3OKQA

Crystal structure of a core domain of yeast actin nucleation cofactor bud6
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
125
structure length
125
Chain Sequence
b'SSNRMYMEKSQTELGDLSDTLLSKVDDLQDVIEIMRKDVAERRSQPAKKKLETVSKDLENAQADVLKLQEFIDTEKPHWKKTWEAELDKVCEEQQFLTLQEELILDLKEDLGKALETFDLIKLCC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bud site selection protein 6
molecule tags Protein binding
source organism Saccharomyces cerevisiae
publication title Structure of the formin-interaction domain of the actin nucleation-promoting factor Bud6.
pubmed doi rcsb
total genus 62
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3okqA00
3ONXA 3OKQA
chains in the Genus database with same CATH superfamily
4H9NC 3QOFA 3ZT7A 2DNXA 2HPJA 3T1YT 4A97A 4QX7B 4KI0F 3HKEE 2V7KA 4H9RC 4L9IA 4ZEYA 1N33T 1IBKT 3PU3A 4JI8T 2NW9A 5J1GA 1XMOT 1XZYA 2XQ8A 3PUQA 4JEHB 5HEUA 5L3GB 3KFWX 2VKDA 1KFYA 3PU8A 4GKJT 1VCTA 5DJQC 5L4EA 1YXRA 3KINB 4TUYE 3NRXA 4JEUB 2EHOD 1WR0A 4IE6A 4UVCB 3RKOA 3S4UA 3ZEFB 2NTYA 3B13A 4UR9A 2CLYB 3ZSTA 3MJXA 4PJMA 3N9QA 3Q9DA 2D0TA 5L3FB 3OVUA 4IDNA 4C90A 2DWGA 2ODVA 2W66A 1R8IA 1T72A 3P4SA 4WZXA 3JC6D 4YTMA 2WWVA 1FJGT 4NIQA 2CBJA 2YK0A 3CK6A 3F31A 4PJLA 4DR7T 1T98A 2ZM2A 1WR6A 3UU8A 5KMGP 5AQOB 1NWMX 2IDOB 2BS2A 2ES0A 2HN2A 3FHNA 5ETWA 4DR2T 1LVKA 3TKLB 4B3TT 2XASB 3AE8A 3JADA 5F8PA 4DV1T 4CN1A 2C5JA 2KLQA 4JI7T 3AA0B 3RPUA 1FEWA 4EEDA 5LG4A 4X1KE 2B1EA 3CPZA 4HGAA 2X51A 5AQVB 2WU2A 2V6XA 3AXJB 3NWIA 5AFUL 4LFCT 3N9NA 2N9DA 2EHOA 3LG7A 4DR5T 3ZJ2A 2BG9A 1ZHCA 2K5BB 3MKDA 2M67A 3EVYA 3P50A 4H9OC 2LJLA 3SOLA 4HFIA 4TWFA 2HPLA 2LOPA 5CB4E 5TAOA 5HXHA 3VKGA 2WMNA 2JPFA 3K3NA 1UURA 1KNRA 3MA9A 4TN7B 5LGTB 3UQ7A 3RH3A 4DBRA 4B3ST 5J0ZA 5AQMB 3LBXA 3NZPA 5FXXA 1ZV4X 5JDFA 2CXFA 3ABVA 4QX8B 5L2LA 2BG9C 2PFVA 4HFCA 4OYKA 5FY7A 2LSKA 5JREA 2WP9A 5L3EB 1L0VA 3RX6A 3RYIE 2E2AA 4HWCA 1KNPA 4O2BE 3CX6B 1YQ3A 4HWIB 2V7JA 4Z8XA 4QWNB 2JJ9A 2LE8A 2XQAA 4OHFA 2WZIA 2MAWA 3P4WA 4P09A 2FJDA 2JMHA 2NP9A 3SFEA 3I9WA 2Q9QA 2WM9A 3AVSA 4GYRA 1J5ET 4AISA 5KXJA 2CHNA 2D9DA 3EAMA 4IE4A 5AQQB 3ZT5A 4U7YA 4B3RT 5LP6E 1W09A 2MOZA 5AQHB 1VRBA 1FMWA 2W62A 3F57A 4ZI2D 1U5PA 4DV5T 3FZHB 3GA8A 2LSYA 3L3PA 1T8BA 1E7PA 1SE7A 3CQCB 4A98A 3V5UA 4COFA 3FXDB 1IBMT 4DV2T 4A56A 2KINB 2I59A 4PK6A 4PW8A 4X1YE 2QGSA 4IE0A 3UUXB 4BA9A 2NWBA 2KSRA 2LEHA 3I9YA 1W0AA 3DJBA 5LMNT 3RYFE 2XQ6A 5E0OA 1MMNA 2HHHT 2CPTA 1MMDA 2K3WA 4ZS3A 3X1DA 4F8HA 4IREA 4ILCA 3KV9A 2PBIA 3O9XA 2X9YA 3EHZA 4XZCA 3UUBA 4QXHB 4UIGA 3H3AA 5JDQA 5AQSB 2IMLA 4HFHA 4GOUA 4CI3B 2XUEA 4IDQA 5CA1E 2VVSA 3ZKRA 2WBLA 3IHRA 4DUYT 4DV4T 4IL4A 4EOZB 3HI2A 1MMAA 3QUJA 2WZHA 5EK2A 1MMGA 4YSYA 5F3JA 2NW7A 4ZZBA 1YKHB 4AKRB 5HEOA 5IYZE 4EZ4A 4JLEA 2XSBA 4CI1B 2KT9A 4H63V 1E2AA 5JDMA 2MBGA 5AQPB 4YXDA 2WS3A 3AEDA 5FNVE 2W61A 4CI2B 4BAYB 5ADXL 4IE7A 2K48A 2YEVC 1IJ5A 3TLSA 3UTKA 5LXTE 2B76A 3AE2A 3ANWB 3N9LA 5C3JA 4ZI3C 3EUHA 4YHJA 4IDZA 5J2UE 3UU6A 5AQKB 4EIWA 2NOXA 4I43B 1D0ZA 2BVLA 3FB2A 4I4TE 4DR3T 1X9BA 2CEAA 3AA1B 3PURA 4HWDA 4JI4T 5JRCB 2WDQA 3AXJA 4MLKA 2IUBA 2WB5A 1G73A 1H7CA 2XPKA 3K1SA 3CQGB 1ZOYA 3NKZA 1T7SA 2AE9A 3C98B 3OYXA 3B5MA 2WDVA 3OPCA 4ILBA 3ZMVB 2CRBA 2E5VA 3IF8B 1GQEA 2X0HA 5H6RB 4CXWA 5DQVA 5ABFB 3N9MA 1LVFA 3TLUA 3NRYA 5ABHA 3AEGA 3PUYF 4UF0A 2E5LT 1SA0E 4HKAA 2VL0A 4O8SA 5FXZA 2UU9T 4LMKA 4NPPA 4LF6T 3K3OA 4UV9B 2G0UA 3C4WA 3AECA 4ILUA 1ZKEA 2BZBA 3ZYMA 3ZMZB 3D0TA 4GK0E 3OYZA 1SHZC 5LJNA 4OFZA 4AKLA 1XMQT 3O1JA 2SPCA 5LNKA 2W0GA 2V7IA 1JNZA 4ZI3D 3JC6C 4TV9E 2JRKA 3NBXX 2E9XA 3H3MA 3FZLB 2V7LA 2OA5A 5CA0E 3R6NA 2FJEA 2ZM0A 3GN5A 4JUYA 4QHOA 5HCMA 3RYCE 2XJ7A 3UUMA 2KWIB 1W0BA 3SRZA 4YSXA 4ZI7E 3BK9A 4JYAT 4LMLA 5JH7E 2KZ7B 4GYSA 4O4IE 4U72A 5AQNB 3FZMB 1QSDA 4YFSA 2V1DB 5HEHA 1XDPA 2E9XC 3V5SA 2YOEA 3ZMTB 4DUZT 3AE9A 2XZEA 4FI5A 1KK7A 4U7IA 4U2YA 4CXXA 4ISSA 3MZKB 3W15B 5C8YE 2CWYA 2KXPB 2UXCT 2UXXB 1W9RA 3RGLA 4QXCB 4IIJE 5HYAA 3M65A 5EK3A 5C2TA 1BR4A 4JI6T 2X67A 3AE7A 3KV4A 3RHWA 4OK0A 3RQUA 3ZC1A 4ERRA 5BMVE 4AXPA 1M62A 5JQGE 2QYWA 2VQET 4Z90A 3R84B 4TX5A 5LBMA 1D1AA 3BQKA 4CQIA 5FXWA 3HA4A 2VVNA 3I0QA 3L39A 2F4VT 1M7KA 4IHJE 5JR9B 3JAFA 4YSZA 2OV9A 4EYUA 5CJ5A 1WFDA 4IT4A 1YKEB 2LM9A 3AE3A 5AQJB 3VRBA 1B7TA 1UK5A 5KX5E 5LHIB 