3CX6B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
185
Chain Sequence
LIIGPEEESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein alpha-13 subunit
publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 185
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx6B00
3AB3B 3C4ZA 3QC9A 3C50A 3CX7B 1SHZC 3CX6B 2A72A 3C4XA 3C4WA 4IGUA 1IAPA 2I59A 2ES0A 2PBIA 4GOUA 3CX8B 4WBOA 2DLRA 4PNIA 1ZV4X 1HTJF 4YHJA 3C51A 4L9IA 3T8OA 4WNKA 2ACXA
chains in the Genus database with same CATH superfamily
4CN6A 2DWGA 2WU5A 2KWIB 2A9UA 2VL0A 3EAMA 3L09A 4IGUA 4YFSA 2WDRA 4N78D 4DMWA 2XASB 2D9DA 2CLYC 2LSJA 4TNVA 5LCYA 5JDQA 2VKJA 4X20E 4GK0E 2XQ3A 1X79A 4QXCB 2J47A 5AQPB 4DV2T 2NTYA 3AAAB 5L3GB 5AQJB 2NW7A 3AE7A 3CPZA 2V5DA 3PJAJ 4JEHB 3JADA 4WW0A 5TAOA 3UQ7A 3B57A 2G0UA 3H37A 5H6RB 3Q9DA 5ETWA 4DMVA 4TUYE 3AEGA 4ZI3C 3AE2A 3AE6A 4NUVA 5JDGA 3GMIA 5FXWA 3C50A 3R6NA 4A56A 3TLUA 1ZP0A 4PK5A 4UEMA 4PNIA 3RIAA 4Q25A 5J0ZA 3AEDA 2LRLA 4UVBB 3EABA 5AQFB 3FZFB 1WYCA 4U7IA 3OKQA 4OX9T 1I6ZA 4DR5T 3KDSE 2V7IA 4E7ZA 1D0YA 3T1HT 4YSXA 3SFDA 2XQYA 4IDQA 3UUBA 5CGMA 2W67A 3CKDA 1UX4A 1LVFA 4MLKA 1B7TA 5LA6E 3EI0A 3ZMZB 3RX6A 4PJMA 4EGWA 5M4YA 5FXZA 1VCTA 2HN2A 2I0MA 2YK0A 4Z8XA 1N34T 4PJJA 3LBXA 4HFVA 3P50A 2BBJA 2OV9A 4DIDB 1R8IA 4EZHA 4U33A 4ZI3D 4TWDA 4JI4T 2LHNA 5LHGB 3N9QA 4ASKA 1OEDB 4U2ZA 4AKLA 2Y48B 1HNWT 5J1GA 5JRCB 2JQKA 2CMRA 3PV0F 2NW8A 3P4SA 3CX8B 3G06A 3NBXX 2NOXA 1S35A 3F2EA 2X0HA 3I0OA 2MAWA 4H9NC 5LMUT 2LKHA 1XMQT 3VRBA 2MBGA 5KDMC 3RQUA 3SRZA 3E08A 4DR1T 2YDQA 3AVRA 2EHOB 2XQ9A 1WFDA 3KFWX 1WYBA 4LF8T 2LLYA 3ZEFB 4H9OC 5ABFA 5JREA 2N2NA 3CX7B 3KV9A 4UVCB 4KP3C 5J2TE 1NWMX 4QWNB 2BG9B 3K3QC 4O2BE 2D0TA 2C5JA 2Y8DA 2WDQA 4ILAA 3GWHA 1JNRA 4X65T 2X51A 2XAJB 2PTFA 3AE4A 3ZCJA 2OA5A 3TKLB 5JDLA 3RI5A 3ANWA 5L4HA 2X66A 4UELA 3KINB 1WCRA 3B13A 4BJNA 3HKBE 4PAGA 4U74A 3LJCA 1XDOA 3I1AA 2YEVC 2DHRA 1KNRA 3CQCB 4B3RT 4GIWA 3TLWA 3QK6A 2CA5A 4GKJT 4X1IE 2VQET 4H9SE 4K0UA 3Q5EA 3U78A 4UIGA 4P09A 4YJ3E 4YTMA 3VR9A 2NP9A 4CI3B 2LSGA 5LBMA 1MMGA 5LJNA 2BVMA 3J7Yq 2QGSA 4JV5T 4IL4A 3J9X1 5HEHA 3N2OA 4NXNT 1MMDA 4IDNA 3AE1A 4KMCA 3OJAA 4ERRA 5LGTB 1HX8A 4QXHB 2LM9A 2E5VA 2XQ8A 5LYJE 2YU1A 5HCJA 4BAYB 4DV6T 2V6YB 1JNZA 1L0VA 3N9MA 4ADZA 4YSYA 2CE7A 3LSVA 4WBNE 4ZHQE 3RGLA 2ODUA 2XQ4A 3ZC0A 3PUVF 4ANJA 1H7CA 2D0UA 5FYMA 4QXBB 5ADXL 2NW9A 4HFIA 4O4IE 5L3EB 3VR8A 5JVDE 5HEJA 4HGAA 5FP3A 5LGUB 4A5XA 1XNRT 5AQHB 3LBXB 3ZMTB 4ZXLA 4TWFA 4HFCA 4TNWA 4CZZB 2ZM2A 3PJAA 3VKHA 3WAJA 4JEUB 4LF9T 3K8PC 4UV9B 3P7IA 5F5WA 1BR1A 3RKOA 4AKHA 2BKNA 4J2CA 4JI7T 4DV4T 1D0ZA 3ZMSB 2V6XA 4P0AA 3T1YT 3KV4A 2XZEA 3F57A 2CXFA 3LK3B 3AEEA 1OWAA 2ES0A 3RQWA 4G2AA 3ZYMA 2WCAA 3UU8A 4U31A 5ABFB 4YJ2E 1OEDE 4H63V 4AIUA 3H3AA 3WAKA 4JI1T 2V7KA 1D1BA 4YLHA 5CB4E 3ZKRA 2K3WA 1J5ET 2LSIA 2H89A 2WAUA 2HPJA 1YKHB 4NUUA 3HKDE 4JI8T 2VK9A 1MIYA 4IE6A 5EZYE 4YT0A 2XPKA 2WZHA 4HFHA 3O9XA 1EZ3A 1HG2A 3ETVA 3GN5A 3LDQB 4MHCA 3NVOA 3Q5DA 1KF6A 1N33T 2CCQA 5LNKA 4HWIB 5L47A 1FEWA 3ONJA 5DQVA 4HEAA 3ZLIA 2KMFA 3MACA 3LG7A 3RKGA 5AQNB 3TLSA 5FVLA 4BJMA 2E9XC 2X9WA 3C51A 2XQAA 4ZS3A 1ZKEA 2LE8A 1W0AA 2L9QA 4HTEA 5IUXA 1Y64B 2JPFA 3AE8A 4UR9A 4B3MT 4COFA 2LSYA 4XBFB 5JR9B 2W4XA 3JC6C 4O4LE 4TN7B 3OTOT 4XAXB 2ZM0A 2WBLA 1ZHCA 4H9RC 2PFVA 4DO0A 2CWYA 4X1YE 2IC9A 1T98A 3AE5A 5EK2A 4X1KE 1MIVA 1HTJF 2E5LT 4A98A 4OHFA 1W09A 3O1JA 4DVDA 3AA7B 3UU5A 2XAHB 3ESLA 2KXPB 3WI3A 3AXJA 3BQIA 2PG8A 3ZYKA 2BS2A 3UU6A 2BDEA 4K0KT 3FXDB 4JYAT 3AEFA 3X1DA 1I94T 3VU7H 1LVKA 3VHLA 5AQMB 5CJ5A 4B3TT 1M7KA 2KT9A 2YOEA 5GONE 3L39A 2E9XD 5DJQC 4X62T 3PUGA 4A97A 5LGNB 3E22E 1ZV4X 3NZQA 1J5WA 4AISA 4O2AE 3N5LA 5AQVB 4UF0A 3JC6D 2WY2A 3TLTA 4JI6T 1MMAA 4JUYA 4YTPA 5HXSA 2CEAA 2NTXA 1KEYA 1N32T 2UXDT 4L5GA 4PJLA 4WBOA 2WWUA 1Z8UA 3FHNA 3QUJA 2Z6EA 2LHRA 1XMOT 4LFBT 3PUAA 5HEOA 5FXVA 3CQXC 2XSAA 1UX5A 3UUXB 4AKIA 5FY1A 5AFUL 3MZKB 3V5UA 4AKRB 2H88A 1BR4A 1SE7A 1VCSA 3UFEA 3HR0A 5C8YE 2PJQA 2K5BB 1KNPA 2ZM6T 1KK7A 2UUCT 1Y01A 2WU2A 2H7OA 3UT5E 4WYVA 4JI5T 4FJOA 3P4RA 2DL1A 3N9OA 1YQ4A 3AAEB 3P4QA 3NRYA 3PU3A 3FZMB 4IDZA 2ODVA 2B76A 4MFRA 2A72A 3RYIE 4LFCT 3RLFF 3IEEA 3K3OA 2WMNA 1BR2A 1MNEA 1W9RA 1IZNB 2Q9QC 2XJ7A 5JDMA 4H63H 4IE5A 4DR4T 5FY0A 2E9XA 3MXZA 5ABHA 3ZN1B 3ONLC 1Z0PA 2LM2A 