3OKQA

Crystal structure of a core domain of yeast actin nucleation cofactor bud6
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
125
structure length
125
Chain Sequence
SSNRMYMEKSQTELGDLSDTLLSKVDDLQDVIEIMRKDVAERRSQPAKKKLETVSKDLENAQADVLKLQEFIDTEKPHWKKTWEAELDKVCEEQQFLTLQEELILDLKEDLGKALETFDLIKLCC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the formin-interaction domain of the actin nucleation-promoting factor Bud6.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Bud site selection protein 6
total genus 62
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3okqA00
3OKQA 3ONXA
chains in the Genus database with same CATH superfamily
1MMDA 2WU5A 3AEEA 1BR4A 4WW0A 4YLHA 5LMNT 1KNZA 1YKHB 1IZNB 2JQKA 1IJ5A 2LM9A 5FXXA 1HG5A 2XPKA 2YDSA 3SOLA 5LGNB 4K0KT 3QUJA 2N9DA 2A72A 4IL4A 2K3WA 1IAPA 1XDOA 2K5BB 1MIWA 3CPZA 1NEKA 3ONJA 2C5IT 2CXDA 4MBQA 3QB5K 4JEHB 5HEUA 2HPJA 3R6NA 5EK2A 5LCYA 5ABGA 3AE4A 3PUSA 1MNEA 4OYKA 2NR4A 3C50A 4OK0A 2ACZA 3ETUA 3PUXF 3PUGA 3UUBA 3VHLA 2WWVA 4CQIA 3CWZB 2VL8A 3H3AA 1Z0PA 3VRBA 4WBOA 3CQGB 3FBLA 2W61A 4YHHT 4ISTA 3PJAA 2BDEA 2V7LA 5AQHB 4YSXA 3NWIA 4HN9A 1WYBA 2E2AA 2WDVA 3ZPOA 1IBMT 3JC6D 1U4QA 2YU2A 2W2UA 1WR6A 2KINB 4QXBB 4QX8B 2BG9E 4HFVA 2MAWA 2BS4A 4HFCA 3VKGA 1N34T 3ETVA 4IDZA 4UVAB 1AJ3A 5L3CB 4GKJT 5C8YE 4X62T 4DNDA 2YEVC 1VCTA 1HX8A 3AAEB 3JC6C 2B1EA 2CLYB 1ZKEA 2CBJA 3AECA 4JLEA 5HAXA 4A98A 4BJMA 2FBWA 2LEHA 4JI0T 4DR6T 1D1AA 3KV6A 2XASB 5L4EA 1XWMA 2D5UA 1BR1A 2JIWA 3UU5A 2CHOA 3KV5A 3O1IA 5FP3A 5KX5E 5LYJE 1HS7A 4X64T 4PJMA 5F5WA 2VWAA 3PU8A 4ILUA 1HF8A 4O4IE 3JCFA 3DTOA 1SHZC 3EUHA 4OHFA 5JDNA 4EIWA 4EYYR 3LBXA 3KBUA 3AAIA 4X65T 2H88A 4YTNA 3RIFA 4HWHA 3ZKRA 5JQGE 1HNXT 1M62A 3MXZA 3C4XA 2K48A 5FYMA 3ZJ2A 1OEDB 2VVNA 3UT5E 4ASKA 5JDLA 4CXYA 4JEUB 3AEGA 3N5LA 2DCFA 3OKQA 3GWHA 2Y48B 3T1YT 4PJJA 5E0OA 4A97A 2L9QA 4CXXA 4KUMB 4I0UA 4OYJA 5FL0A 2LHNA 2KSRA 2M6BA 2JQQA 2EHOD 3FBZA 3PUWF 3Q2MA 3T8OA 4YY3T 3ZT6A 3KBTA 2K24A 1HFAA 4H9OC 5IUXA 5FMNA 4NXMT 3F2EA 3N9QA 3N9OA 4FI5A 4YSZA 2LOPA 2BVLA 1QSDA 2W63A 3A5XA 4AIUA 3B13A 2FJAA 3PE0A 2BS3A 4YSYA 3AA6B 5LHIB 4L5GA 2WS3A 2EHOC 5FVKA 4TWHA 3FZLB 5ABHA 4LFCT 4AKIA 4AKHA 1XZYA 3AA7B 4Z8XA 3EVYA 2AXDS 2LOSA 3LK42 3I9WA 1QLBA 1W0AA 3C4ZA 2Z6EA 3FZMB 4MHCA 4CN1A 2X0HA 2IUBA 2WQYA 2XZEA 3ZYKA 4DR4T 4QH5A 1MMNA 2CCQA 4Q25A 1OEDC 2OA5A 2UUBT 3HA4A 3AEFA 4DBQA 3I1AA 4U31A 2YU1A 1UUSA 4AQFC 4JI7T 3CVRA 5JR9B 5HWXA 1WYCA 2FUPA 2SPCA 5J2TE 1US7B 1O3XA 4IIJE 5HEOA 2DLRA 4KX6A 5LJMA 2V1DB 4YTPA 3LJCA 3HKEE 4IDPA 4KI0F 3P4SA 3WI3A 3CX8B 5FY0A 2X9YA 4DR1T 2G0UA 5FXZA 3PDYA 1LRZA 4EZ4A 3CX6B 4DIDB 3ZEFB 5LP6E 4ZXLA 2VASA 4GK0E 1Y01A 3ZC0A 2CM0A 4IE7A 2UXDT 4ZZBA 4A56A 5HCJA 3C64A 4G63A 4GKKT 1YQ3A 1OEDE 2XSAA 3PUYF 3RYCE 2L3LA 5FXWA 4U74A 2Y8DA 4GYSA 3B57A 3VR9A 3PTRB 3AA1B 5JRCA 2BBHA 1G73A 2UXXB 3L8RA 3KVAA 1HNZT 1N32T 3ANWA 2YINA 4LF9T 2CEAA 4UIGA 2IW5B 3FZHB 1KK7A 1YQ4A 3CQCB 4CI2B 2FJDA 2CA5A 2JRKA 4QX7B 5AQLB 2XY8B 2LM2A 5FL1A 3MACA 5JR9C 2LSYA 5HXCA 3RYIE 5AQGB 5LBQB 2OLTA 3AE8A 2J1DG 2E9XA 1V9DA 3KVBA 3O1JA 3QB5A 5M4YA 3ZN1B 1ZP0A 3OYXA 2M67A 2BVMA 2E5LT 3W15B 4DV2T 1MNDA 3RKOA 4AISA 1R8IA 2V7KA 3J7Yq 4JBWF 4E7ZA 4HFHA 3MK7C 5HEHA 2C5KT 1ZOYA 4X20E 4LF6T 3O9XA 2WWUA 5J1GA 4HWFA 4X1KE 2KT9A 3WAJA 3Q5XA 3SWHA 5ADXL 4H9QC 2H3RA 3ZT7A 2X68A 2JPFA 2ZM8A 1HX1B 4IE5A 4O8SA 4XZCA 4YJ2E 3EDUA 2JJ9A 4PK5A 5HEJA 2HN1A 1J1JA 1NENA 1UX5A 2FJEA 2XM1A 4GOUA 2ZM0A 4LMKA 5JDMA 2ZM2A 2XQ9A 3LBXB 2UXNB 4AQGA 2VVSA 3QC9A 4QH4A 2DHRA 2WAUA 5AQIB 2WZHA 3UUMA 3ZN0B 1LVFA 4C90A 4CN6A 2UXCT 4WBNE 2XQ7A 1OEDA 1KNPA 4NPPA 3M65A 3TLUA 3I9YA 2K9AA 4GIWA 3JADA 4L0RA 4O2BE 2UUAT 2IIUA 4CZZB 1SE7A 5JDGA 2H89A 2XSBA 2HN2A 1VRBA 2XTLA 3LSVA 2R6GF 3NRXA 1Y64B 2KNDA 4X1IE 1D0XA 3UUXB 1WCRA 4PNIA 3ZMTB 5LGTB 3RC3A 1J5WA 3UQ7A 2ACXA 3PJAJ 2XQ5A 4JI2T 4HKAA 1JNZA 2WY2A 4H9SE 4IREA 1KF6A 4P09A 4LMLA 4EAHA 1G8XA 2LT3A 2XM2A 3LK3B 3PURA 4PFPA 3TLVA 2WZIA 3ZJ1A 2WCAA 4TUYE 5TAOA 5L3EB 1XNQT 4NIQA 4QKNA 4I55E 3RQUA 3L39A 1D1BA 1KFYA 3UQ4A 4IE4A 5FKYA 1ZEEA 2BKOA 2I59A 2V7IA 3Q5WA 3RIUA 3SFEA 3AE7A 3AE6A 4MLKA 2WDRA 4KMCA 5ABFA 1HG2A 2VKDA 3HI2A 5DABA 3ZCJA 3G06A 2Y6XA 1HR0T 4ISSA 2QVAA 4ILCA 4EZHA 2KMFA 3RYHE 3ESLA 2XUEA 4K0UA 3RLFF 