4OYJA

Structure of the apo hoip pub domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 60
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oyjA00
2CCQA 5LJNA 4JUYA 4P0BA 2CM0A 2D5UA 4OYJA 4P0AA 4OYKA 2HPLA 4P09A 2HPJA 5LJMA
chains in the Genus database with same CATH superfamily
4DV7T 1W0AA 3RF1A 2WB5A 3B57A 5ABFB 4KX6A 2QVAA 5L3DB 3JAEA 3UTKA 3PJAJ 4ADZA 4DR6T 2J4GA 3P7IA 3RHWA 5ETWA 5KMGP 2V8SV 1I6ZA 4LMKA 3I1AA 4ZHQE 3EDUA 1LKXA 3CQCB 2D0UA 4HE8A 3RKOA 2W00A 4QXBB 5IWAT 5AQSB 3ANWB 2M67A 5LGNB 2E9XB 2X9XA 2CXDA 3UULA 5JDLA 3VHLA 3FXEB 4CQIA 4HFHA 3QB5K 4YY3T 4AISA 3OBVE 2K48A 3FB2A 2WP9A 2L9QA 4KBMB 2XZEA 3O9XA 3DP7A 3FZMB 2WZHA 5ABGA 5L3EB 1S35A 4TWHA 2LEHA 4YSZA 3AXJA 4HEAA 4IGUA 1FMVA 5L3GB 4N78D 4ZZBA 2DWKA 3UQ4A 2LRLA 2D0TA 4NUUA 1BR2A 3EDVA 4JI3T 1HTJF 1ZOYA 4H9QC 2YDSA 4I43B 5FYMA 1YXRA 4YTMA 3NRYA 3RGLA 3ZMSB 4X62T 5FY0A 4CZZB 4JI0T 3SRZA 3C64A 3KBUA 3RPUA 3NVOA 3RLFF 5LOVE 1OWAA 3LSVA 1XWMA 5ABFA 5FY7A 5FXZA 4X1IE 1CHUA 3N9NA 4DNDA 2BZBA 2HPLA 5LBQB 2WMOA 1FIOA 4DV1T 4YT0A 4K0UA 4OYKA 2D2SA 4UEMA 2H88A 2VVNA 4JI4T 2WS3A 2HN1A 2XQ4A 2LSIA 4JEHB 1US7B 5H6QB 2VB6A 3SOLA 5HEOA 4LFCT 2B76A 2V26A 4CXWA 3LBXB 4ZI3D 3QC9A 2ZMAA 3AE4A 3EI0A 5HEGA 3ANWA 1Z8UA 2E9XA 4IL9A 4IE0A 3BQKA 4DR2T 4HFIA 1CUNA 5AQTB 2WWUA 1X79A 2LOSA 4P0BA 4TWFA 2XAFB 3HKEE 2FJEA 1OXZA 2WU5A 3ZN1B 2K5BB 3I9WA 5JRCB 1J1JA 5CB4E 4P0AA 2UXDT 2E5LT 5L3BB 3JADA 2LT3A 4TNVA 1N33T 3CPZA 2W67A 1VCTA 3MACA 2HHHT 3HKCE 4U7IA 1MNEA 1SHZC 2UXCT 2WQYA 4A5XA 2VQET 2EHOD 2OLTA 2D9DA 3HI2A 2E2AA 3JC6C 3J7Yq 3M65A 2OV9A 2W66A 4IDPA 1WR0A 2EHOC 3VKGA 1HNWT 1AJ3A 3ZT7A 3HR0A 3UUXB 3P4PA 5LHHB 2CCQA 3Q5WA 4Z8XA 1WYCA 4K0KT 3VKHA 5JDMA 4O4IE 2CBIA 2V7KA 4A56A 3F2EA 4HFEA 3ZC1A 2WDVA 4TV9E 2W2UA 3T1HT 1D0ZA 4GIWA 4AKGA 2XAQB 2JIWA 3ETUA 4CXXA 4MALA 4NXNT 3BQLA 3WAJA 5L4HA 2VASA 2CWYA 2X0LB 2LOPA 4H63V 3T1YT 1YQ3A 1NAFA 4LFBT 5JDQA 3KV5A 3TLSA 5LA6E 1WR6A 3K8PC 1KK7A 3ZMUB 3LDQB 4GKKT 2NTYA 3AEFA 3TLUA 5A1LA 2KXPB 4AQYT 5JREA 2CXLA 5JRCA 3AEGA 1HFAA 3PTRB 4NPPA 4LF9T 2AE9A 4QXHB 2LHNA 2L8KA 5FP3A 1KNRA 2BKOA 1WCRA 3DTOA 3Q2MA 3CMLA 4ILUA 2MTQA 2IC6A 3Q5DA 2XSBA 1D1CA 3I9YA 3IA3A 4H9OC 4ZI7E 2Y48B 4EZ4A 1IBMT 3CK6A 5JDFA 3ZSTA 4EV6A 3Q5XA 4XAXB 3F31A 2IC9A 2YINA 4OYJA 2JPFA 3RH3A 3CVRA 2JJ9A 5HCMA 2C0SA 5AQGB 2H7OA 4DIDB 2FJBA 5JDNA 4QX7B 4U72A 3JAFA 4U2YA 5H6RB 3J9X1 2C5JA 3NBXX 1YW0A 4L0RA 2M6BA 4KMCA 2ZM8A 1E2AA 2FJDA 1XMQT 1J5ET 3NWIA 4CI2B 3RQUA 5LNKA 2J47A 1UK5A 3QK6A 5CA0E 3K3NA 3N5LA 2KMFA 4QX8B 5IUXA 2Y8DA 2ZM2A 5AQKB 2VWAA 2VQFT 4AIUA 3ZLIA 2K3WA 2XTLA 2XQAA 2E9XC 4X65T 3ZYLA 1HF8A 2NR4A 3ZJ1A 3OKQA 3UQ7A 3KVAA 3KV4A 3MA9A 3AECA 4DVDA 4COFA 4AKIA 2X9WA 2XY8B 3AB3B 5LCYA 2J62A 4HWHA 2ODUA 2CPTA 4U7YA 5BR8T 4YSXA 3X1DA 3ONLC 3C50A 3EVYA 1MMGA 2LE8A 2X0YA 4P1NA 3CX7B 2UUBT 1XZYA 2LSJA 3A8YC 3GMIA 2JMKA 4EYYR 3N9LA 3PDYA 1MMDA 5FVLA 2H89A 2XHEB 3UFEA 3PV0F 1QSDA 4GK0E 5AQJB 4GYSA 1WFDA 1IBKT 2W62A 4NXMT 5LJMA 2EHOA 3FZLB 2VL0A 4DMVA 4LMLA 2ZM0A 2XAHB 4KUMB 4IE7A 3C98B 4Z91A 5CGMA 1IZNB 1XNQT 3TLVA 5AQQB 4LF4T 4HWIB 2CHOA 3SWHA 3RYHE 2UU9T 2BS4A 1UURA 4EEBA 3T8OA 3QB5A 1DU2A 2NP9A 3RX6A 2BVLA 2W61A 3F57A 4UR9A 4YSYA 2FJAA 2JRKA 1MNDA 2IAKA 4PK6A 3WI3A 4JV5T 1IBLT 3AEDA 1D0YA 2ACZA 3FZFB 3HKDE 3ZMZB 1SE7A 5LHGB 5LXTE 5HEHA 3LK42 2YN6A 1YD8G 3TLWA 4O2AE 2YEVC 3IHRA 4WZXA 4BA9A 1KNPA 4AQGA 2BBJA 4IDOA 2MPKA 4DV5T 3PUGA 4WYVA 2NW9A 5LYJE 2LKGA 2N2NA 4DV0T 3LFMA 5IHYA 2QRXA 2I59A 4EGWA 2IW5B 1S94A 3PUWF 4ERRA 3ONJA 5FKYA 3C4ZA 4JI2T 3L09A 2JMHA 5AQPB 5HXCA 1BR4A 4NUVA 5DABA 3AVRA 4G2AA 2CEAA 2PJQA 3ZPOA 1IJ5A 3ETVA 4X1YE 1U4QA 2PG8A 2W63A 4DMWA 3D0TA 4KHZF 2M6IA 2VURA 3RC3A 4HFVA 4HWFA 4L5GA 5L47A 4E7ZA 4AKRB 3KV6A 3UT5E 2YDRA 4IIJE 3AEBA 4C91A 2V5CA 4H63H 1MMAA 2CA5A 1LVFA 3FZKB 2LM2A 2RA1A 4OFZA 4QWNB 4PJJA 2K9AA 3PUAA 4JUYA 2YU1A 3P4SA 1HG5A 3A7MA 1MIVA 3VR8A 4I55E 2L3LA 3UU6A 4CN6A 5AQMB 3O1HA 3ZC0A 2BVMA 5LMNT 3AE9A 3NZPA 2VKDA 2G0UA 4YLHA 4JI7T 1NWMX 4AKHA 4IE6A 3C4XA 4LMJA 3N9MA 2WBLA 4LF5T 1HX8A 2XQYA 4ZI3C 1W0BA 1U5PA 1WLXA 4U74A 4ASKA 2XJ7A 2VKJA 5FY1A 1HNZT 2Q9QD 3AE7A 4JI5T 3RI5A 4IREA 3DJBA 3GWHA 4X5TA 5AQOB 4ZXLA 2V6YB 4I0UA 1UUSA 3V5UA 4MBQA 2UUCT 1ZKEA 4YFSA 4EB6E 