3OKQA

Crystal structure of a core domain of yeast actin nucleation cofactor bud6
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
125
structure length
125
Chain Sequence
SSNRMYMEKSQTELGDLSDTLLSKVDDLQDVIEIMRKDVAERRSQPAKKKLETVSKDLENAQADVLKLQEFIDTEKPHWKKTWEAELDKVCEEQQFLTLQEELILDLKEDLGKALETFDLIKLCC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bud site selection protein 6
publication title Structure of the formin-interaction domain of the actin nucleation-promoting factor Bud6.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 62
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3okqA00
3ONXA 3OKQA
chains in the Genus database with same CATH superfamily
4YSXA 2ZM0A 3LDQB 4AIUA 3L8RA 1SUMB 5LJMA 5HEOA 2DNXA 5EK3A 2QA7A 3N2OA 3U78A 3AE8A 2VVSA 3RF1A 3PU8A 2ZM6T 4DR2T 3HKDE 5F3JA 2NOXA 1Z8UA 4UIGA 1BR2A 2YK0A 5FXXA 3JAEA 2E9XC 2V1DB 2NWBA 1KNRA 4YT0A 3J9X1 5EK4A 2DL1A 4U31A 1HR0T 3A8YC 3O1IA 4NUUA 3RYIE 2EHOA 4DR7T 2UU9T 4HWFA 3EDUA 1UK5A 2C5JA 1OXZA 2K9AA 3RC3A 1ZKEA 2CPTA 3ABVA 2H3RA 4DUYT 2LKHA 1D1BA 2CRBA 2XUEA 4GK5E 3RYFE 3ZEFB 1UURA 2CLYB 4QH5A 2V8SV 1YQ4A 3FB2A 2QGSA 2JMKA 3RIFA 3PDYA 5L4EA 2KZ7B 5KX5E 3CX7B 1O3XA 1HG5A 1UGOA 3NVOA 2LM9A 4EOZB 3F31A 3OYXA 1YW0A 5LB7B 5IHYA 5E0OA 2A9UA 5JRCB 4QKNA 5H6QB 2UXCT 1N33T 2HN2A 3AA7B 4JYAT 4DUZT 3O9XA 2B1EA 2OV9A 4WZXA 1XNRT 3KV4A 1MMDA 3N5LA 4B3TT 2V7LA 2K5BB 5LP6E 4O2AE 3H37A 3GN5B 3ESLA 3F2EA 5LG3A 3X1DA 4DVDA 2X67A 3RRWA 5DABA 3BQLA 3O4XE 3AE4A 5HYAA 3O1JA 4NXNT 3KFWX 2M67A 1MNDA 3C4XA 3ANWA 3I9YA 3C98B 3LFMA 4UVCB 4ILCA 1Z0PA 1VRBA 2PJQA 4QH1A 1NEKA 4DMWA 2XAHB 3RI5A 1LKXA 2M6IA 4P0AA 3MK7C 4ZI2D 2IC6A 1QUUA 5HXCA 4IE5A 2J47A 1NENA 2VKOA 3R84B 3UULA 4COFA 1ZP0A 1HS7A 4ISSA 4YJ3E 4DR3T 4CI2B 3N9OA 4CZZB 3QK6A 4EAHA 3MACA 2MYSA 3UU3A 3ZSTA 2XQ3A 1YXRA 4V1Av 4DR4T 4FI5A 4G63A 2YU2A 5TAOA 3VR9A 2VWAA 4HN9A 2UXDT 2UUCT 5FP3A 2YDQA 3HI2A 2RPAA 3EDVA 2WDQA 2LSGA 4LMLA 3Q5XA 4HFEA 3CX6B 4TWFA 2R6GF 3HL6A 2LSYA 3UU4A 5CGMA 5ADXL 3CQXC 2QYWA 1JNZA 2D9DA 4PK4A 5L3FB 2LSKA 2X9YA 2ZM8A 5JR9C 3HKCE 5AQQB 1LVFA 3N9QA 4ILAA 5JTGA 3KBTA 2XASB 3HKEE 3N2GE 4DNDA 3FBZA 2Q9QC 5JDQA 4HE8A 4EXTA 2YN6A 4CQIA 2C0SA 4NIQA 3FZKB 4IE7A 5LBMA 3AA6B 2CWOA 5JH7E 2LEHA 5BMVE 2X68A 3LG7A 4CI1B 4OHFA 3IF8B 2WS3A 1XMQT 2MPKA 1E2AA 4UR9A 3ZYMA 3PUSA 2ACZA 5GONE 5FXVA 3KV5A 3CK6A 4TWDA 4IL9A 3L09A 4CN4A 4UF0B 3KV6A 2V6XA 3BK9A 3JCFA 3TKLB 4LFCT 3RH3A 3ZMZB 3WAJA 4YSZA 4LF7T 3Q5WA 3H3MA 2LRLA 4HEAA 4DV1T 4QXCB 4GOUA 3GA8A 4LF4T 3FZMB 2QVAA 4OYJA 2ODUA 5LHIB 3ONXA 5ABHA 4IDOA 5J1GA 3UFEA 2JQQA 3I0QA 5AQIB 5HEJA 4DV5T 2FJAA 2H7OA 3SWHA 3K3OA 3MKDA 5A1LA 2J4GA 1G8XA 2CBIA 1V9DA 2CXFA 2LHNA 3RKGA 4O4HE 2FBWA 4JEUB 4DV6T 2AE9A 5L2LA 4JI4T 3CMLA 5H6RB 4H9SE 5AQGB 4ZI3D 4PAGA 3UUMA 4CN1A 2EHOC 4HGAA 1OEDB 1OEDE 3Q5EA 1S94A 2Y48B 3P50A 4MBQA 1X9BA 2LOPA 4H9PC 2P9BA 3ZN0B 4YY3T 4YTMA 2ACXA 1W9RA 4M1PA 2WDVA 4I0UA 4EB6E 1R8IA 3ZLIA 2CEAA 2Q9QD 3C51A 4CN6A 4QH4A 4IDQA 2IIUA 4QXBB 1QLBA 4TV8E 5AQHB 5JDNA 3HA4A 2E5LT 4B3MT 3T8OA 5ABFB 3SRZA 5JDLA 3RYHE 4TX5A 1D0ZA 4DMVA 4YXDA 3PU3A 2WAUA 5ABFA 5AQLB 3AVRA 2YDRA 5DQWA 1D1AA 3RPUA 2LSIA 3V5SA 4ZEYA 3B57A 4EYUA 2Q9QA 2D0UA 3FXEB 5JREA 1WRDA 5LJNA 4O2BE 3OTOT 4TN7B 5L3EB 1MIYA 3RQWA 2UXNB 3ZJ1A 4DBQA 2HPJA 4O4LE 4JI1T 4HFDA 1HF8A 3RX6A 3UUXB 5JDHA 2WSSV 2D5UA 3MA9A 5FVLA 4QXHB 2KMFA 5LHHB 3RKOA 4LFAT 3ZKRA 2FJBA 3NKZA 4PJLA 4KHZF 4ZI7E 3CWZB 4DIDB 4H9QC 1NAFA 2LLYA 4AKHA 3QB5K 4JBWF 2HPLA 4ILUA 3VRBA 3ZMUB 3I1AA 2PBIA 4AQYT 2K48A 4TWHA 2W2UA 4EGWA 2YU1A 2DWGA 5LXTE 1HCIA 4HFIA 2IC9A 5FY7A 4IE4A 2PTFA 4IDPA 2EHOD 2W67A 2WM9A 4IHJE 3P7IA 4ZI2C 1Y01A 3UQ4A 5CA1E 3OPCA 3SFEA 1L0VA 2BS3A 2A72A 4B3ST 4NUVA 5FXWA 4DV2T 4DV0T 2JQKA 4LFBT 1UX5A 3NZPA 5FYMA 3PJAJ 3ZC1A 4LMJA 4X1YE 2XQ8A 1WCRA 4TUYE 2UUBT 5FVKA 5JDMA 1XDOA 2I59A 5AQSB 1WR0A 3V5UA 3UT5E 4CXXA 5HEHA 2JRKA 2YINA 4OFZA 4UELA 5FY1A 4N78D 4X1IE 4IL4A 1HNWT 2YEVC 3MZKB 5L3GB 1MMNA 1N34T 4HWIB 3LSVA 4DR1T 1IJ5A 4IIJE 2JIWA 2W61A 2IDOB 1FMWA 3M3ZB 2I6HA 3PUAA 3TLSA 2NW8A 3QOFA 4I4TE 4A56A 2IAKA 2E8IA 1FJGT 5FL1A 1VCTA 2KXPB 2WBLA 4JV5T 4U72A 4PW8A 2KWHA 2RP4A 2JMHA 2KINB 2DWKA 1UX4A 1B7TA 5LG4A 3AEDA 1GQEA 3PTRB 4X64T 2BBJA 4PFPA 4JI8T 3Q2MA 4JEHB 3TLWA 4OX9T 5JRCA 1H7CA 