2ODUA 1OEDA 1US7B 2E9XD 3EABA 3ZCJA 3RLFF 2ZM6T 2GK9A 4ZXLA 2L9QA 4TWHA 4P0AA 2BKOA 4DV3T 5L3DB 2CLYC 5HXSA 4DBQA 5HXEA 1BR0A 2W4XA 1FMVA 3E22E 3MXZA 2UUAT 3ONXA 1Z8UA 4LF7T 2R6GF 3U78A 2MTQA 4H9QC 3UQ4A 1Z0PA 4HFEA 2IAKA 2KMFA 2M6BA 2YINA 1Y01A 5FVLA 4BJNA 2BS4A 2XQ5A 3P4RA 3UFEA 1VCSA 4K0KT 3FXEB 5FVKA 2Q9QD 2Y6XA 3EDVA 2YDQA 1HNZT 2CWOA 3AAIA 4PJJA 1QUUA 2ZM8A 4KP3C 1NENA 1WCRA 2CE7A 4QKNA 3SS1A 1D0XA 4U31A 4ANJA 2XQ4A 2V7MA 4PJNA 1XWMA 4JI1T 4YTPA 4DR6T 1XNQT 5AQGB 1UX5A 2DHRA 2XM2A 2YU2A 3AEAA 4DV6T 2WU5A 4KX6A 3AE5A 1XDOA 3CMLA 3PE0A 1HX1B 3PUAA 2HH7A 2RPAA 1HX8A 1MIWA 2WWUA 2V6YB 3EDUA 4X64T 1D0YA 3O1IA 3QB5A 1S94A 4OYJA 2C5KT 5M4YA 3UU5A 4MFRA 3IBPA 2UUCT 2RP4A 5AQRB 2BKPA 3ONJA 1IZNB 4DV0T 4HFBA 1YW0A 1UUSA 2CA5A 4ZOLE 1V9DA 5L3CB 3EI0A 5JDGA 4V1Av 5LGUB 1N34T 4L5GA 4X20E 2XM1A 4HEAA 4P0BA 3ONLC 3LK42 5F5WA 3UU3A 3VRAA 3M3ZB 4DR4T 5LOVE 2D5UA 4PFPA 4C91A 2WMOA 4KHZF 5LA6E 3PJAA 1ZP0A 4UVAB 3ZN0B 2DCFA 5HCJA 2KNDA 4AKHA 3N2GE 3RF1A 2J1DG 2H3RA 2XQYA 3O1HA 5EZYE 4DO0A 2BG9E 3Q2MA 4UV8B 3C50A 3LBXB 3WAKA 1N32T 4WNKA 4YJ2E 1YD8G 2V6YA 4PK4A 3AEBA 2Y48B 3RIFA 3FBLA 5JRCA 3RQWA 4YTNA 4UVBB 5JDLA 3K8PC 4EV6A 5HWXA 2L3LA 3P4PA 2BBJA 2EHOC 3CX8B 4DR1T 2XQ7A 4AKIA 5HXRA 1N36T 3PUSA 3T8OA 3ETUA 2AXDS 2VWAA 2DI4A 2LRLA 2YN6A 4YLHA 3G06A 4I50E 4I55E 4U2ZA 5HEJA 4AQFC 3HKCE 3VHLA 1HS7A 3CQXC 4PK5A 4HWFA 3QB5K 4P1NA 5CFBA 3HKDE 4KUMB 5CGMA 3C4ZA 3CKDA 3KV5A 5FXVA 1HTJF 3PJAJ 5LHGB 2A3DA 4AIUA 4U3CA 3RRWA 4AQYT 1FIOA 3AA7B 3JCFA 1HG5A 2VB6A 4Q25A 3KVAA 2XHEB 3Q5EA 1UCUA 1YQ4A 4AQFA 1UX4A 1WLXA 3AAEB 2NW8A 1I6ZA 1Y64B 4CXYA 4GKKT 2JIWA 3RIAA 4DNDA 2Q9QC 5AQTB 3ZPOA 2PJQA 2VASA 3I1AA 1HFAA 4QH5A 2A2FX 2LOSA 4E7ZA 2Y8DA 3RKGA 2I0MA 1BR2A 4BJMA 2ACZA 3GMIA 2XQ9A 4O4HE 5JDHA 2DWKA 2J47A 3GN5B 4M1PA 1KNZA 2CXLA 2XAQB 5JVDE 4ADZA 2LM2A 4EEBA 1KF6A 2D2SA 2X68A 5L3BB 3VKHA 2FJBA 2N2NA 4O2AE 3RC3A 1XNRT 4ZHQE 2A9UA 3QK6A 5JTGA 4EXTA 3SWHA 3UUNA 4JI0T 4NUUA 4AI6A 1S35A 4O4LE 3KVBA 4DIDB 2UXDT 4MHCA 2VKHA 2BS3A 1O3XA 3N9PA 1CUNA 2VURA 2YDRA 2V8SV 4YJ3E 3ZMSB 5HXCA 4IE5A 2HN1A 5LJMA 4CN4A 2PTFA 4KBMB 2QRXA 2V5DA 4AKGA 1HCIA 2JQ9A 3RC8A 3P7IA 5AQUB 2XAHB 1EZ3A 3FZKB 3QC9A 3J9X1 3UU4A 3LJCA 5DABA 3BQIA 4HFVA 5L4HA 3PUXF 5EK4A 4UELA 3RI5A 4E7SA 2VK9A 4JI3T 2UXBT 2LHNA 3OTOT 2CXDA 3AEFA 3C51A 2W63A 3IEEA 2WDRA 5LBQB 4Z91A 2CMRA 1OEDE 4PNIA 5FP3A 4NXMT 2LKGA 2W00A 4TNVA 2A72A 3K3QC 1SUMB 2LSJA 3N5LA 5LCYA 4IGUA 5DQWA 4NXNT 2DLRA 2WQYA 4X5TA 2VKJA 5ABGA 5FY1A 5FMNA 1HNWT 1MIYA 4HFDA 4YT0A 4H9SE 1AJ3A 2CM0A 2E8IA 4ASKA 3FBZA 2W2UA 3KV6A 2EHOB 3AE4A 2P9BA 5IUXA 4EB6E 2VKOA 3MK7C 1JNRA 2FUPA 3AE1A 4PFOA 4TZ4C 3SFDA 4X62T 5LYJE 4ZZCA 3ZC0A 2IHR1 4ILAA 2IC6A 2WY2A 4HE8A 1LRZA 3L09A 1MIVA 3FZFB 4G63A 2IW5B 4CZZB 1OXZA 2X9WA 5ABFA 3DTOA 5J2TE 2BBHA 2XAJB 3N9OA 4WYVA 3A5XA 3CX7B 3OKQA 3UFGA 5LB7B 4DMVA 4QXBB 3AVRA 1HF8A 2ACXA 2XAGB 3AA6B 3F2EA 3HR0A 3OBVE 3UT5E 2H89A 4FJOA 1J1JA 2M6IA 4XBFB 2WCAA 2D0UA 2IIUA 2MYSA 1HG2A 2YDSA 3PDYA 4N78D 1IAPA 4QH1A 2LRKA 5GONE 3ZLIA 5IWAT 2E9XB 1HNXT 3KDSE 4F6RC 5FL0A 2J4GA 3QNUA 5JR9A 4X65T 2BG9B 1VOMA 2K9AA 5FY0A 3U3IA 2C5IT 4G2AA 4EZHA 4WBNE 2QA7A 5KDMC 5L47A 4YY3T 2XSAA 4H9PC 1MNDA 2CBIA 3HL6A 3NVOA 4B3MT 4O4JE 2KWHA 3OJAA 4TNWA 4LF5T 4U74A 3Q5WA 3VU7H 2XY8B 2H7OA 3AE6A 3B57A 3N2KE 2XQ3A 3PUWF 1IJ6A 4H63H 2YKSA 4I0UA 5IHYA 3WI3A 2QVAA 5JR9C 4JBWF 3AB3B 1ZEEA 4KMCA 3BQLA 4TWDA 4ZS2A 5FYMA 3ZYKA 4X66T 1BR1A 3DP7A 4LFAT 2YU1A 2Q9QB 4AQGA 2IC9A 3PTRB 4DMWA 2JMKA 2LKHA 4JV5T 3P8CD 3IA3A 1E1HB 2K24A 5BR8T 3CVRA 5HEGA 3VR8A 5HWYA 3PUVF 2ZMAA 3N2OA 2ZLYA 3P4QA 4TV8E 2PG8A 2L8KA 2BKNA 1OEDB 2XTLA 3AAAB 5A1LA 2NR4A 3TLVA 3TLTA 2FBWA 3ZSSA 2X0YA 5AQLB 2VL8A 3LK2B 4DV7T 1MNEA 2BDEA 2LSIA 2CHOA 3O4XE 4IDPA 2I6HA 3A8YC 4X1IE 1OWAA 3ANWA 1J5WA 1LKXA 3I0OA 3ZT6A 3E0ZA 3GWHA 4UEMA 4K0UA 3ZN1B 1HR0T 3WAJA 3ZYLA 4NUVA 3RYHE 4KHPT 1U4QA 2VQFT 3RRCA 3LDQB 4IL9A 4HTEA 4XAXB 4WW0A 3ZJ1A 3CIRA 3AEEA 2JQKA 4JI2T 4U33A 5AQFB 5FL1A 2UUBT 2UXNB 3Q5DA 4IDOA 4LF9T 5HAXA 5FKYA 1D1BA 3T1HT 1WYBA 2JQQA 4J2CA 1D1CA 1WRDA 2NTXA 3C4XA 3LSVA 4UF0B 4LF8T 3RIUC 2LHRA 2V5CA 2LLYA 3ZCIA 2WAUA 3KBUA 2C0SA 2FJAA 3Q5XA 4EYYR 1DU2A 5LMUT 1NAFA 2OLTA 4JI5T 5LHHB 3MACA 2N1GA 5AQIB 5ABEA 3NZQA 3LFMA 4EAHA 1UGOA 4OX9T 4LFBT 4HN9A 4HWHA 5H6QB 2RA1A 2X9XA 3RIUA 3J7Yq 5LGNB 4MBQA 2W67A 4ZI2C 3E08A 4ISTA 2CCQA 4LMJA 3TLWA 4LF4T 3UULA 3H37A 3HKBE 1I94T 3C64A 2DL1A 1G8XA 1WYCA 4YHHT 1OEDC 4CN6A 2LT3A 4WBOA 3VR9A 3ZMUB 3ETVA 4L0RA 4A5XA 2X0LB 4MALA 3ESLA 3PUGA 1NEKA 5JDNA 2BVMA 2JQHA 2V26A 2X9HA 3L8RA 3PUZF 4GK5E 3PV0F 4PAGA 4QH4A 5LG3A 4UXNB 3A7MA 3CWZB 3LK3B 1KEYA 3KBTA 4DVDA 2MPKA 1IBLT 2H7VC 2WSSV 2H88A 2LSGA 3JAEA 4B6XA 2J62A 2XAFB 2X66A 1QLBA 4GIWA 4EGWA 1CHUA 1X79A 2Z6EA