1FMWA 3ONLC 3ZSSA 3CIRA 2NTXA 3NRYA 3PV0F 3GN5B 2BG9A 1X9BA 2CE7A 3L09A 2V7JA 5EK3A 4DVDA 3TLWA 3RC8A 2CMRA 5JR9A 1W09A 5AQMB 2D0UA 5H6RB 5KMGP 3I0OA 3RKGA 4B3RT 4JV5T 3FXEB 1FIOA 2A2FX 4J2CA 4BJNA 4UVCB 4DR2T 1HCIA 4JI1T 2V26A 3ONXA 2LHRA 4MFRA 3OJAA 4B3ST 1DU2A 1BR2A 4UEMA 2LSIA 3KINB 3AE5A 2YK0A 3NZQA 3P8CD 3VR8A 2IMLA 3MA9A 3Q5EA 4KHPT 3N2KE 4NUUA 2XAJB 4IDOA 5LMUT 5LXTE 2CWYA 1KEYA 2CXFA 3AE9A 3EAMA 3FZFB 3HKDE 4I43B 3AVSA 4MALA 4DO0A 5KXJA 4IHJE 4CN4A 4PK6A 2MBGA 3FHNA 4HFIA 3A7MA 4YT0A 2KLQA 2LRLA 4DV0T 5DQVA 4ZEYA 3AEDA 4IE6A 5LNKA 3ZMZB 1YD8G 1EZ3A 4ZS3A 3E22E 4HTEA 2H7VC 2KWIB 2V6YA 3ZCIA 5JRCB 3CX7B 3RGLA 3RX6A 1WLXA 4UF0B 2X0YA 4O4HE 1T8BA 5LB7B 2CHNA 4BAYB 4TV9E 3TLTA 1SUMB 3N9PA 3Q9DA 3ZMVB 4UXNB 2X9XA 2BG9C 2W0GA 3ZYLA 1E7PA 2VKJA 2D2SA 4WNKA 4COFA 4ZHQE 4ZI2C 5HEGA 3AAAB 4GYRA 3N2OA 3RQWA 5EK4A 3RH3A 3H37A 5AQNB 4CI1B 2JQ9A 2LSJA 4PJNA 1WR0A 3VRAA 3GMIA 2KXPB 1ZHCA 3D0TA 3AEBA 3K3NA 5CA1E 4JI3T 5IWAT 4DR3T 3CQXC 3K1SA 2DL1A 2YN6A 3UFGA 4EB6E 3DP7A 1HTJF 2IDOB 3JAFA 2X9WA 5GONE 2N1GA 4AQYT 1W0BA 2EHOA 2NWBA 3VU7H 2PJQA 4NXNT 2W00A 3GA8A 3L3PA 4UV9B 3ZYMA 4AKRB 4B3TT 4TV8E 4CI3B 1OXZA 2C5JA 5LGUB 4NUVA 3IEEA 3FXDB 2WMNA 2CRBA 3AE2A 3OYZA 1WRDA 4HEAA 4UF0A 5H6QB 1FMVA 4KHZF 5JDHA 4DR5T 3N9LA 5CFBA 1FJGT 1IBKT 5FY1A 2WP9A 3ZMSB 1L0VA 4HFBA 3N9MA 2VK9A 4IT4A 4TN7B 4F8HA 4YFSA 4ADZA 1U5PA 3N9NA 2BKPA 3M3ZB 4HGAA 4JUYA 4JI5T 3ZSTA 2VQET 1UK5A 4KP3C 2BBJA 4YJ3E 5JH7E 4EV6A 4DV6T 2UU9T 1FEWA 2XQ3A 4H63V 4TWDA 4Z90A 5AQTB 2BS2A 5L47A 4U7IA 4OX9T 1I6ZA 4I50E 3SRZA 3ZMUB 5L4HA 3HKBE 3K8PC 4DV1T 5AQKB 5AQQB 1OWAA 4U72A 3VKHA 3AEAA 3TLSA 3HR0A 2ES0A 3QK6A 2QGSA 3C98B 4H9PC 2KWHA 1QUUA 5DQWA 4U3CA 2NW8A 1D1CA 3QOFA 4M1PA 3LDQB 2BKNA 2FJBA 1SA0E 2Q9QC 3UUNA 2D0TA 1UCUA 3NZPA 5ABFB 4ANJA 5JDQA 2I0MA 4X66T 3ANWB 2PFVA 5FY7A 5LHHB 4LFBT 2YOEA 5C2TA 4O4JE 2WBLA 3SS1A 4UV8B 5FXVA 4TZ4C 4WYVA 2LLYA 3BK9A 5LG3A 5LHGB 4DV4T 2XAFB 2VL0A 4I4TE 1D0ZA 2XQ6A 4DBRA 4TWFA 5J0ZA 3IBPA 4DUZT 4QWNB 2Q9QD 2RP4A 2B76A 2YDRA 3EDVA 3JAEA 3QNUA 5JVDE 4CXWA 3AE3A 5L3FB 2V7MA 1T72A 2V8SV 2XAQB 3AXJA 3BQLA 1YW0A 5LOVE 4U33A 3RHWA 3IF8B 4DUYT 1YKEB 3S4UA 4JYAT 3U78A 2PBIA 5LA6E 4DV7T 2MYSA 4XBFB 1MMAA 1VOMA 2E8IA 3F57A 2A3DA 1T7SA 2XAHB 5LJNA 3LK2B 2HPLA 2WB5A 3OBVE 4YTMA 4HWDA 4ILAA 3OPCA 2W67A 2LKGA 4PJLA 3KFWX 3RPUA 3K3OA 5EZYE 2V5CA 3CK6A 2XJ7A 1KNRA 1S94A 3AVRA 1ZV4X 2JMHA 2L8KA 1MIVA 2WMOA 4X1YE 5HWYA 5F3JA 4B6XA 2X67A 3J9X1 1UX4A 4EGWA 2RA1A 3C51A 4GK5E 3FB2A 1GQEA 2X66A 3P50A 3UU4A 1I94T 2J62A 2QA7A 3PU3A 4DR7T 3N2GE 4LF8T 2CXLA 4KBMB 4HWCA 2GK9A 1NAFA 2NP9A 4H63H 3UULA 1MMGA 3OTOT 1H7CA 2XHEB 3GN5A 4PAGA 4EYUA 4P0BA 5AQRB 2E9XC 4E7SA 5HXHA 2IHR1 3UFEA 4QH1A 3KV4A 2LE8A 2RPAA 3FZKB 4TNVA 5CGMA 3E0ZA 4UVBB 2CBIA 1JNRA 2WU2A 3IA3A 5IHYA 5HYAA 1UGOA 5JREA 2IAKA 4AKLA 4H9NC 5DJQC 4EXTA 2HHHT 1IJ6A 2CWOA 3KDSE 2AE9A 1S35A 2XQ8A 3AB3B 3DJBA 3O4XE 4X5TA 3MKDA 5KDMC 2MPKA 2LKHA 3EI0A 3EABA 1NWMX 4TX5A 2XQAA 4N78D 1X79A 2E9XD 4HFEA 5L3BB 5F8PA 2JQHA 2N2NA 4IDQA 4ZI2D 2X9HA 4U2YA 4PK4A 3ZC1A 3C4WA 1XMOT 4PW8A 1XNRT 2HH7A 3LG7A 3E08A 3ZT5A 4YHJA 4HFDA 2XQ4A 4BA9A 4ZZCA 2JMKA 2OV9A 4IE0A 5L3GB 4JI6T 2VKHA 2F4VT 1T98A 2VURA 4UELA 3CKDA 2UUCT 2I6HA 3UU8A 5C3JA 3R84B 1YXRA 3U3IA 3AA0B 4O4LE 2IC6A 5AQPB 2XAGB 3PUAA 4HWIB 4YXDA 4DV3T 2V6YB 2BG9B 2J47A 3RIUC 4AKGA 2WM9A 3KV9A 4U7YA 4DMVA 5JTGA 2LJLA 2W66A 4ZI3C 4ERRA 4DV5T 4LFAT 2E5VA 1XDPA 2UXBT 2KZ7B 3PUVF 3X1DA 3AE1A 2PG8A 2J4GA 3RRWA 5FNVE 2YKSA 4QHOA 3RI5A 1CHUA 4AXPA 2QRXA 5J2UE 5BMVE 4AQFA 4LF5T 5CA0E 3HL6A 3MJXA 2NOXA 5ETWA 2ODVA 4XAXB 3WAKA 3V5SA 3P4QA 2LSGA 2ZLYA 3TKLB 2LRKA 4G2AA 5AFUL 3SFDA 2DI4A 5L2LA 2NW7A 4LF7T 5HCMA 2C0SA 3PUZF 1WFDA 1VCSA 1D0YA 2EHOB 5AQSB 5AQUB 1N36T 4Z91A 2BZBA 4ZS2A 5A1LA 5ABEA 1LKXA 4AI6A 3LFMA 1UURA 3P4WA 3H3MA 3NBXX 2ZM6T 3B5MA 4EEDA 2PTFA 3NVOA 2H7OA 2CPTA 2W4XA 2YDQA 3A8YC 2MOZA 5CB4E 3UU3A 3V5UA 5L3DB 4P1NA 5HXSA 2DWKA 5IYZE 1IBLT 1BR0A 2Q9QA 5FVLA 5AQFB 2ODUA 3I0QA 3RRCA 4ILBA 4JI8T 5AQOB 2WDQA 3IHRA 3RF1A 3ABVA 4O2AE 3AXJB 2DWGA 4IGUA 4UR9A 5HXEA 3BQIA 2VB6A 3OVUA 4WZXA 3RYFE 2X0LB 3HKCE 4EEBA 4ZI7E 2QYWA 2WSSV 3NKZA 2MTQA 2P9BA 4DMWA 2VQFT 2XQYA 3T1HT 4QXHB 4C91A 5HXRA 4LF4T 3EHZA 4U2ZA 1HNWT 5AQJB 1M7KA 1LVKA 1E1HB 2D9DA 1W9RA 4IL9A 4HE8A 4PFOA 3P7IA 4V1Av 4B3MT 2DNXA 2X51A 4ZI3D 1XMQT 4IDNA 2A9UA 3O1HA 2NTYA 5CJ5A 4EOZB 5AQVB 3Q5DA 4LMJA 5JDFA 4P0AA 2ZMAA 3P4RA 3K3QC 2NW9A 2W62A 3BQKA 3UU6A 4A5XA 2VKOA 4TNWA 4ZOLE 3UTKA 3F31A 2IC9A 2V6XA 2CLYC 1CUNA 5LBMA 4L9IA 1J5ET 5LG4A 1MIYA 3CMLA 3P4PA 1B7TA 3RIAA 5BR8T 4JI4T 4FJOA 4H9RC 2LSKA 2Q9QB 4F6RC 1Z8UA 3MZKB 3PUQA 1E2AA 3ZLIA 1N33T 2M6IA 2V5DA 4OFZA 4QXCB 2E9XB