4PFOA 4X20E 3PUYF 4QHOA 4GIWA 3AEGA 3KBUA 4EIWA 2G0UA 2WZHA 3PUVF 3GN5A 3KV9A 2UXXB 2WZIA 3RYCE 2HHHT 3C50A 3HR0A 5L47A 1IJ6A 1DU2A 1VOMA 5HCMA 4B6XA 3W15B 3C64A 1BR0A 1US7B 4JI2T 4DV3T 2NTYA 2V5DA 3N9PA 4UV8B 3B5MA 2X9XA 2WP9A 3T1YT 2ZM2A 5AQVB 2Z6EA 3CKDA 3H3AA 1MMAA 2XJ7A 1EZ3A 4FJOA 1HTJF 3B13A 4Q25A 3FHNA 2HN1A 5LGUB 5L3DB 2BG9B 2BG9E 4EV6A 4JI0T 4ILBA 4P09A 2BDEA 3JADA 3EVYA 4AISA 4IT4A 2C5IT 2VKDA 1SA0E 2YDSA 4NPPA 1KFYA 1D0XA 1NWMX 3UTKA 1W0AA 4MHCA 3ONLC 4HWCA 2FJDA 2X51A 3NRYA 4ZI3C 4GYSA 4X65T 3ETVA 3PJAA 3TLVA 4GK0E 4K0UA 4I50E 1JNRA 4HFBA 3FZHB 4GKJT 2E9XB 1J1JA 5J0ZA 2AXDS 3AEBA 3F57A 3FZFB 2XSAA 3RRCA 5FXZA 5FNVE 3LK42 5F5WA 3OVUA 4GKKT 4HWHA 2NR4A 4U2YA 4EEBA 2X0YA 3UQ7A 5C2TA 5CFBA 3AEFA 1CUNA 1MNEA 2J62A 5EZYE 2VL8A 2IW5B 3QNUA 5HWXA 3DJBA 4ZS2A 2ZLYA 1E7PA 4YTNA 3K3QC 5HAXA 2V7MA 4PNIA 4LF8T 3ZYLA 3WI3A 4WW0A 3K8PC 1AJ3A 4ZOLE 4AQGA 4P1NA 3AE5A 4JI3T 3N9MA 2YOEA 1KNPA 3FBLA 1UCUA 5CB4E 1FMVA 4HKAA 5L3BB 2WB5A 4G2AA 1IZNB 2LHRA 2KNDA 1WFDA 3ETUA 4UF0A 4ISTA 5F8PA 4Z8XA 5CJ5A 2W00A 1OWAA 2CCQA 2XQAA 4I43B 4O4IE 5AQOB 1J5ET 2V7KA 1BR1A 3C4WA 4H63H 1LVKA 5IYZE 2UUAT 1M62A 3NZQA 3CX8B 1XZYA 5KXJA 4JI6T 4P0BA 1G73A 4YSYA 4ZZCA 3QC9A 4O4JE 3HKBE 4X62T 3AAIA 1XWMA 2K3WA 2XM1A 4CXYA 1FEWA 2V7IA 4BAYB 1KEYA 5DQVA 1VCSA 2XZEA 1T8BA 2VQFT 4NXMT 3LBXB 3EHZA 2WMOA 2CHNA 5EK2A 4UEMA 4LF5T 3UUNA 3K3NA 4L5GA 1OEDA 2L9QA 4KHPT 1N36T 5AQPB 4PK6A 4AXPA 5ABGA 3DTOA 3AE1A 3I9WA 3CQCB 3K1SA 5LBQB 2CLYC 3C4ZA 3PURA 4PK5A 1I6ZA 2M6BA 1MMGA 3ZC0A 2W62A 4PJJA 4LF6T 5AQUB 3AEEA 4HFVA 2XQ9A 4J2CA 5JR9B 3RLFF 4H9NC 1U4QA 1HNZT 2L8KA 3FZLB 2ODVA 5AFUL 4ERRA 3LJCA 2H89A 5IWAT 2W66A 2ZMAA 2IMLA 3J7Yq 3OYZA 4QX8B 2V5CA 2XQYA 3JAFA 4YJ2E 4EZ4A 3UU8A 5LGTB 2LJLA 1ZHCA 3PV0F 5JDGA 5FL0A 4ZS3A 2MTQA 4U7IA 4EYYR 3EABA 2XTLA 3P8CD 3ZN1B 3N2KE 4U74A 5HEUA 4IGUA 4WBNE 4E7ZA 2XSBA 3AE3A 3FXDB 2GK9A 4CXWA 3LK3B 3I0OA 4DO0A 1N32T 4YHJA 4KI0F 3PUZF 3RIUC 5DJQC 3ZCIA 4IE0A 2LM2A 3RC8A 3CQGB 3ZT5A 3E22E 4B3RT 4A5XA 5HXRA 2FUPA 2Y6XA 1IBLT 1KK7A 2N2NA 1BR4A 4KMCA 2BG9C 4JUYA 4QWNB 4EZHA 4C90A 3ZMSB 4DV7T 3T1HT 3PUXF 5FKYA 2VB6A 1WLXA 4XBFB 2FJEA 4BA9A 4TNVA 1ZOYA 3P4RA 5KMGP 3OKQA 4AKGA 3JC6C 2X66A 5AQKB 2CM0A 5ABEA 1MIWA 5AQRB 2EHOB 2PG8A 3AA1B 3AE6A 2X0LB 3A7MA 1X79A 1WR6A 2L3LA 3QB5A 4DR6T 1XNQT 1U5PA 2LE8A 2XQ6A 4MFRA 5AQMB 4PJMA 1ZV4X 1J5WA 2CMRA 3M65A 2LKGA 2N1GA 2BBHA 3QUJA 4UVBB 3SFDA 2BVLA 2X9HA 5LCYA 4AI6A 3ZCJA 2BVMA 3TLUA 3AAEB 3UFGA 3A5XA 2W0GA 2KLQA 3GMIA 3IHRA 5LOVE 2VURA 4KX6A 2VKHA 3L3PA 2OA5A 4U33A 4JLEA 2XQ5A 3AECA 2A3DA 2LSJA 2CWYA 4KBMB 1LRZA 5LHGB 2KSRA 4AQFA 1IAPA 5HEGA 1T72A 2WCAA 3IBPA 3RHWA 1KF6A 4ANJA 3O1HA 3U3IA 3AE2A 5AQJB 4XAXB 3SOLA 4ZZBA 4HFHA 4L9IA 3BQIA 2MAWA 3ANWB 2H88A 4MLKA 4HFCA 3R6NA 5JVDE 3OJAA 3G06A 3ZT7A 5AQNB 3TLTA 5JQGE 2XAJB 1T98A 2UXBT 2V26A 4AKIA 4UV9B 3ZSSA 1IBKT 3RIUA 5FMNA 4HWDA 4E7SA 4IE6A 4O8SA 4DV4T 5C8YE 4JI7T 2E5VA 2BKPA 3NBXX 4F6RC 2OLTA 4Z91A 3PUGA 4IDZA 3VR8A 3VKGA 4F8HA 5LNKA 1MIVA 4U2ZA 1YD8G 1OEDC 3AVSA 3JC6D 5HCJA 1YKEB 2SPCA 2BG9A 2E9XD 2CXDA 2CE7A 2C5KT 2LRKA 4UXNB 1S35A 3GWHA 5HXEA 4BJMA 4H9OC 3DP7A 3UU6A 3ZT6A 3P4QA 3RQUA 4C91A 3EAMA 5LMUT 2KWIB 2KT9A 2I0MA 3PE0A 2JQHA 2Y8DA 5AQFB 1T7SA 2YKSA 5L3CB 3KINB 4H9RC 3IA3A 2K24A 2E9XA 3P4WA 3AE7A 3AXJB 3KVAA 2DI4A 2N9DA 2WY2A 1HX8A 3EI0A 4AKLA 3AA0B 4LMKA 4IDNA 4QX7B 3N9NA 3L39A 3Q5DA 2BZBA 2X9WA 1ZEEA 3ZJ2A 3AXJA 3BQKA 1UUSA 1Y64B 4PJNA 4WBOA 1YQ3A 2NP9A 5HWYA 5LGNB 4Z90A 2CBJA 3VRAA 4DR5T 2J1DG 2WWUA 4MALA 5AQTB 4KP3C 3MJXA 3WAKA 2ES0A 2F4VT 4I55E 5C3JA 2NW7A 3OBVE 2MBGA 3AB3B 2IUBA 3ZPOA 4U7YA 2XAFB 2BKOA 3ZMTB 2D2SA 4X5TA 2DCFA 3UU5A 2B76A 4UVAB 3LK2B 4H63V 2D0TA 4YHHT 2XQ4A 4X66T 2VVNA 2WQYA 2XHEB 2IHR1 3CIRA 3P4SA 4BJNA 2DHRA 2DLRA 2CHOA 1HG2A 4A97A 3NWIA 1M7KA 1XMOT 4TZ4C 2JQ9A 2RA1A 2WU5A 2LT3A 5LMNT 2NTXA 4OYKA 3RGLA 2XY8B 1D1CA 5J2TE 3PUWF 1D0YA 3KVBA 1KNZA 4YLHA 3EUHA 2BKNA 5LYJE 1FIOA 5BR8T 2LOSA 3KDSE 5IUXA 1W09A 5JDFA 3LBXA 1IBMT 2JJ9A 5HXSA 3ONJA 5LA6E 4K0KT 4WYVA 2MOZA 1YKHB 4IREA 3PUQA 2CXLA 5J2UE 3AEAA 2PFVA 2V6YB 3RIAA 3CPZA 4EEDA 2QRXA 2VK9A 3E0ZA 4X1KE 2VKJA 4AKRB 2V7JA 3UUBA 2V6YA 4CI3B 2WU2A 2WMNA 2XAGB 2JPFA 4WNKA 3P4PA 4XZCA 1I94T 5FY0A 2WWVA 3E08A 1CHUA 2XPKA 2WDRA 4AQFC 4U3CA 5CA0E 1HFAA 4LF9T 3VKHA 2NW9A 4JI5T 3IEEA 2Q9QB 1XDPA 5JR9A 4OK0A 5L4HA 2VASA 2XQ7A 4ZXLA 3VU7H 3Q9DA 2W4XA 2VQET 2HH7A 4A98A 3CVRA 1SHZC 2X0HA 4ASKA 4ADZA 3AAAB 4TNWA 5M4YA 1HX1B 1HNXT 2BS4A 3S4UA 2H7VC 1QSDA 1W0BA 2A2FX 1SE7A 3MXZA 5KDMC 2CA5A 1E1HB 2XAQB 2E2AA 4YFSA 3SS1A 2XM2A 4YTPA 4ZHQE 4HTEA 1WYBA 3VHLA 4DBRA 3NRXA 2W63A 3AE9A 1WYCA 3D0TA 5ETWA 3N9LA 2BS2A 4GYRA 3ZYKA 3ZMVB 5HXHA 4L0RA 4KUMB 4TV9E 2VL0A