2BG9B 4UF0B 3HL6A 2I6HA 4DUZT 2D5UA 5TAOA 2X66A 2C5IT 5DQVA 3RRCA 2A2FX 4QH4A 5LG3A 3MZKB 5DQWA 5AQLB 1X9BA 2XQ3A 3TKLB 2XQ7A 4G63A 4ZS2A 4ZI2D 2BKPA 2DCFA 5C2TA 2LLYA 3ZYKA 3OYXA 5ABEA 1N32T 2KWIB 2F4VT 4KHPT 3IF8B 2KZ7B 4DBRA 4TN7B 3AE5A 3AE8A 4EEDA 2VKOA 2MOZA 1T98A 3ESLA 1HNXT 4OX9T 4DV6T 5FL0A 2XM1A 2WDRA 5FMNA 2Z6EA 4TNWA 2WMNA 4UV9B 3SFDA 2XAJB 1HS7A 2HN2A 3LBXA 5CA1E 2X0HA 5HAXA 4YTNA 2CXFA 4HFCA 2NOXA 2W4XA 1NEKA 1T8BA 2AXDS 3VRAA 1LVKA 4JI1T 3JCFA 3Q9DA 3N2KE 4Z90A 3M3ZB 4ANJA 3UU3A 4L9IA 3PJAA 3OYZA 4TUYE 3L39A 3R84B 1O3XA 3H3AA 2YK0A 2IMLA 2ACXA 4YJ2E 4MFRA 4CN4A 2XSAA 5EK4A 2Q9QB 3BQIA 2I0MA 3WAKA 1R8IA 4HFBA 3CIRA 3RQWA 5J1GA 2CRBA 4HGAA 5HXEA 4PK4A 4H9NC 2MAWA 4WNKA 2BDEA 3GN5B 3N9QA 4U31A 2V6YA 3AA6B 4DBQA 2C5KT 5F8PA 1IAPA 3UUBA 2E8IA 2BG9A 4UF0A 4U33A 3UUNA 3AEAA 4O2BE 4JBWF 3UUMA 5L2LA 3ABVA 2UUAT 2V1DB 5JVDE 1T72A 3EUHA 1UCUA 2NW8A 3OVUA 3L8RA 1YKHB 2OA5A 4ILBA 5HEJA 3AEEA 3CX8B 2A3DA 2NTXA 2XM2A 4U2ZA 3N9OA 2FUPA 5LBMA 3B13A 4I50E 4A97A 2LM9A 4GYRA 4GOUA 4CXYA 2ES0A 2V7MA 2CE7A 2WCAA 1MIYA 1JNZA 1SA0E 5E0OA 4PJNA 4CI1B 3RRWA 1VOMA 2A72A 4B3TT 4ZEYA 3ZT5A 1YKEB 3CKDA 3QNUA 4PJLA 5JR9B 4WBOA 2RP4A 3IEEA 3ZEFB 3AE2A 4ILAA 1Z0PA 3LJCA 1JNRA 5FNVE 5LB7B 3BK9A 2YOEA 2DI4A 4JLEA 2XAGB 3H3MA 3VU7H 3AE3A 1OEDB 2VL8A 3NZQA 4IDZA 3I0OA 5HCJA 4X66T 4PJMA 1VRBA 2IUBA 4DR4T 3K1SA 4DR1T 4DO0A 5KXJA 2KNDA 3EAMA 4O4JE 5FXXA 4FI5A 4DR3T 3ONXA 2JQQA 4ISTA 1Y01A 4LF8T 2N1GA 4YHJA 2KWHA 2JQHA 3KDSE 4QH5A 4BJNA 2PFVA 3E0ZA 3HA4A 3EHZA 2Q9QA 4CN1A 1WRDA 5F3JA 2LKHA 4H9RC 2PTFA 2HH7A 2XASB 3OJAA 1BR0A 4O4HE 3FHNA 3GN5A 2X67A 4ILCA 4YHHT 3V5SA 5HWYA 4PW8A 1XNRT 4GK5E 5DJQC 1ZHCA 1NENA 3FBLA 5J0ZA 2CMRA 2RPAA 1I94T 4HN9A 3RIAA 2NWBA 2BG9E 2H3RA 3RIUA 1D1AA 2IDOB 3AA0B 3PUQA 4LF7T 3O4XE 3ZCJA 2HPJA 3G06A 3RYCE 2W0GA 2JQKA 3H37A 3CX6B 5LGTB 2ODVA 4DV3T 2XQ8A 2CBJA 2BS3A 2YU2A 4XBFB 2LHRA 2BKNA 1E1HB 3K3OA 4FJOA 5M4YA 2JQ9A 3ZMTB 1B7TA 5JR9A 5LG4A 5HXHA 2E5VA 3N2OA 2N9DA 5EK2A 4ZZCA 2XPKA 2LRKA 1H7CA 2PBIA 2WM9A 3UU4A 5JQGE 1OEDA 3MKDA 2BS2A 2IHR1 3HKBE 1ZV4X 3P8CD 3ZYMA 2FBWA 3S4UA 3QOFA 2Y6XA 4DR5T 3IBPA 1HCIA 3ZN0B 4QXCB 3AAAB 2V7LA 5LJNA 1VCSA 4EYUA 2CLYB 1UX5A 3A5XA 3SFEA 4HKAA 3O1JA 4O4LE 4YJ3E 3TLTA 1HX1B 4TZ4C 2QA7A 1MIWA 3KV9A 4I4TE 4PNIA 1UX4A 3VR9A 3U3IA 2KT9A 4IHJE 5JDGA 2LJLA 4B3MT 1HG2A 5AFUL 4QKNA 2BG9C 5GONE 3AAIA 3FXDB 3Q5EA 2SPCA 5CFBA 2NW7A 4X20E 5C8YE 4HTEA 1N34T 4YTPA 3P4WA 4LF6T 4M1PA 2V7IA 2KSRA 1G8XA 3RYFE 3AE6A 5L3CB 3NKZA 4EZHA 1FMWA 4UVAB 2UXXB 3PUXF 2VK9A 4TWDA 5LHIB 4LFAT 4DV4T 1EZ3A 1ZP0A 2B1EA 1YQ4A 4DV2T 4UVCB 3VRBA 2DHRA 4Q25A 4ZOLE 2KLQA 3LK2B 3AA1B 3P4RA 1QLBA 2KINB 4PAGA 1FJGT 3P4QA 4GKJT 4UV8B 1XDOA 3N2GE 2X9YA 5KDMC 3FZHB 1GQEA 4PK5A 4ZS3A 1OEDE 3B5MA 3L3PA 2XQ6A 4A98A 5AQVB 4EAHA 3PE0A 4P09A 3ZKRA 3R6NA 3CQXC 2Q9QC 3PUYF 2WAUA 3U78A 4AQFA 3AVSA 1M62A 5HYAA 2DWGA 5LP6E 2WY2A 5ADXL 3ZJ2A 2CWOA 4JYAT 3CWZB 3GA8A 3JC6D 3RYIE 4J2CA 2IIUA 2LSYA 4ISSA 3SS1A 4WBNE 4X64T 4KP3C 4UIGA 2BBHA 3RIUC 3AA7B 2R6GF 5L3FB 2A9UA 5AQNB 1KNZA 5LMUT 4ZI2C 5L4EA 3O1IA 4C90A 2CHNA 4H9SE 2J1DG 2VVSA 5FVKA 3P50A 3LK3B 4PFOA 2DLRA 5BMVE 2YDQA 5JR9C 3AAEB 3FBZA 4WW0A 3PU3A 3MK7C 5F5WA 3PUZF 1HR0T 4IL4A 1D0XA 1UGOA 1V9DA 4BJMA 2UXBT 1OEDC 1KFYA 2YKSA 1MMNA 2WSSV 4NIQA 3ZMVB 3MJXA 5HXRA 5EZYE 4HFDA 5AQRB 2XQ9A 3UU8A 2QYWA 3PUVF 4QHOA 4IDQA 2V6XA 5FL1A 4OHFA 5JH7E 1LRZA 3KBTA 5AQFB 2CM0A 2V7JA 4QH1A 3OTOT 5J2TE 5HXSA 3MXZA 1XDPA 2WU2A 3AE1A 4EIWA 4BAYB 5JDHA 5AQHB 4JEUB 2X51A 4IDNA 3C51A 3PUSA 4OK0A 3ZCIA 5C3JA 5JTGA 4TX5A 2XQ5A 2MBGA 5FXWA 2MYSA 4DUYT 3W15B 3NRXA 4UVBB 1SUMB 2WZIA 4HWCA 4B3ST 4MHCA 3EABA 1W09A 2H7VC 4DR7T 5HWXA 2EHOB 4X1KE 5FXVA 1BR1A 4E7SA 3RC8A 2X9HA 3CQGB 2QGSA 2V5DA 4XZCA 2WWVA 4V1Av 5J2UE 4MLKA 4IE5A 3ZSSA 1J5WA 4KI0F 3OPCA 4EOZB 5IYZE 4HWDA 2DNXA 1ZEEA 3I0QA 4CI3B 5ABHA 3C4WA 3KFWX 1QUUA 3RKGA 1E7PA 2P9BA 4EXTA 4IT4A 4IE4A 1D1BA 3PURA 4O8SA 4JI8T 4B3RT 4B6XA 5LGUB 2X68A 1XMOT 5EK3A 1FEWA 3KVBA 3E22E 2E9XD 2ZM6T 4H9PC 1N36T 2UXNB 3E08A 1M7KA 5HEUA 4U3CA 1Y64B 1L0VA 1W9RA 3UU5A 4YXDA 1G73A 1KEYA 1KF6A 4AKLA 1IJ6A 2GK9A 1WYBA 5KX5E 4AI6A 1T7SA 4TV8E 3LG7A 3KINB 3QUJA 4F8HA 3AXJB 2DL1A 3RIFA 5AQIB 5CJ5A 4UELA 2WDQA 4JI6T 5AQUB 3UFGA 2ZLYA 3K3QC 2CLYC 2K24A 3N9PA 4AQFC 4PFPA 4UXNB 3ZT6A 2LSKA 2XUEA 3PU8A 2LSGA 4F6RC 4AXPA 2VKHA
