5AQPB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 111
sequence length 111
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqpB00
5AQTB 1M62A 5AQHB 1UK5A 5AQJB 3FZHB 3FZMB 4HWIB 2D9DA 1I6ZA 4HWCA 5AQRB 5AQGB 5AQVB 3FZFB 5AQIB 3FZLB 5AQKB 5AQQB 3FZKB 3LDQB 5AQUB 1HX1B 1UGOA 5AQLB 5AQMB 3A8YC 4HWFA 5AQFB 3M3ZB 1M7KA 5AQSB 5AQNB 4HWDA 1T7SA 5AQOB 4HWHA 5AQPB
chains in the Genus database with same CATH superfamily
3PU8A 4TNVA 3QB5K 4B3RT 2WAUA 5LGTB 3AEBA 1N32T 5IHYA 4GYSA 4QH1A 5IWAT 3UU5A 3HA4A 2XJ7A 2LE8A 3OTOT 3R6NA 3VRAA 5ABHA 5LJMA 4YFSA 3ZMSB 4O2BE 3UUXB 3I0OA 4O4IE 2EHOA 3OYZA 2X66A 3K3QC 3Q5DA 2WWVA 3ABVA 1OEDB 2OLTA 5FL1A 1U4QA 2VWAA 3HKEE 3PUYF 2KLQA 3NRYA 2YDQA 1SHZC 2V26A 3JCFA 4HFDA 4HFEA 4UIGA 2XZEA 1XMOT 3H3MA 2FBWA 5BMVE 4U2YA 3Q9DA 4NIQA 1G8XA 3CMLA 4AKLA 1KK7A 4V1Av 2V6YA 3CPZA 4CXXA 2VL0A 4IREA 4TZ4C 3RHWA 3VKGA 2C5IT 2BG9E 3AEEA 2XTLA 2CWYA 3PUGA 2QYWA 4U72A 4HE8A 5A1LA 2WU2A 1E1HB 1O3XA 3AVSA 2UUBT 3CQXC 4I4TE 3PV0F 4HWFA 3RIUC 5HXRA 4ILBA 1M7KA 3HR0A 1IBKT 5LCYA 1WR0A 3GA8A 2W2UA 4DBRA 2H7VC 5AQRB 4CZZB 3GN5B 4LF5T 1AJ3A 3WI3A 2E2AA 2BDEA 5FYMA 3RYIE 5L47A 2V1DB 4PK4A 4PK5A 5AQFB 5IYZE 1OWAA 1KEYA 5HWXA 4PJNA 2BBJA 1UX4A 3ZC0A 1WYBA 4DR6T 3Q5EA 3UULA 4H9SE 3S4UA 4QHOA 2RPAA 4JI2T 1YXRA 2HHHT 2K5BB 4YSYA 3PUVF 1D1CA 4OK0A 2WDVA 3AA0B 5FNVE 3Q5WA 3HKDE 4MLKA 3SOLA 4YXDA 2JQQA 3VU7H 3TKLB 4YSXA 3VR8A 3RRWA 2XAGB 2XPKA 3UTKA 3U3IA 4TV9E 2PTFA 4AXPA 1KNPA 4L9IA 4BJMA 4IL4A 3M65A 2QRXA 2X9HA 5FY1A 2I6HA 1VCSA 2XQ5A 2WDRA 2XY8B 2LEHA 2IHR1 1ZV4X 4IL9A 5JTGA 4GK5E 2UUCT 2E9XD 4OHFA 3UU8A 2XAFB 2ZM2A 4CQIA 2WBLA 3GMIA 3UFGA 4IDPA 4QXCB 3AE8A 4DUZT 3LFMA 5ADXL 4KBMB 2LLYA 3UQ7A 3TLWA 4DO0A 1IZNB 2M67A 4DV6T 2CXDA 3VHLA 4ZOLE 1XNRT 1D1AA 3N9QA 2LRKA 1WR6A 4AKHA 2YOEA 4PAGA 2FJDA 4JI4T 1XDPA 3PJAJ 4CI3B 5LHIB 4COFA 4B3MT 4HGAA 2MTQA 3E08A 2XSAA 3AE1A 4LMLA 2XQ3A 4TWFA 3QOFA 2OV9A 4I50E 4KP3C 2KXPB 3R84B 1N36T 2D5UA 2XASB 5AQPB 1HX8A 4EYUA 3IBPA 1XDOA 2DNXA 4L0RA 1Y01A 2V6YB 3T1YT 3ONJA 1MIVA 1S94A 4DMVA 2H3RA 3MXZA 2ZMAA 4UVCB 4CXWA 5HEOA 3AE5A 3NZPA 5EK3A 4AIUA 3P8CD 2KT9A 3N9MA 3K3NA 2W00A 3OPCA 4LMJA 5FMNA 3TLUA 3I9WA 2LOPA 3KV9A 3J7Yq 4JI1T 1HF8A 4ILCA 5HEHA 5EK4A 4ZI2D 2X9XA 2X9YA 2VK9A 3FXEB 3OJAA 5LNKA 4XBFB 4A5XA 1UUSA 2VB6A 1L0VA 3AE7A 5EK2A 3PUSA 3ZYKA 4L5GA 4QX7B 5LOVE 4C90A 4DV3T 1M62A 2X0LB 1UK5A 2YK0A 4LFCT 2QVAA 4FI5A 4Z90A 3RYFE 5AQQB 3ZMVB 3NKZA 2J1DG 3O1JA 3NVOA 3MA9A 4JLEA 1KFYA 5CB4E 2X68A 4UV9B 2KSRA 2H88A 1Z0PA 4EIWA 3T8OA 4MALA 4YJ2E 3VR9A 5F5WA 5DJQC 2J47A 5FY7A 4LFBT 2Q9QC 1GQEA 4CN4A 4YJ3E 2YEVC 3FXDB 1MNDA 1W09A 1NENA 5JR9C 4YT0A 5HEJA 2WQYA 3O1IA 3FB2A 4QH4A 4ZZCA 4KUMB 3F31A 5JDFA 2IC6A 3A7MA 3O9XA 2PFVA 5J2TE 2X9WA 4IDOA 2W67A 4A97A 4ZEYA 4LF8T 3RIFA 3JAFA 