4OYJA

Structure of the apo hoip pub domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF31
total genus 60
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oyjA00
5LJNA 2D5UA 2CM0A 2HPLA 5LJMA 2CCQA 4OYKA 4P0AA 4JUYA 4P09A 4P0BA 4OYJA 2HPJA
chains in the Genus database with same CATH superfamily
4H9NC 3E08A 4HFCA 3CQXC 4KX6A 4OYKA 3G06A 3ZCIA 2LOPA 4DBQA 5JQGE 3MK7C 1I94T 1FJGT 2RP4A 4BJNA 3V5SA 5DJQC 3ZT5A 4ILCA 2CM0A 2YDQA 4WZXA 4EEBA 4YSYA 2J47A 2XAGB 4G63A 2VVNA 3EAMA 3K3NA 4J2CA 4WYVA 3RI5A 3RYCE 3PUXF 4JI4T 1N33T 4HGAA 4IIJE 3F2EA 1D0XA 3TLSA 2CRBA 4CXXA 4JI0T 4DV7T 4ANJA 1MNEA 4DV1T 2X9XA 4ZEYA 4IGUA 5J2UE 4JI5T 2WWUA 3ZJ1A 3AE7A 2JMHA 2LHRA 4PJNA 5AQNB 1R8IA 2NW9A 2WDQA 2LOSA 3PE0A 2C5KT 3AAEB 2LJLA 3F31A 3PTRB 1N36T 4YY3T 2ZMAA 1JNRA 2JQHA 3QOFA 2W4XA 3AXJB 3C4XA 3NVOA 1Z0PA 4PK5A 2V7IA 4AQFA 1UX5A 2FJDA 4AIUA 4KUMB 4EV6A 5LMNT 4ERRA 2BKNA 2CXFA 2LSIA 3P4RA 4ISSA 3SWHA 3ZYLA 2QGSA 3N5LA 2BZBA 3AEDA 1D1BA 2C0SA 3AE1A 3PUZF 4U2ZA 4JEHB 5HXCA 3C98B 3RF1A 1MMDA 3ZMZB 4F6RC 3PJAA 4AXPA 3SFEA 4EZ4A 1UK5A 3GN5A 3WAJA 3RGLA 2D5UA 1Z8UA 2CHOA 2BVLA 1KNPA 4MBQA 3IF8B 4H9RC 2W0GA 1BR0A 3O4XE 5IUXA 3ZT7A 4E7SA 4AKHA 3C50A 3E0ZA 4Q25A 5ABFB 2LRKA 3OYXA 5ABHA 4LFAT 3C4ZA 3RKGA 3PUAA 2N1GA 3QB5A 5EK3A 3PUVF 4ASKA 1FIOA 2LHNA 2VL0A 5AQOB 2CXLA 3UU4A 2W2UA 2LSYA 5AQVB 4TV8E 5HCMA 2FJEA 2YKSA 4XAXB 3ANWA 2WZIA 4IT4A 5FXWA 5H6QB 2KWIB 3J9X1 3RH3A 5C8YE 4GOUA 1WCRA 5AQRB 3PURA 4WNKA 2H7OA 2CMRA 2X9WA 4DMVA 2Q9QD 2BG9A 3AE4A 3PU8A 4HWDA 4CN4A 1HG5A 3L8RA 2JQ9A 5EK2A 3ZSTA 3N2KE 3ZPOA 2B76A 4AQYT 5JRCB 3PUYF 4DR3T 5AQLB 2LKGA 2XJ7A 1YW0A 2X68A 5JDMA 1MIYA 4H9SE 2XHEB 3N9QA 3OPCA 3HKCE 2OA5A 4IHJE 4O4JE 3UQ7A 4X65T 5L4EA 3TKLB 1V9DA 4JI1T 2BVMA 2E9XA 1U5PA 5JTGA 1WLXA 2QA7A 2W67A 3B57A 2BDEA 4EXTA 4X66T 2D0TA 2PG8A 3HA4A 2FUPA 3LG7A 4H9PC 4KMCA 2V26A 4QXBB 4LFBT 1X79A 2V7KA 3FZMB 3GWHA 5CA0E 2WBLA 3ZMVB 3AVRA 1XDPA 4UV8B 4ADZA 3HKEE 2NTXA 4HFDA 4BAYB 2PTFA 4UVBB 3KBTA 1XDOA 3NRYA 4FJOA 4JV5T 1IJ5A 3O1IA 4CZZB 4EIWA 3ZCJA 2AE9A 3DJBA 4XZCA 1QSDA 5IWAT 1HS7A 3GN5B 2VB6A 3QUJA 4TX5A 4B3ST 5AQHB 4IE0A 3Q9DA 2QRXA 3AA0B 5F3JA 1SUMB 5HAXA 1VCSA 2M6BA 3QB5K 4X1YE 3R6NA 3RIUA 5CB4E 5AQSB 4GIWA 3NZQA 3VKGA 1ZP0A 4QXHB 4PFOA 2X0YA 1W9RA 2AXDS 3SFDA 3EI0A 3ZN0B 5KX5E 5L47A 4NIQA 4CI2B 3LK42 1NEKA 2PFVA 2YN6A 2DWGA 2MTQA 3GA8A 4WBOA 2EHOC 2IMLA 2EHOA 3KV6A 5F5WA 1D1AA 5KDMC 4EZHA 2CCQA 2HHHT 5C3JA 3CIRA 4Z91A 1VCTA 1W0BA 2KNDA 3KVAA 3NKZA 4I50E 4PJLA 4X1IE 5AQGB 3CX7B 3LK3B 1MMAA 4MALA 3WI3A 2CLYC 3QNUA 2V5DA 4CQIA 3AE9A 2MAWA 2KMFA 4NXNT 2MOZA 2WAUA 2BG9B 3P50A 2ZM8A 4ILAA 1QUUA 2DHRA 2V6XA 3E22E 3P4SA 4IREA 2YOEA 3UU3A 2WS3A 5CJ5A 5LP6E 2VASA 4JEUB 3CX8B 1OWAA 1ZKEA 3LDQB 4QH1A 4A56A 5J2TE 3Q5DA 3RQWA 4ZI7E 2KXPB 2VVSA 5LNKA 3N2GE 4HFIA 4DR1T 2PJQA 3OKQA 3M65A 1M62A 2KINB 4GYSA 3W15B 4YJ3E 3AA1B 2CEAA 3B13A 4NPPA 2K48A 3MKDA 3CKDA 1FEWA 2YDRA 2XAHB 2CE7A 3EUHA 3C64A 3MA9A 1ZV4X 4ZHQE 4JBWF 1CUNA 3I0OA 1WYBA 2C5JA 4IDOA 3UTKA 3HKBE 4L0RA 4U74A 3AEFA 4AQGA 1NENA 3LK2B 5AQTB 3O9XA 1HNXT 4JI7T 2XQ5A 1J5WA 2LSGA 3K1SA 4HWHA 2Q9QA 4UR9A 4DO0A 3LSVA 2W00A 2V8SV 3L3PA 2J4GA 2XASB 4HN9A 2UXXB 4OHFA 4X5TA 3UT5E 4O2BE 2DCFA 3UUXB 3ZT6A 1OEDE 4I55E 4AKLA 2I59A 3ONLC 2BKPA 4YJ2E 5J0ZA 4DUYT 4ILBA 3ONJA 3N9OA 3BK9A 3DP7A 3PDYA 2WU5A 4Z8XA 5AQQB 3LBXB 3RIFA 2P9BA 4JI3T 3PV0F 2H88A 2V1DB 1N32T 3ZMTB 1IBLT 1WR0A 1Y01A 2ODUA 4HWCA 5LCYA 4LF8T 3PUWF 4IE5A 4UXNB 4UF0A 2XQ4A 2YU2A 1HCIA 2DWKA 4UVAB 3LJCA 5H6RB 3J7Yq 2YK0A 4DV2T 5JVDE 2X67A 3KDSE 2UXBT 3U78A 2I6HA 1UGOA 3EHZA 5ABGA 5A1LA 5HWYA 2E5LT 2ACXA 2PBIA 3O1HA 4UF0B 1EZ3A 5FXVA 3AE3A 1LKXA 2LT3A 3X1DA 2Z6EA 4DV4T 3RRCA 1GQEA 5BMVE 5HXEA 4PK4A 3UFEA 4LF6T 4YTNA 2VKJA 4C90A 1ZOYA 3RC8A 2Y8DA 4TWDA 4MHCA 3T8OA 2VKOA 2Q9QC 4B3TT 1IZNB 2XUEA 3JCFA 1W0AA 2XAQB 3RKOA 2CA5A 3IEEA 3RPUA 5JH7E 5JREA 2UU9T 3ZEFB 2HH7A 3JAFA 2FJAA 2LSKA 2RA1A 2V6YB 1YQ4A 3AA6B 4F8HA 2UXNB 2V7MA 4PJMA 3KINB 3AXJA 3QK6A 3FZFB 4P09A 3K8PC 3JC6C 3FB2A 4TV9E 2UUBT 2A72A 3HL6A 4ZI2C 3P4PA 5FY0A 2E9XC 3CWZB 1KK7A 3MZKB 3P4QA 1E7PA 2H7VC 2V6YA 4K0UA 4QX7B 2CPTA 2JIWA 2BS2A 3UUNA 4EOZB 4UIGA 1HNWT 3R84B 2X66A 2WDRA 3CX6B 5LXTE 2KLQA 2V5CA 2X9YA 5HEGA 4X62T 2YDSA 