR1T 4MHCA 5C2TA 4CI3B 2H7VC 4ZOLE 4PJNA 4ZS3A 3KV4A 3ZC1A 4NUVA 1NAFA 3KFWX 4IT4A 4QWNB 4TN7B 5DJQC 4I0UA 2EHOD 4P0BA 4M1PA 2LLYA 2RPAA 4OYKA 2B76A 2XHEB 3K3QC 5JRCA 4G63A 2CCQA 2RA1A 2QRXA 4YTPA 4I50E 3N2GE 4ZI2C 3C50A 4JI7T 4EZHA 2V5CA 3EUHA 1T7SA 2DWKA 1MNDA 4OFZA 4X20E 2ZMAA 4YFSA 4UXNB 3RLFF 3RYCE 1SHZC 3EDVA 4AQYT 2IAKA 2YDSA 3C4ZA 4N78D 5FYMA 3D0TA 3PTRB 4DV0T 3AE6A 3R84B 1HX8A 2XAHB 3VKGA 2XQ5A 2XAFB 4V1Av 5CA0E 5H6RB 4I43B
chains in the Genus database with same CATH topology
2Y8DA 3J9X1 5LGUB 1UCUA 2Q9QD 2N1GA 4H63H 2WAUA 3AA6B 5FY1A 2LHRA 3GN5A 3UULA 4BJMA 3VKHA 1KNZA 3RRWA 5F8PA 5L3CB 4H9RC 2YINA 1IJ6A 3L09A 3KVBA 4AKHA 3ZCIA 2CWOA 5M4YA 3U3IA 5HXEA 4YHJA 5L3GB 1O3XA 3E08A 3RYIE 3KINB 2LHNA 1FMVA 3NRXA 3BK9A 5JDHA 3IF8B 3ZMVB 4OHFA 4MALA 5J2UE 3LK2B 3ZN0B 4CI1B 1US7B 2PFVA 4PJLA 1BR1A 4PK6A 3BQLA 1U5PA 4U72A 2W61A 1BR0A 2VK9A 2ACXA 2CEAA 2H3RA 5HWYA 5H6QB 4ZS2A 3N9NA 3DP7A 3LK3B 2V7MA 5GONE 1AJ3A 2NOXA 3N2KE 3Q2MA 2CLYB 4WNKA 5HXRA 3CQXC 3RC3A 4C90A 4GOUA 4JLEA 4WBNE 4UVCB 5KDMC 3Q9DA 4CXYA 4YJ2E 2BVLA 2ZM0A 5JR9B 3I9WA 1MIYA 2W00A 3I9YA 3UUXB 2KNDA 4IE5A 1ZKEA 1WYBA 2LE8A 4ZI2D 1MMAA 1S94A 1G8XA 3B57A 3N5LA 3N9PA 4AXPA 3ANWA 2V1DB 5LJNA 3LBXB 2HPJA 4WW0A 2IW5B 3CKDA 5EK3A 4GYRA 3MXZA 3ZYLA 4QXCB 3S4UA 2CXDA 2Z6EA 3AA0B 1LKXA 4ASKA 4O4JE 3RX6A 3OBVE 3GA8A 2LSJA 3MKDA 4O2BE 2E9XD 1MIVA 2W63A 3KBUA 1VOMA 3PUGA 2MBGA 3ZLIA 3I0QA 4Z8XA 2XAJB 5LGTB 2LOPA 3UT5E 3NZPA 3O9XA 5CA1E 4HFVA 4FJOA 2K5BB 3AAEB 3B13A 2CE7A 2V7LA 4H9OC 4XAXB 4E7SA 2PJQA 4NUUA 5FNVE 4H9SE 4XBFB 2LOSA 1HS7A 1D0YA 1QSDA 1ZEEA 2L9QA 5L3FB 1MMNA 4CZZB 2VKJA 3K8PC 4PFOA 4H63V 2LT3A 1MMDA 1ZV4X 2HPLA 3C4WA 1IAPA 1Z0PA 3HKBE 4IE4A 3SOLA 5C8YE 3DTOA 2CLYC 1MIWA 4IGUA 1D0XA 3C98B 3VU7H 5HXSA 5JR9C 4B6XA 2NW8A 2JMKA 3OKQA 3R6NA 2KMFA 4TUYE 1U4QA 2VKDA 4UV8B 3NBXX 4UEMA 2XAQB 2KT9A 5FMNA 3UFEA 5FXZA 4L0RA 4ILUA 3SRZA 2DLRA 3ETUA 3KV6A 4ISTA 3HKDE 4QHOA 3UTKA 5JRCB 2DHRA 4ADZA 5A1LA 4AKIA 3FBZA 5L3DB 2YK0A 2ZM8A 1FMWA 2X9WA 1B7TA 3FXEB 5KMGP 2E9XA 5J1GA 4TZ4C 5TAOA 3O1IA 4O4IE 2N9DA 5F3JA 1S35A 3H3AA 4O4HE 4PJMA 4QX7B 3I0OA 4QXBB 1YD8G 3Q5XA 1V9DA 5L3BB 5IHYA 3I1AA 5JR9A 3LG7A 4AQFA 5AFUL 3ZMZB 2UXXB 4L5GA 4EB6E 2LSIA 1WR6A 3LFMA 2DI4A 3FBLA 3ZPOA 4BJNA 4EYUA 2MOZA 3PUSA 2XUEA 2LSKA 3ESLA 4I4TE 3JC6C 4ZI7E 4PAGA 4DMWA 5FXWA 4DBRA 4UVAB 4BA9A 4L9IA 2VWAA 4KMCA 5LCYA 4IE7A 1D0ZA 3F2EA 4WBOA 1LRZA 5LNKA 5DQVA 5ETWA 2C5IT 4JEHB 2BZBA 2X0LB 3ZN1B 4PJJA 2EHOB 2JMHA 2XQYA 5L3EB 2BVMA 5FY7A 3HL6A 5LHGB 4X1KE 5DABA 1BR2A 4JEUB 1X79A 2NP9A 2V7KA 4GYSA 2KLQA 5HYAA 2K48A 2PG8A 4CQIA 4F6RC 2VB6A 2X68A 3PUAA 1G73A 2UXNB 4KUMB 2QA7A 5LOVE 3PU8A 4UF0A 4KP3C 1YKHB 2A3DA 3PE0A 2I59A 3E22E 4GK5E 4PW8A 2VL8A 2X51A 2X9HA 2B1EA 2XASB 3GN5B 3SS1A 4CXWA 3CQGB 3AAAB 3AVRA 3CX6B 4PNIA 3J7Yq 2CWYA 2CXLA 3LJCA 3M65A 3PDYA 4PK4A 3KVAA 2E8IA 3HA4A 3HR0A 3AA7B 5FXXA 4E7ZA 3ZJ2A 5DQWA 4I55E 3GMIA 5LBQB 2WM9A 4YJ3E 3ZMSB 3QK6A 3F31A 3PU3A 5LYJE 1YW0A 2Y48B 4MFRA 4EXTA 4DO0A 4IDZA 4EYYR 2KZ7B 3ETVA 4O8SA 4PFPA 3ZEFB 2YU1A 3AB3B 4U74A 1HFAA 2C0SA 1Y64B 2D0TA 4TX5A 3AVSA 2NTXA 3CPZA 4K0UA 3TKLB 2EHOC 5JQGE 5FY0A 2ODUA 2X67A 2NW9A 2CM0A 1HF8A 4H9PC 5LBMA 2NTYA 2V7IA 5IYZE 