4OYJA

Structure of the apo hoip pub domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF31
total genus 60
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oyjA00
5LJNA 2HPJA 2D5UA 4OYJA 5LJMA 4JUYA 4P0AA 2CCQA 4OYKA 4P0BA 4P09A 2HPLA 2CM0A
chains in the Genus database with same CATH superfamily
3ONJA 2VWAA 1S35A 2ES0A 4U2YA 2XSAA 4ILUA 1W0AA 2HN1A 1XWMA 3KV6A 3T8OA 3N2KE 2Q9QC 3ZMVB 4JI6T 4V1Av 5JR9B 4AKIA 3P4SA 2KWIB 3HKBE 2PTFA 4QXCB 5FKYA 5JDNA 3A5XA 3A8YC 5AQIB 4YSZA 4ZI2D 5L4EA 4DUYT 2LSYA 4OHFA 3JC6C 3RIUC 5CJ5A 1KFYA 5JR9A 5HXEA 5JREA 3RHWA 4B6XA 1N36T 4QKNA 1UUSA 5HYAA 3AA0B 3C64A 3EI0A 3M3ZB 4UVCB 1ZV4X 1L0VA 3ZT5A 5L3DB 4PFOA 3PUWF 3LK42 3N2GE 4L9IA 4CXWA 5JVDE 4MALA 2MYSA 2EHOB 2X9WA 4HEAA 4IIJE 4JI3T 5AQHB 4LF5T 4LF8T 2D0TA 4KHZF 4C90A 5LG4A 4Q25A 4UR9A 5LBQB 2YK0A 3NKZA 2BG9E 3KV5A 3W15B 5KXJA 1O3XA 4YT0A 4J2CA 2QVAA 3CPZA 5F3JA 3PUQA 2I6HA 1QUUA 3HA4A 3LBXB 2PG8A 1WYCA 2XQYA 5FXWA 3DJBA 2I59A 3N9NA 4IE7A 3PJAA 2XQAA 4ZZBA 4KP3C 1J5ET 5DJQC 1IBKT 3K3OA 3P4RA 4TV8E 3NZPA 5L3CB 3FZMB 3H37A 3RYFE 5L3BB 1XMQT 3PUVF 4HE8A 5AQPB 4AQFC 2HPLA 1HTJF 3O1JA 3H3MA 4HFBA 5ABGA 4DR3T 3AA1B 5AQRB 4AKRB 4YY3T 1UCUA 5HXCA 2XAFB 5LA6E 3FXEB 5FYMA 1I94T 4O2AE 5FMNA 2H7OA 4HFCA 3KV4A 5LYJE 3KV9A 1SHZC 5AQUB 4HGAA 2YOEA 2N2NA 5FNVE 4DMWA 1ZHCA 2Z6EA 2V5CA 4JBWF 2UUBT 3O1IA 4U7YA 4XAXB 2NTXA 2N9DA 1LKXA 3KBUA 2XAGB 2W4XA 2DL1A 1UURA 3AEDA 4TN7B 3ZYLA 5ABEA 1HNZT 2CE7A 5TAOA 3OPCA 4U74A 4A56A 2IMLA 3UUNA 4EZ4A 4KMCA 4CQIA 3I0QA 3AE4A 5IWAT 1SE7A 2NP9A 1T7SA 5LHIB 3FZKB 4YHHT 3Q5XA 3FB2A 2FJDA 3PE0A 3UUBA 4ZHQE 3IF8B 2W00A 5FVKA 3BQKA 2XPKA 5EK4A 2I0MA 1WR0A 1MMDA 3CQGB 4I0UA 4ZXLA 2BKOA 4UF0B 3NBXX 2YKSA 5LGTB 3B57A 3N9PA 1R8IA 2CWOA 4PJJA 3RGLA 4DR7T 2JRKA 1N32T 2CPTA 2WMNA 2UXCT 2XQ6A 3TLUA 2RA1A 3RPUA 3Q5WA 1WCRA 3ZSSA 4E7ZA 1M62A 4O2BE 3KDSE 4DR4T 4PK4A 3I1AA 2H89A 3C50A 4IE5A 4YSXA 2DCFA 2YDSA 5AFUL 4DNDA 1YXRA 1B7TA 4IT4A 4I50E 3RC3A 3O4XE 1VOMA 3J9X1 2V7IA 5FL0A 4AKHA 4X62T 4WBNE 3VKGA 1EZ3A 4AKLA 2D2SA 4IHJE 1KEYA 1MNDA 3AE3A 3CVRA 1XMOT 5FY1A 3Q5DA 2UXXB 1GQEA 2VK9A 1IBLT 4EIWA 3C98B 3F31A 1ZP0A 3CQXC 4ILBA 4DR5T 2XQ9A 4IDPA 3VU7H 3FZFB 3AE9A 4IL4A 3R84B 1G8XA 3VR9A 2JPFA 1E7PA 2WZIA 3AA6B 3JAFA 3EHZA 3K3QC 3LDQB 4H9PC 2WU2A 2IC9A 4UF0A 3ZJ1A 3ZMSB 2XAJB 4G2AA 5LG3A 1FMWA 1M7KA 3TLSA 5C8YE 3NRXA 2KZ7B 3B5MA 4QXBB 3UU4A 3RRCA 4GOUA 3NWIA 1MMGA 4DVDA 4EYYR 4QX7B 2QRXA 2YEVC 3AECA 3OYXA 4TZ4C 4JEHB 4MHCA 3OJAA 1HX8A 2NW9A 4CZZB 4JV5T 2WQYA 2LKHA 2B1EA 2PBIA 3CK6A 1JNZA 3RI5A 3OTOT 1SUMB 2MBGA 3ZPOA 2CLYC 2L3LA 1QLBA 4X1KE 2BKNA 5FXZA 5H6QB 1BR4A 2WBLA 2NW8A 3RIUA 1UX4A 2V26A 2M6BA 4X1YE 5FL1A 2IW5B 1MMAA 2FBWA 2CBJA 3LFMA 1XDOA 2JQQA 5FXXA 3KINB 5FP3A 3TLTA 2DNXA 3GN5A 5LGUB 2WU5A 4AKGA 2BZBA 2JIWA 2XSBA 3H3AA 3ZC1A 5HAXA 5LBMA 3N9QA 4H9OC 2M67A 2BG9B 4LMLA 5JDMA 4KHPT 2W62A 2HN2A 1JNRA 2AE9A 4PJLA 4ILAA 5LHHB 3JCFA 2LJLA 2JQ9A 2XJ7A 1D0XA 2W63A 3QB5K 5HCMA 2JMHA 1BR1A 4HTEA 5BR8T 3N9OA 2XZEA 4B3RT 3CQCB 3N2OA 1QSDA 3QB5A 2V1DB 4K0UA 5LCYA 5CA1E 4ISSA 3MKDA 4I4TE 1KNRA 4X1IE 4CI1B 4CXYA 1MIVA 4YHJA 2LSJA 3RYHE 3HR0A 2CHNA 2H7VC 3JAEA 4DV0T 2WAUA 3EVYA 3ZMUB 1OEDE 1WR6A 4AQFA 4QXHB 5LJNA 3SFDA 2Q9QB 2ZM6T 3PDYA 2JQHA 5FVLA 4AXPA 3IHRA 3K8PC 1HF8A 1OEDB 2X0HA 4GK0E 3JADA 5CGMA 3LK3B 4IE0A 1HFAA 2L9QA 2X0YA 4JI2T 4ZI3C 3LJCA 2ODVA 5FXVA 3VHLA 5KDMC 2IAKA 1LVFA 1BR2A 2DHRA 4O4HE 3HKCE 4LFBT 5HEJA 5AQNB 2PFVA 3L8RA 4HN9A 1G73A 4IE6A 5FY0A 4LF7T 2V6XA 4AI6A 2CLYB 2XQ8A 3L3PA 3AE6A 4DV3T 4HFHA 1KNZA 5AQQB 1T98A 3Q9DA 4HKAA 3SOLA 5L3EB 2PJQA 5AQGB 2HHHT 2LHRA 3AEEA 4GYSA 4K0KT 2JQKA 2MPKA 2W61A 1IJ6A 5AQMB 3ONLC 4IREA 2D0UA 4I55E 4LF4T 5HWYA 4H63V 1D0ZA 1HS7A 2X9YA 1E2AA 3KFWX 5JQGE 1Z8UA 3G06A 3I0OA 2GK9A 3D0TA 3KBTA 3Q2MA 4ZS3A 2J62A 3P4PA 2BS4A 5ABFB 1MMNA 1US7B 2BS3A 3QK6A 4GIWA 5JDFA 3ZLIA 4EXTA 5A1LA 2WDQA 5BMVE 1HNXT 2E5LT 3MA9A 2NOXA 2UXNB 2CHOA 4NUVA 5ABFA 3E22E 3AE7A 3LSVA 4EOZB 2CEAA 1NENA 1FIOA 1IJ5A 2EHOD 1XZYA 2YU1A 4HFVA 2DI4A 4IDNA 1KNPA 4QH5A 3VRBA 2V7LA 4NIQA 1T8BA 1ZEEA 1YQ4A 4PW8A 4U2ZA 2V8SV 1HG5A 4X5TA 5HXHA 2RP4A 5LOVE 4EEBA 4QHOA 4P0AA 2DWKA 2VURA 2D5UA 3BQIA 5L3GB 1N33T 1DU2A 5CA0E 4IE4A 2LKGA 4GK5E 2JJ9A 5HCJA 3EDVA 2WB5A 