3CX6B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
185
Chain Sequence
LIIGPEEESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein alpha-13 subunit
total genus 63
structure length 185
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx6B00
2A72A 3CX7B 1ZV4X 2ACXA 2DLRA 4GOUA 3C4XA 4WNKA 3C50A 4WBOA 3CX6B 3QC9A 4L9IA 4PNIA 2PBIA 3CX8B 3C4ZA 4IGUA 4YHJA 2I59A 3C51A 3C4WA 3AB3B 1SHZC 2ES0A 1HTJF 3T8OA 1IAPA
chains in the Genus database with same CATH superfamily
5AQNB 2MTQA 3TLWA 4DNDA 4BJNA 1J1JA 3N9OA 2CLYC 2UXXB 2XQ9A 3EVYA 3RPUA 1WRDA 2I0MA 2VB6A 4ZZBA 4K0UA 4NXMT 1AJ3A 1FMWA 3MXZA 4ZS3A 2WMNA 2MBGA 4IREA 4EYYR 3O4XE 4CN6A 1I94T 3ONLC 3K3QC 4EEDA 2KSRA 3AEGA 2I6HA 4AKIA 2DWGA 2W4XA 4ILBA 1LKXA 4EV6A 1MNDA 2YDRA 4U7YA 3Q2MA 3ZJ2A 2N2NA 2WCAA 2Q9QD 2I59A 5KMGP 3ZMZB 1E2AA 5M4YA 3OVUA 3PUZF 3PE0A 1IZNB 4IT4A 2VQET 3VKGA 4DV4T 1U4QA 3JAFA 3PDYA 3TLVA 3ZPOA 4QX7B 3ZKRA 3QK6A 3FZMB 2XQYA 4Q25A 5LMNT 1XDOA 5F3JA 3KV9A 5FL0A 2L3LA 4YFSA 2V7LA 3ZYLA 4DV6T 2K24A 3RHWA 1WCRA 2VL0A 3LJCA 4GYSA 4LFCT 4UF0A 4Z91A 1YXRA 4HTEA 3VR9A 5JQGE 2KT9A 5IHYA 1YW0A 4OHFA 4H9NC 3I9WA 2CLYB 2YK0A 3PUGA 3Q5EA 2J62A 2D0TA 4I0UA 5TAOA 2LRKA 3AE4A 2WBLA 4ZI3C 2WQYA 3KFWX 5JVDE 3OPCA 5JDQA 5C8YE 2V6YA 4DO0A 1B7TA 2X51A 3ONXA 2XAHB 3Q5XA 4PJJA 4ASKA 3N9MA 3ZCJA 5AQIB 4ZOLE 4JI5T 3WAKA 2E9XA 2YINA 4DMVA 2BG9E 1H7CA 4TUYE 1HCIA 2DWKA 4MLKA 1NWMX 5AQSB 1LVKA 4PK6A 2CWOA 4NUVA 1ZP0A 5DQVA 3JC6C 1DU2A 4ZHQE 3CIRA 5JR9B 3AE3A 5AQKB 2V7JA 5FY7A 3TKLB 3X1DA 2LKGA 3EI0A 2KWHA 1SA0E 4OYJA 4X1IE 4H9QC 2ACXA 5F5WA 5LB7B 4PAGA 4NPPA 1MIYA 3GN5A 3D0TA 2WY2A 3I1AA 2XAJB 4JI2T 4KI0F 2X66A 4UR9A 2CXLA 1I6ZA 1YKHB 1JNZA 2BDEA 3ZLIA 3B13A 3DTOA 3L09A 3P4WA 2VKHA 4O8SA 4OYKA 1D1BA 1YKEB 2X9HA 5EK4A 2LSGA 3P50A 3AVRA 3N2GE 4AXPA 4YHJA 3UU4A 1BR0A 3MK7C 1IJ5A 1E7PA 1UUSA 2LM9A 1D0XA 4X65T 4DV7T 4ISSA 4EAHA 5CJ5A 2V5DA 4YTMA 2FJAA 2BBHA 2KNDA 4KMCA 5L3EB 1IBMT 5GONE 2UUBT 3LDQB 2ES0A 3MZKB 4TWFA 1T72A 3O1JA 1FMVA 2V7IA 3ZMUB 2IAKA 2JMKA 2GK9A 2IMLA 2D0UA 1CHUA 2XSBA 3N9PA 4EZHA 5LP6E 2WDQA 1N32T 1WFDA 2XAQB 2OV9A 3PUYF 4ERRA 3PUSA 4GOUA 5JTGA 1W0AA 4PK4A 2BS2A 4I43B 5JDMA 5IUXA 