chains in the Genus database with same CATH topology
4H9NC 2DNXA 2HPJA 4QX7B 3HKEE 2V7KA 4H9RC 4L9IA 3PU3A 2NW9A 5J1GA 3PUQA 4JEHB 5L3GB 3KFWX 2VKDA 3PU8A 5DJQC 3KINB 4TUYE 3NRXA 4JEUB 2EHOD 4IE6A 4UVCB 3S4UA 3RKOA 3ZEFB 1BR0A 2NTYA 3B13A 2CLYB 3MJXA 4PJMA 3N9QA 3Q9DA 2D0TA 4C90A 2DWGA 2ODVA 3JC6D 2YK0A 3F31A 4PJLA 1T98A 2ZM2A 1WR6A 5KMGP 1NWMX 2ES0A 3FHNA 5ETWA 1LVKA 3TKLB 2XASB 5F8PA 2C5JA 2KLQA 3AA0B 3RPUA 1FEWA 5LG4A 4X1KE 2B1EA 3CPZA 4HGAA 2X51A 5AFUL 3N9NA 2N9DA 2EHOA 3LG7A 3ZJ2A 1ZHCA 2K5BB 3MKDA 2M67A 3EVYA 4H9OC 3SOLA 2LJLA 5TAOA 2HPLA 2LOPA 5CB4E 3VKGA 5HXHA 2WMNA 2JPFA 3K3NA 3MA9A 4TN7B 3RH3A 4DBRA 3LBXA 3NZPA 5FXXA 1ZV4X 5JDFA 2CXFA 5L2LA 4QX8B 2PFVA 4OYKA 5FY7A 2LSKA 5JREA 5L3EB 3RX6A 3RYIE 4O2BE 3CX6B 2V7JA 4Z8XA 4QWNB 2JJ9A 2LE8A 4OHFA 4P09A 2JMHA 2NP9A 3I9WA 2Q9QA 2WM9A 3AVSA 4GYRA 4IE4A 4AKGA 5LP6E 2MOZA 1VRBA 1FMWA 2W62A 3F57A 4ZI2D 1U5PA 3GA8A 2LSYA 3L3PA 3CQCB 3V5UA 3FXDB 4A56A 2KINB 2I59A 4PK6A 4PW8A 4X1YE 2QGSA 4BA9A 3UUXB 2NWBA 2LEHA 3I9YA 3DJBA 3RYFE 5E0OA 1MMNA 1MMDA 4ZS3A 3KV9A 2PBIA 2X9YA 4XZCA 4QXHB 4UIGA 3H3AA 5JDQA 4CI3B 4GOUA 5CA1E 2XUEA 2WBLA 3IHRA 4EOZB 3HI2A 1MMAA 3QUJA 5EK2A 1MMGA 5F3JA 2NW7A 1YKHB 4AKRB 4EZ4A 5IYZE 4JLEA 4CI1B 2KT9A 4H63V 5JDMA 2MBGA 4CI2B 5FNVE 2W61A 4BAYB 5ADXL 4IE7A 2K48A 2YEVC 1IJ5A 3UTKA 3ANWB 3N9LA 4ZI3C 3EUHA 4YHJA 4IDZA 5J2UE 4EIWA 2NOXA 4I43B 1D0ZA 2BVLA 3FB2A 4I4TE 3AA1B 2CEAA 3PURA 5JRCB 4MLKA 3O9XA 5L3FB 1G73A 1H7CA 4IE0A 4AXPA 3CQGB 3ZMVB 3C98B 3OYXA 3IF8B 5H6RB 4CXWA 5DQVA 3N9MA 1LVFA 3NRYA 4UF0A 1SA0E 4HKAA 4O8SA 5FXZA 3K3OA 4UV9B 2G0UA 3C4WA 4ILUA 1ZKEA 2BZBA 3ZYMA 3ZMZB 3D0TA 4GK0E 3OYZA 1SHZC 4OFZA 4AKLA 3O1JA 2SPCA 5LNKA 2W0GA 2V7IA 4ZI3D 3JC6C 4TV9E 2JRKA 3NBXX 2E9XA 2V7LA 2OA5A 5CA0E 3R6NA 2ZM0A 3GN5A 4JUYA 4QHOA 3RYCE 3UUMA 2KWIB 4ZI7E 3SRZA 3BK9A 5JH7E 2KZ7B 4GYSA 4O4IE 4U72A 1QSDA 4YFSA 2V1DB 2E9XC 3V5SA 3ZMTB 4CXXA 4FI5A 1KK7A 4ISSA 3MZKB 3W15B 5C8YE 2CWYA 2KXPB 2UXXB 4QXCB 4IIJE 5HYAA 3M65A 5EK3A 1BR4A 2X67A 3ZC1A 3KV4A 5BMVE 4OK0A 5JQGE 4ERRA 3R84B 4TX5A 5LBMA 1D1AA 3BQKA 4CQIA 5FXWA 3HA4A 3I0QA 4IHJE 5JR9B 4EYUA 1YKEB 2LM9A 5LHIB 1B7TA 5KX5E 2ODUA 2E9XD 1US7B 3ZCJA 2GK9A 2L9QA 4P0AA 5L3DB 2CLYC 5HXSA 4DBQA 5HXEA 3MXZA 1FMVA 3E22E 3ONXA 3U78A 2MTQA 4H9QC 1Z0PA 2IAKA 2KMFA 2YINA 4BJNA 3UFEA 3FXEB 2Q9QD 2Y6XA 3EDVA 2CWOA 3AAIA 4PJJA 1QUUA 2ZM8A 4KP3C 2CE7A 3SS1A 4QKNA 4ANJA 1D0XA 4PJNA 2V7MA 1UX5A 2DHRA 2YU2A 3CMLA 3PE0A 3PUAA 2HH7A 2WWUA 1HX8A 1MIWA 3EDUA 1D0YA 3O1IA 1S94A 4OYJA 2C5KT 5M4YA 4MFRA 3IBPA 2RP4A 1IZNB 1YW0A 2CA5A 4ZOLE 1V9DA 5L3CB 5JDGA 4V1Av 5LGUB 4L5GA 4X20E 4HEAA 4P0BA 3LK42 5LOVE 2D5UA 4PFPA 4C91A 2WMOA 5LA6E 4UVAB 3ZN0B 2DCFA 4AKHA 2KNDA 3N2GE 4DO0A 2J1DG 2H3RA 2XQYA 3O1HA 5EZYE 3Q2MA 4UV8B 3C50A 3LBXB 3WAKA 4WNKA 4YJ2E 1YD8G 4PK4A 2Y48B 5JRCA 3FBLA 4UVBB 5JDLA 3K8PC 5HWXA 2L3LA 2EHOC 3CX8B 4AKIA 5HXRA 3PUSA 3T8OA 3ETUA 2VWAA 2DI4A 4YLHA 4I50E 4I55E 4AQFC 3HKCE 3VHLA 1HS7A 3CQXC 4PK5A 3HKDE 4KUMB 3C4ZA 3CKDA 3KV5A 5FXVA 1HTJF 5LHGB 2A3DA 3RRWA 1FIOA 3AA7B 1HG5A 2VB6A 5LGTB 3KVAA 2XHEB 4AQFA 1UCUA 5LJNA 1UX4A 1WLXA 3AAEB 2NW8A 1Y64B 4CXYA 4DNDA 2Q9QC 3ZPOA 2PJQA 2VASA 3I1AA 1HFAA 2A2FX 2LOSA 2Y8DA 1BR2A 4BJMA 3GMIA 4O4HE 5JDHA 2DWKA 4M1PA 3GN5B 2CXLA 2XAQB 5JVDE 4ADZA 5L3BB 3VKHA 2D2SA 2X68A 3RC3A 2N2NA 4O2AE 4ZHQE 3QK6A 4EXTA 3SWHA 3UUNA 4AI6A 4NUUA 1S35A 4O4LE 3KVBA 4MHCA 2VKHA 1O3XA 3N9PA 1CUNA 4YJ3E 4E7ZA 3ZMSB 5LJMA 5HXCA 4IE5A 4KBMB 1HCIA 3RC8A 3P7IA 2XAHB 1EZ3A 3QC9A 3J9X1 3LJCA 5DABA 3BQIA 4HFVA 4E7SA 5EK4A 4UELA 2VK9A 2LHNA 2CXDA 3C51A 2W63A 3IEEA 5LBQB 2CMRA 4PNIA 5FP3A 2W00A 2A72A 3K3QC 3N5LA 2LSJA 5LCYA 4IGUA 5DQWA 2DLRA 2VKJA 5FY1A 5FMNA 1AJ3A 1MIYA 4H9SE 2CM0A 2E8IA 4ASKA 3FBZA 3KV6A 2EHOB 2P9BA 4EB6E 2VKOA 3MK7C 4PFOA 4TZ4C 3ZC0A 5LYJE 