2SPCA 2JRKA 4TV8E 2WMOA 4XZCA 3IHRA 2CMRA 3ZCJA 3OJAA 3CMLA 4DMVA 2NWBA 2V26A 4J2CA 4O2AE 4UVBB 1BR4A 4IHJE 3O4XE 4X1IE 2DCFA 3KDSE 5HAXA 2WMNA 4CI2B 1T98A 2Q9QB 4CXXA 2W62A 2ES0A 3OYXA 5FXVA 4ZI3C 3WI3A 1OWAA 3ANWB 2BDEA 4AQGA 1IJ5A 5EK2A 4GIWA 5J2TE 3F57A 3N9LA 4UELA 3ONXA 2N2NA 5FP3A 3ZYMA 5ADXL 3ZYKA 3P7IA 1FIOA 1MMGA 2X9YA 3A5XA 4EOZB 2RP4A 4GK0E 4AKRB 3MACA 4DVDA 4IIJE 3JC6D 3ZC0A 3FHNA 3BQIA 1UX5A 2VASA 3C51A 2ZM2A 4MBQA 2DNXA 2KXPB 2JQQA 5HWXA 5KX5E 5JH7E 2X66A 3T8OA 2QGSA 5JREA 2L8KA 3KBTA 2A2FX 3H37A 1UX4A 1EZ3A 3CX8B 3RYFE 4HEAA 4EIWA 4HTEA 1NWMX 3MK7C 2C5JA 4PK5A 4UIGA 3SWHA 1QUUA 3PUQA 2LSYA 2CXFA 2IC9A 2HH7A 4IE0A 2XTLA 2H7OA 4EAHA 5JDMA 1WYCA 1LVKA 3LBXA 3ZMUB 4MLKA 4O4LE 3N9MA 2V7JA 1IZNB 2LM9A 2VKOA 2G0UA 2J1DG 2ODVA 3PURA 3V5UA 1MNEA 4QX8B 3U78A 3KV9A 1WRDA 4AKLA 2WWUA 5EK4A 1HTJF 1WLXA 2CA5A 3UUMA 4HGAA 4DBQA 3QUJA 3UUNA 2JPFA 3IEEA 4QXHB 3N2OA 3RH3A 2JJ9A 4ANJA 1FEWA 5EZYE 5JDGA 3NRYA 2KINB 4X1YE 3O1HA 5JDQA 2D2SA 4FI5A 2Q9QC 5JDLA 3RRCA 4EZ4A 3N9QA 2MYSA 3O1JA 5HXHA 2YEVC 3MA9A 1CUNA 5HXCA 2GK9A 3IBPA 5JDFA 5LP6E 2P9BA 2KWIB 4YLHA 3VHLA 1YKEB 2K24A 5L2LA 4HN9A 3RC8A 1D1CA 2C5KT 5E0OA 2E9XB 2MTQA 3BQKA 3NZQA 4MHCA 2KWHA 3RYHE 4CI3B 3Q5WA 1OXZA 2H7VC 4ZOLE 4PJNA 4ZS3A 3KV4A 3ZC1A 3FXDB 5CB4E 3AA1B 2D0UA 3EDUA 4NUVA 1NAFA 3KFWX 1LVFA 3OYZA 4QWNB 2X9XA 4TN7B 5DJQC 3LK42 4P09A 2EHOD 4P0BA 2Q9QA 4M1PA 4H9NC 5JVDE 4OYKA 4AKGA 5LHHB 3K3NA 1D1AA 4IE6A 2XHEB 4P0AA 3ZJ1A 3K3QC 3CWZB 5JRCA 4G63A 2PBIA 2CCQA 4DNDA 4AI6A 2RA1A 5BMVE 5LJMA 5LHIB 2LJLA 3L3PA 3ZMTB 4I50E 2VKHA 3N2GE 4ZI2C 3QC9A 3C50A 4ZI3D 3CVRA 1SA0E 4BAYB 2DWGA 4OYJA 4EZHA 1HG2A 4JUYA 5LG4A 2K9AA 3EUHA 3C4XA 3DJBA 2DWKA 1MNDA 4OFZA 4X20E 2WSSV 3C64A 3KV5A 2OA5A 2ZMAA 3E0ZA 1HG5A 1KK7A 4UF0B 4YFSA 4UXNB 2IC6A 3CQCB 3RYCE 1SHZC 1VRBA 3EVYA 3AAIA 4H9QC 3V5SA 3RPUA 4ISSA 2LSGA 2E9XC 4TV9E 3RKOA 3EDVA 2Y6XA 1E1HB 2NW7A 2A72A 1H7CA 2IAKA 1HCIA 1D1BA 3P8CD 5JDNA 3MZKB 2L3LA 4HE8A 4AQFC 2LEHA 3C4ZA 4QKNA 4ERRA 4OK0A 2EHOA 2ZLYA 4N78D 3HKCE 2W0GA 3FB2A 3HKEE 5FYMA 5LXTE 4A56A 3WAJA 3N9OA 5LGNB 4HKAA 3D0TA 3PTRB 2D5UA 3HI2A 3MJXA 3R84B 1HX8A 2XAHB 4UV9B 5LA6E 3WAKA 3VKGA 2M67A 4KBMB 4C91A 2XAFB 4V1Av 5CA0E 5H6RB 4ZHQE 3CX7B 4I43B 3GWHA 3W15B 4G2AA 3K3OA 1ZHCA 2WBLA 2XAGB 2YU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYK A;  2CCQ A;  4OYJ A;  4JUY A;  4P09 A;  4P0A A;  5LJM A;  2HPL A;  2CM0 A;  4P0B A;  5LJN A;  2D5U A;  2HPJ A; 
#chains in the Genus database with same CATH topology
 2N1G A;  4OX9 T;  3RRW A;  5L3C B;  5CFB A;  1IJ6 A;  3L09 A;  2KSR A;  1O3X A;  3A8Y C;  3NRX A;  3LK2 B;  4CI1 B;  3EHZ A;  4YT0 A;  2BS3 A;  4PK6 A;  1YXR A;  2XZE A;  2BS4 A;  5HWY A;  4Q25 A;  4ZS2 A;  2LRK A;  3N2K E;  2BG9 E;  2CLY B;  4WNK A;  1ZOY A;  5KDM C;  3Q9D A;  4YJ2 E;  2BVL A;  5JR9 B;  2AE9 A;  2XQ6 A;  3I9W A;  3I9Y A;  4IE5 A;  3PJA J;  4ZI2 D;  3EI0 A;  3AEA A;  3N5L A;  4CN6 A;  2BKO A;  4LFB T;  4AXP A;  3LBX B;  2HPJ A;  4WW0 A;  5EK3 A;  2QVA A;  5AQS B;  1KNR A;  1LKX A;  4ASK A;  4O4J E;  3OBV E;  4EED A;  3GA8 A;  4O2B E;  3X1D A;  2W63 A;  3KBU A;  4QH1 A;  5LGT B;  4Z8X A;  2XAJ B;  2HHH T;  3NZP A;  4FJO A;  2K5B B;  