5L2LA 4QX8B 1J5WA 4UV9B 2WZHA 2UUAT 2UUCT 2E9XC 4ASKA 2P9BA 4ZEYA 2XY8B 4ZOLE 4IL9A 4JI5T 5H6RB 4O8SA 5ETWA 3BQLA 4A5XA 4ISTA 5J1GA 5JTGA 4A97A 2QA7A 3MJXA 5EK3A 5L47A 2AXDS 2ACZA 4PJMA 4YTPA 2BVMA 1D1CA 4X20E 5HEGA 2V6YA 1SA0E 3RH3A 3PUSA 3PUAA 2F4VT 4DR6T 2C5JA 2K9AA 2KNDA 3L39A 1N34T 2XTLA 4A98A 3ZSTA 4LF9T 2B76A 3C4ZA 2X51A 3P4WA 5E0OA 3UT5E 4NXNT 4C91A 2X66A 5CB4E 4AISA 1YKHB 1YD8G 2CM0A 2XM2A 4GKKT 3LK2B 2H3RA 2FJAA 3AE1A 4H9RC 4UIGA 3PU8A 1WRDA 2A3DA 3ZN0B 3RIFA 3IA3A 2NTYA 2A2FX 2YN6A 1KF6A 3K3NA 2DWGA 2LE8A 3FBLA 3TLWA 2ZM2A 5LJMA 5LMUT 4ZI2C 1YKEB 3EABA 3QOFA 4O4JE 3AE8A 3AVSA 3AA7B 2KSRA 4WYVA 3AXJA 2NW7A 3ZYKA 3Q5EA 2CXFA 1LVKA 2UXDT 1CHUA 1HX1B 3EUHA 4H63H 2DLRA 2LRLA 4PAGA 1V9DA 1YQ3A 3U78A 3SFEA 3GMIA 5M4YA 4IDOA 3EDUA 2LM2A 3PUZF 3NZQA 2HPJA 5HEHA 3ANWB 3ZMZB 4MFRA 2CXDA 2KMFA 2V6YB 2E8IA 2XQ5A 3SS1A 4NUUA 5J2TE 3MZKB 1XNRT 4B3TT 1FEWA 1LRZA 4U3CA 2BBHA 4XBFB 4PFPA 5LXTE 2L8KA 2Q9QD 3AAAB 2E9XD 4O4IE 4KUMB 4TWHA 1H7CA 4XZCA 4U33A 4ERRA 4AQYT 2WWUA 1BR0A 2KT9A 4TNVA 3P8CD 1WLXA 3GN5B 2C5IT 2LOPA 4DV6T 4DR1T 4UEMA 3PV0F 2KXPB 5FY7A 2RPAA 3T1HT 4UXNB 3UU8A 2ACXA 3QUJA 4DMVA 5JDQA 1YW0A 3VR8A 4IDZA 5J0ZA 4X66T 2IIUA 3AE2A 4EAHA 4DV5T 2A9UA 4Z91A 3UUXB 3WI3A 2CXLA 4JUYA 5HEUA 5CFBA 3RRWA 2LOSA 2NWBA 4IGUA 3SWHA 4JLEA 4DV4T 4EGWA 5AQVB 2KINB 2J1DG 3CX8B 2VVSA 2IC6A 1ZOYA 2J47A 1NWMX 4M1PA 1J1JA 2QGSA 4ZI7E 1D1AA 2ZLYA 4YJ2E 1Z0PA 3HI2A 3B13A 4NPPA 4EV6A 5LHGB 3CIRA 3PUGA 2EHOA 2E9XA 2H88A 4PK5A 5C2TA 5EK2A 1WFDA 2XASB 2YINA 3E0ZA 2V5DA 4OX9T 3V5SA 4YXDA 2X0LB 2A72A 4GKJT 5AQLB 4COFA 3RYIE 1FMVA 4U31A 3SRZA 2MTQA 4CXXA 3M65A 1IBMT 1ZKEA 3AEFA 3OBVE 4H9NC 3AEBA 5AQJB 4BAYB 5AQKB 3TKLB 2N1GA 4ANJA 5KX5E 3LBXA 4KBMB 4Z90A 2CBIA 3CMLA 4CN4A 2CWYA 2ZMAA 4TWDA 4ZZCA 5JDLA 4B3MT 4JYAT 2KWHA 4BA9A 3HL6A 1X9BA 3HKEE 4HFEA 4LMJA 3UULA 1HG2A 2OA5A 2Y48B 2MOZA 2WS3A 3N5LA 5F8PA 3ZT7A 1I6ZA 1UK5A 2XHEB 2YDQA 3AAEB 3MK7C 4L0RA 3U3IA 4ADZA 4FJOA 3HKDE 1XNQT 1HNWT 1D0YA 2XUEA 4EYUA 2IUBA 5DQVA 4DV1T 5C3JA 4MLKA 3WAJA 2VB6A 2Y8DA 4OYKA 2XM1A 2BDEA 3UU5A 5LNKA 4L5GA 2X68A 2M6IA 4TV9E 3RF1A 2WMOA 2CRBA 4CI3B 4U72A 3AEGA 3RKOA 3WAKA 4CI2B 2BG9C 4G63A 3UUMA 4HWDA 5JDHA 1HCIA 4DR2T 3ZEFB 1HR0T 4B3ST 4Z8XA 1VCSA 2FJBA 4UVBB 3ZJ2A 1OWAA 4DV2T 3CKDA 3JC6D 2YU2A 5JR9C 4KI0F 4P09A 2VVNA 4DUZT 1D1BA 2LT3A 3L09A 3P4QA 4LMKA 5AQSB 3C4WA 5L4HA 4WW0A 2E5VA 3ZN1B 5J2UE 2IDOB 4WNKA 2E2AA 5LP6E 3EAMA 2V7KA 2Y6XA 3MACA 5AQFB 2XQ3A 2WDRA 2WSSV 1W09A 2VL8A 3OYZA 2W0GA 4PK6A 4WBOA 5IYZE 1W9RA 5ABHA 5LGNB 4TNWA 3AAIA 2WCAA 3P7IA 5HXRA 2WP9A 3RIAA 2VASA 4O4LE 4CN6A 2LSIA 1U5PA 4MBQA 1OEDC 4YFSA 3UQ7A 4YTMA 3ZYMA 4JI1T 4QH1A 4F8HA 2FJEA 3RQUA 4EZHA 3C51A 4I43B 2G0UA 2BKPA 2HH7A 2W66A 2WDVA 2WM9A 4HWIB 4KX6A 2VQET 2LSGA 3O1HA 4QWNB 3T1YT 3CX7B 3AVRA 5L3FB 3OKQA 3KVAA 2W2UA 4YSYA 3AE5A 3PJAJ 3F2EA 5DQWA 2LM9A 2LRKA 4QH4A 4UVAB 3DP7A 1NEKA 3F57A 2K24A 2CMRA 2LHNA 3BK9A 1CUNA 3RKGA 3UTKA 3J7Yq 4LFCT 3RYCE 2UXBT 2X9HA 3R6NA 1IZNB 4OYJA 2K5BB 5DABA 4CN1A 2VQFT 5HWXA 5EZYE 1NAFA 3AXJB 1UGOA 4YTNA 3K1SA 3AB3B 2CA5A 2OV9A 3PU3A 2D9DA 2C0SA 5HXSA 1VRBA 2UU9T 3A7MA 3FXDB 2BVLA 3UFEA 4PJNA 3V5UA 4P1NA 2J4GA 3ANWA 2XQ7A 3FHNA 4U7IA 4ZS2A 2BBJA 5GONE 3KVBA 3IBPA 2V7MA 4GYRA 5AQTB 3MXZA 3UQ4A 4H9QC 2W67A 4BJNA 3RLFF 1FJGT 3S4UA 2R6GF 3VKHA 4ZI3D 2K3WA 3O9XA 4LFAT 3ABVA 4JEUB 2VL0A 2IHR1 4TX5A 2V7JA 3ETVA 2FUPA 4YJ3E 5JRCA 2QYWA 2ZM0A 1Y01A 2LLYA 2NR4A 4PNIA 3CX6B 3PTRB 3UU6A 3DTOA 4F6RC 4AIUA 5JRCB 3UFGA 3PURA 3FBZA 4IDQA 3ESLA 3GWHA 3NVOA 3ZMTB 2LSKA 2CCQA 4P0BA 4TUYE 5LMNT 4YLHA 2WWVA 3RQWA 5ADXL 3PUXF 3QNUA 1OXZA 3RX6A 2XQ4A 3PUYF 1KK7A 3TLVA 5IUXA 5KMGP 3RC8A 1MIWA 3ZC0A 4HFIA 4HWCA 4UELA 1UX5A 4OK0A 2ZM8A 4E7SA 3CWZB 4UV8B 5F5WA 4FI5A 3QC9A 2EHOC 2VKOA 3FZHB 4JI7T 1MIYA 2BG9A 4X64T 2XAHB 2SPCA 1W0BA 2VKDA 3ZKRA 1MNEA 2OLTA 3VRAA 4JI4T 3E08A 4WZXA 5HEOA 5IHYA 3C4XA 3X1DA 4AQGA 4NXMT 1S94A 1Y64B 4HWFA 4H9SE 2JMKA 4DV7T 4X65T 2C5KT 3IEEA 2E9XB 2VKHA 2MAWA 3LG7A 2VKJA 2X67A 5JH7E 1WYBA 4EEDA 4JI8T 1AJ3A 2XAQB 3AEAA 4HWHA 2X9XA 5LB7B 3ETUA 1U4QA 2ODUA 3I9WA 3ONXA 3ZCIA 2KLQA 4DBRA 3GA8A 1XDPA 4BJMA 3P50A 3N9MA 2Q9QA 3ZCJA 3I9YA 4JI0T 4ILCA 5AQOB 1X79A 3OVUA 4LF6T 1IAPA 1OEDA 3ZT6A 4DIDB 4HFDA 1T72A 4DO0A 2WY2A 1VCTA 4N78D 2LEHA 3FZLB 2YDRA 2K48A 3N9LA 4OFZA 4TWFA 4EB6E 5JDGA 4DBQA 3UU3A 3NRYA 2BS2A 1E1HB