2IC6A 4CZZB 4HE8A 1LRZA 3L09A 1MIVA 2IW5B 4G63A 5J2TE 1OXZA 2X9WA 3DTOA 2XAJB 3N9OA 3A5XA 3CX7B 3OKQA 4DMVA 4QXBB 3AVRA 1HF8A 2ACXA 2XAGB 3AA6B 3F2EA 3HR0A 3OBVE 3UT5E 4FJOA 4XBFB 2D0UA 3PDYA 2MYSA 1HG2A 4N78D 1IAPA 5GONE 3ZLIA 2E9XB 3KDSE 4F6RC 5JR9A 1VOMA 2K9AA 5FY0A 3U3IA 2C5IT 4G2AA 4EZHA 4WBNE 2QA7A 5KDMC 4H9PC 1MNDA 3HL6A 4O4JE 2KWHA 3OJAA 4U74A 3Q5WA 3VU7H 2H7OA 3B57A 3N2KE 5IHYA 3WI3A 4H63H 1IJ6A 5JR9C 4KMCA 3AB3B 1ZEEA 3BQLA 4ZS2A 5FYMA 3ZYKA 1BR1A 3DP7A 2YU1A 2Q9QB 4AQGA 2IC9A 3PTRB 4DMWA 2JMKA 3P8CD 1E1HB 2K24A 3CVRA 5HWYA 2ZMAA 3N2OA 2ZLYA 4TV8E 2PG8A 2L8KA 2XTLA 3AAAB 5A1LA 2VL8A 3LK2B 1MNEA 2BDEA 2LSIA 3O4XE 4X1IE 1OWAA 3ANWA 3I0OA 1LKXA 3E0ZA 3GWHA 4UEMA 4K0UA 3ZN1B 3WAJA 3ZYLA 4NUVA 3RYHE 1U4QA 3RRCA 4XAXB 4HTEA 3ZJ1A 4WW0A 2UXNB 5HAXA 1D1BA 1WYBA 2JQQA 4J2CA 1D1CA 1WRDA 2NTXA 3C4XA 4UF0B 3ZCIA 5LXTE 1KNZA 2LHRA 2WAUA 3KBUA 2C0SA 3Q5XA 4EYYR 1NAFA 5LHHB 3MACA 2N1GA 3NZQA 3LFMA 4EAHA 4HN9A 5H6QB 2RA1A 2X9XA 3J7Yq 5LGNB 4MBQA 4ZI2C 3E08A 4ISTA 2CCQA 3UULA 3H37A 3HKBE 3C64A 1G8XA 1WYCA 2LT3A 4WBOA 3ZMUB 3ETVA 4L0RA 2X0LB 4MALA 3ESLA 3PUGA 5JDNA 2BVMA 2V26A 2X9HA 4GK5E 4PAGA 4UXNB 3CWZB 3LK3B 3KBTA 4DVDA 2H7VC 2WSSV 2LSGA 4B6XA 2XAFB 2X66A 4GIWA 1X79A 2Z6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONX A;  3OKQ A; 
#chains in the Genus database with same CATH topology
 4H9N C;  3QOF A;  3ZT7 A;  2DNX A;  2HPJ A;  3T1Y T;  4A97 A;  4QX7 B;  4KI0 F;  3HKE E;  2V7K A;  4H9R C;  4L9I A;  4ZEY A;  1N33 T;  1IBK T;  3PU3 A;  4JI8 T;  2NW9 A;  5J1G A;  1XMO T;  1XZY A;  2XQ8 A;  3PUQ A;  4JEH B;  5HEU A;  5L3G B;  3KFW X;  2VKD A;  1KFY A;  3PU8 A;  4GKJ T;  1VCT A;  5DJQ C;  5L4E A;  1YXR A;  3KIN B;  4TUY E;  3NRX A;  4JEU B;  2EHO D;  1WR0 A;  4IE6 A;  4UVC B;  3RKO A;  3S4U A;  3ZEF B;  2NTY A;  3B13 A;  4UR9 A;  2CLY B;  3ZST A;  3MJX A;  4PJM A;  3N9Q A;  3Q9D A;  2D0T A;  5L3F B;  3OVU A;  4IDN A;  4C90 A;  2DWG A;  2ODV A;  2W66 A;  1R8I A;  1T72 A;  3P4S A;  4WZX A;  3JC6 D;  4YTM A;  2WWV A;  1FJG T;  4NIQ A;  2CBJ A;  2YK0 A;  3CK6 A;  3F31 A;  4PJL A;  4DR7 T;  1T98 A;  2ZM2 A;  1WR6 A;  3UU8 A;  5KMG P;  5AQO B;  1NWM X;  2IDO B;  2BS2 A;  2ES0 A;  2HN2 A;  3FHN A;  5ETW A;  4DR2 T;  1LVK A;  3TKL B;  4B3T T;  2XAS B;  3AE8 A;  3JAD A;  5F8P A;  4DV1 T;  4CN1 A;  2C5J A;  2KLQ A;  4JI7 T;  3AA0 B;  3RPU A;  1FEW A;  4EED A;  5LG4 A;  4X1K E;  2B1E A;  3CPZ A;  4HGA A;  2X51 A;  5AQV B;  2WU2 A;  2V6X A;  3AXJ B;  3NWI A;  5AFU L;  4LFC T;  3N9N A;  2N9D A;  2EHO A;  3LG7 A;  4DR5 T;  3ZJ2 A;  2BG9 A;  1ZHC A;  2K5B B;  3MKD A;  2M67 A;  3EVY A;  3P50 A;  4H9O C;  2LJL A;  3SOL A;  4HFI A;  4TWF A;  2HPL A;  2LOP A;  5CB4 E;  5TAO A;  5HXH A;  3VKG A;  2WMN A;  2JPF A;  3K3N A;  1UUR A;  1KNR A;  3MA9 A;  4TN7 B;  5LGT B;  3UQ7 A;  3RH3 A;  4DBR A;  4B3S T;  5J0Z A;  5AQM B;  3LBX A;  3NZP A;  5FXX A;  1ZV4 X;  5JDF A;  2CXF A;  3ABV A;  4QX8 B;  5L2L A;  2BG9 C;  2PFV A;  4HFC A;  4OYK A;  5FY7 A;  2LSK A;  5JRE A;  2WP9 A;  5L3E B;  1L0V A;  3RX6 A;  3RYI E;  2E2A A;  4HWC A;  1KNP A;  4O2B E;  3CX6 B;  1YQ3 A;  4HWI B;  2V7J A;  4Z8X A;  4QWN B;  2JJ9 A;  2LE8 A;  2XQA A;  4OHF A;  2WZI A;  2MAW A;  3P4W A;  4P09 A;  2FJD A;  2JMH A;  2NP9 A;  3SFE A;  3I9W A;  2Q9Q A;  2WM9 A;  3AVS A;  4GYR A;  1J5E T;  4AIS A;  5KXJ A;  2CHN A;  2D9D A;  3EAM A;  4IE4 A;  5AQQ B;  3ZT5 A;  4U7Y A;  4B3R T;  5LP6 E;  1W09 A;  2MOZ A;  5AQH B;  1VRB A;  1FMW A;  2W62 A;  3F57 A;  4ZI2 D;  1U5P A;  4DV5 T;  3FZH B;  3GA8 A;  2LSY A;  3L3P A;  1T8B A;  1E7P A;  1SE7 A;  3CQC B;  4A98 A;  3V5U A;  4COF A;  3FXD B;  1IBM T;  4DV2 T;  4A56 A;  2KIN B;  2I59 A;  4PK6 A;  4PW8 A;  4X1Y E;  2QGS A;  4IE0 A;  3UUX B;  4BA9 A;  2NWB A;  2KSR A;  2LEH A;  3I9Y A;  1W0A A;  3DJB A;  5LMN T;  3RYF E;  2XQ6 A;  5E0O A;  1MMN A;  2HHH T;  2CPT A;  1MMD A;  2K3W A;  4ZS3 A;  3X1D A;  4F8H A;  4IRE A;  4ILC A;  3KV9 A;  2PBI A;  3O9X A;  2X9Y A;  3EHZ A;  4XZC A;  3UUB A;  4QXH B;  4UIG A;  3H3A A;  5JDQ A;  5AQS B;  2IML A;  4HFH A;  4GOU A;  4CI3 B;  2XUE A;  4IDQ A;  5CA1 E;  2VVS A;  3ZKR A;  2WBL A;  3IHR A;  4DUY T;  4DV4 T;  4IL4 A;  4EOZ B;  3HI2 A;  1MMA A;  3QUJ A;  2WZH A;  5EK2 