chains in the Genus database with same CATH topology
4L9IA 3BQIA 1CUNA 2ZM0A 2ACXA 3ANWB 4M1PA 1MNEA 5EZYE 5LJMA 4MLKA 2VL8A 2IW5B 3R6NA 4EB6E 5JVDE 2DNXA 2CEAA 3ZLIA 5HWXA 2Q9QD 3C51A 3DJBA 3OJAA 5EK3A 4ZS2A 2QA7A 3N2OA 3U78A 2ZLYA 4QXBB 4TV8E 5JDNA 3HA4A 3PU8A 3K3QC 5JQGE 2XAJB 1T98A 5HAXA 3T8OA 2V7MA 4PNIA 3SRZA 2V26A 3ZYLA 3HKDE 5JDLA 3WI3A 4AKIA 4UV9B 4WW0A 3K8PC 1AJ3A 4ZOLE 4AQGA 5F3JA 5FMNA 2NOXA 4E7SA 4IE6A 3RYHE 4O8SA 4TX5A 1D0ZA 4UIGA 1BR2A 4DMVA 5C8YE 2YK0A 5FXXA 3N9MA 3PU3A 2E9XC 2WAUA 3NBXX 4F6RC 3AVRA 3FBLA 2V1DB 5DQWA 1D1AA 3PUGA 3RPUA 2NWBA 1UCUA 2LSIA 4IDZA 3VKGA 5CB4E 1FMVA 4HKAA 3J9X1 5L3BB 3V5SA 4G2AA 5EK4A 5LNKA 1IZNB 2LHRA 1MIVA 3B57A 2KNDA 4EYUA 2Q9QA 3O1IA 4NUUA 3RYIE 3ETUA 2D0UA 3FXEB 1YD8G 2EHOA 4UF0A 4ISTA 5F8PA 3AVSA 3JC6D 5JREA 1YKEB 1WRDA 5LJNA 2SPCA 3EDUA 4O2BE 2C5JA 4TN7B 1OXZA 5L3EB 2K9AA 3RC3A 4Z8XA 2E9XD 1ZKEA 1MIYA 3ZJ1A 2UXNB 2CXDA 4DBQA 2HPJA 2H3RA 2CE7A 2C5KT 1D1BA 4UXNB 1S35A 3GWHA 4O4LE 2XUEA 4GK5E 3RYFE 2W00A 5HXEA 4BJMA 1OWAA 3ZEFB 2CCQA 4I43B 1HF8A 2CLYB 3RX6A 3UUXB 4H9OC 4O4IE 3DP7A 5JDHA 2WSSV 2D5UA 2V7KA 3MA9A 3FB2A 2QGSA 4QXHB 1BR1A 3C4WA 2JMKA 4H63H 2KMFA 1LVKA 5LHHB 3PDYA 5IYZE 3RKOA 4C91A 2KZ7B 5KX5E 3CX7B 1O3XA 3NZQA 3CX8B 2KWIB 2KT9A 3PE0A 1HG5A 4P0BA 1G73A 2LM9A 2Y8DA 4EOZB 3QC9A 4O4JE 3F31A 4PJLA 3HKBE 3OYXA 4ZI7E 3CWZB 3AAIA 1YW0A 3KINB 5L3CB 4H9QC 1NAFA 4H9RC 5IHYA 5E0OA 2K24A 5JRCB 4QKNA 4AKHA 5H6QB 4CXYA 1FEWA 2E9XA 2V7IA 3AA7B 4BAYB 2HPLA 4ILUA 5DQVA 3ZMUB 3O9XA 3I1AA 3KVAA 2B1EA 2PBIA 2DI4A 2N9DA 3LBXB 1HX8A 3KV4A 4AKLA 2K48A 2WMOA 1MMDA 3AA0B 3N5LA 5EK2A 2V7LA 2K5BB 4UEMA 4QX7B 5LP6E 3N9NA 3UUNA 4O2AE 3H37A 3GN5B 3ESLA 3K3NA 2YU1A 3F2EA 2BZBA 2X9WA 4L5GA 1ZEEA 2DWGA 2L9QA 3ZJ2A 4DVDA 3BQKA 2X67A 5LXTE 3RRWA 1Y64B 1HCIA 4PJNA 5DABA 4PK6A 4WBOA 4AXPA 2IC9A 5FY7A 4IE4A 3BQLA 3O4XE 2EHOD 2NP9A 2WM9A 4IHJE 5HWYA 5HYAA 3DTOA 3P7IA 3I9WA 4ZI2C 3O1JA 3KFWX 5CA1E 5LGNB 2M67A 1MNDA 3C4XA 3ANWA 3I9YA 3C98B 3CQCB 2A72A 5LBQB 2CLYC 2J1DG 3LFMA 3C4ZA 4UVCB 1Z0PA 2WWUA 4NUVA 4MALA 5FXWA 1VRBA 3PURA 4KP3C 4PK5A 2PJQA 1UX5A 3NZPA 3MJXA 3WAKA 4DMWA 5FYMA 2ES0A 2XAHB 1MMGA 3ZC1A 3ZC0A 4X1YE 2W62A 4I55E 4PJJA 1LKXA 4P0AA 2NW7A 4TUYE 3MK7C 3OBVE 2MBGA 3AB3B 4HFVA 4ZI2D 2IC6A 4J2CA 5JDMA 1QUUA 5HXCA 3ZPOA 5JR9B 2I59A 4IE5A 4H9NC 2VKOA 2XAFB 3R84B 1U4QA 2D2SA 3UULA 2DCFA 2L8KA 3V5UA 2ODVA 3ZMTB 5AFUL 1HS7A 3UT5E 4ERRA 4ISSA 3LJCA 4YJ3E 4CI2B 3N9OA 4CXXA 2JRKA 2YINA 4OFZA 4UELA 4UVAB 5FY1A 4N78D 2ZMAA 4X1IE 3J7Yq 3OYZA 4CZZB 4QX8B 3LK2B 4H63V 3QK6A 4EAHA 3MACA 2YEVC 2D0TA 2MYSA 3MZKB 5L3GB 2XQYA 4YJ2E 4EZ4A 1MMNA 5LGTB 4V1Av 2LJLA 2XHEB 1IJ5A 1ZHCA 4IIJE 4FI5A 5JDGA 4BJNA 4ZS3A 2DHRA 4G63A 2W61A 2MTQA 2YU2A 5TAOA 4EYYR 2VWAA 2DLRA 1FMWA 1HG2A 2XTLA 3P8CD 4HN9A 3PUAA 3ZN1B 3N2KE 4U74A 5FP3A 3HI2A 2NW8A 4I4TE 4IGUA 4A56A 4WBNE 4E7ZA 2IAKA 3FXDB 2GK9A 4CXWA 3EDVA 3LK3B 2E8IA 4TZ4C 3I0OA 4DO0A 2LSGA 4YHJA 2KXPB 3Q5XA 2RA1A 3CX6B 2WBLA 2LT3A 4U72A 4PW8A 2KWHA 2NTXA 2RP4A 3HL6A 2JMHA 2LSYA 2KINB 5DJQC 2DWKA 4IE0A 3ZCIA 5ADXL 4OYKA 3CQXC 1D1CA 1UX4A 3RC8A 1B7TA 3CQGB 5LG4A 5J2TE 4PK4A 5L3FB 2LSKA 3E22E 3PTRB 2X9YA 1D0YA 2ZM8A 5JR9C 3HKCE 4PFPA 3KVBA 1LVFA 3N9QA 3Q2MA 1KNZA 4YLHA 3EUHA 5HXRA 4JEHB 5LYJE 3KBTA 2XASB 2Y6XA 5JRCA 1FIOA 1H7CA 4PFOA 3HKEE 4X20E 3N2GE 4DNDA 3FBZA 2LOSA 1KK7A 3KDSE 2Q9QC 2N2NA 4QHOA 5JDQA 1BR4A 4GIWA 4HE8A 4EXTA 5JDFA 3LBXA 3KBUA 4EIWA 2G0UA 2JJ9A 4KMCA 5HXSA 4CQIA 5LA6E 2MOZA 1YKHB 2C0SA 4JUYA 3GN5A 3PUQA 2CXLA 4QWNB 3KV9A 5J2UE 4EZHA 4IE7A 2UXXB 2PFVA 4C90A 3RYCE 3CPZA 5LBMA 3ZMSB 3AA6B 2CWOA 5JH7E 3C50A 3HR0A 2LEHA 5BMVE 2VK9A 1IJ6A 1VOMA 2VB6A 2X68A 3LG7A 4B6XA 1WLXA 3E0ZA 4X1KE 2VKJA 3W15B 4CI1B 3C64A 2V7JA 4AKRB 1BR0A 1US7B 4XBFB 4CI3B 2NTYA 4OHFA 2WMNA 2XAGB 3IF8B 4BA9A 3N9PA 2JPFA 5KMGP 4WNKA 4XZCA 4UV8B 3OKQA 