3HKCE 2WZIA 1MIYA 2L9QA 1HR0T 3KV4A 1N34T 3FZHB 2XSBA 1YQ4A 3LJCA 1MIWA 4U7YA 3ZYMA 1SUMB 2PG8A 2LRLA 2FJEA 4YTMA 4DIDB 3ZYLA 5IUXA 5HXCA 2XQ9A 4E7ZA 1FIOA 3UUBA 3AAAB 3MZKB 4HFIA 1JNZA 4Z8XA 3Q5XA 1KNZA 1B7TA 3C51A 5L3GB 5J0ZA 2XAJB 5ABFA 4O8SA 2VQET 2X67A 3K8PC 5LBQB 5LG4A 2V5CA 4O4JE 4IE7A 4JI5T 3LG7A 4AQFA 1HG2A 5HEGA 3EHZA 4NUVA 3PJAA 4J2CA 2CBIA 5LP6E 2DLRA 5FY0A 2A3DA 2HPJA 3AE9A 3PUAA 1VRBA 3RIUA 4TX5A 3E22E 5JQGE 3EAMA 4DV7T 1HX1B 2JQKA 3EVYA 5AQLB 1HS7A 3UU3A 3IEEA 5L3CB 3PDYA 3HI2A 2E5VA 2LOSA 1HNZT 2UXNB 3AE6A 4LF9T 3VRBA 5LHGB 2WZHA 1U5PA 4DV5T 2W62A 3FZKB 1BR1A 1E2AA 3TLVA 1BR4A 4IT4A 2B1EA 2WS3A 2ZLYA 3AA1B 5JRCA 1E7PA 3GWHA 3CX7B 5FKYA 4UVAB 4DNDA 3EDVA 1I6ZA 2WSSV 5HWYA 3AAIA 2BKPA 4G2AA 4H9PC 4OX9T 1NWMX 2BVMA 3FHNA 4MFRA 2IDOB 4TWHA 2LSKA 5L2LA 3I0QA 2CBJA 4IIJE 2YN6A 1KF6A 1X9BA 2V7MA 2JMHA 5E0OA 1XMQT 2VKHA 4TNWA 2L8KA 5FXXA 1HFAA 2LSGA 3EDUA 3RYHE 2C5JA 4OYKA 5JDMA 3L09A 2E9XA 2DL1A 3N2OA 2CEAA 4YY3T 5KX5E 3N2GE 2B76A 3Q2MA 4BAYB 4DVDA 2JIWA 1Z8UA 3I9YA 2BS2A 5FXZA 4LFAT 4DV0T 2WB5A 3WAKA 3L8RA 4O4HE 5CJ5A 3A5XA 1WFDA 3N9LA 2BS3A 3SFEA 5ABGA 2NP9A 1UX5A 2Y8DA 2VQFT 3F57A 4P09A 4GKJT 4X5TA 5JDQA 5ETWA 3ONLC 4PFOA 4CN1A 5FVKA 1D1BA 3RQWA 5HCJA 1D0XA 4OYJA 3OKQA 1WLXA 1VOMA 3RX6A 3O4XE 2EHOC 2EHOD 2NTYA 3RI5A 3ONXA 5FXVA 4EAHA 4NUUA 3MACA 3P4PA 2KWIB 3CVRA 2XHEB 3AEFA 4YTPA 4EXTA 2JJ9A 1Y64B 5ABFB 5M4YA 4LF6T 2V6XA 2UXDT 5L3BB 2BS4A 2V7JA 5L3FB 3AE3A 5GONE 4TN7B 1WRDA 5CFBA 2CWOA 4AKRB 5JDHA 2CE7A 5LGUB 4QWNB 5L3EB 1IBMT 2BG9A 2LM9A 1WYCA 2KINB 1T72A 3ZMUB 4UV8B 3RIAA 4DR7T 1HG5A 3KBTA 2XQ8A 3K1SA 2P9BA 2WU5A 3ZT6A 4O4LE 3EABA 4NXNT 3PUZF 4H9QC 4AISA 1ZHCA 2ODVA 4G63A 3KDSE 2VL8A 4AKIA 2NW9A 2N1GA 5HYAA 1ZEEA 2YU2A 2PJQA 3AVRA 4EZ4A 4PK6A 4JI6T 2X0HA 3PTRB 2LT3A 1MNEA 3LBXA 2DWKA 3ZPOA 1XWMA 2M6BA 5JRCB 3KV6A 2X51A 1J5WA 2C0SA 3N2KE 4IDZA 2CXFA 2GK9A 1G73A 4LF4T 1UURA 2V7IA 1YQ3A 3N9OA 2BVLA 2WDQA 4EGWA 3P4SA 1T98A 4ZS3A 5FL0A 5BR8T 5C8YE 2K24A 1FMWA 4MHCA 4PFPA 3N5LA 3TLTA 1HNWT 4B6XA 2VASA 4WBNE 2RP4A 4JI0T 2IAKA 4X1IE 5JVDE 4AKGA 2V7LA 1DU2A 3ZC1A 2G0UA 2WY2A 3UFEA 3P50A 4EV6A 5AQMB 3UUMA 1H7CA 3KVBA 3RGLA 4BJNA 4KMCA 3KVAA 3RPUA 3MK7C 2BZBA 4Z91A 1WCRA 2E9XB 3JAEA 4X66T 3FZLB 4UELA 4WW0A 2IC9A 4YHHT 4DR4T 5CA0E 2MYSA 2NOXA 3CQCB 3OVUA 5AQJB 4H9OC 2I0MA 4GK0E 2CLYC 1S35A 4HEAA 2V7KA 1NAFA 3SFDA 2CMRA 3F2EA 2ZM6T 3C64A 4MBQA 4QX8B 3J9X1 4QKNA 5JDLA 2LHRA 2A2FX 4X1KE 5TAOA 4DV2T 4KI0F 3H3AA 3ZT7A 3QUJA 3K3OA 3RH3A 2W66A 2Z6EA 5FVLA 2VKJA 4HFHA 4HWCA 2KNDA 3L39A 5HXEA 5L4HA 4UF0B 3ZN0B 5KXJA 2V8SV 2W4XA 1W0AA 4LMKA 1KNRA 4CN6A 4ZXLA 2HN2A 4JUYA 1CHUA 5LA6E 4BA9A 4JI7T 2Q9QD 2LKGA 2W0GA 2A9UA 5ABEA 2J4GA 2BG9B 3ZLIA 2SPCA 2A72A 3ZJ2A 2KMFA 3AE4A 3P4RA 4QH5A 4F8HA 2WMNA 5LHHB 5LYJE 2QGSA 