5J2UE 2JQQA 5C2TA 3BK9A 4H9OC 2JQHA 1D1AA 2NWBA 2X67A 3FBLA 4IE6A 3OYZA 4H63H 5BMVE 5L4HA 4DR2T 4HWIB 2YU1A 4DBQA 5HXHA 1E1HB 1SUMB 1W0BA 4UVBB 2ZM6T 3RIAA 3IHRA 3ZT5A 4AKHA 4ILAA 5HXCA 3Q5WA 4OK0A 3FHNA 4IE5A 1ZHCA 4X64T 3CK6A 3RYCE 2ZLYA 4IDQA 4OFZA 1KNZA 4YXDA 2CCQA 3PUAA 3QNUA 5AQJB 4NIQA 3ZN0B 4V1Av 5L3FB 3OJAA 1BR2A 5JRCB 2LE8A 3CQGB 2W00A 3E08A 3LG7A 4DUZT 2BS4A 1G8XA 2NW9A 2VASA 2BKOA 2IC6A 4CXWA 4JI3T 1J5WA 2A2FX 3AE2A 1FEWA 3B5MA 4MFRA 2C0SA 2LOSA 3UUNA 4DIDB 4KX6A 1WYCA 1LRZA 3FZHB 3HA4A 4IDZA 4DR7T 2V7KA 5FXZA 5F8PA 2M6IA 4PNIA 4XZCA 2PBIA 3O1IA 4U74A 3KV6A 4JI4T 3UU8A 1NENA 3EDUA 3BQKA 2EHOC 3HKEE 4QH4A 2B76A 4GKJT 1UX4A 5LA6E 4ILCA 5AFUL 4EYUA 2CHNA 2NTXA 4MHCA 4XBFB 2NR4A 3RH3A 1KF6A 2FJEA 3AA1B 4IE7A 3VRAA 3KBTA 3O9XA 4LF4T 2J1DG 3F57A 5HCMA 5ABFB 3T1YT 4EGWA 4JV5T 1YQ4A 2FUPA 2CXFA 3A7MA 4HFIA 2DI4A 4TNWA 2WSSV 2JIWA 3MACA 4LMKA 4I50E 4A97A 2HN2A 2XASB 5DABA 3ZCIA 1X79A 2NOXA 3KVBA 5LXTE 5AQVB 4X62T 1UX5A 1XNRT 3CPZA 1KNPA 3K3NA 4LF8T 3UUXB 3RLFF 2PJQA 4HWHA 5L47A 3C4ZA 4IE4A 2ACZA 2BS3A 1D0YA 2F4VT 2ZMAA 1M7KA 5FNVE 3SFEA 3ABVA 2RP4A 4QKNA 5HYAA 5JDFA 1BR4A 4LMJA 3N9NA 3P8CD 3N2OA 3FB2A 2QGSA 2LSYA 2X9XA 2J47A 1T8BA 1HG5A 3NRXA 2D2SA 3HI2A 1M62A 2ODUA 4QXHB 3VKHA 5H6QB 2J4GA 2Z6EA 2ZM2A 4DVDA 1S94A 1UCUA 2BVLA 2YKSA 3JCFA 5LBMA 1OWAA 4JBWF 4HE8A 3PJAJ 4JEUB 3PUVF 5FVKA 1Z8UA 2N9DA 2BBJA 1VRBA 2CBIA 4DBRA 4HWDA 2PFVA 5JDLA 1KEYA 4ADZA 5LJNA 5J2TE 5ADXL 4DV5T 3JADA 3J9X1 2MAWA 4QX8B 2L9QA 4O4IE 3ZC0A 1WLXA 2E8IA 2CXDA 2LSJA 3E0ZA 3L8RA 3N5LA 4EEBA 5HWYA 5CA0E 1X9BA 3J7Yq 4LF5T 3ANWB 4TN7B 4QH5A 2VWAA 2XJ7A 3I0OA 4K0KT 4AKLA 4BAYB 3SS1A 4EOZB 2Q9QB 3EHZA 2V26A 4HFHA 4PW8A 3LK42 5LCYA 5LG3A 3RIUC 5LGUB 4JI8T 2NP9A 3FZFB 3P4SA 3TLTA 2EHOA 3LBXA 3RF1A 4CI2B 2LLYA 2K3WA 1XZYA 4JUYA 4ZEYA 2XAGB 2W0GA 3BQIA 2CE7A 4CXXA 1CUNA 4B3TT 2WZHA 3NVOA 1MIVA 4KHZF 4C91A 4AQGA 4IE0A 5FMNA 2WP9A 3KV4A 4I55E 3ZC1A 3V5SA 4B6XA 4E7SA 4YSZA 1XMQT 4L0RA 2CBJA 2AE9A 3RX6A 4UXNB 3UFEA 3C4XA 5HEUA 2Y48B 4H9PC 4KUMB 5HXRA 2HPJA 2MOZA 4L9IA 3RRCA 4AKRB 4UIGA 4H9RC 4QHOA 3CX8B 4YJ3E 4ZI3D 3JAEA 5LJMA 4PJMA 2WMOA 2VL8A 4WYVA 1MMDA 2KLQA 4QH1A 2Y6XA 