3OKQA

Crystal structure of a core domain of yeast actin nucleation cofactor bud6
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
125
structure length
125
Chain Sequence
SSNRMYMEKSQTELGDLSDTLLSKVDDLQDVIEIMRKDVAERRSQPAKKKLETVSKDLENAQADVLKLQEFIDTEKPHWKKTWEAELDKVCEEQQFLTLQEELILDLKEDLGKALETFDLIKLCC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Bud site selection protein 6
publication title Structure of the formin-interaction domain of the actin nucleation-promoting factor Bud6.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 62
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3okqA00
3ONXA 3OKQA
chains in the Genus database with same CATH superfamily
3WI3A 3P4SA 4CZZB 4AKLA 4WBOA 2WDVA 3OJAA 2YEVC 3CKDA 4EZHA 4QXCB 4PJLA 2ACXA 5LBMA 2YKSA 2CLYB 2IIUA 1YKEB 2CWOA 3KFWX 5KDMC 1BR1A 5FVLA 3R6NA 3CK6A 2H7VC 1MMAA 5AQUB 3N2GE 5FP3A 3A5XA 1WLXA 2V7KA 2RP4A 4UELA 2UUAT 3VHLA 3GWHA 4M1PA 4O4IE 2UXNB 1OWAA 3R84B 2QVAA 2PTFA 4IDZA 4LFAT 3NZQA 5ABFA 2ZM2A 1HFAA 4PK6A 1IBLT 2GK9A 3QNUA 1HX1B 1G8XA 3KV6A 5FL1A 3NBXX 3RC8A 3EAMA 5CB4E 2KLQA 2XY8B 2E2AA 3I0QA 2BG9C 3F57A 2LT3A 3UUMA 2X66A 4KUMB 3IHRA 2X0HA 3LK2B 4PAGA 1ZV4X 2V6YA 1JNRA 4ZI3C 3ZN1B 2VKJA 2YN6A 3ZMZB 4IDQA 3QUJA 5L3DB 4B6XA 3M65A 2FJDA 5BMVE 3Q5DA 2UU9T 4DMVA 1N36T 3CWZB 3UTKA 4DR7T 4QH4A 4FJOA 4OYJA 2FJAA 1U5PA 1MMGA 3JADA 3M3ZB 4X62T 3RGLA 4OX9T 4H9NC 2DWKA 3N9QA 1T8BA 2YU1A 2XAFB 3K3OA 2H89A 1U4QA 3T8OA 3QB5K 3ZC1A 1MMNA 2CHOA 2ODUA 1V9DA 3ONLC 4LFBT 4AQYT 1W09A 5FY1A 5J1GA 3GN5B 4I4TE 3LDQB 4PJJA 4YY3T 4GYRA 1WR6A 4UR9A 3AE8A 3WAKA 5IWAT 4DR4T 5IYZE 2W4XA 5HWYA 1MIWA 1N34T 4F6RC 3KV4A 4AIUA 2LSYA 3DP7A 2K24A 3LJCA 4UF0B 1UUSA 3PJAJ 3ZN0B 3KVAA 3Q5XA 4WNKA 4L5GA 3EABA 1X9BA 4UV8B 5KMGP 4NXMT 3K3NA 4GK0E 5JRCB 4AKHA 2RPAA 1UGOA 3PUSA 1T72A 3OPCA 2ACZA 3O1IA 2C0SA 2XPKA 4ZXLA 5AQTB 3B13A 2LLYA 4IE4A 3QC9A 3AA6B 3T1HT 4YJ3E 2C5JA 2CWYA 1Y64B 3HA4A 3AEAA 5ABGA 3NZPA 2MPKA 2V5CA 3NWIA 3ZMUB 1OEDE 3PV0F 3AE9A 2G0UA 3RPUA 2LOPA 3ZMVB 2V7JA 2VB6A 5LHHB 2HH7A 4X64T 4BAYB 4OFZA 4YSYA 2MTQA 1NEKA 5AQRB 1IJ5A 1WYBA 3MZKB 1HX8A 2E9XA 4JV5T 2I6HA 5AQPB 5JVDE 2UXCT 4G63A 3OTOT 1QUUA 2CBIA 1E2AA 3DJBA 5LA6E 2YU2A 3ZT7A 4WZXA 3TLVA 2NTYA 1LKXA 2UUBT 2BKPA 4HFHA 4DO0A 4QXBB 3AEGA 2Q9QC 2WAUA 3VRAA 2EHOB 3RLFF 5LJNA 4TN7B 3AECA 5AQMB 3BQKA 2VKHA 3ONJA 4Q25A 4F8HA 4ZOLE 1UCUA 4UV9B 4MLKA 2W0GA 2C5IT 4BJMA 2CM0A 2ZMAA 2X68A 3MXZA 2LKHA 4LF5T 5FKYA 2CMRA 2VWAA 2XQ8A 4AI6A 4YTNA 2WWVA 1Z0PA 3AAEB 1N32T 3N9MA 4HFIA 4MFRA 3UT5E 3NVOA 3Q2MA 3L39A 3PUQA 3U78A 5LMNT 4DV0T 4IDPA 3G06A 3MACA 3OBVE 3FZLB 4I0UA 1MMDA 5AQGB 3C4XA 4IDOA 2DHRA 4IL4A 3RC3A 5AQIB 4YJ2E 1B7TA 4AISA 3PUGA 3C64A 2M6IA 5DQVA 3RIUA 3AVSA 4PJMA 3KBUA 4WBNE 4DV4T 4LFCT 4BJNA 3L8RA 4YSXA 1BR4A 2IMLA 2B76A 3TLTA 5F5WA 2BZBA 3RQWA 1OEDB 2KXPB 4DV1T 2BKNA 4CXWA 4ZI2C 3J7Yq 3E08A 4HWFA 5J0ZA 4AKIA 3UQ7A 2V6XA 2WBLA 2V7IA 3K8PC 4P0AA 2X0YA 4FI5A 4TNWA 2A9UA 2CBJA 4DV7T 3A7MA 2JRKA 5L3FB 2IDOB 2CPTA 5LHIB 1H7CA 3QK6A 1W9RA 3O4XE 3IEEA 5CGMA 3ZPOA 2I0MA 4XZCA 2NR4A 2XM2A 4K0UA 3B57A 3P4QA 4U3CA 2UXDT 2XQ6A 2JQKA 2J62A 4U7YA 3AE6A 3F2EA 4UVAB 3RKGA 4DBQA 2IC6A 3PURA 2OA5A 2A3DA 3UUBA 4X1YE 2L3LA 2A72A 1M62A 3FZMB 2WSSV 2YK0A 4EOZB 5ABFB 3IBPA 4H9PC 4O2BE 5JDNA 2CXDA 4H9SE 1KF6A 3RIUC 1WRDA 1YQ3A 3PUZF 2WB5A 4DUYT 1HNWT 3HKCE 1G73A 4U33A 5LGNB 2BBJA 3N9NA 5JH7E 2D9DA 4DV5T 4H9QC 5ABHA 2WCAA 2QRXA 4ZZCA 2BG9A 5LCYA 4GOUA 2W61A 4DVDA 2LEHA 4TWHA 2HN1A 2V6YB 2Y48B 4OYKA 4HWHA 2XSBA 5F8PA 3QB5A 4Z91A 3ZCIA 4HFBA 2X9XA 2E5LT 4KP3C 4V1Av 4ZI2D 4GK5E 2CCQA 2DLRA 3K1SA 3TLWA 2QGSA 4WYVA 3AEFA 3I0OA 4I43B 2ODVA 5AQNB 1EZ3A 2UUCT 4A98A 4XAXB 5L3GB 1SE7A 2V26A 4B3ST 4X65T 4U74A 1IBMT 3D0TA 2LSJA 3ETUA 1JNZA 4HKAA 5L2LA 2XQ4A 4OHFA 3NKZA 3SOLA 3ZMTB 4JI5T 4CN1A 3AA1B 5FMNA 2XQ7A 5AQSB 3PUAA 2N1GA 5FY0A 3N2KE 1CUNA 3SS1A 5AQOB 5JDMA 4YHJA 2JMHA 2IC9A 3PE0A 5DJQC 2PFVA 4QWNB 1KFYA 2J47A 4PFPA 4H9OC 3WAJA 1VCTA 1HG2A 4AQFC 5HYAA 3EI0A 4JYAT 4AKGA 2X9WA 4KMCA 4ZEYA 2I59A 3LBXA 5HEGA 2MBGA 1J5ET 4X66T 2BDEA 4GKJT 2D0UA 3CVRA 4U2ZA 4CXYA 1W0BA 3CX8B 3AE7A 4JUYA 5FNVE 5IHYA 2D5UA 1ZHCA 5L3EB 4YTPA 3KVBA 1XNQT 1S94A 5L3CB 3AE3A 3AAAB 2WMNA 2BS4A 5HCMA 2KMFA 3UFEA 1IBKT 4CN4A 2VASA 2K9AA 4YFSA 3FXEB 