2CHOA 2XQ7A 4EEBA 2D0TA 5AQTB 3CWZB 1QSDA 2UU9T 2RA1A 4O2AE 1LVFA 4M1PA 2F4VT 4DR3T 3QC9A 3LBXB 5AQVB 2IW5B 4JEHB 5JH7E 2N9DA 2VVNA 4X65T 2K3WA 4ISTA 3B57A 2MOZA 4U7IA 1OEDC 3C50A 1YKEB 2BKNA 4UEMA 5H6QB 4ZZBA 4IHJE 4WZXA 2LHNA 3ZJ1A 2CCQA 1LKXA 2KWHA 5LXTE 4DR2T 4U33A 2XAQB 4QXHB 3I1AA 5AFUL 2VURA 3CX8B 4ZI3C 3P4WA 3ETVA 4CI1B 4X62T 5HCMA 4ZI7E 5C3JA 4NPPA 2K9AA 1ZP0A 2YDSA 3LSVA 1LRZA 1BR0A 3C4WA 3M3ZB 3SRZA 3L3PA 4PW8A 1N33T 4EZHA 1IJ5A 2FJBA 2BKOA 2KZ7B 3DTOA 3AA7B 2W63A 3JADA 4A56A 4JI3T 3AXJA 5H6RB 5LBMA 1IJ6A 1XNQT 2L3LA 2MAWA 2DHRA 4IDNA 3ANWA 4ASKA 1HTJF 2H89A 4GIWA 3TLSA 2AE9A 4U2ZA 1CUNA 3FZFB 1HCIA 4UR9A 4X64T 4JI8T 3ZEFB 2CPTA 3PE0A 1V9DA 4PJJA 4WBOA 4IE5A 3ZCIA 4DR1T 1IBLT 2UXBT 4HFVA 1ZOYA 2I59A 2IIUA 4EOZB 3N9NA 1JNRA 4UXNB 3RRCA 5HEUA 2N2NA 2X0YA 2CA5A 4YTNA 2XAHB 1EZ3A 2XM2A 4IE6A 1W9RA 2UXCT 2IUBA 4JEUB 3AB3B 3QNUA 3C98B 3U78A 3CX6B 4C91A 2K48A 4DUYT 3V5UA 4HFBA 1HNXT 3EUHA 2QA7A 2YU1A 2V5DA 2ES0A 3O1HA 4AQFC 4HWIB 4Q25A 2DI4A 3C4ZA 3B13A 3PUWF 5FXWA 4YHJA 1J1JA 5HAXA 3C4XA 2XUEA 4N78D 4DV4T 5AQSB 3NZQA 3JC6C 3JC6D 4JBWF 3AEGA 2XQAA 3NWIA 2HN1A 3KBUA 3QB5A 3RLFF 2VKOA 1YD8G 4KX6A 3ZSTA 3HKBE 5FP3A 1T7SA 2CRBA 4GKKT 4GOUA 1R8IA 3AA6B 3CQGB 1FJGT 1YW0A 3ZN1B 3LK2B 2ACZA 4E7SA 2NR4A 2LSIA 4UF0A 3BQKA 4A98A 3HL6A 1VCTA 4HWHA 3PURA 3UU6A 1FEWA 2UXXB 3FZMB 4X1YE 3RKGA 2R6GF 2WCAA 3CK6A 3AE2A 2Y6XA 2D9DA 4ILUA 3BK9A 4TUYE 3EI0A 1ZKEA 2M6IA 3PUQA 3MKDA 2XQYA 4H63H 3X1DA 3ZKRA 2CXLA 5JREA 4NXMT 4B3ST 1UCUA 2IMLA 1YKHB 5HXSA 4DV1T 5J1GA 3LK42 2ZM0A 5DQVA 5LMUT 2JRKA 4LF7T 1UGOA 4X20E 2MBGA 4PNIA 1W0BA 2E9XC 3IHRA 4UVBB 1J5ET 4HWDA 3SWHA 2HH7A 3VKHA 5AQGB 3AXJB 3AAEB 5F3JA 2W61A 4ZHQE 3N9PA 2FUPA 2WP9A 3ANWB 1OEDE 2CM0A 3H37A 3CKDA 4K0KT 3SS1A 2MPKA 3AECA 3G06A 1FMVA 1BR2A 4JYAT 5HXHA 5JDNA 5F8PA 4H9NC 2XQ4A 4EEDA 4HKAA 4EYYR 2EHOB 2H7OA 3W15B 3IA3A 1IAPA 3CIRA 3BQIA 1MMNA 2HPLA 3RC3A 3UT5E 2BBHA 1SE7A 5AQHB 3PU3A 2VVSA 3T1HT 3FBLA 1SA0E 3E0ZA 3B5MA 2NTXA 4HFCA 4DMWA 4EB6E 2LJLA 4H63V 5DQWA 2UUAT 2YDRA 2Q9QA 5LB7B 3RYCE 5JR9A 1I94T 2LKHA 3RKOA 5CGMA 4U31A 3P4QA 3ZMZB 5CA1E 4I43B 4JV5T 2NW7A 3KV5A 4OFZA 2YINA 5LG3A 5DABA 2BG9C 1US7B 4FJOA 4K0UA 2PBIA 2WWUA 2FJAA 3KFWX 4YLHA 4ZI2C 4HN9A 4TWDA 5AQUB 1NEKA 4CXYA 4AQGA 2JPFA 2AXDS 1MMAA 4ISSA 3QK6A 1OEDA 4IGUA 3BQLA 1D0ZA 3LK3B 2ODUA 3ESLA 4DBQA 3ZSSA 2ZM8A 4I55E 4AQYT 2WM9A 3WAJA 2JQHA 4IE0A 3ZCJA 3V5SA 3FBZA 4WYVA 4AI6A 3AEDA 2Y48B 2DCFA 5L4EA 4ANJA 4GYRA 2NW8A 4TV8E 2D2SA 3NRXA 4P1NA 1QUUA 1XZYA 3ZMTB 3DJBA 1T8BA 4KHPT 4I0UA 3IF8B 4ILAA 1X79A 2DWGA 3A8YC 4KHZF 4XAXB 4H9RC 5KDMC 1QLBA 4U74A 4B3TT 3ETUA 2OA5A 4PJMA 1D0YA 3OYXA 3RQUA 2JMKA 5LMNT 3DP7A 5KMGP 5L3DB 2XQ6A 3GN5A 3LDQB 2CLYB 2NWBA 5JDGA 5AQNB 3UQ4A 1MMDA 2ACXA 3NBXX 2LM2A 4HTEA 4IE4A 5LGNB 3UU4A 3AEAA 4U3CA 3RF1A 4XZCA 5LJNA 5AQOB 4P0AA 2XM1A 3PUXF 2CHNA 3P7IA 2WMOA 4CI2B 3UUNA 5AQIB 1LVKA 4WNKA 5C2TA 5EZYE 5AQKB 1OXZA 4IDQA 2LSYA 2LSJA 4PJLA 2D0UA 3D0TA 4YSZA 2E5LT 3MJXA 4ADZA 2VKDA 5J2UE 4ZI3D 4ERRA 2J62A 1MMGA 3ZT5A 2C5KT 4QXBB 4ZS2A 4F6RC 2E8IA 3KINB 4DR5T 3RC8A 2Q9QB 2JQ9A 4P0BA 2YKSA 3OBVE 5JR9B