chains in the Genus database with same CATH topology
2VWAA 1S35A 2ES0A 4ILUA 3KV6A 3T8OA 3N2KE 2Q9QC 3ZMVB 4V1Av 5JR9B 4AKIA 2KWIB 3HKBE 4QXCB 5JDNA 3A5XA 4ZI2D 2LSYA 4OHFA 3JC6C 5HXEA 5JR9A 5JREA 4B6XA 4QKNA 5HYAA 3AA0B 3C64A 4UVCB 5L3DB 1ZV4X 4PFOA 3LK42 3N2GE 4L9IA 4CXWA 5JVDE 4MALA 2MYSA 2EHOB 2X9WA 4HEAA 4IIJE 2D0TA 4C90A 5LG4A 5LBQB 2YK0A 3KV5A 3W15B 1O3XA 4J2CA 3CPZA 5F3JA 3PUQA 1QUUA 3HA4A 3LBXB 2PG8A 1WYCA 2XQYA 5FXWA 3DJBA 2I59A 3N9NA 4IE7A 4KP3C 5DJQC 3K3OA 4TV8E 3NZPA 5L3CB 3H37A 3RYFE 5L3BB 4HE8A 4AQFC 2HPLA 1HTJF 3O1JA 3AA1B 4AKRB 1UCUA 5HXCA 2XAFB 5LA6E 3FXEB 5FYMA 4O2AE 5FMNA 2H7OA 3KV4A 5LYJE 3KV9A 1SHZC 4HGAA 2N2NA 5FNVE 4DMWA 1ZHCA 2Z6EA 3O1IA 4XAXB 2NTXA 2N9DA 1LKXA 3KBUA 2XAGB 4TN7B 2CE7A 5TAOA 4U74A 4A56A 3UUNA 4EZ4A 4KMCA 4CQIA 3I0QA 2NP9A 5LHIB 3Q5XA 3FB2A 3PE0A 4ZHQE 3IF8B 2W00A 3BQKA 5EK4A 1MMDA 3CQGB 5LGTB 4UF0B 3NBXX 3B57A 3N9PA 2CWOA 4PJJA 2JRKA 2WMNA 2RA1A 3RPUA 3Q5WA 4E7ZA 4O2BE 3KDSE 4PK4A 3I1AA 3C50A 4IE5A 5AFUL 2DCFA 4DNDA 1B7TA 3RC3A 4I50E 3O4XE 1VOMA 3J9X1 2V7IA 4AKHA 4WBNE 3VKGA 1EZ3A 4AKLA 2D2SA 4IHJE 1MNDA 3CVRA 5FY1A 2UXXB 2VK9A 4EIWA 3C98B 3F31A 3CQXC 3VU7H 3R84B 1G8XA 2JPFA 3AA6B 4H9PC 3K3QC 4UF0A 2IC9A 3ZJ1A 3ZMSB 2XAJB 4G2AA 1FMWA 5C8YE 3NRXA 2KZ7B 4QXBB 3RRCA 4GOUA 4EYYR 1MMGA 4DVDA 4QX7B 2YEVC 3OYXA 4TZ4C 2NW9A 4JEHB 4MHCA 3OJAA 1HX8A 4CZZB 2B1EA 2PBIA 2MBGA 2CLYC 2L3LA 4X1KE 5FXZA 5H6QB 1BR4A 2WBLA 2NW8A 1UX4A 2V26A 4X1YE 2IW5B 1MMAA 3LFMA 2JQQA 5FXXA 3KINB 5FP3A 2DNXA 3GN5A 5LGUB 4AKGA 2BZBA 3H3AA 3ZC1A 5HAXA 5LBMA 3N9QA 4H9OC 2M67A 5JDMA 2W62A 4PJLA 5LHHB 2LJLA 1D0XA 2W63A 2JMHA 1BR1A 4HTEA 3N9OA 3CQCB 3N2OA 1QSDA 4K0UA 2V1DB 5LCYA 5CA1E 4ISSA 3MKDA 4I4TE 4X1IE 4CI1B 4CXYA 1MIVA 4YHJA 2LSJA 3RYHE 3HR0A 2H7VC 2WAUA 3EVYA 3ZMUB 4AQFA 1WR6A 4QXHB 5LJNA 2Q9QB 3PDYA 4AXPA 3IHRA 3K8PC 1HF8A 4GK0E 3LK3B 4IE0A 1HFAA 2L9QA 4ZI3C 3LJCA 2ODVA 5FXVA 3VHLA 5KDMC 2IAKA 1LVFA 1BR2A 2DHRA 4O4HE 3HKCE 2PFVA 4HN9A 4IE6A 1G73A 5FY0A 4AI6A 2CLYB 3L3PA 1KNZA 1T98A 3Q9DA 4HKAA 3SOLA 5L3EB 2PJQA 2LHRA 4GYSA 2W61A 1IJ6A 2D0UA 4I55E 5HWYA 4H63V 1D0ZA 1HS7A 2X9YA 3KFWX 5JQGE 3I0OA 2GK9A 3D0TA 3KBTA 3Q2MA 4ZS3A 1MMNA 1US7B 3QK6A 3ZLIA 4GIWA 5JDFA 5A1LA 4EXTA 5BMVE 3MA9A 2NOXA 2UXNB 4NUVA 3E22E 4EOZB 2CEAA 1FIOA 1IJ5A 2EHOD 2YU1A 4HFVA 2DI4A 2V7LA 4PW8A 1ZEEA 5HXHA 1HG5A 2RP4A 5LOVE 4P0AA 4QHOA 2DWKA 3BQIA 2D5UA 5L3GB 5CA0E 4IE4A 4GK5E 2JJ9A 3EDVA 5L2LA 4QX8B 4UV9B 2E9XC 4ASKA 2P9BA 4ZOLE 5H6RB 4O8SA 5ETWA 3BQLA 4ISTA 5J1GA 2QA7A 3MJXA 5EK3A 4PJMA 2BVMA 1D1CA 4X20E 1SA0E 3RH3A 3PUSA 3PUAA 2C5JA 2K9AA 2KNDA 2XTLA 3C4ZA 2X51A 5E0OA 3UT5E 4C91A 2X66A 5CB4E 1YKHB 1YD8G 2CM0A 3LK2B 2H3RA 4H9RC 4UIGA 3PU8A 1WRDA 2A3DA 3ZN0B 2NTYA 2A2FX 3K3NA 2DWGA 2LE8A 3FBLA 5LJMA 2ZM2A 4ZI2C 1YKEB 4O4JE 3AVSA 3AA7B 2NW7A 3ZYKA 2CXFA 1LVKA 3EUHA 4H63H 2DLRA 4PAGA 1V9DA 3U78A 3GMIA 5M4YA 3EDUA 3NZQA 2HPJA 3ANWB 4MFRA 2CXDA 2KMFA 3SS1A 2E8IA 5J2TE 4NUUA 3MZKB 1FEWA 1LRZA 4XBFB 4PFPA 5LXTE 2L8KA 2Q9QD 3AAAB 2E9XD 4O4IE 4KUMB 1H7CA 4XZCA 4ERRA 1BR0A 2WWUA 2KT9A 3P8CD 3GN5B 1WLXA 2C5IT 2LOPA 4UEMA 2KXPB 5FY7A 4UXNB 2ACXA 3QUJA 4DMVA 5JDQA 1YW0A 4IDZA 4EAHA 3UUXB 3WI3A 2CXLA 4JUYA 3RRWA 2LOSA 2NWBA 4IGUA 3SWHA 4JLEA 2KINB 2J1DG 3CX8B 2IC6A 4M1PA 1NWMX 2QGSA 4ZI7E 1D1AA 2ZLYA 4YJ2E 1Z0PA 3HI2A 3B13A 5LHGB 3PUGA 2EHOA 2E9XA 4PK5A 5EK2A 3E0ZA 2XASB 2YINA 3V5SA 2X0LB 2A72A 3RYIE 1FMVA 3SRZA 2MTQA 4CXXA 3M65A 1ZKEA 3OBVE 4H9NC 4BAYB 3TKLB 2N1GA 4ANJA 5KX5E 3LBXA 4KBMB 3CMLA 2CWYA 2ZMAA 5JDLA 2KWHA 4BA9A 3HL6A 3HKEE 3UULA 1HG2A 2OA5A 2Y48B 2MOZA 3N5LA 5F8PA 3MK7C 2XHEB 3AAEB 4L0RA 3U3IA 4ADZA 4FJOA 3HKDE 1D0YA 2XUEA 4EYUA 5DQVA 4MLKA 3WAJA 2VB6A 2Y8DA 4OYKA 2BDEA 5LNKA 4L5GA 2X68A 4TV9E 2WMOA 4CI3B 4U72A 3RKOA 3WAKA 4CI2B 4G63A 3UUMA 5JDHA 1HCIA 3ZEFB 4Z8XA 4UVBB 3ZJ2A 1OWAA 3CKDA 3JC6D 2YU2A 5JR9C 4P09A 1D1BA 2LT3A 3L09A 3ZPOA 3C4WA 3ZN1B 4WW0A 5J2UE 4WNKA 5LP6E 2V7KA 2Y6XA 3MACA 2WSSV 4WBOA 2VL8A 3OYZA 4PK6A 2W0GA 5LGNB 5IYZE 3AAIA 3P7IA 5HXRA 2VASA 4O4LE 2LSIA 1U5PA 4MBQA 4YFSA 3ZYMA 4EZHA 3C51A 4I43B 2G0UA 2HH7A 2WM9A 2LSGA 3O1HA 4QWNB 3CX7B 3AVRA 