2NW7A 3UU3A 2ZM0A 2D0TA 2DWGA 5LG4A 1Y01A 5HEHA 3UU4A 1UK5A 1IAPA 2MYSA 1UX5A 2JQHA 3FXDB 3ANWA 2KWHA 2E9XB 2N2NA 2VL8A 4PW8A 3AE4A 2E8IA 3C4ZA 2WP9A 1N33T 2X9HA 3RRWA 1BR0A 5ETWA 5C8YE 3LK3B 3RKOA 1XZYA 1QLBA 4TV9E 2H3RA 1YQ4A 3ZSSA 5HEOA 4NIQA 2JJ9A 4IE5A 5KX5E 4E7SA 1VCSA 2WQYA 5AQJB 3JC6D 3LK42 3ZEFB 4JEHB 2Q9QA 3AE2A 3RQUA 4JI6T 1I6ZA 3ETVA 4ZHQE 1KEYA 5EK3A 1HCIA 5ADXL 4LF7T 2KWIB 5LOVE 1T7SA 3C4WA 4Z90A 3AE1A 2CE7A 4ILBA 5JR9C 3AA0B 4GIWA 2HN2A 5AQFB 1HS7A 1W0AA 2YDRA 2NW9A 4TWFA 5JTGA 3P4PA 3CQXC 2WU5A 2V8SV 4DR2T 5LGTB 4DR1T 2LOSA 5HCJA 5EK2A 4QHOA 5JDFA 2BG9E 3C50A 4LMJA 2DI4A 2L9QA 3JAEA 3KV5A 4GKKT 2ZM8A 5J2UE 4I55E 2CHNA 2VVNA 3EDVA 3CQGB 4MBQA 3HR0A 2FBWA 3NRYA 2W00A 4B3RT 2HPJA 4O4LE 3EHZA 2CA5A 5AFUL 5AQQB 4HFEA 4QH5A 4JI1T 5CA0E 2A2FX 3O1HA 3OKQA 2LJLA 4ILAA 3HI2A 2DNXA 4HGAA 4TNVA 3E0ZA 3ZC0A 5LGUB 3RHWA 4TWDA 1YKHB 4HFCA 3UQ4A 4KBMB 4XBFB 1GQEA 2ZLYA 3ONXA 2XQAA 3AEDA 5JDQA 5CJ5A 3AB3B 4LMKA 2J4GA 4JBWF 5LNKA 5HXEA 4DR6T 4C90A 3O1JA 3TLUA 4IHJE 2N9DA 4LF9T 3AAIA 4JLEA 4A56A 4HFDA 2WDQA 1D0ZA 3C51A 4TUYE 4NPPA 3J9X1 3OYXA 3PDYA 2LRLA 4HN9A 3ZYLA 5FL0A 2IUBA 3VU7H 2WMOA 1J1JA 1VRBA 5L3BB 3CQCB 1QSDA 2NP9A 2LRKA 3MJXA 3N9LA 2WWUA 4JI3T 3IA3A 4X1IE 1XMQT 3UFGA 4HWIB 5LXTE 1WYCA 3LSVA 3JCFA 4CI2B 1HTJF 2B1EA 3N9PA 3EUHA 1LVFA 5A1LA 3I9YA 2MAWA 3RIAA 4BA9A 3O9XA 4O8SA 2VQET 4GYSA 4DBRA 1T98A 1SUMB 3RI5A 1FIOA 4HEAA 3Q9DA 4EEDA 2JIWA 3IF8B 2BG9B 3LG7A 1ZP0A 5J2TE 4LMLA 3RYIE 3FBLA 3TLSA 1AJ3A 5JREA 2BVLA 4DV6T 4EIWA 1HNXT 3PUXF 1X79A 2LSKA 1DU2A 3RF1A 4HFVA 2YDQA 1D0YA 3OYZA 4U7IA 4JI4T 2WS3A 2WY2A 3AXJA 3VKHA 5LJMA 3MKDA 1SA0E 2CXLA 2FJBA 3P8CD 1ZEEA 2X0LB 4IE0A 4IE7A 3VR9A 2NWBA 1KNZA 3U3IA 5C2TA 3UU6A 2QA7A 1IZNB 3ZLIA 4IIJE 4TV8E 2E9XD 4IDNA 2HHHT 4IREA 2W66A 2V7LA 2XQ3A 4LF6T 1IJ6A 3RYHE 3MK7C 4AQFA 2PBIA 4G2AA 5FVKA 1NENA 3EDUA 3OVUA 3LBXB 2V1DB 4HE8A 3ZT5A 4WW0A 4YSZA 5LYJE 2Y8DA 2KT9A 2XASB 4U31A 2QYWA 2JMKA 2D2SA 4U72A 4IGUA 3SFDA 3P7IA 3ZYKA 4YTMA 4DMWA 4EV6A 2VQFT 3FZKB 4EB6E 4JI8T 3I1AA 4YLHA 4L9IA 1MIYA 2DCFA 2XTLA 4UVBB 2PJQA 5JR9B 2Y6XA 3SWHA 4ZS3A 3F31A 2JQQA 5HAXA 3A8YC 3CPZA 3HKDE 2IHR1 3AVRA 5JQGE 4PJNA 3H37A 4CN6A 4DR5T 1UURA 3BQIA 5LB7B 1L0VA 3ZJ2A 2X9YA 3ANWB 5HXSA 5DABA 3N2OA 4YT0A 1D1AA 4AQGA 4X20E 2JQ9A 2FJEA 3H3MA 3CIRA 3RH3A 3W15B 3FBZA 4YHHT 2ZM6T 1YXRA 1SHZC 4DIDB 3EVYA 5HEUA 3JC6C 4COFA 4UXNB 3KINB 5FXXA 1KNRA 2WU2A 1HR0T 3ZMSB 2NTXA 1VOMA 3AA7B 4ISSA 2Q9QB 2K3WA 1OEDC 4B3MT 2XZEA 3TKLB 3FZFB 5FXWA 2LE8A 2KNDA 2CEAA 3KDSE 2XQ9A 2VKOA 3P4WA 2F4VT 5HXCA 2PG8A 2V5DA 2VK9A 2EHOD 4ADZA 3AEBA 5JR9A 2AE9A 4QH1A 2M6BA 5H6QB 2UXXB 4ERRA 4HTEA 3LFMA 4PK5A 2CXFA 2W67A 5FXZA 4EEBA 5FXVA 1S35A 3ABVA 4AKRB 5JDHA 2V7MA 5FY7A 3RYCE 4YXDA 2XUEA 4IT4A 5IUXA 2RA1A 2LKGA 2LHRA 3PU8A 4MHCA 4B3TT 3NRXA 4UEMA 3T1YT 2ES0A 1YW0A 3HKBE 3ZCJA 2WZIA 4LF8T 2AXDS 2YINA 1FEWA 2WM9A 4DNDA 4X1KE 4ZZBA 1WCRA 4P0BA 4QKNA 3UULA 1R8IA 2XAGB 4I50E 4UIGA 4K0KT 3FHNA 3SRZA 4TZ4C 2SPCA 5BR8T 3UUXB 5AQLB 2H88A 5CFBA 5M4YA 3E22E 4CI3B 2W63A 3V5UA 3HL6A 3VR8A 2BKOA 4DV2T 5FYMA 2BS3A 4OK0A 3ZYMA 4A97A 3UU5A 2LSGA 4ILUA 2CRBA 3GMIA 2CLYC 3Q5EA 3ZJ1A 3ZT6A 3FB2A 2K48A 1XWMA 5EZYE 4A5XA 2M67A 4ZI3D 4DV3T 4C91A 3CMLA 5CA1E 2Z6EA 5KXJA 5JDLA 1M7KA 3QOFA 1WR0A 2VURA 4NUVA 4QXHB 5HWXA 2BVMA 2OV9A 4ZI7E 3ZSTA 2XQYA 4JI0T 3JAFA 5L4HA 1UX4A 3I9WA 4J2CA 4IE6A 2E5VA 4ZS2A 4EYYR 2XJ7A 3ESLA 2LHNA 3DTOA 3GN5A 5TAOA 5HXRA 5AQVB 3H3AA 4EZ4A 3RX6A 4KX6A 3PTRB 2XAQB 4UF0A 5F3JA 2L8KA 5L4EA 2YDSA 2H7OA 4O2AE 1HG5A 4P09A 2OLTA 4E7ZA 1XMOT 5JRCA 3AEEA 4PNIA 4ASKA 1E1HB 2P9BA 2LM9A 4CI1B 2YOEA 1D0XA 3HKEE 2IW5B 1NAFA 3VKGA 4PFOA 1LRZA 4CXXA 4Z8XA 5AQHB 3AXJB 5EK4A 3FZHB 4IL9A 3SFEA 3KBTA 1LVKA 5GONE 1I94T 4NXNT 4N78D 2BS2A 4EGWA 2XQ5A 3BQLA 4DR3T 3ZKRA 4H9RC 2E9XC 4UVCB 3PU3A 3L09A 1WFDA 3GA8A 2VKDA 3X1DA 3PJAA 2NOXA 2W62A 3RIFA 4NUUA 4EXTA 1ZOYA 2XHEB 1CHUA 3VRBA 4KHZF 4ANJA 2XAJB 1BR2A 3Q5WA 2VL0A 3N9OA 2J1DG 2LSIA 1HF8A 2X67A 3K3QC 1MNEA 4AXPA 3RRCA 2KZ7B 5L47A 4EAHA 4KI0F 2W2UA 2DL1A 3AE5A 2HPLA 2WDRA 3L3PA 5ABEA 1Z8UA 4O4JE 4MALA 2EHOA 5C3JA 2WZHA 4L0RA 2LM2A 2BBHA 2Q9QD 3CX6B 1MIVA 4O4HE 2MOZA 3PUYF 5LHGB 5H6RB 3BK9A 5LMUT 4DUZT 2NW8A 3PUVF 4P1NA 3C98B 2XAHB 1D1CA 5LG3A 1XDOA 3UUNA 5HEJA 2XSAA 1O3XA 1KNPA 1MNDA 1YD8G 3MA9A 2VVSA 2K5BB 4X5TA 2C5KT 1FJGT 2X51A 4H63V 3V5SA 1XNRT 4JI2T 5E0OA 5DQWA 5AQKB 1XDPA 4ILCA 4JI7T 4TX5A 4QX8B 3B5MA 4U2YA 1OXZA 2IAKA 3UU8A 4CQIA 5HXHA 3N5LA 4EYUA 1ZKEA 3RYFE 1KK7A 4JEUB 3CX7B 3P4RA 1US7B 2XM1A 5LBQB 1E7PA 1J5WA 5LP6E 1NWMX 3S4UA 3KV9A 2R6GF 2EHOC 4ISTA 4HWDA 4QX7B 1FMWA 2UXBT 4H63H 4HWCA 4KHPT 2JPFA 2FUPA 1OEDA 4PK4A 5JDGA 1FMVA 4LF4T 3PUWF 2KSRA 1HNZT 3P50A 2KINB 1D1BA