5FY0A 2X9XA 3E08A 3ZYMA 3PUSA 4AQFC 2ZM2A 5GONE 5FXVA 5CA0E 1HFAA 4AKGA 3KV5A 3JC6C 2X66A 2Z6EA 3VKHA 3CKDA 2CM0A 3H3AA 1MMAA 2NW9A 1MIWA 1EZ3A 4FJOA 3L09A 3IEEA 2Q9QB 1HTJF 4UF0B 3B13A 2EHOB 2PG8A 3KV6A 5JR9A 3AA1B 4OK0A 3FHNA 3BK9A 3TKLB 5LGUB 3RH3A 5L3DB 2VASA 2X0LB 3ZMZB 3WAJA 3VU7H 3Q9DA 1X79A 4P09A 3Q5WA 1WR6A 2BDEA 2L3LA 2HH7A 3EVYA 4HEAA 4QXCB 4GOUA 2C5IT 3CVRA 3GA8A 1SHZC 2VKDA 1SA0E 1U5PA 2LE8A 4ASKA 4ADZA 3AAAB 4OYJA 4MFRA 2ODUA 4PJMA 5LHIB 5M4YA 1ZV4X 1D0XA 2CMRA 3ONXA 3M65A 1NWMX 3UTKA 5J1GA 3UFEA 2N1GA 2JQQA 3I0QA 3S4UA 4MHCA 2H7VC 1QSDA 2A2FX 3QUJA 4UVBB 2X51A 3NRYA 3MXZA 5KDMC 2BVLA 2CA5A 2X9HA 4GYSA 4ZI3C 5LCYA 4AI6A 2H7OA 3ZCJA 1E1HB 3SWHA 2BVMA 2XAQB 3ETVA 3AAEB 3A5XA 2W0GA 2KLQA 3K3OA 4YFSA 3SS1A 3GMIA 3MKDA 4GK0E 4K0UA 4I50E 5A1LA 3IHRA 4ZHQE 4HTEA 5LOVE 1G8XA 2VKHA 3L3PA 2OA5A 4JLEA 1V9DA 2CXFA 2E9XB 1WYBA 2A3DA 3VHLA 4DBRA 2LHNA 3NRXA 2LSJA 2CWYA 4O4HE 4KBMB 1LRZA 2W63A 5LHGB 4JEUB 3F57A 4AQFA 5L2LA 3CMLA 5H6RB 1WYCA 1IAPA 4H9SE 4ZI3D 3RRCA 3D0TA 4PAGA 3UUMA 5ETWA 5FXZA 2EHOC 3IBPA 3N9LA 4HGAA 5FNVE 3LK42 1S94A 2Y48B 4MBQA 4ANJA 3O1HA 4GYRA 3U3IA 3ZYKA 3ZMVB 2LOPA 4H9PC 2P9BA 5HXHA 4L0RA 4XAXB 4KUMB 3ZN0B 3SOLA 4TV9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONX A;  3OKQ A; 
#chains in the Genus database with same CATH topology
 4YSX A;  2ZM0 A;  3LDQ B;  4AIU A;  3L8R A;  1SUM B;  5LJM A;  5HEO A;  2DNX A;  5EK3 A;  2QA7 A;  3N2O A;  3U78 A;  3AE8 A;  2VVS A;  3RF1 A;  3PU8 A;  2ZM6 T;  4DR2 T;  3HKD E;  5F3J A;  2NOX A;  1Z8U A;  4UIG A;  1BR2 A;  2YK0 A;  5FXX A;  3JAE A;  2E9X C;  2V1D B;  2NWB A;  1KNR A;  4YT0 A;  3J9X 1;  5EK4 A;  2DL1 A;  4U31 A;  1HR0 T;  3A8Y C;  3O1I A;  4NUU A;  3RYI E;  2EHO A;  4DR7 T;  2UU9 T;  4HWF A;  3EDU A;  1UK5 A;  2C5J A;  1OXZ A;  2K9A A;  3RC3 A;  1ZKE A;  2CPT A;  3ABV A;  2H3R A;  4DUY T;  2LKH A;  1D1B A;  2CRB A;  2XUE A;  4GK5 E;  3RYF E;  3ZEF B;  1UUR A;  2CLY B;  4QH5 A;  2V8S V;  1YQ4 A;  3FB2 A;  2QGS A;  2JMK A;  3RIF A;  3PDY A;  5L4E A;  2KZ7 B;  5KX5 E;  3CX7 B;  1O3X A;  1HG5 A;  1UGO A;  3NVO A;  2LM9 A;  4EOZ B;  3F31 A;  3OYX A;  1YW0 A;  5LB7 B;  5IHY A;  5E0O A;  2A9U A;  5JRC B;  4QKN A;  5H6Q B;  2UXC T;  1N33 T;  2HN2 A;  3AA7 B;  4JYA T;  4DUZ T;  3O9X A;  2B1E A;  2OV9 A;  4WZX A;  1XNR T;  3KV4 A;  1MMD A;  3N5L A;  4B3T T;  2V7L A;  2K5B B;  5LP6 E;  4O2A E;  3H37 A;  3GN5 B;  3ESL A;  3F2E A;  5LG3 A;  3X1D A;  4DVD A;  2X67 A;  3RRW A;  5DAB A;  3BQL A;  3O4X E;  3AE4 A;  5HYA A;  3O1J A;  4NXN T;  3KFW X;  2M67 A;  1MND A;  3C4X A;  3ANW A;  3I9Y A;  3C98 B;  3LFM A;  4UVC B;  4ILC A;  1Z0P A;  1VRB A;  2PJQ A;  4QH1 A;  1NEK A;  4DMW A;  2XAH B;  3RI5 A;  1LKX A;  2M6I A;  4P0A A;  3MK7 C;  4ZI2 D;  2IC6 A;  1QUU A;  5HXC A;  4IE5 A;  2J47 A;  1NEN A;  2VKO A;  3R84 B;  3UUL A;  4COF A;  1ZP0 A;  1HS7 A;  4ISS A;  4YJ3 E;  4DR3 T;  4CI2 B;  3N9O A;  4CZZ B;  3QK6 A;  4EAH A;  3MAC A;  2MYS A;  3UU3 A;  3ZST A;  2XQ3 A;  1YXR A;  4V1A v;  4DR4 T;  4FI5 A;  4G63 A;  2YU2 A;  5TAO A;  3VR9 A;  2VWA A;  4HN9 A;  2UXD T;  2UUC T;  5FP3 A;  2YDQ A;  3HI2 A;  2RPA A;  3EDV A;  2WDQ A;  2LSG A;  4LML A;  3Q5X A;  4HFE A;  3CX6 B;  4TWF A;  2R6G F;  3HL6 A;  2LSY A;  3UU4 A;  5CGM A;  5ADX L;  3CQX C;  2QYW A;  1JNZ A;  2D9D A;  4PK4 A;  5L3F B;  2LSK A;  2X9Y A;  2ZM8 A;  5JR9 C;  3HKC E;  5AQQ B;  1LVF A;  3N9Q A;  4ILA A;  5JTG A;  3KBT A;  2XAS B;  3HKE E;  3N2G E;  4DND A;  3FBZ A;  2Q9Q C;  5JDQ A;  4HE8 A;  4EXT A;  2YN6 A;  4CQI A;  2C0S A;  4NIQ A;  3FZK B;  4IE7 A;  5LBM A;  3AA6 B;  2CWO A;  5JH7 E;  2LEH A;  5BMV E;  2X68 A;  3LG7 A;  4CI1 B;  4OHF A;  3IF8 B;  2WS3 A;  1XMQ T;  2MPK A;  1E2A A;  4UR9 A;  3ZYM A;  3PUS A;  2ACZ A;  5GON E;  5FXV A;  3KV5 A;  3CK6 A;  4TWD A;  4IL9 A;  3L09 A;  4CN4 A;  4UF0 B;  3KV6 A;  2V6X A;  3BK9 A;  3JCF A;  3TKL B;  4LFC T;  3RH3 A;  3ZMZ B;  3WAJ A;  4YSZ A;  4LF7 T;  3Q5W A;  3H3M A;  2LRL A;  4HEA A;  4DV1 T;  4QXC B;  4GOU A;  3GA8 A;  4LF4 T;  3FZM B;  2QVA A;  4OYJ A;  2ODU A;  5LHI B;  3ONX A;  5ABH A;  4IDO A;  5J1G A;  3UFE A;  2JQQ A;  3I0Q A;  5AQI B;  5HEJ A;  4DV5 T;  2FJA A;  2H7O A;  3SWH A;  3K3O A;  3MKD A;  5A1L A;  2J4G