A;  1MMG A;  4YSY A;  5F3J A;  2NW7 A;  4ZZB A;  1YKH B;  4AKR B;  5HEO A;  5IYZ E;  4EZ4 A;  4JLE A;  2XSB A;  4CI1 B;  2KT9 A;  4H63 V;  1E2A A;  5JDM A;  2MBG A;  5AQP B;  4YXD A;  2WS3 A;  3AED A;  5FNV E;  2W61 A;  4CI2 B;  4BAY B;  5ADX L;  4IE7 A;  2K48 A;  2YEV C;  1IJ5 A;  3TLS A;  3UTK A;  5LXT E;  2B76 A;  3AE2 A;  3ANW B;  3N9L A;  5C3J A;  4ZI3 C;  3EUH A;  4YHJ A;  4IDZ A;  5J2U E;  3UU6 A;  5AQK B;  4EIW A;  2NOX A;  4I43 B;  1D0Z A;  2BVL A;  3FB2 A;  4I4T E;  4DR3 T;  1X9B A;  2CEA A;  3AA1 B;  3PUR A;  4HWD A;  4JI4 T;  5JRC B;  2WDQ A;  3AXJ A;  4MLK A;  2IUB A;  2WB5 A;  1G73 A;  1H7C A;  2XPK A;  3K1S A;  3CQG B;  1ZOY A;  3NKZ A;  1T7S A;  2AE9 A;  3C98 B;  3OYX A;  3B5M A;  2WDV A;  3OPC A;  4ILB A;  3ZMV B;  2CRB A;  2E5V A;  3IF8 B;  1GQE A;  2X0H A;  5H6R B;  4CXW A;  5DQV A;  5ABF B;  3N9M A;  1LVF A;  3TLU A;  3NRY A;  5ABH A;  3AEG A;  3PUY F;  4UF0 A;  2E5L T;  1SA0 E;  4HKA A;  2VL0 A;  4O8S A;  5FXZ A;  2UU9 T;  4LMK A;  4NPP A;  4LF6 T;  3K3O A;  4UV9 B;  2G0U A;  3C4W A;  3AEC A;  4ILU A;  1ZKE A;  2BZB A;  3ZYM A;  3ZMZ B;  3D0T A;  4GK0 E;  3OYZ A;  1SHZ C;  5LJN A;  4OFZ A;  4AKL A;  1XMQ T;  3O1J A;  2SPC A;  5LNK A;  2W0G A;  2V7I A;  1JNZ A;  4ZI3 D;  3JC6 C;  4TV9 E;  2JRK A;  3NBX X;  2E9X A;  3H3M A;  3FZL B;  2V7L A;  2OA5 A;  5CA0 E;  3R6N A;  2FJE A;  2ZM0 A;  3GN5 A;  4JUY A;  4QHO A;  5HCM A;  3RYC E;  2XJ7 A;  3UUM A;  2KWI B;  1W0B A;  3SRZ A;  4YSX A;  4ZI7 E;  3BK9 A;  4JYA T;  4LML A;  5JH7 E;  2KZ7 B;  4GYS A;  4O4I E;  4U72 A;  5AQN B;  3FZM B;  1QSD A;  4YFS A;  2V1D B;  5HEH A;  1XDP A;  2E9X C;  3V5S A;  2YOE A;  3ZMT B;  4DUZ T;  3AE9 A;  2XZE A;  4FI5 A;  1KK7 A;  4U7I A;  4U2Y A;  4CXX A;  4ISS A;  3MZK B;  3W15 B;  5C8Y E;  2CWY A;  2KXP B;  2UXC T;  2UXX B;  1W9R A;  3RGL A;  4QXC B;  4IIJ E;  5HYA A;  3M65 A;  5EK3 A;  5C2T A;  1BR4 A;  4JI6 T;  2X67 A;  3AE7 A;  3KV4 A;  3RHW A;  4OK0 A;  3RQU A;  3ZC1 A;  4ERR A;  5BMV E;  4AXP A;  1M62 A;  5JQG E;  2QYW A;  2VQE T;  4Z90 A;  3R84 B;  4TX5 A;  5LBM A;  1D1A A;  3BQK A;  4CQI A;  5FXW A;  3HA4 A;  2VVN A;  3I0Q A;  3L39 A;  2F4V T;  1M7K A;  4IHJ E;  5JR9 B;  3JAF A;  4YSZ A;  2OV9 A;  4EYU A;  5CJ5 A;  1WFD A;  4IT4 A;  1YKE B;  2LM9 A;  3AE3 A;  5AQJ B;  3VRB A;  1B7T A;  1UK5 A;  5KX5 E;  5LHI B;  2ODU A;  1OED A;  1US7 B;  2E9X D;  3EAB A;  3ZCJ A;  3RLF F;  2ZM6 T;  2GK9 A;  4ZXL A;  2L9Q A;  4TWH A;  4P0A A;  2BKO A;  4DV3 T;  5L3D B;  2CLY C;  5HXS A;  4DBQ A;  5HXE A;  1BR0 A;  2W4X A;  1FMV A;  3E22 E;  3MXZ A;  2UUA T;  3ONX A;  1Z8U A;  4LF7 T;  2R6G F;  3U78 A;  2MTQ A;  4H9Q C;  3UQ4 A;  1Z0P A;  4HFE A;  2IAK A;  2KMF A;  2M6B A;  2YIN A;  1Y01 A;  5FVL A;  4BJN A;  2BS4 A;  2XQ5 A;  3P4R A;  3UFE A;  1VCS A;  4K0K T;  3FXE B;  5FVK A;  2Q9Q D;  2Y6X A;  3EDV A;  2YDQ A;  1HNZ T;  2CWO A;  3AAI A;  4PJJ A;  1QUU A;  2ZM8 A;  4KP3 C;  1NEN A;  1WCR A;  2CE7 A;  4QKN A;  3SS1 A;  1D0X A;  4U31 A;  4ANJ A;  2XQ4 A;  2V7M A;  4PJN A;  1XWM A;  4JI1 T;  4YTP A;  4DR6 T;  1XNQ T;  5AQG B;  1UX5 A;  2DHR A;  2XM2 A;  2YU2 A;  3AEA A;  4DV6 T;  2WU5 A;  4KX6 A;  3AE5 A;  1XDO A;  3CML A;  3PE0 A;  1HX1 B;  3PUA A;  2HH7 A;  2RPA A;  1HX8 A;  1MIW A;  2WWU A;  2V6Y B;  3EDU A;  4X64 T;  1D0Y A;  3O1I A;  3QB5 A;  1S94 A;  4OYJ A;  2C5K T;  5M4Y A;  3UU5 A;  4MFR A;  3IBP A;  2UUC T;  2RP4 A;  5AQR B;  2BKP A;  3ONJ A;  1IZN B;  4DV0 T;  4HFB A;  1YW0 A;  1UUS A;  2CA5 A;  4ZOL E;  1V9D A;  5L3C B;  3EI0 A;  5JDG A;  4V1A v;  5LGU B;  1N34 T;  4L5G A;  4X20 E;  2XM1 A;  4HEA A;  4P0B A;  3ONL C;  3LK4 2;  5F5W A;  3UU3 A;  3VRA A;  3M3Z B;  4DR4 T;  5LOV E;  2D5U A;  4PFP A;  4C91 A;  2WMO A;  4KHZ F;  5LA6 E;  3PJA A;  1ZP0 A;  4UVA B;  3ZN0 B;  2DCF A;  5HCJ A;  2KND A;  4AKH A;  3N2G E;  3RF1 A;  2J1D G;  2H3R A;  2XQY A;  3O1H A;  5EZY E;  4DO0 A;  2BG9 E;  3Q2M A;  4UV8 B;  3C50 A;  3LBX B;  3WAK A;  1N32 T;  4WNK A;  4YJ2 E;  1YD8 G;  2V6Y A;  4PK4 A;  3AEB A;  2Y48 B;  3RIF A;  3FBL A;  5JRC A;  3RQW A;  4YTN A;  4UVB B;  5JDL A;  3K8P C;  4EV6 A;  5HWX A;  2L3L A;  3P4P A;  2BBJ A;  2EHO C;  3CX8 B;  4DR1 T;  2XQ7 A;  4AKI A;  5HXR A;  1N36 T;  3PUS A;  3T8O A;  