chains in the Genus database with same CATH topology
1MMDA 1BR4A 4WW0A 4YLHA 1KNZA 1YKHB 1IZNB 2LM9A 1IJ5A 5FXXA 1HG5A 3SOLA 5LGNB 3QUJA 2N9DA 2A72A 1IAPA 2K5BB 1MIWA 3CPZA 2C5IT 2CXDA 4MBQA 3R6NA 4JEHB 5EK2A 2HPJA 5LCYA 3PUSA 1MNEA 4OYKA 3C50A 4OK0A 3VHLA 3ETUA 3PUGA 4CQIA 3CWZB 2VL8A 3H3AA 1Z0PA 4WBOA 3CQGB 3FBLA 2W61A 4ISTA 2BDEA 2V7LA 4HN9A 1WYBA 3ZPOA 3JC6D 1U4QA 2YU2A 4QXBB 1WR6A 2KINB 4QX8B 4HFVA 3VKGA 3ETVA 4IDZA 4UVAB 1AJ3A 5L3CB 5C8YE 4DNDA 2YEVC 1HX8A 3AAEB 3JC6C 2B1EA 2CLYB 1ZKEA 4JLEA 4BJMA 5HAXA 2LEHA 1D1AA 3KV6A 2XASB 2D5UA 1BR1A 5KX5E 3O1IA 3KV5A 5FP3A 5LYJE 1HS7A 4PJMA 2VWAA 3PU8A 4ILUA 1HF8A 4O4IE 4OHFA 3DTOA 1SHZC 3EUHA 5JDNA 4EIWA 4EYYR 3LBXA 3KBUA 3AAIA 5JQGE 3MXZA 3C4XA 2K48A 5FYMA 3ZJ2A 3UT5E 4ASKA 5JDLA 4CXYA 4JEUB 3N5LA 2DCFA 3OKQA 3GWHA 2Y48B 4PJJA 5E0OA 2L9QA 4CXXA 4KUMB 4OYJA 2LHNA 2JQQA 2EHOD 3FBZA 3T8OA 3Q2MA 3KBTA 2K24A 1HFAA 4H9OC 5FMNA 3F2EA 3N9QA 3N9OA 4FI5A 2LOPA 2BVLA 1QSDA 2W63A 3A5XA 3B13A 3PE0A 3AA6B 5LHIB 4L5GA 2EHOC 4AKIA 4AKHA 3AA7B 4Z8XA 3EVYA 3LK42 2LOSA 3I9WA 3C4ZA 2Z6EA 4MHCA 3ZYKA 1MMNA 2CCQA 2OA5A 3HA4A 4DBQA 3I1AA 2YU1A 4AQFC 3CVRA 5JR9B 5HWXA 1WYCA 2SPCA 5J2TE 1US7B 1O3XA 4IIJE 5LJMA 2DLRA 2V1DB 3LJCA 3HKEE 3WI3A 3CX8B 5FY0A 2X9YA 2G0UA 5FXZA 3PDYA 1LRZA 4EZ4A 3CX6B 3ZEFB 2VASA 4GK0E 3ZC0A 2CM0A 4IE7A 4A56A 3C64A 4G63A 3RYCE 2L3LA 5FXWA 4U74A 2Y8DA 4GYSA 3B57A 3PTRB 3AA1B 5JRCA 1G73A 2UXXB 3KVAA 3ANWA 2YINA 2CEAA 4UIGA 2IW5B 1KK7A 3CQCB 4CI2B 2JRKA 2CA5A 4QX7B 5JR9C 3MACA 2LSYA 5HXCA 3RYIE 5LBQB 2J1DG 2E9XA 1V9DA 3KVBA 3O1JA 5M4YA 3ZN1B 3OYXA 2M67A 2BVMA 3W15B 1MNDA 3RKOA 2V7KA 3J7Yq 4E7ZA 3MK7C 2C5KT 4X20E 3O9XA 2WWUA 5J1GA 4X1KE 2KT9A 3WAJA 3Q5XA 3SWHA 5ADXL 4H9QC 2H3RA 2X68A 2JPFA 2ZM8A 4IE5A 4O8SA 4XZCA 4YJ2E 5CA0E 3EDUA 2JJ9A 4PK5A 1UX5A 4GOUA 5JDMA 2ZM0A 2ZM2A 3LBXB 4AQGA 2UXNB 3QC9A 2DHRA 2WAUA 3UUMA 3ZN0B 4C90A 1LVFA 4WBNE 3M65A 3I9YA 2K9AA 4GIWA 4L0RA 4O2BE 4CZZB 5JDGA 1VRBA 2XTLA 3NRXA 1Y64B 2KNDA 4X1IE 1D0XA 3UUXB 4PNIA 3ZMTB 5LGTB 3RC3A 2ACXA 4HKAA 4H9SE 4P09A 4EAHA 1G8XA 2LT3A 3LK3B 3PURA 4PFPA 3ZJ1A 5L3EB 4TUYE 5TAOA 4QKNA 4I55E 1D1BA 4IE4A 1ZEEA 2I59A 2V7IA 3Q5WA 4MLKA 4KMCA 1HG2A 2VKDA 3HI2A 5DABA 3ZCJA 2Y6XA 4ISSA 4EZHA 2KMFA 3RYHE 3ESLA 2XUEA 4K0UA 1FMWA 5LP6E 2NTXA 3NRYA 3GN5B 5EK3A 3RC8A 2CE7A 3L09A 2V7JA 4DVDA 2CMRA 5JR9A 5H6RB 2D0UA 5KMGP 3I0OA 3FXEB 1FIOA 2A2FX 4J2CA 4BJNA 4UVCB 1HCIA 2V26A 3ONXA 2LHRA 4MFRA 3OJAA 1BR2A 4UEMA 2LSIA 3KINB 2YK0A 3NZQA 3P8CD 3MA9A 3N2KE 4NUUA 2XAJB 5LXTE 2CWYA 2CXFA 4I43B 3HKDE 3AVSA 4MALA 4DO0A 4IHJE 4PK6A 2MBGA 3FHNA 2KLQA 5DQVA 4IE6A 5LNKA 3ZMZB 1YD8G 1EZ3A 4ZS3A 3E22E 4HTEA 2H7VC 2KWIB 3ZCIA 5JRCB 3CX7B 3RX6A 4EOZB 1WLXA 4UF0B 4O4HE 4BAYB 4TV9E 3N9PA 3Q9DA 3ZMVB 4UXNB 2X9XA 2W0GA 3ZYLA 2VKJA 2D2SA 4WNKA 4ZHQE 4ZI2C 3AAAB 4GYRA 3N2OA 5EK4A 3RH3A 3H37A 4CI1B 2LSJA 4PJNA 3GMIA 2KXPB 1ZHCA 3D0TA 5CA1E 3K3NA 3CQXC 4EB6E 3DP7A 1HTJF 2X9WA 5GONE 2N1GA 2EHOA 2NWBA 3VU7H 2PJQA 2W00A 3GA8A 3L3PA 4UV9B 3ZYMA 4AKRB 4TV8E 4CI3B 1OXZA 2C5JA 5LGUB 4NUVA 3IEEA 3FXDB 2WMNA 3OYZA 4HEAA 5H6QB 1WRDA 4UF0A 5JDHA 1FMVA 3N9LA 5FY1A 3ZMSB 3N9MA 2VK9A 4TN7B 4YFSA 4ADZA 1U5PA 3N9NA 4HGAA 4JUYA 4KP3C 4YJ3E 5JH7E 1FEWA 4H63V 4I50E 3SRZA 3ZMUB 3HKBE 3K8PC 1OWAA 4U72A 3VKHA 3HR0A 2ES0A 3QK6A 2QGSA 3C98B 4H9PC 2KWHA 1QUUA 5DQWA 2NW8A 1D1CA 4M1PA 1SA0E 2Q9QC 3UUNA 2D0TA 1UCUA 3NZPA 5JDQA 4ANJA 3ANWB 2PFVA 5FY7A 5LHHB 4O4JE 2WBLA 3SS1A 4UV8B 5FXVA 4TZ4C 3BK9A 5LHGB 2XAFB 4DBRA 4I4TE 1D0ZA 3IBPA 4QWNB 2Q9QD 2RP4A 3EDVA 5JVDE 4CXWA 5L3FB 2V7MA 2XAQB 3BQLA 1YW0A 5LOVE 3IF8B 1YKEB 3S4UA 3U78A 2PBIA 5LA6E 2MYSA 4XBFB 1MMAA 1VOMA 3F57A 2E8IA 2A3DA 2XAHB 5LJNA 3LK2B 2HPLA 3OBVE 4PJLA 3KFWX 3RPUA 3K3OA 5EZYE 1S94A 3AVRA 1ZV4X 2JMHA 2L8KA 1MIVA 2WMOA 4X1YE 5HWYA 5F3JA 4B6XA 2X67A 3J9X1 1UX4A 2RA1A 3C51A 4GK5E 3FB2A 2X66A 