chains in the Genus database with same CATH topology
5DQWA 3I9YA 2SPCA 2NW7A 4H9OC 4ZI7E 3B57A 4X20E 2Y48B 5C8YE 4EZ4A 4HTEA 3TKLB 5JDFA 4G63A 4ZS2A 4ZI2D 2DCFA 3Q5XA 4XAXB 5L3DB 3ZYKA 3UTKA 3F31A 2IC9A 4M1PA 4ADZA 2YINA 3OYXA 4OYJA 2JPFA 3P7IA 2KWIB 3RH3A 3CVRA 2V7IA 2JJ9A 1G8XA 3RYFE 2C0SA 2H7OA 5L3CB 4EZHA 5ETWA 1FMWA 3IF8B 5JDNA 5KMGP 2KZ7B 4DBRA 4QX7B 4TN7B 4U72A 4UVAB 5H6RB 2UXXB 3J9X1 2VK9A 2C5JA 3I1AA 3NBXX 2VKOA 4ZHQE 5LHIB 1YW0A 4L0RA 2MOZA 3EDUA 1T98A 1LKXA 3CQCB 3ESLA 4KMCA 1EZ3A 2D0UA 2ZM8A 4HE8A 2B1EA 3RKOA 2W00A 4CI2B 4QXBB 5FMNA 2Z6EA 4UV9B 2WMNA 5LNKA 2XAJB 4UVCB 1HS7A 3QK6A 5CA0E 3ANWB 3LBXA 5CA1E 3K3NA 3N5LA 5HAXA 2M67A 2KMFA 4QX8B 2CXFA 2E9XB 5LGNB 2X9XA 2Y8DA 2NOXA 2ZM2A 2VWAA 2CXDA 2DHRA 3ZLIA 2XTLA 1LVKA 3UULA 3VHLA 5JDLA 4ZOLE 3FXEB 2KLQA 2E9XC 4CQIA 3LK2B 3AA1B 3ZYLA 1HF8A 2KINB 3Q9DA 4PAGA 3ZJ1A 3OKQA 3N2KE 3OBVE 3KVAA 4ANJA 4L9IA 3KV4A 3MA9A 2K48A 3OYZA 3FB2A 4UV8B 4TUYE 4DVDA 4AKIA 2L9QA 2X9WA 4KBMB 3O9XA 3R84B 3N2GE 2X9YA 5KDMC 1O3XA 3H3AA 3AB3B 2YK0A 4PK5A 5LCYA 4ZS3A 3L3PA 3DP7A 2ODUA 2ACXA 4YJ2E 4MFRA 5EK4A 2Q9QB 3BQIA 5L3EB 1S35A 2LEHA 3C50A 3EVYA 1MMGA 2LE8A 4EAHA 3PE0A 4P09A 3WAKA 3CX7B 4HEAA 4IGUA 5J1GA 3R6NA 4HGAA 5HXEA 1FMVA 5L3GB 4N78D 2LSJA 3CQXC 2Q9QC 2DWKA 2D0TA 4PK4A 3GMIA 2JMKA 4EYYR 4H9NC 4NUUA 3N9LA 1BR2A 3PDYA 3EDVA 2WAUA 1HTJF 1MMDA 4H9QC 3U78A 4WNKA 4AQFA 2BDEA 3AVSA 2XHEB 3UFEA 3GN5B 3N9QA 4I43B 5FYMA 5HYAA 2DWGA 3AA6B 5LP6E 1QSDA 5ADXL 3NRYA 3ZJ2A 4DBQA 2CWOA 2C5KT 3ZMSB 4GK0E 5F8PA 1IAPA 3CWZB 3GA8A 5FY0A 3JC6D 4CZZB 4GYSA 3SRZA 2E8IA 3C64A 3KBUA 3RYIE 4UF0A 4J2CA 3RPUA 2W62A 3UUNA 4O2BE 3UUMA 5L2LA 2LSYA 2V1DB 5JVDE 5LJMA 2EHOA 3EUHA 1UCUA 4ISSA 2NW8A 5LOVE 3SS1A 4DMVA 4WBNE 1OWAA 2ZM0A 1YKHB 2XAHB 2OA5A 4KUMB 5FY7A 5FXZA 4KP3C 4X1IE 3N9NA 4IE7A 3CX8B 4UIGA 4DNDA 2A3DA 2NTXA 3C98B 3AA7B 3N9OA 5L3FB 2BZBA 2HPLA 5LBMA 5LBQB 1KNZA 3B13A 4I50E 2WMOA 4ZI2C 1FIOA 1IZNB 2LM9A 4GYRA 3O1IA 4GOUA 4K0UA 4OYKA 4CXYA 2D2SA 2ES0A 2V7MA 4UEMA 2CE7A 3SWHA 3RYHE 1MIYA 1SA0E 4C90A 2LSIA 5E0OA 4JEHB 4PJNA 4CI1B 1US7B 5H6QB 2VB6A 4H9SE 3T8OA 2J1DG 3RRWA 1VOMA 2A72A 3SOLA 1YKEB 3CKDA 4PJLA 2NP9A 5JR9B 2V26A 3LK3B 4WBOA 2RP4A 3IEEA 3RX6A 2BVLA 4CXWA 2W61A 4PFOA 3F57A 3ZEFB 1Z0PA 2DLRA 2JRKA 1MNDA 3LJCA 3LBXB 5BMVE 5FNVE 3BK9A 2IAKA 3AAEB 5JR9C 3FBZA 4ZI3D 2DI4A 4JLEA 4WW0A 2XAGB 3PU3A 3VU7H 4PK6A 3MK7C 3QC9A 2VL8A 2ZMAA 3NZQA 3WI3A 3ANWA 4IDZA 1D0XA 3I0OA 2E9XA 1V9DA 4BJMA 1D0YA 3HKDE 4PJMA 3ZMZB 4IE0A 1VRBA 3BQKA 1MMNA 2WSSV 3ZMVB 5LHGB 3MJXA 5LXTE 4DO0A 2KNDA 3LK42 5HXRA 1CUNA 5EZYE 2WWUA 1YD8G 4O4JE 1X79A 4O2AE 2YEVC 5FXXA 3IHRA 2LOSA 4FI5A 4BA9A 4P0BA 4QHOA 2XAFB 3ONXA 2JQQA 3HKEE 4ISTA 4OHFA 4AQGA 5JH7E 1LRZA 3KBTA 1OXZA 2N1GA 2CM0A 2KWHA 2V7JA 4YHJA 3ZN1B 3KDSE 2K5BB 3I9WA 4BJNA 2PFVA 3E0ZA 3HA4A 5JRCB 3PUGA 5J2TE 5CB4E 2Q9QA 5HXSA 4P0AA 2NW9A 3MXZA 5LYJE 2N2NA 5L3BB 1WRDA 2LT3A 5F3JA 3LFMA 4H9RC 5IHYA 2I59A 3CPZA 2HH7A 4EIWA 2XASB 4BAYB 5JDHA 2IW5B 3MACA 1S94A 3OJAA 3HKCE 4JEUB 4ERRA 1MNEA 5M4YA 1BR0A 2X51A 3C4ZA 3C51A 4O4HE 1SHZC 3PUSA 4OK0A 3FHNA 3ZCIA 3GN5A 4TX5A 2X67A 3L09A 5FXWA 2JMHA 2MBGA 2MYSA 5HXCA 3W15B 2EHOD 3NRXA 4UVBB 3V5SA 5HWYA 4PW8A 1BR4A 4GK5E 4MHCA 4NUVA 5DJQC 1ZHCA 5DABA 3AVRA 4G2AA 2CEAA 2PJQA 3HI2A 1IJ5A 3ZPOA 2H7VC 3FBLA 3ETVA 3JC6C 5HWXA 3M65A 3J7Yq 2EHOB 4X1KE 2CMRA 4X1YE 1U4QA 2PG8A 4HN9A 5FXVA 1BR1A 4E7SA 2W63A 3RC8A 2NWBA 2X9HA 3CQGB 2QGSA 3D0TA 2EHOC 4DMWA 3RC3A 2H3RA 4XZCA 3VKGA 4V1Av 5J2UE 1D1AA 1AJ3A 4MLKA 4HFVA 4IE5A 3AA0B 3PUQA 4L5GA 4E7ZA 3HR0A 3UUXB 4AKRB 3O4XE 3KV6A 2HPJA 3ZCJA 5LHHB 3UT5E 2CCQA 3Q5WA 4IIJE 4C91A 4H63H 3RYCE 1MMAA 2CA5A 1LVFA 5IYZE 4Z8XA 2W0GA 4EOZB 1WYCA 2RA1A 2DNXA 3VKHA 1ZEEA 3H37A 4OFZA 3CX6B 3I0QA 5LGTB 4CI3B 4QWNB 2ODVA 4PJJA 3C4WA 3KFWX 5JDMA 4O4IE 1QUUA 2K9AA 3PUAA 4JUYA 2V7KA 2YU1A 2YU2A 4A56A 2P9BA 2LHRA 3F2EA 1HG5A 4EXTA 4XBFB 1E1HB 3K3OA 1MIVA 1D1BA 3PURA 4FJOA 4IE4A 4O8SA 3ZC1A 4B6XA 4I55E 2L3LA 5LGUB 4TV9E 2X68A 3ZMTB 3O1HA 5EK3A 3ZC0A 1B7TA 1FEWA 5JR9A 3KVBA 5HXHA 3E22E 5LG4A 2BVMA 1D0ZA 4GIWA 2E9XD 3N2OA 3NZPA 2VKDA 2G0UA 4H9PC 4YLHA 4AKGA 