A;  1G8X A;  2CBI A;  1V9D A;  2CXF A;  2LHN A;  3RKG A;  4O4H E;  2FBW A;  4JEU B;  4DV6 T;  2AE9 A;  5L2L A;  4JI4 T;  3CML A;  5H6R B;  4H9S E;  5AQG B;  4ZI3 D;  4PAG A;  3UUM A;  4CN1 A;  2EHO C;  4HGA A;  1OED B;  1OED E;  3Q5E A;  1S94 A;  2Y48 B;  3P50 A;  4MBQ A;  1X9B A;  2LOP A;  4H9P C;  2P9B A;  3ZN0 B;  4YY3 T;  4YTM A;  2ACX A;  1W9R A;  4M1P A;  2WDV A;  4I0U A;  4EB6 E;  1R8I A;  3ZLI A;  2CEA A;  2Q9Q D;  3C51 A;  4CN6 A;  4QH4 A;  4IDQ A;  2IIU A;  4QXB B;  1QLB A;  4TV8 E;  5AQH B;  5JDN A;  3HA4 A;  2E5L T;  4B3M T;  3T8O A;  5ABF B;  3SRZ A;  5JDL A;  3RYH E;  4TX5 A;  1D0Z A;  4DMV A;  4YXD A;  3PU3 A;  2WAU A;  5ABF A;  5AQL B;  3AVR A;  2YDR A;  5DQW A;  1D1A A;  3RPU A;  2LSI A;  3V5S A;  4ZEY A;  3B57 A;  4EYU A;  2Q9Q A;  2D0U A;  3FXE B;  5JRE A;  1WRD A;  5LJN A;  4O2B E;  3OTO T;  4TN7 B;  5L3E B;  1MIY A;  3RQW A;  2UXN B;  3ZJ1 A;  4DBQ A;  2HPJ A;  4O4L E;  4JI1 T;  4HFD A;  1HF8 A;  3RX6 A;  3UUX B;  5JDH A;  2WSS V;  2D5U A;  3MA9 A;  5FVL A;  4QXH B;  2KMF A;  5LHH B;  3RKO A;  4LFA T;  3ZKR A;  2FJB A;  3NKZ A;  4PJL A;  4KHZ F;  4ZI7 E;  3CWZ B;  4DID B;  4H9Q C;  1NAF A;  2LLY A;  4AKH A;  3QB5 K;  4JBW F;  2HPL A;  4ILU A;  3VRB A;  3ZMU B;  3I1A A;  2PBI A;  4AQY T;  2K48 A;  4TWH A;  2W2U A;  4EGW A;  2YU1 A;  2DWG A;  5LXT E;  1HCI A;  4HFI A;  2IC9 A;  5FY7 A;  4IE4 A;  2PTF A;  4IDP A;  2EHO D;  2W67 A;  2WM9 A;  4IHJ E;  3P7I A;  4ZI2 C;  1Y01 A;  3UQ4 A;  5CA1 E;  3OPC A;  3SFE A;  1L0V A;  2BS3 A;  2A72 A;  4B3S T;  4NUV A;  5FXW A;  4DV2 T;  4DV0 T;  2JQK A;  4LFB T;  1UX5 A;  3NZP A;  5FYM A;  3PJA J;  3ZC1 A;  4LMJ A;  4X1Y E;  2XQ8 A;  1WCR A;  4TUY E;  2UUB T;  5FVK A;  5JDM A;  1XDO A;  2I59 A;  5AQS B;  1WR0 A;  3V5U A;  3UT5 E;  4CXX A;  5HEH A;  2JRK A;  2YIN A;  4OFZ A;  4UEL A;  5FY1 A;  4N78 D;  4X1I E;  4IL4 A;  1HNW T;  2YEV C;  3MZK B;  5L3G B;  1MMN A;  1N34 T;  4HWI B;  3LSV A;  4DR1 T;  1IJ5 A;  4IIJ E;  2JIW A;  2W61 A;  2IDO B;  1FMW A;  3M3Z B;  2I6H A;  3PUA A;  3TLS A;  2NW8 A;  3QOF A;  4I4T E;  4A56 A;  2IAK A;  2E8I A;  1FJG T;  5FL1 A;  1VCT A;  2KXP B;  2WBL A;  4JV5 T;  4U72 A;  4PW8 A;  2KWH A;  2RP4 A;  2JMH A;  2KIN B;  2DWK A;  1UX4 A;  1B7T A;  5LG4 A;  3AED A;  1GQE A;  3PTR B;  4X64 T;  2BBJ A;  4PFP A;  4JI8 T;  3Q2M A;  4JEH B;  3TLW A;  4OX9 T;  5JRC A;  1H7C A;  4PFO A;  4X20 E;  3PUY F;  4QHO A;  4GIW A;  3AEG A;  3KBU A;  4EIW A;  2G0U A;  2WZH A;  3PUV F;  3GN5 A;  3KV9 A;  2UXX B;  2WZI A;  3RYC E;  2HHH T;  3C50 A;  3HR0 A;  5L47 A;  1IJ6 A;  1DU2 A;  1VOM A;  5HCM A;  4B6X A;  3W15 B;  3C64 A;  1BR0 A;  1US7 B;  4JI2 T;  4DV3 T;  2NTY A;  2V5D A;  3N9P A;  4UV8 B;  3B5M A;  2X9X A;  2WP9 A;  3T1Y T;  2ZM2 A;  5AQV B;  2Z6E A;  3CKD A;  3H3A A;  1MMA A;  2XJ7 A;  1EZ3 A;  4FJO A;  1HTJ F;  3B13 A;  4Q25 A;  3FHN A;  2HN1 A;  5LGU B;  5L3D B;  2BG9 B;  2BG9 E;  4EV6 A;  4JI0 T;  4ILB A;  4P09 A;  2BDE A;  3JAD A;  3EVY A;  4AIS A;  4IT4 A;  2C5I T;  2VKD A;  1SA0 E;  2YDS A;  4NPP A;  1KFY A;  1D0X A;  1NWM X;  3UTK A;  1W0A A;  4MHC A;  3ONL C;  4HWC A;  2FJD A;  2X51 A;  3NRY A;  4ZI3 C;  4GYS A;  4X65 T;  3ETV A;  3PJA A;  3TLV A;  4GK0 E;  4K0U A;  4I50 E;  1JNR A;  4HFB A;  3FZH B;  4GKJ T;  2E9X B;  1J1J A;  5J0Z A;  2AXD S;  3AEB A;  3F57 A;  3FZF B;  2XSA A;  3RRC A;  5FXZ A;  5FNV E;  3LK4 2;  5F5W A;  3OVU A;  4GKK T;  4HWH A;  2NR4 A;  4U2Y A;  4EEB A;  2X0Y A;  3UQ7 A;  5C2T A;  5CFB A;  3AEF A;  1CUN A;  1MNE A;  2J62 A;  5EZY E;  2VL8 A;  2IW5 B;  3QNU A;  5HWX A;  3DJB A;  4ZS2 A;  2ZLY A;  1E7P A;  4YTN A;  3K3Q C;  5HAX A;  2V7M A;  4PNI A;  4LF8 T;  3ZYL A;  3WI3 A;  4WW0 A;  3K8P C;  1AJ3 A;  4ZOL E;  4AQG A;  4P1N A;  3AE5 A;  4JI3 T;  3N9M A;  2YOE A;  1KNP A;  3FBL A;  1UCU A;  5CB4 E;  1FMV A;  4HKA A;  5L3B B;  2WB5 A;  4G2A A;  1IZN B;  2LHR A;  2KND A;  1WFD A;  3ETU A;  4UF0 A;  4IST A;  5F8P A;  4Z8X A;  5CJ5 A;  2W00 A;  1OWA A;  2CCQ A;  2XQA A;  4I43 B;  4O4I E;  5AQO B;  1J5E T;  2V7K A;  1BR1 A;  3C4W A;  4H63 H;  1LVK A;  5IYZ E;  2UUA T;  1M62 A;  3NZQ A;  3CX8 B;  1XZY A;  5KXJ A;  4JI6 T;  4P0B A;  1G73 A;  4YSY A;  4ZZC A;  3QC9 A;  4O4J E;  3HKB E;  