4OYJA

Structure of the apo hoip pub domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
b'PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 60
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oyjA00
5LJMA 2D5UA 2HPJA 4JUYA 4P0BA 2HPLA 4P09A 4OYKA 2CM0A 2CCQA 4OYJA 4P0AA 5LJNA
chains in the Genus database with same CATH superfamily
3P4SA 1HX8A 2DI4A 3PUQA 4AIUA 1KNZA 3NKZA 4AQYT 2VQET 4B6XA 5AQHB 3K3NA 4ZS3A 1J1JA 4U74A 2W66A 3JC6D 5L3CB 2JQHA 5AQMB 5CJ5A 3RYHE 4P1NA 5JRCB 1US7B 3GMIA 1IAPA 2KWHA 2WB5A 2V5CA 1E2AA 2LT3A 2G0UA 2BS4A 5L3DB 3AE2A 2HHHT 2K9AA 3AVSA 5ABGA 2BVMA 5JRCA 4IDQA 3PUAA 5AQSB 2CLYB 5BR8T 3ONJA 5FL0A 4ZI2C 4JI1T 3HKCE 1BR2A 2WBLA 4PK4A 5A1LA 2D9DA 4O4JE 3PUYF 2XY8B 4PJLA 5ABFB 4IDPA 4HTEA 3QOFA 4HWIB 4TV8E 3RYCE 1D0ZA 1IBKT 2WDQA 4EV6A 1D1AA 3LJCA 4WW0A 3WI3A 4ZEYA 4AXPA 4XAXB 3AEFA 3OYZA 2VL0A 3AE1A 2XHEB 3UULA 2YDSA 1FEWA 3L8RA 3CMLA 3PJAJ 2JIWA 1MMNA 3T1HT 4UELA 4HGAA 4QX8B 5AQVB 4QH4A 5L2LA 2YDQA 4NXMT 3AEDA 5H6QB 4LMKA 5HEGA 1JNRA 2NW8A 3HKDE 1YQ4A 1HG5A 2J47A 2UXCT 5KX5E 5J2UE 4DV1T 4DV4T 2XQ3A 4H9RC 4U31A 5CA1E 1KF6A 3LK3B 1LVKA 4G2AA 3PUVF 2ZM0A 3AXJA 4BA9A 1GQEA 4MHCA 5JVDE 3ZN1B 2LKGA 2IW5B 1HFAA 2QRXA 2LRLA 3RQWA 1E7PA 3ZMTB 3WAKA 4YT0A 2WWVA 3UU3A 1W0BA 1VCTA 3C51A 3SOLA 1HX1B 3CQCB 3AVRA 2XQ4A 2GK9A 3NBXX 4WYVA 2E9XB 3JC6C 3RIUC 2XQ6A 4AI6A 4GYRA 3IHRA 4K0UA 4AQGA 5LYJE 3M3ZB 2BS2A 4YHJA 3W15B 3AAAB 3QK6A 2VK9A 3KVAA 4DIDB 1I6ZA 4EZHA 1L0VA 2ACXA 4O4LE 4TUYE 2XZEA 4QKNA 2XQ9A 3RLFF 2E9XA 4PJJA 2R6GF 3ZLIA 4AKLA 2LSKA 2F4VT 4DVDA 3CIRA 4ZI3C 4CZZB 4JI6T 3AEGA 4CI1B 1MIVA 4YSYA 4CXWA 4NPPA 3PTRB 1MIYA 2LM2A 3CK6A 4ILUA 3ZCIA 4JEUB 4DNDA 3FBLA 4U33A 1N36T 4MALA 2XQAA 4I55E 3FZHB 5LHHB 3QB5A 1KNRA 3Q9DA 4B3RT 3ZMSB 1YXRA 4YJ3E 5ABHA 4HWFA 5JR9C 2ODUA 2WMOA 2OA5A 2X0YA 3OKQA 3AECA 2WM9A 3CX7B 2BVLA 2NR4A 4PNIA 5LJMA 3MJXA 4X64T 4F8HA 4DR6T 1D1BA 4PFOA 2E5VA 1OEDE 4LF9T 3PUGA 3UUBA 5L3BB 1QLBA 3BQIA 4ASKA 1S35A 3I9YA 2BKPA 3ONXA 4HFIA 2MAWA 1UX5A 2E9XD 2UUCT 2ZM8A 5JDQA 5LNKA 3NVOA 5GONE 2KNDA 1Y01A 4YSZA 1MNDA 2CCQA 3IF8B 4X62T 3ETUA 4IDOA 2HPLA 3P7IA 4JI8T 1M7KA 2X66A 4IDNA 4WBOA 1YKEB 2DWGA 2Y48B 1X79A 2VURA 1MNEA 4NIQA 2E2AA 2IDOB 3KV4A 4UEMA 5J2TE 4EIWA 5LHGB 5LGNB 4DR2T 4L9IA 2VB6A 1O3XA 3EI0A 4QXHB 4DV2T 5JDMA 2ZM6T 4X1KE 4IGUA 2VQFT 2HN1A 1FMVA 4TV9E 1CHUA 2K24A 2VKHA 4X66T 3LSVA 4ZOLE 5M4YA 5L47A 4UVAB 1SA0E 3R6NA 2JQQA 4U7IA 4H9QC 1SHZC 4JLEA 2BBJA 2X0LB 2ES0A 5IUXA 2EHOB 5AFUL 3QNUA 4JEHB 4EGWA 1NAFA 2C5IT 3C4WA 5HWXA 1XZYA 4U2ZA 3UTKA 4C90A 4A56A 3Q5WA 4ILBA 2LE8A 5FXZA 2N1GA 4IE6A 4ILAA 2Y6XA 4X20E 4ZXLA 2FUPA 3KFWX 2EHOA 3RC8A 2WCAA 2Q9QB 4A97A 1HF8A 3BQKA 4K0KT 4DUYT 2LSGA 3AEEA 3NZPA 3SRZA 3EAMA 2A3DA 3EUHA 2X9WA 4UV8B 3RRCA 4DR3T 3CQXC 2HPJA 2J4GA 1U5PA 5JDLA 3QB5K 5LXTE 4C91A 3OVUA 3N9MA 3OPCA 4E7SA 2Z6EA 1MMDA 3AE7A 3ZT6A 2LOSA 4XBFB 1OXZA 5HWYA 3N9OA 4FJOA 1KNPA 2WDRA 4JYAT 3UQ4A 3C4ZA 2WZHA 4J2CA 4NXNT 4BAYB 2V7JA 3N2OA 4OX9T 3SS1A 1IZNB 3ZC1A 2V8SV 3CPZA 5HEHA 4IIJE 3OBVE 3ZJ2A 2M6IA 2L3LA 4UR9A 1XMOT 4O2BE 4Q25A 2ZM2A 3I1AA 3UUNA 1QUUA 2LHRA 2CEAA 4EEBA 3JADA 3ESLA 3ZYKA 2A9UA 3RKOA 5AQRB 3VKHA 2VVSA 3LK2B 1BR1A 2JQKA 3OJAA 1R8IA 1T72A 2CXLA 4LFCT 2WAUA 5FMNA 4G63A 2V7MA 5AQGB 1AJ3A 1NEKA 1WFDA 2EHOD 2XQYA 1XMQT 4UIGA 5AQQB 2UU9T 2IHR1 5KDMC 4DR7T 2YOEA 2H7VC 3M65A 2C0SA 2H88A 3K1SA 1SUMB 3PJAA 1CUNA 1UK5A 4OFZA 2LSYA 3FZFB 4OK0A 3LG7A 1HCIA 4ADZA 3RX6A 5AQOB 3AE6A 4KMCA 1VOMA 3Q2MA 2YK0A 3PUSA 3SWHA 5ABFA 5LA6E 4B3MT 3UU5A 4Z91A 4HFVA 5FYMA 1IJ6A 2VASA 4CN6A 4IL9A 2NOXA 3EHZA 4HEAA 4ZS2A 2XUEA 2W67A 3ONLC 3AA6B 3KBTA 3G06A 2KT9A 3P8CD 3AAIA 3FHNA 2LSIA 2YEVC 4OYKA 2XAGB 4U7YA 2D0TA 5IHYA 3BK9A 4V1Av 4DR5T 2X68A 3AA1B 2XSBA 3TLVA 5DQWA 3CX8B 4DMWA 5CGMA 1X9BA 4HFHA 5LGTB 4EYYR 3O9XA 3MKDA 1ZV4X 3C98B 3CVRA 2ZMAA 2D2SA 1KK7A 4HFCA 2MYSA 2XQ7A 2BG9C 1D1CA 3N9PA 3K3QC 4DBRA 1I94T 3KDSE 3Q5XA 3HKBE 3S4UA 4MLKA 4YHHT 1EZ3A 3GN5B 1XNQT 2HH7A 1UURA 4M1PA 4O8SA 4AKHA 2LKHA 5FVKA 2V6YB 2VKDA 2JMKA 4HFBA 1D0XA 3NRXA 3O1JA 4JV5T 3ZT5A 2XQ5A 3ZYLA 4PK5A 4UF0B 2JMHA 3RHWA 5F5WA 2K5BB 5AQIB 4UVBB 2DHRA 1MMAA 3H37A 3ZMZB 2XASB 2V6YA 3R84B 4PK6A 4ISSA 1G73A 1V9DA 4JBWF 1KEYA 3ABVA 3NWIA 4UF0A 5C2TA 5J1GA 