2ZM2A 1LVKA 1KNZA 4K0KT 2XAFB 1LRZA 3OBVE 5LGNB 3AEAA 2NTYA 2KT9A 2M6IA 3PJAJ 2N9DA 2CXDA 2DL1A 2ES0A 1HF8A 1YD8G 1UX4A 2JQQA 3H3MA 4WW0A 2SPCA 3A7MA 3Q5XA 5HEJA 2XSBA 5HEOA 1T7SA 1HG2A 1QLBA 2JMKA 2NOXA 3AE2A 3DTOA 5HEHA 5JDQA 5JDHA 2V7JA 2RPAA 4DR6T 5FVLA 3RC3A 4PAGA 4X20E 5JDFA 3RYHE 1XWMA 3OJAA 3U3IA 1BR1A 3EVYA 4L9IA 3VR8A 2W63A 3ANWB 5FMNA 2E5VA 3AEEA 4U7YA 1HNZT 4HFHA 1SHZC 4X64T 4B3RT 5L3DB 3A5XA 4JUYA 5JR9A 3NZPA 3H3AA 2L8KA 3I0QA 4PJJA 2W66A 4ZS3A 1US7B 5JDLA 2D2SA 4O4LE 4TWHA 5LOVE 3RLFF 4AKRB 2ZLYA 3ONXA 5LJNA 5L3BB 1YXRA 4EEDA 4PNIA 4KHZF 2WSSV 2GK9A 3C51A 4L5GA 2XZEA 4GYRA 4U33A 4UV9B 5DQWA 2ZM6T 4HEAA 4O4HE 4LF7T 4OX9T 4O8SA 4BA9A 3GMIA 5JRCA 1UUSA 2NWBA 1LVFA 1MMGA 1YKHB 2HN1A 4JI8T 2VWAA 5LGUB 4DV5T 4E7ZA 3RQUA 3FXDB 5C2TA 1KFYA 3TLWA 4IE6A 1D1CA 5FP3A 3UU6A 1CHUA 4DIDB 3FBZA 2LM9A 2E8IA 3AE5A 3O1JA 3LFMA 3HI2A 4QKNA 4I43B 5M4YA 2FJBA 4YT0A 2FBWA 2MBGA 1T72A 2LRLA 2G0UA 1HR0T 2XQ3A 3K3QC 3P4WA 4COFA 4TUYE 5HXRA 2J62A 4ZI3C 4DV0T 1WFDA 2BBJA 2LM2A 3P7IA 3Q2MA 5LYJE 5LG4A 1WYCA 5EK4A 3FBLA 4DR2T 1D0ZA 3KFWX 1MMNA 5HEUA 3VU7H 3V5UA 3AB3B 4QHOA 1FMVA 4EYYR 4KI0F 1D0YA 1FMWA 2OV9A 3OYZA 4OK0A 3RX6A 1T8BA 4A97A 4YHHT 4LFCT 2IW5B 5FNVE 2IC9A 3ZYKA 3KV5A 2L3LA 3AE6A 5HYAA 2CWOA 5LMUT 2WU2A 5E0OA 2V7LA 5LA6E 4H9QC 4HE8A 4DV6T 2XQ8A 1JNZA 5FY1A 2DLRA 4IE7A 4DBRA 2BBHA 3ZMUB 1S35A 4H63H 4YXDA 3KV9A 1KF6A 3ZYMA 4LF4T 2DNXA 2XQYA 1XZYA 4H9OC 2F4VT 4CI3B 3ETVA 2ODVA 2NW7A 1B7TA 1UCUA 4YLHA 4IL4A 1E1HB 2A3DA 3KVBA 3ZKRA 4EYUA 2YINA 4O2AE 5CFBA 3BQLA 5HXHA 3T1YT 2XQAA 3SOLA 3Q5WA 4X1KE 3UFGA 2HPJA 2KSRA 2LE8A 3FZLB 4N78D 3F57A 5JR9B 3N2OA 1S94A 5AQKB 3SS1A 4YSZA 2IIUA 5LGTB 1AJ3A 2QYWA 4QX8B 2D0UA 1XNQT 2VURA 3TLTA 4OYJA 4U3CA 5IYZE 2X51A 2Y48B 5L2LA 2IAKA 3AECA 4PK6A 5DABA 2HN2A 2WY2A 3ETUA 3ZLIA 5KXJA 2E9XB 3L09A 2NW8A 2Y6XA 4MLKA 4DUZT 4YSXA 3MXZA 5L3EB 1I6ZA 2WCAA 3JADA 1YQ3A 2H89A 5LBQB 4IE4A 2WB5A 5L4HA 4A98A 2R6GF 4HFEA 2NP9A 4AISA 2XTLA 4V1Av 2VL8A 3WAKA 2MPKA 2IHR1 1M7KA 3AEBA 3QC9A 4AI6A 2WZHA 1X9BA 5TAOA 3A8YC 4LMKA 4AKIA 4ZXLA 1YKEB 2JPFA 2BS4A 3IHRA 4DR5T 2EHOD 3KBUA 5LB7B 3PU3A 4ILUA 2IDOB 1IBMT 4U31A 5LHHB 3PUGA 4LF5T 2BG9C 4HWFA 1KNRA 1HFAA 4BJMA 4GK0E 4A5XA 4EB6E 4KP3C 1U4QA 2CLYB 4CN6A 3Q5EA 2XAJB 3ABVA 4UEMA 1XNRT 2C5IT 2DI4A 3AA7B 3H37A 1HX1B 2VKDA 4PW8A 4M1PA 2LKHA 2EHOB 1N34T 2LEHA 2D9DA 3OTOT 3FZKB 3B5MA 4GK5E 4JYAT 4JLEA 2WWVA 4YFSA 4LF9T 4O4IE 2JJ9A 2K3WA 3AVSA 5FY7A 3UQ4A 2XY8B 1MIWA 5AQPB 3KV4A 4IL9A 3N9NA 3I9WA 3OVUA 3TLVA 5FL1A 3RRWA 1MIVA 2X0HA 4GKKT 1J1JA 2X0LB 5LHGB 2A9UA 2BKOA 1OEDB 4CXWA 4DV3T 2BS3A 5FXXA 5L3GB 5ABEA 2L9QA 3FZHB 1E2AA 3UUMA 4QH5A 2WDVA 2CWYA 5L3FB 2XM1A 2WM9A 2K9AA 1OEDC 4HKAA 2XQ9A 4JI6T 5FVKA 1J5ET 2XQ7A 5ETWA 4DMWA 3ZN1B 2ACZA 3MACA 4ZZCA 3FHNA 3RYIE 5JDNA 2UXDT 4QXCB 3BQKA 4Z90A 4P0AA 2B1EA 3UU5A 1XMQT 1OXZA 1NWMX 3CQCB 3EDUA 5HWXA 1DU2A 4QWNB 4AQFC 3ZC0A 3MJXA 4CN1A 3S4UA 2QVAA 3AAAB 4U7IA 4JI2T 2WQYA 3P8CD 3T1HT 2XQ6A 5CGMA 5LBMA 4B3MT 5JR9C 5CA1E 4ZI3D 1SA0E 3AE8A 5FKYA 2Q9QB 5AFUL 2J1DG 3I9YA 4PFPA 5DQVA 1IAPA 3SRZA 2X9HA 1NAFA 4B6XA 3EABA 4CI1B 4IDNA 2H3RA 4TN7B 4UVCB 3CMLA 5L3CB 1XMOT 1T98A 4TNWA 5AQFB 2KZ7B 4TNVA 1IBKT 4KHPT 2YU1A 1H7CA 4IDPA 2WMNA 3HKDE 2K5BB 5KMGP 3C4WA 5FYMA 1MNDA 3CPZA 2E2AA 3IA3A 1BR4A 4NXMT 1Y64B 1HTJF 2VKHA 2XM2A 3NRXA 3IBPA 3PUSA 5FXZA 4KBMB 4NUVA 5LG3A 4CXYA 2VQFT 2HPLA 4C91A 4TWFA 4YTMA 3UULA 2XSAA 1SE7A 3K3OA 3M3ZB 3TLUA 3LBXA 4IDZA 4MFRA 2UUAT 3NWIA 4ZS2A 5F8PA 4LMJA 4P0BA 4IDQA 5AQIB 2A2FX 4HWIB 2I0MA 4FI5A 3N9PA 4HFVA 4UELA 5IHYA 3N9MA 4ZOLE 4I4TE 2IUBA 4U2YA 2CBIA 1OEDA 2MYSA 5JDGA 4DVDA 2YEVC 3EDVA 3ZJ2A 3I1AA 1KEYA 5J1GA 2M67A 2CHNA 2W61A 3ZC1A 2OLTA 3VHLA 3FXEB 2IC6A 4H63V 4NUUA 3RYFE 3VRBA 4YHJA 3CQGB 5AQJB 5GONE 2ZM0A 4GKJT 4HFBA 1VOMA 3VKHA 2UUCT 3BQIA 3CK6A 4DR4T 4DR7T 5LJMA 2K24A 3N9LA 1WR6A 3ZSSA 2UXCT 3UU8A 1HX8A 4WBNE 1W09A 1ZHCA 2NR4A 4LMLA 1IJ6A 2WP9A 2VQET 2CBJA 4P1NA 4AKGA 1BR2A 1ZEEA 4OFZA 1UURA 5AQUB 5HXSA 1G8XA 2LLYA 3NBXX 4U72A 2BG9E 4ISTA 2N2NA 3ESLA 2VK9A 4DNDA 4EAHA 5LHIB 1WRDA 3HR0A 3VR9A 2JQKA 2LSJA 3JAEA 4I0UA 4XBFB 3VRAA 4TZ4C 2WMOA 4ZZBA 3L39A 3AEGA 4G2AA 3RIAA 5ADXL 3AAIA 3CVRA 3UUBA 5BR8T 2XPKA 5FL0A 1O3XA 2JRKA 5ABFA 3RHWA 2W62A 3PUQA 1L0VA 5HCJA 1VRBA 5EZYE 3JC6D 3RIUC 4YTPA 4EGWA 4ZI2D 4HTEA 3ZMSB 2KWHA 5AQMB 1G73A 2E9XD 4QH4A 3D0TA