4LFBT 5HEGA 3UT5E 1KFYA 1O3XA 1D0ZA 2VURA 3FZKB 3MKDA 3VU7H 4HN9A 4O2BE 1QUUA 3NRYA 5JH7E 3O1HA 3ESLA 2XTLA 5ABGA 3AVSA 4FJOA 1HR0T 1OEDA 2VKOA 4HGAA 4GK0E 2VKJA 3AE6A 2EHOD 2XSAA 2WM9A 3HR0A 4ZS2A 3ZEFB 4YSYA 3QB5K 4UVCB 3ZN1B 1HNWT 4TV8E 4AISA 2NTYA 2OLTA 2VVSA 2LOPA 4IL4A 3FBZA 3OKQA 2WS3A 4A98A 3KDSE 1MIWA 5FL1A 4G63A 4QWNB 4E7ZA 2DCFA 2YU2A 5AQRB 2XUEA 2Q9QC 3K8PC 4O4JE 4IDPA 4ANJA 3FXDB 3AXJA 5EZYE 3H37A 3FZLB 4H63V 4DV2T 3QC9A 4ILUA 5AQGB 2UUAT 3RQUA 3PUWF 4MBQA 4J2CA 1GQEA 4HFCA 4IDNA 3RYHE 3ZYMA 1OEDC 3AAIA 3E22E 3LK3B 4U33A 4A5XA 4YY3T 4JI6T 5FXXA 3NZQA 3PU3A 4B3MT 3AEDA 2D5UA 3VHLA 1KK7A 2LT3A 4H9SE 2G0UA 2E9XB 2M67A 1SHZC 3AEFA 2XQ4A 2Y8DA 3ONJA 5EK2A 4BJMA 2Q9QA 4HKAA 3AAEB 3UTKA 2K9AA 1VCTA 4ISTA 4G2AA 4CXYA 1SE7A 2H88A 2RPAA 3AECA 2A72A 2BKNA 4IIJE 3RI5A 2UXNB 4M1PA 4UVAB 5HEJA 2HHHT 4P1NA 2H7VC 3HKBE 3AA0B 4X1KE 4X5TA 2ZM8A 5HCJA 3RKOA 3N9QA 2JPFA 3NKZA 3KINB 5EK3A 3R84B 3AAAB 2LSIA 3NWIA 4WNKA 3TLSA 2UXCT 3CQXC 4YJ2E 4TWDA 5FXWA 1VOMA 2LSKA 4GYRA 3VR8A 3SRZA 5CA1E 2YDQA 4EZ4A 3OTOT 2YN6A 2VVNA 2H7OA 1FJGT 1WYBA 4PJLA 2LJLA 2DHRA 5FKYA 3H3MA 1J5ET 2WDVA 3LK2B 4IL9A 1UGOA 2JRKA 2XAFB 3M65A 4HWFA 5JDGA 4HFBA 1T7SA 4X66T 3B57A 4P0AA 3T1HT 3PTRB 3PJAA 3TLUA 3DP7A 2CPTA 4TV9E 1QSDA 4ZI2D 4DR3T 1HTJF 1KNRA 2H3RA 2W63A 3CKDA 3IA3A 5LOVE 4LF9T 1Y64B 2DL1A 2FJDA 4U72A 2VQFT 2H89A 3ZT6A 4EB6E 2AXDS 3F31A 3CX7B 2LM2A 4XAXB 2CMRA 3RRWA 4HEAA 1Y01A 2NW7A 2ODVA 5FP3A 5ABFA 3PUQA 4PK5A 3UUBA 2BVMA 1UK5A 4AQFA 3EDVA 5KXJA 2X0YA 1HNZT 2E5VA 2WB5A 4U3CA 1ZKEA 5FY0A 3RGLA 5C3JA 3QOFA 2X9WA 2XQ3A 1US7B 2K48A 2UXBT 5CGMA 3C51A 2BG9A 3AXJB 3AA7B 3JC6D 3M3ZB 3K1SA 4IDOA 3C4WA 5LBQB 3UU3A 5L3GB 2SPCA 2W66A 3AB3B 5JREA 4DR6T 1VCSA 1MMGA 2KXPB 2A9UA 4A56A 5DQWA 5AQHB 4YTNA 1MNEA 3L3PA 3P4RA 2RA1A 3SWHA 1YQ3A 3AE1A 1XMOT 1HG2A 1XDPA 2WU2A 2QRXA 5HEHA 3CVRA 3K3OA 5HEOA 5JDHA 1IAPA 2C5IT 3G06A 3KV5A 3SOLA 2WU5A 1N33T 4Z8XA 3UULA 4TZ4C 3P7IA 2IHR1 2QA7A 2KINB 3VRBA 2HN1A 2ZM0A 4FI5A 2XHEB 1ZEEA 1QLBA 3NZPA 3RIFA 3KVAA 1V9DA 2BG9C 2N1GA 2WAUA 4N78D 1S35A 2V1DB 3HKCE 4LMLA 5DJQC 2IUBA 4P0BA 1NAFA 4X1YE 2XPKA 3ZYKA 2KWIB 3CX6B 4BA9A 4CN1A 2XQ5A 5LYJE 4MALA 