5H6QB 3E0ZA 2CM0A 4ZI2C 1HF8A 2V7JA 3FB2A 3GN5B 3UFGA 1E7PA 1NEKA 4JLEA 3RPUA 2MOZA 4UV8B 1WLXA 2AE9A 5JH7E 4H9QC 1OEDC 3AA0B 2I59A 5HXCA 3S4UA 5FXXA 3EDVA 4IL9A 3KVAA 4FI5A 5A1LA 4G63A 3M3ZB 3KVBA 2ACZA 2HHHT 2IC6A 5L2LA 4LFAT 4AI6A 4GKKT 3ETUA 2J1DG 5AQQB 5LP6E 4LMJA 4WNKA 2YDRA 5LG3A 3FZHB 2EHOC 2Q9QD 2W63A 2LRKA 3OYXA 2LOSA 4TZ4C 3HA4A 2V1DB 3LFMA 3C4XA 4QH5A 5HYAA 3FXEB 3MA9A 4I50E 3C98B 2PBIA 2MYSA 5AQSB 5LHHB 4UVAB 3ZT7A 3ZN0B 2IUBA 4PFOA 1O3XA 2VKHA 3QB5A 4ILBA 2BG9C 2YKSA 4ZI2D 4M1PA 3SFEA 4AQYT 3ZSTA 3P4PA 2D5UA 2IW5B 5LJMA 2XY8B 4EEDA 4IREA 2V7MA 1UK5A 3CQGB 1ZOYA 3RRCA 5LBQB 3RYHE 2ZMAA 1SA0E 3EVYA 3KV5A 4OYKA 1D1CA 5BMVE 4NIQA 4QX7B 3JAEA 3Q5WA 5IHYA 5JQGE 2KNDA 4CI2B 2VURA 5FNVE 3JAFA 4EAHA 4DNDA 5HCMA 4UF0B 2KINB 2V5CA 3BQKA 4JI3T 4DUYT 3K3NA 2CXLA 3RIUC 2YDSA 2UUBT 2DLRA 4QH1A 4DV0T 2EHOD 4PK6A 2XM2A 2XQ6A 4L9IA 4HWHA 2ACXA 2JJ9A 1US7B 3N9PA 3H3MA 4ILCA 3RYFE 4IDPA 3TLVA 2CXDA 2VL8A 2QVAA 1IBMT 4X5TA 3UU4A 1XWMA 2FJDA 1YW0A 2L3LA 2FJAA 3L3PA 5FKYA 2Q9QA 1IJ5A 2J4GA 2N1GA 3P8CD 5AQIB 1HNXT 4JI0T 5HEGA 2OLTA 3MK7C 3UULA 5JDHA 4DR7T 4EV6A 2FUPA 1LKXA 5L4EA 5LMNT 1VRBA 5KX5E 4IT4A 1N36T 5ABGA 3AB3B 1E1HB 3MJXA 2YINA 1WR6A 5DABA 2VKDA 4F8HA 3ZT6A 2RA1A 1QSDA 4ZI7E 3CWZB 1OEDA 4YSZA 2VWAA 5KMGP 2XHEB 2W66A 3CIRA 4DV7T 4KBMB 2XUEA 3RYCE 4HFDA 3EDUA 3BQLA 4HKAA 2AXDS 2WZIA 5L3DB 4IE0A 1KNZA 3EHZA 3K1SA 3AE3A 2MPKA 3DJBA 2CLYB 2LKGA 2BZBA 2BS4A 4EIWA 4WZXA 3SWHA 2CRBA 2CPTA 2EHOA 4GOUA 3M65A 1ZEEA 4E7SA 3OYZA 3FZKB 4PK4A 5LHIB 3OPCA 4CXXA 3I9YA 3ANWB 1FJGT 2R6GF 5F3JA 4EYUA 2CBIA 2X9YA 3PU8A 3AE9A 4DR3T 2A3DA 1HFAA 2WP9A 2BG9E 4BA9A 2WSSV 1S94A 2N9DA 5C2TA 2X0YA 3CX6B 4U7YA 5FL0A 2CBJA 4EB6E 1UCUA 1G8XA 2JQ9A 3SOLA 1DU2A 2I6HA 2Y6XA 4P1NA 3PUYF 2KLQA 2M67A 4EOZB 5F8PA 4O4JE 4OYJA 2LT3A 3NKZA 1U5PA 3L8RA 4EZ4A 1HX1B 2DCFA 2XM1A 3V5SA 2V7LA 2P9BA 3RC8A 4Z91A 3DTOA 4GYSA 2W2UA 1WR0A 1HG5A 2K48A 2W00A 2E8IA 4O4HE 3ZSSA 3ABVA 1VOMA 3RIUA 5AQOB 5HXEA 4DV3T 3UUNA 1CHUA 3FBLA 1T72A 3I9WA 1UUSA 3KV6A 4UXNB 2C5IT 4ZZCA 5LG4A 1XNQT 2WDVA 3JCFA 1SUMB 2DI4A 2M6IA 3KBUA 2L8KA 3D0TA 3ZCIA 4P0BA 4U2YA 2LEHA 4X64T 3C4WA 4AKGA 2RP4A 2JMHA 5ABEA 4IHJE 5AQLB 1UGOA 3N9NA 2DNXA 1FIOA 1MNDA 2A2FX 4I4TE 5JR9C 4MBQA 5LOVE 3ZMVB 2V6YA 4PW8A 4HWFA 5J2UE 4IE7A 4CN4A 2XQ5A 2J62A 4YTNA 3UU3A 2VVSA 3UUMA 3IF8B 3ZC1A 4U72A 2Q9QB 3O1IA 4C90A 3RH3A 2XSBA 3BK9A 3A5XA 3PURA 4GYRA 1MMNA 3VRAA 2BS3A 4CN1A 2ZLYA 4KHPT 4OK0A 1YD8G 3ONXA 5FY7A 2UXBT 2JRKA 2H3RA 4AQGA 4L0RA 3LK42 4KUMB 3EUHA 1IAPA 2JMKA 3IHRA 2QYWA 3OBVE 5HWXA 5AQTB 3ZT5A 5LXTE 2X68A 5HXHA 4LF7T 2CWOA 4H9PC 4JI2T 5AQKB 1IBKT 3PE0A 4I55E 4TWHA 1U4QA 2V8SV 3PUXF 2FBWA 2X9HA 2CHOA 2NR4A 2LSKA 3NZPA 4LMLA 2QA7A 3SS1A 3CVRA 4DBRA 5HAXA 4MALA 4HE8A 3RC3A 4ZZBA 2IDOB 4X66T 5AQRB 1XDPA 4XZCA 4QKNA 4DR6T 2W0GA 1M62A 2DWKA 1V9DA 2HH7A 3PDYA 3R84B 3PUQA 4CXYA 2XTLA 4U3CA 2IMLA 4PJNA 1OXZA 3U3IA 3ZMUB 5EK3A 3C4ZA 2XAQB 3DP7A 5LB7B 2XQ7A 1NENA 4ZOLE 2RPAA 3ZPOA 4QX8B 2KZ7B 3CK6A 4JBWF 5CA0E 1T7SA 3A8YC 4DUZT 3UQ4A 3QOFA 3HKCE 1BR0A 2YU2A 2M6BA 4HWDA 1WRDA 3RRWA 3ZYLA 2IIUA 4LF4T 4ISTA 2BBHA 4NPPA 4PFPA 4Z90A 2UU9T 5BR8T 4QHOA 3GA8A 2BVLA 4TX5A 4HFBA 5KXJA 4IDOA 4EYYR 2VKOA 4KI0F 1AJ3A 2VB6A 5FMNA 2H7VC 3AAIA 5AQGB 3F31A 3AEBA 3AXJB 5L3BB 1QLBA 2KWHA 2HPLA 3IA3A 4IE4A 5JR9A 3O4XE 1NAFA 1YXRA 2B1EA 4AQFC 4ISSA 2BKPA 5EK4A 5L3FB 1FMWA 2K24A 3HKEE 3PUWF 4HN9A 1XZYA 2WB5A 2FJBA 3CMLA 2XAFB 3I0QA 2UUAT 1HNZT 4LMKA 1QUUA 1SHZC 2JQHA 1D0XA 2FJEA 2C5KT 3O1HA 2IAKA 2UXXB 4B6XA 2LJLA 2VQFT 5IWAT 1GQEA 3RF1A 3OVUA 4YHHT 1J1JA 1FMVA 1HR0T 4YXDA 3FBZA 3A7MA 2C0SA 4I0UA 5FL1A 1D1AA 5AQUB 3AEAA 3LK2B 2F4VT 3N9LA 3FZLB 4LF5T 2GK9A 1IBLT 5E0OA 4YY3T 2HN1A 3B5MA 1W0BA 1CUNA 4QH4A 2VVNA 2MTQA 5HXRA 3W15B 4OFZA 4TV8E 5C3JA 1X9BA 3NWIA 4KX6A 2D2SA 2WS3A 4O8SA 5IYZE 1YQ3A 4DV5T 4DR2T 2SPCA 1IJ6A 1G73A 1HS7A 4HWCA 2WQYA 1YKEB 4V1Av 4CXWA 4IIJE 2WWVA 5CA1E 3AA6B 3HL6A 2K9AA 1MIWA 2UXNB 4CI1B 3QNUA 3AVSA 2LOPA 3RHWA 2X67A 4LF6T 5DQWA 3RIFA 3UTKA 1UURA 2IHR1 2WMOA 3IBPA 2X0LB 3QB5K 3N2GE 3T8OA 2QRXA 2E2AA 4ILUA 5HWYA 4TV9E 2ZM8A 3ZJ1A 2X9XA 2E9XB 5JRCA 4NXMT 1LRZA 1T8BA 3KBTA 3PUZF 3Q5XA 3PUSA 4YHJA 4CQIA 3P4WA 4DBQA 3ZJ2A 4I43B 1E2AA 3C64A 2XAGB 5L3CB 2NWBA 2W62A 4ZS2A 2CHNA 5JDNA 2JQQA 3Q2MA 5FVKA 3VKGA 2W61A 3AECA 3PTRB 5CFBA 2V26A 5JDFA 1HCIA 4ZEYA 3AA1B 2BG9A 5JTGA 4HFEA 4KHZF 2YN6A 2KSRA 3HI2A 4AQFA 2WM9A 3QC9A 2VASA 4AXPA 4EXTA 2JIWA 4GK5E 4B3ST 3MKDA 4EEBA 4F6RC 2UXCT 5HEUA 2BKOA 4C91A 3NRXA 4DV1T 3N2KE 1KFYA