chains in the Genus database with same CATH topology
4H9NC 3E08A 3ZCIA 3CQXC 4DBQA 4OYKA 2LOPA 5JQGE 3MK7C 2RP4A 4BJNA 3V5SA 5DJQC 2CM0A 2XAGB 4G63A 3K3NA 4J2CA 3RYCE 4HGAA 4IIJE 3F2EA 1D0XA 4CXXA 4ANJA 1MNEA 2X9XA 4IGUA 5J2UE 2WWUA 3ZJ1A 2JMHA 2LHRA 4PJNA 2NW9A 2LOSA 3PE0A 2C5KT 3AAEB 2LJLA 3F31A 3PTRB 2ZMAA 4AQFA 3C4XA 4PK5A 1Z0PA 2V7IA 1UX5A 4KUMB 4ERRA 4ISSA 2CXFA 2LSIA 3SWHA 3ZYLA 2QGSA 3N5LA 2BZBA 1D1BA 2C0SA 5HXCA 4JEHB 3C98B 1MMDA 3ZMZB 4F6RC 4AXPA 4EZ4A 3GN5A 3WAJA 2D5UA 2BVLA 4MBQA 3IF8B 4H9RC 2W0GA 1BR0A 3O4XE 4E7SA 4AKHA 3C50A 3E0ZA 3OYXA 3C4ZA 3PUAA 2N1GA 5EK3A 4ASKA 1FIOA 2LHNA 2CXLA 2LSYA 4TV8E 5FXWA 4XAXB 3ANWA 5H6QB 3J9X1 2KWIB 3RH3A 5C8YE 4GOUA 3PURA 4WNKA 2H7OA 2CMRA 2X9WA 4DMVA 2Q9QD 3PU8A 1HG5A 5EK2A 3N2KE 3ZPOA 5JRCB 1YW0A 2X68A 5JDMA 1MIYA 4H9SE 2XHEB 3N9QA 4O4JE 3HKCE 2OA5A 4IHJE 3TKLB 1V9DA 2BVMA 2E9XA 1U5PA 1WLXA 2QA7A 3B57A 4EXTA 2BDEA 2D0TA 2PG8A 3HA4A 4H9PC 3LG7A 4KMCA 4QXBB 2V26A 1X79A 2V7KA 3GWHA 5CA0E 2WBLA 3ZMVB 3AVRA 4UV8B 4ADZA 3HKEE 2NTXA 4BAYB 4UVBB 3KBTA 3NRYA 4FJOA 1IJ5A 3O1IA 4CZZB 4EIWA 3ZCJA 4XZCA 3DJBA 1QSDA 3GN5B 2VB6A 3QUJA 4TX5A 4IE0A 3Q9DA 3AA0B 5F3JA 5HAXA 4X1YE 3R6NA 5CB4E 4GIWA 3NZQA 3VKGA 4QXHB 4PFOA 5KX5E 3ZN0B 4CI2B 3LK42 2PFVA 2DWGA 2MTQA 3GA8A 4WBOA 2EHOC 3KV6A 2EHOA 1D1AA 5KDMC 4EZHA 2CCQA 5L3GB 2KNDA 3KVAA 4I50E 4X1IE 4PJLA 3CX7B 3LK3B 1MMAA 4MALA 3WI3A 2CLYC 4CQIA 2KMFA 2MOZA 2WAUA 2ZM8A 1QUUA 2DHRA 3E22E 5LP6E 2VASA 4JEUB 3CX8B 1OWAA 1ZKEA 4A56A 5J2TE 4ZI7E 2KXPB 5LNKA 3N2GE 2PJQA 3OKQA 3M65A 3W15B 2KINB 4GYSA 4YJ3E 3AA1B 2CEAA 3B13A 4P09A 2K48A 3MKDA 3EUHA 1FEWA 3CKDA 2XAHB 2CE7A 3MA9A 3C64A 4KBMB 1ZV4X 4ZHQE 1CUNA 3I0OA 1WYBA 2C5JA 3UTKA 4AQGA 3HKBE 4L0RA 4U74A 3O9XA 3LK2B 2LSGA 4DO0A 2Q9QA 2W00A 3L3PA 4HN9A 2XASB 4OHFA 5L2LA 2UXXB 3UT5E 4AKLA 4O2BE 2DCFA 3UUXB 4YJ2E 4I55E 2I59A 4Z8XA 3N9OA 3BK9A 3DP7A 3PDYA 3LBXB 2P9BA 2V1DB 3ZMTB 2ODUA 5LCYA 4UVAB 4IE5A 4UXNB 4UF0A 2YU2A 1HCIA 2DWKA 5H6RB 3LJCA 3J7Yq 2YK0A 5JVDE 2X67A 3KDSE 3U78A 5A1LA 5HWYA 2ACXA 2PBIA 3O1HA 4UF0B 1EZ3A 5FXVA 1LKXA 2LT3A 2Z6EA 3RRCA 5BMVE 5HXEA 4PK4A 3UFEA 2VKJA 4C90A 3RC8A 2Y8DA 4MHCA 3T8OA 2VKOA 2Q9QC 1IZNB 2XUEA 5JH7E 2XAQB 3RKOA 5JREA 2CA5A 3IEEA 3RPUA 2HH7A 3AA6B 2LSKA 2RA1A 2UXNB 2V7MA 4PJMA 3KINB 3QK6A 5EZYE 4TV9E 3K8PC 3JC6C 3FB2A 2A72A 3HL6A 4ZI2C 5FY0A 2E9XC 3CWZB 1KK7A 3MZKB 2H7VC 4K0UA 4QX7B 3UUNA 4EOZB 4UIGA 3R84B 2X66A 3CX6B 5LXTE 2KLQA 2X9YA 2ZM2A 1LVKA 1KNZA 2XAFB 1LRZA 3OBVE 5LGNB 2NTYA 2KT9A 2N9DA 2CXDA 2ES0A 4WW0A 1HF8A 1YD8G 1UX4A 2JQQA 2SPCA 3Q5XA 1HG2A 2NOXA 2JMKA 3DTOA 5JDQA 5JDHA 2V7JA 3RC3A 4PAGA 4X20E 5JDFA 3RYHE 3OJAA 3U3IA 1BR1A 3EVYA 4L9IA 2W63A 3ANWB 5FMNA 4AI6A 1SHZC 5L3DB 3A5XA 4JUYA 5JR9A 3NZPA 3H3AA 2L8KA 3I0QA 4PJJA 4ZS3A 5JDLA 1US7B 2D2SA 4O4LE 5LOVE 4AKRB 5LJNA 2ZLYA 3ONXA 5L3BB 4PNIA 2WSSV 2GK9A 3C51A 4L5GA 4GYRA 4UV9B 5DQWA 4HEAA 4O4HE 4O8SA 4BA9A 3GMIA 5JRCA 2NWBA 1LVFA 1MMGA 1YKHB 2VWAA 5LGUB 4E7ZA 3FXDB 3ZEFB 4IE6A 1D1CA 5FP3A 3FBZA 2LM9A 2E8IA 3O1JA 5M4YA 3LFMA 3HI2A 4QKNA 4I43B 2MBGA 2G0UA 3K3QC 4TUYE 5HXRA 4ZI3C 1AJ3A 3Q2MA 5LYJE 3P7IA 5LG4A 1WYCA 5EK4A 3FBLA 1D0ZA 3KFWX 1MMNA 3VU7H 3V5UA 3AB3B 4QHOA 1FMVA 4EYYR 3RX6A 1D0YA 1FMWA 3OYZA 4OK0A 1HS7A 2IW5B 5FNVE 2IC9A 3ZYKA 3KV5A 2L3LA 5HYAA 2CWOA 5E0OA 2V7LA 5LA6E 4H9QC 4HE8A 5FY1A 2DLRA 4IE7A 4DBRA 3ZMUB 1S35A 4H63H 3KV9A 3ZYMA 2DNXA 2XQYA 4H9OC 4CI3B 3ETVA 2ODVA 2NW7A 1UCUA 1B7TA 4YLHA 1E1HB 2A3DA 3KVBA 4EYUA 2YINA 4O2AE 3BQLA 5HXHA 3SOLA 3Q5WA 4X1KE 2HPJA 2LE8A 4N78D 3F57A 5JR9B 3N2OA 1S94A 3SS1A 5LGTB 4QX8B 2D0UA 4OYJA 5IYZE 2X51A 2Y48B 2IAKA 4PK6A 5DABA 3ETUA 3ZLIA 2E9XB 3L09A 2NW8A 2Y6XA 4MLKA 3MXZA 5L3EB 5LBQB 4IE4A 2NP9A 2XTLA 4V1Av 2VL8A 3WAKA 3QC9A 5TAOA 4AKIA 1YKEB 2JPFA 3IHRA 2EHOD 3KBUA 3PU3A 4ILUA 5LHHB 3PUGA 1HFAA 4BJMA 4GK0E 4EB6E 4KP3C 1U4QA 2CLYB 2XAJB 4UEMA 2C5IT 2DI4A 3AA7B 3H37A 2VKDA 4PW8A 4M1PA 2EHOB 2LEHA 4GK5E 4JLEA 4YFSA 4O4IE 2JJ9A 3AVSA 5FY7A 1MIWA 3KV4A 3N9NA 3I9WA 3RRWA 1MIVA 2X0LB 5LHGB 4CXWA 5FXXA 2L9QA 3UUMA 2CWYA 5L3FB 2WM9A 2K9AA 4HKAA 5ETWA 4DMWA 3ZN1B 3MACA 5JDNA 3FHNA 3RYIE 4QXCB 