chains in the Genus database with same CATH topology
5FXVA 1S35A 4AKRB 3WI3A 4BJNA 4CZZB 5JDHA 4AKLA 1BR4A 4WBOA 3OJAA 2V7MA 2YEVC 5CA0E 2A2FX 3O1HA 3CKDA 3OKQA 2LJLA 2BZBA 3HI2A 2DNXA 4EZHA 5FY7A 2KXPB 4QXCB 4HGAA 4PJLA 4CXWA 3E0ZA 3RYCE 3ZC0A 5LGUB 4ZI2C 2XUEA 2ACXA 3J7Yq 2RA1A 3E08A 2LHRA 3PU8A 5LBMA 4MHCA 2CLYB 4AKIA 1YKEB 1YKHB 2CWOA 3KFWX 2WBLA 3NRXA 2V7IA 5KDMC 3K8PC 4KBMB 4UEMA 1BR1A 4XBFB 2ES0A 3R6NA 1YW0A 4P0AA 2ZLYA 3ONXA 2H7VC 1MMAA 5JDQA 3HKBE 4FI5A 3AB3B 3N2GE 3ZCJA 5FP3A 3A5XA 1WLXA 2V7KA 5LNKA 2JRKA 5L3FB 2RP4A 2YINA 4UELA 1FEWA 5HXEA 2WM9A 5LHIB 1H7CA 3VHLA 3QK6A 4C90A 4DNDA 4X1KE 3O1JA 3GWHA 4M1PA 4IHJE 4O4IE 3O4XE 4P0BA 2UXNB 3IEEA 4QKNA 3ZPOA 1OWAA 3UULA 3R84B 4XZCA 2XAGB 4I50E 4K0UA 3B57A 4UIGA 2N9DA 4IDZA 3AAIA 3FHNA 4JLEA 3NZQA 4A56A 3SRZA 2ZM2A 4TZ4C 1HFAA 2SPCA 1D0ZA 3C51A 3UUXB 3F2EA 4PK6A 4TUYE 4UVAB 5M4YA 3E22E 4CI3B 2W63A 4DBQA 2GK9A 2IC6A 3PURA 3V5UA 2OA5A 3HL6A 2A3DA 4X1YE 3J9X1 2L3LA 3OYXA 2A72A 1G8XA 3PDYA 4HN9A 5FYMA 3KV6A 3ZYLA 3NBXX 3RC8A 2WSSV 2YK0A 4EOZB 5CB4E 3IBPA 3VU7H 2KLQA 4OK0A 4H9PC 4O2BE 2WMOA 5JDNA 2CXDA 4H9SE 3ZYMA 1VRBA 5L3BB 3I0QA 2LSGA 4ILUA 3CQCB 1WRDA 3F57A 1QSDA 3GMIA 2LT3A 2NP9A 3UUMA 2CLYC 2X66A 3MJXA 4KUMB 3IHRA 3N9LA 2WWUA 3ZJ1A 4X1IE 3FB2A 3HKCE 1G73A 2K48A 3LK2B 5LGNB 5EZYE 5LXTE 3N9NA 4PAGA 1ZV4X 5JH7E 2M67A 1WYCA 4ZI3D 4CI2B 1HTJF 4C91A 4H9QC 4ZI3C 3ZN1B 2VKJA 3CMLA 2B1EA 2Z6EA 3ZMZB 5CA1E 3N9PA 3EUHA 5JDLA 3QUJA 5L3DB 1LVFA 4B6XA 5A1LA 4NUVA 3I9YA 3M65A 4GOUA 5LCYA 4QXHB 5HWXA 2BVMA 5BMVE 2W61A 4ZI7E 3O9XA 4BA9A 4DVDA 4O8SA 4GYSA 2LEHA 4DBRA 4DMVA 3CWZB 3UTKA 2XQYA 1T98A 4FJOA 2Y48B 4OYKA 4OYJA 1UX4A 1FIOA 5F8PA 3ZCIA 3I9WA 4HEAA 2X9XA 3Q9DA 4J2CA 4IE6A 1U5PA 4KP3C 1MMGA 4V1Av 4ZI2D 4ZS2A 4GK5E 2CCQA 3IF8B 2DLRA 4EYYR 2QGSA 3LG7A 5J2TE 3I0OA 4I43B 4H9NC 2ODVA 3ESLA 2DWKA 3N9QA 1EZ3A 2YU1A 2LHNA 3DTOA 3GN5A 2XAFB 3RYIE 3K3OA 3FBLA 4XAXB 5L3GB 5TAOA 1U4QA 1AJ3A 5HXRA 2V26A 5JREA 3T8OA 4U74A 2BVLA 3H3AA 3ZC1A 3D0TA 1MMNA 2LSJA 4EIWA 3ETUA 2ODUA 4HKAA 1V9DA 4EZ4A 5L2LA 4OHFA 3RX6A 3SOLA 3ZMTB 3PTRB 1X79A 2XAQB 5FY1A 2LSKA 5J1GA 3GN5B 4I4TE 4UF0A 3AA1B 5FMNA 4HFVA 5F3JA 4PJJA 2L8KA 4GYRA 1D0YA 3OYZA 1WR6A 2H7OA 3PUAA 1HG5A 2N1GA 4O2AE 4P09A 5FY0A 3N2KE 1CUNA 3SS1A 3WAKA 5JDMA 4E7ZA 4YHJA 5JRCA 3VKHA 5LJMA 3MKDA 2JMHA 1SA0E 2CXLA 5IYZE 2IC9A 4PNIA 5HWYA 3PE0A 1MIWA 5DJQC 2PFVA 3P8CD 1E1HB 2P9BA 4ASKA 4F6RC 4QWNB 2LM9A 3KV4A 4CI1B 2LSYA 3DP7A 2K24A 1D0XA 3HKEE 3LJCA 1ZEEA 4UF0B 2IW5B 4PFPA 3ZN0B 1NAFA 3VKGA 4H9OC 3KVAA 3Q5XA 4PFOA 1LRZA 4CXXA 3WAJA 2X0LB 4WNKA 4L5GA 4UV8B 5KMGP 1HG2A 3K3NA 4Z8XA 4AQFC 5HYAA 4IE0A 4AKGA 2X9WA 4IE7A 4GK0E 2NWBA 1KNZA 5JRCB 4AKHA 4KMCA 3PUSA 5EK4A 3U3IA 3O1IA 2C0SA 2QA7A 2I59A 3KBTA 1IZNB 3B13A 3LBXA 3ZLIA 4IE4A 3QC9A 1LVKA 3AA6B 4IIJE 5GONE 4N78D 4YJ3E 4TV8E 2MBGA 2E9XD 2C5JA 2BDEA 3CVRA 2D0UA 2CWYA 2V7LA 3BQLA 1Y64B 4H9RC 4CXYA 2E9XC 3CX8B 3HA4A 4UVCB 3PU3A 3L09A 1IJ6A 4JUYA 5FNVE 5IHYA 3RYHE 3MK7C 3NZPA 3GA8A 2VKDA 4AQFA 2D5UA 2PBIA 4G2AA 1ZHCA 5L3EB 3EDUA 3ZMUB 2NOXA 2W62A 3LBXB 3KVBA 4NUUA 2V1DB 1S94A 4HE8A 4EXTA 2G0UA 4WW0A 5L3CB 2XHEB 3RPUA 2LOPA 3AAAB 2WMNA 3ZMVB 2V7JA 2KMFA 2VB6A 4ANJA 2HH7A 2XAJB 5LHHB 5LYJE 2Y8DA 2KT9A 1BR2A 3Q5WA 3UFEA 3N9OA 4BAYB 2XASB 4OFZA 2MTQA 2J1DG 2LSIA 1IJ5A 2VASA 2K9AA 4YFSA 1HF8A 1WYBA 2JMKA 2X67A 3MZKB 1HX8A 2D2SA 3FXEB 3K3QC 2E9XA 2NW7A 4U72A 1MNEA 2ZM0A 2D0TA 4IGUA 2DWGA 3P7IA 5LG4A 4AXPA 3RRCA 3ZYKA 4DMWA 5JVDE 2KZ7B 4G63A 4EB6E 4EAHA 1QUUA 3I1AA 4YLHA 4L9IA 1MIYA 2DCFA 2XTLA 3DJBA 4UVBB 1IAPA 2PJQA 2MYSA 1UX5A 2YU2A 5LA6E 3FXDB 5JR9B 3ANWA 2NTYA 1LKXA 2KWHA 2Y6XA 3SWHA 2HPLA 3L3PA 3F31A 2JQQA 4ZS3A 2E9XB 4O4JE 4MALA 2N2NA 2EHOA 2VL8A 5HAXA 4PW8A 3CPZA 3HKDE 4L0RA 4DO0A 3AVRA 5JQGE 2E8IA 2Q9QD 3CX6B 3H37A 3C4ZA 4PJNA 4QXBB 3BQIA 1MIVA 4O4HE 2MOZA 