chains in the Genus database with same CATH topology
5AQTB 1M62A 5AQHB 1UK5A 5AQJB 3FZHB 3FZMB 4HWIB 2D9DA 1I6ZA 4HWCA 5AQRB 5AQGB 5AQVB 3FZFB 5AQIB 3FZLB 5AQKB 5AQQB 3FZKB 3LDQB 5AQUB 1HX1B 1UGOA 5AQLB 5AQMB 3A8YC 4HWFA 5AQFB 3M3ZB 1M7KA 5AQSB 5AQNB 4HWDA 1T7SA 5AQOB 4HWHA 5AQPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQT B;  1M62 A;  5AQH B;  1UK5 A;  5AQJ B;  3FZH B;  3FZM B;  4HWI B;  2D9D A;  1I6Z A;  4HWC A;  5AQR B;  5AQG B;  5AQV B;  3FZF B;  5AQI B;  3FZL B;  5AQK B;  5AQQ B;  3FZK B;  3LDQ B;  5AQU B;  1HX1 B;  1UGO A;  5AQL B;  5AQM B;  3A8Y C;  4HWF A;  5AQF B;  3M3Z B;  1M7K A;  5AQS B;  5AQN B;  4HWD A;  1T7S A;  5AQO B;  4HWH A;  5AQP B; 
#chains in the Genus database with same CATH topology
 3PU8 A;  4TNV A;  3QB5 K;  4B3R T;  2WAU A;  5LGT B;  3AEB A;  1N32 T;  5IHY A;  4GYS A;  4QH1 A;  5IWA T;  3UU5 A;  3HA4 A;  2XJ7 A;  2LE8 A;  3OTO T;  3R6N A;  3VRA A;  5ABH A;  5LJM A;  4YFS A;  3ZMS B;  4O2B E;  3UUX B;  3I0O A;  4O4I E;  2EHO A;  3OYZ A;  2X66 A;  3K3Q C;  3Q5D A;  2WWV A;  3ABV A;  1OED B;  2OLT A;  5FL1 A;  1U4Q A;  2VWA A;  3HKE E;  3PUY F;  2KLQ A;  3NRY A;  2YDQ A;  1SHZ C;  2V26 A;  3JCF A;  4HFD A;  4HFE A;  4UIG A;  2XZE A;  1XMO T;  3H3M A;  2FBW A;  5BMV E;  4U2Y A;  3Q9D A;  4NIQ A;  1G8X A;  3CML A;  4AKL A;  1KK7 A;  4V1A v;  2V6Y A;  3CPZ A;  4CXX A;  2VL0 A;  4IRE A;  4TZ4 C;  3RHW A;  3VKG A;  2C5I T;  2BG9 E;  3AEE A;  2XTL A;  2CWY A;  3PUG A;  2QYW A;  4U72 A;  4HE8 A;  5A1L A;  2WU2 A;  1E1H B;  1O3X A;  3AVS A;  2UUB T;  3CQX C;  4I4T E;  3PV0 F;  4HWF A;  3RIU C;  5HXR A;  4ILB A;  1M7K A;  3HR0 A;  1IBK T;  5LCY A;  1WR0 A;  3GA8 A;  2W2U A;  4DBR A;  2H7V C;  5AQR B;  4CZZ B;  3GN5 B;  4LF5 T;  1AJ3 A;  3WI3 A;  2E2A A;  2BDE A;  5FYM A;  3RYI E;  5L47 A;  2V1D B;  4PK4 A;  4PK5 A;  5AQF B;  5IYZ E;  1OWA A;  1KEY A;  5HWX A;  4PJN A;  2BBJ A;  1UX4 A;  3ZC0 A;  1WYB A;  4DR6 T;  3Q5E A;  3UUL A;  4H9S E;  3S4U A;  4QHO A;  2RPA A;  4JI2 T;  1YXR A;  2HHH T;  2K5B B;  4YSY A;  3PUV F;  1D1C A;  4OK0 A;  2WDV A;  3AA0 B;  5FNV E;  3Q5W A;  3HKD E;  4MLK A;  3SOL A;  4YXD A;  2JQQ A;  3VU7 H;  3TKL B;  4YSX A;  3VR8 A;  3RRW A;  2XAG B;  2XPK A;  3UTK A;  3U3I A;  4TV9 E;  2PTF A;  4AXP A;  1KNP A;  4L9I A;  4BJM A;  4IL4 A;  3M65 A;  2QRX A;  2X9H A;  5FY1 A;  2I6H A;  1VCS A;  2XQ5 A;  2WDR A;  2XY8 B;  2LEH A;  2IHR 1;  1ZV4 X;  4IL9 A;  