4JI7T 4WBNE 5LHIB 3I0QA 4O2AE 2CHOA 2XQ6A 2K5BB 4GIWA 2C5JA 4YSXA 3KBUA 5FYMA 2D9DA 2V6YB 3V5UA 3DJBA 3FXEB 4COFA 4JEHB 3PURA 4DR1T 2LHNA 2C5KT 5LHHB 5A1LA 4NXNT 1YD8G 4CQIA 4TWHA 5LGTB 5HXSA 3CWZB 3ANWA 4JYAT 4UF0B 5BR8T 3U78A 5HAXA 4JLEA 3AEBA 2XY8B 3OYXA 1JNRA 3RKGA 1U5PA 2DNXA 5L4EA 1HX1B 2EHOB 4UEMA 5AQQB 5J1GA 2W67A 3ZMSB 2PTFA 2B1EA 2KZ7B 3L39A 4CN4A 4YHHT 3A5XA 3CMLA 3ZSSA 2IC9A 2PG8A 4B3RT 2CA5A 3QUJA 1ZOYA 1OEDE 5LNKA 2CEAA 3HKDE 5LMUT 4HWCA 2YEVC 2XQ7A 5AQUB 4DV0T 5AQMB 5LGNB 2E9XD 2FJBA 4U31A 1IBLT 2X0HA 4IHJE 4ZI7E 2BZBA 4KBMB 2KMFA 4L5GA 3AA6B 3C98B 4QXBB 5ETWA 5FVLA 5JDNA 4QXCB 3HL6A 5E0OA 5FY1A 5JR9A 3LBXB 2V6XA 4AQYT 2CWYA 3MJXA 4YT0A 3EAMA 5AQOB 2BG9B 4YTPA 2HH7A 2XQ8A 3A8YC 4PJNA 1G73A 2CRBA 3IF8B 3Q9DA 3T8OA 4AKGA 3AE8A 5L3CB 3N9LA 3W15B 1Z0PA 4WW0A 2FBWA 4HFVA 4OX9T 2WWUA 2DLRA 1N36T 4DMWA 4EXTA 4GK5E 4UV9B 1HFAA 5AQTB 3R6NA 3RIUA 3WI3A 4O4LE 2QVAA 3PU8A 4KHPT 3C50A 3UQ4A 2XQAA 3AE7A 3AEAA 3AE5A 4U7IA 4WBOA 3ZMTB 1FIOA 3U3IA 2W2UA 3RC8A 2VK9A 3PUXF 4DR5T 4CI3B 1W09A 2X9YA 2R6GF 1NEKA 2LEHA 2V8SV 1LVFA 1WR0A 1WR6A 1UURA 1XWMA 3C64A 4AIUA 2IIUA 5IYZE 3ZMVB 3WAJA 4LF6T 4UELA 2IW5B 4X20E 1OEDB 2JQKA 1D1CA 2MPKA 3ZSTA 3LSVA 2E5LT 3LFMA 3PV0F 3RYFE 5L2LA 1HNXT 2VKDA 3RQWA 3UUMA 3GA8A 3QB5A 1L0VA 4U2YA 3ZT7A 2LKHA 5LG4A 5L3BB 4DR4T 2CM0A 3GWHA 1R8IA 3ETVA 5CB4E 4PFOA 2XZEA 1EZ3A 4TX5A 4AI6A 2YOEA 4YLHA 2WZIA 1T98A 4P09A 2JQ9A 2XM2A 4I4TE 4CZZB 3CQCB 5H6RB 3EABA 2MYSA 2OA5A 1MMNA 5FXVA 4C90A 1W9RA 4B3ST 5JR9C 4U2ZA 2M6BA 3F2EA 3OBVE 3IEEA 3UU5A 2X0LB 4NUUA 2UU9T 2LRLA 3UQ7A 1N34T 3UFGA 4ZZCA 3P4QA 2IDOB 2P9BA 2QYWA 2WDRA 4EIWA 5ABHA 5JRCA 2NW8A 2BKPA 2L8KA 3P4PA 4LF7T 4F6RC 2LHRA 5AQLB 2V5CA 4HFDA 1HF8A 5AQFB 2WWVA 4O4HE 3RC3A 4LFAT 4HFEA 5KX5E 4AQFC 3BQLA 5HXEA 2YDSA 3SFDA 4GKKT 4ZI2C 3IBPA 1IJ6A 4TNVA 1OXZA 3UU6A 2V7MA 1BR1A 4KP3C 1ZV4X 2E2AA 3NBXX 2JJ9A 3ZJ1A 5ABEA 5J0ZA 4WZXA 4UV8B 3RYIE 4JI1T 3N2KE 2UUCT 1HS7A 3AE9A 2HPLA 4CI1B 4DV3T 2W61A 4F8HA 3H3AA 3Q5DA 1HX8A 3MA9A 5AQPB 2XM1A 4IGUA 5L3DB 1IBKT 2A3DA 5LHGB 1XNQT 4Z90A 2W62A 4ZXLA 5CFBA 2UXDT 3I9YA 3ETUA 3GMIA 1MMAA 3AEEA 5HWXA 4DV1T 5KDMC 5IWAT 4DUYT 3EUHA 4PFPA 2JMHA 4JI0T 3S4UA 2E9XC 3GN5B 2X68A