2N9DA 2XAQB 5EK2A 1NWMX 1H7CA 2PBIA 3ETUA 4AKHA 2UXNB 3E08A 4IE6A 4MALA 4CXXA 3C4XA 2WM9A 3BQLA 3N9MA 2WBLA 5JQGE 3WAJA 1Y64B 1HX8A 2XQYA 3MKDA 2VASA 4ZI3C 1G73A 1U5PA 2CWYA 2X0LB 3HKBE 1ZV4X 2LOPA 4H63V 1WLXA 4U74A 1NAFA 3P8CD 3ZYMA 4AKLA 3S4UA 1IJ6A 4ASKA 2GK9A 1WYBA 5KX5E 2Y6XA 4AI6A 2VKJA 5JDQA 5FY1A 4TV8E 3KV5A 3LG7A 3KINB 3IBPA 1HCIA 3QUJA 5LA6E 2Q9QD 1WR6A 4QXCB 3K8PC 3ZN0B 1KK7A 3AAAB 2V7LA 5LJNA 3ZMUB 4EYUA 2CLYB 1UX5A 2NTYA 3DJBA 3A5XA 4UELA 3GWHA 5A1LA 2KXPB 5JREA 4HKAA 3O1JA 4O4LE 2CXLA 4YJ3E 4TZ4C 5JRCA 3V5UA 2QA7A 4MBQA 1MIWA 2ZLYA 3KV9A 1HFAA 3K3QC 3PTRB 2CLYC 4I4TE 4PNIA 1ZKEA 1UX4A 2K24A 2LHNA 4QXHB 2L8KA 5FP3A 4YFSA 3N9PA 4AQFC 4EB6E 3U3IA 2KT9A 4PFPA 4UF0B 4IHJE 4UXNB 3HL6A 5JDGA 3DTOA 3Q2MA 2LJLA 2LSKA 2XUEA 2D5UA 3CMLA 3PU8A 1HG2A 2LSGA 5TAOA 5AFUL 4ILUA 4F6RC 2X66A 2C5IT 2MTQA 4QKNA 5DQVA 2IC6A 3RRCA 4AXPA 2A2FX 5GONE 3AAIA 2VKHA 3FXDB 3MZKB 1D1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCQ A;  5LJN A;  4JUY A;  4P0B A;  2CM0 A;  2D5U A;  4OYJ A;  4P0A A;  4OYK A;  2HPL A;  4P09 A;  2HPJ A;  5LJM A; 
#chains in the Genus database with same CATH topology
 4DV7 T;  1W0A A;  3RF1 A;  2WB5 A;  3B57 A;  5ABF B;  4KX6 A;  2QVA A;  5L3D B;  3JAE A;  3UTK A;  3PJA J;  4ADZ A;  4DR6 T;  2J4G A;  3P7I A;  3RHW A;  5ETW A;  5KMG P;  2V8S V;  1I6Z A;  4LMK A;  3I1A A;  4ZHQ E;  3EDU A;  1LKX A;  3CQC B;  2D0U A;  4HE8 A;  3RKO A;  2W00 A;  4QXB B;  5IWA T;  5AQS B;  3ANW B;  2M67 A;  5LGN B;  2E9X B;  2X9X A;  2CXD A;  3UUL A;  5JDL A;  3VHL A;  3FXE B;  4CQI A;  4HFH A;  3QB5 K;  4YY3 T;  4AIS A;  3OBV E;  2K48 A;  3FB2 A;  2WP9 A;  2L9Q A;  4KBM B;  2XZE A;  3O9X A;  3DP7 A;  3FZM B;  2WZH A;  5ABG A;  5L3E B;  1S35 A;  4TWH A;  2LEH A;  4YSZ A;  3AXJ A;  4HEA A;  4IGU A;  1FMV A;  5L3G B;  4N78 D;  4ZZB A;  2DWK A;  3UQ4 A;  2LRL A;  2D0T A;  4NUU A;  1BR2 A;  3EDV A;  4JI3 T;  1HTJ F;  1ZOY A;  4H9Q C;  2YDS A;  4I43 B;  5FYM A;  1YXR A;  4YTM A;  3NRY A;  3RGL A;  3ZMS B;  4X62 T;  5FY0 A;  4CZZ B;  4JI0 T;  3SRZ A;  3C64 A;  3KBU A;  3RPU A;  3NVO A;  3RLF F;  5LOV E;  1OWA A;  3LSV A;  1XWM A;  5ABF A;  5FY7 A;  5FXZ A;  4X1I E;  1CHU A;  3N9N A;  4DND A;  2BZB A;  2HPL A;  5LBQ B;  2WMO A;  1FIO A;  4DV1 T;  4YT0 A;  4K0U A;  4OYK A;  2D2S A;  4UEM A;  2H88 A;  2VVN A;  4JI4 T;  2WS3 A;  2HN1 A;  2XQ4 A;  2LSI A;  4JEH B;  1US7 B;  5H6Q B;  2VB6 A;  3SOL A;  5HEO A;  4LFC T;  2B76 A;  2V26 A;  4CXW A;  3LBX B;  4ZI3 D;  3QC9 A;  2ZMA A;  3AE4 A;  3EI0 A;  5HEG A;  3ANW A;  1Z8U A;  2E9X A;  4IL9 A;  4IE0 A;  3BQK A;  4DR2 T;  4HFI A;  1CUN A;  5AQT B;  2WWU A;  1X79 A;  2LOS A;  4P0B A;  4TWF A;  2XAF B;  3HKE E;  2FJE A;  1OXZ A;  2WU5 A;  3ZN1 B;  2K5B B;  3I9W A;  5JRC B;  1J1J A;  5CB4 E;  4P0A A;  2UXD T;  2E5L T;  5L3B B;  3JAD A;  2LT3 A;  4TNV A;  1N33 T;  3CPZ A;  2W67 A;  1VCT A;  3MAC A;  2HHH T;  3HKC E;  4U7I A;  1MNE A;  1SHZ C;  2UXC T;  2WQY A;  4A5X A;  2VQE T;  2EHO D;  2OLT A;  2D9D A;  3HI2 A;  2E2A A;  3JC6 C;  3J7Y q;  3M65 A;  2OV9 A;  2W66 A;  4IDP A;  1WR0 A;  2EHO C;  3VKG A;  1HNW T;  1AJ3 A;  3ZT7 A;  3HR0 A;  3UUX B;  3P4P A;  5LHH B;  2CCQ A;  3Q5W A;  4Z8X A;  1WYC A;  4K0K T;  3VKH A;  5JDM A;  4O4I E;  2CBI A;  2V7K A;  4A56 A;  3F2E A;  4HFE A;  3ZC1 A;  2WDV A;  4TV9 E;  2W2U A;  3T1H T;  1D0Z A;  4GIW A;  4AKG A;  2XAQ B;  2JIW A;  3ETU A;  4CXX A;  4MAL A;  4NXN T;  3BQL A;  3WAJ A;  5L4H A;  2VAS A;  2CWY A;  2X0L B;  2LOP A;  4H63 V;  3T1Y T;  1YQ3 A;  1NAF A;  4LFB T;  5JDQ A;  3KV5 A;  3TLS A;  5LA6 E;  1WR6 A;  3K8P C;  1KK7 A;  3ZMU B;  3LDQ B;  4GKK T;  2NTY A;  3AEF A;  3TLU A;  5A1L A;  2KXP B;  4AQY T;  5JRE A;  2CXL A;  5JRC A;  3AEG A;  1HFA A;  3PTR B;  4NPP A;  4LF9 T;  2AE9 A;  4QXH B;  2LHN A;  2L8K A;  5FP3 A;  1KNR A;  2BKO A;  1WCR A;  3DTO A;  3Q2M A;  3CML A;  4ILU A;  2MTQ A;  2IC6 A;  3Q5D A;  2XSB A;  1D1C A;  3I9Y A;  3IA3 A;  4H9O C;  4ZI7 E;  2Y48 B;  4EZ4 A;  1IBM T;  3CK6 A;  5JDF A;  3ZST A;  4EV6 A;  3Q5X A;  4XAX B;  3F31 A;  2IC9 A;  2YIN A;  4OYJ A;  2JPF A;  3RH3 A;  3CVR A;  2JJ9 A;  5HCM A;  2C0S A;  5AQG B;  2H7O A;  4DID B;  2FJB A;  5JDN A;  4QX7 