5JTG A;  4GK5 E;  2UUC T;  2E9X D;  4OHF A;  3UU8 A;  2XAF B;  2ZM2 A;  4CQI A;  2WBL A;  3GMI A;  3UFG A;  4IDP A;  4QXC B;  3AE8 A;  4DUZ T;  3LFM A;  5ADX L;  4KBM B;  2LLY A;  3UQ7 A;  3TLW A;  4DO0 A;  1IZN B;  2M67 A;  4DV6 T;  2CXD A;  3VHL A;  4ZOL E;  1XNR T;  1D1A A;  3N9Q A;  2LRK A;  1WR6 A;  4AKH A;  2YOE A;  4PAG A;  2FJD A;  4JI4 T;  1XDP A;  3PJA J;  4CI3 B;  5LHI B;  4COF A;  4B3M T;  4HGA A;  2MTQ A;  3E08 A;  2XSA A;  3AE1 A;  4LML A;  2XQ3 A;  4TWF A;  3QOF A;  2OV9 A;  4I50 E;  4KP3 C;  2KXP B;  3R84 B;  1N36 T;  2D5U A;  2XAS B;  5AQP B;  1HX8 A;  4EYU A;  3IBP A;  1XDO A;  2DNX A;  4L0R A;  1Y01 A;  2V6Y B;  3T1Y T;  3ONJ A;  1MIV A;  1S94 A;  4DMV A;  2H3R A;  3MXZ A;  2ZMA A;  4UVC B;  4CXW A;  5HEO A;  3AE5 A;  3NZP A;  5EK3 A;  4AIU A;  3P8C D;  2KT9 A;  3N9M A;  3K3N A;  2W00 A;  3OPC A;  4LMJ A;  5FMN A;  3TLU A;  3I9W A;  2LOP A;  3KV9 A;  3J7Y q;  4JI1 T;  1HF8 A;  4ILC A;  5HEH A;  5EK4 A;  4ZI2 D;  2X9X A;  2X9Y A;  2VK9 A;  3FXE B;  3OJA A;  5LNK A;  4XBF B;  4A5X A;  1UUS A;  2VB6 A;  1L0V A;  3AE7 A;  5EK2 A;  3PUS A;  3ZYK A;  4L5G A;  4QX7 B;  5LOV E;  4C90 A;  4DV3 T;  1M62 A;  2X0L B;  1UK5 A;  2YK0 A;  4LFC T;  2QVA A;  4FI5 A;  4Z90 A;  3RYF E;  5AQQ B;  3ZMV B;  3NKZ A;  2J1D G;  3O1J A;  3NVO A;  3MA9 A;  4JLE A;  1KFY A;  5CB4 E;  2X68 A;  4UV9 B;  2KSR A;  2H88 A;  1Z0P A;  4EIW A;  3T8O A;  4MAL A;  4YJ2 E;  3VR9 A;  5F5W A;  5DJQ C;  2J47 A;  5FY7 A;  4LFB T;  2Q9Q C;  1GQE A;  4CN4 A;  4YJ3 E;  2YEV C;  3FXD B;  1MND A;  1W09 A;  1NEN A;  5JR9 C;  4YT0 A;  5HEJ A;  2WQY A;  3O1I A;  3FB2 A;  4QH4 A;  4ZZC A;  4KUM B;  3F31 A;  5JDF A;  2IC6 A;  3A7M A;  3O9X A;  2PFV A;  5J2T E;  2X9W A;  4IDO A;  2W67 A;  4A97 A;  4ZEY A;  4LF8 T;  3RIF A;  3JAF A;  3HKC E;  2WZI A;  1MIY A;  2L9Q A;  1HR0 T;  3KV4 A;  1N34 T;  3FZH B;  2XSB A;  1YQ4 A;  3LJC A;  1MIW A;  4U7Y A;  3ZYM A;  1SUM B;  2PG8 A;  2LRL A;  2FJE A;  4YTM A;  4DID B;  3ZYL A;  5IUX A;  5HXC A;  2XQ9 A;  4E7Z A;  1FIO A;  3UUB A;  3AAA B;  3MZK B;  4HFI A;  1JNZ A;  4Z8X A;  3Q5X A;  1KNZ A;  1B7T A;  3C51 A;  5L3G B;  5J0Z A;  2XAJ B;  5ABF A;  4O8S A;  2VQE T;  2X67 A;  3K8P C;  5LBQ B;  5LG4 A;  2V5C A;  4O4J E;  4IE7 A;  4JI5 T;  3LG7 A;  4AQF A;  1HG2 A;  5HEG A;  3EHZ A;  4NUV A;  3PJA A;  4J2C A;  2CBI A;  5LP6 E;  2DLR A;  5FY0 A;  2A3D A;  2HPJ A;  3AE9 A;  3PUA A;  1VRB A;  3RIU A;  4TX5 A;  3E22 E;  5JQG E;  3EAM A;  4DV7 T;  1HX1 B;  2JQK A;  3EVY A;  5AQL B;  1HS7 A;  3UU3 A;  3IEE A;  5L3C B;  3PDY A;  3HI2 A;  2E5V A;  2LOS A;  1HNZ T;  2UXN B;  3AE6 A;  4LF9 T;  3VRB A;  5LHG B;  2WZH A;  1U5P A;  4DV5 T;  2W62 A;  3FZK B;  1BR1 A;  1E2A A;  3TLV A;  1BR4 A;  4IT4 A;  2B1E A;  2WS3 