2QA7A 3PU3A 3N2GE 2CXLA 4KBMB 2GK9A 1NAFA 2NP9A 4H63H 3UULA 1MMGA 1H7CA 2XHEB 3GN5A 4PAGA 4EYUA 4P0BA 4E7SA 2E9XC 5HXHA 3UFEA 3KV4A 2LE8A 3E0ZA 4UVBB 5IHYA 5HYAA 5JREA 2IAKA 4AKLA 4H9NC 5DJQC 4EXTA 1IJ6A 2CWOA 3KDSE 1S35A 3AB3B 3O4XE 3DJBA 3MKDA 5KDMC 4TX5A 1NWMX 4N78D 1X79A 2E9XD 5L3BB 5F8PA 2N2NA 4ZI2D 2X9HA 3ZC1A 4PK4A 3C4WA 4PW8A 2HH7A 3LG7A 3E08A 4YHJA 4BA9A 5L3GB 2JMKA 4IE0A 2VKHA 1T98A 4UELA 3CKDA 3R84B 3U3IA 3AA0B 4O4LE 2IC6A 2XAGB 3PUAA 4AKGA 2WM9A 3KV9A 4DMVA 2LJLA 4ZI3C 4ERRA 2KZ7B 2PG8A 3RRWA 5FNVE 4QHOA 4AXPA 5J2UE 5BMVE 4AQFA 3HL6A 3MJXA 2NOXA 5ETWA 2ODVA 4XAXB 3WAKA 3V5SA 2LSGA 2ZLYA 3TKLB 4G2AA 5L2LA 2DI4A 2NW7A 2C0SA 1D0YA 2EHOB 2BZBA 4ZS2A 5A1LA 1LKXA 4AI6A 3LFMA 3NBXX 2H7OA 5CB4E 2MOZA 3V5UA 5L3DB 5HXSA 2DWKA 5IYZE 1BR0A 2Q9QA 2ODUA 3I0QA 3RRCA 3IHRA 5HXEA 4O2AE 2DWGA 4IGUA 3BQIA 2VB6A 3RYFE 2X0LB 3HKCE 4ZI7E 2WSSV 2MTQA 2P9BA 4DMWA 2XQYA 4QXHB 4C91A 5HXRA 1LVKA 1E1HB 4PFOA 4V1Av 4HE8A 3P7IA 2DNXA 2X51A 4ZI3D 3O1HA 2NTYA 5JDFA 4P0AA 2ZMAA 3K3QC 2NW9A 2W62A 3BQKA 5AFUL 2VKOA 3UTKA 4ZOLE 3F31A 2IC9A 2CLYC 1CUNA 5LBMA 4L9IA 5LG4A 1MIYA 3CMLA 1B7TA 4FJOA 4H9RC 2LSKA 2Q9QB 4F6RC 3PUQA 3MZKB 3ZLIA 4OFZA 4QXCB 2E9XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKQ A;  3ONX A; 
#chains in the Genus database with same CATH topology
 1MMD A;  2WU5 A;  3AEE A;  1BR4 A;  4WW0 A;  4YLH A;  5LMN T;  1KNZ A;  1YKH B;  1IZN B;  2JQK A;  1IJ5 A;  2LM9 A;  5FXX A;  1HG5 A;  2XPK A;  2YDS A;  3SOL A;  5LGN B;  4K0K T;  3QUJ A;  2N9D A;  2A72 A;  4IL4 A;  2K3W A;  1IAP A;  1XDO A;  2K5B B;  1MIW A;  3CPZ A;  1NEK A;  3ONJ A;  2C5I T;  2CXD A;  4MBQ A;  3QB5 K;  4JEH B;  5HEU A;  2HPJ A;  3R6N A;  5EK2 A;  5LCY A;  5ABG A;  3AE4 A;  3PUS A;  1MNE A;  4OYK A;  2NR4 A;  3C50 A;  4OK0 A;  2ACZ A;  3ETU A;  3PUX F;  3PUG A;  3UUB A;  3VHL A;  2WWV A;  4CQI A;  3CWZ B;  2VL8 A;  3H3A A;  1Z0P A;  3VRB A;  4WBO A;  3CQG B;  3FBL A;  2W61 A;  4YHH T;  4IST A;  3PJA A;  2BDE A;  2V7L A;  5AQH B;  4YSX A;  3NWI A;  4HN9 A;  1WYB A;  2E2A A;  2WDV A;  3ZPO A;  1IBM T;  3JC6 D;  1U4Q A;  2YU2 A;  2W2U A;  1WR6 A;  2KIN B;  4QXB B;  4QX8 B;  2BG9 E;  4HFV A;  2MAW A;  2BS4 A;  4HFC A;  3VKG A;  1N34 T;  3ETV A;  4IDZ A;  4UVA B;  1AJ3 A;  5L3C B;  4GKJ T;  5C8Y E;  4X62 T;  4DND A;  2YEV C;  1VCT A;  1HX8 A;  3AAE B;  3JC6 C;  2B1E A;  2CLY B;  1ZKE A;  2CBJ A;  3AEC A;  4JLE A;  5HAX A;  4A98 A;  4BJM A;  2FBW A;  2LEH A;  4JI0 T;  4DR6 T;  1D1A A;  3KV6 A;  2XAS B;  5L4E A;  1XWM A;  2D5U A;  1BR1 A;  2JIW A;  3UU5 A;  2CHO A;  3KV5 A;  3O1I A;  5FP3 A;  5KX5 E;  5LYJ E;  1HS7 A;  4X64 T;  4PJM A;  5F5W A;  2VWA A;  3PU8 A;  4ILU A;  1HF8 A;  4O4I E;  3JCF A;  3DTO A;  1SHZ C;  3EUH A;  4OHF A;  5JDN A;  4EIW A;  4EYY R;  3LBX A;  3KBU A;  3AAI A;  4X65 T;  2H88 A;  4YTN A;  3RIF A;  4HWH A;  3ZKR A;  5JQG E;  1HNX T;  1M62 A;  3MXZ A;  3C4X A;  2K48 A;  5FYM A;  3ZJ2 A;  1OED B;  2VVN A;  3UT5 E;  4ASK A;  5JDL A;  4CXY A;  4JEU B;  3AEG A;  3N5L A;  2DCF A;  3OKQ A;  3GWH A;  2Y48 B;  3T1Y T;  4PJJ A;  5E0O A;  4A97 A;  2L9Q A;  4CXX A;  4KUM B;  4I0U A;  4OYJ A;  5FL0 A;  2LHN A;  2KSR A;  2M6B A;  2JQQ A;  2EHO D;  3FBZ A;  3PUW F;  3Q2M A;  3T8O A;  4YY3 T;  3ZT6 A;  3KBT A;  2K24 A;  1HFA A;  4H9O C;  5IUX A;  5FMN A;  4NXM T;  3F2E A;  3N9Q A;  3N9O A;  4FI5 A;  4YSZ A;  2LOP A;  2BVL A;  1QSD A;  2W63 A;  3A5X A;  4AIU A;  3B13 A;  2FJA A;  3PE0 A;  2BS3 A;  4YSY A;  3AA6 B;  5LHI B;  4L5G A;  2WS3 A;  2EHO C;  5FVK A;  4TWH A;  3FZL B;  5ABH A;  4LFC T;  4AKI A;  4AKH A;  1XZY A;  3AA7 B;  4Z8X A;  3EVY A;  2AXD S;  2LOS A;  3LK4 2;  3I9W A;  1QLB A;  1W0A A;  3C4Z A;  2Z6E A;  3FZM B;  4MHC A;  4CN1 A;  2X0H A;  2IUB A;  2WQY A;  2XZE A;  3ZYK A;  4DR4 T;  4QH5 A;  1MMN A;  2CCQ A;  4Q25 A;  1OED C;  2OA5 A;  2UUB T;  3HA4 A;  3AEF A;  4DBQ A;  3I1A A;  4U31 A;  2YU1 A;  1UUS A;  4AQF C;  4JI7 T;  3CVR A;  5JR9 B;  5HWX A;  1WYC A;  2FUP A;  2SPC A;  5J2T E;  1US7 B;  1O3X A;  4IIJ E;  5HEO A;  2DLR A;  4KX6 A;  5LJM A;  2V1D B;  4YTP A;  3LJC A;  3HKE E;  4IDP A;  4KI0 F;  3P4S A;  3WI3 A;  3CX8 B;  5FY0 A;  2X9Y A;  4DR1 T;  2G0U A;  5FXZ A;  3PDY A;  1LRZ A;  4EZ4 A;  3CX6 