B;  4U72 A;  3JAF A;  4U2Y A;  5H6R B;  3J9X 1;  2C5J A;  3NBX X;  1YW0 A;  4L0R A;  2M6B A;  4KMC A;  2ZM8 A;  1E2A A;  2FJD A;  1XMQ T;  1J5E T;  3NWI A;  4CI2 B;  3RQU A;  5LNK A;  2J47 A;  1UK5 A;  3QK6 A;  5CA0 E;  3K3N A;  3N5L A;  2KMF A;  4QX8 B;  5IUX A;  2Y8D A;  2ZM2 A;  5AQK B;  2VWA A;  2VQF T;  4AIU A;  3ZLI A;  2K3W A;  2XTL A;  2XQA A;  2E9X C;  4X65 T;  3ZYL A;  1HF8 A;  2NR4 A;  3ZJ1 A;  3OKQ A;  3UQ7 A;  3KVA A;  3KV4 A;  3MA9 A;  3AEC A;  4DVD A;  4COF A;  4AKI A;  2X9W A;  2XY8 B;  3AB3 B;  5LCY A;  2J62 A;  4HWH A;  2ODU A;  2CPT A;  4U7Y A;  5BR8 T;  4YSX A;  3X1D A;  3ONL C;  3C50 A;  3EVY A;  1MMG A;  2LE8 A;  2X0Y A;  4P1N A;  3CX7 B;  2UUB T;  1XZY A;  2LSJ A;  3A8Y C;  3GMI A;  2JMK A;  4EYY R;  3N9L A;  3PDY A;  1MMD A;  5FVL A;  2H89 A;  2XHE B;  3UFE A;  3PV0 F;  1QSD A;  4GK0 E;  5AQJ B;  4GYS A;  1WFD A;  1IBK T;  2W62 A;  4NXM T;  5LJM A;  2EHO A;  3FZL B;  2VL0 A;  4DMV A;  4LML A;  2ZM0 A;  2XAH B;  4KUM B;  4IE7 A;  3C98 B;  4Z91 A;  5CGM A;  1IZN B;  1XNQ T;  3TLV A;  5AQQ B;  4LF4 T;  4HWI B;  2CHO A;  3SWH A;  3RYH E;  2UU9 T;  2BS4 A;  1UUR A;  4EEB A;  3T8O A;  3QB5 A;  1DU2 A;  2NP9 A;  3RX6 A;  2BVL A;  2W61 A;  3F57 A;  4UR9 A;  4YSY A;  2FJA A;  2JRK A;  1MND A;  2IAK A;  4PK6 A;  3WI3 A;  4JV5 T;  1IBL T;  3AED A;  1D0Y A;  2ACZ A;  3FZF B;  3HKD E;  3ZMZ B;  1SE7 A;  5LHG B;  5LXT E;  5HEH A;  3LK4 2;  2YN6 A;  1YD8 G;  3TLW A;  4O2A E;  2YEV C;  3IHR A;  4WZX A;  4BA9 A;  1KNP A;  4AQG A;  2BBJ A;  4IDO A;  2MPK A;  4DV5 T;  3PUG A;  4WYV A;  2NW9 A;  5LYJ E;  2LKG A;  2N2N A;  4DV0 T;  3LFM A;  5IHY A;  2QRX A;  2I59 A;  4EGW A;  2IW5 B;  1S94 A;  3PUW F;  4ERR A;  3ONJ A;  5FKY A;  3C4Z A;  4JI2 T;  3L09 A;  2JMH A;  5AQP B;  5HXC A;  1BR4 A;  4NUV A;  5DAB A;  3AVR A;  4G2A A;  2CEA A;  2PJQ A;  3ZPO A;  1IJ5 A;  3ETV A;  4X1Y E;  1U4Q A;  2PG8 A;  2W63 A;  4DMW A;  3D0T A;  4KHZ F;  2M6I A;  2VUR A;  3RC3 A;  4HFV A;  4HWF A;  4L5G A;  5L47 A;  4E7Z A;  4AKR B;  3KV6 A;  3UT5 E;  2YDR A;  4IIJ E;  3AEB A;  4C91 A;  2V5C A;  4H63 H;  1MMA A;  2CA5 A;  1LVF A;  3FZK B;  2LM2 A;  2RA1 A;  4OFZ A;  4QWN B;  4PJJ A;  2K9A A;  3PUA A;  4JUY A;  2YU1 A;  3P4S A;  1HG5 A;  3A7M A;  1MIV A;  3VR8 A;  4I55 E;  2L3L A;  3UU6 A;  4CN6 A;  5AQM B;  3O1H A;  3ZC0 A;  2BVM A;  5LMN T;  3AE9 A;  3NZP A;  2VKD A;  2G0U A;  4YLH A;  4JI7 T;  1NWM X;  4AKH A;  4IE6 A;  3C4X A;  4LMJ A;  3N9M A;  2WBL A;  4LF5 T;  1HX8 A;  2XQY A;  4ZI3 C;  1W0B A;  1U5P A;  1WLX A;  4U74 A;  4ASK A;  2XJ7 A;  2VKJ A;  5FY1 A;  1HNZ T;  2Q9Q D;  3AE7 A;  4JI5 T;  3RI5 A;  4IRE A;  3DJB A;  3GWH A;  4X5T A;  5AQO B;  4ZXL A;  2V6Y B;  4I0U A;  1UUS A;  3V5U A;  4MBQ A;  2UUC T;  1ZKE A;  4YFS A;  4EB6 E;  2BG9 B;  4UF0 B;  3HL6 A;  2I6H A;  4DUZ T;  2D5U A;  5TAO A;  2X66 A;  2C5I T;  5DQV A;  3RRC A;  2A2F X;  4QH4 A;  5LG3 A;  3MZK B;  5DQW A;  5AQL B;  1X9B A;  2XQ3 A;  3TKL B;  2XQ7 A;  4G63 A;  4ZS2 A;  4ZI2 D;  2BKP A;  2DCF A;  5C2T A;  2LLY A;  3ZYK A;  3OYX A;  5ABE A;  1N32 T;  2KWI B;  2F4V T;  4KHP T;  3IF8 B;  2KZ7 B;  4DBR A;  4TN7 B;  3AE5 A;  3AE8 A;  4EED A;  2VKO A;  2MOZ A;  1T98 A;  3ESL A;  1HNX T;  4OX9 T;  4DV6 T;  5FL0 A;  2XM1 A;  2WDR A;  5FMN A;  2Z6E A;  4TNW A;  2WMN A;  4UV9 B;  3SFD A;  2XAJ B;  1HS7 A;  2HN2 A;  3LBX A;  5CA1 E;  2X0H A;  5HAX A;  4YTN A;  2CXF A;  4HFC A;  2NOX A;  2W4X A;  1NEK A;  1T8B A;  2AXD S;  3VRA A;  1LVK A;  4JI1 T;  3JCF A;  3Q9D A;  3N2K E;  4Z90 A;  3M3Z B;  4ANJ A;  3UU3 A;  4L9I A;  3PJA A;  3OYZ A;  4TUY E;  3L39 A;  3R84 B;  1O3X A;  3H3A A;  2YK0 A;  2IML A;  2ACX A;  4YJ2 E;  4MFR A;  4CN4 A;  2XSA A;  5EK4 A;  2Q9Q B;  3BQI A;  2I0M A;  3WAK A;  1R8I A;  4HFB A;  3CIR A;  3RQW A;  5J1G A;  2CRB A;  4HGA A;  5HXE A;  4PK4 A;  4H9N C;  2MAW A;  4WNK A;  2BDE A;  3GN5 B;  3N9Q A;  4U31 A;  2V6Y A;  3AA6 B;  4DBQ A;  2C5K T;  5F8P A;  1IAP A;  3UUB A;  2E8I A;  2BG9 A;  4UF0 A;  4U33 A;  3UUN A;  3AEA A;  4O2B E;  4JBW F;  3UUM A;  5L2L A;  3ABV A;  2UUA T;  2V1D B;  5JVD E;  1T72 A;  3EUH A;  1UCU A;  2NW8 A;  3OVU A;  3L8R A;  1YKH B;  2OA5 A;  4ILB A;  5HEJ A;  