chains in the Genus database with same CATH topology
4J2CA 3LK42 2DWGA 2EHOC 2KWIB 2Q9QD 2W63A 3OYXA 2LOSA 4KUMB 3EUHA 4TZ4C 3HA4A 2V1DB 3LFMA 3C4XA 3L09A 4IGUA 5HYAA 1IAPA 3FXEB 3MA9A 4YFSA 1D0ZA 2JMKA 3C98B 4I50E 3ZMSB 3IHRA 2PBIA 4N78D 4P0AA 2MYSA 4DMWA 3OBVE 2XASB 5HWXA 4UVAB 5LHHB 2CLYC 2LSJA 5LCYA 5JDQA 2VKJA 3ZN0B 4X20E 3KV4A 4GK0E 4PFOA 2X68A 5HXHA 5LXTE 1O3XA 3F57A 2CWOA 2VKHA 4H9PC 1X79A 4QXCB 3PE0A 4I55E 2NTYA 2CXFA 1U4QA 4ZI2D 3AAAB 5L3GB 3LK3B 2NW7A 2X9HA 3CPZA 4M1PA 1OWAA 2ES0A 4JEHB 4WW0A 5TAOA 2LSKA 2D5UA 3B57A 2G0UA 2IW5B 5LJMA 3H37A 3NZPA 5H6RB 2QA7A 3SS1A 3Q9DA 4G2AA 2V7MA 5ETWA 3ZYMA 4DMVA 3CVRA 4DBRA 4TUYE 3CQGB 5HAXA 3RRCA 4ZI3C 4MALA 4HE8A 4YJ2E 5LBQB 3RC3A 4NUVA 3RYHE 2ZMAA 1SA0E 3EVYA 3GMIA 5JDGA 3KV5A 5FXWA 3C50A 4H63V 1D1CA 4OYKA 4QX7B 3R6NA 5BMVE 3H3AA 4A56A 3WAKA 2V7KA 4XZCA 1D1BA 4QKNA 4YLHA 4PK5A 5CB4E 3Q5WA 5IHYA 5JQGE 4UEMA 2KNDA 4CI2B 2W0GA 5FNVE 2DWKA 1V9DA 2HH7A 3PDYA 4PNIA 3R84B 2LSIA 3PUQA 4EAHA 4DNDA 4CXYA 2XTLA 2WAUA 2HPJA 1YKHB 4PJNA 1OXZA 4NUUA 3HKDE 3U3IA 3ZMUB 5EK3A 3C4ZA 4UVBB 2XAQB 4UF0B 3DP7A 2KINB 1WYCA 2VK9A 1MIYA 3OKQA 4IE6A 5EZYE 3BQKA 3K3NA 3KDSE 4ZOLE 2CXLA 2V7IA 4E7ZA 1D0YA 2DLRA 2EHOD 2XQYA 4PK6A 3ZPOA 3O9XA 4QX8B 1EZ3A 1HG2A 2KZ7B 3ETVA 3GN5A 4L9IA 4MHCA 2ACXA 2JJ9A 3CKDA 5CA0E 1US7B 1UX4A 3N9PA 1LVFA 2CCQA 4MLKA 1B7TA 5LNKA 5LA6E 1FEWA 3RYFE 3HKCE 5DQVA 4HEAA 3ZLIA 1BR0A 3ZMZB 2KMFA 3RX6A 2CXDA 3LG7A 3MACA 2VL8A 4PJMA 2YU2A 5FXZA 5M4YA 4BJMA 2E9XC 2YK0A 4Z8XA 2X9WA 4PJJA 3C51A 1YW0A 1WRDA 2L3LA 4ZS3A 3RRWA 3LBXA 1ZKEA 2LE8A 4HFVA 3ZYLA 3L3PA 4ISTA 2Q9QA 1IJ5A 2L9QA 2N1GA 4HTEA 3P8CD 4PFPA 1Y64B 2JPFA 4QHOA 4EZHA 3GA8A 2BVLA 4TX5A 2LSYA 3MK7C 3UULA 5JDHA 4EYYR 4ZI3D 5JR9B 4XBFB 1LKXA 3JC6C 4O4LE 4TN7B 2VKOA 4XAXB 1AJ3A 2LHNA 1VRBA 5KX5E 2ZM0A 2VB6A 5LHGB 3N9QA 2WBLA 4ASKA 1ZHCA 5FMNA 4H9RC 4AKLA 2PFVA 4DO0A 2H7VC 2Y48B 3AB3B 3AAIA 1E1HB 3F31A 2CWYA 5J1GA 5L3BB 2KWHA 4X1YE 2HPLA 5JRCB 3MJXA 2YINA 4IE4A 1WR6A 2IC9A 2CMRA 5DABA 5JR9A 1T98A 3O4XE 2NW8A 5EK2A 1NAFA 2B1EA 3CX8B 2VKDA 4ISSA 4AQFC 4X1KE 1MIVA 2NOXA 2RA1A 1S35A 3NBXX 1HTJF 1QSDA 5EK4A 4ZI7E 3F2EA 5L3FB 4OHFA 3CWZB 3O1JA 4DVDA 3AA7B 1FMWA 2K24A 3HKEE 4HN9A 2VWAA 3I0OA 2XAHB 3ESLA 4H9NC 5KMGP 2KXPB 2XHEB 3CMLA 3WI3A 2XAFB 3I0QA 4KBMB 2XUEA 1QUUA 3BQIA 1SHZC 3RYCE 1D0XA 3EDUA 2C5KT 3O1HA 2MBGA 2PG8A 3ZYKA 5KDMC 3BQLA 2IAKA 2UXXB 4HKAA 2LJLA 4B6XA 3SRZA 3E08A 2BDEA 3FXDB 3AVRA 5L3DB 4IE0A 2EHOB 1KNZA 3KFWX 1WYBA 3ZEFB 3VU7H 4H9OC 1LVKA 3VHLA 1FMVA 3FBZA 2KT9A 5GONE 5JREA 2C0SA 2N2NA 3CX7B 3DJBA 2E9XD 2CLYB 1D1AA 3KV9A 2BZBA 5DJQC 4UVCB 4EIWA 3PUGA 4KP3C 3SWHA 5J2TE 1NWMX 3LK2B 5LGNB 4QWNB 2EHOA 4GOUA 3N9LA 3E22E 3M65A 1ZV4X 3K3QC 3NZQA 2GK9A 4O2BE 1ZEEA 5E0OA 4E7SA 2D0TA 3OYZA 2C5JA 4PK4A 2Y8DA 4O2AE 3GWHA 5LHIB 4CXXA 3I9YA 1CUNA 3ANWB 3N5LA 4UF0A 2MTQA 3JC6D 2X51A 5F3JA 5HXRA 4EYUA 2XAJB 3W15B 4OFZA 2X9YA 4TV8E 3PU8A 3ZCJA 2OA5A 1MMAA 4JUYA 3TKLB 2D2SA 5HXSA 4O8SA 5JDLA 2CEAA 2A3DA 1HFAA 2NTXA 5IYZE 2SPCA 4L5GA 3ANWA 1IJ6A 1G73A 1HS7A 4PJLA 4WBOA 2WSSV 2WWUA 1S94A 2N9DA 4BA9A 2X66A 3FHNA 3QUJA 2Z6EA 4UELA 2LHRA 1YKEB 3KINB 3CX6B 3PUAA 4V1Av 3B13A 4EB6E 1UCUA 4BJNA 5FXVA 1G8XA 3HKBE 4PAGA 4CXWA 4IIJE 3SOLA 4U74A 3LJCA 3I1AA 5CA1E 3AA6B 2YEVC 3CQXC 2DHRA 2Y6XA 1UX5A 3UUXB 2KLQA 3HL6A 5FY1A 4AKIA 3CQCB 2K9AA 2M67A 3MZKB 3V5UA 4AKRB 4EOZB 4GIWA 5F8PA 5AFUL 4O4JE 4OYJA 2LT3A 1MIWA 1BR4A 2UXNB 3QK6A 3UFEA 1U5PA 4CI1B 2CA5A 3AVSA 2LOPA 3HR0A 5C8YE 2X67A 4X1IE 2PJQA 5DQWA 4H9SE 4K0UA 4EZ4A 2K5BB 3U78A 2DCFA 3V5SA 1KK7A 2V7LA 3UTKA 2P9BA 3RC8A 4UIGA 4P09A 3DTOA 4GYSA 4YJ3E 2H7OA 3UT5E 2NP9A 4FJOA 4CI3B 2WMOA 1HG5A 2K48A 3IBPA 2LSGA 2W00A 3N9OA 5LBMA 2X0LB 1MMGA 2E8IA 3N2GE 4O4HE 3T8OA 4ILUA 5HWYA 3AAEB 1VOMA 4TV9E 3NRYA 3PU3A 4IDZA 2ZM8A 3ZJ1A 5LJNA 2BVMA 2X9XA 5HXEA 3J7Yq 2QGSA 2ODVA 2E9XB 3UUNA 4MFRA 2A72A 3RYIE 5JRCA 3J9X1 3FBLA 3KV6A 3I9WA 3IEEA 3N2OA 3K3OA 2WMNA 1LRZA 3KBTA 1BR2A 1MNEA 4UXNB 1IZNB 2Q9QC 1MMDA 2C5IT 5LG4A 3Q5XA 3PUSA 4YHJA 4KMCA 5JDMA 3OJAA 