A;  2ZLY A;  3AA1 B;  5JRC A;  1E7P A;  3GWH A;  3CX7 B;  5FKY A;  4UVA B;  4DND A;  3EDV A;  1I6Z A;  2WSS V;  5HWY A;  3AAI A;  2BKP A;  4G2A A;  4H9P C;  4OX9 T;  1NWM X;  2BVM A;  3FHN A;  4MFR A;  2IDO B;  4TWH A;  2LSK A;  5L2L A;  3I0Q A;  2CBJ A;  4IIJ E;  2YN6 A;  1KF6 A;  1X9B A;  2V7M A;  2JMH A;  5E0O A;  1XMQ T;  2VKH A;  4TNW A;  2L8K A;  5FXX A;  1HFA A;  2LSG A;  3EDU A;  3RYH E;  2C5J A;  4OYK A;  5JDM A;  3L09 A;  2E9X A;  2DL1 A;  3N2O A;  2CEA A;  4YY3 T;  5KX5 E;  3N2G E;  2B76 A;  3Q2M A;  4BAY B;  4DVD A;  2JIW A;  1Z8U A;  3I9Y A;  2BS2 A;  5FXZ A;  4LFA T;  4DV0 T;  2WB5 A;  3WAK A;  3L8R A;  4O4H E;  5CJ5 A;  3A5X A;  1WFD A;  3N9L A;  2BS3 A;  3SFE A;  5ABG A;  2NP9 A;  1UX5 A;  2Y8D A;  2VQF T;  3F57 A;  4P09 A;  4GKJ T;  4X5T A;  5JDQ A;  5ETW A;  3ONL C;  4PFO A;  4CN1 A;  5FVK A;  1D1B A;  3RQW A;  5HCJ A;  1D0X A;  4OYJ A;  3OKQ A;  1WLX A;  1VOM A;  3RX6 A;  3O4X E;  2EHO C;  2EHO D;  2NTY A;  3RI5 A;  3ONX A;  5FXV A;  4EAH A;  4NUU A;  3MAC A;  3P4P A;  2KWI B;  3CVR A;  2XHE B;  3AEF A;  4YTP A;  4EXT A;  2JJ9 A;  1Y64 B;  5ABF B;  5M4Y A;  4LF6 T;  2V6X A;  2UXD T;  5L3B B;  2BS4 A;  2V7J A;  5L3F B;  3AE3 A;  5GON E;  4TN7 B;  1WRD A;  5CFB A;  2CWO A;  4AKR B;  5JDH A;  2CE7 A;  5LGU B;  4QWN B;  5L3E B;  1IBM T;  2BG9 A;  2LM9 A;  1WYC A;  2KIN B;  1T72 A;  3ZMU B;  4UV8 B;  3RIA A;  4DR7 T;  1HG5 A;  3KBT A;  2XQ8 A;  3K1S A;  2P9B A;  2WU5 A;  3ZT6 A;  4O4L E;  3EAB A;  4NXN T;  3PUZ F;  4H9Q C;  4AIS A;  1ZHC A;  2ODV A;  4G63 A;  3KDS E;  2VL8 A;  4AKI A;  2NW9 A;  2N1G A;  5HYA A;  1ZEE A;  2YU2 A;  2PJQ A;  3AVR A;  4EZ4 A;  4PK6 A;  4JI6 T;  2X0H A;  3PTR B;  2LT3 A;  1MNE A;  3LBX A;  2DWK A;  3ZPO A;  1XWM A;  2M6B A;  5JRC B;  3KV6 A;  2X51 A;  1J5W A;  2C0S A;  3N2K E;  4IDZ A;  2CXF A;  2GK9 A;  1G73 A;  4LF4 T;  1UUR A;  2V7I A;  1YQ3 A;  3N9O A;  2BVL A;  2WDQ A;  4EGW A;  3P4S A;  1T98 A;  4ZS3 A;  5FL0 A;  5BR8 T;  5C8Y E;  2K24 A;  1FMW A;  4MHC A;  4PFP A;  3N5L A;  3TLT A;  1HNW T;  4B6X A;  2VAS A;  4WBN E;  2RP4 A;  4JI0 T;  2IAK A;  4X1I E;  5JVD E;  4AKG A;  2V7L A;  1DU2 A;  3ZC1 A;  2G0U A;  2WY2 A;  3UFE A;  3P50 A;  4EV6 A;  5AQM B;  3UUM A;  1H7C A;  3KVB A;  3RGL A;  4BJN A;  4KMC A;  3KVA A;  3RPU A;  3MK7 C;  2BZB A;  4Z91 A;  1WCR A;  2E9X B;  3JAE A;  4X66 T;  3FZL B;  4UEL A;  4WW0 A;  2IC9 A;  4YHH T;  4DR4 T;  5CA0 E;  2MYS A;  2NOX A;  3CQC B;  3OVU A;  5AQJ B;  4H9O C;  2I0M A;  4GK0 E;  2CLY C;  1S35 A;  4HEA A;  2V7K A;  1NAF A;  3SFD A;  2CMR A;  3F2E A;  2ZM6 T;  3C64 A;  4MBQ A;  4QX8 B;  3J9X 1;  4QKN A;  5JDL A;  2LHR A;  2A2F X;  4X1K E;  5TAO A;  4DV2 T;  4KI0 F;  3H3A A;  3ZT7 A;  3QUJ A;  3K3O A;  3RH3 A;  2W66 A;  2Z6E