3AEE A;  3CX8 B;  2A3D A;  2NTX A;  2XM2 A;  4U2Z A;  3N9O A;  2FUP A;  5LBM A;  3B13 A;  4I50 E;  4A97 A;  2LM9 A;  4GYR A;  4GOU A;  4CXY A;  2ES0 A;  2V7M A;  2CE7 A;  2WCA A;  1MIY A;  1JNZ A;  1SA0 E;  5E0O A;  4PJN A;  4CI1 B;  3RRW A;  1VOM A;  2A72 A;  4B3T T;  4ZEY A;  3ZT5 A;  1YKE B;  3CKD A;  3QNU A;  4PJL A;  5JR9 B;  4WBO A;  2RP4 A;  3IEE A;  3ZEF B;  3AE2 A;  4ILA A;  1Z0P A;  3LJC A;  1JNR A;  5FNV E;  5LB7 B;  3BK9 A;  2YOE A;  2DI4 A;  4JLE A;  2XAG B;  3H3M A;  3VU7 H;  3AE3 A;  1OED B;  2VL8 A;  3NZQ A;  4IDZ A;  3I0O A;  5HCJ A;  4X66 T;  4PJM A;  1VRB A;  2IUB A;  4DR4 T;  3K1S A;  4DR1 T;  4DO0 A;  5KXJ A;  2KND A;  3EAM A;  4O4J E;  5FXX A;  4FI5 A;  4DR3 T;  3ONX A;  2JQQ A;  4IST A;  1Y01 A;  4LF8 T;  2N1G A;  4YHJ A;  2KWH A;  2JQH A;  3KDS E;  4QH5 A;  4BJN A;  2PFV A;  3E0Z A;  3HA4 A;  3EHZ A;  2Q9Q A;  4CN1 A;  1WRD A;  5F3J A;  2LKH A;  4H9R C;  2PTF A;  2HH7 A;  2XAS B;  3OJA A;  1BR0 A;  4O4H E;  3FHN A;  3GN5 A;  2X67 A;  4ILC A;  4YHH T;  3V5S A;  5HWY A;  4PW8 A;  1XNR T;  4GK5 E;  5DJQ C;  1ZHC A;  1NEN A;  3FBL A;  5J0Z A;  2CMR A;  2RPA A;  1I94 T;  4HN9 A;  3RIA A;  2NWB A;  2BG9 E;  2H3R A;  3RIU A;  1D1A A;  2IDO B;  3AA0 B;  3PUQ A;  4LF7 T;  3O4X E;  3ZCJ A;  2HPJ A;  3G06 A;  3RYC E;  2W0G A;  2JQK A;  3H37 A;  3CX6 B;  5LGT B;  2ODV A;  4DV3 T;  2XQ8 A;  2CBJ A;  2BS3 A;  2YU2 A;  4XBF B;  2LHR A;  2BKN A;  1E1H B;  3K3O A;  4FJO A;  5M4Y A;  2JQ9 A;  3ZMT B;  1B7T A;  5JR9 A;  5LG4 A;  5HXH A;  2E5V A;  3N2O A;  2N9D A;  5EK2 A;  4ZZC A;  2XPK A;  2LRK A;  1H7C A;  2PBI A;  2WM9 A;  3UU4 A;  5JQG E;  1OED A;  3MKD A;  2BS2 A;  2IHR 1;  3HKB E;  1ZV4 X;  3P8C D;  3ZYM A;  2FBW A;  3S4U A;  3QOF A;  2Y6X A;  4DR5 T;  3IBP A;  1HCI A;  3ZN0 B;  4QXC B;  3AAA B;  2V7L A;  5LJN A;  1VCS A;  4EYU A;  2CLY B;  1UX5 A;  3A5X A;  3SFE A;  4HKA A;  3O1J A;  4O4L E;  4YJ3 E;  3TLT A;  1HX1 B;  4TZ4 C;  2QA7 A;  1MIW A;  3KV9 A;  4I4T E;  4PNI A;  1UX4 A;  3VR9 A;  3U3I A;  2KT9 A;  4IHJ E;  5JDG A;  2LJL A;  4B3M T;  1HG2 A;  5AFU L;  4QKN A;  2BG9 C;  5GON E;  3AAI A;  3FXD B;  3Q5E A;  2SPC A;  5CFB A;  2NW7 A;  4X20 E;  5C8Y E;  4HTE A;  1N34 T;  4YTP A;  3P4W A;  4LF6 T;  4M1P A;  2V7I A;  2KSR A;  1G8X A;  3RYF E;  3AE6 A;  5L3C B;  3NKZ A;  4EZH A;  1FMW A;  4UVA B;  2UXX B;  3PUX F;  2VK9 A;  4TWD A;  5LHI B;  4LFA T;  4DV4 T;  1EZ3 A;  1ZP0 A;  2B1E A;  1YQ4 A;  4DV2 T;  4UVC B;  3VRB A;  2DHR A;  4Q25 A;  4ZOL E;  2KLQ A;  3LK2 B;  3AA1 B;  3P4R A;  1QLB A;  2KIN B;  4PAG A;  1FJG T;  3P4Q A;  4GKJ T;  4UV8 B;  1XDO A;  3N2G E;  2X9Y A;  5KDM C;  3FZH B;  1GQE A;  4PK5 A;  4ZS3 A;  1OED E;  3B5M A;  3L3P A;  2XQ6 A;  4A98 A;  5AQV B;  4EAH A;  3PE0 A;  4P09 A;  3ZKR A;  3R6N A;  3CQX C;  2Q9Q C;  3PUY F;  2WAU A;  3U78 A;  4AQF A;  3AVS A;  1M62 A;  5HYA A;  2DWG A;  5LP6 E;  2WY2 A;  5ADX L;  3ZJ2 A;  2CWO A;  4JYA T;  3CWZ B;  3GA8 A;  3JC6 D;  3RYI E;  4J2C A;  2IIU A;  2LSY A;  4ISS A;  3SS1 A;  4WBN E;  4X64 T;  4KP3 C;  4UIG A;  2BBH A;  3RIU C;  3AA7 B;  2R6G F;  5L3F B;  2A9U A;  5AQN B;  1KNZ A;  5LMU T;  4ZI2 C;  5L4E A;  3O1I A;  4C90 A;  2CHN A;  4H9S E;  2J1D G;  2VVS A;  5FVK A;  3P50 A;  3LK3 B;  4PFO A;  2DLR A;  5BMV E;  2YDQ A;  5JR9 C;  3AAE B;  3FBZ A;  4WW0 A;  3PU3 A;  3MK7 C;  5F5W A;  3PUZ F;  1HR0 T;  4IL4 A;  1D0X A;  1UGO A;  1V9D A;  4BJM A;  2UXB T;  1OED C;  1KFY A;  2YKS A;  1MMN A;  2WSS V;  4NIQ A;  3ZMV B;  3MJX A;  5HXR A;  5EZY E;  4HFD A;  5AQR B;  2XQ9 A;  3UU8 A;  2QYW A;  3PUV F;  4QHO A;  4IDQ A;  2V6X A;  5FL1 A;  4OHF A;  5JH7 E;  1LRZ A;  3KBT A;  5AQF B;  2CM0 A;  2V7J A;  4QH1 A;  3OTO T;  5J2T E;  5HXS A;  3MXZ A;  1XDP A;  2WU2 A;  3AE1 A;  4EIW A;  4BAY B;  5JDH A;  5AQH B;  4JEU B;  2X51 A;  4IDN A;  3C51 A;  3PUS A;  4OK0 A;  3ZCI A;  5C3J A;  5JTG A;  4TX5 A;  2XQ5 A;  2MBG A;  5FXW A;  2MYS A;  4DUY T;  3W15 B;  3NRX A;  4UVB B;  1SUM B;  2WZI A;  4HWC A;  4B3S T;  4MHC A;  3EAB A;  1W09 A;  2H7V C;  4DR7 T;  5HWX A;  2EHO B;  4X1K E;  5FXV A;  1BR1 A;  4E7S A;  3RC8 A;  2X9H A;  3CQG B;  2QGS A;  2V5D A;  4XZC A;  2WWV A;  4V1A v;  5J2U E;  4MLK