4CQIA 4ERRA 4H63H 4IE5A 1HX8A 5LGTB 4QXHB 2LM9A 4DBQA 2DI4A 3KBUA 3ZJ2A 2L8KA 5LYJE 5FY0A 2E9XA 4I43B 2YU1A 3D0TA 3MXZA 3C64A 3ZCIA 3ZN1B 4P0BA 2XAGB 4BAYB 2LEHA 1Z0PA 5L3CB 2NWBA 3C4WA 4AKGA 5H6QB 2W62A 3N9MA 2RP4A 4ZS2A 3E0ZA 2CM0A 2JMHA 4ADZA 4ZI2C 5JDNA 1HF8A 2JQQA 4IHJE 2CE7A 4WBNE 4ZHQE 2V7JA 3Q2MA 3FB2A 2ODUA 3GN5B 3N9NA 3VKGA 2DNXA 2W61A 1FIOA 1MNDA 2A2FX 4I4TE 4JLEA 5JR9C 4MBQA 3PTRB 3ZC0A 2V26A 3RPUA 5LOVE 2MOZA 4UV8B 5JDFA 3ZMVB 4ANJA 1H7CA 1HCIA 2D0UA 1WLXA 5FYMA 4QXBB 5ADXL 2NW9A 4PW8A 4O4IE 5JH7E 4H9QC 5L3EB 3AA0B 5JVDE 5J2UE 3AA1B 2I59A 4IE7A 5HXCA 4HGAA 3S4UA 5FP3A 5LGUB 5FXXA 3EDVA 3KVAA 4FI5A 3UUMA 5A1LA 3IF8B 3ZC1A 4G63A 3HI2A 3LBXB 3ZMTB 4AQFA 3KVBA 2WM9A 4U72A 2IC6A 3QC9A 2Q9QB 2VASA 4AXPA 3O1IA 4C90A 3RH3A 4EXTA 5L2LA 3BK9A 4GK5E 3A5XA 4CZZB 2ZM2A 3VKHA 3PURA 3MKDA 3WAJA 4JEUB 3K8PC 4GYRA 4AI6A 1MMNA 4UV9B 4F6RC 2ZLYA 4C91A 4OK0A 1YD8G 3ETUA 3NRXA 3P7IA 3ONXA 2J1DG 5FY7A 5LP6E 1BR1A 2JRKA 2H3RA 3RKOA 4AQGA 3N2KE 4AKHA 4WNKA 4L0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB3 B;  3C4Z A;  3QC9 A;  3C50 A;  3CX7 B;  1SHZ C;  3CX6 B;  2A72 A;  3C4X A;  3C4W A;  4IGU A;  1IAP A;  2I59 A;  2ES0 A;  2PBI A;  4GOU A;  3CX8 B;  4WBO A;  2DLR A;  4PNI A;  1ZV4 X;  1HTJ F;  4YHJ A;  3C51 A;  4L9I A;  3T8O A;  4WNK A;  2ACX A; 
#chains in the Genus database with same CATH topology
 4CN6 A;  2DWG A;  2WU5 A;  2KWI B;  2A9U A;  2VL0 A;  3EAM A;  3L09 A;  4IGU A;  4YFS A;  2WDR A;  4N78 D;  4DMW A;  2XAS B;  2D9D A;  2CLY C;  2LSJ A;  4TNV A;  5LCY A;  5JDQ A;  2VKJ A;  4X20 E;  4GK0 E;  2XQ3 A;  1X79 A;  4QXC B;  2J47 A;  5AQP B;  4DV2 T;  2NTY A;  3AAA B;  5L3G B;  5AQJ B;  2NW7 A;  3AE7 A;  3CPZ A;  2V5D A;  3PJA J;  4JEH B;  3JAD A;  4WW0 A;  5TAO A;  3UQ7 A;  3B57 A;  2G0U A;  3H37 A;  5H6R B;  3Q9D A;  5ETW A;  4DMV A;  4TUY E;  3AEG A;  4ZI3 C;  3AE2 A;  3AE6 A;  4NUV A;  5JDG A;  3GMI A;  5FXW A;  3C50 A;  3R6N A;  4A56 A;  3TLU A;  1ZP0 A;  4PK5 A;  4UEM A;  4PNI A;  3RIA A;  4Q25 A;  5J0Z A;  3AED A;  2LRL A;  4UVB B;  3EAB A;  5AQF B;  3FZF B;  1WYC A;  4U7I A;  3OKQ A;  4OX9 T;  1I6Z A;  4DR5 T;  3KDS E;  2V7I A;  4E7Z A;  1D0Y A;  3T1H T;  4YSX A;  3SFD A;  2XQY A;  4IDQ A;  3UUB A;  5CGM A;  2W67 A;  3CKD A;  1UX4 A;  1LVF A;  4MLK A;  1B7T A;  5LA6 E;  3EI0 A;  3ZMZ B;  3RX6 A;  4PJM A;  4EGW A;  5M4Y A;  5FXZ A;  1VCT A;  2HN2 A;  2I0M A;  2YK0 A;  4Z8X A;  1N34 T;  4PJJ A;  3LBX A;  4HFV A;  3P50 A;  2BBJ A;  2OV9 A;  4DID B;  1R8I A;  4EZH A;  4U33 A;  4ZI3 D;  4TWD A;  4JI4 T;  2LHN A;  5LHG B;  3N9Q A;  4ASK A;  1OED B;  4U2Z A;  4AKL A;  2Y48 B;  1HNW T;  5J1G A;  5JRC B;  2JQK A;  2CMR A;  3PV0 F;  2NW8 A;  3P4S A;  3CX8 B;  3G06 A;  3NBX X;  2NOX A;  1S35 A;  3F2E A;  2X0H A;  3I0O A;  2MAW A;  4H9N C;  5LMU T;  2LKH A;  1XMQ T;  3VRB A;  2MBG A;  5KDM C;  3RQU A;  3SRZ A;  3E08 A;  4DR1 T;  2YDQ A;  3AVR A;  2EHO B;  2XQ9 A;  1WFD A;  3KFW X;  1WYB A;  4LF8 T;  2LLY A;  3ZEF B;  4H9O C;  5ABF A;  5JRE A;  2N2N A;  3CX7 B;  3KV9 A;  4UVC B;  4KP3 C;  5J2T E;  1NWM X;  4QWN B;  2BG9 B;  3K3Q C;  4O2B E;  2D0T A;  2C5J A;  2Y8D A;  2WDQ A;  4ILA A;  3GWH A;  1JNR A;  4X65 T;  2X51 A;  2XAJ B;  2PTF A;  3AE4 A;  3ZCJ A;  2OA5 A;  3TKL B;  5JDL A;  3RI5 A;  3ANW A;  5L4H A;  2X66 A;  4UEL A;  3KIN B;  1WCR A;  3B13 A;  4BJN A;  3HKB E;  4PAG A;  4U74 A;  3LJC A;  1XDO A;  3I1A A;  2YEV C;  2DHR A;  1KNR A;  3CQC B;  4B3R T;  4GIW A;  3TLW A;  3QK6 A;  2CA5 A;  4GKJ T;  4X1I E;  2VQE T;  4H9S E;  4K0U A;  3Q5E A;  3U78 A;  4UIG A;  4P09 A;  4YJ3 E;  4YTM A;  3VR9 A;  2NP9 A;  4CI3 B;  2LSG A;  5LBM A;  1MMG A;  5LJN A;  2BVM A;  3J7Y q;  2QGS A;  4JV5 T;  4IL4 A;  3J9X 1;  5HEH A;  3N2O A;  4NXN T;  1MMD A;  4IDN A;  3AE1 A;  4KMC A;  3OJA A;  4ERR A;  5LGT B;  1HX8 A;  4QXH B;  2LM9 A;  2E5V A;  2XQ8 A;  5LYJ E;  2YU1 A;  5HCJ A;  4BAY B;  4DV6 T;  2V6Y B;  1JNZ A;  1L0V A;  3N9M A;  4ADZ A;  4YSY A;  2CE7 A;  3LSV A;  4WBN E;  4ZHQ E;  3RGL A;  2ODU A;  2XQ4 A;  3ZC0 A;  3PUV F;  4ANJ A;  1H7C A;  2D0U A;  5FYM A;  4QXB B;  5ADX L;  2NW9 A;  4HFI A;  4O4I E;  5L3E B;  3VR8 A;  5JVD E;  5HEJ A;  4HGA A;  5FP3 A;  5LGU B;  4A5X A;  1XNR T;  5AQH B;  3LBX B;  