A;  5FVL A;  2VKJ A;  4HFH A;  4HWC A;  2KND A;  3L39 A;  5HXE A;  5L4H A;  4UF0 B;  3ZN0 B;  5KXJ A;  2V8S V;  2W4X A;  1W0A A;  4LMK A;  1KNR A;  4CN6 A;  4ZXL A;  2HN2 A;  4JUY A;  1CHU A;  5LA6 E;  4BA9 A;  4JI7 T;  2Q9Q D;  2LKG A;  2W0G A;  2A9U A;  5ABE A;  2J4G A;  2BG9 B;  3ZLI A;  2SPC A;  2A72 A;  3ZJ2 A;  2KMF A;  3AE4 A;  3P4R A;  4QH5 A;  4F8H A;  2WMN A;  5LHH B;  5LYJ E;  2QGS A;  2CHO A;  2XQ7 A;  4EEB A;  2D0T A;  5AQT B;  3CWZ B;  1QSD A;  2UU9 T;  2RA1 A;  4O2A E;  1LVF A;  4M1P A;  2F4V T;  4DR3 T;  3QC9 A;  3LBX B;  5AQV B;  2IW5 B;  4JEH B;  5JH7 E;  2N9D A;  2VVN A;  4X65 T;  2K3W A;  4IST A;  3B57 A;  2MOZ A;  4U7I A;  1OED C;  3C50 A;  1YKE B;  2BKN A;  4UEM A;  5H6Q B;  4ZZB A;  4IHJ E;  4WZX A;  2LHN A;  3ZJ1 A;  2CCQ A;  1LKX A;  2KWH A;  5LXT E;  4DR2 T;  4U33 A;  2XAQ B;  4QXH B;  3I1A A;  5AFU L;  2VUR A;  3CX8 B;  4ZI3 C;  3P4W A;  3ETV A;  4CI1 B;  4X62 T;  5HCM A;  4ZI7 E;  5C3J A;  4NPP A;  2K9A A;  1ZP0 A;  2YDS A;  3LSV A;  1LRZ A;  1BR0 A;  3C4W A;  3M3Z B;  3SRZ A;  3L3P A;  4PW8 A;  1N33 T;  4EZH A;  1IJ5 A;  2FJB A;  2BKO A;  2KZ7 B;  3DTO A;  3AA7 B;  2W63 A;  3JAD A;  4A56 A;  4JI3 T;  3AXJ A;  5H6R B;  5LBM A;  1IJ6 A;  1XNQ T;  2L3L A;  2MAW A;  2DHR A;  4IDN A;  3ANW A;  4ASK A;  1HTJ F;  2H89 A;  4GIW A;  3TLS A;  2AE9 A;  4U2Z A;  1CUN A;  3FZF B;  1HCI A;  4UR9 A;  4X64 T;  4JI8 T;  3ZEF B;  2CPT A;  3PE0 A;  1V9D A;  4PJJ A;  4WBO A;  4IE5 A;  3ZCI A;  4DR1 T;  1IBL T;  2UXB T;  4HFV A;  1ZOY A;  2I59 A;  2IIU A;  4EOZ B;  3N9N A;  1JNR A;  4UXN B;  3RRC A;  5HEU A;  2N2N A;  2X0Y A;  2CA5 A;  4YTN A;  2XAH B;  1EZ3 A;  2XM2 A;  4IE6 A;  1W9R A;  2UXC T;  2IUB A;  4JEU B;  3AB3 B;  3QNU A;  3C98 B;  3U78 A;  3CX6 B;  4C91 A;  2K48 A;  4DUY T;  3V5U A;  4HFB A;  1HNX T;  3EUH A;  2QA7 A;  2YU1 A;  2V5D A;  2ES0 A;  3O1H A;  4AQF C;  4HWI B;  4Q25 A;  2DI4 A;  3C4Z A;  3B13 A;  3PUW F;  5FXW A;  4YHJ A;  1J1J A;  5HAX A;  3C4X A;  2XUE A;  4N78 D;  4DV4 T;  5AQS B;  3NZQ A;  3JC6 C;  3JC6 D;  4JBW F;  3AEG A;  2XQA A;  3NWI A;  2HN1 A;  3KBU A;  3QB5 A;  3RLF F;  2VKO A;  1YD8 G;  4KX6 A;  3ZST A;  3HKB E;  5FP3 A;  1T7S A;  2CRB A;  4GKK T;  4GOU A;  1R8I A;  3AA6 B;  3CQG B;  1FJG T;  1YW0 A;  3ZN1 B;  3LK2 B;  2ACZ A;  4E7S A;  2NR4 A;  2LSI A;  4UF0 A;  3BQK A;  4A98 A;  3HL6 A;  1VCT A;  4HWH A;  3PUR A;  3UU6 A;  1FEW A;  2UXX B;  3FZM B;  4X1Y E;  3RKG A;  2R6G F;  2WCA A;  3CK6 A;  3AE2 A;  2Y6X A;  2D9D A;  4ILU A;  3BK9 A;  4TUY E;  3EI0 A;  1ZKE A;  2M6I A;  3PUQ A;  3MKD A;  2XQY A;  4H63 H;  3X1D A;  3ZKR A;  2CXL A;  5JRE A;  4NXM T;  4B3S T;  1UCU A;  2IML A;  1YKH B;  5HXS A;  4DV1 T;  5J1G A;  3LK4 2;  2ZM0 A;  5DQV A;  5LMU T;  2JRK A;  