5L3FB 3OKQA 3KVAA 3F2EA 5DQWA 2LM9A 4UVAB 3ZMZB 3ZYLA 3DP7A 3F57A 2K24A 2CMRA 2LHNA 3BK9A 1CUNA 3J7Yq 3UTKA 3RYCE 2X9HA 3R6NA 1IZNB 4OYJA 2K5BB 5DABA 5HWXA 5EZYE 1NAFA 3AB3B 2CA5A 3PU3A 2C0SA 5HXSA 1VRBA 3FXDB 2BVLA 3UFEA 4PJNA 3V5UA 3ANWA 3FHNA 4ZS2A 5GONE 3KVBA 3IBPA 2V7MA 4GYRA 3MXZA 4BJNA 4H9QC 3S4UA 3VKHA 4ZI3D 3O9XA 4JEUB 4TX5A 2V7JA 3ETVA 4YJ3E 5JRCA 2ZM0A 4PNIA 3CX6B 3PTRB 3DTOA 4F6RC 5JRCB 3PURA 3FBZA 3ESLA 3GWHA 3ZMTB 2LSKA 2CCQA 4P0BA 4TUYE 4YLHA 5ADXL 1OXZA 3RX6A 3RC8A 1KK7A 5KMGP 3ZC0A 1MIWA 4UELA 1UX5A 4OK0A 2ZM8A 4E7SA 3CWZB 4UV8B 4FI5A 3QC9A 2EHOC 2VKOA 1MIYA 2XAHB 2SPCA 2VKDA 1MNEA 3E08A 5IHYA 3C4XA 4AQGA 1S94A 1Y64B 4H9SE 2JMKA 2C5KT 3IEEA 2E9XB 2VKHA 3LG7A 2VKJA 2X67A 5JH7E 1WYBA 1AJ3A 2XAQB 2X9XA 3ETUA 1U4QA 2ODUA 3I9WA 3ONXA 3ZCIA 2KLQA 4DBRA 3GA8A 4BJMA 3N9MA 2Q9QA 3ZCJA 3I9YA 1X79A 1IAPA 4DO0A 4N78D 2LEHA 4OFZA 4EB6E 2K48A 3N9LA 5JDGA 4DBQA 3NRYA 1E1HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJN A;  2HPJ A;  2D5U A;  4OYJ A;  5LJM A;  4JUY A;  4P0A A;  2CCQ A;  4OYK A;  4P0B A;  4P09 A;  2HPL A;  2CM0 A; 
#chains in the Genus database with same CATH topology
 3ONJ A;  2VWA A;  1S35 A;  2ES0 A;  4U2Y A;  2XSA A;  4ILU A;  1W0A A;  2HN1 A;  1XWM A;  3KV6 A;  3T8O A;  3N2K E;  2Q9Q C;  3ZMV B;  4JI6 T;  4V1A v;  5JR9 B;  4AKI A;  3P4S A;  2KWI B;  3HKB E;  2PTF A;  4QXC B;  5FKY A;  5JDN A;  3A5X A;  3A8Y C;  5AQI B;  4YSZ A;  4ZI2 D;  5L4E A;  4DUY T;  2LSY A;  4OHF A;  3JC6 C;  3RIU C;  5CJ5 A;  1KFY A;  5JR9 A;  5HXE A;  5JRE A;  3RHW A;  4B6X A;  1N36 T;  4QKN A;  1UUS A;  5HYA A;  3AA0 B;  3C64 A;  3EI0 A;  3M3Z B;  4UVC B;  1ZV4 X;  1L0V A;  3ZT5 A;  5L3D B;  4PFO A;  3PUW F;  3LK4 2;  3N2G E;  4L9I A;  4CXW A;  5JVD E;  4MAL A;  2MYS A;  2EHO B;  2X9W A;  4HEA A;  4IIJ E;  4JI3 T;  5AQH B;  4LF5 T;  4LF8 T;  2D0T A;  4KHZ F;  4C90 A;  5LG4 A;  4Q25 A;  4UR9 A;  5LBQ B;  2YK0 A;  3NKZ A;  2BG9 E;  3KV5 A;  3W15 B;  5KXJ A;  1O3X A;  4YT0 A;  4J2C A;  2QVA A;  3CPZ A;  5F3J A;  3PUQ A;  2I6H A;  1QUU A;  3HA4 A;  3LBX B;  2PG8 A;  1WYC A;  2XQY A;  5FXW A;  3DJB A;  2I59 A;  3N9N A;  4IE7 A;  3PJA A;  2XQA A;  4ZZB A;  4KP3 C;  1J5E T;  5DJQ C;  1IBK T;  3K3O A;  3P4R A;  4TV8 E;  3NZP A;  5L3C B;  3FZM B;  3H37 A;  3RYF E;  5L3B B;  1XMQ T;  3PUV F;  4HE8 A;  5AQP B;  4AQF C;  2HPL A;  1HTJ F;  3O1J A;  3H3M A;  4HFB A;  5ABG A;  4DR3 T;  3AA1 B;  5AQR B;  4AKR B;  4YY3 T;  1UCU A;  5HXC A;  2XAF B;  5LA6 E;  3FXE B;  5FYM A;  1I94 T;  4O2A E;  5FMN A;  2H7O A;  4HFC A;  3KV4 A;  5LYJ E;  3KV9 A;  1SHZ C;  5AQU B;  4HGA A;  2YOE A;  2N2N A;  5FNV E;  4DMW A;  1ZHC A;  2Z6E A;  2V5C A;  4JBW F;  2UUB T;  3O1I A;  4U7Y A;  4XAX B;  2NTX A;  2N9D A;  1LKX A;  3KBU A;  2XAG B;  2W4X A;  2DL1 A;  1UUR A;  3AED A;  4TN7 B;  3ZYL A;  5ABE A;  1HNZ T;  2CE7 A;  5TAO A;  3OPC A;  4U74 A;  4A56 A;  2IML A;  3UUN A;  4EZ4 A;  4KMC A;  4CQI A;  3I0Q A;  3AE4 A;  5IWA T;  1SE7 A;  2NP9 A;  1T7S A;  5LHI B;  3FZK B;  4YHH T;  3Q5X A;  3FB2 A;  2FJD A;  3PE0 A;  3UUB A;  4ZHQ E;  3IF8 B;  2W00 A;  5FVK A;  3BQK A;  2XPK A;  5EK4 A;  2I0M A;  1WR0 A;  1MMD A;  3CQG B;  4I0U A;  4ZXL A;  2BKO A;  4UF0 B;  3NBX X;  2YKS A;  5LGT B;  3B57 A;  3N9P A;  1R8I A;  2CWO A;  4PJJ A;  3RGL A;  4DR7 T;  2JRK A;  1N32 T;  2CPT A;  2WMN A;  2UXC T;  2XQ6 A;  3TLU A;  2RA1 A;  3RPU A;  3Q5W A;  1WCR A;  3ZSS A;  4E7Z A;  1M62 A;  4O2B E;  3KDS E;  4DR4 T;  4PK4 A;  3I1A A;  2H89 A;  3C50 A;  4IE5 A;  4YSX A;  2DCF A;  2YDS A;  5AFU L;  4DND A;  1YXR A;  1B7T A;  4IT4 A;  4I50 E;  3RC3 A;  3O4X E;  1VOM A;  3J9X 1;  2V7I A;  5FL0 A;  4AKH A;  4X62 T;  4WBN E;  3VKG A;  1EZ3 A;  4AKL A;  2D2S A;  4IHJ E;  1KEY A;  1MND A;  3AE3 A;  3CVR A;  1XMO T;  5FY1 A;  3Q5D A;  2UXX B;  1GQE A;  2VK9 A;  1IBL T;  4EIW A;  3C98 B;  3F31 A;  1ZP0 A;  3CQX C;  4ILB A;  4DR5 T;  2XQ9 A;  4IDP A;  3VU7 H;  3FZF B;  3AE9 A;  4IL4 A;  3R84 B;  1G8X A;  3VR9 A;  2JPF A;  1E7P A;  2WZI A;  3AA6 B;  3JAF A;  3EHZ A;  3K3Q C;  3LDQ B;  4H9P C;  2WU2 A;  2IC9 A;  4UF0 A;  3ZJ1 A;  3ZMS B;  2XAJ B;  4G2A A;  5LG3 A;  1FMW A;  1M7K A;  3TLS A;  5C8Y E;  3NRX A;  2KZ7 