4X62 T;  3AAI A;  1XWM A;  2K3W A;  2XM1 A;  4CXY A;  1FEW A;  2V7I A;  4BAY B;  1KEY A;  5DQV A;  1VCS A;  2XZE A;  1T8B A;  2VQF T;  4NXM T;  3LBX B;  3EHZ A;  2WMO A;  2CHN A;  5EK2 A;  4UEM A;  4LF5 T;  3UUN A;  3K3N A;  4L5G A;  1OED A;  2L9Q A;  4KHP T;  1N36 T;  5AQP B;  4PK6 A;  4AXP A;  5ABG A;  3DTO A;  3AE1 A;  3I9W A;  3CQC B;  3K1S A;  5LBQ B;  2CLY C;  3C4Z A;  3PUR A;  4PK5 A;  1I6Z A;  2M6B A;  1MMG A;  3ZC0 A;  2W62 A;  4PJJ A;  4LF6 T;  5AQU B;  3AEE A;  4HFV A;  2XQ9 A;  4J2C A;  5JR9 B;  3RLF F;  4H9N C;  1U4Q A;  1HNZ T;  2L8K A;  3FZL B;  2ODV A;  5AFU L;  4ERR A;  3LJC A;  2H89 A;  5IWA T;  2W66 A;  2ZMA A;  2IML A;  3J7Y q;  3OYZ A;  4QX8 B;  2V5C A;  2XQY A;  3JAF A;  4YJ2 E;  4EZ4 A;  3UU8 A;  5LGT B;  2LJL A;  1ZHC A;  3PV0 F;  5JDG A;  5FL0 A;  4ZS3 A;  2MTQ A;  4U7I A;  4EYY R;  3EAB A;  2XTL A;  3P8C D;  3ZN1 B;  3N2K E;  4U74 A;  5HEU A;  4IGU A;  4WBN E;  4E7Z A;  2XSB A;  3AE3 A;  3FXD B;  2GK9 A;  4CXW A;  3LK3 B;  3I0O A;  4DO0 A;  1N32 T;  4YHJ A;  4KI0 F;  3PUZ F;  3RIU C;  5DJQ C;  3ZCI A;  4IE0 A;  2LM2 A;  3RC8 A;  3CQG B;  3ZT5 A;  3E22 E;  4B3R T;  4A5X A;  5HXR A;  2FUP A;  2Y6X A;  1IBL T;  1KK7 A;  2N2N A;  1BR4 A;  4KMC A;  2BG9 C;  4JUY A;  4QWN B;  4EZH A;  4C90 A;  3ZMS B;  4DV7 T;  3T1H T;  3PUX F;  5FKY A;  2VB6 A;  1WLX A;  4XBF B;  2FJE A;  4BA9 A;  4TNV A;  1ZOY A;  3P4R A;  5KMG P;  3OKQ A;  4AKG A;  3JC6 C;  2X66 A;  5AQK B;  2CM0 A;  5ABE A;  1MIW A;  5AQR B;  2EHO B;  2PG8 A;  3AA1 B;  3AE6 A;  2X0L B;  3A7M A;  1X79 A;  1WR6 A;  2L3L A;  3QB5 A;  4DR6 T;  1XNQ T;  1U5P A;  2LE8 A;  2XQ6 A;  4MFR A;  5AQM B;  4PJM A;  1ZV4 X;  1J5W A;  2CMR A;  3M65 A;  2LKG A;  2N1G A;  2BBH A;  3QUJ A;  4UVB B;  3SFD A;  2BVL A;  2X9H A;  5LCY A;  4AI6 A;  3ZCJ A;  2BVM A;  3TLU A;  3AAE B;  3UFG A;  3A5X A;  2W0G A;  2KLQ A;  3GMI A;  3IHR A;  5LOV E;  2VUR A;  4KX6 A;  2VKH A;  3L3P A;  2OA5 A;  4U33 A;  4JLE A;  2XQ5 A;  3AEC A;  2A3D A;  2LSJ A;  2CWY A;  4KBM B;  1LRZ A;  5LHG B;  2KSR A;  4AQF A;  1IAP A;  5HEG A;  1T72 A;  2WCA A;  3IBP A;  3RHW A;  1KF6 A;  4ANJ A;  3O1H A;  3U3I A;  3AE2 A;  5AQJ B;  4XAX B;  3SOL A;  4ZZB A;  4HFH A;  4L9I A;  3BQI A;  2MAW A;  3ANW B;  2H88 A;  4MLK A;  4HFC A;  3R6N A;  5JVD E;  3OJA A;  3G06 A;  3ZT7 A;  5AQN B;  3TLT A;  5JQG E;  2XAJ B;  1T98 A;  2UXB T;  2V26 A;  4AKI A;  4UV9 B;  3ZSS A;  1IBK T;  3RIU A;  5FMN A;  4HWD A;  4E7S A;  4IE6 A;  4O8S A;  4DV4 T;  5C8Y E;  4JI7 T;  2E5V A;  2BKP A;  3NBX X;  4F6R C;  2OLT A;  4Z91 A;  3PUG A;  4IDZ A;  3VR8 A;  3VKG A;  4F8H A;  5LNK A;  1MIV A;  4U2Z A;  1YD8 G;  1OED C;  3AVS A;  3JC6 D;  5HCJ A;  1YKE B;  2SPC A;  2BG9 A;  2E9X D;  2CXD A;  2CE7 A;  2C5K T;  2LRK A;  4UXN B;  1S35 A;  3GWH A;  5HXE A;  4BJM A;  4H9O C;  3DP7 A;  3UU6 A;  3ZT6 A;  3P4Q A;  3RQU A;  4C91 A;  3EAM A;  5LMU T;  2KWI B;  2KT9 A;  2I0M A;  3PE0 A;  2JQH A;  2Y8D A;  5AQF B;  1T7S A;  2YKS A;  5L3C B;  3KIN B;  4H9R C;  3IA3 A;  2K24 A;  2E9X A;  3P4W A;  3AE7 A;  3AXJ B;  3KVA A;  2DI4 A;  2N9D A;  2WY2 A;  1HX8 A;  3EI0 A;  4AKL A;  3AA0 B;  4LMK A;  4IDN A;  4QX7 B;  3N9N A;  3L39 A;  3Q5D A;  2BZB A;  2X9W A;  1ZEE A;  3ZJ2 A;  3AXJ A;  3BQK A;  1UUS A;  1Y64 B;  4PJN A;  4WBO A;  1YQ3 A;  2NP9 A;  5HWY A;  5LGN B;  4Z90 A;  2CBJ A;  3VRA A;  4DR5 T;  2J1D G;  2WWU A;  4MAL A;  5AQT B;  4KP3 C;  3MJX A;  3WAK A;  2ES0 A;  2F4V T;  4I55 E;  5C3J A;  2NW7 A;  3OBV E;  2MBG A;  3AB3 B;  2IUB A;  3ZPO A;  4U7Y A;  2XAF B;  2BKO A;  3ZMT B;  2D2S A;  4X5T A;  2DCF A;  3UU5 A;  2B76 A;  4UVA B;  3LK2 B;  4H63 V;  2D0T A;  4YHH T;  2XQ4 A;  4X66 T;  2VVN A;  2WQY A;  2XHE B;  2IHR 1;  3CIR A;  3P4S A;  4BJN A;  2DHR A;  2DLR A;  2CHO A;  1HG2 A;  4A97 A;  3NWI A;  1M7K A;  1XMO T;  4TZ4 C;  2JQ9 A;  2RA1 A;  2WU5 A;  2LT3 A;  5LMN T;  2NTX A;  4OYK A;  3RGL A;  2XY8 B;  1D1C A;  5J2T E;  3PUW F;  1D0Y A;  3KVB A;  1KNZ A;  4YLH A;  3EUH A;  2BKN A;  5LYJ E;  1FIO A;  5BR8 T;  2LOS A;  3KDS E;  5IUX A;  1W09 A;  5JDF A;  3LBX A;  1IBM T;  2JJ9 A;  5HXS A;  3ONJ A;  5LA6 E;  4K0K T;  4WYV A;  2MOZ A;  1YKH B;  4IRE A;  3PUQ A;  2CXL A;  5J2U E;  3AEA A;  2PFV A;  2V6Y