3ZMT B;  4ZXL A;  4TWF A;  4HFC A;  4TNW A;  4CZZ B;  2ZM2 A;  3PJA A;  3VKH A;  3WAJ A;  4JEU B;  4LF9 T;  3K8P C;  4UV9 B;  3P7I A;  5F5W A;  1BR1 A;  3RKO A;  4AKH A;  2BKN A;  4J2C A;  4JI7 T;  4DV4 T;  1D0Z A;  3ZMS B;  2V6X A;  4P0A A;  3T1Y T;  3KV4 A;  2XZE A;  3F57 A;  2CXF A;  3LK3 B;  3AEE A;  1OWA A;  2ES0 A;  3RQW A;  4G2A A;  3ZYM A;  2WCA A;  3UU8 A;  4U31 A;  5ABF B;  4YJ2 E;  1OED E;  4H63 V;  4AIU A;  3H3A A;  3WAK A;  4JI1 T;  2V7K A;  1D1B A;  4YLH A;  5CB4 E;  3ZKR A;  2K3W A;  1J5E T;  2LSI A;  2H89 A;  2WAU A;  2HPJ A;  1YKH B;  4NUU A;  3HKD E;  4JI8 T;  2VK9 A;  1MIY A;  4IE6 A;  5EZY E;  4YT0 A;  2XPK A;  2WZH A;  4HFH A;  3O9X A;  1EZ3 A;  1HG2 A;  3ETV A;  3GN5 A;  3LDQ B;  4MHC A;  3NVO A;  3Q5D A;  1KF6 A;  1N33 T;  2CCQ A;  5LNK A;  4HWI B;  5L47 A;  1FEW A;  3ONJ A;  5DQV A;  4HEA A;  3ZLI A;  2KMF A;  3MAC A;  3LG7 A;  3RKG A;  5AQN B;  3TLS A;  5FVL A;  4BJM A;  2E9X C;  2X9W A;  3C51 A;  2XQA A;  4ZS3 A;  1ZKE A;  2LE8 A;  1W0A A;  2L9Q A;  4HTE A;  5IUX A;  1Y64 B;  2JPF A;  3AE8 A;  4UR9 A;  4B3M T;  4COF A;  2LSY A;  4XBF B;  5JR9 B;  2W4X A;  3JC6 C;  4O4L E;  4TN7 B;  3OTO T;  4XAX B;  2ZM0 A;  2WBL A;  1ZHC A;  4H9R C;  2PFV A;  4DO0 A;  2CWY A;  4X1Y E;  2IC9 A;  1T98 A;  3AE5 A;  5EK2 A;  4X1K E;  1MIV A;  1HTJ F;  2E5L T;  4A98 A;  4OHF A;  1W09 A;  3O1J A;  4DVD A;  3AA7 B;  3UU5 A;  2XAH B;  3ESL A;  2KXP B;  3WI3 A;  3AXJ A;  3BQI A;  2PG8 A;  3ZYK A;  2BS2 A;  3UU6 A;  2BDE A;  4K0K T;  3FXD B;  4JYA T;  3AEF A;  3X1D A;  1I94 T;  3VU7 H;  1LVK A;  3VHL A;  5AQM B;  5CJ5 A;  4B3T T;  1M7K A;  2KT9 A;  2YOE A;  5GON E;  3L39 A;  2E9X D;  5DJQ C;  4X62 T;  3PUG A;  4A97 A;  5LGN B;  3E22 E;  1ZV4 X;  3NZQ A;  1J5W A;  4AIS A;  4O2A E;  3N5L A;  5AQV B;  4UF0 A;  3JC6 D;  2WY2 A;  3TLT A;  4JI6 T;  1MMA A;  4JUY A;  4YTP A;  5HXS A;  2CEA A;  2NTX A;  1KEY A;  1N32 T;  2UXD T;  4L5G A;  4PJL A;  4WBO A;  2WWU A;  1Z8U A;  3FHN A;  3QUJ A;  2Z6E A;  2LHR A;  1XMO T;  4LFB T;  3PUA A;  5HEO A;  5FXV A;  3CQX C;  2XSA A;  1UX5 A;  3UUX B;  4AKI A;  5FY1 A;  5AFU L;  3MZK B;  3V5U A;  4AKR B;  2H88 A;  1BR4 A;  1SE7 A;  1VCS A;  3UFE A;  3HR0 A;  5C8Y E;  2PJQ A;  2K5B B;  1KNP A;  2ZM6 T;  1KK7 A;  2UUC T;  1Y01 A;  2WU2 A;  2H7O A;  3UT5 E;  4WYV A;  4JI5 T;  4FJO A;  3P4R A;  2DL1 A;  3N9O A;  1YQ4 A;  3AAE B;  3P4Q A;  3NRY A;  3PU3 A;  3FZM B;  4IDZ A;  2ODV A;  2B76 A;  4MFR A;  2A72 A;  3RYI E;  4LFC T;  3RLF F;  3IEE A;  3K3O A;  2WMN A;  1BR2 A;  1MNE A;  1W9R A;  1IZN B;  2Q9Q C;  2XJ7 A;  5JDM A;  4H63 H;  4IE5 A;  4DR4 T;  5FY0 A;  2E9X A;  3MXZ A;  5ABH A;  3ZN1 B;  3ONL C;  1Z0P A;  2LM2 A;  5H6Q B;  3E0Z A;  2CM0 A;  4ZI2 C;  1HF8 A;  2V7J A;  3FB2 A;  3GN5 B;  3UFG A;  1E7P A;  1NEK A;  4JLE A;  3RPU A;  2MOZ A;  4UV8 B;  1WLX A;  2AE9 A;  5JH7 E;  4H9Q C;  1OED C;  3AA0 B;  2I59 A;  5HXC A;  3S4U A;  5FXX A;  3EDV A;  4IL9 A;  3KVA A;  4FI5 A;  5A1L A;  4G63 A;  3M3Z B;  3KVB A;  2ACZ A;  2HHH T;  2IC6 A;  5L2L A;  4LFA T;  4AI6 A;  4GKK T;  3ETU A;  2J1D G;  5AQQ B;  5LP6 E;  4LMJ A;  4WNK A;  2YDR A;  5LG3 A;  3FZH B;  2EHO C;  2Q9Q D;  2W63 A;  2LRK A;  3OYX A;  2LOS A;  4TZ4 C;  3HA4 A;  2V1D B;  3LFM A;  3C4X A;  4QH5 A;  5HYA A;  3FXE B;  3MA9 A;  4I50 E;  3C98 B;  2PBI A;  2MYS A;  5AQS B;  5LHH B;  4UVA B;  3ZT7 A;  3ZN0 B;  2IUB A;  4PFO A;  1O3X A;  2VKH A;  3QB5 A;  4ILB A;  2BG9 C;  2YKS A;  4ZI2 D;  4M1P A;  3SFE A;  4AQY T;  3ZST A;  3P4P A;  2D5U A;  2IW5 B;  5LJM A;  2XY8 B;  4EED A;  4IRE A;  2V7M A;  1UK5 A;  3CQG B;  1ZOY A;  3RRC A;  5LBQ B;  3RYH E;  2ZMA A;  1SA0 E;  3EVY A;  3KV5 A;  4OYK A;  1D1C A;  5BMV E;  4NIQ A;  4QX7 B;  3JAE A;  3Q5W A;  5IHY A;  5JQG E;  2KND A;  4CI2 B;  2VUR A;  5FNV E;  3JAF A;  4EAH A;  4DND A;  5HCM A;  4UF0 B;  2KIN B;  2V5C A;  3BQK A;  4JI3 T;  4DUY T;  3K3N A;  2CXL A;  3RIU C;  2YDS A;  2UUB T;  2DLR A;  4QH1 A;  4DV0 T;  2EHO D;  4PK6 A;  2XM2 A;  2XQ6 A;  4L9I A;  4HWH A;  2ACX A;  2JJ9 A;  1US7 B;  3N9P A;  3H3M A;  4ILC A;  3RYF E;  4IDP A;  3TLV A;  2CXD A;  2VL8 A;  2QVA A;  1IBM T;  4X5T A;  3UU4 A;  1XWM A;  2FJD A;  1YW0 A;  2L3L A;  2FJA A;  3L3P A;  5FKY A;  2Q9Q