B;  3B5M A;  4QXB B;  3UU4 A;  3RRC A;  4GOU A;  3NWI A;  1MMG A;  4DVD A;  4EYY R;  4QX7 B;  2QRX A;  2YEV C;  3AEC A;  3OYX A;  4TZ4 C;  4JEH B;  4MHC A;  3OJA A;  1HX8 A;  2NW9 A;  4CZZ B;  4JV5 T;  2WQY A;  2LKH A;  2B1E A;  2PBI A;  3CK6 A;  1JNZ A;  3RI5 A;  3OTO T;  1SUM B;  2MBG A;  3ZPO A;  2CLY C;  2L3L A;  1QLB A;  4X1K E;  2BKN A;  5FXZ A;  5H6Q B;  1BR4 A;  2WBL A;  2NW8 A;  3RIU A;  1UX4 A;  2V26 A;  2M6B A;  4X1Y E;  5FL1 A;  2IW5 B;  1MMA A;  2FBW A;  2CBJ A;  3LFM A;  1XDO A;  2JQQ A;  5FXX A;  3KIN B;  5FP3 A;  3TLT A;  2DNX A;  3GN5 A;  5LGU B;  2WU5 A;  4AKG A;  2BZB A;  2JIW A;  2XSB A;  3H3A A;  3ZC1 A;  5HAX A;  5LBM A;  3N9Q A;  4H9O C;  2M67 A;  2BG9 B;  4LML A;  5JDM A;  4KHP T;  2W62 A;  2HN2 A;  1JNR A;  2AE9 A;  4PJL A;  4ILA A;  5LHH B;  3JCF A;  2LJL A;  2JQ9 A;  2XJ7 A;  1D0X A;  2W63 A;  3QB5 K;  5HCM A;  2JMH A;  1BR1 A;  4HTE A;  5BR8 T;  3N9O A;  2XZE A;  4B3R T;  3CQC B;  3N2O A;  1QSD A;  3QB5 A;  2V1D B;  4K0U A;  5LCY A;  5CA1 E;  4ISS A;  3MKD A;  4I4T E;  1KNR A;  4X1I E;  4CI1 B;  4CXY A;  1MIV A;  4YHJ A;  2LSJ A;  3RYH E;  3HR0 A;  2CHN A;  2H7V C;  3JAE A;  4DV0 T;  2WAU A;  3EVY A;  3ZMU B;  1OED E;  1WR6 A;  4AQF A;  4QXH B;  5LJN A;  3SFD A;  2Q9Q B;  2ZM6 T;  3PDY A;  2JQH A;  5FVL A;  4AXP A;  3IHR A;  3K8P C;  1HF8 A;  1OED B;  2X0H A;  4GK0 E;  3JAD A;  5CGM A;  3LK3 B;  4IE0 A;  1HFA A;  2L9Q A;  2X0Y A;  4JI2 T;  4ZI3 C;  3LJC A;  2ODV A;  5FXV A;  3VHL A;  5KDM C;  2IAK A;  1LVF A;  1BR2 A;  2DHR A;  4O4H E;  3HKC E;  4LFB T;  5HEJ A;  5AQN B;  2PFV A;  3L8R A;  4HN9 A;  1G73 A;  4IE6 A;  5FY0 A;  4LF7 T;  2V6X A;  4AI6 A;  2CLY B;  2XQ8 A;  3L3P A;  3AE6 A;  4DV3 T;  4HFH A;  1KNZ A;  5AQQ B;  1T98 A;  3Q9D A;  4HKA A;  3SOL A;  5L3E B;  2PJQ A;  5AQG B;  2HHH T;  2LHR A;  3AEE A;  4GYS A;  4K0K T;  2JQK A;  2MPK A;  2W61 A;  1IJ6 A;  5AQM B;  3ONL C;  4IRE A;  2D0U A;  4I55 E;  4LF4 T;  5HWY A;  4H63 V;  1D0Z A;  1HS7 A;  2X9Y A;  1E2A A;  3KFW X;  5JQG E;  1Z8U A;  3G06 A;  3I0O A;  2GK9 A;  3D0T A;  3KBT A;  3Q2M A;  4ZS3 A;  2J62 A;  3P4P A;  2BS4 A;  5ABF B;  1MMN A;  1US7 B;  2BS3 A;  3QK6 A;  4GIW A;  5JDF A;  3ZLI A;  4EXT A;  5A1L A;  2WDQ A;  5BMV E;  1HNX T;  2E5L T;  3MA9 A;  2NOX A;  2UXN B;  2CHO A;  4NUV A;  5ABF A;  3E22 E;  3AE7 A;  3LSV A;  4EOZ B;  2CEA A;  1NEN A;  1FIO A;  1IJ5 A;  2EHO D;  1XZY A;  2YU1 A;  4HFV A;  2DI4 A;  4IDN A;  1KNP A;  4QH5 A;  3VRB A;  2V7L A;  4NIQ A;  1T8B A;  1ZEE A;  1YQ4 A;  4PW8 A;  4U2Z A;  2V8S V;  1HG5 A;  4X5T A;  5HXH A;  2RP4 A;  5LOV E;  4EEB A;  4QHO A;  4P0A A;  2DWK A;  2VUR A;  2D5U A;  3BQI A;  5L3G B;  1N33 T;  1DU2 A;  5CA0 E;  4IE4 A;  2LKG A;  4GK5 E;  2JJ9 A;  5HCJ A;  3EDV A;  2WB5 A;  5L2L A;  4QX8 B;  1J5W A;  4UV9 B;  2WZH A;  2UUA T;  2UUC T;  2E9X C;  4ASK A;  2P9B A;  4ZEY A;  2XY8 B;  4ZOL E;  4IL9 A;  4JI5 T;  5H6R B;  4O8S A;  5ETW A;  3BQL A;  4A5X A;  4IST A;  5J1G A;  5JTG A;  4A97 A;  2QA7 A;  3MJX A;  5EK3 A;  5L47 A;  2AXD S;  2ACZ A;  4PJM A;  4YTP A;  2BVM A;  1D1C A;  4X20 E;  5HEG A;  2V6Y A;  1SA0 E;  3RH3 A;  3PUS A;  3PUA A;  2F4V T;  4DR6 T;  2C5J A;  2K9A A;  2KND A;  3L39 A;  1N34 T;  2XTL A;  4A98 A;  3ZST A;  4LF9 T;  2B76 A;  3C4Z A;  2X51 A;  3P4W A;  5E0O A;  3UT5 E;  4NXN T;  4C91 A;  2X66 A;  5CB4 E;  4AIS A;  1YKH B;  1YD8 G;  2CM0 A;  2XM2 A;  4GKK T;  3LK2 B;  2H3R A;  2FJA A;  3AE1 A;  4H9R C;  4UIG A;  3PU8 A;  1WRD A;  2A3D A;  3ZN0 B;  3RIF A;  3IA3 A;  2NTY A;  2A2F X;  2YN6 A;  1KF6 A;  3K3N A;  2DWG A;  2LE8 A;  3FBL A;  3TLW A;  2ZM2 A;  5LJM A;  5LMU T;  4ZI2 C;  1YKE B;  3EAB A;  3QOF A;  4O4J E;  3AE8 A;  3AVS A;  3AA7 B;  2KSR A;  4WYV A;  3AXJ A;  2NW7 A;  3ZYK A;  3Q5E A;  2CXF A;  1LVK A;  2UXD T;  1CHU A;  1HX1 B;  3EUH A;  4H63 H;  2DLR A;  2LRL A;  4PAG A;  1V9D A;  1YQ3 A;  3U78 A;  3SFE A;  3GMI A;  5M4Y A;  4IDO A;  3EDU A;  2LM2 A;  3PUZ F;  3NZQ A;  2HPJ A;  5HEH A;  3ANW B;  3ZMZ B;  4MFR A;  2CXD A;  2KMF A;  2V6Y B;  2E8I A;  2XQ5 A;  3SS1 A;  4NUU A;  5J2T E;  3MZK B;  1XNR T;  4B3T T;  1FEW A;  1LRZ A;  4U3C A;  2BBH A;  4XBF B;  4PFP A;  5LXT E;  2L8K A;  2Q9Q