5LGUB 4HKAA 4KHZF 2UUAT 3D0TA 4Z8XA 3E08A 3RYIE 3ZMUB 2DCFA 3GA8A 2V26A 2YU2A 3RF1A 4P09A 4B3TT 3GWHA 3UU4A 4A5XA 5F3JA 1XWMA 5HCMA 4ERRA 2Y8DA 5HAXA 3ZEFB 5CA0E 4YTPA 2KSRA 4U72A 5JDFA 3ZSTA 1FMWA 1OEDC 3TLSA 5IYZE 3QC9A 3TLWA 3ZPOA 2WS3A 5HXEA 3KINB 3UQ7A 2PJQA 3C64A 5ETWA 4QXCB 3MK7C 4UV9B 1WYBA 4JI5T 2SPCA 4TX5A 2J62A 2CRBA 5AQFB 2LSJA 4HWDA 5DABA 2V7KA 4O4IE 1N34T 1UUSA 1HTJF 3UU6A 5HXRA 3RC3A 4ZZCA 3AEAA 3RIAA 3L09A 4IE5A 3P4RA 5HEJA 3SFDA 3LFMA 4H9OC 1ZKEA 2PFVA 2XAQB 5EK3A 4X5TA 4YXDA 5HXHA 1T8BA 4ZHQE 3PV0F 4X1YE 2LOPA 2NW9A 3P50A 2WWUA 2FBWA 2D0UA 4DUZT 4EAHA 2ACZA 3EABA 3T8OA 3H3AA 3JAFA 1XNRT 5JREA 4I0UA 5H6RB 5AQPB 2WU2A 4CI2B 1Z8UA 4DR4T 2IC9A 3RIFA 1HG2A 4GK0E 1NWMX 2CBIA 3PURA 4DV0T 4H63V 3HR0A 2XSAA 4JUYA 3FXDB 1XDPA 5AQJB 2CLYC 2XQ8A 2WDVA 1HS7A 4TN7B 3UT5E 4LFAT 3FB2A 5HCJA 2PTFA 3KV9A 2QYWA 3FBZA 2X9XA 4QWNB 3ZC0A 4JI4T 2YDRA 4ZI2D 4JI7T 4TNVA 3P4WA 4JI2T 3MXZA 4KX6A 2CA5A 2WMNA 3ZSSA 3AB3B 2V1DB 1IBMT 1YQ3A 2CWOA 4EEDA 5JDHA 4IE4A 2NWBA 4AQFA 3LK42 3PU3A 5EK2A 1H7CA 5AQLB 3B57A 5FXXA 5LBQB 4MBQA 2CBJA 3Q5DA 1D0YA 2BZBA 1N32T 5JH7E 3MACA 3LBXB 3U3IA 1HNXT 4GOUA 5F8PA 3CQGB 5LBMA 5ABEA 4UXNB 3JCFA 4EB6E 3ETVA 3RGLA 4LF5T 3B5MA 3AAEB 4PAGA 3B13A 1NENA 4IREA 5JDNA 1WR6A 2Q9QA 2L9QA 4MFRA 3LBXA 4O2AE 2D5UA 4CN1A 2IMLA 5LB7B 5LG3A 1HR0T 2FJDA 3E22E 4EZ4A 1BR4A 1XDOA 5JR9B 4I4TE 2WZIA 2PBIA 2LJLA 2DL1A 2OV9A 3O1IA 2CMRA 2H89A 1M62A 3HI2A 2XPKA 5JR9A 4LMJA 4GKJT 1IJ5A 3AEBA 2E9XC 2XM1A 3A8YC 2A2FX 2WU5A 5L3FB 2VKJA 1WCRA 4EOZB 4N78D 5LCYA 3RQUA 3KBUA 4CN4A 5CFBA 2XAFB 2H7OA 1FJGT 4IE0A 1YW0A 5L4HA 3IA3A 4CXYA 3AA7B 4LFBT 2X0HA 3UUXB 2CXFA 4UVCB 3P4QA 2LLYA 5LMNT 4H9PC 3IBPA 1HNZT 3KV5A 4H9SE 1U4QA 3AA0B 4YSXA 2K48A 4WBNE 3FZKB 2FJAA 2YKSA 3I0OA 4IT4A 4ZI3D 4E7ZA 5KMGP 3C4XA 1VRBA 3VR8A 3ZT7A 4X65T 1UCUA 3VRAA 3ZYMA 1UX4A 3FZMB 2Q9QD 2DWKA 5FP3A 3N5LA 2YN6A 2QGSA 5L3GB 1W0AA 3RRWA 3VHLA 2V7IA 4QH5A 5AQNB 4YTNA 3UFGA 2HN2A 4IDZA 4CI3B 1ZHCA 4YY3T 2CHNA 1LKXA 2YINA 2IUBA 3OYXA 4YFSA 4H63H 2JPFA 2B1EA 2QA7A 1UGOA 1B7TA 2RA1A 4U3CA 3HKEE 2CXDA 2I6HA 5FVLA 3PE0A 1E1HB 4B3ST 3V5SA 2ZLYA 3ZKRA 2CHOA 3PUZF 3I0QA 4A98A 5IWAT 4LF7T 2IIUA 3PDYA 2BS3A 1N33T 1HNWT 5FNVE 2BDEA 3AE8A 4TWHA 4BJNA 5LHIB 5JTGA 2X9YA 5L3EB 1DU2A 3HA4A 2V5DA 3AXJB 3HL6A 2FJEA 1T98A 3QUJA 3UUMA 4KUMB 4DV5T 3MZKB 3E0ZA 4AKGA 3AE4A 4WNKA 1W9RA 5AQTB 4NUUA 2W0GA 2AE9A 4Z90A 3NZQA 2E8IA 4JI0T 3F2EA 2UXBT 2DLRA 4KP3C 2N2NA 2WP9A 5TAOA 2FJBA 4IL4A 3BQLA 1FIOA 3KV6A 4PJMA 3RPUA 3GN5A 2L8KA 4U2YA 1ZOYA 2LM9A 3WAJA 3CWZB 3ANWB 4AKRB 5LMUT 3O1HA 4O4HE 4L0RA 4QXBB 3X1DA 5EZYE 4ZZBA 2NW7A 5FY0A 4OYJA 1JNZA 3K3OA 5FXWA 3VRBA 4KBMB 1T7SA 2MOZA 2V7LA 3AE3A 4NUVA 4ZI7E 3LDQB 4FI5A 2CE7A 1WRDA 2KWIB 2WQYA 4AQFC 2UXDT 1BR0A 4KHPT 2BBHA 3ZMVB 2E5LT 3I9WA 5C3JA 2BG9E 2XAHB 3ANWA 1S94A 4DO0A 3N9LA 2P9BA 2UXXB 4QH1A 5HXSA 2EHOC 3A5XA 2WSSV 4H9NC 4F6RC 2W00A 4L5GA 3SFEA 2W4XA 2NTYA 2W2UA 2RPAA 5L4EA 4AISA 2LRKA 4LF8T 2KMFA 4GKKT 4P0BA 4GYSA 2MTQA 3FZLB 5C8YE 2XM2A 2Q9QC 4IHJE 2J1DG 4HWHA 5KXJA 5DQVA 2V6XA 3EDVA 3F31A 1Y64B 5AQUB 2BKOA 2YU1A 4TZ4C 3F57A 2I59A 4TNWA 2CM0A 3TKLB 2C5JA 1LRZA 4DV6T 2ODVA 2C5KT 4DR1T 5JQGE 3VKGA 3OTOT 2LEHA 4EXTA 4JI3T 2PG8A 5FKYA 2WY2A 3VR9A 4PFPA 3N2GE 4ISTA 3K8PC 5AQKB 1MMGA 1WLXA 4YTMA 4KI0F 4P0AA 4DV7T 2MBGA 3MA9A 3ZN0B 5LOVE 3UU8A 5LG4A 5HYAA 1KFYA 4HN9A 3DJBA 4YLHA 4QHOA 3C50A 3H3MA 5DJQC 2BKNA 3KVBA 3N9QA 4DMVA 3UFEA 4HE8A 2BG9B 2VKOA 2CWYA 3RKGA 3ZJ1A 3IEEA 2N9DA 4BJMA 2X67A 2RP4A 4HFEA 1YD8G 2M6BA 2JQ9A 2MPKA 3AE9A 1W09A 2A72A 4HFDA 5HXCA 4LF4T 2JJ9A 2UUBT 2W62A 2BG9A 3CKDA 4LF6T 4QX7B 3JAEA 2VWAA 5LJNA 5HEOA 2DNXA 3P4PA 4X1IE 1LVFA 3L39A 2KINB 2KLQA 4I43B 4TWFA 3N2KE 1YKHB 2AXDS 3ZCJA 2QVAA 1MIWA 1QSDA 3Q5EA 5BMVE 2KXPB 4CXXA 4PW8A 3RIUA 3EVYA 4PJNA 2OLTA 3J9X1 3N9NA 3TLTA 1ZEEA 2M67A 3O4XE 3TLUA 2VVNA 1WR0A 1J5WA 4WZXA 1WYCA 5FY1A 4IE7A 3CX6B 4AKIA 3V5UA 1J5ET 2H3RA 2X51A 4YJ2E 5CB4E 1Z0PA 3VU7H 3PUWF 3PU8A 4EYUA 2NP9A 3EDUA 3FXEB 1OEDB 2IC6A 5FXVA 3NRYA 2JRKA 1IBLT 3L3PA 2W61A 2I0MA 2XAJB 5JDGA 3AE5A 1OWAA 3RH3A 1OEDA 3RI5A 3DTOA 4HWCA 3U78A 4LMLA 4CQIA 4TWDA 5HEUA 4GIWA 3A7MA 1SE7A 3PUXF 2B76A 2X9HA 4DBQA 4I50E 2IAKA 4ILCA 2KZ7B 4ANJA 2XTLA 5EK4A 5J0ZA 1VCSA 2NTXA 4XZCA 5FL1A 4DV3T 5E0OA 4GK5E 4COFA 5LP6E 2LHNA 2K3WA 2VL8A 3RYFE 2UXNB 2XJ7A 3DP7A 4OHFA 2W63A 5ADXL 3J7Yq 2CPTA 1ZP0A 5FY7A 3T1YT 1G8XA