2Q9QC 2WAUA 5LHGB 5H6RB 3ZJ2A 2X9HA 3RRWA 3BK9A 1BR0A 2X9YA 3ANWB 5ETWA 5C8YE 5HXSA 5DABA 3LK3B 3RKOA 3N2OA 2EHOB 2NW8A 1D1AA 5LJNA 4TN7B 4TV9E 4AQGA 2H3RA 3C98B 2XAHB 3BQKA 1D1CA 4X20E 2JJ9A 4IE5A 2VKHA 3RH3A 3UUNA 3W15B 3FBZA 5KX5E 4E7SA 4ZOLE 1SHZC 1O3XA 1UCUA 3JC6D 3LK42 3ZEFB 4JEHB 1MNDA 2Q9QA 1YD8G 3EVYA 4UV9B 3JC6C 4MLKA 2W0GA 2C5IT 3MA9A 3ETVA 4ZHQE 4UXNB 4BJMA 5EK3A 1HCIA 5ADXL 2CM0A 2K5BB 3KINB 2ZMAA 5FXXA 2C5KT 2KWIB 5LOVE 2X51A 4H63V 2X68A 3C4WA 3MXZA 3V5SA 2CMRA 2VWAA 5E0OA 3ZMSB 2CE7A 2NTXA 1VOMA 5DQWA 3AA7B 4AI6A 4ISSA 5JR9C 2Q9QB 4QX8B 4TX5A 3AA0B 1Z0PA 3AAEB 3N9MA 1OXZA 2IAKA 4CQIA 4MFRA 3UT5E 5HXHA 4GIWA 3Q2MA 3PUQA 3U78A 3TKLB 5FXWA 3N5LA 1HS7A 4EYUA 2LE8A 2NW9A 2KNDA 1ZKEA 2CEAA 3KDSE 3MACA 3CQXC 3RYFE 5LGTB 1KK7A 2VKOA 2LOSA 3OBVE 3CX7B 4JEUB 5EK2A 1MMDA 1US7B 5LBQB 4QHOA 5JDFA 5HXCA 3C50A 2DI4A 2L9QA 1NWMX 2PG8A 2VK9A 3KV5A 2EHOD 2ZM8A 3C4XA 3S4UA 5J2UE 5LP6E 4ADZA 3KV9A 2DHRA 4I55E 2EHOC 4ISTA 4QX7B 1FMWA 3RC3A 3EDVA 4H63H 3CQGB 4MBQA 5JR9A 2JPFA 3HR0A 3NRYA 2W00A 4YJ2E 1B7TA 5H6QB 2UXXB 4PK4A 5JDGA 4ERRA 3PUGA 4HTEA 3LFMA 1FMVA 3C64A 4PK5A 2CXFA 5DQVA 2HPJA 3AVSA 4PJMA 5FXZA 4O4LE 3KBUA 4WBNE 2CA5A 5AFUL 2KINB 1D1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONX A;  3OKQ A; 
#chains in the Genus database with same CATH topology
 3WI3 A;  3P4S A;  4CZZ B;  4AKL A;  4WBO A;  2WDV A;  3OJA A;  2YEV C;  3CKD A;  4EZH A;  4QXC B;  4PJL A;  2ACX A;  5LBM A;  2YKS A;  2CLY B;  2IIU A;  1YKE B;  2CWO A;  3KFW X;  5KDM C;  1BR1 A;  5FVL A;  3R6N A;  3CK6 A;  2H7V C;  1MMA A;  5AQU B;  3N2G E;  5FP3 A;  3A5X A;  1WLX A;  2V7K A;  2RP4 A;  4UEL A;  2UUA T;  3VHL A;  3GWH A;  4M1P A;  4O4I E;  2UXN B;  1OWA A;  3R84 B;  2QVA A;  2PTF A;  4IDZ A;  4LFA T;  3NZQ A;  5ABF A;  2ZM2 A;  1HFA A;  4PK6 A;  1IBL T;  2GK9 A;  3QNU A;  1HX1 B;  1G8X A;  3KV6 A;  5FL1 A;  3NBX X;  3RC8 A;  3EAM A;  5CB4 E;  2KLQ A;  2XY8 B;  2E2A A;  3I0Q A;  2BG9 C;  3F57 A;  2LT3 A;  3UUM A;  2X66 A;  4KUM B;  3IHR A;  2X0H A;  3LK2 B;  4PAG A;  1ZV4 X;  2V6Y A;  1JNR A;  4ZI3 C;  3ZN1 B;  2VKJ A;  2YN6 A;  3ZMZ B;  4IDQ A;  3QUJ A;  5L3D B;  4B6X A;  3M65 A;  2FJD A;  5BMV E;  3Q5D A;  2UU9 T;  4DMV A;  1N36 T;  3CWZ B;  3UTK A;  4DR7 T;  4QH4 A;  4FJO A;  4OYJ A;  2FJA A;  1U5P A;  1MMG A;  3JAD A;  3M3Z B;  4X62 T;  3RGL A;  4OX9 T;  4H9N C;  2DWK A;  3N9Q A;  1T8B A;  2YU1 A;  2XAF B;  3K3O A;  2H89 A;  1U4Q A;  3T8O A;  3QB5 K;  3ZC1 A;  1MMN A;  2CHO A;  2ODU A;  1V9D A;  3ONL C;  4LFB T;  4AQY T;  1W09 A;  5FY1 A;  5J1G A;  3GN5 B;  4I4T E;  3LDQ B;  4PJJ A;  4YY3 T;  4GYR A;  1WR6 A;  4UR9 A;  3AE8 A;  3WAK A;  5IWA T;  4DR4 T;  5IYZ E;  2W4X A;  5HWY A;  1MIW A;  1N34 T;  4F6R C;  3KV4 A;  4AIU A;  2LSY A;  3DP7 A;  2K24 A;  3LJC A;  4UF0 B;  1UUS A;  3PJA J;  3ZN0 B;  3KVA A;  3Q5X A;  4WNK A;  4L5G A;  3EAB A;  1X9B A;  4UV8 B;  5KMG P;  4NXM T;  3K3N A;  4GK0 E;  5JRC B;  4AKH A;  2RPA A;  1UGO A;  3PUS A;  1T72 A;  3OPC A;  2ACZ A;  3O1I A;  2C0S A;  2XPK A;  4ZXL A;  5AQT B;  3B13 A;  2LLY A;  4IE4 A;  3QC9 A;  3AA6 B;  3T1H T;  4YJ3 E;  2C5J A;  2CWY A;  1Y64 B;  3HA4 A;  3AEA A;  5ABG A;  3NZP A;  2MPK A;  2V5C A;  3NWI A;  3ZMU B;  1OED E;  3PV0 F;  3AE9 A;  2G0U A;  3RPU A;  2LOP A;  3ZMV B;  2V7J A;  2VB6 A;  5LHH B;  2HH7 A;  4X64 T;  4BAY B;  4OFZ A;  4YSY A;  2MTQ A;  1NEK A;  5AQR B;  1IJ5 A;  1WYB A;  3MZK B;  1HX8 A;  2E9X A;  4JV5 T;  2I6H A;  5AQP B;  5JVD E;  2UXC T;  4G63 A;  3OTO T;  1QUU A;  2CBI A;  1E2A A;  3DJB A;  5LA6 E;  2YU2 A;  3ZT7 A;  4WZX A;  3TLV A;  2NTY A;  1LKX A;  2UUB T;  2BKP A;  4HFH A;  4DO0 A;  4QXB B;  3AEG A;  2Q9Q C;  2WAU A;  3VRA A;  2EHO B;  3RLF F;  5LJN A;  4TN7 B;  3AEC A;  5AQM B;  3BQK A;  2VKH A;  3ONJ A;  4Q25 A;  4F8H A;  4ZOL E;  1UCU A;  4UV9 B;  4MLK A;  2W0G A;  2C5I T;  4BJM A;  2CM0 A;  2ZMA A;  2X68 A;  3MXZ A;  2LKH A;  4LF5 T;  5FKY A;  2CMR A;  2VWA A;  2XQ8 A;  4AI6 A;  4YTN A;  2WWV A;  1Z0P A;  3AAE B;  1N32 T;  3N9M A;  4HFI A;  4MFR A;  3UT5 E;  3NVO A;  3Q2M A;  3L39 A;  3PUQ A;  3U78 A;  5LMN T;  4DV0 T;  4IDP A;  3G06 A;  3MAC A;  3OBV E;  3FZL B;  4I0U A;  1MMD A;  5AQG B;  3C4X A;  4IDO A;  2DHR A;  4IL4 