A;  4IE5 A;  3ZSS A;  1J5W A;  4KI0 F;  3OPC A;  4EOZ B;  5IYZ E;  4HWD A;  2DNX A;  1ZEE A;  3I0Q A;  4CI3 B;  5ABH A;  3C4W A;  3KFW X;  1QUU A;  3RKG A;  1E7P A;  2P9B A;  4EXT A;  4IT4 A;  4IE4 A;  1D1B A;  3PUR A;  4O8S A;  4JI8 T;  4B3R T;  4B6X A;  5LGU B;  2X68 A;  1XMO T;  5EK3 A;  1FEW A;  3KVB A;  3E22 E;  2E9X D;  2ZM6 T;  4H9P C;  1N36 T;  2UXN B;  3E08 A;  1M7K A;  5HEU A;  4U3C A;  1Y64 B;  1L0V A;  1W9R A;  3UU5 A;  4YXD A;  1G73 A;  1KEY A;  1KF6 A;  4AKL A;  1IJ6 A;  2GK9 A;  1WYB A;  5KX5 E;  4AI6 A;  1T7S A;  4TV8 E;  3LG7 A;  3KIN B;  3QUJ A;  4F8H A;  3AXJ B;  2DL1 A;  3RIF A;  5AQI B;  5CJ5 A;  4UEL A;  2WDQ A;  4JI6 T;  5AQU B;  3UFG A;  2ZLY A;  3K3Q C;  2CLY C;  2K24 A;  3N9P A;  4AQF C;  4PFP A;  4UXN B;  3ZT6 A;  2LSK A;  2XUE A;  3PU8 A;  2LSG A;  4F6R C;  4AXP A;  2VKH A; 
#chains in the Genus database with same CATH homology
 5DQW A;  3I9Y A;  2SPC A;  2NW7 A;  4H9O C;  4ZI7 E;  3B57 A;  4X20 E;  2Y48 B;  5C8Y E;  4EZ4 A;  4HTE A;  3TKL B;  5JDF A;  4G63 A;  4ZS2 A;  4ZI2 D;  2DCF A;  3Q5X A;  4XAX B;  5L3D B;  3ZYK A;  3UTK A;  3F31 A;  2IC9 A;  4M1P A;  4ADZ A;  2YIN A;  3OYX A;  4OYJ A;  2JPF A;  3P7I A;  2KWI B;  3RH3 A;  3CVR A;  2V7I A;  2JJ9 A;  1G8X A;  3RYF E;  2C0S A;  2H7O A;  5L3C B;  4EZH A;  5ETW A;  1FMW A;  3IF8 B;  5JDN A;  5KMG P;  2KZ7 B;  4DBR A;  4QX7 B;  4TN7 B;  4U72 A;  4UVA B;  5H6R B;  2UXX B;  3J9X 1;  2VK9 A;  2C5J A;  3I1A A;  3NBX X;  2VKO A;  4ZHQ E;  5LHI B;  1YW0 A;  4L0R A;  2MOZ A;  3EDU A;  1T98 A;  1LKX A;  3CQC B;  3ESL A;  4KMC A;  1EZ3 A;  2D0U A;  2ZM8 A;  4HE8 A;  2B1E A;  3RKO A;  2W00 A;  4CI2 B;  4QXB B;  5FMN A;  2Z6E A;  4UV9 B;  2WMN A;  5LNK A;  2XAJ B;  4UVC B;  1HS7 A;  3QK6 A;  5CA0 E;  3ANW B;  3LBX A;  5CA1 E;  3K3N A;  3N5L A;  5HAX A;  2M67 A;  2KMF A;  4QX8 B;  2CXF A;  2E9X B;  5LGN B;  2X9X A;  2Y8D A;  2NOX A;  2ZM2 A;  2VWA A;  2CXD A;  2DHR A;  3ZLI A;  2XTL A;  1LVK A;  3UUL A;  3VHL A;  5JDL A;  4ZOL E;  3FXE B;  2KLQ A;  2E9X C;  4CQI A;  3LK2 B;  3AA1 B;  3ZYL A;  1HF8 A;  2KIN B;  3Q9D A;  4PAG A;  3ZJ1 A;  3OKQ A;  3N2K E;  3OBV E;  3KVA A;  4ANJ A;  4L9I A;  3KV4 A;  3MA9 A;  2K48 A;  3OYZ A;  3FB2 A;  4UV8 B;  4TUY E;  4DVD A;  4AKI A;  2L9Q A;  2X9W A;  4KBM B;  3O9X A;  3R84 B;  3N2G E;  2X9Y A;  5KDM C;  1O3X A;  3H3A A;  3AB3 B;  2YK0 A;  4PK5 A;  5LCY A;  4ZS3 A;  3L3P A;  3DP7 A;  2ODU A;  2ACX A;  4YJ2 E;  4MFR A;  5EK4 A;  2Q9Q B;  3BQI A;  5L3E B;  1S35 A;  2LEH A;  3C50 A;  3EVY A;  1MMG A;  2LE8 A;  4EAH A;  3PE0 A;  4P09 A;  3WAK A;  3CX7 B;  4HEA A;  4IGU A;  5J1G A;  3R6N A;  4HGA A;  5HXE A;  1FMV A;  5L3G B;  4N78 D;  2LSJ A;  3CQX C;  2Q9Q C;  2DWK A;  2D0T A;  4PK4 A;  3GMI A;  2JMK A;  4EYY R;  4H9N C;  4NUU A;  3N9L A;  1BR2 A;  3PDY A;  3EDV A;  2WAU A;  1HTJ F;  1MMD A;  4H9Q C;  3U78 A;  4WNK A;  4AQF A;  2BDE A;  3AVS A;  2XHE B;  3UFE A;  3GN5 B;  3N9Q A;  4I43 B;  5FYM A;  5HYA A;  2DWG A;  3AA6 B;  5LP6 E;  1QSD A;  5ADX L;  3NRY A;  3ZJ2 A;  4DBQ A;  2CWO A;  2C5K T;  3ZMS B;  4GK0 E;  5F8P A;  1IAP A;  3CWZ B;  3GA8 A;  5FY0 A;  3JC6 D;  4CZZ B;  4GYS A;  3SRZ A;  2E8I A;  3C64 A;  3KBU A;  3RYI E;  4UF0 A;  4J2C A;  3RPU A;  2W62 A;  3UUN A;  4O2B E;  3UUM A;  5L2L A;  2LSY A;  2V1D B;  5JVD E;  5LJM A;  2EHO A;  3EUH A;  1UCU A;  4ISS A;  2NW8 A;  5LOV E;  3SS1 A;  4DMV A;  4WBN E;  1OWA A;  2ZM0 A;  1YKH B;  2XAH B;  2OA5 A;  4KUM B;  5FY7 A;  5FXZ A;  4KP3 C;  4X1I E;  3N9N A;  4IE7 A;  3CX8 B;  4UIG A;  4DND A;  2A3D A;  2NTX A;  3C98 B;  3AA7 B;  3N9O A;  5L3F B;  2BZB A;  2HPL A;  5LBM A;  5LBQ B;  1KNZ A;  3B13 A;  4I50 E;  2WMO A;  4ZI2 C;  1FIO A;  1IZN B;  2LM9 A;  4GYR A;  3O1I A;  4GOU A;  4K0U A;  4OYK A;  4CXY A;  2D2S A;  2ES0 A;  2V7M A;  4UEM A;  2CE7 A;  3SWH A;  3RYH E;  1MIY A;  1SA0 E;  4C90 A;  2LSI A;  5E0O A;  4JEH B;  4PJN A;  4CI1 B;  1US7 B;  5H6Q B;  2VB6 A;  4H9S E;  3T8O A;  2J1D G;  3RRW A;  1VOM A;  2A72 A;  3SOL A;  1YKE B;  3CKD A;  4PJL A;  2NP9 A;  5JR9 B;  2V26 A;  3LK3 B;  4WBO A;  2RP4 A;  3IEE A;  3RX6 A;  2BVL A;  4CXW A;  2W61 A;  4PFO A;  3F57 A;  3ZEF B;  1Z0P A;  2DLR A;  