chains in the Genus database with same CATH topology
5FNVE 2BDEA 5JDMA 3KINB 1HX8A 2DI4A 2PJQA 3C64A 4X1KE 5ETWA 4BJNA 3PUQA 4QXCB 3MK7C 4IGUA 5LHIB 2X9YA 5L3EB 4UV9B 1KNZA 1FMVA 3HA4A 4TV9E 3HL6A 1WYBA 2K24A 2VKHA 4B6XA 1T98A 4ZOLE 3QUJA 2SPCA 3K3NA 4ZS3A 5M4YA 4TX5A 4U74A 3UUMA 3JC6D 4KUMB 5L3CB 4UVAB 1SA0E 3MZKB 2JQQA 3R6NA 2LSJA 3RYHE 5DABA 4H9QC 3E0ZA 1SHZC 4JLEA 5JRCB 4AKGA 2V7KA 4O4IE 4WNKA 2X0LB 2ES0A 4NUUA 2EHOB 5AFUL 1US7B 4JEHB 3GMIA 2W0GA 1IAPA 2KWHA 3NZQA 1NAFA 2E8IA 2C5IT 3C4WA 5HWXA 3F2EA 1HTJF 2LT3A 2G0UA 5HXRA 3RC3A 5L3DB 2DLRA 4KP3C 2N2NA 3UTKA 4C90A 4A56A 3Q5WA 3L09A 2K9AA 5TAOA 2LE8A 3AVSA 2N1GA 4IE6A 4IE5A 5FXZA 2BVMA 2Y6XA 4X20E 5JRCA 3BQLA 1FIOA 3KFWX 3PUAA 2CLYB 3KV6A 4PJMA 2EHOA 3RPUA 3GN5A 3RC8A 2L8KA 3LFMA 4H9OC 1ZKEA 2PFVA 4ZI2C 2LM9A 3HKCE 2Q9QB 3CWZB 3WAJA 2XAQB 3ANWB 4AKRB 3O1HA 4O4HE 4L0RA 4QXBB 1BR2A 5EZYE 2WBLA 4PK4A 5EK3A 5HXHA 1HF8A 2NW7A 5A1LA 5FY0A 4OYJA 3BQKA 4O4JE 3K3OA 4ZHQE 5FXWA 2LSGA 4PJLA 4KBMB 2MOZA 2V7LA 4HTEA 4X1YE 4NUVA 3NZPA 3SRZA 2LOPA 2NW9A 2A3DA 4ZI7E 3EUHA 4FI5A 1D0ZA 2X9WA 4TV8E 4UV8B 3RYCE 2CE7A 1WRDA 2KWIB 3RRCA 4AQFC 1D1AA 3LJCA 1BR0A 3CQXC 2HPJA 2WWUA 3ZMVB 3I9WA 2D0UA 2XAHB 3ANWA 4WW0A 4EAHA 1S94A 1U5PA 4DO0A 3N9LA 5JDLA 3T8OA 2P9BA 2UXXB 3WI3A 5HXSA 4AXPA 3H3AA 5LXTE 4C91A 4XAXB 2EHOC 3N9MA 5JREA 3A5XA 2WSSV 2Z6EA 1MMDA 4H9NC 4E7SA 5H6RB 4F6RC 2W00A 4L5GA 3OYZA 4CI2B 2NTYA 2LOSA 4XBFB 2IC9A 1HG2A 4GK0E 1NWMX 1OXZA 2XHEB 5HWYA 3UULA 3PURA 4H63V 3N9OA 3HR0A 1FEWA 2KMFA 3CMLA 4FJOA 4JUYA 3FXDB 1MMNA 4P0BA 4GYSA 4UELA 2MTQA 4HGAA 2CLYC 4QX8B 3C4ZA 4J2CA 5L2LA 1HS7A 5C8YE 4BAYB 5H6QB 2V7JA 4TN7B 3UT5E 2Q9QC 4IHJE 2J1DG 3FB2A 3N2OA 5DQVA 2NW8A 3SS1A 1IZNB 3HKDE 3ZC1A 3CPZA 1HG5A 3KV9A 4IIJE 3OBVE 3ZJ2A 3FBZA 2L3LA 3EDVA 2X9XA 3F31A 4O2BE 5KX5E 5J2UE 4QWNB 2ZM2A 3I1AA 1Y64B 4H9RC 3UUNA 3ZC0A 1QUUA 2LHRA 5CA1E 4ZI2D 2YU1A 4TZ4C 3F57A 3LK3B 2CEAA 2I59A 1LVKA 4G2AA 3MXZA 3ZYKA 2CM0A 3ESLA 2CA5A 2WMNA 3TKLB 2C5JA 3AB3B 2ZM0A 2V1DB 3RKOA 1LRZA 3VKHA 2ODVA 2C5KT 4BA9A 3LK2B 4MHCA 2CWOA 5JVDE 1BR1A 5JDHA 5JQGE 3ZN1B 4IE4A 3VKGA 2NWBA 2LEHA 4AQFA 3OJAA 2IW5B 3LK42 4EXTA 1HFAA 2CXLA 3PU3A 2WAUA 2PG8A 5EK2A 5FMNA 1H7CA 4G63A 3B57A 5FXXA 4PFPA 2V7MA 3ZMTB 1AJ3A 3WAKA 5LBQB 3N2GE 4ISTA 3K8PC 1MMGA 2EHOD 1WLXA 2XQYA 4MBQA 3C51A 3SOLA 4P0AA 4UIGA 2MBGA 3CQCB 1D0YA 2BZBA 3AVRA 5JH7E 3MACA 5KDMC 3LBXB 3MA9A 3U3IA 4GOUA 2H7VC 5F8PA 3M65A 3CQGB 2C0SA 2GK9A 5LOVE 3ZN0B 5LBMA 5LG4A 5HYAA 4UXNB 1CUNA 3NBXX 4EB6E 4HN9A 3ETVA 2E9XB 3JC6C 3DJBA 4YLHA 4OFZA 3AAEB 2LSYA 3C50A 4PAGA 4QHOA 4AI6A 3B13A 4GYRA 3IHRA 4K0UA 4AQGA 4OK0A 5DJQC 5LYJE 3KVBA 3N9QA 5JDNA 1WR6A 4YHJA 3W15B 3AAAB 3LG7A 3QK6A 2VK9A 2Q9QA 2L9QA 3KVAA 1HCIA 4ADZA 4EZHA 3RX6A 2ACXA 4MFRA 3LBXA 4O4LE 4O2AE 4DMVA 4TUYE 3UFEA 4HE8A 2D5UA 4KMCA 1VOMA 4QKNA 3Q2MA 2YK0A 3PUSA 3SWHA 2VKOA 2CWYA 5LA6E 2E9XA 4HFVA 4PJJA 5FYMA 3ZLIA 1IJ6A 3ZJ1A 2LSKA 2VASA 2N9DA 3IEEA 4AKLA 4BJMA 2X67A 4DVDA 2NOXA 2RP4A 3E22E 1YD8G 4HEAA 4EZ4A 4ZS2A 2XUEA 1BR4A 5JR9B 4I4TE 3AA6B 3KBTA 2PBIA 2A72A 2LJLA 5HXCA 2JJ9A 4ZI3C 2KT9A 3P8CD 3AAIA 3O1IA 4CZZB 3FHNA 2LSIA 2W62A 2YEVC 4OYKA 2XAGB 2CMRA 4CI1B 3CKDA 2D0TA 5IHYA 3BK9A 1MIVA 4V1Av 4CXWA 2X68A 4QX7B 3AA1B 3PTRB 1MIYA 3HI2A 5JR9A 2VWAA 4ILUA 5DQWA 3CX8B 4DMWA 5LJNA 2DNXA 1IJ5A 4X1IE 1LVFA 2E9XC 3ZCIA 4JEUB 4DNDA 2KINB 2A2FX 3FBLA 5LGTB 2KLQA 5L3FB 2VKJA 4I43B 4EYYR 3O9XA 4EOZB 4MALA 3MKDA 4N78D 5LCYA 1ZV4X 3N2KE 4I55E 3C98B 3CVRA 5LHHB 1YKHB 2ZMAA 3ZCJA 2D2SA 1KK7A 3Q9DA 1MIWA 2MYSA 1D1CA 3KBUA 1QSDA 5BMVE 2KXPB 2XAFB 3N9PA 3K3QC 4PW8A 4CXXA 3ZMSB 2H7OA 3EVYA 4PJNA 4DBRA 4IE0A 1YW0A 4YJ3E 3J9X1 3KDSE 3N9NA 4CXYA 3Q5XA 1ZEEA 3HKBE 2M67A 3S4UA 3O4XE 2ODUA 2WMOA 3AA7B 4MLKA 5JR9C 1EZ3A 2OA5A 3UUXB 3OKQA 2CXFA 3GN5B 1WYCA 4UVCB 2WM9A 3CX7B 5FY1A 2BVLA 3CX6B 4IE7A 4PNIA 5LJMA 4H9PC 3MJXA 4AKIA 3V5UA 2HH7A 2H3RA 4M1PA 2X51A 3IBPA 4O8SA 4YJ2E 4AKHA 5CB4E 1Z0PA 2VKDA 3KV5A 2JMKA 1D0XA 4H9SE 3VU7H 1D1BA 4PFOA 3PU8A 3NRXA 3O1JA 4EYUA 3PUGA 2NP9A 1U4QA 3AA0B 2K48A 4WBNE 3EDUA 3FXEB 5L3BB 3ZYLA 4PK5A 4UF0B 