A;  3RC3 A;  5AQI B;  4YJ2 E;  1B7T A;  4AIS A;  3PUG A;  3C64 A;  2M6I A;  5DQV A;  3RIU A;  3AVS A;  4PJM A;  3KBU A;  4WBN E;  4DV4 T;  4LFC T;  4BJN A;  3L8R A;  4YSX A;  1BR4 A;  2IML A;  2B76 A;  3TLT A;  5F5W A;  2BZB A;  3RQW A;  1OED B;  2KXP B;  4DV1 T;  2BKN A;  4CXW A;  4ZI2 C;  3J7Y q;  3E08 A;  4HWF A;  5J0Z A;  4AKI A;  3UQ7 A;  2V6X A;  2WBL A;  2V7I A;  3K8P C;  4P0A A;  2X0Y A;  4FI5 A;  4TNW A;  2A9U A;  2CBJ A;  4DV7 T;  3A7M A;  2JRK A;  5L3F B;  2IDO B;  2CPT A;  5LHI B;  1H7C A;  3QK6 A;  1W9R A;  3O4X E;  3IEE A;  5CGM A;  3ZPO A;  2I0M A;  4XZC A;  2NR4 A;  2XM2 A;  4K0U A;  3B57 A;  3P4Q A;  4U3C A;  2UXD T;  2XQ6 A;  2JQK A;  2J62 A;  4U7Y A;  3AE6 A;  3F2E A;  4UVA B;  3RKG A;  4DBQ A;  2IC6 A;  3PUR A;  2OA5 A;  2A3D A;  3UUB A;  4X1Y E;  2L3L A;  2A72 A;  1M62 A;  3FZM B;  2WSS V;  2YK0 A;  4EOZ B;  5ABF B;  3IBP A;  4H9P C;  4O2B E;  5JDN A;  2CXD A;  4H9S E;  1KF6 A;  3RIU C;  1WRD A;  1YQ3 A;  3PUZ F;  2WB5 A;  4DUY T;  1HNW T;  3HKC E;  1G73 A;  4U33 A;  5LGN B;  2BBJ A;  3N9N A;  5JH7 E;  2D9D A;  4DV5 T;  4H9Q C;  5ABH A;  2WCA A;  2QRX A;  4ZZC A;  2BG9 A;  5LCY A;  4GOU A;  2W61 A;  4DVD A;  2LEH A;  4TWH A;  2HN1 A;  2V6Y B;  2Y48 B;  4OYK A;  4HWH A;  2XSB A;  5F8P A;  3QB5 A;  4Z91 A;  3ZCI A;  4HFB A;  2X9X A;  2E5L T;  4KP3 C;  4V1A v;  4ZI2 D;  4GK5 E;  2CCQ A;  2DLR A;  3K1S A;  3TLW A;  2QGS A;  4WYV A;  3AEF A;  3I0O A;  4I43 B;  2ODV A;  5AQN B;  1EZ3 A;  2UUC T;  4A98 A;  4XAX B;  5L3G B;  1SE7 A;  2V26 A;  4B3S T;  4X65 T;  4U74 A;  1IBM T;  3D0T A;  2LSJ A;  3ETU A;  1JNZ A;  4HKA A;  5L2L A;  2XQ4 A;  4OHF A;  3NKZ A;  3SOL A;  3ZMT B;  4JI5 T;  4CN1 A;  3AA1 B;  5FMN A;  2XQ7 A;  5AQS B;  3PUA A;  2N1G A;  5FY0 A;  3N2K E;  1CUN A;  3SS1 A;  5AQO B;  5JDM A;  4YHJ A;  2JMH A;  2IC9 A;  3PE0 A;  5DJQ C;  2PFV A;  4QWN B;  1KFY A;  2J47 A;  4PFP A;  4H9O C;  3WAJ A;  1VCT A;  1HG2 A;  4AQF C;  5HYA A;  3EI0 A;  4JYA T;  4AKG A;  2X9W A;  4KMC A;  4ZEY A;  2I59 A;  3LBX A;  5HEG A;  2MBG A;  1J5E T;  4X66 T;  2BDE A;  4GKJ T;  2D0U A;  3CVR A;  4U2Z A;  4CXY A;  1W0B A;  3CX8 B;  3AE7 A;  4JUY A;  5FNV E;  5IHY A;  2D5U A;  1ZHC A;  5L3E B;  4YTP A;  3KVB A;  1XNQ T;  1S94 A;  5L3C B;  3AE3 A;  3AAA B;  2WMN A;  2BS4 A;  5HCM A;  2KMF A;  3UFE A;  1IBK T;  4CN4 A;  2VAS A;  2K9A A;  4YFS A;  3FXE B;  2NW7 A;  3UU3 A;  2ZM0 A;  2D0T A;  2DWG A;  5LG4 A;  1Y01 A;  5HEH A;  3UU4 A;  1UK5 A;  1IAP A;  2MYS A;  1UX5 A;  2JQH A;  3FXD B;  3ANW A;  2KWH A;  2E9X B;  2N2N A;  2VL8 A;  4PW8 A;  3AE4 A;  2E8I A;  3C4Z A;  2WP9 A;  1N33 T;  2X9H A;  3RRW A;  1BR0 A;  5ETW A;  5C8Y E;  3LK3 B;  3RKO A;  1XZY A;  1QLB A;  4TV9 E;  2H3R A;  1YQ4 A;  3ZSS A;  5HEO A;  4NIQ A;  2JJ9 A;  4IE5 A;  5KX5 E;  4E7S A;  1VCS A;  2WQY A;  5AQJ B;  3JC6 D;  3LK4 2;  3ZEF B;  4JEH B;  2Q9Q A;  3AE2 A;  3RQU A;  4JI6 T;  1I6Z A;  3ETV A;  4ZHQ E;  1KEY A;  5EK3 A;  1HCI A;  5ADX L;  4LF7 T;  2KWI B;  5LOV E;  1T7S A;  3C4W A;  4Z90 A;  3AE1 A;  2CE7 A;  4ILB A;  5JR9 C;  3AA0 B;  4GIW A;  2HN2 A;  5AQF B;  1HS7 A;  1W0A A;  2YDR A;  2NW9 A;  4TWF A;  5JTG A;  3P4P A;  3CQX C;  2WU5 A;  2V8S V;  4DR2 T;  5LGT B;  4DR1 T;  2LOS A;  5HCJ A;  5EK2 A;  4QHO A;  5JDF A;  2BG9 E;  3C50 A;  4LMJ A;  2DI4 A;  2L9Q A;  3JAE A;  3KV5 A;  4GKK T;  2ZM8 A;  5J2U E;  4I55 E;  2CHN A;  2VVN A;  3EDV A;  3CQG B;  4MBQ A;  3HR0 A;  2FBW A;  3NRY A;  2W00 A;  4B3R T;  2HPJ A;  4O4L E;  3EHZ A;  2CA5 A;  5AFU L;  5AQQ B;  4HFE A;  4QH5 A;  4JI1 T;  5CA0 E;  2A2F X;  3O1H A;  3OKQ A;  2LJL A;  4ILA A;  3HI2 A;  2DNX A;  4HGA A;  4TNV A;  3E0Z A;  3ZC0 A;  5LGU B;  3RHW A;  4TWD A;  1YKH B;  4HFC A;  3UQ4 A;  4KBM B;  4XBF B;  1GQE A;  2ZLY A;  3ONX A;  2XQA A;  3AED A;  5JDQ A;  5CJ5 A;  3AB3 B;  4LMK A;  2J4G A;  4JBW F;  5LNK A;  5HXE A;  4DR6 T;  4C90 A;  3O1J A;  3TLU A;  4IHJ E;  2N9D A;  4LF9 T;  3AAI A;  4JLE A;  4A56 A;  4HFD A;  2WDQ A;  1D0Z A;  3C51 A;  4TUY E;  4NPP A;  3J9X 1;  3OYX A;  3PDY A;  2LRL A;  4HN9 A;  3ZYL A;  5FL0 A;  2IUB A;  3VU7 H;  2WMO A;  1J1J A;  1VRB A;  5L3B B;  3CQC B;  1QSD A;  2NP9 A;  2LRK A;  3MJX A;  3N9L A;  2WWU A;  4JI3 T;  3IA3 A;  