chains in the Genus database with same CATH topology
2MTQA 4DNDA 4BJNA 3N9OA 2CLYC 2UXXB 3EVYA 3RPUA 1WRDA 2VB6A 4K0UA 1AJ3A 1FMWA 3MXZA 4ZS3A 2WMNA 2MBGA 4EYYR 3O4XE 3K3QC 4AKIA 2DWGA 1LKXA 1MNDA 3Q2MA 3ZJ2A 2N2NA 2Q9QD 2I59A 5KMGP 3ZMZB 5M4YA 3PE0A 1IZNB 3VKGA 1U4QA 3PDYA 3ZPOA 4QX7B 3QK6A 2XQYA 5F3JA 3KV9A 2L3LA 4YFSA 2V7LA 3ZYLA 2K24A 3LJCA 4GYSA 4UF0A 4HTEA 5JQGE 2KT9A 5IHYA 1YW0A 4OHFA 4H9NC 3I9WA 2CLYB 2YK0A 3PUGA 2D0TA 5TAOA 2WBLA 4ZI3C 3KFWX 5JVDE 5JDQA 5C8YE 4DO0A 1B7TA 2X51A 3ONXA 2XAHB 3Q5XA 4PJJA 4ASKA 3N9MA 3ZCJA 5LJNA 4ZOLE 3WAKA 2E9XA 2YINA 4DMVA 4TUYE 1H7CA 1HCIA 2DWKA 4MLKA 1NWMX 1LVKA 4PK6A 2CWOA 4NUVA 5DQVA 3JC6C 4ZHQE 5JR9B 2V7JA 5FY7A 3TKLB 2KWHA 1SA0E 4OYJA 4X1IE 4H9QC 2ACXA 4PAGA 4C91A 1MIYA 3GN5A 3D0TA 3I1AA 4CXYA 2XAJB 2X66A 2CXLA 1YKHB 2BDEA 3ZLIA 3B13A 3DTOA 3L09A 2VKHA 4O8SA 4OYKA 1D1BA 1YKEB 2X9HA 5EK4A 2LSGA 3AVRA 3N2GE 4AXPA 4YHJA 1BR0A 3MK7C 1IJ5A 2LM9A 1D0XA 4ISSA 4EAHA 2KNDA 4KMCA 5L3EB 5GONE 2ES0A 3MZKB 3O1JA 1FMVA 2V7IA 3ZMUB 2IAKA 2JMKA 2GK9A 2D0UA 3N9PA 4EZHA 5LP6E 2XAQB 4ERRA 3PUSA 4GOUA 4PK4A 5JDMA 4I43B 5J2UE 2JQQA 3BK9A 4H9OC 2NWBA 1D1AA 2X67A 3FBLA 4IE6A 3OYZA 4H63H 5BMVE 4DBQA 2YU1A 5HXHA 1E1HB 4UVBB 3IHRA 4AKHA 5HXCA 3Q5WA 4OK0A 3FHNA 4IE5A 1ZHCA 1KNZA 3RYCE 2ZLYA 4OFZA 2CCQA 3PUAA 3ZN0B 4V1Av 5L3FB 3OJAA 1BR2A 5JRCB 2LE8A 3CQGB 3E08A 2W00A 3LG7A 1G8XA 2NW9A 2VASA 2IC6A 4CXWA 2A2FX 1FEWA 4MFRA 3UUNA 2C0SA 2LOSA 1WYCA 1LRZA 4IDZA 3HA4A 2V7KA 5FXZA 5F8PA 4PNIA 4XZCA 2PBIA 3O1IA 4U74A 3KV6A 3EDUA 3HKEE 3BQKA 2EHOC 1UX4A 5LA6E 5AFUL 4EYUA 4MHCA 2NTXA 4XBFB 3RH3A 3AA1B 3O9XA 4IE7A 3KBTA 2J1DG 3F57A 2CXFA 2DI4A 2WSSV 3MACA 4I50E 2XASB 5DABA 3ZCIA 5LXTE 1X79A 2NOXA 3KVBA 1UX5A 3CPZA 3K3NA 3UUXB 2PJQA 3C4ZA 4IE4A 1D0YA 2ZMAA 5FNVE 2RP4A 4QKNA 5HYAA 5JDFA 1BR4A 3N9NA 3P8CD 3N2OA 3FB2A 2QGSA 2LSYA 2X9XA 1HG5A 3NRXA 2D2SA 3HI2A 2ODUA 4QXHB 3VKHA 5H6QB 2Z6EA 2ZM2A 4DVDA 1S94A 1UCUA 2BVLA 5LBMA 1OWAA 4HE8A 4JEUB 2N9DA 1VRBA 4DBRA 2PFVA 5JDLA 4ADZA 5J2TE 5ADXL 3J9X1 4QX8B 2L9QA 4O4IE 3ZC0A 1WLXA 2E8IA 2CXDA 2LSJA 3E0ZA 3N5LA 5HWYA 5CA0E 3J7Yq 3ANWB 4TN7B 2VWAA 3I0OA 4AKLA 4BAYB 