B;  3RIA A;  3CPZ A;  4EED A;  2QRX A;  2VK9 A;  3E0Z A;  4X1K E;  2VKJ A;  4AKR B;  2V7J A;  3UUB A;  2V6Y A;  4CI3 B;  2WU2 A;  2WMN A;  2XAG B;  2JPF A;  4WNK A;  3P4P A;  4XZC A;  1I94 T;  5FY0 A;  2WWV A;  3E08 A;  1CHU A;  2XPK A;  2WDR A;  4AQF C;  4U3C A;  5CA0 E;  1HFA A;  4LF9 T;  3VKH A;  2NW9 A;  4JI5 T;  3IEE A;  2Q9Q B;  1XDP A;  5JR9 A;  4OK0 A;  5L4H A;  2VAS A;  2XQ7 A;  4ZXL A;  3VU7 H;  3Q9D A;  2W4X A;  2VQE T;  2HH7 A;  4A98 A;  3CVR A;  1SHZ C;  2X0H A;  4ASK A;  4ADZ A;  3AAA B;  4TNW A;  5M4Y A;  1HX1 B;  1HNX T;  2BS4 A;  3S4U A;  2H7V C;  1QSD A;  1W0B A;  2A2F X;  1SE7 A;  3MXZ A;  5KDM C;  2CA5 A;  1E1H B;  2XAQ B;  2E2A A;  4YFS A;  3SS1 A;  2XM2 A;  4YTP A;  4ZHQ E;  4HTE A;  1WYB A;  3VHL A;  4DBR A;  3NRX A;  2W63 A;  3AE9 A;  1WYC A;  3D0T A;  5ETW A;  3N9L A;  2BS2 A;  4GYR A;  3ZYK A;  3ZMV B;  5HXH A;  4L0R A;  4KUM B;  4TV9 E;  2VL0 A; 
#chains in the Genus database with same CATH homology
 4L9I A;  3BQI A;  1CUN A;  2ZM0 A;  2ACX A;  3ANW B;  4M1P A;  1MNE A;  5EZY E;  5LJM A;  4MLK A;  2VL8 A;  2IW5 B;  3R6N A;  4EB6 E;  5JVD E;  2DNX A;  2CEA A;  3ZLI A;  5HWX A;  2Q9Q D;  3C51 A;  3DJB A;  3OJA A;  5EK3 A;  4ZS2 A;  2QA7 A;  3N2O A;  3U78 A;  2ZLY A;  4QXB B;  4TV8 E;  5JDN A;  3HA4 A;  3PU8 A;  3K3Q C;  5JQG E;  2XAJ B;  1T98 A;  5HAX A;  3T8O A;  2V7M A;  4PNI A;  3SRZ A;  2V26 A;  3ZYL A;  3HKD E;  5JDL A;  3WI3 A;  4AKI A;  4UV9 B;  4WW0 A;  3K8P C;  1AJ3 A;  4ZOL E;  4AQG A;  5F3J A;  5FMN A;  2NOX A;  4E7S A;  4IE6 A;  3RYH E;  4O8S A;  4TX5 A;  1D0Z A;  4UIG A;  1BR2 A;  4DMV A;  5C8Y E;  2YK0 A;  5FXX A;  3N9M A;  3PU3 A;  2E9X C;  2WAU A;  3NBX X;  4F6R C;  3AVR A;  3FBL A;  2V1D B;  5DQW A;  1D1A A;  3PUG A;  3RPU A;  2NWB A;  1UCU A;  2LSI A;  4IDZ A;  3VKG A;  5CB4 E;  1FMV A;  4HKA A;  3J9X 1;  5L3B B;  3V5S A;  4G2A A;  5EK4 A;  5LNK A;  1IZN B;  2LHR A;  1MIV A;  3B57 A;  2KND A;  4EYU A;  2Q9Q A;  3O1I A;  4NUU A;  3RYI E;  3ETU A;  2D0U A;  3FXE B;  1YD8 G;  2EHO A;  4UF0 A;  4IST A;  5F8P A;  3AVS A;  3JC6 D;  5JRE A;  1YKE B;  1WRD A;  5LJN A;  2SPC A;  3EDU A;  4O2B E;  2C5J A;  4TN7 B;  1OXZ A;  5L3E B;  2K9A A;  3RC3 A;  4Z8X A;  2E9X D;  1ZKE A;  1MIY A;  3ZJ1 A;  2UXN B;  2CXD A;  4DBQ A;  2HPJ A;  2H3R A;  2CE7 A;  2C5K T;  1D1B A;  4UXN B;  1S35 A;  3GWH A;  4O4L E;  2XUE A;  4GK5 E;  3RYF E;  2W00 A;  5HXE A;  4BJM A;  1OWA A;  3ZEF B;  2CCQ A;  4I43 B;  1HF8 A;  2CLY B;  3RX6 A;  3UUX B;  4H9O C;  4O4I E;  3DP7 A;  5JDH A;  2WSS V;  2D5U A;  2V7K A;  3MA9 A;  3FB2 A;  2QGS A;  4QXH B;  1BR1 A;  3C4W A;  2JMK A;  4H63 H;  2KMF A;  1LVK A;  5LHH B;  3PDY A;  5IYZ E;  3RKO A;  4C91 A;  2KZ7 B;  5KX5 E;  3CX7 B;  1O3X A;  3NZQ A;  3CX8 B;  2KWI B;  2KT9 A;  3PE0 A;  1HG5 A;  4P0B A;  1G73 A;  2LM9 A;  2Y8D A;  4EOZ B;  3QC9 A;  4O4J E;  3F31 A;  4PJL A;  3HKB E;  3OYX A;  4ZI7 E;  3CWZ B;  3AAI A;  1YW0 A;  3KIN B;  5L3C B;  4H9Q C;  1NAF A;  4H9R C;  5IHY A;  5E0O A;  2K24 A;  5JRC B;  4QKN A;  4AKH A;  5H6Q B;  4CXY A;  1FEW A;  2E9X A;  2V7I A;  3AA7 B;  4BAY B;  2HPL A;  4ILU A;  5DQV A;  3ZMU B;  3O9X A;  3I1A A;  3KVA A;  2B1E A;  2PBI A;  2DI4 A;  2N9D A;  3LBX B;  1HX8 A;  3KV4 A;  4AKL A;  2K48 A;  2WMO A;  1MMD A;  3AA0 B;  3N5L A;  5EK2 A;  2V7L A;  2K5B B;  4UEM A;  4QX7 B;  5LP6 E;  3N9N A;  3UUN A;  4O2A E;  3H37 A;  3GN5 B;  3ESL A;  3K3N A;  2YU1 A;  3F2E A;  2BZB A;  2X9W A;  4L5G A;  1ZEE A;  2DWG A;  2L9Q A;  3ZJ2 A;  4DVD A;  3BQK A;  2X67 A;  5LXT E;  3RRW A;  1Y64 B;  1HCI A;  4PJN A;  5DAB A;  4PK6 A;  4WBO A;  4AXP A;  2IC9 A;  5FY7 A;  4IE4 A;  3BQL A;  3O4X E;  2EHO D;  2NP9 A;  2WM9 A;  4IHJ E;  5HWY A;  5HYA A;  3DTO A;  3P7I A;  3I9W A;  4ZI2 C;  3O1J A;  3KFW X;  5CA1 E;  5LGN B;  2M67 A;  1MND A;  3C4X A;  3ANW A;  3I9Y A;  3C98 B;  3CQC B;  2A72 A;  5LBQ B;  2CLY C;  2J1D G;  3LFM A;  3C4Z A;  4UVC B;  1Z0P A;  2WWU A;  4NUV A;  4MAL A;  5FXW A;  1VRB A;  3PUR A;  4KP3 C;  4PK5 A;  2PJQ A;  1UX5 A;  3NZP A;  3MJX A;  3WAK A;  4DMW A;  5FYM A;  2ES0 A;  2XAH B;  1MMG A;  3ZC1 A;  3ZC0 A;  4X1Y E;  2W62 A;  4I55 E;  4PJJ A;  1LKX A;  4P0A A;  2NW7 A;  4TUY E;  3MK7 C;  3OBV E;  2MBG A;  