4X1I E;  1XMQ T;  3UFG A;  4HWI B;  5LXT E;  1WYC A;  3LSV A;  3JCF A;  4CI2 B;  1HTJ F;  2B1E A;  3N9P A;  3EUH A;  1LVF A;  5A1L A;  3I9Y A;  2MAW A;  3RIA A;  4BA9 A;  3O9X A;  4O8S A;  2VQE T;  4GYS A;  4DBR A;  1T98 A;  1SUM B;  3RI5 A;  1FIO A;  4HEA A;  3Q9D A;  4EED A;  2JIW A;  3IF8 B;  2BG9 B;  3LG7 A;  1ZP0 A;  5J2T E;  4LML A;  3RYI E;  3FBL A;  3TLS A;  1AJ3 A;  5JRE A;  2BVL A;  4DV6 T;  4EIW A;  1HNX T;  3PUX F;  1X79 A;  2LSK A;  1DU2 A;  3RF1 A;  4HFV A;  2YDQ A;  1D0Y A;  3OYZ A;  4U7I A;  4JI4 T;  2WS3 A;  2WY2 A;  3AXJ A;  3VKH A;  5LJM A;  3MKD A;  1SA0 E;  2CXL A;  2FJB A;  3P8C D;  1ZEE A;  2X0L B;  4IE0 A;  4IE7 A;  3VR9 A;  2NWB A;  1KNZ A;  3U3I A;  5C2T A;  3UU6 A;  2QA7 A;  1IZN B;  3ZLI A;  4IIJ E;  4TV8 E;  2E9X D;  4IDN A;  2HHH T;  4IRE A;  2W66 A;  2V7L A;  2XQ3 A;  4LF6 T;  1IJ6 A;  3RYH E;  3MK7 C;  4AQF A;  2PBI A;  4G2A A;  5FVK A;  1NEN A;  3EDU A;  3OVU A;  3LBX B;  2V1D B;  4HE8 A;  3ZT5 A;  4WW0 A;  4YSZ A;  5LYJ E;  2Y8D A;  2KT9 A;  2XAS B;  4U31 A;  2QYW A;  2JMK A;  2D2S A;  4U72 A;  4IGU A;  3SFD A;  3P7I A;  3ZYK A;  4YTM A;  4DMW A;  4EV6 A;  2VQF T;  3FZK B;  4EB6 E;  4JI8 T;  3I1A A;  4YLH A;  4L9I A;  1MIY A;  2DCF A;  2XTL A;  4UVB B;  2PJQ A;  5JR9 B;  2Y6X A;  3SWH A;  4ZS3 A;  3F31 A;  2JQQ A;  5HAX A;  3A8Y C;  3CPZ A;  3HKD E;  2IHR 1;  3AVR A;  5JQG E;  4PJN A;  3H37 A;  4CN6 A;  4DR5 T;  1UUR A;  3BQI A;  5LB7 B;  1L0V A;  3ZJ2 A;  2X9Y A;  3ANW B;  5HXS A;  5DAB A;  3N2O A;  4YT0 A;  1D1A A;  4AQG A;  4X20 E;  2JQ9 A;  2FJE A;  3H3M A;  3CIR A;  3RH3 A;  3W15 B;  3FBZ A;  4YHH T;  2ZM6 T;  1YXR A;  1SHZ C;  4DID B;  3EVY A;  5HEU A;  3JC6 C;  4COF A;  4UXN B;  3KIN B;  5FXX A;  1KNR A;  2WU2 A;  1HR0 T;  3ZMS B;  2NTX A;  1VOM A;  3AA7 B;  4ISS A;  2Q9Q B;  2K3W A;  1OED C;  4B3M T;  2XZE A;  3TKL B;  3FZF B;  5FXW A;  2LE8 A;  2KND A;  2CEA A;  3KDS E;  2XQ9 A;  2VKO A;  3P4W A;  2F4V T;  5HXC A;  2PG8 A;  2V5D A;  2VK9 A;  2EHO D;  4ADZ A;  3AEB A;  5JR9 A;  2AE9 A;  4QH1 A;  2M6B A;  5H6Q B;  2UXX B;  4ERR A;  4HTE A;  3LFM A;  4PK5 A;  2CXF A;  2W67 A;  5FXZ A;  4EEB A;  5FXV A;  1S35 A;  3ABV A;  4AKR B;  5JDH A;  2V7M A;  5FY7 A;  3RYC E;  4YXD A;  2XUE A;  4IT4 A;  5IUX A;  2RA1 A;  2LKG A;  2LHR A;  3PU8 A;  4MHC A;  4B3T T;  3NRX A;  4UEM A;  3T1Y T;  2ES0 A;  1YW0 A;  3HKB E;  3ZCJ A;  2WZI A;  4LF8 T;  2AXD S;  2YIN A;  1FEW A;  2WM9 A;  4DND A;  4X1K E;  4ZZB A;  1WCR A;  4P0B A;  4QKN A;  3UUL A;  1R8I A;  2XAG B;  4I50 E;  4UIG A;  4K0K T;  3FHN A;  3SRZ A;  4TZ4 C;  2SPC A;  5BR8 T;  3UUX B;  5AQL B;  2H88 A;  5CFB A;  5M4Y A;  3E22 E;  4CI3 B;  2W63 A;  3V5U A;  3HL6 A;  3VR8 A;  2BKO A;  4DV2 T;  5FYM A;  2BS3 A;  4OK0 A;  3ZYM A;  4A97 A;  3UU5 A;  2LSG A;  4ILU A;  2CRB A;  3GMI A;  2CLY C;  3Q5E A;  3ZJ1 A;  3ZT6 A;  3FB2 A;  2K48 A;  1XWM A;  5EZY E;  4A5X A;  2M67 A;  4ZI3 D;  4DV3 T;  4C91 A;  3CML A;  5CA1 E;  2Z6E A;  5KXJ A;  5JDL A;  1M7K A;  3QOF A;  1WR0 A;  2VUR A;  4NUV A;  4QXH B;  5HWX A;  2BVM A;  2OV9 A;  4ZI7 E;  3ZST A;  2XQY A;  4JI0 T;  3JAF A;  5L4H A;  1UX4 A;  3I9W A;  4J2C A;  4IE6 A;  2E5V A;  4ZS2 A;  4EYY R;  2XJ7 A;  3ESL A;  2LHN A;  3DTO A;  3GN5 A;  5TAO A;  5HXR A;  5AQV B;  3H3A A;  4EZ4 A;  3RX6 A;  4KX6 A;  3PTR B;  2XAQ B;  4UF0 A;  5F3J A;  2L8K A;  5L4E A;  2YDS A;  2H7O A;  4O2A E;  1HG5 A;  4P09 A;  2OLT A;  4E7Z A;  1XMO T;  5JRC A;  3AEE A;  4PNI A;  4ASK A;  1E1H B;  2P9B A;  2LM9 A;  4CI1 B;  2YOE A;  1D0X A;  3HKE E;  2IW5 B;  1NAF A;  3VKG A;  4PFO A;  1LRZ A;  4CXX A;  4Z8X A;  5AQH B;  3AXJ B;  5EK4 A;  3FZH B;  4IL9 A;  3SFE A;  3KBT A;  1LVK A;  5GON E;  1I94 T;  4NXN T;  4N78 D;  2BS2 A;  4EGW A;  2XQ5 A;  3BQL A;  4DR3 T;  3ZKR A;  4H9R C;  2E9X C;  4UVC B;  3PU3 A;  3L09 A;  1WFD A;  3GA8 A;  2VKD A;  3X1D A;  3PJA A;  2NOX A;  2W62 A;  3RIF A;  4NUU A;  4EXT A;  1ZOY A;  2XHE B;  1CHU A;  3VRB A;  4KHZ F;  4ANJ A;  2XAJ B;  1BR2 A;  3Q5W A;  2VL0 A;  3N9O A;  2J1D G;  2LSI A;  1HF8 A;  2X67 A;  3K3Q C;  1MNE A;  4AXP A;  3RRC A;  2KZ7 B;  5L47 A;  4EAH A;  4KI0 F;  2W2U A;  2DL1 A;  3AE5 A;  2HPL A;  2WDR A;  3L3P A;  5ABE A;  1Z8U A;  4O4J E;  4MAL