3ETU A;  2AXD S;  2VWA A;  2DI4 A;  2LRL A;  2YN6 A;  4YLH A;  3G06 A;  4I50 E;  4I55 E;  4U2Z A;  5HEJ A;  4AQF C;  3HKC E;  3VHL A;  1HS7 A;  3CQX C;  4PK5 A;  4HWF A;  3QB5 K;  4P1N A;  5CFB A;  3HKD E;  4KUM B;  5CGM A;  3C4Z A;  3CKD A;  3KV5 A;  5FXV A;  1HTJ F;  3PJA J;  5LHG B;  2A3D A;  4AIU A;  4U3C A;  3RRW A;  4AQY T;  1FIO A;  3AA7 B;  3JCF A;  1HG5 A;  2VB6 A;  4Q25 A;  3KVA A;  2XHE B;  3Q5E A;  1UCU A;  1YQ4 A;  4AQF A;  1UX4 A;  1WLX A;  3AAE B;  2NW8 A;  1I6Z A;  1Y64 B;  4CXY A;  4GKK T;  2JIW A;  3RIA A;  4DND A;  2Q9Q C;  5AQT B;  3ZPO A;  2PJQ A;  2VAS A;  3I1A A;  1HFA A;  4QH5 A;  2A2F X;  2LOS A;  4E7Z A;  2Y8D A;  3RKG A;  2I0M A;  1BR2 A;  4BJM A;  2ACZ A;  3GMI A;  2XQ9 A;  4O4H E;  5JDH A;  2DWK A;  2J47 A;  3GN5 B;  4M1P A;  1KNZ A;  2CXL A;  2XAQ B;  5JVD E;  4ADZ A;  2LM2 A;  4EEB A;  1KF6 A;  2D2S A;  2X68 A;  5L3B B;  3VKH A;  2FJB A;  2N2N A;  4O2A E;  3RC3 A;  1XNR T;  4ZHQ E;  2A9U A;  3QK6 A;  5JTG A;  4EXT A;  3SWH A;  3UUN A;  4JI0 T;  4NUU A;  4AI6 A;  1S35 A;  4O4L E;  3KVB A;  4DID B;  2UXD T;  4MHC A;  2VKH A;  2BS3 A;  1O3X A;  3N9P A;  1CUN A;  2VUR A;  2YDR A;  2V8S V;  4YJ3 E;  3ZMS B;  5HXC A;  4IE5 A;  2HN1 A;  5LJM A;  4CN4 A;  2PTF A;  4KBM B;  2QRX A;  2V5D A;  4AKG A;  1HCI A;  2JQ9 A;  3RC8 A;  3P7I A;  5AQU B;  2XAH B;  1EZ3 A;  3FZK B;  3QC9 A;  3J9X 1;  3UU4 A;  3LJC A;  5DAB A;  3BQI A;  4HFV A;  5L4H A;  3PUX F;  5EK4 A;  4UEL A;  3RI5 A;  4E7S A;  2VK9 A;  4JI3 T;  2UXB T;  2LHN A;  3OTO T;  2CXD A;  3AEF A;  3C51 A;  2W63 A;  3IEE A;  2WDR A;  5LBQ B;  4Z91 A;  2CMR A;  1OED E;  4PNI A;  5FP3 A;  4NXM T;  2LKG A;  2W00 A;  4TNV A;  2A72 A;  3K3Q C;  1SUM B;  2LSJ A;  3N5L A;  5LCY A;  4IGU A;  5DQW A;  4NXN T;  2DLR A;  2WQY A;  4X5T A;  2VKJ A;  5ABG A;  5FY1 A;  5FMN A;  1HNW T;  1MIY A;  4HFD A;  4YT0 A;  4H9S E;  1AJ3 A;  2CM0 A;  2E8I A;  4ASK A;  3FBZ A;  2W2U A;  3KV6 A;  2EHO B;  3AE4 A;  2P9B A;  5IUX A;  4EB6 E;  2VKO A;  3MK7 C;  1JNR A;  2FUP A;  3AE1 A;  4PFO A;  4TZ4 C;  3SFD A;  4X62 T;  5LYJ E;  4ZZC A;  3ZC0 A;  2IHR 1;  4ILA A;  2IC6 A;  2WY2 A;  4HE8 A;  1LRZ A;  3L09 A;  1MIV A;  3FZF B;  4G63 A;  2IW5 B;  4CZZ B;  1OXZ A;  2X9W A;  5ABF A;  3DTO A;  5J2T E;  2BBH A;  2XAJ B;  3N9O A;  4WYV A;  3A5X A;  3CX7 B;  3OKQ A;  3UFG A;  5LB7 B;  4DMV A;  4QXB B;  3AVR A;  1HF8 A;  2ACX A;  2XAG B;  3AA6 B;  3F2E A;  3HR0 A;  3OBV E;  3UT5 E;  2H89 A;  4FJO A;  1J1J A;  2M6I A;  4XBF B;  2WCA A;  2D0U A;  2IIU A;  2MYS A;  1HG2 A;  2YDS A;  3PDY A;  4N78 D;  1IAP A;  4QH1 A;  2LRK A;  5GON E;  3ZLI A;  5IWA T;  2E9X B;  1HNX T;  3KDS E;  4F6R C;  5FL0 A;  2J4G A;  3QNU A;  5JR9 A;  4X65 T;  2BG9 B;  1VOM A;  2K9A A;  5FY0 A;  3U3I A;  2C5I T;  4G2A A;  4EZH A;  4WBN E;  2QA7 A;  5KDM C;  5L47 A;  4YY3 T;  2XSA A;  4H9P C;  1MND A;  2CBI A;  3HL6 A;  3NVO A;  4B3M T;  4O4J E;  2KWH A;  3OJA A;  4TNW A;  4LF5 T;  4U74 A;  3Q5W A;  3VU7 H;  2XY8 B;  2H7O A;  3AE6 A;  3B57 A;  3N2K E;  2XQ3 A;  3PUW F;  1IJ6 A;  4H63 H;  2YKS A;  4I0U A;  5IHY A;  3WI3 A;  2QVA A;  5JR9 C;  4JBW F;  3AB3 B;  1ZEE A;  4KMC A;  3BQL A;  4TWD A;  4ZS2 A;  5FYM A;  3ZYK A;  4X66 T;  1BR1 A;  3DP7 A;  4LFA T;  2YU1 A;  2Q9Q B;  4AQG A;  2IC9 A;  3PTR B;  4DMW A;  2JMK A;  2LKH A;  4JV5 T;  3P8C D;  3IA3 A;  1E1H B;  2K24 A;  5BR8 T;  3CVR A;  5HEG A;  3VR8 A;  5HWY A;  3PUV F;  2ZMA A;  3N2O A;  2ZLY A;  3P4Q A;  4TV8 E;  2PG8 A;  2L8K A;  2BKN A;  1OED B;  2XTL A;  3AAA B;  5A1L A;  2NR4 A;  3TLV A;  3TLT A;  2FBW A;  3ZSS A;  2X0Y A;  5AQL B;  2VL8 A;  3LK2 B;  4DV7 T;  1MNE A;  2BDE A;  2LSI A;  2CHO A;  3O4X E;  4IDP A;  2I6H A;  3A8Y C;  4X1I E;  1OWA A;  3ANW A;  1J5W A;  1LKX A;  3I0O A;  3ZT6 A;  3E0Z A;  3GWH A;  4UEM A;  4K0U A;  3ZN1 B;  1HR0 T;  3WAJ A;  3ZYL A;  4NUV A;  3RYH E;  4KHP T;  1U4Q A;  2VQF T;  3RRC A;  3LDQ B;  4IL9 A;  4HTE A;  4XAX B;  4WW0 A;  3ZJ1 A;  3CIR A;  3AEE A;  2JQK A;  4JI2 T;  4U33 A;  5AQF B;  5FL1 A;  2UUB T;  2UXN B;  3Q5D A;  4IDO A;  4LF9 T;  5HAX A;  5FKY A;  1D1B A;  3T1H T;  1WYB A;  2JQQ A;  4J2C A;  1D1C A;  1WRD A;  2NTX A;  3C4X A;  3LSV A;  4UF0 B;  4LF8 T;  3RIU C;  2LHR A;  2V5C A;  