D;  3AAA B;  2E9X D;  4O4I E;  4KUM B;  4TWH A;  1H7C A;  4XZC A;  4U33 A;  4ERR A;  4AQY T;  2WWU A;  1BR0 A;  2KT9 A;  4TNV A;  3P8C D;  1WLX A;  3GN5 B;  2C5I T;  2LOP A;  4DV6 T;  4DR1 T;  4UEM A;  3PV0 F;  2KXP B;  5FY7 A;  2RPA A;  3T1H T;  4UXN B;  3UU8 A;  2ACX A;  3QUJ A;  4DMV A;  5JDQ A;  1YW0 A;  3VR8 A;  4IDZ A;  5J0Z A;  4X66 T;  2IIU A;  3AE2 A;  4EAH A;  4DV5 T;  2A9U A;  4Z91 A;  3UUX B;  3WI3 A;  2CXL A;  4JUY A;  5HEU A;  5CFB A;  3RRW A;  2LOS A;  2NWB A;  4IGU A;  3SWH A;  4JLE A;  4DV4 T;  4EGW A;  5AQV B;  2KIN B;  2J1D G;  3CX8 B;  2VVS A;  2IC6 A;  1ZOY A;  2J47 A;  1NWM X;  4M1P A;  1J1J A;  2QGS A;  4ZI7 E;  1D1A A;  2ZLY A;  4YJ2 E;  1Z0P A;  3HI2 A;  3B13 A;  4NPP A;  4EV6 A;  5LHG B;  3CIR A;  3PUG A;  2EHO A;  2E9X A;  2H88 A;  4PK5 A;  5C2T A;  5EK2 A;  1WFD A;  2XAS B;  2YIN A;  3E0Z A;  2V5D A;  4OX9 T;  3V5S A;  4YXD A;  2X0L B;  2A72 A;  4GKJ T;  5AQL B;  4COF A;  3RYI E;  1FMV A;  4U31 A;  3SRZ A;  2MTQ A;  4CXX A;  3M65 A;  1IBM T;  1ZKE A;  3AEF A;  3OBV E;  4H9N C;  3AEB A;  5AQJ B;  4BAY B;  5AQK B;  3TKL B;  2N1G A;  4ANJ A;  5KX5 E;  3LBX A;  4KBM B;  4Z90 A;  2CBI A;  3CML A;  4CN4 A;  2CWY A;  2ZMA A;  4TWD A;  4ZZC A;  5JDL A;  4B3M T;  4JYA T;  2KWH A;  4BA9 A;  3HL6 A;  1X9B A;  3HKE E;  4HFE A;  4LMJ A;  3UUL A;  1HG2 A;  2OA5 A;  2Y48 B;  2MOZ A;  2WS3 A;  3N5L A;  5F8P A;  3ZT7 A;  1I6Z A;  1UK5 A;  2XHE B;  2YDQ A;  3AAE B;  3MK7 C;  4L0R A;  3U3I A;  4ADZ A;  4FJO A;  3HKD E;  1XNQ T;  1HNW T;  1D0Y A;  2XUE A;  4EYU A;  2IUB A;  5DQV A;  4DV1 T;  5C3J A;  4MLK A;  3WAJ A;  2VB6 A;  2Y8D A;  4OYK A;  2XM1 A;  2BDE A;  3UU5 A;  5LNK A;  4L5G A;  2X68 A;  2M6I A;  4TV9 E;  3RF1 A;  2WMO A;  2CRB A;  4CI3 B;  4U72 A;  3AEG A;  3RKO A;  3WAK A;  4CI2 B;  2BG9 C;  4G63 A;  3UUM A;  4HWD A;  5JDH A;  1HCI A;  4DR2 T;  3ZEF B;  1HR0 T;  4B3S T;  4Z8X A;  1VCS A;  2FJB A;  4UVB B;  3ZJ2 A;  1OWA A;  4DV2 T;  3CKD A;  3JC6 D;  2YU2 A;  5JR9 C;  4KI0 F;  4P09 A;  2VVN A;  4DUZ T;  1D1B A;  2LT3 A;  3L09 A;  3P4Q A;  4LMK A;  5AQS B;  3C4W A;  5L4H A;  4WW0 A;  2E5V A;  3ZN1 B;  5J2U E;  2IDO B;  4WNK A;  2E2A A;  5LP6 E;  3EAM A;  2V7K A;  2Y6X A;  3MAC A;  5AQF B;  2XQ3 A;  2WDR A;  2WSS V;  1W09 A;  2VL8 A;  3OYZ A;  2W0G A;  4PK6 A;  4WBO A;  5IYZ E;  1W9R A;  5ABH A;  5LGN B;  4TNW A;  3AAI A;  2WCA A;  3P7I A;  5HXR A;  2WP9 A;  3RIA A;  2VAS A;  4O4L E;  4CN6 A;  2LSI A;  1U5P A;  4MBQ A;  1OED C;  4YFS A;  3UQ7 A;  4YTM A;  3ZYM A;  4JI1 T;  4QH1 A;  4F8H A;  2FJE A;  3RQU A;  4EZH A;  3C51 A;  4I43 B;  2G0U A;  2BKP A;  2HH7 A;  2W66 A;  2WDV A;  2WM9 A;  4HWI B;  4KX6 A;  2VQE T;  2LSG A;  3O1H A;  4QWN B;  3T1Y T;  3CX7 B;  3AVR A;  5L3F B;  3OKQ A;  3KVA A;  2W2U A;  4YSY A;  3AE5 A;  3PJA J;  3F2E A;  5DQW A;  2LM9 A;  2LRK A;  4QH4 A;  4UVA B;  3DP7 A;  1NEK A;  3F57 A;  2K24 A;  2CMR A;  2LHN A;  3BK9 A;  1CUN A;  3RKG A;  3UTK A;  3J7Y q;  4LFC T;  3RYC E;  2UXB T;  2X9H A;  3R6N A;  1IZN B;  4OYJ A;  2K5B B;  5DAB A;  4CN1 A;  2VQF T;  5HWX A;  5EZY E;  1NAF A;  3AXJ B;  1UGO A;  4YTN A;  3K1S A;  3AB3 B;  2CA5 A;  2OV9 A;  3PU3 A;  2D9D A;  2C0S A;  5HXS A;  1VRB A;  2UU9 T;  3A7M A;  3FXD B;  2BVL A;  3UFE A;  4PJN A;  3V5U A;  4P1N A;  2J4G A;  3ANW A;  2XQ7 A;  3FHN A;  4U7I A;  4ZS2 A;  2BBJ A;  5GON E;  3KVB A;  3IBP A;  2V7M A;  4GYR A;  5AQT B;  3MXZ A;  3UQ4 A;  4H9Q C;  2W67 A;  4BJN A;  3RLF F;  1FJG T;  3S4U A;  2R6G F;  3VKH A;  4ZI3 D;  2K3W A;  3O9X A;  4LFA T;  3ABV A;  4JEU B;  2VL0 A;  2IHR 1;  4TX5 A;  2V7J A;  3ETV A;  2FUP A;  4YJ3 E;  5JRC A;  2QYW A;  2ZM0 A;  1Y01 A;  2LLY A;  2NR4 A;  4PNI A;  3CX6 B;  3PTR B;  3UU6 A;  3DTO A;  4F6R C;  4AIU A;  5JRC B;  3UFG A;  3PUR A;  3FBZ A;  4IDQ A;  3ESL A;  3GWH A;  3NVO A;  3ZMT B;  2LSK A;  2CCQ A;  4P0B A;  4TUY E;  5LMN T;  4YLH A;  2WWV A;  3RQW A;  5ADX L;  3PUX F;  3QNU A;  1OXZ A;  3RX6 A;  2XQ4 A;  3PUY F;  1KK7 A;  3TLV A;  5IUX A;  5KMG P;  3RC8 A;  1MIW A;  3ZC0 A;  4HFI A;  4HWC A;  4UEL A;  1UX5 A;  4OK0 A;  2ZM8 A;  4E7S A;  3CWZ B;  4UV8 B;  5F5W A;  4FI5 A;  3QC9 A;  2EHO C;  2VKO A;  3FZH B;  4JI7 T;  