3SS1A 4EOZB 2Q9QB 2V26A 4PW8A 5LCYA 3LK42 5LGUB 2NP9A 2EHOA 3LBXA 4CI2B 4JUYA 2XAGB 3BQIA 2W0GA 2CE7A 4CXXA 1CUNA 1MIVA 4AQGA 4IE0A 5FMNA 3KV4A 4I55E 3ZC1A 4B6XA 3V5SA 4E7SA 4L0RA 3RX6A 4UXNB 3UFEA 3C4XA 2Y48B 4H9PC 4KUMB 5HXRA 2HPJA 2MOZA 4L9IA 3RRCA 4AKRB 4UIGA 4H9RC 4QHOA 3CX8B 4YJ3E 4ZI3D 5LJMA 4PJMA 2WMOA 2VL8A 1MMDA 2KLQA 2Y6XA 3UT5E 1O3XA 1D0ZA 3MKDA 3VU7H 4HN9A 4O2BE 1QUUA 3NRYA 5JH7E 3O1HA 3ESLA 2XTLA 3AVSA 4FJOA 2VKOA 4HGAA 4GK0E 2VKJA 3HR0A 2EHOD 4ZS2A 2WM9A 3ZEFB 4UVCB 3ZN1B 4TV8E 2NTYA 2LOPA 3FBZA 3OKQA 3KDSE 1MIWA 4G63A 4QWNB 4E7ZA 2DCFA 2YU2A 2XUEA 2Q9QC 3K8PC 4O4JE 4ANJA 3FXDB 5EZYE 4AI6A 3H37A 4H63V 3QC9A 4ILUA 4MBQA 4J2CA 3RYHE 3ZYMA 3AAIA 3E22E 3LK3B 5FXXA 3NZQA 3PU3A 2D5UA 3VHLA 1KK7A 2LT3A 4H9SE 2G0UA 2E9XB 2M67A 1SHZC 2Y8DA 5EK2A 4BJMA 2Q9QA 4HKAA 3AAEB 3UTKA 2K9AA 4ISTA 4G2AA 4IIJE 2A72A 2UXNB 4M1PA 4UVAB 2H7VC 3HKBE 3AA0B 4X1KE 3RKOA 2ZM8A 3N9QA 2JPFA 3R84B 3KINB 5EK3A 3AAAB 2LSIA 4WNKA 3CQXC 4YJ2E 5FXWA 1VOMA 2LSKA 4GYRA 3SRZA 5CA1E 4EZ4A 2H7OA 1WYBA 4PJLA 2LJLA 2DHRA 3LK2B 5JDGA 2JRKA 2XAFB 3M65A 3B57A 4P0AA 3PTRB 4ZI2D 3DP7A 4TV9E 1QSDA 1HTJF 2H3RA 2W63A 3CKDA 5LOVE 1Y64B 4U72A 4EB6E 3F31A 3CX7B 4XAXB 2CMRA 3RRWA 4HEAA 2NW7A 5FP3A 2ODVA 3PUQA 4PK5A 2BVMA 4AQFA 3EDVA 1ZKEA 5FY0A 2X9WA 1US7B 2K48A 3C51A 3JC6D 5LBQB 3AA7B 5L3GB 3C4WA 2SPCA 3AB3B 5JREA 1MMGA 2KXPB 4A56A 5HXSA 5DQWA 1MNEA 3L3PA 2RA1A 3SWHA 1HG2A 5JDHA 3CVRA 3K3OA 1IAPA 2C5IT 3KV5A 3SOLA 4Z8XA 3UULA 4TZ4C 3P7IA 2QA7A 2KINB 2ZM0A 4FI5A 2XHEB 1ZEEA 3NZPA 3KVAA 1V9DA 4N78D 2N1GA 2WAUA 1S35A 2V1DB 3HKCE 5DJQC 4P0BA 1NAFA 4X1YE 5LYJE 3ZYKA 2KWIB 3CX6B 4BA9A 4MALA 4WBNE 5LHIB 3I0QA 4O2AE 4GIWA 2K5BB 2C5JA 3KBUA 5FYMA 3V5UA 3DJBA 3FXEB 4JEHB 3PURA 2LHNA 2C5KT 5LHHB 5A1LA 1YD8G 4CQIA 5LGTB 3CWZB 3ANWA 4UF0B 3U78A 5HAXA 4JLEA 3OYXA 1U5PA 2DNXA 2EHOB 4UEMA 5J1GA 3ZMSB 2B1EA 2KZ7B 3A5XA 3CMLA 2IC9A 2PG8A 2CA5A 3QUJA 5LNKA 2CEAA 3HKDE 2YEVC 5LGNB 2E9XD 4IHJE 4ZI7E 2BZBA 4KBMB 2KMFA 4L5GA 3AA6B 3C98B 4QXBB 5ETWA 5JDNA 4QXCB 3HL6A 5E0OA 5FY1A 5JR9A 3LBXB 2CWYA 3MJXA 2HH7A 4PJNA 1G73A 3IF8B 3T8OA 3Q9DA 4AKGA 5L3CB 3N9LA 3W15B 1Z0PA 4WW0A 4HFVA 2WWUA 2DLRA 4DMWA 4EXTA 