2LLY A;  3ZCI A;  2WAU A;  3KBU A;  2C0S A;  2FJA A;  3Q5X A;  4EYY R;  1DU2 A;  5LMU T;  1NAF A;  2OLT A;  4JI5 T;  5LHH B;  3MAC A;  2N1G A;  5AQI B;  5ABE A;  3NZQ A;  3LFM A;  4EAH A;  1UGO A;  4OX9 T;  4LFB T;  4HN9 A;  4HWH A;  5H6Q B;  2RA1 A;  2X9X A;  3RIU A;  3J7Y q;  5LGN B;  4MBQ A;  2W67 A;  4ZI2 C;  3E08 A;  4IST A;  2CCQ A;  4LMJ A;  3TLW A;  4LF4 T;  3UUL A;  3H37 A;  3HKB E;  1I94 T;  3C64 A;  2DL1 A;  1G8X A;  1WYC A;  4YHH T;  1OED C;  4CN6 A;  2LT3 A;  4WBO A;  3VR9 A;  3ZMU B;  3ETV A;  4L0R A;  4A5X A;  2X0L B;  4MAL A;  3ESL A;  3PUG A;  1NEK A;  5JDN A;  2BVM A;  2JQH A;  2V26 A;  2X9H A;  3L8R A;  3PUZ F;  4GK5 E;  3PV0 F;  4PAG A;  4QH4 A;  5LG3 A;  4UXN B;  3A7M A;  3CWZ B;  3LK3 B;  1KEY A;  3KBT A;  4DVD A;  2MPK A;  1IBL T;  2H7V C;  2WSS V;  2H88 A;  2LSG A;  3JAE A;  4B6X A;  2J62 A;  2XAF B;  2X66 A;  1QLB A;  4GIW A;  4EGW A;  1CHU A;  1X79 A;  2Z6E A; 
#chains in the Genus database with same CATH homology
 4H9N C;  2DNX A;  2HPJ A;  4QX7 B;  3HKE E;  2V7K A;  4H9R C;  4L9I A;  3PU3 A;  2NW9 A;  5J1G A;  3PUQ A;  4JEH B;  5L3G B;  3KFW X;  2VKD A;  3PU8 A;  5DJQ C;  3KIN B;  4TUY E;  3NRX A;  4JEU B;  2EHO D;  4IE6 A;  4UVC B;  3S4U A;  3RKO A;  3ZEF B;  1BR0 A;  2NTY A;  3B13 A;  2CLY B;  3MJX A;  4PJM A;  3N9Q A;  3Q9D A;  2D0T A;  4C90 A;  2DWG A;  2ODV A;  3JC6 D;  2YK0 A;  3F31 A;  4PJL A;  1T98 A;  2ZM2 A;  1WR6 A;  5KMG P;  1NWM X;  2ES0 A;  3FHN A;  5ETW A;  1LVK A;  3TKL B;  2XAS B;  5F8P A;  2C5J A;  2KLQ A;  3AA0 B;  3RPU A;  1FEW A;  5LG4 A;  4X1K E;  2B1E A;  3CPZ A;  4HGA A;  2X51 A;  5AFU L;  3N9N A;  2N9D A;  2EHO A;  3LG7 A;  3ZJ2 A;  1ZHC A;  2K5B B;  3MKD A;  2M67 A;  3EVY A;  4H9O C;  3SOL A;  2LJL A;  5TAO A;  2HPL A;  2LOP A;  5CB4 E;  3VKG A;  5HXH A;  2WMN A;  2JPF A;  3K3N A;  3MA9 A;  4TN7 B;  3RH3 A;  4DBR A;  3LBX A;  3NZP A;  5FXX A;  1ZV4 X;  5JDF A;  2CXF A;  5L2L A;  4QX8 B;  2PFV A;  4OYK A;  5FY7 A;  2LSK A;  5JRE A;  5L3E B;  3RX6 A;  3RYI E;  4O2B E;  3CX6 B;  2V7J A;  4Z8X A;  4QWN B;  2JJ9 A;  2LE8 A;  4OHF A;  4P09 A;  2JMH A;  2NP9 A;  3I9W A;  2Q9Q A;  2WM9 A;  3AVS A;  4GYR A;  4IE4 A;  4AKG A;  5LP6 E;  2MOZ A;  1VRB A;  1FMW A;  2W62 A;  3F57 A;  4ZI2 D;  1U5P A;  3GA8 A;  2LSY A;  3L3P A;  3CQC B;  3V5U A;  3FXD B;  4A56 A;  2KIN B;  2I59 A;  4PK6 A;  4PW8 A;  4X1Y E;  2QGS A;  4BA9 A;  3UUX B;  2NWB A;  2LEH A;  3I9Y A;  3DJB A;  3RYF E;  5E0O A;  1MMN A;  1MMD A;  4ZS3 A;  3KV9 A;  2PBI A;  2X9Y A;  4XZC A;  4QXH B;  4UIG A;  3H3A A;  5JDQ A;  4CI3 B;  4GOU A;  5CA1 E;  2XUE A;  2WBL A;  3IHR A;  4EOZ B;  3HI2 A;  1MMA A;  3QUJ A;  5EK2 A;  1MMG A;  5F3J A;  2NW7 A;  1YKH B;  4AKR B;  4EZ4 A;  5IYZ E;  4JLE A;  4CI1 B;  2KT9 A;  4H63 V;  5JDM A;  2MBG A;  4CI2 B;  5FNV E;  2W61 A;  4BAY B;  5ADX L;  4IE7 A;  2K48 A;  2YEV C;  1IJ5 A;  3UTK A;  3ANW B;  3N9L A;  4ZI3 C;  3EUH A;  4YHJ A;  4IDZ A;  5J2U E;  4EIW A;  2NOX A;  4I43 B;  1D0Z A;  2BVL A;  3FB2 A;  4I4T E;  3AA1 B;  2CEA A;  3PUR A;  5JRC B;  4MLK A;  3O9X A;  5L3F B;  1G73 A;  1H7C A;  4IE0 A;  4AXP A;  3CQG B;  3ZMV B;  3C98 B;  3OYX A;  3IF8 B;  5H6R B;  4CXW A;  5DQV A;  3N9M A;  1LVF A;  3NRY A;  4UF0 A;  1SA0 E;  4HKA A;  4O8S A;  5FXZ A;  3K3O A;  4UV9 B;  2G0U A;  3C4W A;  4ILU A;  1ZKE A;  2BZB A;  3ZYM A;  3ZMZ B;  3D0T A;  4GK0 E;  3OYZ A;  1SHZ C;  4OFZ A;  4AKL A;  3O1J A;  2SPC A;  5LNK A;  2W0G A;  2V7I A;  4ZI3 D;  3JC6 C;  4TV9 E;  2JRK A;  3NBX X;  2E9X A;  2V7L A;  2OA5 A;  5CA0 E;  3R6N A;  2ZM0 A;  3GN5 A;  4JUY A;  4QHO A;  3RYC E;  3UUM A;  2KWI B;  4ZI7 E;  3SRZ A;  3BK9 A;  5JH7 E;  2KZ7 B;  4GYS A;  4O4I E;  4U72 A;  1QSD A;  4YFS A;  2V1D B;  2E9X C;  3V5S A;  3ZMT B;  4CXX A;  4FI5 A;  1KK7 A;  4ISS A;  3MZK B;  3W15 B;  5C8Y E;  2CWY A;  2KXP B;  2UXX B;  4QXC B;  4IIJ E;  5HYA A;  3M65 A;  5EK3 A;  1BR4 A;  2X67 A;  3ZC1 A;  3KV4 A;  5BMV E;  4OK0 A;  5JQG E;  4ERR A;  3R84 B;  4TX5 A;  5LBM A;  1D1A A;  3BQK A;  4CQI A;  5FXW A;  3HA4 A;  3I0Q A;  4IHJ E;  5JR9 B;  4EYU A;  1YKE B;  2LM9 A;  5LHI B;  1B7T A;  5KX5 E;  2ODU A;  2E9X D;  1US7 B;  3ZCJ A;  2GK9 A;  2L9Q A;  4P0A A;  5L3D B;  2CLY C;  5HXS A;  4DBQ A;  5HXE