A;  2EHO A;  5C3J A;  2WZH A;  4L0R A;  2LM2 A;  2BBH A;  2Q9Q D;  3CX6 B;  1MIV A;  4O4H E;  2MOZ A;  3PUY F;  5LHG B;  5H6R B;  3BK9 A;  5LMU T;  4DUZ T;  2NW8 A;  3PUV F;  4P1N A;  3C98 B;  2XAH B;  1D1C A;  5LG3 A;  1XDO A;  3UUN A;  5HEJ A;  2XSA A;  1O3X A;  1KNP A;  1MND A;  1YD8 G;  3MA9 A;  2VVS A;  2K5B B;  4X5T A;  2C5K T;  1FJG T;  2X51 A;  4H63 V;  3V5S A;  1XNR T;  4JI2 T;  5E0O A;  5DQW A;  5AQK B;  1XDP A;  4ILC A;  4JI7 T;  4TX5 A;  4QX8 B;  3B5M A;  4U2Y A;  1OXZ A;  2IAK A;  3UU8 A;  4CQI A;  5HXH A;  3N5L A;  4EYU A;  1ZKE A;  3RYF E;  1KK7 A;  4JEU B;  3CX7 B;  3P4R A;  1US7 B;  2XM1 A;  5LBQ B;  1E7P A;  1J5W A;  5LP6 E;  1NWM X;  3S4U A;  3KV9 A;  2R6G F;  2EHO C;  4IST A;  4HWD A;  4QX7 B;  1FMW A;  2UXB T;  4H63 H;  4HWC A;  4KHP T;  2JPF A;  2FUP A;  1OED A;  4PK4 A;  5JDG A;  1FMV A;  4LF4 T;  3PUW F;  2KSR A;  1HNZ T;  3P50 A;  2KIN B;  1D1B A; 
#chains in the Genus database with same CATH homology
 5FXV A;  1S35 A;  4AKR B;  3WI3 A;  4BJN A;  4CZZ B;  5JDH A;  4AKL A;  1BR4 A;  4WBO A;  3OJA A;  2V7M A;  2YEV C;  5CA0 E;  2A2F X;  3O1H A;  3CKD A;  3OKQ A;  2LJL A;  2BZB A;  3HI2 A;  2DNX A;  4EZH A;  5FY7 A;  2KXP B;  4QXC B;  4HGA A;  4PJL A;  4CXW A;  3E0Z A;  3RYC E;  3ZC0 A;  5LGU B;  4ZI2 C;  2XUE A;  2ACX A;  3J7Y q;  2RA1 A;  3E08 A;  2LHR A;  3PU8 A;  5LBM A;  4MHC A;  2CLY B;  4AKI A;  1YKE B;  1YKH B;  2CWO A;  3KFW X;  2WBL A;  3NRX A;  2V7I A;  5KDM C;  3K8P C;  4KBM B;  4UEM A;  1BR1 A;  4XBF B;  2ES0 A;  3R6N A;  1YW0 A;  4P0A A;  2ZLY A;  3ONX A;  2H7V C;  1MMA A;  5JDQ A;  3HKB E;  4FI5 A;  3AB3 B;  3N2G E;  3ZCJ A;  5FP3 A;  3A5X A;  1WLX A;  2V7K A;  5LNK A;  2JRK A;  5L3F B;  2RP4 A;  2YIN A;  4UEL A;  1FEW A;  5HXE A;  2WM9 A;  5LHI B;  1H7C A;  3VHL A;  3QK6 A;  4C90 A;  4DND A;  4X1K E;  3O1J A;  3GWH A;  4M1P A;  4IHJ E;  4O4I E;  3O4X E;  4P0B A;  2UXN B;  3IEE A;  4QKN A;  3ZPO A;  1OWA A;  3UUL A;  3R84 B;  4XZC A;  2XAG B;  4I50 E;  4K0U A;  3B57 A;  4UIG A;  2N9D A;  4IDZ A;  3AAI A;  3FHN A;  4JLE A;  3NZQ A;  4A56 A;  3SRZ A;  2ZM2 A;  4TZ4 C;  1HFA A;  2SPC A;  1D0Z A;  3C51 A;  3UUX B;  3F2E A;  4PK6 A;  4TUY E;  4UVA B;  5M4Y A;  3E22 E;  4CI3 B;  2W63 A;  4DBQ A;  2GK9 A;  2IC6 A;  3PUR A;  3V5U A;  2OA5 A;  3HL6 A;  2A3D A;  4X1Y E;  3J9X 1;  2L3L A;  3OYX A;  2A72 A;  1G8X A;  3PDY A;  4HN9 A;  5FYM A;  3KV6 A;  3ZYL A;  3NBX X;  3RC8 A;  2WSS V;  2YK0 A;  4EOZ B;  5CB4 E;  3IBP A;  3VU7 H;  2KLQ A;  4OK0 A;  4H9P C;  4O2B E;  2WMO A;  5JDN A;  2CXD A;  4H9S E;  3ZYM A;  1VRB A;  5L3B B;  3I0Q A;  2LSG A;  4ILU A;  3CQC B;  1WRD A;  3F57 A;  1QSD A;  3GMI A;  2LT3 A;  2NP9 A;  3UUM A;  2CLY C;  2X66 A;  3MJX A;  4KUM B;  3IHR A;  3N9L A;  2WWU A;  3ZJ1 A;  4X1I E;  3FB2 A;  3HKC E;  1G73 A;  2K48 A;  3LK2 B;  5LGN B;  5EZY E;  5LXT E;  3N9N A;  4PAG A;  1ZV4 X;  5JH7 E;  2M67 A;  1WYC A;  4ZI3 D;  4CI2 B;  1HTJ F;  4C91 A;  4H9Q C;  4ZI3 C;  3ZN1 B;  2VKJ A;  3CML A;  2B1E A;  2Z6E A;  3ZMZ B;  5CA1 E;  3N9P A;  3EUH A;  5JDL A;  3QUJ A;  5L3D B;  1LVF A;  4B6X A;  5A1L A;  4NUV A;  3I9Y A;  3M65 A;  4GOU A;  5LCY A;  4QXH B;  5HWX A;  2BVM A;  5BMV E;  2W61 A;  4ZI7 E;  3O9X A;  4BA9 A;  4DVD A;  4O8S A;  4GYS A;  2LEH A;  4DBR A;  4DMV A;  3CWZ B;  3UTK A;  2XQY A;  1T98 A;  4FJO A;  2Y48 B;  4OYK A;  4OYJ A;  1UX4 A;  1FIO A;  5F8P A;  3ZCI A;  3I9W A;  4HEA A;  2X9X A;  3Q9D A;  4J2C A;  4IE6 A;  1U5P A;  4KP3 C;  1MMG A;  4V1A v;  4ZI2 D;  4ZS2 A;  4GK5 E;  2CCQ A;  3IF8 B;  2DLR A;  4EYY R;  2QGS A;  3LG7 A;  5J2T E;  3I0O A;  4I43 B;  4H9N C;  2ODV A;  3ESL A;  2DWK A;  3N9Q A;  1EZ3 A;  2YU1 A;  2LHN A;  3DTO A;  3GN5 A;  2XAF B;  3RYI E;  3K3O A;  3FBL A;  4XAX B;  5L3G B;  5TAO A;  1U4Q A;  1AJ3 A;  5HXR A;  2V26 A;  5JRE A;  3T8O A;  4U74 A;  2BVL A;  3H3A A;  3ZC1 A;  3D0T A;  1MMN A;  2LSJ A;  4EIW A;  3ETU A;  2ODU A;  4HKA A;  1V9D A;  4EZ4 A;  5L2L A;  4OHF A;  3RX6 A;  3SOL A;  3ZMT B;  3PTR B;  1X79 A;  2XAQ B;  5FY1 A;  2LSK A;  5J1G A;  3GN5 B;  4I4T E;  4UF0 A;  3AA1 B;  5FMN A;  4HFV A;  5F3J A;  4PJJ A;  2L8K A;  4GYR A;  1D0Y A;  3OYZ A;  1WR6 A;  2H7O A;  3PUA A;  1HG5 A;  2N1G A;  4O2A E;  