3AAE B;  3B13 A;  4E7S A;  4H9S E;  5IWA T;  4JI5 T;  1D0Y A;  1YQ4 A;  4CZZ B;  2AXD S;  4PFO A;  2HPL A;  3C4W A;  5HEG A;  3QB5 A;  2XSB A;  3VU7 H;  4IL9 A;  3FZM B;  1U4Q A;  2VKD A;  2WB5 A;  3NBX X;  4ILU A;  4IDP A;  3ETU A;  4IST A;  3L39 A;  3AE8 A;  2ZM8 A;  3OPC A;  2J4G A;  4JI1 T;  5TAO A;  2N9D A;  4O4H E;  3PUV F;  2V6X A;  3I0O A;  5AQR B;  5JR9 A;  3LG7 A;  5AFU L;  2UXX B;  1XMQ T;  4EB6 E;  3FBL A;  3L8R A;  3ESL A;  4ZI7 E;  5FXW A;  2XM2 A;  4UVA B;  5LCY A;  2VWA A;  3FZL B;  5ETW A;  4JEH B;  2EHO B;  2XQY A;  5L3E B;  4LF6 T;  3HL6 A;  5ABE A;  3OTO T;  4F6R C;  2XSA A;  2QA7 A;  4UF0 A;  3E22 E;  4PW8 A;  4ILB A;  2B1E A;  3GN5 B;  4CXW A;  3AAA B;  3AVR A;  4PNI A;  3M65 A;  3LJC A;  3PDY A;  4PK4 A;  3KVA A;  5FXX A;  4HFE A;  2MPK A;  5BR8 T;  1QLB A;  3PU3 A;  2IUB A;  4ZZB A;  4U7I A;  4PFP A;  4O8S A;  4TX5 A;  2C0S A;  1Y64 B;  4LF9 T;  3TKL B;  5JQG E;  3PV0 F;  5LBM A;  2NTY A;  4DR7 T;  3ZCJ A;  3NVO A;  2UXD T;  2WMN A;  2WY2 A;  3P4P A;  1L0V A;  3ZT6 A;  2W62 A;  3ANW B;  2BDE A;  1W9R A;  2UUB T;  4UEL A;  3ONX A;  3ZYM A;  2FJD A;  5ADX L;  2X9Y A;  1MMG A;  3A5X A;  2RP4 A;  4DVD A;  3MAC A;  4IIJ E;  2W2U A;  2J62 A;  3C51 A;  2JQQ A;  4HWI B;  5HWX A;  2X66 A;  2QGS A;  2XM1 A;  2CBI A;  2WQY A;  3H37 A;  1EZ3 A;  4HEA A;  4EIW A;  4A98 A;  4U33 A;  1NWM X;  3MK7 C;  2LSY A;  2CRB A;  4EAH A;  1WYC A;  1LVK A;  4MLK A;  3N9M A;  3NKZ A;  1IZN B;  2VKO A;  2ODV A;  2W67 A;  3PUR A;  4QX8 B;  3U78 A;  1T72 A;  2XQ8 A;  2BKN A;  3UUN A;  3N2O A;  2JJ9 A;  5AQI B;  4LF7 T;  1UUS A;  5JDL A;  3MA9 A;  1CUN A;  5HXC A;  3UU4 A;  5LP6 E;  2K24 A;  2VQE T;  1D1C A;  2C5K T;  3SFE A;  3RYH E;  2WS3 A;  5CB4 E;  3OYZ A;  2OV9 A;  1D1A A;  4IE6 A;  3ZKR A;  3ZJ1 A;  3T1H T;  3RHW A;  1E7P A;  4DND A;  3RIU C;  4AI6 A;  3CVR A;  3Q5E A;  2DWG A;  1HG2 A;  2MAW A;  2BG9 A;  5CGM A;  2WSS V;  3C64 A;  2OA5 A;  2YOE A;  2H88 A;  2F4V T;  2IC6 A;  3CQC B;  1VRB A;  3EVY A;  2E9X C;  3RKO A;  2Y6X A;  4TNW A;  1D1B A;  5JDN A;  4YTM A;  2L3L A;  4AQF C;  2LEH A;  3RI5 A;  2ZLY A;  3HKC E;  4HKA A;  4IRE A;  3MJX A;  4UV9 B;  4C91 A;  3AXJ B;  3W15 B;  3JAF A;  2WBL A;  4IL4 A;  2YU2 A;  3B5M A;  1UCU A;  2LHR A;  4BJM A;  4LMK A;  4H9R C;  3RF1 A;  2CWO A;  4F8H A;  3ZSS A;  4TNV A;  3RYI E;  3KIN B;  5JDH A;  3IF8 B;  4MAL A;  3ZN0 B;  1BR1 A;  5HCJ A;  3P4W A;  1U5P A;  5HEH A;  4U72 A;  1BR0 A;  2CEA A;  5H6Q B;  4UR9 A;  5AQH B;  5GON E;  1XWM A;  3RC3 A;  4C90 A;  4GOU A;  4WBN E;  4UVC B;  5CJ5 A;  1MIY A;  2D9D A;  2FJA A;  2LE8 A;  3AEC A;  4NXN T;  4KHP T;  1G8X A;  3B57 A;  3N9P A;  4JI6 T;  4LF5 T;  5HEU A;  2WZI A;  5LJN A;  2DL1 A;  2IW5 B;  1IBL T;  4GYR A;  3ZYL A;  4QXC B;  3S4U A;  3UU6 A;  3AA0 B;  4A97 A;  1KFY A;  3RQW A;  2E9X D;  3I0Q A;  3UT5 E;  4U31 A;  3AXJ A;  5CA1 E;  4HFV A;  2M6B A;  4H9O C;  3P50 A;  4NUU A;  5FNV E;  2LOS A;  1HS7 A;  1NEK A;  1ZEE A;  3UU3 A;  2WCA A;  2VKJ A;  3K8P C;  4H63 V;  3SOL A;  3DTO A;  1MIW A;  3AE9 A;  1WCR A;  2PTF A;  2JMK A;  3R6N A;  5AQN B;  2I6H A;  5AQO B;  3UTK A;  2DHR A;  3RQU A;  3AE7 A;  5A1L A;  3FBZ A;  1E2A A;  5LB7 B;  3ONJ A;  3ONL C;  4DV7 T;  3Q5X A;  1T8B A;  1V9D A;  5L3B B;  3I1A A;  1OED C;  2LRL A;  1M7K A;  4BJN A;  4EYU A;  3VRA A;  3PUX F;  4EGW A;  5KXJ A;  5HEJ A;  4BA9 A;  4HWC A;  4L9I A;  4QH5 A;  4IE7 A;  1D0Z A;  4NXM T;  5LNK A;  2X0L B;  2JMH A;  5FY7 A;  5LHG B;  3RGL A;  5HYA A;  2CHO A;  3P4S A;  2PG8 A;  4X65 T;  2VB6 A;  2X68 A;  4KUM B;  5LOV E;  3PU8 A;  1YKH B;  2A3D A;  3A7M A;  4GK5 E;  1W0B A;  1UGO A;  3QNU A;  4GKJ T;  3SS1 A;  3CQG B;  4WYV A;  3J7Y q;  2CXL A;  2WDQ A;  4YY3 T;  4E7Z A;  2YDR A;  2VQF T;  5DQW A;  3EAB A;  4I55 E;  1R8I A;  5LBQ B;  4YJ3 E;  3QK6 A;  3F31 A;  3IA3 A;  5LYJ E;  2Y48 B;  4EYY R;  2E5L T;  1XDO A;  4ZXL A;  2YU1 A;  1JNR A;  2ODU A;  4EV6 A;  3TLU A;  2CM0 A;  4YHH T;  2V8S V;  3OJA A;  2NWB A;  2V26 A;  4O2A E;  4JI3 T;  5HAX A;  2X0Y A;  4CI2 B;  4DV1 T;  4WZX A;  4DV5 T;  2FJE A;  2WWV A;  3PJA A;  4DUY T;  3RIA A;  3ZYK A;  3P7I A;  4EOZ B;  4AKR B;  2IML A;  5LG3 A;  3BQI A;  2VAS A;  1HNX T;  4U3C A;  2DNX A;  3LDQ B;  5FL0 A;  2WDV A;  3KBT A;  3RYF E;  4HTE A;  5AQK B;  4UIG A;  3PUQ A;  2IC9 A;  2H7O A;  3LBX A;  2LM9 A;  3AEE A;  2J1D G;  1MNE A;  3KV9 A;  1WRD A;  2WWU A;  3UUM A;  4DID B;  3IEE A;  5EZY E;  3CIR A;  3NRY A;  2KIN B;  3O1H A;  5JDQ A;  2Q9Q C;  3RRC A;  4EZ4 A;  2MYS A;  2VUR A;  4NPP A;  1KEY A;  3FZF B;  5ABF B;  5JDF A;  2P9B A;  1YKE B;  4HN9 A;  4YSY A;  2E9X B;  3NZQ A;  5FL1 A;  1JNZ A;  3QB5 K;  3Q5W A;  1OXZ A;  1VCS A;  4HWF A;  2X0H A;  3VR9 A;  2HN1 A;  3AA1 B;  2D0U A;  3EDU A;  2X9X A;  4P09 A;  1Y01 A;  2JIW A;  1J1J A;  5LHH B;  3K3N A;  3AEB A;  3CWZ B;  2PBI A;  2OLT A;  5BMV E;  2QYW A;  3PUZ F;  3L3P A;  4Z91 A;  4X66 T;  1SA0 E;  4BAY B;  2UUA T;  5AQM B;  3C4X A;  3DJB A;  2XQ9 A;  3KV5 A;  3E0Z A;  1HG5 A;  4CN1 A;  4HWD A;  3H3M A;  1SUM B;  3EAM A;  3RPU A;  2A9U A;  2NW7 A;  2CBJ A;  2V6Y B;  3RIU A;  1HCI A;  3TLS A;  4LF8 T;  3MZK B;  2WU2 A;  4HE8 A;  4OK0 A;  2EHO A;  3HKE E;  3FB2 A;  4X62 T;  2M6I A;  3N9O A;  5LGN B;  4U2Z A;  2D5U A;  3WAK A;  5LA6 E;  2UXC T;  4KBM B;  4YSX A;  3CX7 B;  3GWH A;  5HEO A;  5ABF A;  1ZHC A;  4HWH A;  5L3G B;  2XAG B;  4HFH A;  3TLV A;  2Q9Q D;  4H63 H;  4HFC A;  2WAU A;  3AA6 B;  5FY1 A;  4JV5 T;  3GN5 A;  3UUL A;  2YIN A;  3KVB A;  3ZCI A;  3U3I A;  5HXE A;  2LHN A;  5J2U E;  4EEB A;  1US7 B;  3UFG A;  3QOF A;  2XQ4 A;  2W61 A;  3RKG A;  5LMN T;  2VK9 A;  3AE2 A;  3N9N A;  3DP7 A;  3LK3 B;  2UU9 T;  2IHR 1;  5HXR A;  4JLE A;  2W00 A;  4LMJ A;  3UUX B;  2KND A;  1SE7 A;  2I0M A;  1ZKE A;  1WYB A;  2XQ3 A;  1MMA A;  1S94 A;  5FVK A;  3ANW A;  2V1D B;  4HFB A;  4DR6 T;  2Z6E A;  2LSJ A;  5AQT B;  1VOM A;  3PUG A;  1W0A A;  4NIQ A;  1OED B;  3PUW F;  3O9X A;  4DR3 T;  2CE7 A;  2V7L A;  4XAX B;  3PUY F;  2PJQ A;  4DV2 T;  4ZZC A;  4XBF B;  3UQ4 A;  2VL0 A;  5L3F B;  2LT3 A;  1ZV4 X;  3HKB E;  3SFD A;  5C8Y E;  3G06 A;  3ZT5 A;  5HXS A;  4U7Y A;  4P1N A;  4B6X A;  2NW8 A;  2BKP A;  2KMF A;  3UFE A;  3AEG A;  5FXZ A;  4L0R A;  3HKD E;  4QHO A;  5JRC B;  3M3Z B;  3UU5 A;  1FMW A;  2X9W A;  3UU8 A;  1B7T A;  2BS2 A;  3FXE B;  1S35 A;  4QX7 B;  