3BQKA 4P0AA 2B1EA 1OXZA 1NWMX 3CQCB 3EDUA 5HWXA 4QWNB 4AQFC 3ZC0A 3MJXA 3S4UA 3AAAB 3P8CD 5LBMA 5JR9C 5CA1E 4ZI3D 1SA0E 5AFUL 2Q9QB 2J1DG 3I9YA 4PFPA 5DQVA 1IAPA 3SRZA 2X9HA 1NAFA 4B6XA 4CI1B 2H3RA 4TN7B 4UVCB 3CMLA 5L3CB 1T98A 2KZ7B 2YU1A 1H7CA 2WMNA 3HKDE 2K5BB 5KMGP 3C4WA 5FYMA 1MNDA 3CPZA 1BR4A 1Y64B 1HTJF 2VKHA 5FXZA 3NRXA 3IBPA 3PUSA 4CXYA 4NUVA 2HPLA 4C91A 3UULA 3K3OA 3LBXA 4IDZA 4MFRA 4ZS2A 5F8PA 4P0BA 2A2FX 5IHYA 4FI5A 3N9PA 4HFVA 4UELA 3N9MA 4ZOLE 4I4TE 2MYSA 5JDGA 4DVDA 2YEVC 3EDVA 3ZJ2A 3I1AA 5J1GA 2M67A 2W61A 3ZC1A 3VHLA 3FXEB 2IC6A 4H63V 4NUUA 3RYFE 4YHJA 3CQGB 5GONE 2ZM0A 1VOMA 3VKHA 3BQIA 5LJMA 2K24A 3N9LA 1WR6A 1HX8A 4WBNE 1ZHCA 1IJ6A 4AKGA 1BR2A 1ZEEA 4OFZA 5HXSA 1G8XA 3NBXX 4U72A 4DNDA 4ISTA 2N2NA 3ESLA 2VK9A 4EAHA 5LHIB 1WRDA 3HR0A 2LSJA 4XBFB 4TZ4C 2WMOA 4G2AA 5ADXL 3AAIA 3CVRA 1O3XA 2JRKA 2W62A 3PUQA 1VRBA 3JC6D 4ZI2D 4HTEA 3ZMSB 2KWHA 1G73A 2E9XD 3D0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJN A;  2D5U A;  2CM0 A;  2HPL A;  5LJM A;  2CCQ A;  4OYK A;  4P0A A;  4JUY A;  4P09 A;  4P0B A;  4OYJ A;  2HPJ A; 
#chains in the Genus database with same CATH topology
 4H9N C;  3E08 A;  4HFC A;  3CQX C;  4KX6 A;  4OYK A;  3G06 A;  3ZCI A;  2LOP A;  4DBQ A;  5JQG E;  3MK7 C;  1I94 T;  1FJG T;  2RP4 A;  4BJN A;  3V5S A;  5DJQ C;  3ZT5 A;  4ILC A;  2CM0 A;  2YDQ A;  4WZX A;  4EEB A;  4YSY A;  2J47 A;  2XAG B;  4G63 A;  2VVN A;  3EAM A;  3K3N A;  4J2C A;  4WYV A;  3RI5 A;  3RYC E;  3PUX F;  4JI4 T;  1N33 T;  4HGA A;  4IIJ E;  3F2E A;  1D0X A;  3TLS A;  2CRB A;  4CXX A;  4JI0 T;  4DV7 T;  4ANJ A;  1MNE A;  4DV1 T;  2X9X A;  4ZEY A;  4IGU A;  5J2U E;  4JI5 T;  2WWU A;  3ZJ1 A;  3AE7 A;  2JMH A;  2LHR A;  4PJN A;  5AQN B;  1R8I A;  2NW9 A;  2WDQ A;  2LOS A;  3PE0 A;  2C5K T;  3AAE B;  2LJL A;  3F31 A;  3PTR B;  1N36 T;  4YY3 T;  2ZMA A;  1JNR A;  2JQH A;  3QOF A;  2W4X A;  3AXJ B;  3C4X A;  3NVO A;  1Z0P A;  4PK5 A;  2V7I A;  4AQF A;  1UX5 A;  2FJD A;  4AIU A;  4KUM B;  4EV6 A;  5LMN T;  4ERR A;  2BKN A;  2CXF A;  2LSI A;  3P4R A;  4ISS A;  3SWH A;  3ZYL A;  2QGS A;  3N5L A;  2BZB A;  3AED A;  1D1B A;  2C0S A;  3AE1 A;  3PUZ F;  4U2Z A;  4JEH B;  5HXC A;  3C98 B;  3RF1 A;  1MMD A;  3ZMZ B;  4F6R C;  3PJA A;  4AXP A;  3SFE A;  4EZ4 A;  1UK5 A;  3GN5 A;  3WAJ A;  3RGL A;  2D5U A;  1Z8U A;  2CHO A;  2BVL A;  1KNP A;  4MBQ A;  3IF8 B;  4H9R C;  2W0G A;  1BR0 A;  3O4X E;  5IUX A;  3ZT7 A;  4E7S A;  4AKH A;  3C50 A;  3E0Z A;  4Q25 A;  5ABF B;  2LRK A;  3OYX A;  5ABH A;  4LFA T;  3C4Z A;  3RKG A;  3PUA A;  2N1G A;  3QB5 A;  5EK3 A;  3PUV F;  4ASK A;  1FIO A;  2LHN A;  2VL0 A;  5AQO B;  2CXL A;  3UU4 A;  2W2U A;  2LSY A;  5AQV B;  4TV8 E;  5HCM A;  2FJE A;  2YKS A;  4XAX B;  3ANW A;  2WZI A;  4IT4 A;  5FXW A;  5H6Q B;  2KWI B;  3J9X 1;  3RH3 A;  5C8Y E;  4GOU A;  1WCR A;  5AQR B;  3PUR A;  4WNK A;  2H7O A;  2CMR A;  2X9W A;  4DMV A;  2Q9Q D;  2BG9 A;  3AE4 A;  3PU8 A;  4HWD A;  4CN4 A;  1HG5 A;  3L8R A;  2JQ9 A;  5EK2 A;  3ZST A;  3N2K E;  3ZPO A;  2B76 A;  4AQY T;  5JRC B;  3PUY F;  4DR3 T;  5AQL B;  2LKG A;  2XJ7 A;  1YW0 A;  2X68 A;  5JDM A;  1MIY A;  4H9S E;  2XHE B;  3N9Q A;  3OPC A;  3HKC E;  2OA5 A;  4IHJ E;  4O4J E;  3UQ7 A;  4X65 T;  5L4E A;  3TKL B;  1V9D A;  4JI1 T;  2BVM A;  2E9X A;  1U5P A;  5JTG A;  1WLX A;  2QA7 A;  2W67 A;  3B57 A;  2BDE A;  4EXT A;  4X66 T;  2D0T A;  2PG8 A;  3HA4 A;  2FUP A;  3LG7 A;  4H9P C;  4KMC A;  2V26 A;  4QXB B;  4LFB T;  1X79 A;  2V7K A;  3FZM B;  3GWH A;  5CA0 E;  2WBL A;  3ZMV B;  3AVR A;  1XDP A;  4UV8 B;  4ADZ A;  3HKE E;  2NTX A;  4HFD A;  4BAY B;  2PTF A;  4UVB B;  3KBT A;  1XDO A;  3NRY A;  4FJO A;  4JV5 T;  1IJ5 A;  3O1I A;  4CZZ B;  4EIW A;  3ZCJ A;  2AE9 A;  3DJB A;  4XZC A;  1QSD A;  5IWA T;  1HS7 A;  3GN5 B;  2VB6 A;  3QUJ A;  4TX5 A;  4B3S T;  5AQH B;  4IE0 A;  3Q9D A;  2QRX A;  3AA0 B;  5F3J A;  1SUM B;  5HAX A;  1VCS A;  2M6B A;  3QB5 K;  4X1Y E;  3R6N A;  3RIU A;  5CB4 E;  5AQS B;  4GIW A;  3NZQ A;  3VKG A;  1ZP0 A;  4QXH B;  4PFO A;  2X0Y A;  1W9R A;  2AXD S;  3SFD A;  3EI0 A;  3ZN0 B;  5KX5 E;  5L47 A;  4NIQ A;  4CI2 B;  3LK4 2;  1NEK A;  2PFV A;  2YN6 A;  2DWG A;  2MTQ A;  3GA8 