4GK5E 4UV9B 1HFAA 3R6NA 3WI3A 4O4LE 3PU8A 3C50A 4WBOA 3RC8A 3ZMTB 1FIOA 3U3IA 2VK9A 4CI3B 2X9YA 3IEEA 2LEHA 3C64A 1LVFA 1WR6A 3WAJA 5IYZE 3ZMVB 4UELA 2IW5B 4X20E 1D1CA 3LFMA 3RYFE 5L2LA 2VKDA 3UUMA 3GA8A 5LG4A 5L3BB 2CM0A 3GWHA 3ETVA 5CB4E 4PFOA 1EZ3A 4TX5A 4YLHA 1T98A 4P09A 4I4TE 4CZZB 3CQCB 5H6RB 2MYSA 2OA5A 1MMNA 5FXVA 4C90A 5JR9C 3F2EA 3OBVE 2X0LB 4NUUA 2P9BA 5JRCA 4EIWA 2NW8A 2L8KA 4F6RC 2LHRA 1HF8A 4O4HE 3RC3A 5KX5E 4AQFC 3BQLA 5HXEA 4ZI2C 3IBPA 1IJ6A 1OXZA 2V7MA 1BR1A 4KP3C 1ZV4X 3NBXX 2JJ9A 3ZJ1A 4UV8B 3RYIE 3N2KE 1HS7A 2HPLA 4CI1B 2W61A 3H3AA 5L3DB 1HX8A 3MA9A 4IGUA 2A3DA 5LHGB 2W62A 3I9YA 3ETUA 3GMIA 1MMAA 5HWXA 5KDMC 3EUHA 4PFPA 2JMHA 3S4UA 2E9XC 3GN5B 2X68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A72 A;  3CX7 B;  1ZV4 X;  2ACX A;  2DLR A;  4GOU A;  3C4X A;  4WNK A;  3C50 A;  4WBO A;  3CX6 B;  3QC9 A;  4L9I A;  4PNI A;  2PBI A;  3CX8 B;  3C4Z A;  4IGU A;  4YHJ A;  2I59 A;  3C51 A;  3C4W A;  3AB3 B;  1SHZ C;  2ES0 A;  1HTJ F;  3T8O A;  1IAP A; 
#chains in the Genus database with same CATH topology
 5AQN B;  2MTQ A;  3TLW A;  4DND A;  4BJN A;  1J1J A;  3N9O A;  2CLY C;  2UXX B;  2XQ9 A;  3EVY A;  3RPU A;  1WRD A;  2I0M A;  2VB6 A;  4ZZB A;  4K0U A;  4NXM T;  1AJ3 A;  1FMW A;  3MXZ A;  4ZS3 A;  2WMN A;  2MBG A;  4IRE A;  4EYY R;  3O4X E;  4CN6 A;  1I94 T;  3ONL C;  3K3Q C;  4EED A;  2KSR A;  3AEG A;  2I6H A;  4AKI A;  2DWG A;  2W4X A;  4ILB A;  1LKX A;  4EV6 A;  1MND A;  2YDR A;  4U7Y A;  3Q2M A;  3ZJ2 A;  2N2N A;  2WCA A;  2Q9Q D;  2I59 A;  5KMG P;  3ZMZ B;  1E2A A;  5M4Y A;  3OVU A;  3PUZ F;  3PE0 A;  1IZN B;  4IT4 A;  2VQE T;  3VKG A;  4DV4 T;  1U4Q A;  3JAF A;  3PDY A;  3TLV A;  3ZPO A;  4QX7 B;  3ZKR A;  3QK6 A;  3FZM B;  2XQY A;  4Q25 A;  5LMN T;  1XDO A;  5F3J A;  3KV9 A;  5FL0 A;  2L3L A;  4YFS A;  2V7L A;  3ZYL A;  4DV6 T;  2K24 A;  3RHW A;  1WCR A;  2VL0 A;  3LJC A;  4GYS A;  4LFC T;  4UF0 A;  4Z91 A;  1YXR A;  4HTE A;  3VR9 A;  5JQG E;  2KT9 A;  5IHY A;  1YW0 A;  4OHF A;  4H9N C;  3I9W A;  2CLY B;  2YK0 A;  3PUG A;  3Q5E A;  2J62 A;  2D0T A;  4I0U A;  5TAO A;  2LRK A;  3AE4 A;  2WBL A;  4ZI3 C;  2WQY A;  