2CHN A;  5IHY A;  2WP9 A;  1WR0 A;  2JQH A;  4L5G A;  1M62 A;  1WR6 A;  3K1S A;  2UXB T;  2MOZ A;  4B3T T;  4Z90 A;  4I4T E;  3JC6 C;  2WZH A;  4YSZ A;  4WBO A;  3AEF A;  2C5I T;  2HN2 A;  2H89 A;  4PJJ A;  2BVM A;  4X1K E;  5DAB A;  1BR2 A;  4JEU B;  1X79 A;  4GYS A;  2KLQ A;  2K48 A;  4JBW F;  3UUB A;  3PUA A;  2UXN B;  1W09 A;  2JQ9 A;  4KP3 C;  1DU2 A;  4K0K T;  2I59 A;  2VL8 A;  5AQF B;  5F5W A;  2XAS B;  2BG9 C;  2CWY A;  3JCF A;  3HA4 A;  3HR0 A;  3AA7 B;  4KI0 F;  3ZMS B;  1YW0 A;  4MFR A;  4EXT A;  3ETV A;  1J5E T;  3AE3 A;  2XJ7 A;  4HFD A;  3AVS A;  2NTX A;  5AQQ B;  1HF8 A;  3UQ7 A;  2V7I A;  5IYZ E;  2BBH A;  2SPC A;  4TV8 E;  2WMO A;  4XZC A;  2CMR A;  4DMV A;  3CML A;  4IDN A;  4UVB B;  1BR4 A;  2DCF A;  3LSV A;  1T98 A;  2Q9Q B;  3TLT A;  2ES0 A;  4ZI3 C;  3WI3 A;  1IJ5 A;  3VRB A;  5EK2 A;  5J2T E;  3F57 A;  4JI4 T;  5JTG A;  5FP3 A;  4ILA A;  4HFI A;  4GK0 E;  3JC6 D;  3ZC0 A;  1UX5 A;  2ZM2 A;  1XMO T;  2KXP B;  2FBW A;  5KX5 E;  3T8O A;  4AIU A;  3ZT7 A;  1UX4 A;  1KNP A;  4PK5 A;  2C5J A;  1QUU A;  4IE0 A;  4B3R T;  5JDM A;  2LKG A;  2V7J A;  2G0U A;  5AQP B;  2IDO B;  4AKL A;  2J47 A;  1Z8U A;  3AE4 A;  1WLX A;  3P4R A;  4HGA A;  4QXH B;  3RH3 A;  2WDR A;  4ANJ A;  4X1Y E;  2D2S A;  4FI5 A;  3N9Q A;  1NEN A;  3O1J A;  1N33 T;  2YEV C;  2GK9 A;  2KWI B;  5L2L A;  5E0O A;  2MTQ A;  3BQK A;  2KWH A;  5ABG A;  4DR2 T;  3AED A;  3FXD B;  1LVF A;  1HNZ T;  4X5T A;  3LK4 2;  4ILC A;  2Q9Q A;  1I94 T;  4H9N C;  5JVD E;  4AKG A;  3JAD A;  4DV4 T;  3FZH B;  4P0A A;  1CHU A;  4KHZ F;  1N32 T;  5LJM A;  5LHI B;  2LJL A;  3ZMT B;  2VKH A;  3QC9 A;  4ZI3 D;  4OYJ A;  4JUY A;  5LG4 A;  2K9A A;  5ABH A;  3RIF A;  3NWI A;  5AQJ B;  1KK7 A;  4UF0 B;  5L4E A;  5IUX A;  5LMU T;  3AAI A;  4H9Q C;  3V5S A;  4ISS A;  2LSG A;  3OVU A;  4TV9 E;  2LM2 A;  1E1H B;  2A72 A;  1H7C A;  3P8C D;  4CN4 A;  5HCM A;  4QKN A;  4ERR A;  2W0G A;  3AE1 A;  5LXT E;  4A56 A;  3WAJ A;  2NR4 A;  2VVN A;  3HI2 A;  1OED E;  2M67 A;  4ZHQ E;  4G2A A;  3K3O A;  1KF6 A;  2Y8D A;  3J9X 1;  5LGU B;  4B3S T;  1YQ3 A;  1I6Z A;  3VKH A;  1KNZ A;  5F8P A;  1HX1 B;  4AKH A;  4U2Y A;  5M4Y A;  1GQE A;  4YHJ A;  1XNQ T;  4KX6 A;  3E08 A;  1FMV A;  3BK9 A;  3ZMV B;  4OHF A;  4YXD A;  2PFV A;  4PJL A;  3BQL A;  2XPK A;  4IDQ A;  2ACX A;  2H3R A;  4QH4 A;  2V7M A;  1AJ3 A;  2NOX A;  3Q2M A;  3CQX C;  3Q5D A;  3AE5 A;  4CXY A;  4JYA T;  4X64 T;  2ZM0 A;  2FUP A;  1FJG T;  4LF4 T;  3CKD A;  4DR4 T;  3MXZ A;  2CXD A;  4IDO A;  2FJB A;  4TWD A;  3RX6 A;  1HNW T;  3MKD A;  1MIV A;  2MBG A;  3ZLI A;  2LOP A;  1ZP0 A;  2E2A A;  4ZEY A;  4JI8 T;  4LML A;  1QSD A;  2L9Q A;  1MMN A;  2XQA A;  1MMD A;  1IAP A;  1Z0P A;  4IE4 A;  4TWF A;  3CK6 A;  2CLY C;  4IGU A;  1D0X A;  3C98 B;  5FVL A;  5JR9 C;  3OKQ A;  4TUY E;  4UV8 B;  3JAE A;  4UEM A;  5C3J A;  2XAQ B;  2KT9 A;  5FMN A;  1HR0 T;  3SRZ A;  1XDP A;  1J5W A;  2DLR A;  3KV6 A;  4JI2 T;  2IIU A;  4AIS A;  2BBJ A;  4ADZ A;  4AKI A;  1X9B A;  5L3D B;  2YK0 A;  5AQG B;  4TWH A;  3FZK B;  3P4Q A;  5KMG P;  2E9X A;  5J1G A;  4DUZ T;  4TZ4 C;  3O1I A;  4O4I E;  5F3J A;  3H3A A;  4PJM A;  4QXB B;  1YD8 G;  