A;  4WBO A;  2EHO C;  2IML A;  2EHO A;  3KV6 A;  5F5W A;  1D1A A;  5KDM C;  4EZH A;  2CCQ A;  2HHH T;  5C3J A;  3CIR A;  4Z91 A;  1VCT A;  1W0B A;  2KND A;  3KVA A;  3NKZ A;  4I50 E;  4PJL A;  4X1I E;  5AQG B;  3CX7 B;  3LK3 B;  1MMA A;  4MAL A;  3WI3 A;  2CLY C;  3QNU A;  2V5D A;  4CQI A;  3AE9 A;  2MAW A;  2KMF A;  4NXN T;  2MOZ A;  2WAU A;  2BG9 B;  3P50 A;  2ZM8 A;  4ILA A;  1QUU A;  2DHR A;  2V6X A;  3E22 E;  3P4S A;  4IRE A;  2YOE A;  3UU3 A;  2WS3 A;  5CJ5 A;  5LP6 E;  2VAS A;  4JEU B;  3CX8 B;  1OWA A;  1ZKE A;  3LDQ B;  4QH1 A;  4A56 A;  5J2T E;  3Q5D A;  3RQW A;  4ZI7 E;  2KXP B;  2VVS A;  5LNK A;  3N2G E;  4HFI A;  4DR1 T;  2PJQ A;  3OKQ A;  3M65 A;  1M62 A;  2KIN B;  4GYS A;  3W15 B;  4YJ3 E;  3AA1 B;  2CEA A;  3B13 A;  4NPP A;  2K48 A;  3MKD A;  3CKD A;  1FEW A;  2YDR A;  2XAH B;  2CE7 A;  3EUH A;  3C64 A;  3MA9 A;  1ZV4 X;  4ZHQ E;  4JBW F;  1CUN A;  3I0O A;  1WYB A;  2C5J A;  4IDO A;  3UTK A;  3HKB E;  4L0R A;  4U74 A;  3AEF A;  4AQG A;  1NEN A;  3LK2 B;  5AQT B;  3O9X A;  1HNX T;  4JI7 T;  2XQ5 A;  1J5W A;  2LSG A;  3K1S A;  4HWH A;  2Q9Q A;  4UR9 A;  4DO0 A;  3LSV A;  2W00 A;  2V8S V;  3L3P A;  2J4G A;  2XAS B;  4HN9 A;  2UXX B;  4OHF A;  4X5T A;  3UT5 E;  4O2B E;  2DCF A;  3UUX B;  3ZT6 A;  1OED E;  4I55 E;  4AKL A;  2I59 A;  3ONL C;  2BKP A;  4YJ2 E;  5J0Z A;  4DUY T;  4ILB A;  3ONJ A;  3N9O A;  3BK9 A;  3DP7 A;  3PDY A;  2WU5 A;  4Z8X A;  5AQQ B;  3LBX B;  3RIF A;  2P9B A;  4JI3 T;  3PV0 F;  2H88 A;  2V1D B;  1N32 T;  3ZMT B;  1IBL T;  1WR0 A;  1Y01 A;  2ODU A;  4HWC A;  5LCY A;  4LF8 T;  3PUW F;  4IE5 A;  4UXN B;  4UF0 A;  2XQ4 A;  2YU2 A;  1HCI A;  2DWK A;  4UVA B;  3LJC A;  5H6R B;  3J7Y q;  2YK0 A;  4DV2 T;  5JVD E;  2X67 A;  3KDS E;  2UXB T;  3U78 A;  2I6H A;  1UGO A;  3EHZ A;  5ABG A;  5A1L A;  5HWY A;  2E5L T;  2ACX A;  2PBI A;  3O1H A;  4UF0 B;  1EZ3 A;  5FXV A;  3AE3 A;  1LKX A;  2LT3 A;  3X1D A;  2Z6E A;  4DV4 T;  3RRC A;  1GQE A;  5BMV E;  5HXE A;  4PK4 A;  3UFE A;  4LF6 T;  4YTN A;  2VKJ A;  4C90 A;  1ZOY A;  3RC8 A;  2Y8D A;  4TWD A;  4MHC A;  3T8O A;  2VKO A;  2Q9Q C;  4B3T T;  1IZN B;  2XUE A;  3JCF A;  1W0A A;  2XAQ B;  3RKO A;  2CA5 A;  3IEE A;  3RPU A;  5JH7 E;  5JRE A;  2UU9 T;  3ZEF B;  2HH7 A;  3JAF A;  2FJA A;  2LSK A;  2RA1 A;  2V6Y B;  1YQ4 A;  3AA6 B;  4F8H A;  2UXN B;  2V7M A;  4PJM A;  3KIN B;  3AXJ A;  3QK6 A;  3FZF B;  4P09 A;  3K8P C;  3JC6 C;  3FB2 A;  4TV9 E;  2UUB T;  2A72 A;  3HL6 A;  4ZI2 C;  3P4P A;  5FY0 A;  2E9X C;  3CWZ B;  1KK7 A;  3MZK B;  3P4Q A;  1E7P A;  2H7V C;  2V6Y A;  4K0U A;  4QX7 B;  2CPT A;  2JIW A;  2BS2 A;  3UUN A;  4EOZ B;  4UIG A;  1HNW T;  3R84 B;  2X66 A;  2WDR A;  3CX6 B;  5LXT E;  2KLQ A;  2V5C A;  2X9Y A;  5HEG A;  4X62 T;  2YDS A;  2ZM2 A;  1LVK A;  1KNZ A;  4K0K T;  2XAF B;  1LRZ A;  3OBV E;  5LGN B;  3AEA A;  2NTY A;  2KT9 A;  2M6I A;  3PJA J;  2N9D A;  2CXD A;  2DL1 A;  2ES0 A;  1HF8 A;  1YD8 G;  1UX4 A;  2JQQ A;  3H3M A;  4WW0 A;  2SPC A;  3A7M A;  3Q5X A;  5HEJ A;  2XSB A;  5HEO A;  1T7S A;  1HG2 A;  1QLB A;  2JMK A;  2NOX A;  3AE2 A;  3DTO A;  5HEH A;  5JDQ A;  5JDH A;  2V7J A;  2RPA A;  4DR6 T;  5FVL A;  3RC3 A;  4PAG A;  4X20 E;  5JDF A;  3RYH E;  1XWM A;  3OJA A;  3U3I A;  1BR1 A;  3EVY A;  4L9I A;  3VR8 A;  2W63 A;  3ANW B;  5FMN A;  2E5V A;  3AEE A;  4U7Y A;  1HNZ T;  4HFH A;  1SHZ C;  4X64 T;  4B3R T;  5L3D B;  3A5X A;  4JUY A;  5JR9 A;  3NZP A;  3H3A A;  2L8K A;  3I0Q A;  4PJJ A;  2W66 A;  4ZS3 A;  1US7 B;  5JDL A;  2D2S A;  4O4L E;  4TWH A;  5LOV E;  3RLF F;  4AKR B;  2ZLY A;  3ONX A;  5LJN A;  5L3B B;  1YXR A;  4EED A;  4PNI A;  4KHZ F;  2WSS V;  2GK9 A;  3C51 A;  4L5G A;  2XZE A;  4GYR A;  4U33 A;  4UV9 B;  5DQW A;  2ZM6 T;  4HEA A;  4O4H E;  4LF7 T;  4OX9 T;  4O8S A;  4BA9 A;  3GMI A;  5JRC A;  1UUS A;  2NWB A;  1LVF A;  1MMG A;  1YKH B;  2HN1 A;  4JI8 T;  2VWA A;  5LGU B;  4DV5 T;  4E7Z A;  3RQU A;  3FXD B;  5C2T A;  1KFY A;  3TLW A;  4IE6 A;  1D1C A;  5FP3 A;  3UU6 A;  1CHU A;  4DID B;  3FBZ A;  2LM9 A;  2E8I A;  3AE5 A;  3O1J A;  3LFM A;  3HI2 A;  4QKN A;  4I43 B;  5M4Y A;  2FJB A;  4YT0 A;  2FBW A;  2MBG A;  1T72 A;  2LRL A;  2G0U A;  1HR0 T;  2XQ3 A;  3K3Q C;  3P4W A;  4COF A;  4TUY E;  5HXR A;  2J62 A;  4ZI3 C;  4DV0 T;  1WFD A;  2BBJ A;  2LM2 A;  3P7I A;  3Q2M A;  5LYJ E;  5LG4 A;  1WYC A;  5EK4 A;  3FBL A;  4DR2 T;  1D0Z A;  3KFW X;  1MMN A;  5HEU A;  3VU7 H;  3V5U A;  3AB3 B;  4QHO A;  1FMV A;  4EYY R;  4KI0 F;  1D0Y A;  1FMW A;  2OV9 A;  3OYZ A;  4OK0 A;  3RX6 A;  1T8B A;  4A97 A;  4YHH T;  4LFC T;  2IW5 B;  5FNV E;  2IC9 A;  3ZYK A;  3KV5 A;  2L3L A;  3AE6 A;  5HYA A;  2CWO A;  5LMU T;  2WU2 A;  5E0O A;  2V7L A;  5LA6 E;  4H9Q C;  4HE8 A;  4DV6 T;  2XQ8 A;  1JNZ A;  5FY1 A;  2DLR A;  4IE7 A;  4DBR A;  2BBH A;  3ZMU B;  1S35 A;  4H63 H;  4YXD A;  3KV9 A;  1KF6 A;  3ZYM A;  4LF4 T;  2DNX A;  2XQY A;  1XZY A;  4H9O C;  2F4V T;  4CI3 B;  3ETV A;  2ODV A;  2NW7 A;  1B7T A;  1UCU A;  4YLH A;  4IL4 A;  1E1H B;  2A3D A;  3KVB A;  3ZKR A;  4EYU A;  2YIN A;  4O2A E;  5CFB A;  3BQL A;  5HXH A;  3T1Y T;  2XQA A;  3SOL A;  3Q5W A;  4X1K E;  3UFG A;  2HPJ A;  2KSR A;  2LE8 A;  3FZL B;  4N78 D;  3F57 A;  5JR9 B;  3N2O A;  1S94 A;  5AQK B;  3SS1 A;  4YSZ A;  2IIU A;  5LGT B;  1AJ3 A;  2QYW A;  4QX8 B;  2D0U A;  1XNQ T;  2VUR A;  3TLT A;  4OYJ A;  4U3C A;  5IYZ E;  2X51 A;  2Y48 B;  5L2L A;  2IAK A;  3AEC A;  4PK6 A;  5DAB A;  2HN2 A;  2WY2 A;  3ETU A;  3ZLI A;  5KXJ A;  2E9X B;  3L09 A;  2NW8 A;  2Y6X A;  4MLK A;  4DUZ T;  4YSX A;  3MXZ A;  5L3E B;  1I6Z A;  2WCA A;  3JAD A;  1YQ3 A;  2H89 A;  5LBQ B;  4IE4 A;  2WB5 A;  5L4H A;  4A98 A;  2R6G F;  4HFE A;  2NP9 A;  4AIS A;  2XTL A;  4V1A v;  2VL8 A;  3WAK A;  2MPK A;  2IHR 1;  1M7K A;  3AEB A;  3QC9 A;  4AI6 A;  2WZH A;  1X9B A;  5TAO A;  3A8Y C;  4LMK A;  4AKI A;  4ZXL A;  1YKE B;  2JPF A;  2BS4 A;  3IHR A;  4DR5 T;  2EHO D;  3KBU A;  5LB7 B;  3PU3 A;  4ILU A;  2IDO B;  1IBM T;  4U31 A;  5LHH B;  3PUG A;  4LF5 T;  2BG9 C;  4HWF A;  1KNR A;  1HFA A;  4BJM A;  4GK0 E;  4A5X A;  4EB6 E;  4KP3 C;  1U4Q A;  2CLY B;  4CN6 A;  3Q5E A;  2XAJ B;  3ABV A;  4UEM A;  1XNR T;  2C5I T;  2DI4 A;  3AA7 B;  3H37 A;  1HX1 B;  2VKD A;  4PW8 A;  4M1P A;  2LKH A;  2EHO B;  1N34 T;  2LEH A;  2D9D A;  3OTO T;  3FZK B;  3B5M A;  4GK5 E;  4JYA T;  4JLE A;  2WWV A;  4YFS A;  4LF9 T;  4O4I E;  2JJ9 A;  2K3W A;  3AVS A;  5FY7 A;  3UQ4 A;  2XY8 B;  1MIW A;  5AQP B;  3KV4 A;  4IL9 A;  3N9N A;  3I9W A;  3OVU A;  3TLV A;  5FL1 A;  3RRW A;  1MIV A;  2X0H A;  4GKK T;  1J1J A;  2X0L B;  5LHG B;  2A9U A;  2BKO A;  1OED B;  4CXW A;  4DV3 T;  2BS3 A;  5FXX A;  5L3G B;  5ABE A;  2L9Q A;  3FZH B;  1E2A A;  3UUM A;  4QH5 A;  2WDV A;  2CWY A;  5L3F B;  2XM1 A;  2WM9 A;  2K9A A;  1OED C;  4HKA A;  2XQ9 A;  4JI6 T;  5FVK A;  1J5E T;  2XQ7 A;  5ETW A;  4DMW A;  3ZN1 B;  2ACZ A;  3MAC A;  4ZZC A;  3FHN A;  3RYI E;  5JDN A;  2UXD T;  4QXC B;  3BQK A;  4Z90 A;  4P0A A;  2B1E A;  3UU5 A;  1XMQ T;  1OXZ A;  1NWM X;  3CQC B;  3EDU A;  5HWX A;  1DU2 A;  4QWN B;  4AQF C;  3ZC0 A;  3MJX A;  4CN1 A;  3S4U A;  2QVA A;  3AAA B;  4U7I A;  4JI2 T;  2WQY A;  3P8C D;  3T1H T;  2XQ6 A;  5CGM A;  5LBM A;  4B3M T;  5JR9 C;  5CA1 E;  4ZI3 D;  1SA0 E;  3AE8 A;  5FKY A;  2Q9Q B;  5AFU L;  2J1D G;  3I9Y A;  4PFP A;  5DQV A;  1IAP A;  3SRZ A;  2X9H A;  1NAF A;  4B6X A;  3EAB A;  4CI1 B;  4IDN A;  2H3R A;  4TN7 B;  4UVC B;  3CML A;  5L3C B;  1XMO T;  1T98 A;  4TNW A;  5AQF B;  2KZ7 B;  4TNV A;  1IBK T;  4KHP T;  2YU1 A;  1H7C A;  4IDP A;  2WMN A;  3HKD E;  2K5B B;  5KMG P;  3C4W A;  5FYM A;  1MND A;  3CPZ A;  2E2A A;  3IA3 A;  1BR4 A;  4NXM T;  1Y64 B;  1HTJ F;  2VKH A;  2XM2 A;  3NRX A;  3IBP A;  3PUS A;  5FXZ A;  4KBM B;  4NUV A;  5LG3 A;  4CXY A;  2VQF T;  2HPL A;  4C91 A;  4TWF A;  4YTM A;  3UUL A;  2XSA A;  1SE7 A;  3K3O A;  3M3Z B;  3TLU A;  3LBX A;  4IDZ A;  4MFR A;  2UUA T;  3NWI A;  4ZS2 A;  5F8P A;  4LMJ A;  4P0B A;  4IDQ A;  5AQI B;  2A2F X;  4HWI B;  2I0M A;  4FI5 A;  3N9P A;  4HFV A;  4UEL A;  5IHY A;  3N9M A;  4ZOL E;  4I4T E;  2IUB A;  4U2Y A;  2CBI A;  1OED A;  2MYS A;  5JDG A;  4DVD A;  2YEV C;  3EDV A;  3ZJ2 A;  3I1A A;  1KEY A;  5J1G A;  2M67 A;  2CHN A;  2W61 A;  3ZC1 A;  2OLT A;  3VHL A;  3FXE B;  2IC6 A;  4H63 V;  4NUU A;  3RYF E;  3VRB A;  4YHJ A;  3CQG B;  5AQJ B;  5GON E;  2ZM0 A;  4GKJ T;  