1MIY A;  2BG9 A;  4X64 T;  2XAH B;  2SPC A;  1W0B A;  2VKD A;  3ZKR A;  1MNE A;  2OLT A;  3VRA A;  4JI4 T;  3E08 A;  4WZX A;  5HEO A;  5IHY A;  3C4X A;  3X1D A;  4AQG A;  4NXM T;  1S94 A;  1Y64 B;  4HWF A;  4H9S E;  2JMK A;  4DV7 T;  4X65 T;  2C5K T;  3IEE A;  2E9X B;  2VKH A;  2MAW A;  3LG7 A;  2VKJ A;  2X67 A;  5JH7 E;  1WYB A;  4EED A;  4JI8 T;  1AJ3 A;  2XAQ B;  3AEA A;  4HWH A;  2X9X A;  5LB7 B;  3ETU A;  1U4Q A;  2ODU A;  3I9W A;  3ONX A;  3ZCI A;  2KLQ A;  4DBR A;  3GA8 A;  1XDP A;  4BJM A;  3P50 A;  3N9M A;  2Q9Q A;  3ZCJ A;  3I9Y A;  4JI0 T;  4ILC A;  5AQO B;  1X79 A;  3OVU A;  4LF6 T;  1IAP A;  1OED A;  3ZT6 A;  4DID B;  4HFD A;  1T72 A;  4DO0 A;  2WY2 A;  1VCT A;  4N78 D;  2LEH A;  3FZL B;  2YDR A;  2K48 A;  3N9L A;  4OFZ A;  4TWF A;  4EB6 E;  5JDG A;  4DBQ A;  3UU3 A;  3NRY A;  2BS2 A;  1E1H B; 
#chains in the Genus database with same CATH homology
 2VWA A;  1S35 A;  2ES0 A;  4ILU A;  3KV6 A;  3T8O A;  3N2K E;  2Q9Q C;  3ZMV B;  4V1A v;  5JR9 B;  4AKI A;  2KWI B;  3HKB E;  4QXC B;  5JDN A;  3A5X A;  4ZI2 D;  2LSY A;  4OHF A;  3JC6 C;  5HXE A;  5JR9 A;  5JRE A;  4B6X A;  4QKN A;  5HYA A;  3AA0 B;  3C64 A;  4UVC B;  5L3D B;  1ZV4 X;  4PFO A;  3LK4 2;  3N2G E;  4L9I A;  4CXW A;  5JVD E;  4MAL A;  2MYS A;  2EHO B;  2X9W A;  4HEA A;  4IIJ E;  2D0T A;  4C90 A;  5LG4 A;  5LBQ B;  2YK0 A;  3KV5 A;  3W15 B;  1O3X A;  4J2C A;  3CPZ A;  5F3J A;  3PUQ A;  1QUU A;  3HA4 A;  3LBX B;  2PG8 A;  1WYC A;  2XQY A;  5FXW A;  3DJB A;  2I59 A;  3N9N A;  4IE7 A;  4KP3 C;  5DJQ C;  3K3O A;  4TV8 E;  3NZP A;  5L3C B;  3H37 A;  3RYF E;  5L3B B;  4HE8 A;  4AQF C;  2HPL A;  1HTJ F;  3O1J A;  3AA1 B;  4AKR B;  1UCU A;  5HXC A;  2XAF B;  5LA6 E;  3FXE B;  5FYM A;  4O2A E;  5FMN A;  2H7O A;  3KV4 A;  5LYJ E;  3KV9 A;  1SHZ C;  4HGA A;  2N2N A;  5FNV E;  4DMW A;  1ZHC A;  2Z6E A;  3O1I A;  4XAX B;  2NTX A;  2N9D A;  1LKX A;  3KBU A;  2XAG B;  4TN7 B;  2CE7 A;  5TAO A;  4U74 A;  4A56 A;  3UUN A;  4EZ4 A;  4KMC A;  4CQI A;  3I0Q A;  2NP9 A;  5LHI B;  3Q5X A;  3FB2 A;  3PE0 A;  4ZHQ E;  3IF8 B;  2W00 A;  3BQK A;  5EK4 A;  1MMD A;  3CQG B;  5LGT B;  4UF0 B;  3NBX X;  3B57 A;  3N9P A;  2CWO A;  4PJJ A;  2JRK A;  2WMN A;  2RA1 A;  3RPU A;  3Q5W A;  4E7Z A;  4O2B E;  3KDS E;  4PK4 A;  3I1A A;  3C50 A;  4IE5 A;  5AFU L;  2DCF A;  4DND A;  1B7T A;  3RC3 A;  4I50 E;  3O4X E;  1VOM A;  3J9X 1;  2V7I A;  4AKH A;  4WBN E;  3VKG A;  1EZ3 A;  4AKL A;  2D2S A;  4IHJ E;  1MND A;  3CVR A;  5FY1 A;  2UXX B;  2VK9 A;  4EIW A;  3C98 B;  3F31 A;  3CQX C;  3VU7 H;  3R84 B;  1G8X A;  2JPF A;  3AA6 B;  4H9P C;  3K3Q C;  4UF0 A;  2IC9 A;  3ZJ1 A;  3ZMS B;  2XAJ B;  4G2A A;  1FMW A;  5C8Y E;  3NRX A;  2KZ7 B;  4QXB B;  3RRC A;  4GOU A;  4EYY R;  1MMG A;  4DVD A;  4QX7 B;  2YEV C;  3OYX A;  4TZ4 C;  2NW9 A;  4JEH B;  4MHC A;  3OJA A;  1HX8 A;  4CZZ B;  2B1E A;  2PBI A;  2MBG A;  2CLY C;  2L3L A;  4X1K E;  5FXZ A;  5H6Q B;  1BR4 A;  2WBL A;  2NW8 A;  1UX4 A;  2V26 A;  4X1Y E;  2IW5 B;  1MMA A;  3LFM A;  2JQQ A;  5FXX A;  3KIN B;  5FP3 A;  2DNX A;  3GN5 A;  5LGU B;  4AKG A;  2BZB A;  3H3A A;  3ZC1 A;  5HAX A;  5LBM A;  3N9Q A;  4H9O C;  2M67 A;  5JDM A;  2W62 A;  4PJL A;  5LHH B;  2LJL A;  1D0X A;  2W63 A;  2JMH A;  1BR1 A;  4HTE A;  3N9O A;  3CQC B;  3N2O A;  1QSD A;  4K0U A;  2V1D B;  5LCY A;  5CA1 E;  4ISS A;  3MKD A;  4I4T E;  4X1I E;  4CI1 B;  4CXY A;  1MIV A;  4YHJ A;  2LSJ A;  3RYH E;  3HR0 A;  2H7V C;  2WAU A;  3EVY A;  3ZMU B;  4AQF A;  1WR6 A;  4QXH B;  5LJN A;  2Q9Q B;  3PDY A;  4AXP A;  3IHR A;  3K8P C;  1HF8 A;  4GK0 E;  3LK3 B;  4IE0 A;  1HFA A;  2L9Q A;  4ZI3 C;  3LJC A;  2ODV A;  5FXV A;  3VHL A;  5KDM C;  2IAK A;  1LVF A;  1BR2 A;  2DHR A;  4O4H E;  3HKC E;  2PFV A;  4HN9 A;  4IE6 A;  1G73 A;  5FY0 A;  4AI6 A;  2CLY B;  3L3P A;  1KNZ A;  1T98 A;  3Q9D A;  4HKA A;  3SOL A;  5L3E B;  2PJQ A;  2LHR A;  4GYS A;  2W61 A;  1IJ6 A;  2D0U A;  4I55 E;  5HWY A;  4H63 V;  1D0Z A;  1HS7 A;  2X9Y A;  3KFW X;  5JQG E;  3I0O A;  2GK9 A;  3D0T A;  3KBT A;  3Q2M A;  4ZS3 A;  1MMN A;  1US7 B;  3QK6 A;  3ZLI A;  4GIW A;  5JDF A;  5A1L A;  4EXT A;  5BMV E;  3MA9 A;  2NOX A;  2UXN B;  4NUV A;  3E22 E;  