3I0OA 2JMHA 4ZI3D 2IC6A 4E7ZA 5KMGP 3C4XA 3BQIA 1VRBA 2K5BB 5FXVA 4ASKA 3NRYA 4UVBB 1UCUA 2DHRA 2JRKA 3ZYMA 1MMAA 3H37A 1S35A 1UX4A 3I9YA 3ZMZB 2Q9QD 3L3PA 2XASB 2DWKA 3R84B 2W61A 5FP3A 3N5LA 3ONXA 4PK6A 2XAJB 5L3GB 2QGSA 4ISSA 5JDGA 1G73A 1V9DA 3RRWA 3VHLA 2V7IA 1OWAA 3RH3A 1UX5A 4UF0A 2E9XD 5J1GA 2ZM8A 5JDQA 5LGUB 4HKAA 3DTOA 5LNKA 3U78A 5GONE 2KNDA 4IDZA 4CI3B 1MNDA 3D0TA 4Z8XA 2CCQA 3E08A 1ZHCA 4CQIA 3RYIE 3IF8B 3ETUA 3ZMUB 1LKXA 4GIWA 2DCFA 2YINA 2HPLA 3GA8A 3P7IA 3OYXA 2X66A 2V26A 4YFSA 4H63H 2YU2A 2JPFA 4WBOA 2B1EA 1YKEB 2Y48B 2DWGA 2X9HA 4DBQA 2QA7A 1X79A 4P09A 1B7TA 2RA1A 3HKEE 3GWHA 1MNEA 4I50E 2CXDA 2IAKA 5F3JA 2KZ7B 4ANJA 3PE0A 2XTLA 5EK4A 1E1HB 3KV4A 4ERRA 3V5SA 2Y8DA 2NTXA 5HAXA 4XZCA 2ZLYA 3ZEFB 5CA0E 4UEMA 5E0OA 4U72A 5JDFA 5J2TE 3I0QA 1FMWA 4GK5E 4EIWA 5LHGB 5LGNB 2LHNA 5LP6E 2VL8A 3RYFE 2UXNB 3DP7A 4L9IA 2W63A 4OHFA 5IYZE 5ADXL 3J7Yq 3PDYA 2VB6A 1O3XA 3QC9A 5FY7A 3ZPOA 1G8XA 4QXHB 5HXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJM A;  2D5U A;  2HPJ A;  4JUY A;  4P0B A;  2HPL A;  4P09 A;  4OYK A;  2CM0 A;  2CCQ A;  4OYJ A;  4P0A A;  5LJN A; 
#chains in the Genus database with same CATH topology
 3P4S A;  1HX8 A;  2DI4 A;  3PUQ A;  4AIU A;  1KNZ A;  3NKZ A;  4AQY T;  2VQE T;  4B6X A;  5AQH B;  3K3N A;  4ZS3 A;  1J1J A;  4U74 A;  2W66 A;  3JC6 D;  5L3C B;  2JQH A;  5AQM B;  5CJ5 A;  3RYH E;  4P1N A;  5JRC B;  1US7 B;  3GMI A;  1IAP A;  2KWH A;  2WB5 A;  2V5C A;  1E2A A;  2LT3 A;  2G0U A;  2BS4 A;  5L3D B;  3AE2 A;  2HHH T;  2K9A A;  3AVS A;  5ABG A;  2BVM A;  5JRC A;  4IDQ A;  3PUA A;  5AQS B;  2CLY B;  5BR8 T;  3ONJ A;  5FL0 A;  4ZI2 C;  4JI1 T;  3HKC E;  1BR2 A;  2WBL A;  4PK4 A;  5A1L A;  2D9D A;  4O4J E;  3PUY F;  2XY8 B;  4PJL A;  5ABF B;  4IDP A;  4HTE A;  3QOF A;  4HWI B;  4TV8 E;  3RYC E;  1D0Z A;  1IBK T;  2WDQ A;  4EV6 A;  1D1A A;  3LJC A;  4WW0 A;  3WI3 A;  4ZEY A;  4AXP A;  4XAX B;  3AEF A;  3OYZ A;  2VL0 A;  3AE1 A;  2XHE B;  3UUL A;  2YDS A;  1FEW A;  3L8R A;  3CML A;  3PJA J;  2JIW A;  1MMN A;  3T1H T;  4UEL A;  4HGA A;  4QX8 B;  5AQV B;  4QH4 A;  5L2L A;  2YDQ A;  4NXM T;  3AED A;  5H6Q B;  4LMK A;  5HEG A;  1JNR A;  2NW8 A;  3HKD E;  1YQ4 A;  1HG5 A;  2J47 A;  2UXC T;  5KX5 E;  5J2U E;  4DV1 T;  4DV4 T;  2XQ3 A;  4H9R C;  4U31 A;  5CA1 E;  1KF6 A;  3LK3 B;  1LVK A;  4G2A A;  3PUV F;  2ZM0 A;  3AXJ A;  4BA9 A;  1GQE A;  4MHC A;  5JVD E;  3ZN1 B;  2LKG A;  2IW5 B;  1HFA A;  2QRX A;  2LRL A;  3RQW A;  1E7P A;  3ZMT B;  3WAK A;  4YT0 A;  2WWV A;  3UU3 A;  1W0B A;  1VCT A;  3C51 A;  3SOL A;  1HX1 B;  3CQC B;  3AVR A;  2XQ4 A;  2GK9 A;  3NBX X;  4WYV A;  2E9X B;  3JC6 C;  3RIU C;  2XQ6 A;  4AI6 A;  4GYR A;  3IHR A;  4K0U A;  4AQG A;  5LYJ E;  3M3Z B;  2BS2 A;  4YHJ A;  3W15 B;  3AAA B;  3QK6 A;  2VK9 A;  3KVA A;  4DID B;  1I6Z A;  4EZH A;  1L0V A;  2ACX A;  4O4L E;  4TUY E;  2XZE A;  4QKN A;  2XQ9 A;  3RLF F;  2E9X A;  4PJJ A;  2R6G F;  3ZLI A;  4AKL A;  2LSK A;  2F4V T;  4DVD A;  3CIR A;  4ZI3 C;  4CZZ B;  4JI6 T;  3AEG A;  4CI1 B;  1MIV A;  4YSY A;  4CXW A;  4NPP A;  3PTR B;  1MIY A;  2LM2 A;  3CK6 A;  4ILU A;  3ZCI A;  4JEU B;  4DND A;  3FBL A;  4U33 A;  1N36 T;  4MAL A;  2XQA A;  4I55 E;  3FZH B;  5LHH B;  3QB5 A;  1KNR A;  3Q9D A;  4B3R T;  3ZMS B;  1YXR A;  4YJ3 E;  5ABH A;  4HWF A;  5JR9 C;  2ODU A;  2WMO A;  2OA5 A;  2X0Y A;  3OKQ A;  3AEC A;  2WM9 A;  3CX7 B;  2BVL A;  2NR4 A;  4PNI A;  5LJM A;  3MJX A;  4X64 T;  4F8H A;  4DR6 T;  1D1B A;  4PFO A;  2E5V A;  1OED E;  4LF9 T;  3PUG A;  3UUB A;  5L3B B;  1QLB A;  3BQI A;  4ASK A;  1S35 A;  3I9Y A;  2BKP A;  3ONX A;  4HFI A;  2MAW A;  1UX5 A;  2E9X D;  2UUC T;  2ZM8 A;  5JDQ A;  5LNK A;  3NVO A;  5GON E;  2KND A;  1Y01 A;  4YSZ A;  1MND A;  2CCQ A;  3IF8 B;  4X62 T;  3ETU A;  4IDO A;  2HPL A;  3P7I A;  4JI8 T;  1M7K A;  2X66 A;  4IDN A;  4WBO A;  1YKE B;  2DWG A;  2Y48 B;  1X79 A;  2VUR A;  1MNE A;  4NIQ A;  2E2A A;  2IDO B;  3KV4 A;  4UEM A;  5J2T E;  4EIW A;  5LHG B;  5LGN B;  4DR2 T;  4L9I A;  2VB6 A;  1O3X A;  3EI0 A;  4QXH B;  4DV2 T;  5JDM A;  2ZM6 T;  4X1K E;  4IGU A;  2VQF T;  2HN1 A;  1FMV A;  4TV9 E;  1CHU A;  2K24 A;  2VKH A;  4X66 T;  3LSV A;  4ZOL E;  