B;  4DID B;  3ZEF B;  5LP6 E;  4ZXL A;  2VAS A;  4GK0 E;  1Y01 A;  3ZC0 A;  2CM0 A;  4IE7 A;  2UXD T;  4ZZB A;  4A56 A;  5HCJ A;  3C64 A;  4G63 A;  4GKK T;  1YQ3 A;  1OED E;  2XSA A;  3PUY F;  3RYC E;  2L3L A;  5FXW A;  4U74 A;  2Y8D A;  4GYS A;  3B57 A;  3VR9 A;  3PTR B;  3AA1 B;  5JRC A;  2BBH A;  1G73 A;  2UXX B;  3L8R A;  3KVA A;  1HNZ T;  1N32 T;  3ANW A;  2YIN A;  4LF9 T;  2CEA A;  4UIG A;  2IW5 B;  3FZH B;  1KK7 A;  1YQ4 A;  3CQC B;  4CI2 B;  2FJD A;  2CA5 A;  2JRK A;  4QX7 B;  5AQL B;  2XY8 B;  2LM2 A;  5FL1 A;  3MAC A;  5JR9 C;  2LSY A;  5HXC A;  3RYI E;  5AQG B;  5LBQ B;  2OLT A;  3AE8 A;  2J1D G;  2E9X A;  1V9D A;  3KVB A;  3O1J A;  3QB5 A;  5M4Y A;  3ZN1 B;  1ZP0 A;  3OYX A;  2M67 A;  2BVM A;  2E5L T;  3W15 B;  4DV2 T;  1MND A;  3RKO A;  4AIS A;  1R8I A;  2V7K A;  3J7Y q;  4JBW F;  4E7Z A;  4HFH A;  3MK7 C;  5HEH A;  2C5K T;  1ZOY A;  4X20 E;  4LF6 T;  3O9X A;  2WWU A;  5J1G A;  4HWF A;  4X1K E;  2KT9 A;  3WAJ A;  3Q5X A;  3SWH A;  5ADX L;  4H9Q C;  2H3R A;  3ZT7 A;  2X68 A;  2JPF A;  2ZM8 A;  1HX1 B;  4IE5 A;  4O8S A;  4XZC A;  4YJ2 E;  3EDU A;  2JJ9 A;  4PK5 A;  5HEJ A;  2HN1 A;  1J1J A;  1NEN A;  1UX5 A;  2FJE A;  2XM1 A;  4GOU A;  2ZM0 A;  4LMK A;  5JDM A;  2ZM2 A;  2XQ9 A;  3LBX B;  2UXN B;  4AQG A;  2VVS A;  3QC9 A;  4QH4 A;  2DHR A;  2WAU A;  5AQI B;  2WZH A;  3UUM A;  3ZN0 B;  1LVF A;  4C90 A;  4CN6 A;  2UXC T;  4WBN E;  2XQ7 A;  1OED A;  1KNP A;  4NPP A;  3M65 A;  3TLU A;  3I9Y A;  2K9A A;  4GIW A;  3JAD A;  4L0R A;  4O2B E;  2UUA T;  2IIU A;  4CZZ B;  1SE7 A;  5JDG A;  2H89 A;  2XSB A;  2HN2 A;  1VRB A;  2XTL A;  3LSV A;  2R6G F;  3NRX A;  1Y64 B;  2KND A;  4X1I E;  1D0X A;  3UUX B;  1WCR A;  4PNI A;  3ZMT B;  5LGT B;  3RC3 A;  1J5W A;  3UQ7 A;  2ACX A;  3PJA J;  2XQ5 A;  4JI2 T;  4HKA A;  1JNZ A;  2WY2 A;  4H9S E;  4IRE A;  1KF6 A;  4P09 A;  4LML A;  4EAH A;  1G8X A;  2LT3 A;  2XM2 A;  3LK3 B;  3PUR A;  4PFP A;  3TLV A;  2WZI A;  3ZJ1 A;  2WCA A;  4TUY E;  5TAO A;  5L3E B;  1XNQ T;  4NIQ A;  4QKN A;  4I55 E;  3RQU A;  3L39 A;  1D1B A;  1KFY A;  3UQ4 A;  4IE4 A;  5FKY A;  1ZEE A;  2BKO A;  2I59 A;  2V7I A;  3Q5W A;  3RIU A;  3SFE A;  3AE7 A;  3AE6 A;  4MLK A;  2WDR A;  4KMC A;  5ABF A;  1HG2 A;  2VKD A;  3HI2 A;  5DAB A;  3ZCJ A;  3G06 A;  2Y6X A;  1HR0 T;  4ISS A;  2QVA A;  4ILC A;  4EZH A;  2KMF A;  3RYH E;  3ESL A;  2XUE A;  4K0U A;  3RLF F;  1FMW A;  3ONL C;  3ZSS A;  3CIR A;  2NTX A;  3NRY A;  3PV0 F;  3GN5 B;  2BG9 A;  1X9B A;  2CE7 A;  3L09 A;  2V7J A;  5EK3 A;  4DVD A;  3TLW A;  3RC8 A;  2CMR A;  5JR9 A;  1W09 A;  5AQM B;  2D0U A;  5H6R B;  5KMG P;  3I0O A;  3RKG A;  4B3R T;  4JV5 T;  3FXE B;  1FIO A;  2A2F X;  4J2C A;  4BJN A;  4UVC B;  4DR2 T;  1HCI A;  4JI1 T;  2V26 A;  3ONX A;  2LHR A;  4MFR A;  3OJA A;  4B3S T;  1DU2 A;  1BR2 A;  4UEM A;  2LSI A;  3KIN B;  3AE5 A;  2YK0 A;  3NZQ A;  3P8C D;  3VR8 A;  2IML A;  3MA9 A;  3Q5E A;  4KHP T;  3N2K E;  4NUU A;  2XAJ B;  4IDO A;  5LMU T;  5LXT E;  2CWY A;  1KEY A;  2CXF A;  3AE9 A;  3EAM A;  3FZF B;  3HKD E;  4I43 B;  3AVS A;  4MAL A;  4DO0 A;  5KXJ A;  4IHJ E;  4CN4 A;  4PK6 A;  2MBG A;  3FHN A;  4HFI A;  3A7M A;  4YT0 A;  2KLQ A;  2LRL A;  4DV0 T;  5DQV A;  4ZEY A;  3AED A;  4IE6 A;  5LNK A;  3ZMZ B;  1YD8 G;  1EZ3 A;  4ZS3 A;  3E22 E;  4HTE A;  2H7V C;  2KWI B;  2V6Y A;  3ZCI A;  5JRC B;  3CX7 B;  3RGL A;  3RX6 A;  1WLX A;  4UF0 B;  2X0Y A;  4O4H E;  1T8B A;  5LB7 B;  2CHN A;  4BAY B;  4TV9 E;  3TLT A;  1SUM B;  3N9P A;  3Q9D A;  3ZMV B;  4UXN B;  2X9X A;  2BG9 C;  2W0G A;  3ZYL A;  1E7P A;  2VKJ A;  2D2S A;  4WNK A;  4COF A;  4ZHQ E;  4ZI2 C;  5HEG A;  3AAA B;  4GYR A;  3N2O A;  3RQW A;  5EK4 A;  3RH3 A;  3H37 A;  5AQN B;  4CI1 B;  2JQ9 A;  2LSJ A;  4PJN A;  1WR0 A;  3VRA A;  3GMI A;  2KXP B;  1ZHC A;  3D0T A;  3AEB A;  3K3N A;  5CA1 E;  4JI3 T;  5IWA T;  4DR3 T;  3CQX C;  3K1S A;  2DL1 A;  2YN6 A;  3UFG A;  4EB6 E;  3DP7 A;  1HTJ F;  2IDO B;  3JAF A;  2X9W A;  5GON E;  2N1G A;  4AQY T;  1W0B A;  2EHO A;  2NWB A;  3VU7 H;  2PJQ A;  4NXN T;  2W00 A;  3GA8 A;  3L3P A;  4UV9 B;  3ZYM A;  4AKR B;  4B3T T;  4TV8 E;  4CI3 B;  1OXZ A;  2C5J A;  5LGU B;  4NUV A;  3IEE A;  3FXD B;  2WMN A;  2CRB A;  3AE2 A;  