4P09 A;  5FY0 A;  3N2K E;  1CUN A;  3SS1 A;  3WAK A;  5JDM A;  4E7Z A;  4YHJ A;  5JRC A;  3VKH A;  5LJM A;  3MKD A;  2JMH A;  1SA0 E;  2CXL A;  5IYZ E;  2IC9 A;  4PNI A;  5HWY A;  3PE0 A;  1MIW A;  5DJQ C;  2PFV A;  3P8C D;  1E1H B;  2P9B A;  4ASK A;  4F6R C;  4QWN B;  2LM9 A;  3KV4 A;  4CI1 B;  2LSY A;  3DP7 A;  2K24 A;  1D0X A;  3HKE E;  3LJC A;  1ZEE A;  4UF0 B;  2IW5 B;  4PFP A;  3ZN0 B;  1NAF A;  3VKG A;  4H9O C;  3KVA A;  3Q5X A;  4PFO A;  1LRZ A;  4CXX A;  3WAJ A;  2X0L B;  4WNK A;  4L5G A;  4UV8 B;  5KMG P;  1HG2 A;  3K3N A;  4Z8X A;  4AQF C;  5HYA A;  4IE0 A;  4AKG A;  2X9W A;  4IE7 A;  4GK0 E;  2NWB A;  1KNZ A;  5JRC B;  4AKH A;  4KMC A;  3PUS A;  5EK4 A;  3U3I A;  3O1I A;  2C0S A;  2QA7 A;  2I59 A;  3KBT A;  1IZN B;  3B13 A;  3LBX A;  3ZLI A;  4IE4 A;  3QC9 A;  1LVK A;  3AA6 B;  4IIJ E;  5GON E;  4N78 D;  4YJ3 E;  4TV8 E;  2MBG A;  2E9X D;  2C5J A;  2BDE A;  3CVR A;  2D0U A;  2CWY A;  2V7L A;  3BQL A;  1Y64 B;  4H9R C;  4CXY A;  2E9X C;  3CX8 B;  3HA4 A;  4UVC B;  3PU3 A;  3L09 A;  1IJ6 A;  4JUY A;  5FNV E;  5IHY A;  3RYH E;  3MK7 C;  3NZP A;  3GA8 A;  2VKD A;  4AQF A;  2D5U A;  2PBI A;  4G2A A;  1ZHC A;  5L3E B;  3EDU A;  3ZMU B;  2NOX A;  2W62 A;  3LBX B;  3KVB A;  4NUU A;  2V1D B;  1S94 A;  4HE8 A;  4EXT A;  2G0U A;  4WW0 A;  5L3C B;  2XHE B;  3RPU A;  2LOP A;  3AAA B;  2WMN A;  3ZMV B;  2V7J A;  2KMF A;  2VB6 A;  4ANJ A;  2HH7 A;  2XAJ B;  5LHH B;  5LYJ E;  2Y8D A;  2KT9 A;  1BR2 A;  3Q5W A;  3UFE A;  3N9O A;  4BAY B;  2XAS B;  4OFZ A;  2MTQ A;  2J1D G;  2LSI A;  1IJ5 A;  2VAS A;  2K9A A;  4YFS A;  1HF8 A;  1WYB A;  2JMK A;  2X67 A;  3MZK B;  1HX8 A;  2D2S A;  3FXE B;  3K3Q C;  2E9X A;  2NW7 A;  4U72 A;  1MNE A;  2ZM0 A;  2D0T A;  4IGU A;  2DWG A;  3P7I A;  5LG4 A;  4AXP A;  3RRC A;  3ZYK A;  4DMW A;  5JVD E;  2KZ7 B;  4G63 A;  4EB6 E;  4EAH A;  1QUU A;  3I1A A;  4YLH A;  4L9I A;  1MIY A;  2DCF A;  2XTL A;  3DJB A;  4UVB B;  1IAP A;  2PJQ A;  2MYS A;  1UX5 A;  2YU2 A;  5LA6 E;  3FXD B;  5JR9 B;  3ANW A;  2NTY A;  1LKX A;  2KWH A;  2Y6X A;  3SWH A;  2HPL A;  3L3P A;  3F31 A;  2JQQ A;  4ZS3 A;  2E9X B;  4O4J E;  4MAL A;  2N2N A;  2EHO A;  2VL8 A;  5HAX A;  4PW8 A;  3CPZ A;  3HKD E;  4L0R A;  4DO0 A;  3AVR A;  5JQG E;  2E8I A;  2Q9Q D;  3CX6 B;  3H37 A;  3C4Z A;  4PJN A;  4QXB B;  3BQI A;  1MIV A;  4O4H E;  2MOZ A;  2Q9Q C;  2WAU A;  5LHG B;  5H6R B;  3ZJ2 A;  2X9H A;  3RRW A;  3BK9 A;  1BR0 A;  2X9Y A;  3ANW B;  5ETW A;  5C8Y E;  5HXS A;  5DAB A;  3LK3 B;  3RKO A;  3N2O A;  2EHO B;  2NW8 A;  1D1A A;  5LJN A;  4TN7 B;  4TV9 E;  4AQG A;  2H3R A;  3C98 B;  2XAH B;  3BQK A;  1D1C A;  4X20 E;  2JJ9 A;  4IE5 A;  2VKH A;  3RH3 A;  3UUN A;  3W15 B;  3FBZ A;  5KX5 E;  4E7S A;  4ZOL E;  1SHZ C;  1O3X A;  1UCU A;  3JC6 D;  3LK4 2;  3ZEF B;  4JEH B;  1MND A;  2Q9Q A;  1YD8 G;  3EVY A;  4UV9 B;  3JC6 C;  4MLK A;  2W0G A;  2C5I T;  3MA9 A;  3ETV A;  4ZHQ E;  4UXN B;  4BJM A;  5EK3 A;  1HCI A;  5ADX L;  2CM0 A;  2K5B B;  3KIN B;  2ZMA A;  5FXX A;  2C5K T;  2KWI B;  5LOV E;  2X51 A;  4H63 V;  2X68 A;  3C4W A;  3MXZ A;  3V5S A;  2CMR A;  2VWA A;  5E0O A;  3ZMS B;  2CE7 A;  2NTX A;  1VOM A;  5DQW A;  3AA7 B;  4AI6 A;  4ISS A;  5JR9 C;  2Q9Q B;  4QX8 B;  4TX5 A;  3AA0 B;  1Z0P A;  3AAE B;  3N9M A;  1OXZ A;  2IAK A;  4CQI A;  4MFR A;  3UT5 E;  5HXH A;  4GIW A;  3Q2M A;  3PUQ A;  3U78 A;  3TKL B;  5FXW A;  3N5L A;  1HS7 A;  4EYU A;  2LE8 A;  2NW9 A;  2KND A;  1ZKE A;  2CEA A;  3KDS E;  3MAC A;  3CQX C;  3RYF E;  5LGT B;  1KK7 A;  2VKO A;  2LOS A;  3OBV E;  3CX7 B;  4JEU B;  5EK2 A;  1MMD A;  1US7 B;  5LBQ B;  4QHO A;  5JDF A;  5HXC A;  3C50 A;  2DI4 A;  2L9Q A;  1NWM X;  2PG8 A;  2VK9 A;  3KV5 A;  2EHO D;  2ZM8 A;  3C4X A;  3S4U A;  5J2U E;  5LP6 E;  4ADZ A;  3KV9 A;  2DHR A;  4I55 E;  2EHO C;  4IST A;  4QX7 B;  1FMW A;  3RC3 A;  3EDV A;  4H63 H;  3CQG B;  4MBQ A;  5JR9 A;  2JPF A;  3HR0 A;  3NRY A;  2W00 A;  4YJ2 E;  1B7T A;  5H6Q B;  2UXX B;  4PK4 A;  5JDG A;  4ERR A;  3PUG A;  4HTE A;  3LFM A;  1FMV A;  3C64 A;  4PK5 A;  2CXF A;  5DQV A;  2HPJ A;  3AVS A;  4PJM A;  5FXZ A;  4O4L E;  3KBU A;  4WBN E;  2CA5 A;  5AFU L;  2KIN B;  1D1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...