5M4Y A;  5L47 A;  4UVA B;  1SA0 E;  3R6N A;  2JQQ A;  4U7I A;  4H9Q C;  1SHZ C;  4JLE A;  2BBJ A;  2X0L B;  2ES0 A;  5IUX A;  2EHO B;  5AFU L;  3QNU A;  4JEH B;  4EGW A;  1NAF A;  2C5I T;  3C4W A;  5HWX A;  1XZY A;  4U2Z A;  3UTK A;  4C90 A;  4A56 A;  3Q5W A;  4ILB A;  2LE8 A;  5FXZ A;  2N1G A;  4IE6 A;  4ILA A;  2Y6X A;  4X20 E;  4ZXL A;  2FUP A;  3KFW X;  2EHO A;  3RC8 A;  2WCA A;  2Q9Q B;  4A97 A;  1HF8 A;  3BQK A;  4K0K T;  4DUY T;  2LSG A;  3AEE A;  3NZP A;  3SRZ A;  3EAM A;  2A3D A;  3EUH A;  2X9W A;  4UV8 B;  3RRC A;  4DR3 T;  3CQX C;  2HPJ A;  2J4G A;  1U5P A;  5JDL A;  3QB5 K;  5LXT E;  4C91 A;  3OVU A;  3N9M A;  3OPC A;  4E7S A;  2Z6E A;  1MMD A;  3AE7 A;  3ZT6 A;  2LOS A;  4XBF B;  1OXZ A;  5HWY A;  3N9O A;  4FJO A;  1KNP A;  2WDR A;  4JYA T;  3UQ4 A;  3C4Z A;  2WZH A;  4J2C A;  4NXN T;  4BAY B;  2V7J A;  3N2O A;  4OX9 T;  3SS1 A;  1IZN B;  3ZC1 A;  2V8S V;  3CPZ A;  5HEH A;  4IIJ E;  3OBV E;  3ZJ2 A;  2M6I A;  2L3L A;  4UR9 A;  1XMO T;  4O2B E;  4Q25 A;  2ZM2 A;  3I1A A;  3UUN A;  1QUU A;  2LHR A;  2CEA A;  4EEB A;  3JAD A;  3ESL A;  3ZYK A;  2A9U A;  3RKO A;  5AQR B;  3VKH A;  2VVS A;  3LK2 B;  1BR1 A;  2JQK A;  3OJA A;  1R8I A;  1T72 A;  2CXL A;  4LFC T;  2WAU A;  5FMN A;  4G63 A;  2V7M A;  5AQG B;  1AJ3 A;  1NEK A;  1WFD A;  2EHO D;  2XQY A;  1XMQ T;  4UIG A;  5AQQ B;  2UU9 T;  2IHR 1;  5KDM C;  4DR7 T;  2YOE A;  2H7V C;  3M65 A;  2C0S A;  2H88 A;  3K1S A;  1SUM B;  3PJA A;  1CUN A;  1UK5 A;  4OFZ A;  2LSY A;  3FZF B;  4OK0 A;  3LG7 A;  1HCI A;  4ADZ A;  3RX6 A;  5AQO B;  3AE6 A;  4KMC A;  1VOM A;  3Q2M A;  2YK0 A;  3PUS A;  3SWH A;  5ABF A;  5LA6 E;  4B3M T;  3UU5 A;  4Z91 A;  4HFV A;  5FYM A;  1IJ6 A;  2VAS A;  4CN6 A;  4IL9 A;  2NOX A;  3EHZ A;  4HEA A;  4ZS2 A;  2XUE A;  2W67 A;  3ONL C;  3AA6 B;  3KBT A;  3G06 A;  2KT9 A;  3P8C D;  3AAI A;  3FHN A;  2LSI A;  2YEV C;  4OYK A;  2XAG B;  4U7Y A;  2D0T A;  5IHY A;  3BK9 A;  4V1A v;  4DR5 T;  2X68 A;  3AA1 B;  2XSB A;  3TLV A;  5DQW A;  3CX8 B;  4DMW A;  5CGM A;  1X9B A;  4HFH A;  5LGT B;  4EYY R;  3O9X A;  3MKD A;  1ZV4 X;  3C98 B;  3CVR A;  2ZMA A;  2D2S A;  1KK7 A;  4HFC A;  2MYS A;  2XQ7 A;  2BG9 C;  1D1C A;  3N9P A;  3K3Q C;  4DBR A;  1I94 T;  3KDS E;  3Q5X A;  3HKB E;  3S4U A;  4MLK A;  4YHH T;  1EZ3 A;  3GN5 B;  1XNQ T;  2HH7 A;  1UUR A;  4M1P A;  4O8S A;  4AKH A;  2LKH A;  5FVK A;  2V6Y B;  2VKD A;  2JMK A;  4HFB A;  1D0X A;  3NRX A;  3O1J A;  4JV5 T;  3ZT5 A;  2XQ5 A;  3ZYL A;  4PK5 A;  4UF0 B;  2JMH A;  3RHW A;  5F5W A;  2K5B B;  5AQI B;  4UVB B;  2DHR A;  1MMA A;  3H37 A;  3ZMZ B;  2XAS B;  2V6Y A;  3R84 B;  4PK6 A;  4ISS A;  1G73 A;  1V9D A;  4JBW F;  1KEY A;  3ABV A;  3NWI A;  4UF0 A;  5C2T A;  5J1G A;  5LGU B;  4HKA A;  4KHZ F;  2UUA T;  3D0T A;  4Z8X A;  3E08 A;  3RYI E;  3ZMU B;  2DCF A;  3GA8 A;  2V26 A;  2YU2 A;  3RF1 A;  4P09 A;  4B3T T;  3GWH A;  3UU4 A;  4A5X A;  5F3J A;  1XWM A;  5HCM A;  4ERR A;  2Y8D A;  5HAX A;  3ZEF B;  5CA0 E;  4YTP A;  2KSR A;  4U72 A;  5JDF A;  3ZST A;  1FMW A;  1OED C;  3TLS A;  5IYZ E;  3QC9 A;  3TLW A;  3ZPO A;  2WS3 A;  5HXE A;  3KIN B;  3UQ7 A;  2PJQ A;  3C64 A;  5ETW A;  4QXC B;  3MK7 C;  4UV9 B;  1WYB A;  4JI5 T;  2SPC A;  4TX5 A;  2J62 A;  2CRB A;  5AQF B;  2LSJ A;  4HWD A;  5DAB A;  2V7K A;  4O4I E;  1N34 T;  1UUS A;  1HTJ F;  3UU6 A;  5HXR A;  3RC3 A;  4ZZC A;  3AEA A;  3RIA A;  3L09 A;  4IE5 A;  3P4R A;  5HEJ A;  3SFD A;  3LFM A;  4H9O C;  1ZKE A;  2PFV A;  2XAQ B;  5EK3 A;  4X5T A;  4YXD A;  5HXH A;  1T8B A;  4ZHQ E;  3PV0 F;  4X1Y E;  2LOP A;  2NW9 A;  3P50 A;  2WWU A;  2FBW A;  2D0U A;  4DUZ T;  4EAH A;  2ACZ A;  3EAB A;  3T8O A;  3H3A A;  3JAF A;  1XNR T;  5JRE A;  4I0U A;  5H6R B;  5AQP B;  2WU2 A;  4CI2 B;  1Z8U A;  4DR4 T;  2IC9 A;  3RIF A;  1HG2 A;  4GK0 E;  1NWM X;  2CBI A;  3PUR A;  4DV0 T;  4H63 V;  3HR0 A;  2XSA A;  4JUY A;  3FXD B;  1XDP A;  5AQJ B;  2CLY C;  2XQ8 A;  2WDV A;  1HS7 A;  4TN7 B;  3UT5 E;  4LFA T;  3FB2 A;  5HCJ A;  2PTF A;  3KV9 A;  2QYW A;  3FBZ A;  2X9X A;  4QWN B;  3ZC0 A;  4JI4 T;  2YDR A;  4ZI2 D;  4JI7 T;  4TNV A;  3P4W A;  4JI2 T;  3MXZ A;  4KX6 A;  2CA5 A;  2WMN A;  3ZSS A;  3AB3 B;  2V1D B;  1IBM