4LF7 T;  1UGO A;  4X20 E;  2MBG A;  4PNI A;  1W0B A;  2E9X C;  3IHR A;  4UVB B;  1J5E T;  4HWD A;  3SWH A;  2HH7 A;  3VKH A;  5AQG B;  3AXJ B;  3AAE B;  5F3J A;  2W61 A;  4ZHQ E;  3N9P A;  2FUP A;  2WP9 A;  3ANW B;  1OED E;  2CM0 A;  3H37 A;  3CKD A;  4K0K T;  3SS1 A;  2MPK A;  3AEC A;  3G06 A;  1FMV A;  1BR2 A;  4JYA T;  5HXH A;  5JDN A;  5F8P A;  4H9N C;  2XQ4 A;  4EED A;  4HKA A;  4EYY R;  2EHO B;  2H7O A;  3W15 B;  3IA3 A;  1IAP A;  3CIR A;  3BQI A;  1MMN A;  2HPL A;  3RC3 A;  3UT5 E;  2BBH A;  1SE7 A;  5AQH B;  3PU3 A;  2VVS A;  3T1H T;  3FBL A;  1SA0 E;  3E0Z A;  3B5M A;  2NTX A;  4HFC A;  4DMW A;  4EB6 E;  2LJL A;  4H63 V;  5DQW A;  2UUA T;  2YDR A;  2Q9Q A;  5LB7 B;  3RYC E;  5JR9 A;  1I94 T;  2LKH A;  3RKO A;  5CGM A;  4U31 A;  3P4Q A;  3ZMZ B;  5CA1 E;  4I43 B;  4JV5 T;  2NW7 A;  3KV5 A;  4OFZ A;  2YIN A;  5LG3 A;  5DAB A;  2BG9 C;  1US7 B;  4FJO A;  4K0U A;  2PBI A;  2WWU A;  2FJA A;  3KFW X;  4YLH A;  4ZI2 C;  4HN9 A;  4TWD A;  5AQU B;  1NEK A;  4CXY A;  4AQG A;  2JPF A;  2AXD S;  1MMA A;  4ISS A;  3QK6 A;  1OED A;  4IGU A;  3BQL A;  1D0Z A;  3LK3 B;  2ODU A;  3ESL A;  4DBQ A;  3ZSS A;  2ZM8 A;  4I55 E;  4AQY T;  2WM9 A;  3WAJ A;  2JQH A;  4IE0 A;  3ZCJ A;  3V5S A;  3FBZ A;  4WYV A;  4AI6 A;  3AED A;  2Y48 B;  2DCF A;  5L4E A;  4ANJ A;  4GYR A;  2NW8 A;  4TV8 E;  2D2S A;  3NRX A;  4P1N A;  1QUU A;  1XZY A;  3ZMT B;  3DJB A;  1T8B A;  4KHP T;  4I0U A;  3IF8 B;  4ILA A;  1X79 A;  2DWG A;  3A8Y C;  4KHZ F;  4XAX B;  4H9R C;  5KDM C;  1QLB A;  4U74 A;  4B3T T;  3ETU A;  2OA5 A;  4PJM A;  1D0Y A;  3OYX A;  3RQU A;  2JMK A;  5LMN T;  3DP7 A;  5KMG P;  5L3D B;  2XQ6 A;  3GN5 A;  3LDQ B;  2CLY B;  2NWB A;  5JDG A;  5AQN B;  3UQ4 A;  1MMD A;  2ACX A;  3NBX X;  2LM2 A;  4HTE A;  4IE4 A;  5LGN B;  3UU4 A;  3AEA A;  4U3C A;  3RF1 A;  4XZC A;  5LJN A;  5AQO B;  4P0A A;  2XM1 A;  3PUX F;  2CHN A;  3P7I A;  2WMO A;  4CI2 B;  3UUN A;  5AQI B;  1LVK A;  4WNK A;  5C2T A;  5EZY E;  5AQK B;  1OXZ A;  4IDQ A;  2LSY A;  2LSJ A;  4PJL A;  2D0U A;  3D0T A;  4YSZ A;  2E5L T;  3MJX A;  4ADZ A;  2VKD A;  5J2U E;  4ZI3 D;  4ERR A;  2J62 A;  1MMG A;  3ZT5 A;  2C5K T;  4QXB B;  4ZS2 A;  4F6R C;  2E8I A;  3KIN B;  4DR5 T;  3RC8 A;  2Q9Q B;  2JQ9 A;  4P0B A;  2YKS A;  3OBV E;  5JR9 B; 
#chains in the Genus database with same CATH homology
 5AQT B;  1M62 A;  5AQH B;  1UK5 A;  5AQJ B;  3FZH B;  3FZM B;  4HWI B;  2D9D A;  1I6Z A;  4HWC A;  5AQR B;  5AQG B;  5AQV B;  3FZF B;  5AQI B;  3FZL B;  5AQK B;  5AQQ B;  3FZK B;  3LDQ B;  5AQU B;  1HX1 B;  1UGO A;  5AQL B;  5AQM B;  3A8Y C;  4HWF A;  5AQF B;  3M3Z B;  1M7K A;  5AQS B;  5AQN B;  4HWD A;  1T7S A;  5AQO B;  4HWH A;  5AQP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...