2BG9 B;  4AQF A;  3ZMZ B;  2LSI A;  3LFM A;  3ZPO A;  2DI4 A;  3PUS A;  2XUE A;  3ABV A;  2LSK A;  2YDQ A;  4PAG A;  4DMW A;  2JQK A;  4DBR A;  4KMC A;  3F2E A;  1LRZ A;  5DQV A;  4JI0 T;  2BZB A;  3ZN1 B;  5L47 A;  2W4X A;  2NP9 A;  2R6G F;  2V7K A;  4B3M T;  4CQI A;  1G73 A;  2YN6 A;  2XQ7 A;  4LFA T;  3PE0 A;  1IBM T;  2X51 A;  2X9H A;  4DV6 T;  1VCT A;  2V6Y A;  3CX6 B;  2E8I A;  2V5D A;  2K3W A;  3ZJ2 A;  1UUR A;  3GMI A;  1N34 T;  2YKS A;  2WM9 A;  4DO0 A;  4IDZ A;  2KZ7 B;  3ZEF B;  3AB3 B;  4U74 A;  5AQU B;  1HFA A;  1XZY A;  2D0T A;  3CPZ A;  4K0U A;  2EHO C;  5FY0 A;  2X67 A;  2NW9 A;  4H9P C;  5FKY A;  2JRK A;  3IHR A;  4J2C A;  3T1Y T;  5L4H A;  4IHJ E;  3O4X E;  4YTN A;  4X1I E;  3KDS E;  1N36 T;  4CXX A;  1IBK T;  3OYX A;  5FXV A;  1OWA A;  4AQG A;  2VVS A;  4GIW A;  3N9L A;  2N2N A;  1FIO A;  1WFD A;  3FHN A;  4MBQ A;  5JH7 E;  5JRE A;  2ZM6 T;  3VR8 A;  2L8K A;  2A2F X;  3CX8 B;  4DR5 T;  3SWH A;  5AQV B;  2XY8 B;  4LFC T;  2CXF A;  2HH7 A;  2XTL A;  4GKK T;  2W66 A;  3ZMU B;  4COF A;  4O4L E;  2ACZ A;  2UUC T;  3V5U A;  1UK5 A;  2CPT A;  5EK4 A;  1HTJ F;  2CA5 A;  4DBQ A;  3QUJ A;  2JPF A;  3ZST A;  1FEW A;  5JDG A;  1XNR T;  5HXH A;  1OED A;  2LKH A;  5J0Z A;  4A5X A;  3IBP A;  2E5V A;  5AQL B;  3VHL A;  4YLH A;  2WU5 A;  4DV3 T;  3RC8 A;  3TLW A;  4DR1 T;  4MHC A;  5C2T A;  4CI3 B;  2H7V C;  4ZOL E;  4PJN A;  4ZS3 A;  3KV4 A;  3ZC1 A;  4NUV A;  1NAF A;  3KFW X;  4IT4 A;  4QWN B;  4TN7 B;  5DJQ C;  4I0U A;  2EHO D;  4P0B A;  4M1P A;  2LLY A;  2RPA A;  4OYK A;  2B76 A;  2XHE B;  3K3Q C;  5JRC A;  4G63 A;  2CCQ A;  2RA1 A;  2QRX A;  4YTP A;  4I50 E;  3N2G E;  4ZI2 C;  3C50 A;  4JI7 T;  4EZH A;  2V5C A;  3EUH A;  1T7S A;  2DWK A;  1MND A;  4OFZ A;  4X20 E;  2ZMA A;  4YFS A;  4UXN B;  3RLF F;  3RYC E;  1SHZ C;  3EDV A;  4AQY T;  2IAK A;  2YDS A;  3C4Z A;  4N78 D;  5FYM A;  3D0T A;  3PTR B;  4DV0 T;  3AE6 A;  3R84 B;  1HX8 A;  2XAH B;  3VKG A;  2XQ5 A;  2XAF B;  4V1A v;  5CA0 E;  5H6R B;  4I43 B; 
#chains in the Genus database with same CATH homology
 2Y8D A;  3J9X 1;  5LGU B;  1UCU A;  2Q9Q D;  2N1G A;  4H63 H;  2WAU A;  3AA6 B;  5FY1 A;  2LHR A;  3GN5 A;  3UUL A;  4BJM A;  3VKH A;  1KNZ A;  3RRW A;  5F8P A;  5L3C B;  4H9R C;  2YIN A;  1IJ6 A;  3L09 A;  3KVB A;  4AKH A;  3ZCI A;  2CWO A;  5M4Y A;  3U3I A;  5HXE A;  4YHJ A;  5L3G B;  1O3X A;  3E08 A;  3RYI E;  3KIN B;  2LHN A;  1FMV A;  3NRX A;  3BK9 A;  5JDH A;  3IF8 B;  3ZMV B;  4OHF A;  4MAL A;  5J2U E;  3LK2 B;  3ZN0 B;  4CI1 B;  1US7 B;  2PFV A;  4PJL A;  1BR1 A;  4PK6 A;  3BQL A;  1U5P A;  4U72 A;  2W61 A;  1BR0 A;  2VK9 A;  2ACX A;  2CEA A;  2H3R A;  5HWY A;  5H6Q B;  4ZS2 A;  3N9N A;  3DP7 A;  3LK3 B;  2V7M A;  5GON E;  1AJ3 A;  2NOX A;  3N2K E;  3Q2M A;  2CLY B;  4WNK A;  5HXR A;  3CQX C;  3RC3 A;  4C90 A;  4GOU A;  4JLE A;  4WBN E;  4UVC B;  5KDM C;  3Q9D A;  4CXY A;  4YJ2 E;  2BVL A;  2ZM0 A;  5JR9 B;  3I9W A;  1MIY A;  2W00 A;  3I9Y A;  3UUX B;  2KND A;  4IE5 A;  1ZKE A;  1WYB A;  2LE8 A;  4ZI2 D;  1MMA A;  1S94 A;  1G8X A;  3B57 A;  3N5L A;  3N9P A;  4AXP A;  3ANW A;  2V1D B;  5LJN A;  3LBX B;  2HPJ A;  4WW0 A;  2IW5 B;  3CKD