T;  1YQ3 A;  2CWO A;  4EED A;  5JDH A;  4IE4 A;  2NWB A;  4AQF A;  3LK4 2;  3PU3 A;  5EK2 A;  1H7C A;  5AQL B;  3B57 A;  5FXX A;  5LBQ B;  4MBQ A;  2CBJ A;  3Q5D A;  1D0Y A;  2BZB A;  1N32 T;  5JH7 E;  3MAC A;  3LBX B;  3U3I A;  1HNX T;  4GOU A;  5F8P A;  3CQG B;  5LBM A;  5ABE A;  4UXN B;  3JCF A;  4EB6 E;  3ETV A;  3RGL A;  4LF5 T;  3B5M A;  3AAE B;  4PAG A;  3B13 A;  1NEN A;  4IRE A;  5JDN A;  1WR6 A;  2Q9Q A;  2L9Q A;  4MFR A;  3LBX A;  4O2A E;  2D5U A;  4CN1 A;  2IML A;  5LB7 B;  5LG3 A;  1HR0 T;  2FJD A;  3E22 E;  4EZ4 A;  1BR4 A;  1XDO A;  5JR9 B;  4I4T E;  2WZI A;  2PBI A;  2LJL A;  2DL1 A;  2OV9 A;  3O1I A;  2CMR A;  2H89 A;  1M62 A;  3HI2 A;  2XPK A;  5JR9 A;  4LMJ A;  4GKJ T;  1IJ5 A;  3AEB A;  2E9X C;  2XM1 A;  3A8Y C;  2A2F X;  2WU5 A;  5L3F B;  2VKJ A;  1WCR A;  4EOZ B;  4N78 D;  5LCY A;  3RQU A;  3KBU A;  4CN4 A;  5CFB A;  2XAF B;  2H7O A;  1FJG T;  4IE0 A;  1YW0 A;  5L4H A;  3IA3 A;  4CXY A;  3AA7 B;  4LFB T;  2X0H A;  3UUX B;  2CXF A;  4UVC B;  3P4Q A;  2LLY A;  5LMN T;  4H9P C;  3IBP A;  1HNZ T;  3KV5 A;  4H9S E;  1U4Q A;  3AA0 B;  4YSX A;  2K48 A;  4WBN E;  3FZK B;  2FJA A;  2YKS A;  3I0O A;  4IT4 A;  4ZI3 D;  4E7Z A;  5KMG P;  3C4X A;  1VRB A;  3VR8 A;  3ZT7 A;  4X65 T;  1UCU A;  3VRA A;  3ZYM A;  1UX4 A;  3FZM B;  2Q9Q D;  2DWK A;  5FP3 A;  3N5L A;  2YN6 A;  2QGS A;  5L3G B;  1W0A A;  3RRW A;  3VHL A;  2V7I A;  4QH5 A;  5AQN B;  4YTN A;  3UFG A;  2HN2 A;  4IDZ A;  4CI3 B;  1ZHC A;  4YY3 T;  2CHN A;  1LKX A;  2YIN A;  2IUB A;  3OYX A;  4YFS A;  4H63 H;  2JPF A;  2B1E A;  2QA7 A;  1UGO A;  1B7T A;  2RA1 A;  4U3C A;  3HKE E;  2CXD A;  2I6H A;  5FVL A;  3PE0 A;  1E1H B;  4B3S T;  3V5S A;  2ZLY A;  3ZKR A;  2CHO A;  3PUZ F;  3I0Q A;  4A98 A;  5IWA T;  4LF7 T;  2IIU A;  3PDY A;  2BS3 A;  1N33 T;  1HNW T;  5FNV E;  2BDE A;  3AE8 A;  4TWH A;  4BJN A;  5LHI B;  5JTG A;  2X9Y A;  5L3E B;  1DU2 A;  3HA4 A;  2V5D A;  3AXJ B;  3HL6 A;  2FJE A;  1T98 A;  3QUJ A;  3UUM A;  4KUM B;  4DV5 T;  3MZK B;  3E0Z A;  4AKG A;  3AE4 A;  4WNK A;  1W9R A;  5AQT B;  4NUU A;  2W0G A;  2AE9 A;  4Z90 A;  3NZQ A;  2E8I A;  4JI0 T;  3F2E A;  2UXB T;  2DLR A;  4KP3 C;  2N2N A;  2WP9 A;  5TAO A;  2FJB A;  4IL4 A;  3BQL A;  1FIO A;  3KV6 A;  4PJM A;  3RPU A;  3GN5 A;  2L8K A;  4U2Y A;  1ZOY A;  2LM9 A;  3WAJ A;  3CWZ B;  3ANW B;  4AKR B;  5LMU T;  3O1H A;  4O4H E;  4L0R A;  4QXB B;  3X1D A;  5EZY E;  4ZZB A;  2NW7 A;  5FY0 A;  4OYJ A;  1JNZ A;  3K3O A;  5FXW A;  3VRB A;  4KBM B;  1T7S A;  2MOZ A;  2V7L A;  3AE3 A;  4NUV A;  4ZI7 E;  3LDQ B;  4FI5 A;  2CE7 A;  1WRD A;  2KWI B;  2WQY A;  4AQF C;  2UXD T;  1BR0 A;  4KHP T;  2BBH A;  3ZMV B;  2E5L T;  3I9W A;  5C3J A;  2BG9 E;  2XAH B;  3ANW A;  1S94 A;  4DO0 A;  3N9L A;  2P9B A;  2UXX B;  4QH1 A;  5HXS A;  2EHO C;  3A5X A;  2WSS V;  4H9N C;  4F6R C;  2W00 A;  4L5G A;  3SFE A;  2W4X A;  2NTY A;  2W2U A;  2RPA A;  5L4E A;  4AIS A;  2LRK A;  4LF8 T;  2KMF A;  4GKK T;  4P0B A;  4GYS A;  2MTQ A;  3FZL B;  5C8Y E;  2XM2 A;  2Q9Q C;  4IHJ E;  2J1D G;  4HWH A;  5KXJ A;  5DQV A;  2V6X A;  3EDV A;  3F31 A;  1Y64 B;  5AQU B;  2BKO A;  2YU1 A;  4TZ4 C;  3F57 A;  2I59 A;  4TNW A;  2CM0 A;  3TKL B;  2C5J A;  1LRZ A;  4DV6 T;  2ODV A;  2C5K T;  4DR1 T;  5JQG E;  3VKG A;  3OTO T;  2LEH A;  4EXT A;  4JI3 T;  2PG8 A;  5FKY A;  2WY2 A;  3VR9 A;  4PFP A;  3N2G E;  4IST A;  3K8P C;  5AQK B;  1MMG A;  1WLX A;  4YTM A;  4KI0 F;  4P0A A;  4DV7 T;  2MBG A;  3MA9 A;  3ZN0 B;  5LOV E;  3UU8 A;  5LG4 A;  5HYA A;  1KFY A;  4HN9 A;  3DJB A;  4YLH A;  4QHO A;  3C50 A;  3H3M A;  5DJQ C;  2BKN A;  3KVB A;  3N9Q A;  4DMV A;  3UFE A;  4HE8 A;  2BG9 B;  2VKO A;  2CWY A;  3RKG A;  3ZJ1 A;  3IEE A;  2N9D A;  4BJM A;  2X67 A;  2RP4 A;  4HFE A;  1YD8 G;  2M6B A;  2JQ9 A;  2MPK A;  3AE9 A;  1W09 A;  2A72 A;  4HFD A;  5HXC A;  4LF4 T;  2JJ9 A;  2UUB T;  2W62 A;  2BG9 A;  3CKD A;  4LF6 T;  4QX7 B;  3JAE A;  2VWA A;  5LJN A;  5HEO A;  2DNX A;  3P4P A;  4X1I E;  1LVF A;  3L39 A;  2KIN B;  2KLQ A;  4I43 B;  4TWF A;  3N2K E;  1YKH B;  2AXD S;  3ZCJ A;  2QVA A;  1MIW A;  1QSD A;  3Q5E A;  5BMV E;  2KXP B;  4CXX A;  4PW8 A;  3RIU A;  3EVY A;  4PJN A;  2OLT A;  3J9X 1;  