3OYZ A;  1WRD A;  4HEA A;  4UF0 A;  5H6Q B;  1FMV A;  4KHZ F;  5JDH A;  4DR5 T;  3N9L A;  5CFB A;  1FJG T;  1IBK T;  5FY1 A;  2WP9 A;  3ZMS B;  1L0V A;  4HFB A;  3N9M A;  2VK9 A;  4IT4 A;  4TN7 B;  4F8H A;  4YFS A;  4ADZ A;  1U5P A;  3N9N A;  2BKP A;  3M3Z B;  4HGA A;  4JUY A;  4JI5 T;  3ZST A;  2VQE T;  1UK5 A;  4KP3 C;  2BBJ A;  4YJ3 E;  5JH7 E;  4EV6 A;  4DV6 T;  2UU9 T;  1FEW A;  2XQ3 A;  4H63 V;  4TWD A;  4Z90 A;  5AQT B;  2BS2 A;  5L47 A;  4U7I A;  4OX9 T;  1I6Z A;  4I50 E;  3SRZ A;  3ZMU B;  5L4H A;  3HKB E;  3K8P C;  4DV1 T;  5AQK B;  5AQQ B;  1OWA A;  4U72 A;  3VKH A;  3AEA A;  3TLS A;  3HR0 A;  2ES0 A;  3QK6 A;  2QGS A;  3C98 B;  4H9P C;  2KWH A;  1QUU A;  5DQW A;  4U3C A;  2NW8 A;  1D1C A;  3QOF A;  4M1P A;  3LDQ B;  2BKN A;  2FJB A;  1SA0 E;  2Q9Q C;  3UUN A;  2D0T A;  1UCU A;  3NZP A;  5ABF B;  4ANJ A;  5JDQ A;  2I0M A;  4X66 T;  3ANW B;  2PFV A;  5FY7 A;  5LHH B;  4LFB T;  2YOE A;  5C2T A;  4O4J E;  2WBL A;  3SS1 A;  4UV8 B;  5FXV A;  4TZ4 C;  4WYV A;  2LLY A;  3BK9 A;  5LG3 A;  5LHG B;  4DV4 T;  2XAF B;  2VL0 A;  4I4T E;  1D0Z A;  2XQ6 A;  4DBR A;  4TWF A;  5J0Z A;  3IBP A;  4DUZ T;  4QWN B;  2Q9Q D;  2RP4 A;  2B76 A;  2YDR A;  3EDV A;  3JAE A;  3QNU A;  5JVD E;  4CXW A;  3AE3 A;  5L3F B;  2V7M A;  1T72 A;  2V8S V;  2XAQ B;  3AXJ A;  3BQL A;  1YW0 A;  5LOV E;  4U33 A;  3RHW A;  3IF8 B;  4DUY T;  1YKE B;  3S4U A;  4JYA T;  3U78 A;  2PBI A;  5LA6 E;  4DV7 T;  2MYS A;  4XBF B;  1MMA A;  1VOM A;  2E8I A;  3F57 A;  2A3D A;  1T7S A;  2XAH B;  5LJN A;  3LK2 B;  2HPL A;  2WB5 A;  3OBV E;  4YTM A;  4HWD A;  4ILA A;  3OPC A;  2W67 A;  2LKG A;  4PJL A;  3KFW X;  3RPU A;  3K3O A;  5EZY E;  2V5C A;  3CK6 A;  2XJ7 A;  1KNR A;  1S94 A;  3AVR A;  1ZV4 X;  2JMH A;  2L8K A;  1MIV A;  2WMO A;  4X1Y E;  5HWY A;  5F3J A;  4B6X A;  2X67 A;  3J9X 1;  1UX4 A;  4EGW A;  2RA1 A;  3C51 A;  4GK5 E;  3FB2 A;  1GQE A;  2X66 A;  3P50 A;  3UU4 A;  1I94 T;  2J62 A;  2QA7 A;  3PU3 A;  4DR7 T;  3N2G E;  4LF8 T;  2CXL A;  4KBM B;  4HWC A;  2GK9 A;  1NAF A;  2NP9 A;  4H63 H;  3UUL A;  1MMG A;  3OTO T;  1H7C A;  2XHE B;  3GN5 A;  4PAG A;  4EYU A;  4P0B A;  5AQR B;  2E9X C;  4E7S A;  5HXH A;  2IHR 1;  3UFE A;  4QH1 A;  3KV4 A;  2LE8 A;  2RPA A;  3FZK B;  4TNV A;  5CGM A;  3E0Z A;  4UVB B;  2CBI A;  1JNR A;  2WU2 A;  3IA3 A;  5IHY A;  5HYA A;  1UGO A;  5JRE A;  2IAK A;  4AKL A;  4H9N C;  5DJQ C;  4EXT A;  2HHH T;  1IJ6 A;  2CWO A;  3KDS E;  2AE9 A;  1S35 A;  2XQ8 A;  3AB3 B;  3DJB A;  3O4X E;  4X5T A;  3MKD A;  5KDM C;  2MPK A;  2LKH A;  3EI0 A;  3EAB A;  1NWM X;  4TX5 A;  2XQA A;  4N78 D;  1X79 A;  2E9X D;  4HFE A;  5L3B B;  5F8P A;  2JQH A;  2N2N A;  4IDQ A;  4ZI2 D;  2X9H A;  4U2Y A;  4PK4 A;  3ZC1 A;  3C4W A;  1XMO T;  4PW8 A;  1XNR T;  2HH7 A;  3LG7 A;  3E08 A;  3ZT5 A;  4YHJ A;  4HFD A;  2XQ4 A;  4BA9 A;  4ZZC A;  2JMK A;  2OV9 A;  4IE0 A;  5L3G B;  4JI6 T;  2VKH A;  2F4V T;  1T98 A;  2VUR A;  4UEL A;  3CKD A;  2UUC T;  2I6H A;  3UU8 A;  5C3J A;  3R84 B;  1YXR A;  3U3I A;  3AA0 B;  4O4L E;  2IC6 A;  5AQP B;  2XAG B;  3PUA A;  4HWI B;  4YXD A;  4DV3 T;  2V6Y B;  2BG9 B;  2J47 A;  3RIU C;  4AKG A;  2WM9 A;  3KV9 A;  4U7Y A;  4DMV A;  5JTG A;  2LJL A;  2W66 A;  4ZI3 C;  4ERR A;  4DV5 T;  4LFA T;  2E5V A;  1XDP A;  2UXB T;  2KZ7 B;  3PUV F;  3X1D A;  3AE1 A;  2PG8 A;  2J4G A;  3RRW A;  5FNV E;  2YKS A;  4QHO A;  3RI5 A;  1CHU A;  4AXP A;  2QRX A;  5J2U E;  5BMV E;  4AQF A;  4LF5 T;  5CA0 E;  3HL6 A;  3MJX A;  2NOX A;  5ETW A;  2ODV A;  4XAX B;  3WAK A;  3V5S A;  3P4Q A;  2LSG A;  2ZLY A;  3TKL B;  2LRK A;  4G2A A;  5AFU L;  3SFD A;  2DI4 A;  5L2L A;  2NW7 A;  4LF7 T;  5HCM A;  2C0S A;  3PUZ F;  1WFD A;  1VCS A;  1D0Y A;  2EHO B;  5AQS B;  5AQU B;  1N36 T;  4Z91 A;  2BZB A;  4ZS2 A;  5A1L A;  5ABE A;  1LKX A;  4AI6 A;  3LFM A;  1UUR A;  3P4W A;  3H3M A;  3NBX X;  2ZM6 T;  3B5M A;  4EED A;  2PTF A;  3NVO A;  2H7O A;  2CPT A;  2W4X A;  2YDQ A;  3A8Y C;  2MOZ A;  5CB4 E;  3UU3 A;  3V5U A;  5L3D B;  4P1N A;  5HXS A;  2DWK A;  5IYZ E;  1IBL T;  1BR0 A;  2Q9Q A;  5FVL A;  5AQF B;  2ODU A;  3I0Q A;  3RRC A;  4ILB A;  4JI8 T;  5AQO B;  2WDQ A;  3IHR A;  3RF1 A;  3ABV A;  4O2A E;  3AXJ B;  2DWG A;  4IGU A;  