3AB3 B;  4HFV A;  4ZI2 D;  2IC6 A;  4J2C A;  5JDM A;  1QUU A;  5HXC A;  3ZPO A;  5JR9 B;  2I59 A;  4IE5 A;  4H9N C;  2VKO A;  2XAF B;  3R84 B;  1U4Q A;  2D2S A;  3UUL A;  2DCF A;  2L8K A;  3V5U A;  2ODV A;  3ZMT B;  5AFU L;  1HS7 A;  3UT5 E;  4ERR A;  4ISS A;  3LJC A;  4YJ3 E;  4CI2 B;  3N9O A;  4CXX A;  2JRK A;  2YIN A;  4OFZ A;  4UEL A;  4UVA B;  5FY1 A;  4N78 D;  2ZMA A;  4X1I E;  3J7Y q;  3OYZ A;  4CZZ B;  4QX8 B;  3LK2 B;  4H63 V;  3QK6 A;  4EAH A;  3MAC A;  2YEV C;  2D0T A;  2MYS A;  3MZK B;  5L3G B;  2XQY A;  4YJ2 E;  4EZ4 A;  1MMN A;  5LGT B;  4V1A v;  2LJL A;  2XHE B;  1IJ5 A;  1ZHC A;  4IIJ E;  4FI5 A;  5JDG A;  4BJN A;  4ZS3 A;  2DHR A;  4G63 A;  2W61 A;  2MTQ A;  2YU2 A;  5TAO A;  4EYY R;  2VWA A;  2DLR A;  1FMW A;  1HG2 A;  2XTL A;  3P8C D;  4HN9 A;  3PUA A;  3ZN1 B;  3N2K E;  4U74 A;  5FP3 A;  3HI2 A;  2NW8 A;  4I4T E;  4IGU A;  4A56 A;  4WBN E;  4E7Z A;  2IAK A;  3FXD B;  2GK9 A;  4CXW A;  3EDV A;  3LK3 B;  2E8I A;  4TZ4 C;  3I0O A;  4DO0 A;  2LSG A;  4YHJ A;  2KXP B;  3Q5X A;  2RA1 A;  3CX6 B;  2WBL A;  2LT3 A;  4U72 A;  4PW8 A;  2KWH A;  2NTX A;  2RP4 A;  3HL6 A;  2JMH A;  2LSY A;  2KIN B;  5DJQ C;  2DWK A;  4IE0 A;  3ZCI A;  5ADX L;  4OYK A;  3CQX C;  1D1C A;  1UX4 A;  3RC8 A;  1B7T A;  3CQG B;  5LG4 A;  5J2T E;  4PK4 A;  5L3F B;  2LSK A;  3E22 E;  3PTR B;  2X9Y A;  1D0Y A;  2ZM8 A;  5JR9 C;  3HKC E;  4PFP A;  3KVB A;  1LVF A;  3N9Q A;  3Q2M A;  1KNZ A;  4YLH A;  3EUH A;  5HXR A;  4JEH B;  5LYJ E;  3KBT A;  2XAS B;  2Y6X A;  5JRC A;  1FIO A;  1H7C A;  4PFO A;  3HKE E;  4X20 E;  3N2G E;  4DND A;  3FBZ A;  2LOS A;  1KK7 A;  3KDS E;  2Q9Q C;  2N2N A;  4QHO A;  5JDQ A;  1BR4 A;  4GIW A;  4HE8 A;  4EXT A;  5JDF A;  3LBX A;  3KBU A;  4EIW A;  2G0U A;  2JJ9 A;  4KMC A;  5HXS A;  4CQI A;  5LA6 E;  2MOZ A;  1YKH B;  2C0S A;  4JUY A;  3GN5 A;  3PUQ A;  2CXL A;  4QWN B;  3KV9 A;  5J2U E;  4EZH A;  4IE7 A;  2UXX B;  2PFV A;  4C90 A;  3RYC E;  3CPZ A;  5LBM A;  3ZMS B;  3AA6 B;  2CWO A;  5JH7 E;  3C50 A;  3HR0 A;  2LEH A;  5BMV E;  2VK9 A;  1IJ6 A;  1VOM A;  2VB6 A;  2X68 A;  3LG7 A;  4B6X A;  1WLX A;  3E0Z A;  4X1K E;  2VKJ A;  3W15 B;  4CI1 B;  3C64 A;  2V7J A;  4AKR B;  1BR0 A;  1US7 B;  4XBF B;  4CI3 B;  2NTY A;  4OHF A;  2WMN A;  2XAG B;  3IF8 B;  4BA9 A;  3N9P A;  2JPF A;  5KMG P;  4WNK A;  4XZC A;  4UV8 B;  3OKQ A;  5FY0 A;  2X9X A;  3E08 A;  3ZYM A;  3PUS A;  4AQF C;  2ZM2 A;  5GON E;  5FXV A;  5CA0 E;  1HFA A;  4AKG A;  3KV5 A;  3JC6 C;  2X66 A;  2Z6E A;  3VKH A;  3CKD A;  2CM0 A;  3H3A A;  1MMA A;  2NW9 A;  1MIW A;  1EZ3 A;  4FJO A;  3L09 A;  3IEE A;  2Q9Q B;  1HTJ F;  4UF0 B;  3B13 A;  2EHO B;  2PG8 A;  3KV6 A;  5JR9 A;  3AA1 B;  4OK0 A;  3FHN A;  3BK9 A;  3TKL B;  5LGU B;  3RH3 A;  5L3D B;  2VAS A;  2X0L B;  3ZMZ B;  3WAJ A;  3VU7 H;  3Q9D A;  1X79 A;  4P09 A;  3Q5W A;  1WR6 A;  2BDE A;  2L3L A;  2HH7 A;  3EVY A;  4HEA A;  4QXC B;  4GOU A;  2C5I T;  3CVR A;  3GA8 A;  1SHZ C;  2VKD A;  1SA0 E;  1U5P A;  2LE8 A;  4ASK A;  4ADZ A;  3AAA B;  4OYJ A;  4MFR A;  2ODU A;  4PJM A;  5LHI B;  5M4Y A;  1ZV4 X;  1D0X A;  2CMR A;  3ONX A;  3M65 A;  1NWM X;  3UTK A;  5J1G A;  3UFE A;  2N1G A;  2JQQ A;  3I0Q A;  3S4U A;  4MHC A;  2H7V C;  1QSD A;  2A2F X;  3QUJ A;  4UVB B;  2X51 A;  3NRY A;  3MXZ A;  5KDM C;  2BVL A;  2CA5 A;  2X9H A;  4GYS A;  4ZI3 C;  5LCY A;  4AI6 A;  2H7O A;  3ZCJ A;  1E1H B;  3SWH A;  2BVM A;  2XAQ B;  3ETV A;  3AAE B;  3A5X A;  2W0G A;  2KLQ A;  3K3O A;  4YFS A;  3SS1 A;  3GMI A;  3MKD A;  4GK0 E;  4K0U A;  4I50 E;  5A1L A;  3IHR A;  4ZHQ E;  4HTE A;  5LOV E;  1G8X A;  2VKH A;  3L3P A;  2OA5 A;  4JLE A;  1V9D A;  2CXF A;  2E9X B;  1WYB A;  2A3D A;  3VHL A;  4DBR A;  2LHN A;  3NRX A;  2LSJ A;  2CWY A;  4O4H E;  4KBM B;  1LRZ A;  2W63 A;  5LHG B;  4JEU B;  3F57 A;  4AQF A;  5L2L A;  3CML A;  5H6R B;  1WYC A;  1IAP A;  4H9S E;  4ZI3 D;  3RRC A;  3D0T A;  4PAG A;  3UUM A;  5ETW A;  5FXZ A;  2EHO C;  3IBP A;  3N9L A;  4HGA A;  5FNV E;  3LK4 2;  1S94 A;  2Y48 B;  4MBQ A;  4ANJ A;  3O1H A;  4GYR A;  3U3I A;  3ZYK A;  3ZMV B;  2LOP A;  4H9P C;  2P9B A;  5HXH A;  4L0R A;  4XAX B;  4KUM B;  3ZN0 B;  3SOL A;  4TV9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...