3N9N A;  3TLT A;  1ZEE A;  2M67 A;  3O4X E;  3TLU A;  2VVN A;  1WR0 A;  1J5W A;  4WZX A;  1WYC A;  5FY1 A;  4IE7 A;  3CX6 B;  4AKI A;  3V5U A;  1J5E T;  2H3R A;  2X51 A;  4YJ2 E;  5CB4 E;  1Z0P A;  3VU7 H;  3PUW F;  3PU8 A;  4EYU A;  2NP9 A;  3EDU A;  3FXE B;  1OED B;  2IC6 A;  5FXV A;  3NRY A;  2JRK A;  1IBL T;  3L3P A;  2W61 A;  2I0M A;  2XAJ B;  5JDG A;  3AE5 A;  1OWA A;  3RH3 A;  1OED A;  3RI5 A;  3DTO A;  4HWC A;  3U78 A;  4LML A;  4CQI A;  4TWD A;  5HEU A;  4GIW A;  3A7M A;  1SE7 A;  3PUX F;  2B76 A;  2X9H A;  4DBQ A;  4I50 E;  2IAK A;  4ILC A;  2KZ7 B;  4ANJ A;  2XTL A;  5EK4 A;  5J0Z A;  1VCS A;  2NTX A;  4XZC A;  5FL1 A;  4DV3 T;  5E0O A;  4GK5 E;  4COF A;  5LP6 E;  2LHN A;  2K3W A;  2VL8 A;  3RYF E;  2UXN B;  2XJ7 A;  3DP7 A;  4OHF A;  2W63 A;  5ADX L;  3J7Y q;  2CPT A;  1ZP0 A;  5FY7 A;  3T1Y T;  1G8X A; 
#chains in the Genus database with same CATH homology
 5FNV E;  2BDE A;  5JDM A;  3KIN B;  1HX8 A;  2DI4 A;  2PJQ A;  3C64 A;  4X1K E;  5ETW A;  4BJN A;  3PUQ A;  4QXC B;  3MK7 C;  4IGU A;  5LHI B;  2X9Y A;  5L3E B;  4UV9 B;  1KNZ A;  1FMV A;  3HA4 A;  4TV9 E;  3HL6 A;  1WYB A;  2K24 A;  2VKH A;  4B6X A;  1T98 A;  4ZOL E;  3QUJ A;  2SPC A;  3K3N A;  4ZS3 A;  5M4Y A;  4TX5 A;  4U74 A;  3UUM A;  3JC6 D;  4KUM B;  5L3C B;  4UVA B;  1SA0 E;  3MZK B;  2JQQ A;  3R6N A;  2LSJ A;  3RYH E;  5DAB A;  4H9Q C;  3E0Z A;  1SHZ C;  4JLE A;  5JRC B;  4AKG A;  2V7K A;  4O4I E;  4WNK A;  2X0L B;  2ES0 A;  4NUU A;  2EHO B;  5AFU L;  1US7 B;  4JEH B;  3GMI A;  2W0G A;  1IAP A;  2KWH A;  3NZQ A;  1NAF A;  2E8I A;  2C5I T;  3C4W A;  5HWX A;  3F2E A;  1HTJ F;  2LT3 A;  2G0U A;  5HXR A;  3RC3 A;  5L3D B;  2DLR A;  4KP3 C;  2N2N A;  3UTK A;  4C90 A;  4A56 A;  3Q5W A;  3L09 A;  2K9A A;  5TAO A;  2LE8 A;  3AVS A;  2N1G A;  4IE6 A;  4IE5 A;  5FXZ A;  2BVM A;  2Y6X A;  4X20 E;  5JRC A;  3BQL A;  1FIO A;  3KFW X;  3PUA A;  2CLY B;  3KV6 A;  4PJM A;  2EHO A;  3RPU A;  3GN5 A;  3RC8 A;  2L8K A;  3LFM A;  4H9O C;  1ZKE A;  2PFV A;  4ZI2 C;  2LM9 A;  3HKC E;  2Q9Q B;  3CWZ B;  3WAJ A;  2XAQ B;  3ANW B;  4AKR B;  3O1H A;  4O4H E;  4L0R A;  4QXB B;  1BR2 A;  5EZY E;  2WBL A;  4PK4 A;  5EK3 A;  5HXH A;  1HF8 A;  2NW7 A;  5A1L A;  5FY0 A;  4OYJ A;  3BQK A;  4O4J E;  3K3O A;  4ZHQ E;  5FXW A;  2LSG A;  4PJL A;  4KBM B;  2MOZ A;  2V7L A;  4HTE A;  4X1Y E;  4NUV A;  3NZP A;  3SRZ A;  2LOP A;  2NW9 A;  2A3D A;  4ZI7 E;  3EUH A;  4FI5 A;  1D0Z A;  2X9W A;  4TV8 E;  4UV8 B;  3RYC E;  2CE7 A;  1WRD A;  2KWI B;  3RRC A;  4AQF C;  1D1A A;  3LJC A;  1BR0 A;  3CQX C;  2HPJ A;  2WWU A;  3ZMV B;  3I9W A;  2D0U A;  2XAH B;  3ANW A;  4WW0 A;  4EAH A;  1S94 A;  1U5P A;  4DO0 A;  3N9L A;  5JDL A;  3T8O A;  2P9B A;  2UXX B;  3WI3 A;  5HXS A;  4AXP A;  3H3A A;  5LXT E;  4C91 A;  4XAX B;  2EHO C;  3N9M A;  5JRE A;  3A5X A;  2WSS V;  2Z6E A;  1MMD A;  4H9N C;  4E7S A;  5H6R B;  4F6R C;  2W00 A;  4L5G A;  3OYZ A;  4CI2 B;  2NTY A;  2LOS A;  4XBF B;  2IC9 A;  1HG2 A;  4GK0 E;  1NWM X;  1OXZ A;  2XHE B;  5HWY A;  3UUL A;  3PUR A;  4H63 V;  3N9O A;  3HR0 A;  1FEW A;  2KMF A;  3CML A;  4FJO A;  4JUY A;  3FXD B;  1MMN A;  4P0B A;  4GYS A;  4UEL A;  2MTQ A;  4HGA A;  2CLY C;  4QX8 B;  3C4Z A;  4J2C A;  5L2L A;  1HS7 A;  5C8Y E;  4BAY B;  5H6Q B;  2V7J A;  4TN7 B;  3UT5 E;  2Q9Q C;  4IHJ E;  2J1D G;  3FB2 A;  3N2O A;  5DQV A;  2NW8 A;  3SS1 A;  1IZN B;  3HKD E;  3ZC1 A;  3CPZ A;  1HG5 A;  3KV9 A;  4IIJ E;  3OBV E;  3ZJ2 A;  3FBZ A;  2L3L A;  3EDV A;  2X9X A;  3F31 A;  4O2B E;  5KX5 E;  5J2U E;  4QWN B;  2ZM2 A;  3I1A A;  1Y64 B;  4H9R C;  3UUN A;  3ZC0 A;  1QUU A;  2LHR A;  5CA1 E;  4ZI2 D;  2YU1 A;  4TZ4 C;  3F57 A;  3LK3 B;  2CEA A;  2I59 A;  1LVK A;  4G2A A;  3MXZ A;  3ZYK A;  2CM0 A;  3ESL A;  2CA5 A;  2WMN A;  3TKL B;  2C5J A;  3AB3 B;  2ZM0 A;  2V1D B;  3RKO A;  1LRZ A;  3VKH A;  2ODV A;  2C5K T;  4BA9 A;  3LK2 B;  4MHC A;  2CWO A;  5JVD E;  1BR1 A;  5JDH A;  5JQG E;  3ZN1 B;  4IE4 A;  3VKG A;  2NWB A;  2LEH A;  4AQF A;  3OJA A;  2IW5 B;  3LK4 2;  4EXT A;  1HFA A;  2CXL A;  3PU3 A;  2WAU A;  2PG8 A;  5EK2 A;  5FMN A;  1H7C A;  4G63 A;  3B57 A;  5FXX A;  4PFP A;  2V7M A;  3ZMT B;  1AJ3 A;  3WAK A;  