4UR9 A;  5HXE A;  3BQI A;  2VB6 A;  3OVU A;  4WZX A;  3RYF E;  2X0L B;  3HKC E;  4EEB A;  4ZI7 E;  2QYW A;  2WSS V;  3NKZ A;  2MTQ A;  2P9B A;  4DMW A;  2VQF T;  2XQY A;  3T1H T;  4QXH B;  4C91 A;  5HXR A;  4LF4 T;  3EHZ A;  4U2Z A;  1HNW T;  5AQJ B;  1M7K A;  1LVK A;  1E1H B;  2D9D A;  1W9R A;  4IL9 A;  4HE8 A;  4PFO A;  3P7I A;  4V1A v;  4B3M T;  2DNX A;  2X51 A;  4ZI3 D;  1XMQ T;  4IDN A;  2A9U A;  3O1H A;  2NTY A;  5CJ5 A;  4EOZ B;  5AQV B;  3Q5D A;  4LMJ A;  5JDF A;  4P0A A;  2ZMA A;  3P4R A;  3K3Q C;  2NW9 A;  2W62 A;  3BQK A;  3UU6 A;  4A5X A;  2VKO A;  4TNW A;  4ZOL E;  3UTK A;  3F31 A;  2IC9 A;  2V6X A;  2CLY C;  1CUN A;  5LBM A;  4L9I A;  1J5E T;  5LG4 A;  1MIY A;  3CML A;  3P4P A;  1B7T A;  3RIA A;  5BR8 T;  4JI4 T;  4FJO A;  4H9R C;  2LSK A;  2Q9Q B;  4F6R C;  1Z8U A;  3MZK B;  3PUQ A;  1E2A A;  3ZLI A;  1N33 T;  2M6I A;  2V5D A;  4OFZ A;  4QXC B;  2E9X B; 
#chains in the Genus database with same CATH homology
 1MMD A;  1BR4 A;  4WW0 A;  4YLH A;  1KNZ A;  1YKH B;  1IZN B;  2LM9 A;  1IJ5 A;  5FXX A;  1HG5 A;  3SOL A;  5LGN B;  3QUJ A;  2N9D A;  2A72 A;  1IAP A;  2K5B B;  1MIW A;  3CPZ A;  2C5I T;  2CXD A;  4MBQ A;  3R6N A;  4JEH B;  5EK2 A;  2HPJ A;  5LCY A;  3PUS A;  1MNE A;  4OYK A;  3C50 A;  4OK0 A;  3VHL A;  3ETU A;  3PUG A;  4CQI A;  3CWZ B;  2VL8 A;  3H3A A;  1Z0P A;  4WBO A;  3CQG B;  3FBL A;  2W61 A;  4IST A;  2BDE A;  2V7L A;  4HN9 A;  1WYB A;  3ZPO A;  3JC6 D;  1U4Q A;  2YU2 A;  4QXB B;  1WR6 A;  2KIN B;  4QX8 B;  4HFV A;  3VKG A;  3ETV A;  4IDZ A;  4UVA B;  1AJ3 A;  5L3C B;  5C8Y E;  4DND A;  2YEV C;  1HX8 A;  3AAE B;  3JC6 C;  2B1E A;  2CLY B;  1ZKE A;  4JLE A;  4BJM A;  5HAX A;  2LEH A;  1D1A A;  3KV6 A;  2XAS B;  2D5U A;  1BR1 A;  5KX5 E;  3O1I A;  3KV5 A;  5FP3 A;  5LYJ E;  1HS7 A;  4PJM A;  2VWA A;  3PU8 A;  4ILU A;  1HF8 A;  4O4I E;  4OHF A;  3DTO A;  1SHZ C;  3EUH A;  5JDN A;  4EIW A;  4EYY R;  3LBX A;  3KBU A;  3AAI A;  5JQG E;  3MXZ A;  3C4X A;  2K48 A;  5FYM A;  3ZJ2 A;  3UT5 E;  4ASK A;  5JDL A;  4CXY A;  4JEU B;  3N5L A;  2DCF A;  3OKQ A;  3GWH A;  2Y48 B;  4PJJ A;  5E0O A;  2L9Q A;  4CXX A;  4KUM B;  4OYJ A;  2LHN A;  2JQQ A;  2EHO D;  3FBZ A;  3T8O A;  3Q2M A;  3KBT A;  2K24 A;  1HFA A;  4H9O C;  5FMN A;  3F2E A;  3N9Q A;  3N9O A;  4FI5 A;  2LOP A;  2BVL A;  1QSD A;  2W63 A;  3A5X A;  3B13 A;  3PE0 A;  3AA6 B;  5LHI B;  4L5G A;  2EHO C;  4AKI A;  4AKH A;  3AA7 B;  4Z8X A;  3EVY A;  3LK4 2;  2LOS A;  3I9W A;  3C4Z A;  2Z6E A;  4MHC A;  3ZYK A;  1MMN A;  2CCQ A;  2OA5 A;  3HA4 A;  4DBQ A;  3I1A A;  2YU1 A;  4AQF C;  3CVR A;  5JR9 B;  5HWX A;  1WYC A;  2SPC A;  5J2T E;  1US7 B;  1O3X A;  4IIJ E;  5LJM A;  2DLR A;  2V1D B;  3LJC A;  3HKE E;  3WI3 A;  3CX8 B;  5FY0 A;  2X9Y A;  2G0U A;  5FXZ A;  3PDY A;  1LRZ A;  4EZ4 A;  3CX6 B;  3ZEF B;  2VAS A;  4GK0 E;  3ZC0 A;  2CM0 A;  4IE7 A;  4A56 A;  3C64 A;  4G63 A;  3RYC E;  2L3L A;  5FXW A;  4U74 A;  2Y8D A;  4GYS A;  3B57 A;  3PTR B;  3AA1 B;  5JRC A;  1G73 A;  2UXX B;  3KVA A;  3ANW A;  2YIN A;  2CEA A;  4UIG A;  2IW5 B;  1KK7 A;  3CQC B;  4CI2 B;  2JRK A;  2CA5 A;  4QX7 B;  5JR9 C;  3MAC A;  2LSY A;  5HXC A;  3RYI E;  5LBQ B;  2J1D G;  2E9X A;  1V9D A;  3KVB A;  3O1J A;  5M4Y A;  3ZN1 B;  3OYX A;  2M67 A;  2BVM A;  3W15 B;  1MND A;  3RKO A;  2V7K A;  3J7Y q;  4E7Z A;  3MK7 C;  2C5K T;  4X20 E;  3O9X A;  2WWU A;  5J1G A;  4X1K E;  2KT9 A;  3WAJ A;  3Q5X A;  3SWH A;  5ADX L;  4H9Q C;  2H3R A;  2X68 A;  2JPF A;  2ZM8 A;  4IE5 A;  4O8S A;  4XZC A;  4YJ2 E;  5CA0 E;  3EDU A;  2JJ9 A;  4PK5 A;  1UX5 A;  4GOU A;  5JDM A;  2ZM0 A;  2ZM2 A;  3LBX B;  4AQG A;  2UXN B;  3QC9 A;  2DHR A;  2WAU A;  3UUM A;  3ZN0 B;  4C90 A;  1LVF A;  4WBN E;  3M65 A;  3I9Y A;  2K9A A;  4GIW A;  4L0R A;  4O2B E;  4CZZ B;  5JDG A;  1VRB A;  2XTL A;  3NRX A;  1Y64 B;  2KND A;  4X1I E;  1D0X A;  3UUX B;  4PNI A;  3ZMT B;  5LGT B;  3RC3 A;  2ACX A;  4HKA A;  4H9S E;  4P09 A;  4EAH A;  1G8X A;  2LT3 A;  3LK3 B;  3PUR A;  4PFP A;  3ZJ1 A;  5L3E B;  4TUY E;  5TAO A;  4QKN A;  4I55 E;  1D1B A;  4IE4 A;  1ZEE A;  2I59 A;  2V7I A;  3Q5W A;  4MLK A;  4KMC A;  1HG2 A;  2VKD A;  3HI2 A;  5DAB A;  3ZCJ A;  2Y6X A;  4ISS A;  4EZH A;  2KMF A;  3RYH