A;  1IJ5 A;  2J4G A;  2N1G A;  3P8C D;  5AQI B;  1HNX T;  4JI0 T;  5HEG A;  2OLT A;  3MK7 C;  3UUL A;  5JDH A;  4DR7 T;  4EV6 A;  2FUP A;  1LKX A;  5L4E A;  5LMN T;  1VRB A;  5KX5 E;  4IT4 A;  1N36 T;  5ABG A;  3AB3 B;  1E1H B;  3MJX A;  2YIN A;  1WR6 A;  5DAB A;  2VKD A;  4F8H A;  3ZT6 A;  2RA1 A;  1QSD A;  4ZI7 E;  3CWZ B;  1OED A;  4YSZ A;  2VWA A;  5KMG P;  2XHE B;  2W66 A;  3CIR A;  4DV7 T;  4KBM B;  2XUE A;  3RYC E;  4HFD A;  3EDU A;  3BQL A;  4HKA A;  2AXD S;  2WZI A;  5L3D B;  4IE0 A;  1KNZ A;  3EHZ A;  3K1S A;  3AE3 A;  2MPK A;  3DJB A;  2CLY B;  2LKG A;  2BZB A;  2BS4 A;  4EIW A;  4WZX A;  3SWH A;  2CRB A;  2CPT A;  2EHO A;  4GOU A;  3M65 A;  1ZEE A;  4E7S A;  3OYZ A;  3FZK B;  4PK4 A;  5LHI B;  3OPC A;  4CXX A;  3I9Y A;  3ANW B;  1FJG T;  2R6G F;  5F3J A;  4EYU A;  2CBI A;  2X9Y A;  3PU8 A;  3AE9 A;  4DR3 T;  2A3D A;  1HFA A;  2WP9 A;  2BG9 E;  4BA9 A;  2WSS V;  1S94 A;  2N9D A;  5C2T A;  2X0Y A;  3CX6 B;  4U7Y A;  5FL0 A;  2CBJ A;  4EB6 E;  1UCU A;  1G8X A;  2JQ9 A;  3SOL A;  1DU2 A;  2I6H A;  2Y6X A;  4P1N A;  3PUY F;  2KLQ A;  2M67 A;  4EOZ B;  5F8P A;  4O4J E;  4OYJ A;  2LT3 A;  3NKZ A;  1U5P A;  3L8R A;  4EZ4 A;  1HX1 B;  2DCF A;  2XM1 A;  3V5S A;  2V7L A;  2P9B A;  3RC8 A;  4Z91 A;  3DTO A;  4GYS A;  2W2U A;  1WR0 A;  1HG5 A;  2K48 A;  2W00 A;  2E8I A;  4O4H E;  3ZSS A;  3ABV A;  1VOM A;  3RIU A;  5AQO B;  5HXE A;  4DV3 T;  3UUN A;  1CHU A;  3FBL A;  1T72 A;  3I9W A;  1UUS A;  3KV6 A;  4UXN B;  2C5I T;  4ZZC A;  5LG4 A;  1XNQ T;  2WDV A;  3JCF A;  1SUM B;  2DI4 A;  2M6I A;  3KBU A;  2L8K A;  3D0T A;  3ZCI A;  4P0B A;  4U2Y A;  2LEH A;  4X64 T;  3C4W A;  4AKG A;  2RP4 A;  2JMH A;  5ABE A;  4IHJ E;  5AQL B;  1UGO A;  3N9N A;  2DNX A;  1FIO A;  1MND A;  2A2F X;  4I4T E;  5JR9 C;  4MBQ A;  5LOV E;  3ZMV B;  2V6Y A;  4PW8 A;  4HWF A;  5J2U E;  4IE7 A;  4CN4 A;  2XQ5 A;  2J62 A;  4YTN A;  3UU3 A;  2VVS A;  3UUM A;  3IF8 B;  3ZC1 A;  4U72 A;  2Q9Q B;  3O1I A;  4C90 A;  3RH3 A;  2XSB A;  3BK9 A;  3A5X A;  3PUR A;  4GYR A;  1MMN A;  3VRA A;  2BS3 A;  4CN1 A;  2ZLY A;  4KHP T;  4OK0 A;  1YD8 G;  3ONX A;  5FY7 A;  2UXB T;  2JRK A;  2H3R A;  4AQG A;  4L0R A;  3LK4 2;  4KUM B;  3EUH A;  1IAP A;  2JMK A;  3IHR A;  2QYW A;  3OBV E;  5HWX A;  5AQT B;  3ZT5 A;  5LXT E;  2X68 A;  5HXH A;  4LF7 T;  2CWO A;  4H9P C;  4JI2 T;  5AQK B;  1IBK T;  3PE0 A;  4I55 E;  4TWH A;  1U4Q A;  2V8S V;  3PUX F;  2FBW A;  2X9H A;  2CHO A;  2NR4 A;  2LSK A;  3NZP A;  4LML A;  2QA7 A;  3SS1 A;  3CVR A;  4DBR A;  5HAX A;  4MAL A;  4HE8 A;  3RC3 A;  4ZZB A;  2IDO B;  4X66 T;  5AQR B;  1XDP A;  4XZC A;  4QKN A;  4DR6 T;  2W0G A;  1M62 A;  2DWK A;  1V9D A;  2HH7 A;  3PDY A;  3R84 B;  3PUQ A;  4CXY A;  2XTL A;  4U3C A;  2IML A;  4PJN A;  1OXZ A;  3U3I A;  3ZMU B;  5EK3 A;  3C4Z A;  2XAQ B;  3DP7 A;  5LB7 B;  2XQ7 A;  1NEN A;  4ZOL E;  2RPA A;  3ZPO A;  4QX8 B;  2KZ7 B;  3CK6 A;  4JBW F;  5CA0 E;  1T7S A;  3A8Y C;  4DUZ T;  3UQ4 A;  3QOF A;  3HKC E;  1BR0 A;  2YU2 A;  2M6B A;  4HWD A;  1WRD A;  3RRW A;  3ZYL A;  2IIU A;  4LF4 T;  4IST A;  2BBH A;  4NPP A;  4PFP A;  4Z90 A;  2UU9 T;  5BR8 T;  4QHO A;  3GA8 A;  2BVL A;  4TX5 A;  4HFB A;  5KXJ A;  4IDO A;  4EYY R;  2VKO A;  4KI0 F;  1AJ3 A;  2VB6 A;  5FMN A;  2H7V C;  3AAI A;  5AQG B;  3F31 A;  3AEB A;  3AXJ B;  5L3B B;  1QLB A;  2KWH A;  2HPL A;  3IA3 A;  4IE4 A;  5JR9 A;  3O4X E;  1NAF A;  1YXR A;  2B1E A;  4AQF C;  4ISS A;  2BKP A;  5EK4 A;  5L3F B;  1FMW A;  2K24 A;  3HKE E;  3PUW F;  4HN9 A;  1XZY A;  2WB5 A;  2FJB A;  3CML A;  2XAF B;  3I0Q A;  2UUA T;  1HNZ T;  4LMK A;  1QUU A;  1SHZ C;  2JQH A;  1D0X A;  2FJE A;  2C5K T;  3O1H A;  2IAK A;  2UXX B;  4B6X A;  2LJL A;  2VQF T;  5IWA T;  1GQE A;  3RF1 A;  3OVU A;  4YHH T;  1J1J A;  1FMV A;  1HR0 T;  4YXD A;  3FBZ A;  3A7M A;  2C0S A;  4I0U A;  5FL1 A;  1D1A A;  5AQU B;  3AEA A;  3LK2 B;  2F4V T;  3N9L A;  3FZL B;  4LF5 T;  2GK9 A;  1IBL T;  5E0O A;  4YY3 T;  2HN1 A;  3B5M A;  1W0B A;  1CUN A;  4QH4 A;  2VVN A;  2MTQ A;  5HXR A;  3W15 B;  4OFZ A;  4TV8 E;  5C3J A;  1X9B A;  3NWI A;  4KX6 A;  2D2S A;  2WS3 A;  4O8S A;  5IYZ E;  1YQ3 A;  4DV5 T;  4DR2 T;  2SPC A;  1IJ6 A;  1G73 A;  1HS7 A;  4HWC A;  2WQY A;  1YKE