4EOZ B;  2CEA A;  1FIO A;  1IJ5 A;  2EHO D;  2YU1 A;  4HFV A;  2DI4 A;  2V7L A;  4PW8 A;  1ZEE A;  5HXH A;  1HG5 A;  2RP4 A;  5LOV E;  4P0A A;  4QHO A;  2DWK A;  3BQI A;  2D5U A;  5L3G B;  5CA0 E;  4IE4 A;  4GK5 E;  2JJ9 A;  3EDV A;  5L2L A;  4QX8 B;  4UV9 B;  2E9X C;  4ASK A;  2P9B A;  4ZOL E;  5H6R B;  4O8S A;  5ETW A;  3BQL A;  4IST A;  5J1G A;  2QA7 A;  3MJX A;  5EK3 A;  4PJM A;  2BVM A;  1D1C A;  4X20 E;  1SA0 E;  3RH3 A;  3PUS A;  3PUA A;  2C5J A;  2K9A A;  2KND A;  2XTL A;  3C4Z A;  2X51 A;  5E0O A;  3UT5 E;  4C91 A;  2X66 A;  5CB4 E;  1YKH B;  1YD8 G;  2CM0 A;  3LK2 B;  2H3R A;  4H9R C;  4UIG A;  3PU8 A;  1WRD A;  2A3D A;  3ZN0 B;  2NTY A;  2A2F X;  3K3N A;  2DWG A;  2LE8 A;  3FBL A;  5LJM A;  2ZM2 A;  4ZI2 C;  1YKE B;  4O4J E;  3AVS A;  3AA7 B;  2NW7 A;  3ZYK A;  2CXF A;  1LVK A;  3EUH A;  4H63 H;  2DLR A;  4PAG A;  1V9D A;  3U78 A;  3GMI A;  5M4Y A;  3EDU A;  3NZQ A;  2HPJ A;  3ANW B;  4MFR A;  2CXD A;  2KMF A;  3SS1 A;  2E8I A;  5J2T E;  4NUU A;  3MZK B;  1FEW A;  1LRZ A;  4XBF B;  4PFP A;  5LXT E;  2L8K A;  2Q9Q D;  3AAA B;  2E9X D;  4O4I E;  4KUM B;  1H7C A;  4XZC A;  4ERR A;  1BR0 A;  2WWU A;  2KT9 A;  3P8C D;  3GN5 B;  1WLX A;  2C5I T;  2LOP A;  4UEM A;  2KXP B;  5FY7 A;  4UXN B;  2ACX A;  3QUJ A;  4DMV A;  5JDQ A;  1YW0 A;  4IDZ A;  4EAH A;  3UUX B;  3WI3 A;  2CXL A;  4JUY A;  3RRW A;  2LOS A;  2NWB A;  4IGU A;  3SWH A;  4JLE A;  2KIN B;  2J1D G;  3CX8 B;  2IC6 A;  4M1P A;  1NWM X;  2QGS A;  4ZI7 E;  1D1A A;  2ZLY A;  4YJ2 E;  1Z0P A;  3HI2 A;  3B13 A;  5LHG B;  3PUG A;  2EHO A;  2E9X A;  4PK5 A;  5EK2 A;  3E0Z A;  2XAS B;  2YIN A;  3V5S A;  2X0L B;  2A72 A;  3RYI E;  1FMV A;  3SRZ A;  2MTQ A;  4CXX A;  3M65 A;  1ZKE A;  3OBV E;  4H9N C;  4BAY B;  3TKL B;  2N1G A;  4ANJ A;  5KX5 E;  3LBX A;  4KBM B;  3CML A;  2CWY A;  2ZMA A;  5JDL A;  2KWH A;  4BA9 A;  3HL6 A;  3HKE E;  3UUL A;  1HG2 A;  2OA5 A;  2Y48 B;  2MOZ A;  3N5L A;  5F8P A;  3MK7 C;  2XHE B;  3AAE B;  4L0R A;  3U3I A;  4ADZ A;  4FJO A;  3HKD E;  1D0Y A;  2XUE A;  4EYU A;  5DQV A;  4MLK A;  3WAJ A;  2VB6 A;  2Y8D A;  4OYK A;  2BDE A;  5LNK A;  4L5G A;  2X68 A;  4TV9 E;  2WMO A;  4CI3 B;  4U72 A;  3RKO A;  3WAK A;  4CI2 B;  4G63 A;  3UUM A;  5JDH A;  1HCI A;  3ZEF B;  4Z8X A;  4UVB B;  3ZJ2 A;  1OWA A;  3CKD A;  3JC6 D;  2YU2 A;  5JR9 C;  4P09 A;  1D1B A;  2LT3 A;  3L09 A;  3ZPO A;  3C4W A;  3ZN1 B;  4WW0 A;  5J2U E;  4WNK A;  5LP6 E;  2V7K A;  2Y6X A;  3MAC A;  2WSS V;  4WBO A;  2VL8 A;  3OYZ A;  4PK6 A;  2W0G A;  5LGN B;  5IYZ E;  3AAI A;  3P7I A;  5HXR A;  2VAS A;  4O4L E;  2LSI A;  1U5P A;  4MBQ A;  4YFS A;  3ZYM A;  4EZH A;  3C51 A;  4I43 B;  2G0U A;  2HH7 A;  2WM9 A;  2LSG A;  3O1H A;  4QWN B;  3CX7 B;  3AVR A;  5L3F B;  3OKQ A;  3KVA A;  3F2E A;  5DQW A;  2LM9 A;  4UVA B;  3ZMZ B;  3ZYL A;  3DP7 A;  3F57 A;  2K24 A;  2CMR A;  2LHN A;  3BK9 A;  1CUN A;  3J7Y q;  3UTK A;  3RYC E;  2X9H A;  3R6N A;  1IZN B;  4OYJ A;  2K5B B;  5DAB A;  5HWX A;  5EZY E;  1NAF A;  3AB3 B;  2CA5 A;  3PU3 A;  2C0S A;  5HXS A;  1VRB A;  3FXD B;  2BVL A;  3UFE A;  4PJN A;  3V5U A;  3ANW A;  3FHN A;  4ZS2 A;  5GON E;  3KVB A;  3IBP A;  2V7M A;  4GYR A;  3MXZ A;  4BJN A;  4H9Q C;  3S4U A;  3VKH A;  4ZI3 D;  3O9X A;  4JEU B;  4TX5 A;  2V7J A;  3ETV A;  4YJ3 E;  5JRC A;  2ZM0 A;  4PNI A;  3CX6 B;  3PTR B;  3DTO A;  4F6R C;  5JRC B;  3PUR A;  3FBZ A;  3ESL A;  3GWH A;  3ZMT B;  2LSK A;  2CCQ A;  4P0B A;  4TUY E;  4YLH A;  5ADX L;  1OXZ A;  3RX6 A;  3RC8 A;  1KK7 A;  5KMG P;  3ZC0 A;  1MIW A;  4UEL A;  1UX5 A;  4OK0 A;  2ZM8 A;  4E7S A;  3CWZ B;  4UV8 B;  4FI5 A;  3QC9 A;  2EHO C;  2VKO A;  1MIY A;  2XAH B;  2SPC A;  2VKD A;  1MNE A;  3E08 A;  5IHY A;  3C4X A;  4AQG A;  1S94 A;  1Y64 B;  4H9S E;  2JMK A;  2C5K T;  3IEE A;  2E9X B;  2VKH A;  3LG7 A;  2VKJ A;  2X67 A;  5JH7 E;  1WYB A;  1AJ3 A;  2XAQ B;  2X9X A;  3ETU A;  1U4Q A;  2ODU A;  3I9W A;  3ONX A;  3ZCI A;  2KLQ A;  4DBR A;  3GA8 A;  4BJM A;  3N9M A;  2Q9Q A;  3ZCJ A;  3I9Y A;  1X79 A;  1IAP A;  4DO0 A;  4N78 D;  2LEH A;  4OFZ A;  4EB6 E;  2K48 A;  3N9L A;  5JDG A;  4DBQ A;  3NRY A;  1E1H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...