E;  3ESL A;  2XUE A;  4K0U A;  1FMW A;  5LP6 E;  2NTX A;  3NRY A;  3GN5 B;  5EK3 A;  3RC8 A;  2CE7 A;  3L09 A;  2V7J A;  4DVD A;  2CMR A;  5JR9 A;  5H6R B;  2D0U A;  5KMG P;  3I0O A;  3FXE B;  1FIO A;  2A2F X;  4J2C A;  4BJN A;  4UVC B;  1HCI A;  2V26 A;  3ONX A;  2LHR A;  4MFR A;  3OJA A;  1BR2 A;  4UEM A;  2LSI A;  3KIN B;  2YK0 A;  3NZQ A;  3P8C D;  3MA9 A;  3N2K E;  4NUU A;  2XAJ B;  5LXT E;  2CWY A;  2CXF A;  4I43 B;  3HKD E;  3AVS A;  4MAL A;  4DO0 A;  4IHJ E;  4PK6 A;  2MBG A;  3FHN A;  2KLQ A;  5DQV A;  4IE6 A;  5LNK A;  3ZMZ B;  1YD8 G;  1EZ3 A;  4ZS3 A;  3E22 E;  4HTE A;  2H7V C;  2KWI B;  3ZCI A;  5JRC B;  3CX7 B;  3RX6 A;  4EOZ B;  1WLX A;  4UF0 B;  4O4H E;  4BAY B;  4TV9 E;  3N9P A;  3Q9D A;  3ZMV B;  4UXN B;  2X9X A;  2W0G A;  3ZYL A;  2VKJ A;  2D2S A;  4WNK A;  4ZHQ E;  4ZI2 C;  3AAA B;  4GYR A;  3N2O A;  5EK4 A;  3RH3 A;  3H37 A;  4CI1 B;  2LSJ A;  4PJN A;  3GMI A;  2KXP B;  1ZHC A;  3D0T A;  5CA1 E;  3K3N A;  3CQX C;  4EB6 E;  3DP7 A;  1HTJ F;  2X9W A;  5GON E;  2N1G A;  2EHO A;  2NWB A;  3VU7 H;  2PJQ A;  2W00 A;  3GA8 A;  3L3P A;  4UV9 B;  3ZYM A;  4AKR B;  4TV8 E;  4CI3 B;  1OXZ A;  2C5J A;  5LGU B;  4NUV A;  3IEE A;  3FXD B;  2WMN A;  3OYZ A;  4HEA A;  5H6Q B;  1WRD A;  4UF0 A;  5JDH A;  1FMV A;  3N9L A;  5FY1 A;  3ZMS B;  3N9M A;  2VK9 A;  4TN7 B;  4YFS A;  4ADZ A;  1U5P A;  3N9N A;  4HGA A;  4JUY A;  4KP3 C;  4YJ3 E;  5JH7 E;  1FEW A;  4H63 V;  4I50 E;  3SRZ A;  3ZMU B;  3HKB E;  3K8P C;  1OWA A;  4U72 A;  3VKH A;  3HR0 A;  2ES0 A;  3QK6 A;  2QGS A;  3C98 B;  4H9P C;  2KWH A;  1QUU A;  5DQW A;  2NW8 A;  1D1C A;  4M1P A;  1SA0 E;  2Q9Q C;  3UUN A;  2D0T A;  1UCU A;  3NZP A;  5JDQ A;  4ANJ A;  3ANW B;  2PFV A;  5FY7 A;  5LHH B;  4O4J E;  2WBL A;  3SS1 A;  4UV8 B;  5FXV A;  4TZ4 C;  3BK9 A;  5LHG B;  2XAF B;  4DBR A;  4I4T E;  1D0Z A;  3IBP A;  4QWN B;  2Q9Q D;  2RP4 A;  3EDV A;  5JVD E;  4CXW A;  5L3F B;  2V7M A;  2XAQ B;  3BQL A;  1YW0 A;  5LOV E;  3IF8 B;  1YKE B;  3S4U A;  3U78 A;  2PBI A;  5LA6 E;  2MYS A;  4XBF B;  1MMA A;  1VOM A;  3F57 A;  2E8I A;  2A3D A;  2XAH B;  5LJN A;  3LK2 B;  2HPL A;  3OBV E;  4PJL A;  3KFW X;  3RPU A;  3K3O A;  5EZY E;  1S94 A;  3AVR A;  1ZV4 X;  2JMH A;  2L8K A;  1MIV A;  2WMO A;  4X1Y E;  5HWY A;  5F3J A;  4B6X A;  2X67 A;  3J9X 1;  1UX4 A;  2RA1 A;  3C51 A;  4GK5 E;  3FB2 A;  2X66 A;  2QA7 A;  3PU3 A;  3N2G E;  2CXL A;  4KBM B;  2GK9 A;  1NAF A;  2NP9 A;  4H63 H;  3UUL A;  1MMG A;  1H7C A;  2XHE B;  3GN5 A;  4PAG A;  4EYU A;  4P0B A;  4E7S A;  2E9X C;  5HXH A;  3UFE A;  3KV4 A;  2LE8 A;  3E0Z A;  4UVB B;  5IHY A;  5HYA A;  5JRE A;  2IAK A;  4AKL A;  4H9N C;  5DJQ C;  4EXT A;  1IJ6 A;  2CWO A;  3KDS E;  1S35 A;  3AB3 B;  3O4X E;  3DJB A;  3MKD A;  5KDM C;  4TX5 A;  1NWM X;  4N78 D;  1X79 A;  2E9X D;  5L3B B;  5F8P A;  2N2N A;  4ZI2 D;  2X9H A;  3ZC1 A;  4PK4 A;  3C4W A;  4PW8 A;  2HH7 A;  3LG7 A;  3E08 A;  4YHJ A;  4BA9 A;  5L3G B;  2JMK A;  4IE0 A;  2VKH A;  1T98 A;  4UEL A;  3CKD A;  3R84 B;  3U3I A;  3AA0 B;  4O4L E;  2IC6 A;  2XAG B;  3PUA A;  4AKG A;  2WM9 A;  3KV9 A;  4DMV A;  2LJL A;  4ZI3 C;  4ERR A;  2KZ7 B;  2PG8 A;  3RRW A;  5FNV E;  4QHO A;  4AXP A;  5J2U E;  5BMV E;  4AQF A;  3HL6 A;  3MJX A;  2NOX A;  5ETW A;  2ODV A;  4XAX B;  3WAK A;  3V5S A;  2LSG A;  2ZLY A;  3TKL B;  4G2A A;  5L2L A;  2DI4 A;  2NW7 A;  2C0S A;  1D0Y A;  2EHO B;  2BZB A;  4ZS2 A;  5A1L A;  1LKX A;  4AI6 A;  3LFM A;  3NBX X;  2H7O A;  5CB4 E;  2MOZ A;  3V5U A;  5L3D B;  5HXS A;  2DWK A;  5IYZ E;  1BR0 A;  2Q9Q A;  2ODU A;  3I0Q A;  3RRC A;  3IHR A;  5HXE A;  4O2A E;  2DWG A;  4IGU A;  3BQI A;  2VB6 A;  3RYF E;  2X0L B;  3HKC E;  4ZI7 E;  2WSS V;  2MTQ A;  2P9B A;  4DMW A;  2XQY A;  4QXH B;  4C91 A;  5HXR A;  1LVK A;  1E1H B;  4PFO A;  4V1A v;  4HE8 A;  3P7I A;  2DNX A;  2X51 A;  4ZI3 D;  3O1H A;  2NTY A;  5JDF A;  4P0A A;  2ZMA A;  3K3Q C;  2NW9 A;  2W62 A;  3BQK A;  5AFU L;  2VKO A;  3UTK A;  4ZOL E;  3F31 A;  2IC9 A;  2CLY C;  1CUN A;  5LBM A;  4L9I A;  5LG4 A;  1MIY A;  3CML A;  1B7T A;  4FJO A;  4H9R C;  2LSK A;  2Q9Q B;  4F6R C;  3PUQ A;  3MZK B;  3ZLI A;  4OFZ A;  4QXC B;  2E9X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...