B;  4V1A v;  4CXW A;  4IIJ E;  2WWV A;  5CA1 E;  3AA6 B;  3HL6 A;  2K9A A;  1MIW A;  2UXN B;  4CI1 B;  3QNU A;  3AVS A;  2LOP A;  3RHW A;  2X67 A;  4LF6 T;  5DQW A;  3RIF A;  3UTK A;  1UUR A;  2IHR 1;  2WMO A;  3IBP A;  2X0L B;  3QB5 K;  3N2G E;  3T8O A;  2QRX A;  2E2A A;  4ILU A;  5HWY A;  4TV9 E;  2ZM8 A;  3ZJ1 A;  2X9X A;  2E9X B;  5JRC A;  4NXM T;  1LRZ A;  1T8B A;  3KBT A;  3PUZ F;  3Q5X A;  3PUS A;  4YHJ A;  4CQI A;  3P4W A;  4DBQ A;  3ZJ2 A;  4I43 B;  1E2A A;  3C64 A;  2XAG B;  5L3C B;  2NWB A;  2W62 A;  4ZS2 A;  2CHN A;  5JDN A;  2JQQ A;  3Q2M A;  5FVK A;  3VKG A;  2W61 A;  3AEC A;  3PTR B;  5CFB A;  2V26 A;  5JDF A;  1HCI A;  4ZEY A;  3AA1 B;  2BG9 A;  5JTG A;  4HFE A;  4KHZ F;  2YN6 A;  2KSR A;  3HI2 A;  4AQF A;  2WM9 A;  3QC9 A;  2VAS A;  4AXP A;  4EXT A;  2JIW A;  4GK5 E;  4B3S T;  3MKD A;  4EEB A;  4F6R C;  2UXC T;  5HEU A;  2BKO A;  4C91 A;  3NRX A;  4DV1 T;  3N2K E;  1KFY A; 
#chains in the Genus database with same CATH homology
 4J2C A;  3LK4 2;  2DWG A;  2EHO C;  2KWI B;  2Q9Q D;  2W63 A;  3OYX A;  2LOS A;  4KUM B;  3EUH A;  4TZ4 C;  3HA4 A;  2V1D B;  3LFM A;  3C4X A;  3L09 A;  4IGU A;  5HYA A;  1IAP A;  3FXE B;  3MA9 A;  4YFS A;  1D0Z A;  2JMK A;  3C98 B;  4I50 E;  3ZMS B;  3IHR A;  2PBI A;  4N78 D;  4P0A A;  2MYS A;  4DMW A;  3OBV E;  2XAS B;  5HWX A;  4UVA B;  5LHH B;  2CLY C;  2LSJ A;  5LCY A;  5JDQ A;  2VKJ A;  3ZN0 B;  4X20 E;  3KV4 A;  4GK0 E;  4PFO A;  2X68 A;  5HXH A;  5LXT E;  1O3X A;  3F57 A;  2CWO A;  2VKH A;  4H9P C;  1X79 A;  4QXC B;  3PE0 A;  4I55 E;  2NTY A;  2CXF A;  1U4Q A;  4ZI2 D;  3AAA B;  5L3G B;  3LK3 B;  2NW7 A;  2X9H A;  3CPZ A;  4M1P A;  1OWA A;  2ES0 A;  4JEH B;  4WW0 A;  5TAO A;  2LSK A;  2D5U A;  3B57 A;  2G0U A;  2IW5 B;  5LJM A;  3H37 A;  3NZP A;  5H6R B;  2QA7 A;  3SS1 A;  3Q9D A;  4G2A A;  2V7M A;  5ETW A;  3ZYM A;  4DMV A;  3CVR A;  4DBR A;  4TUY E;  3CQG B;  5HAX A;  3RRC A;  4ZI3 C;  4MAL A;  4HE8 A;  4YJ2 E;  5LBQ B;  3RC3 A;  4NUV A;  3RYH E;  2ZMA A;  1SA0 E;  3EVY A;  3GMI A;  5JDG A;  3KV5 A;  5FXW A;  3C50 A;  4H63 V;  1D1C A;  4OYK A;  4QX7 B;  3R6N A;  5BMV E;  3H3A A;  4A56 A;  3WAK A;  2V7K A;  4XZC A;  1D1B A;  4QKN A;  4YLH A;  4PK5 A;  5CB4 E;  3Q5W A;  5IHY A;  5JQG E;  4UEM A;  2KND A;  4CI2 B;  2W0G A;  5FNV E;  2DWK A;  1V9D A;  2HH7 A;  3PDY A;  4PNI A;  3R84 B;  2LSI A;  3PUQ A;  4EAH A;  4DND A;  4CXY A;  2XTL A;  2WAU A;  2HPJ A;  1YKH B;  4PJN A;  1OXZ A;  4NUU A;  3HKD E;  3U3I A;  3ZMU B;  5EK3 A;  3C4Z A;  4UVB B;  2XAQ B;  4UF0 B;  3DP7 A;  2KIN B;  1WYC A;  2VK9 A;  1MIY A;  3OKQ A;  4IE6 A;  5EZY E;  3BQK A;  3K3N A;  3KDS E;  4ZOL E;  2CXL A;  2V7I A;  4E7Z A;  1D0Y A;  2DLR A;  2EHO D;  2XQY A;  4PK6 A;  3ZPO A;  3O9X A;  4QX8 B;  1EZ3 A;  1HG2 A;  2KZ7 B;  3ETV A;  3GN5 A;  4L9I A;  4MHC A;  2ACX A;  2JJ9 A;  3CKD A;  5CA0 E;  1US7 B;  1UX4 A;  3N9P A;  1LVF A;  2CCQ A;  4MLK A;  1B7T A;  5LNK A;  5LA6 E;  1FEW A;  3RYF E;  3HKC E;  5DQV A;  4HEA A;  3ZLI A;  1BR0 A;  3ZMZ B;  2KMF A;  3RX6 A;  2CXD A;  3LG7 A;  3MAC A;  2VL8 A;  4PJM A;  2YU2 A;  5FXZ A;  5M4Y A;  4BJM A;  2E9X C;  2YK0 A;  4Z8X A;  2X9W A;  4PJJ A;  3C51 A;  1YW0 A;  1WRD A;  2L3L A;  4ZS3 A;  3RRW A;  3LBX A;  1ZKE A;  2LE8 A;  4HFV A;  3ZYL A;  3L3P A;  4IST A;  2Q9Q A;  1IJ5 A;  2L9Q A;  2N1G A;  4HTE A;  3P8C D;  4PFP A;  1Y64 B;  2JPF A;  4QHO A;  4EZH A;  3GA8 A;  2BVL A;  4TX5 A;  2LSY A;  3MK7 C;  3UUL A;  5JDH A;  4EYY R;  4ZI3 D;  5JR9 B;  4XBF B;  1LKX A;  3JC6 C;  4O4L E;  4TN7 B;  2VKO A;  4XAX B;  1AJ3 A;  2LHN A;  1VRB A;  5KX5 E;  2ZM0 A;  2VB6 A;  5LHG B;  3N9Q A;  2WBL A;  4ASK A;  1ZHC A;  5FMN A;  4H9R C;  4AKL A;  2PFV A;  4DO0 A;  2H7V C;  2Y48 B;  3AB3 B;  3AAI A;  1E1H B;  3F31 A;  2CWY A;  5J1G A;  5L3B B;  2KWH A;  4X1Y E;  2HPL A;  5JRC B;  3MJX A;  2YIN A;  4IE4 A;  1WR6 A;  2IC9 A;  2CMR A;  5DAB A;  5JR9 A;  1T98 A;  3O4X E;  2NW8 A;  5EK2 A;  1NAF A;  2B1E A;  3CX8 B;  2VKD A;  4ISS A;  4AQF C;  4X1K E;  1MIV A;  2NOX A;  2RA1 A;  1S35 A;  3NBX X;  1HTJ F;  1QSD A;  5EK4 A;  4ZI7 E;  3F2E A;  5L3F B;  4OHF A;  3CWZ B;  3O1J A;  4DVD A;  3AA7 B;  1FMW A;  2K24 A;  3HKE E;  4HN9 A;  2VWA A;  3I0O A;  2XAH B;  