5LBQ B;  3N2G E;  4IST A;  3K8P C;  1MMG A;  2EHO D;  1WLX A;  2XQY A;  4MBQ A;  3C51 A;  3SOL A;  4P0A A;  4UIG A;  2MBG A;  3CQC B;  1D0Y A;  2BZB A;  3AVR A;  5JH7 E;  3MAC A;  5KDM C;  3LBX B;  3MA9 A;  3U3I A;  4GOU A;  2H7V C;  5F8P A;  3M65 A;  3CQG B;  2C0S A;  2GK9 A;  5LOV E;  3ZN0 B;  5LBM A;  5LG4 A;  5HYA A;  4UXN B;  1CUN A;  3NBX X;  4EB6 E;  4HN9 A;  3ETV A;  2E9X B;  3JC6 C;  3DJB A;  4YLH A;  4OFZ A;  3AAE B;  2LSY A;  3C50 A;  4PAG A;  4QHO A;  4AI6 A;  3B13 A;  4GYR A;  3IHR A;  4K0U A;  4AQG A;  4OK0 A;  5DJQ C;  5LYJ E;  3KVB A;  3N9Q A;  5JDN A;  1WR6 A;  4YHJ A;  3W15 B;  3AAA B;  3LG7 A;  3QK6 A;  2VK9 A;  2Q9Q A;  2L9Q A;  3KVA A;  1HCI A;  4ADZ A;  4EZH A;  3RX6 A;  2ACX A;  4MFR A;  3LBX A;  4O4L E;  4O2A E;  4DMV A;  4TUY E;  3UFE A;  4HE8 A;  2D5U A;  4KMC A;  1VOM A;  4QKN A;  3Q2M A;  2YK0 A;  3PUS A;  3SWH A;  2VKO A;  2CWY A;  5LA6 E;  2E9X A;  4HFV A;  4PJJ A;  5FYM A;  3ZLI A;  1IJ6 A;  3ZJ1 A;  2LSK A;  2VAS A;  2N9D A;  3IEE A;  4AKL A;  4BJM A;  2X67 A;  4DVD A;  2NOX A;  2RP4 A;  3E22 E;  1YD8 G;  4HEA A;  4EZ4 A;  4ZS2 A;  2XUE A;  1BR4 A;  5JR9 B;  4I4T E;  3AA6 B;  3KBT A;  2PBI A;  2A72 A;  2LJL A;  5HXC A;  2JJ9 A;  4ZI3 C;  2KT9 A;  3P8C D;  3AAI A;  3O1I A;  4CZZ B;  3FHN A;  2LSI A;  2W62 A;  2YEV C;  4OYK A;  2XAG B;  2CMR A;  4CI1 B;  3CKD A;  2D0T A;  5IHY A;  3BK9 A;  1MIV A;  4V1A v;  4CXW A;  2X68 A;  4QX7 B;  3AA1 B;  3PTR B;  1MIY A;  3HI2 A;  5JR9 A;  2VWA A;  4ILU A;  5DQW A;  3CX8 B;  4DMW A;  5LJN A;  2DNX A;  1IJ5 A;  4X1I E;  1LVF A;  2E9X C;  3ZCI A;  4JEU B;  4DND A;  2KIN B;  2A2F X;  3FBL A;  5LGT B;  2KLQ A;  5L3F B;  2VKJ A;  4I43 B;  4EYY R;  3O9X A;  4EOZ B;  4MAL A;  3MKD A;  4N78 D;  5LCY A;  1ZV4 X;  3N2K E;  4I55 E;  3C98 B;  3CVR A;  5LHH B;  1YKH B;  2ZMA A;  3ZCJ A;  2D2S A;  1KK7 A;  3Q9D A;  1MIW A;  2MYS A;  1D1C A;  3KBU A;  1QSD A;  5BMV E;  2KXP B;  2XAF B;  3N9P A;  3K3Q C;  4PW8 A;  4CXX A;  3ZMS B;  2H7O A;  3EVY A;  4PJN A;  4DBR A;  4IE0 A;  1YW0 A;  4YJ3 E;  3J9X 1;  3KDS E;  3N9N A;  4CXY A;  3Q5X A;  1ZEE A;  3HKB E;  2M67 A;  3S4U A;  3O4X E;  2ODU A;  2WMO A;  3AA7 B;  4MLK A;  5JR9 C;  1EZ3 A;  2OA5 A;  3UUX B;  3OKQ A;  2CXF A;  3GN5 B;  1WYC A;  4UVC B;  2WM9 A;  3CX7 B;  5FY1 A;  2BVL A;  3CX6 B;  4IE7 A;  4PNI A;  5LJM A;  4H9P C;  3MJX A;  4AKI A;  3V5U A;  2HH7 A;  2H3R A;  4M1P A;  2X51 A;  3IBP A;  4O8S A;  4YJ2 E;  4AKH A;  5CB4 E;  1Z0P A;  2VKD A;  3KV5 A;  2JMK A;  1D0X A;  4H9S E;  3VU7 H;  1D1B A;  4PFO A;  3PU8 A;  3NRX A;  3O1J A;  4EYU A;  3PUG A;  2NP9 A;  1U4Q A;  3AA0 B;  2K48 A;  4WBN E;  3EDU A;  3FXE B;  5L3B B;  3ZYL A;  4PK5 A;  4UF0 B;  3I0O A;  2JMH A;  4ZI3 D;  2IC6 A;  4E7Z A;  5KMG P;  3C4X A;  3BQI A;  1VRB A;  2K5B B;  5FXV A;  4ASK A;  3NRY A;  4UVB B;  1UCU A;  2DHR A;  2JRK A;  3ZYM A;  1MMA A;  3H37 A;  1S35 A;  1UX4 A;  3I9Y A;  3ZMZ B;  2Q9Q D;  3L3P A;  2XAS B;  2DWK A;  3R84 B;  2W61 A;  5FP3 A;  3N5L A;  3ONX A;  4PK6 A;  2XAJ B;  5L3G B;  2QGS A;  4ISS A;  5JDG A;  1G73 A;  1V9D A;  3RRW A;  3VHL A;  2V7I A;  1OWA A;  3RH3 A;  1UX5 A;  4UF0 A;  2E9X D;  5J1G A;  2ZM8 A;  5JDQ A;  5LGU B;  4HKA A;  3DTO A;  5LNK A;  3U78 A;  5GON E;  2KND A;  4IDZ A;  4CI3 B;  1MND A;  3D0T A;  4Z8X A;  2CCQ A;  3E08 A;  1ZHC A;  4CQI A;  3RYI E;  3IF8 B;  3ETU A;  3ZMU B;  1LKX A;  4GIW A;  2DCF A;  2YIN A;  2HPL A;  3GA8 A;  3P7I A;  3OYX A;  2X66 A;  2V26 A;  4YFS A;  4H63 H;  2YU2 A;  2JPF A;  4WBO A;  2B1E A;  1YKE B;  2Y48 B;  2DWG A;  2X9H A;  4DBQ A;  2QA7 A;  1X79 A;  4P09 A;  1B7T A;  2RA1 A;  3HKE E;  3GWH A;  1MNE A;  4I50 E;  2CXD A;  2IAK A;  5F3J A;  2KZ7 B;  4ANJ A;  3PE0 A;  2XTL A;  5EK4 A;  1E1H B;  3KV4 A;  4ERR A;  3V5S A;  2Y8D A;  2NTX A;  5HAX A;  4XZC A;  2ZLY A;  3ZEF B;  5CA0 E;  4UEM A;  5E0O A;  4U72 A;  5JDF A;  5J2T E;  3I0Q A;  1FMW A;  4GK5 E;  4EIW A;  5LHG B;  5LGN B;  2LHN A;  5LP6 E;  2VL8 A;  3RYF E;  2UXN B;  3DP7 A;  4L9I A;  2W63 A;  4OHF A;  5IYZ E;  5ADX L;  3J7Y q;  3PDY A;  2VB6 A;  1O3X A;  3QC9 A;  5FY7 A;  3ZPO A;  1G8X A;  4QXH B;  5HXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...