4HFB A;  1VOM A;  3VKH A;  2UUC T;  3BQI A;  3CK6 A;  4DR4 T;  4DR7 T;  5LJM A;  2K24 A;  3N9L A;  1WR6 A;  3ZSS A;  2UXC T;  3UU8 A;  1HX8 A;  4WBN E;  1W09 A;  1ZHC A;  2NR4 A;  4LML A;  1IJ6 A;  2WP9 A;  2VQE T;  2CBJ A;  4P1N A;  4AKG A;  1BR2 A;  1ZEE A;  4OFZ A;  1UUR A;  5AQU B;  5HXS A;  1G8X A;  2LLY A;  3NBX X;  4U72 A;  2BG9 E;  4IST A;  2N2N A;  3ESL A;  2VK9 A;  4DND A;  4EAH A;  5LHI B;  1WRD A;  3HR0 A;  3VR9 A;  2JQK A;  2LSJ A;  3JAE A;  4I0U A;  4XBF B;  3VRA A;  4TZ4 C;  2WMO A;  4ZZB A;  3L39 A;  3AEG A;  4G2A A;  3RIA A;  5ADX L;  3AAI A;  3CVR A;  3UUB A;  5BR8 T;  2XPK A;  5FL0 A;  1O3X A;  2JRK A;  5ABF A;  3RHW A;  2W62 A;  3PUQ A;  1L0V A;  5HCJ A;  1VRB A;  5EZY E;  3JC6 D;  3RIU C;  4YTP A;  4EGW A;  4ZI2 D;  4HTE A;  3ZMS B;  2KWH A;  5AQM B;  1G73 A;  2E9X D;  4QH4 A;  3D0T A; 
#chains in the Genus database with same CATH homology
 4H9N C;  3E08 A;  3ZCI A;  3CQX C;  4DBQ A;  4OYK A;  2LOP A;  5JQG E;  3MK7 C;  2RP4 A;  4BJN A;  3V5S A;  5DJQ C;  2CM0 A;  2XAG B;  4G63 A;  3K3N A;  4J2C A;  3RYC E;  4HGA A;  4IIJ E;  3F2E A;  1D0X A;  4CXX A;  4ANJ A;  1MNE A;  2X9X A;  4IGU A;  5J2U E;  2WWU A;  3ZJ1 A;  2JMH A;  2LHR A;  4PJN A;  2NW9 A;  2LOS A;  3PE0 A;  2C5K T;  3AAE B;  2LJL A;  3F31 A;  3PTR B;  2ZMA A;  4AQF A;  3C4X A;  4PK5 A;  1Z0P A;  2V7I A;  1UX5 A;  4KUM B;  4ERR A;  4ISS A;  2CXF A;  2LSI A;  3SWH A;  3ZYL A;  2QGS A;  3N5L A;  2BZB A;  1D1B A;  2C0S A;  5HXC A;  4JEH B;  3C98 B;  1MMD A;  3ZMZ B;  4F6R C;  4AXP A;  4EZ4 A;  3GN5 A;  3WAJ A;  2D5U A;  2BVL A;  4MBQ A;  3IF8 B;  4H9R C;  2W0G A;  1BR0 A;  3O4X E;  4E7S A;  4AKH A;  3C50 A;  3E0Z A;  3OYX A;  3C4Z A;  3PUA A;  2N1G A;  5EK3 A;  4ASK A;  1FIO A;  2LHN A;  2CXL A;  2LSY A;  4TV8 E;  5FXW A;  4XAX B;  3ANW A;  5H6Q B;  3J9X 1;  2KWI B;  3RH3 A;  5C8Y E;  4GOU A;  3PUR A;  4WNK A;  2H7O A;  2CMR A;  2X9W A;  4DMV A;  2Q9Q D;  3PU8 A;  1HG5 A;  5EK2 A;  3N2K E;  3ZPO A;  5JRC B;  1YW0 A;  2X68 A;  5JDM A;  1MIY A;  4H9S E;  2XHE B;  3N9Q A;  4O4J E;  3HKC E;  2OA5 A;  4IHJ E;  3TKL B;  1V9D A;  2BVM A;  2E9X A;  1U5P A;  1WLX A;  2QA7 A;  3B57 A;  4EXT A;  2BDE A;  2D0T A;  2PG8 A;  3HA4 A;  4H9P C;  3LG7 A;  4KMC A;  4QXB B;  2V26 A;  1X79 A;  2V7K A;  3GWH A;  5CA0 E;  2WBL A;  3ZMV B;  3AVR A;  4UV8 B;  4ADZ A;  3HKE E;  2NTX A;  4BAY B;  4UVB B;  3KBT A;  3NRY A;  4FJO A;  1IJ5 A;  3O1I A;  4CZZ B;  4EIW A;  3ZCJ A;  4XZC A;  3DJB A;  1QSD A;  3GN5 B;  2VB6 A;  3QUJ A;  4TX5 A;  4IE0 A;  3Q9D A;  3AA0 B;  5F3J A;  5HAX A;  4X1Y E;  3R6N A;  5CB4 E;  4GIW A;  3NZQ A;  3VKG A;  4QXH B;  4PFO A;  5KX5 E;  3ZN0 B;  4CI2 B;  3LK4 2;  2PFV A;  2DWG A;  2MTQ A;  3GA8 A;  4WBO A;  2EHO C;  3KV6 A;  2EHO A;  1D1A A;  5KDM C;  4EZH A;  2CCQ A;  5L3G B;  2KND A;  3KVA A;  4I50 E;  4X1I E;  4PJL A;  3CX7 B;  3LK3 B;  1MMA A;  4MAL A;  3WI3 A;  2CLY C;  4CQI A;  2KMF A;  2MOZ A;  2WAU A;  2ZM8 A;  1QUU A;  2DHR A;  3E22 E;  5LP6 E;  2VAS A;  4JEU B;  3CX8 B;  1OWA A;  1ZKE A;  4A56 A;  5J2T E;  4ZI7 E;  2KXP B;  5LNK A;  3N2G E;  2PJQ A;  3OKQ A;  3M65 A;  3W15 B;  2KIN B;  4GYS A;  4YJ3 E;  3AA1 B;  2CEA A;  3B13 A;  4P09 A;  2K48 A;  3MKD A;  3EUH A;  1FEW A;  3CKD A;  2XAH B;  2CE7 A;  3MA9 A;  3C64 A;  4KBM B;  1ZV4 X;  4ZHQ E;  1CUN A;  3I0O A;  1WYB A;  2C5J A;  3UTK A;  4AQG A;  3HKB E;  4L0R A;  4U74 A;  3O9X A;  3LK2 B;  2LSG A;  4DO0 A;  2Q9Q A;  2W00 A;  3L3P A;  4HN9 A;  2XAS B;  4OHF A;  5L2L A;  2UXX B;  3UT5 E;  4AKL A;  4O2B E;  2DCF A;  3UUX B;  4YJ2 E;  4I55 E;  2I59 A;  4Z8X A;  3N9O A;  3BK9 A;  3DP7 A;  3PDY A;  3LBX B;  2P9B A;  2V1D B;  3ZMT B;  2ODU A;  5LCY A;  4UVA B;  4IE5 A;  4UXN B;  4UF0 A;  2YU2 A;  1HCI A;  2DWK A;  5H6R B;  3LJC A;  3J7Y q;  2YK0 A;  5JVD E;  2X67 A;  3KDS E;  3U78 A;  5A1L A;  5HWY A;  2ACX A;  2PBI A;  3O1H A;  4UF0 B;  1EZ3 A;  5FXV A;  1LKX A;  2LT3 A;  2Z6E A;  3RRC A;  5BMV E;  5HXE A;  4PK4 A;  3UFE A;  2VKJ A;  4C90 A;  3RC8 A;  2Y8D A;  4MHC A;  3T8O A;  2VKO A;  2Q9Q C;  1IZN B;  2XUE A;  5JH7 E;  2XAQ B;  3RKO A;  5JRE A;  2CA5 A;  3IEE A;  3RPU A;  2HH7 A;  3AA6 B;  2LSK A;  2RA1 A;  2UXN