A;  3MXZ A;  1FMV A;  3E22 E;  3ONX A;  3U78 A;  2MTQ A;  4H9Q C;  1Z0P A;  2IAK A;  2KMF A;  2YIN A;  4BJN A;  3UFE A;  3FXE B;  2Q9Q D;  2Y6X A;  3EDV A;  2CWO A;  3AAI A;  4PJJ A;  1QUU A;  2ZM8 A;  4KP3 C;  2CE7 A;  3SS1 A;  4QKN A;  4ANJ A;  1D0X A;  4PJN A;  2V7M A;  1UX5 A;  2DHR A;  2YU2 A;  3CML A;  3PE0 A;  3PUA A;  2HH7 A;  2WWU A;  1HX8 A;  1MIW A;  3EDU A;  1D0Y A;  3O1I A;  1S94 A;  4OYJ A;  2C5K T;  5M4Y A;  4MFR A;  3IBP A;  2RP4 A;  1IZN B;  1YW0 A;  2CA5 A;  4ZOL E;  1V9D A;  5L3C B;  5JDG A;  4V1A v;  5LGU B;  4L5G A;  4X20 E;  4HEA A;  4P0B A;  3LK4 2;  5LOV E;  2D5U A;  4PFP A;  4C91 A;  2WMO A;  5LA6 E;  4UVA B;  3ZN0 B;  2DCF A;  4AKH A;  2KND A;  3N2G E;  4DO0 A;  2J1D G;  2H3R A;  2XQY A;  3O1H A;  5EZY E;  3Q2M A;  4UV8 B;  3C50 A;  3LBX B;  3WAK A;  4WNK A;  4YJ2 E;  1YD8 G;  4PK4 A;  2Y48 B;  5JRC A;  3FBL A;  4UVB B;  5JDL A;  3K8P C;  5HWX A;  2L3L A;  2EHO C;  3CX8 B;  4AKI A;  5HXR A;  3PUS A;  3T8O A;  3ETU A;  2VWA A;  2DI4 A;  4YLH A;  4I50 E;  4I55 E;  4AQF C;  3HKC E;  3VHL A;  1HS7 A;  3CQX C;  4PK5 A;  3HKD E;  4KUM B;  3C4Z A;  3CKD A;  3KV5 A;  5FXV A;  1HTJ F;  5LHG B;  2A3D A;  3RRW A;  1FIO A;  3AA7 B;  1HG5 A;  2VB6 A;  5LGT B;  3KVA A;  2XHE B;  4AQF A;  1UCU A;  5LJN A;  1UX4 A;  1WLX A;  3AAE B;  2NW8 A;  1Y64 B;  4CXY A;  4DND A;  2Q9Q C;  3ZPO A;  2PJQ A;  2VAS A;  3I1A A;  1HFA A;  2A2F X;  2LOS A;  2Y8D A;  1BR2 A;  4BJM A;  3GMI A;  4O4H E;  5JDH A;  2DWK A;  4M1P A;  3GN5 B;  2CXL A;  2XAQ B;  5JVD E;  4ADZ A;  5L3B B;  3VKH A;  2D2S A;  2X68 A;  3RC3 A;  2N2N A;  4O2A E;  4ZHQ E;  3QK6 A;  4EXT A;  3SWH A;  3UUN A;  4AI6 A;  4NUU A;  1S35 A;  4O4L E;  3KVB A;  4MHC A;  2VKH A;  1O3X A;  3N9P A;  1CUN A;  4YJ3 E;  4E7Z A;  3ZMS B;  5LJM A;  5HXC A;  4IE5 A;  4KBM B;  1HCI A;  3RC8 A;  3P7I A;  2XAH B;  1EZ3 A;  3QC9 A;  3J9X 1;  3LJC A;  5DAB A;  3BQI A;  4HFV A;  4E7S A;  5EK4 A;  4UEL A;  2VK9 A;  2LHN A;  2CXD A;  3C51 A;  2W63 A;  3IEE A;  5LBQ B;  2CMR A;  4PNI A;  5FP3 A;  2W00 A;  2A72 A;  3K3Q C;  3N5L A;  2LSJ A;  5LCY A;  4IGU A;  5DQW A;  2DLR A;  2VKJ A;  5FY1 A;  5FMN A;  1AJ3 A;  1MIY A;  4H9S E;  2CM0 A;  2E8I A;  4ASK A;  3FBZ A;  3KV6 A;  2EHO B;  2P9B A;  4EB6 E;  2VKO A;  3MK7 C;  4PFO A;  4TZ4 C;  3ZC0 A;  5LYJ E;  2IC6 A;  4CZZ B;  4HE8 A;  1LRZ A;  3L09 A;  1MIV A;  2IW5 B;  4G63 A;  5J2T E;  1OXZ A;  2X9W A;  3DTO A;  2XAJ B;  3N9O A;  3A5X A;  3CX7 B;  3OKQ A;  4DMV A;  4QXB B;  3AVR A;  1HF8 A;  2ACX A;  2XAG B;  3AA6 B;  3F2E A;  3HR0 A;  3OBV E;  3UT5 E;  4FJO A;  4XBF B;  2D0U A;  3PDY A;  2MYS A;  1HG2 A;  4N78 D;  1IAP A;  5GON E;  3ZLI A;  2E9X B;  3KDS E;  4F6R C;  5JR9 A;  1VOM A;  2K9A A;  5FY0 A;  3U3I A;  2C5I T;  4G2A A;  4EZH A;  4WBN E;  2QA7 A;  5KDM C;  4H9P C;  1MND A;  3HL6 A;  4O4J E;  2KWH A;  3OJA A;  4U74 A;  3Q5W A;  3VU7 H;  2H7O A;  3B57 A;  3N2K E;  5IHY A;  3WI3 A;  4H63 H;  1IJ6 A;  5JR9 C;  4KMC A;  3AB3 B;  1ZEE A;  3BQL A;  4ZS2 A;  5FYM A;  3ZYK A;  1BR1 A;  3DP7 A;  2YU1 A;  2Q9Q B;  4AQG A;  2IC9 A;  3PTR B;  4DMW A;  2JMK A;  3P8C D;  1E1H B;  2K24 A;  3CVR A;  5HWY A;  2ZMA A;  3N2O A;  2ZLY A;  4TV8 E;  2PG8 A;  2L8K A;  2XTL A;  3AAA B;  5A1L A;  2VL8 A;  3LK2 B;  1MNE A;  2BDE A;  2LSI A;  3O4X E;  4X1I E;  1OWA A;  3ANW A;  3I0O A;  1LKX A;  3E0Z A;  3GWH A;  4UEM A;  4K0U A;  3ZN1 B;  3WAJ A;  3ZYL A;  4NUV A;  3RYH E;  1U4Q A;  3RRC A;  4XAX B;  4HTE A;  3ZJ1 A;  4WW0 A;  2UXN B;  5HAX A;  1D1B A;  1WYB A;  2JQQ A;  4J2C A;  1D1C A;  1WRD A;  2NTX A;  3C4X A;  4UF0 B;  3ZCI A;  5LXT E;  1KNZ A;  2LHR A;  2WAU A;  3KBU A;  2C0S A;  3Q5X A;  4EYY R;  1NAF A;  5LHH B;  3MAC A;  2N1G A;  3NZQ A;  3LFM A;  4EAH A;  4HN9 A;  5H6Q B;  2RA1 A;  2X9X A;  3J7Y q;  5LGN B;  4MBQ A;  4ZI2 C;  3E08 A;  4IST A;  2CCQ A;  3UUL A;  3H37 A;  3HKB E;  3C64 A;  1G8X A;  1WYC A;  2LT3 A;  4WBO A;  3ZMU B;  3ETV A;  4L0R A;  2X0L B;  4MAL A;  3ESL A;  3PUG A;  5JDN A;  2BVM A;  2V26 A;  2X9H A;  4GK5 E;  4PAG A;  4UXN B;  3CWZ B;  3LK3 B;  3KBT A;  4DVD A;  2H7V C;  2WSS V;  2LSG A;  4B6X A;  2XAF B;  2X66 A;  4GIW A;  1X79 A;  2Z6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...