3ESL A;  4H9N C;  5KMG P;  2KXP B;  2XHE B;  3CML A;  3WI3 A;  2XAF B;  3I0Q A;  4KBM B;  2XUE A;  1QUU A;  3BQI A;  1SHZ C;  3RYC E;  1D0X A;  3EDU A;  2C5K T;  3O1H A;  2MBG A;  2PG8 A;  3ZYK A;  5KDM C;  3BQL A;  2IAK A;  2UXX B;  4HKA A;  2LJL A;  4B6X A;  3SRZ A;  3E08 A;  2BDE A;  3FXD B;  3AVR A;  5L3D B;  4IE0 A;  2EHO B;  1KNZ A;  3KFW X;  1WYB A;  3ZEF B;  3VU7 H;  4H9O C;  1LVK A;  3VHL A;  1FMV A;  3FBZ A;  2KT9 A;  5GON E;  5JRE A;  2C0S A;  2N2N A;  3CX7 B;  3DJB A;  2E9X D;  2CLY B;  1D1A A;  3KV9 A;  2BZB A;  5DJQ C;  4UVC B;  4EIW A;  3PUG A;  4KP3 C;  3SWH A;  5J2T E;  1NWM X;  3LK2 B;  5LGN B;  4QWN B;  2EHO A;  4GOU A;  3N9L A;  3E22 E;  3M65 A;  1ZV4 X;  3K3Q C;  3NZQ A;  2GK9 A;  4O2B E;  1ZEE A;  5E0O A;  4E7S A;  2D0T A;  3OYZ A;  2C5J A;  4PK4 A;  2Y8D A;  4O2A E;  3GWH A;  5LHI B;  4CXX A;  3I9Y A;  1CUN A;  3ANW B;  3N5L A;  4UF0 A;  2MTQ A;  3JC6 D;  2X51 A;  5F3J A;  5HXR A;  4EYU A;  2XAJ B;  3W15 B;  4OFZ A;  2X9Y A;  4TV8 E;  3PU8 A;  3ZCJ A;  2OA5 A;  1MMA A;  4JUY A;  3TKL B;  2D2S A;  5HXS A;  4O8S A;  5JDL A;  2CEA A;  2A3D A;  1HFA A;  2NTX A;  5IYZ E;  2SPC A;  4L5G A;  3ANW A;  1IJ6 A;  1G73 A;  1HS7 A;  4PJL A;  4WBO A;  2WSS V;  2WWU A;  1S94 A;  2N9D A;  4BA9 A;  2X66 A;  3FHN A;  3QUJ A;  2Z6E A;  4UEL A;  2LHR A;  1YKE B;  3KIN B;  3CX6 B;  3PUA A;  4V1A v;  3B13 A;  4EB6 E;  1UCU A;  4BJN A;  5FXV A;  1G8X A;  3HKB E;  4PAG A;  4CXW A;  4IIJ E;  3SOL A;  4U74 A;  3LJC A;  3I1A A;  5CA1 E;  3AA6 B;  2YEV C;  3CQX C;  2DHR A;  2Y6X A;  1UX5 A;  3UUX B;  2KLQ A;  3HL6 A;  5FY1 A;  4AKI A;  3CQC B;  2K9A A;  2M67 A;  3MZK B;  3V5U A;  4AKR B;  4EOZ B;  4GIW A;  5F8P A;  5AFU L;  4O4J E;  4OYJ A;  2LT3 A;  1MIW A;  1BR4 A;  2UXN B;  3QK6 A;  3UFE A;  1U5P A;  4CI1 B;  2CA5 A;  3AVS A;  2LOP A;  3HR0 A;  5C8Y E;  2X67 A;  4X1I E;  2PJQ A;  5DQW A;  4H9S E;  4K0U A;  4EZ4 A;  2K5B B;  3U78 A;  2DCF A;  3V5S A;  1KK7 A;  2V7L A;  3UTK A;  2P9B A;  3RC8 A;  4UIG A;  4P09 A;  3DTO A;  4GYS A;  4YJ3 E;  2H7O A;  3UT5 E;  2NP9 A;  4FJO A;  4CI3 B;  2WMO A;  1HG5 A;  2K48 A;  3IBP A;  2LSG A;  2W00 A;  3N9O A;  5LBM A;  2X0L B;  1MMG A;  2E8I A;  3N2G E;  4O4H E;  3T8O A;  4ILU A;  5HWY A;  3AAE B;  1VOM A;  4TV9 E;  3NRY A;  3PU3 A;  4IDZ A;  2ZM8 A;  3ZJ1 A;  5LJN A;  2BVM A;  2X9X A;  5HXE A;  3J7Y q;  2QGS A;  2ODV A;  2E9X B;  3UUN A;  4MFR A;  2A72 A;  3RYI E;  5JRC A;  3J9X 1;  3FBL A;  3KV6 A;  3I9W A;  3IEE A;  3N2O A;  3K3O A;  2WMN A;  1LRZ A;  3KBT A;  1BR2 A;  1MNE A;  4UXN B;  1IZN B;  2Q9Q C;  1MMD A;  2C5I T;  5LG4 A;  3Q5X A;  3PUS A;  4YHJ A;  4KMC A;  5JDM A;  3OJA A;  4CQI A;  4ERR A;  4H63 H;  4IE5 A;  1HX8 A;  5LGT B;  4QXH B;  2LM9 A;  4DBQ A;  2DI4 A;  3KBU A;  3ZJ2 A;  2L8K A;  5LYJ E;  5FY0 A;  2E9X A;  4I43 B;  2YU1 A;  3D0T A;  3MXZ A;  3C64 A;  3ZCI A;  3ZN1 B;  4P0B A;  2XAG B;  4BAY B;  2LEH A;  1Z0P A;  5L3C B;  2NWB A;  3C4W A;  4AKG A;  5H6Q B;  2W62 A;  3N9M A;  2RP4 A;  4ZS2 A;  3E0Z A;  2CM0 A;  2JMH A;  4ADZ A;  4ZI2 C;  5JDN A;  1HF8 A;  2JQQ A;  4IHJ E;  2CE7 A;  4WBN E;  4ZHQ E;  2V7J A;  3Q2M A;  3FB2 A;  2ODU A;  3GN5 B;  3N9N A;  3VKG A;  2DNX A;  2W61 A;  1FIO A;  1MND A;  2A2F X;  4I4T E;  4JLE A;  5JR9 C;  4MBQ A;  3PTR B;  3ZC0 A;  2V26 A;  3RPU A;  5LOV E;  2MOZ A;  4UV8 B;  5JDF A;  3ZMV B;  4ANJ A;  1H7C A;  1HCI A;  2D0U A;  1WLX A;  5FYM A;  4QXB B;  5ADX L;  2NW9 A;  4PW8 A;  4O4I E;  5JH7 E;  4H9Q C;  5L3E B;  3AA0 B;  5JVD E;  5J2U E;  3AA1 B;  2I59 A;  4IE7 A;  5HXC A;  4HGA A;  3S4U A;  5FP3 A;  5LGU B;  5FXX A;  3EDV A;  3KVA A;  4FI5 A;  3UUM A;  5A1L A;  3IF8 B;  3ZC1 A;  4G63 A;  3HI2 A;  3LBX B;  3ZMT B;  4AQF A;  3KVB A;  2WM9 A;  4U72 A;  2IC6 A;  3QC9 A;  2Q9Q B;  2VAS A;  4AXP A;  3O1I A;  4C90 A;  3RH3 A;  4EXT A;  5L2L A;  3BK9 A;  4GK5 E;  3A5X A;  4CZZ B;  2ZM2 A;  3VKH A;  3PUR A;  3MKD A;  3WAJ A;  4JEU B;  3K8P C;  4GYR A;  4AI6 A;  1MMN A;  4UV9 B;  4F6R C;  2ZLY A;  4C91 A;  4OK0 A;  1YD8 G;  3ETU A;  3NRX A;  3P7I A;  3ONX A;  2J1D G;  5FY7 A;  5LP6 E;  1BR1 A;  2JRK A;  2H3R A;  3RKO A;  4AQG A;  3N2K E;  4AKH A;  4WNK A;  4L0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...