B;  2V7M A;  4PJM A;  3KIN B;  3QK6 A;  5EZY E;  4TV9 E;  3K8P C;  3JC6 C;  3FB2 A;  2A72 A;  3HL6 A;  4ZI2 C;  5FY0 A;  2E9X C;  3CWZ B;  1KK7 A;  3MZK B;  2H7V C;  4K0U A;  4QX7 B;  3UUN A;  4EOZ B;  4UIG A;  3R84 B;  2X66 A;  3CX6 B;  5LXT E;  2KLQ A;  2X9Y A;  2ZM2 A;  1LVK A;  1KNZ A;  2XAF B;  1LRZ A;  3OBV E;  5LGN B;  2NTY A;  2KT9 A;  2N9D A;  2CXD A;  2ES0 A;  4WW0 A;  1HF8 A;  1YD8 G;  1UX4 A;  2JQQ A;  2SPC A;  3Q5X A;  1HG2 A;  2NOX A;  2JMK A;  3DTO A;  5JDQ A;  5JDH A;  2V7J A;  3RC3 A;  4PAG A;  4X20 E;  5JDF A;  3RYH E;  3OJA A;  3U3I A;  1BR1 A;  3EVY A;  4L9I A;  2W63 A;  3ANW B;  5FMN A;  4AI6 A;  1SHZ C;  5L3D B;  3A5X A;  4JUY A;  5JR9 A;  3NZP A;  3H3A A;  2L8K A;  3I0Q A;  4PJJ A;  4ZS3 A;  5JDL A;  1US7 B;  2D2S A;  4O4L E;  5LOV E;  4AKR B;  5LJN A;  2ZLY A;  3ONX A;  5L3B B;  4PNI A;  2WSS V;  2GK9 A;  3C51 A;  4L5G A;  4GYR A;  4UV9 B;  5DQW A;  4HEA A;  4O4H E;  4O8S A;  4BA9 A;  3GMI A;  5JRC A;  2NWB A;  1LVF A;  1MMG A;  1YKH B;  2VWA A;  5LGU B;  4E7Z A;  3FXD B;  3ZEF B;  4IE6 A;  1D1C A;  5FP3 A;  3FBZ A;  2LM9 A;  2E8I A;  3O1J A;  5M4Y A;  3LFM A;  3HI2 A;  4QKN A;  4I43 B;  2MBG A;  2G0U A;  3K3Q C;  4TUY E;  5HXR A;  4ZI3 C;  1AJ3 A;  3Q2M A;  5LYJ E;  3P7I A;  5LG4 A;  1WYC A;  5EK4 A;  3FBL A;  1D0Z A;  3KFW X;  1MMN A;  3VU7 H;  3V5U A;  3AB3 B;  4QHO A;  1FMV A;  4EYY R;  3RX6 A;  1D0Y A;  1FMW A;  3OYZ A;  4OK0 A;  1HS7 A;  2IW5 B;  5FNV E;  2IC9 A;  3ZYK A;  3KV5 A;  2L3L A;  5HYA A;  2CWO A;  5E0O A;  2V7L A;  5LA6 E;  4H9Q C;  4HE8 A;  5FY1 A;  2DLR A;  4IE7 A;  4DBR A;  3ZMU B;  1S35 A;  4H63 H;  3KV9 A;  3ZYM A;  2DNX A;  2XQY A;  4H9O C;  4CI3 B;  3ETV A;  2ODV A;  2NW7 A;  1UCU A;  1B7T A;  4YLH A;  1E1H B;  2A3D A;  3KVB A;  4EYU A;  2YIN A;  4O2A E;  3BQL A;  5HXH A;  3SOL A;  3Q5W A;  4X1K E;  2HPJ A;  2LE8 A;  4N78 D;  3F57 A;  5JR9 B;  3N2O A;  1S94 A;  3SS1 A;  5LGT B;  4QX8 B;  2D0U A;  4OYJ A;  5IYZ E;  2X51 A;  2Y48 B;  2IAK A;  4PK6 A;  5DAB A;  3ETU A;  3ZLI A;  2E9X B;  3L09 A;  2NW8 A;  2Y6X A;  4MLK A;  3MXZ A;  5L3E B;  5LBQ B;  4IE4 A;  2NP9 A;  2XTL A;  4V1A v;  2VL8 A;  3WAK A;  3QC9 A;  5TAO A;  4AKI A;  1YKE B;  2JPF A;  3IHR A;  2EHO D;  3KBU A;  3PU3 A;  4ILU A;  5LHH B;  3PUG A;  1HFA A;  4BJM A;  4GK0 E;  4EB6 E;  4KP3 C;  1U4Q A;  2CLY B;  2XAJ B;  4UEM A;  2C5I T;  2DI4 A;  3AA7 B;  3H37 A;  2VKD A;  4PW8 A;  4M1P A;  2EHO B;  2LEH A;  4GK5 E;  4JLE A;  4YFS A;  4O4I E;  2JJ9 A;  3AVS A;  5FY7 A;  1MIW A;  3KV4 A;  3N9N A;  3I9W A;  3RRW A;  1MIV A;  2X0L B;  5LHG B;  4CXW A;  5FXX A;  2L9Q A;  3UUM A;  2CWY A;  5L3F B;  2WM9 A;  2K9A A;  4HKA A;  5ETW A;  4DMW A;  3ZN1 B;  3MAC A;  5JDN A;  3FHN A;  3RYI E;  4QXC B;  3BQK A;  4P0A A;  2B1E A;  1OXZ A;  1NWM X;  3CQC B;  3EDU A;  5HWX A;  4QWN B;  4AQF C;  3ZC0 A;  3MJX A;  3S4U A;  3AAA B;  3P8C D;  5LBM A;  5JR9 C;  5CA1 E;  4ZI3 D;  1SA0 E;  5AFU L;  2Q9Q B;  2J1D G;  3I9Y A;  4PFP A;  5DQV A;  1IAP A;  3SRZ A;  2X9H A;  1NAF A;  4B6X A;  4CI1 B;  2H3R A;  4TN7 B;  4UVC B;  3CML A;  5L3C B;  1T98 A;  2KZ7 B;  2YU1 A;  1H7C A;  2WMN A;  3HKD E;  2K5B B;  5KMG P;  3C4W A;  5FYM A;  1MND A;  3CPZ A;  1BR4 A;  1Y64 B;  1HTJ F;  2VKH A;  5FXZ A;  3NRX A;  3IBP A;  3PUS A;  4CXY A;  4NUV A;  2HPL A;  4C91 A;  3UUL A;  3K3O A;  3LBX A;  4IDZ A;  4MFR A;  4ZS2 A;  5F8P A;  4P0B A;  2A2F X;  5IHY A;  4FI5 A;  3N9P A;  4HFV A;  4UEL A;  3N9M A;  4ZOL E;  4I4T E;  2MYS A;  5JDG A;  4DVD A;  2YEV C;  3EDV A;  3ZJ2 A;  3I1A A;  5J1G A;  2M67 A;  2W61 A;  3ZC1 A;  3VHL A;  3FXE B;  2IC6 A;  4H63 V;  4NUU A;  3RYF E;  4YHJ A;  3CQG B;  5GON E;  2ZM0 A;  1VOM A;  3VKH A;  3BQI A;  5LJM A;  2K24 A;  3N9L A;  1WR6 A;  1HX8 A;  4WBN E;  1ZHC A;  1IJ6 A;  4AKG A;  1BR2 A;  1ZEE A;  4OFZ A;  5HXS A;  1G8X A;  3NBX X;  4U72 A;  4DND A;  4IST A;  2N2N A;  3ESL A;  2VK9 A;  4EAH A;  5LHI B;  1WRD A;  3HR0 A;  2LSJ A;  4XBF B;  4TZ4 C;  2WMO A;  4G2A A;  5ADX L;  3AAI A;  3CVR A;  1O3X A;  2JRK A;  2W62 A;  3PUQ A;  1VRB A;  3JC6 D;  4ZI2 D;  4HTE A;  3ZMS B;  2KWH A;  1G73 A;  2E9X D;  3D0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...