A;  5EK3 A;  4GYR A;  3MXZ A;  3ZYL A;  4QXC B;  3S4U A;  2CXD A;  2Z6E A;  3AA0 B;  1LKX A;  4ASK A;  4O4J E;  3RX6 A;  3OBV E;  3GA8 A;  2LSJ A;  3MKD A;  4O2B E;  2E9X D;  1MIV A;  2W63 A;  3KBU A;  1VOM A;  3PUG A;  2MBG A;  3ZLI A;  3I0Q A;  4Z8X A;  2XAJ B;  5LGT B;  2LOP A;  3UT5 E;  3NZP A;  3O9X A;  5CA1 E;  4HFV A;  4FJO A;  2K5B B;  3AAE B;  3B13 A;  2CE7 A;  2V7L A;  4H9O C;  4XAX B;  4E7S A;  2PJQ A;  4NUU A;  5FNV E;  4H9S E;  4XBF B;  2LOS A;  1HS7 A;  1D0Y A;  1QSD A;  1ZEE A;  2L9Q A;  5L3F B;  1MMN A;  4CZZ B;  2VKJ A;  3K8P C;  4PFO A;  4H63 V;  2LT3 A;  1MMD A;  1ZV4 X;  2HPL A;  3C4W A;  1IAP A;  1Z0P A;  3HKB E;  4IE4 A;  3SOL A;  5C8Y E;  3DTO A;  2CLY C;  1MIW A;  4IGU A;  1D0X A;  3C98 B;  3VU7 H;  5HXS A;  5JR9 C;  4B6X A;  2NW8 A;  2JMK A;  3OKQ A;  3R6N A;  2KMF A;  4TUY E;  1U4Q A;  2VKD A;  4UV8 B;  3NBX X;  4UEM A;  2XAQ B;  2KT9 A;  5FMN A;  3UFE A;  5FXZ A;  4L0R A;  4ILU A;  3SRZ A;  2DLR A;  3ETU A;  3KV6 A;  4IST A;  3HKD E;  4QHO A;  3UTK A;  5JRC B;  2DHR A;  4ADZ A;  5A1L A;  4AKI A;  3FBZ A;  5L3D B;  2YK0 A;  2ZM8 A;  1FMW A;  2X9W A;  1B7T A;  3FXE B;  5KMG P;  2E9X A;  5J1G A;  4TZ4 C;  5TAO A;  3O1I A;  4O4I E;  2N9D A;  5F3J A;  1S35 A;  3H3A A;  4O4H E;  4PJM A;  4QX7 B;  3I0O A;  4QXB B;  1YD8 G;  3Q5X A;  1V9D A;  5L3B B;  5IHY A;  3I1A A;  5JR9 A;  3LG7 A;  4AQF A;  5AFU L;  3ZMZ B;  2UXX B;  4L5G A;  4EB6 E;  2LSI A;  1WR6 A;  3LFM A;  2DI4 A;  3FBL A;  3ZPO A;  4BJN A;  4EYU A;  2MOZ A;  3PUS A;  2XUE A;  2LSK A;  3ESL A;  4I4T E;  3JC6 C;  4ZI7 E;  4PAG A;  4DMW A;  5FXW A;  4DBR A;  4UVA B;  4BA9 A;  4L9I A;  2VWA A;  4KMC A;  5LCY A;  4IE7 A;  1D0Z A;  3F2E A;  4WBO A;  1LRZ A;  5LNK A;  5DQV A;  5ETW A;  2C5I T;  4JEH B;  2BZB A;  2X0L B;  3ZN1 B;  4PJJ A;  2EHO B;  2JMH A;  2XQY A;  5L3E B;  2BVM A;  5FY7 A;  3HL6 A;  5LHG B;  4X1K E;  5DAB A;  1BR2 A;  4JEU B;  1X79 A;  2NP9 A;  2V7K A;  4GYS A;  2KLQ A;  5HYA A;  2K48 A;  2PG8 A;  4CQI A;  4F6R C;  2VB6 A;  2X68 A;  3PUA A;  1G73 A;  2UXN B;  4KUM B;  2QA7 A;  5LOV E;  3PU8 A;  4UF0 A;  4KP3 C;  1YKH B;  2A3D A;  3PE0 A;  2I59 A;  3E22 E;  4GK5 E;  4PW8 A;  2VL8 A;  2X51 A;  2X9H A;  2B1E A;  2XAS B;  3GN5 B;  3SS1 A;  4CXW A;  3CQG B;  3AAA B;  3AVR A;  3CX6 B;  4PNI A;  3J7Y q;  2CWY A;  2CXL A;  3LJC A;  3M65 A;  3PDY A;  4PK4 A;  3KVA A;  2E8I A;  3HA4 A;  3HR0 A;  3AA7 B;  5FXX A;  4E7Z A;  3ZJ2 A;  5DQW A;  4I55 E;  3GMI A;  5LBQ B;  2WM9 A;  4YJ3 E;  3ZMS B;  3QK6 A;  3F31 A;  3PU3 A;  5LYJ E;  1YW0 A;  2Y48 B;  4MFR A;  4EXT A;  4DO0 A;  4IDZ A;  4EYY R;  2KZ7 B;  3ETV A;  4O8S A;  4PFP A;  3ZEF B;  2YU1 A;  3AB3 B;  4U74 A;  1HFA A;  2C0S A;  1Y64 B;  2D0T A;  4TX5 A;  3AVS A;  2NTX A;  3CPZ A;  4K0U A;  3TKL B;  2EHO C;  5JQG E;  5FY0 A;  2ODU A;  2X67 A;  2NW9 A;  2CM0 A;  1HF8 A;  4H9P C;  5LBM A;  2NTY A;  2V7I A;  5IYZ E;  2SPC A;  2JRK A;  4TV8 E;  2WMO A;  4XZC A;  3IHR A;  2CMR A;  3ZCJ A;  3OJA A;  3CML A;  4DMV A;  2NWB A;  2V26 A;  4J2C A;  4O2A E;  4UVB B;  1BR4 A;  4IHJ E;  3O4X E;  4X1I E;  2DCF A;  3KDS E;  5HAX A;  2WMN A;  4CI2 B;  1T98 A;  2Q9Q B;  4CXX A;  2W62 A;  