2JRK A;  1MND A;  3LJC A;  3LBX B;  5BMV E;  5FNV E;  3BK9 A;  2IAK A;  3AAE B;  5JR9 C;  3FBZ A;  4ZI3 D;  2DI4 A;  4JLE A;  4WW0 A;  2XAG B;  3PU3 A;  3VU7 H;  4PK6 A;  3MK7 C;  3QC9 A;  2VL8 A;  2ZMA A;  3NZQ A;  3WI3 A;  3ANW A;  4IDZ A;  1D0X A;  3I0O A;  2E9X A;  1V9D A;  4BJM A;  1D0Y A;  3HKD E;  4PJM A;  3ZMZ B;  4IE0 A;  1VRB A;  3BQK A;  1MMN A;  2WSS V;  3ZMV B;  5LHG B;  3MJX A;  5LXT E;  4DO0 A;  2KND A;  3LK4 2;  5HXR A;  1CUN A;  5EZY E;  2WWU A;  1YD8 G;  4O4J E;  1X79 A;  4O2A E;  2YEV C;  5FXX A;  3IHR A;  2LOS A;  4FI5 A;  4BA9 A;  4P0B A;  4QHO A;  2XAF B;  3ONX A;  2JQQ A;  3HKE E;  4IST A;  4OHF A;  4AQG A;  5JH7 E;  1LRZ A;  3KBT A;  1OXZ A;  2N1G A;  2CM0 A;  2KWH A;  2V7J A;  4YHJ A;  3ZN1 B;  3KDS E;  2K5B B;  3I9W A;  4BJN A;  2PFV A;  3E0Z A;  3HA4 A;  5JRC B;  3PUG A;  5J2T E;  5CB4 E;  2Q9Q A;  5HXS A;  4P0A A;  2NW9 A;  3MXZ A;  5LYJ E;  2N2N A;  5L3B B;  1WRD A;  2LT3 A;  5F3J A;  3LFM A;  4H9R C;  5IHY A;  2I59 A;  3CPZ A;  2HH7 A;  4EIW A;  2XAS B;  4BAY B;  5JDH A;  2IW5 B;  3MAC A;  1S94 A;  3OJA A;  3HKC E;  4JEU B;  4ERR A;  1MNE A;  5M4Y A;  1BR0 A;  2X51 A;  3C4Z A;  3C51 A;  4O4H E;  1SHZ C;  3PUS A;  4OK0 A;  3FHN A;  3ZCI A;  3GN5 A;  4TX5 A;  2X67 A;  3L09 A;  5FXW A;  2JMH A;  2MBG A;  2MYS A;  5HXC A;  3W15 B;  2EHO D;  3NRX A;  4UVB B;  3V5S A;  5HWY A;  4PW8 A;  1BR4 A;  4GK5 E;  4MHC A;  4NUV A;  5DJQ C;  1ZHC A;  5DAB A;  3AVR A;  4G2A A;  2CEA A;  2PJQ A;  3HI2 A;  1IJ5 A;  3ZPO A;  2H7V C;  3FBL A;  3ETV A;  3JC6 C;  5HWX A;  3M65 A;  3J7Y q;  2EHO B;  4X1K E;  2CMR A;  4X1Y E;  1U4Q A;  2PG8 A;  4HN9 A;  5FXV A;  1BR1 A;  4E7S A;  2W63 A;  3RC8 A;  2NWB A;  2X9H A;  3CQG B;  2QGS A;  3D0T A;  2EHO C;  4DMW A;  3RC3 A;  2H3R A;  4XZC A;  3VKG A;  4V1A v;  5J2U E;  1D1A A;  1AJ3 A;  4MLK A;  4HFV A;  4IE5 A;  3AA0 B;  3PUQ A;  4L5G A;  4E7Z A;  3HR0 A;  3UUX B;  4AKR B;  3O4X E;  3KV6 A;  2HPJ A;  3ZCJ A;  5LHH B;  3UT5 E;  2CCQ A;  3Q5W A;  4IIJ E;  4C91 A;  4H63 H;  3RYC E;  1MMA A;  2CA5 A;  1LVF A;  5IYZ E;  4Z8X A;  2W0G A;  4EOZ B;  1WYC A;  2RA1 A;  2DNX A;  3VKH A;  1ZEE A;  3H37 A;  4OFZ A;  3CX6 B;  3I0Q A;  5LGT B;  4CI3 B;  4QWN B;  2ODV A;  4PJJ A;  3C4W A;  3KFW X;  5JDM A;  4O4I E;  1QUU A;  2K9A A;  3PUA A;  4JUY A;  2V7K A;  2YU1 A;  2YU2 A;  4A56 A;  2P9B A;  2LHR A;  3F2E A;  1HG5 A;  4EXT A;  4XBF B;  1E1H B;  3K3O A;  1MIV A;  1D1B A;  3PUR A;  4FJO A;  4IE4 A;  4O8S A;  3ZC1 A;  4B6X A;  4I55 E;  2L3L A;  5LGU B;  4TV9 E;  2X68 A;  3ZMT B;  3O1H A;  5EK3 A;  3ZC0 A;  1B7T A;  1FEW A;  5JR9 A;  3KVB A;  5HXH A;  3E22 E;  5LG4 A;  2BVM A;  1D0Z A;  4GIW A;  2E9X D;  3N2O A;  3NZP A;  2VKD A;  2G0U A;  4H9P C;  4YLH A;  4AKG A;  2N9D A;  2XAQ B;  5EK2 A;  1NWM X;  1H7C A;  2PBI A;  3ETU A;  4AKH A;  2UXN B;  3E08 A;  4IE6 A;  4MAL A;  4CXX A;  3C4X A;  2WM9 A;  3BQL A;  3N9M A;  2WBL A;  5JQG E;  3WAJ A;  1Y64 B;  1HX8 A;  2XQY A;  3MKD A;  2VAS A;  4ZI3 C;  1G73 A;  1U5P A;  2CWY A;  2X0L B;  3HKB E;  1ZV4 X;  2LOP A;  4H63 V;  1WLX A;  4U74 A;  1NAF A;  3P8C D;  3ZYM A;  4AKL A;  3S4U A;  1IJ6 A;  4ASK A;  2GK9 A;  1WYB A;  5KX5 E;  2Y6X A;  4AI6 A;  2VKJ A;  5JDQ A;  5FY1 A;  4TV8 E;  3KV5 A;  3LG7 A;  3KIN B;  3IBP A;  1HCI A;  3QUJ A;  5LA6 E;  2Q9Q D;  1WR6 A;  4QXC B;  3K8P C;  3ZN0 B;  1KK7 A;  3AAA B;  2V7L A;  5LJN A;  3ZMU B;  4EYU A;  2CLY B;  1UX5 A;  2NTY A;  3DJB A;  3A5X A;  4UEL A;  3GWH A;  5A1L A;  2KXP B;  5JRE A;  4HKA A;  3O1J A;  4O4L E;  2CXL A;  4YJ3 E;  4TZ4 C;  5JRC A;  3V5U A;  2QA7 A;  4MBQ A;  1MIW A;  2ZLY A;  3KV9 A;  1HFA A;  3K3Q C;  3PTR B;  2CLY C;  4I4T E;  4PNI A;  1ZKE A;  1UX4 A;  2K24 A;  2LHN A;  4QXH B;  2L8K A;  5FP3 A;  4YFS A;  3N9P A;  4AQF C;  4EB6 E;  3U3I A;  2KT9 A;  4PFP A;  4UF0 B;  4IHJ E;  4UXN B;  3HL6 A;  5JDG A;  3DTO A;  3Q2M A;  2LJL A;  2LSK A;  2XUE A;  2D5U A;  3CML A;  3PU8 A;  1HG2 A;  2LSG A;  5TAO A;  5AFU L;  4ILU A;  4F6R C;  2X66 A;  2C5I T;  2MTQ A;  4QKN A;  5DQV A;  2IC6 A;  3RRC A;  4AXP A;  2A2F X;  5GON E;  3AAI A;  2VKH A;  3FXD B;  3MZK B;  1D1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...