2ES0 A;  3OYX A;  5FXV A;  4ZI3 C;  3WI3 A;  1OWA A;  3ANW B;  2BDE A;  4AQG A;  1IJ5 A;  5EK2 A;  4GIW A;  5J2T E;  3F57 A;  3N9L A;  4UEL A;  3ONX A;  2N2N A;  5FP3 A;  3ZYM A;  5ADX L;  3ZYK A;  3P7I A;  1FIO A;  1MMG A;  2X9Y A;  3A5X A;  4EOZ B;  2RP4 A;  4GK0 E;  4AKR B;  3MAC A;  4DVD A;  4IIJ E;  3JC6 D;  3ZC0 A;  3FHN A;  3BQI A;  1UX5 A;  2VAS A;  3C51 A;  2ZM2 A;  4MBQ A;  2DNX A;  2KXP B;  2JQQ A;  5HWX A;  5KX5 E;  5JH7 E;  2X66 A;  3T8O A;  2QGS A;  5JRE A;  2L8K A;  3KBT A;  2A2F X;  3H37 A;  1UX4 A;  1EZ3 A;  3CX8 B;  3RYF E;  4HEA A;  4EIW A;  4HTE A;  1NWM X;  3MK7 C;  2C5J A;  4PK5 A;  4UIG A;  3SWH A;  1QUU A;  3PUQ A;  2LSY A;  2CXF A;  2IC9 A;  2HH7 A;  4IE0 A;  2XTL A;  2H7O A;  4EAH A;  5JDM A;  1WYC A;  1LVK A;  3LBX A;  3ZMU B;  4MLK A;  4O4L E;  3N9M A;  2V7J A;  1IZN B;  2LM9 A;  2VKO A;  2G0U A;  2J1D G;  2ODV A;  3PUR A;  3V5U A;  1MNE A;  4QX8 B;  3U78 A;  3KV9 A;  1WRD A;  4AKL A;  2WWU A;  5EK4 A;  1HTJ F;  1WLX A;  2CA5 A;  3UUM A;  4HGA A;  4DBQ A;  3QUJ A;  3UUN A;  2JPF A;  3IEE A;  4QXH B;  3N2O A;  3RH3 A;  2JJ9 A;  4ANJ A;  1FEW A;  5EZY E;  5JDG A;  3NRY A;  2KIN B;  4X1Y E;  3O1H A;  5JDQ A;  2D2S A;  4FI5 A;  2Q9Q C;  5JDL A;  3RRC A;  4EZ4 A;  3N9Q A;  2MYS A;  3O1J A;  5HXH A;  2YEV C;  3MA9 A;  1CUN A;  5HXC A;  2GK9 A;  3IBP A;  5JDF A;  5LP6 E;  2P9B A;  2KWI B;  4YLH A;  3VHL A;  1YKE B;  2K24 A;  5L2L A;  4HN9 A;  3RC8 A;  1D1C A;  2C5K T;  5E0O A;  2E9X B;  2MTQ A;  3BQK A;  3NZQ A;  4MHC A;  2KWH A;  3RYH E;  4CI3 B;  3Q5W A;  1OXZ A;  2H7V C;  4ZOL E;  4PJN A;  4ZS3 A;  3KV4 A;  3ZC1 A;  3FXD B;  5CB4 E;  3AA1 B;  2D0U A;  3EDU A;  4NUV A;  1NAF A;  3KFW X;  1LVF A;  3OYZ A;  4QWN B;  2X9X A;  4TN7 B;  5DJQ C;  3LK4 2;  4P09 A;  2EHO D;  4P0B A;  2Q9Q A;  4M1P A;  4H9N C;  5JVD E;  4OYK A;  4AKG A;  5LHH B;  3K3N A;  1D1A A;  4IE6 A;  2XHE B;  4P0A A;  3ZJ1 A;  3K3Q C;  3CWZ B;  5JRC A;  4G63 A;  2PBI A;  2CCQ A;  4DND A;  4AI6 A;  2RA1 A;  5BMV E;  5LJM A;  5LHI B;  2LJL A;  3L3P A;  3ZMT B;  4I50 E;  2VKH A;  3N2G E;  4ZI2 C;  3QC9 A;  3C50 A;  4ZI3 D;  3CVR A;  1SA0 E;  4BAY B;  2DWG A;  4OYJ A;  4EZH A;  1HG2 A;  4JUY A;  5LG4 A;  2K9A A;  3EUH A;  3C4X A;  3DJB A;  2DWK A;  1MND A;  4OFZ A;  4X20 E;  2WSS V;  3C64 A;  3KV5 A;  2OA5 A;  2ZMA A;  3E0Z A;  1HG5 A;  1KK7 A;  4UF0 B;  4YFS A;  4UXN B;  2IC6 A;  3CQC B;  3RYC E;  1SHZ C;  1VRB A;  3EVY A;  3AAI A;  4H9Q C;  3V5S A;  3RPU A;  4ISS A;  2LSG A;  2E9X C;  4TV9 E;  3RKO A;  3EDV A;  2Y6X A;  1E1H B;  2NW7 A;  2A72 A;  1H7C A;  2IAK A;  1HCI A;  1D1B A;  3P8C D;  5JDN A;  3MZK B;  2L3L A;  4HE8 A;  4AQF C;  2LEH A;  3C4Z A;  4QKN A;  4ERR A;  4OK0 A;  2EHO A;  2ZLY A;  4N78 D;  3HKC E;  2W0G A;  3FB2 A;  3HKE E;  5FYM A;  5LXT E;  4A56 A;  3WAJ A;  3N9O A;  5LGN B;  4HKA A;  3D0T A;  3PTR B;  2D5U A;  3HI2 A;  3MJX A;  3R84 B;  1HX8 A;  2XAH B;  4UV9 B;  5LA6 E;  3WAK A;  3VKG A;  2M67 A;  4KBM B;  4C91 A;  2XAF B;  4V1A v;  5CA0 E;  5H6R B;  4ZHQ E;  3CX7 B;  4I43 B;  3GWH A;  3W15 B;  4G2A A;  3K3O A;  1ZHC A;  2WBL A;  2XAG B;  2YU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...