3KFW X;  5JVD E;  3OPC A;  5JDQ A;  5C8Y E;  2V6Y A;  4DO0 A;  1B7T A;  2X51 A;  3ONX A;  2XAH B;  3Q5X A;  4PJJ A;  4ASK A;  3N9M A;  3ZCJ A;  5AQI B;  4ZOL E;  4JI5 T;  3WAK A;  2E9X A;  2YIN A;  4DMV A;  2BG9 E;  1H7C A;  4TUY E;  1HCI A;  2DWK A;  4MLK A;  1NWM X;  5AQS B;  1LVK A;  4PK6 A;  2CWO A;  4NUV A;  1ZP0 A;  5DQV A;  3JC6 C;  1DU2 A;  4ZHQ E;  3CIR A;  5JR9 B;  3AE3 A;  5AQK B;  2V7J A;  5FY7 A;  3TKL B;  3X1D A;  2LKG A;  3EI0 A;  2KWH A;  1SA0 E;  4OYJ A;  4X1I E;  4H9Q C;  2ACX A;  5F5W A;  5LB7 B;  4PAG A;  4NPP A;  1MIY A;  3GN5 A;  3D0T A;  2WY2 A;  3I1A A;  2XAJ B;  4JI2 T;  4KI0 F;  2X66 A;  4UR9 A;  2CXL A;  1I6Z A;  1YKH B;  1JNZ A;  2BDE A;  3ZLI A;  3B13 A;  3DTO A;  3L09 A;  3P4W A;  2VKH A;  4O8S A;  4OYK A;  1D1B A;  1YKE B;  2X9H A;  5EK4 A;  2LSG A;  3P50 A;  3AVR A;  3N2G E;  4AXP A;  4YHJ A;  3UU4 A;  1BR0 A;  3MK7 C;  1IJ5 A;  1E7P A;  1UUS A;  2LM9 A;  1D0X A;  4X65 T;  4DV7 T;  4ISS A;  4EAH A;  5CJ5 A;  2V5D A;  4YTM A;  2FJA A;  2BBH A;  2KND A;  4KMC A;  5L3E B;  1IBM T;  5GON E;  2UUB T;  3LDQ B;  2ES0 A;  3MZK B;  4TWF A;  1T72 A;  3O1J A;  1FMV A;  2V7I A;  3ZMU B;  2IAK A;  2JMK A;  2GK9 A;  2IML A;  2D0U A;  1CHU A;  2XSB A;  3N9P A;  4EZH A;  5LP6 E;  2WDQ A;  1N32 T;  1WFD A;  2XAQ B;  2OV9 A;  3PUY F;  4ERR A;  3PUS A;  4GOU A;  5JTG A;  1W0A A;  4PK4 A;  2BS2 A;  4I43 B;  5JDM A;  5IUX A;  5J2U E;  2JQQ A;  5C2T A;  3BK9 A;  4H9O C;  2JQH A;  1D1A A;  2NWB A;  2X67 A;  3FBL A;  4IE6 A;  3OYZ A;  4H63 H;  5BMV E;  5L4H A;  4DR2 T;  4HWI B;  2YU1 A;  4DBQ A;  5HXH A;  1E1H B;  1SUM B;  1W0B A;  4UVB B;  2ZM6 T;  3RIA A;  3IHR A;  3ZT5 A;  4AKH A;  4ILA A;  5HXC A;  3Q5W A;  4OK0 A;  3FHN A;  4IE5 A;  1ZHC A;  4X64 T;  3CK6 A;  3RYC E;  2ZLY A;  4IDQ A;  4OFZ A;  1KNZ A;  4YXD A;  2CCQ A;  3PUA A;  3QNU A;  5AQJ B;  4NIQ A;  3ZN0 B;  4V1A v;  5L3F B;  3OJA A;  1BR2 A;  5JRC B;  2LE8 A;  3CQG B;  2W00 A;  3E08 A;  3LG7 A;  4DUZ T;  2BS4 A;  1G8X A;  2NW9 A;  2VAS A;  2BKO A;  2IC6 A;  4CXW A;  4JI3 T;  1J5W A;  2A2F X;  3AE2 A;  1FEW A;  3B5M A;  4MFR A;  2C0S A;  2LOS A;  3UUN A;  4DID B;  4KX6 A;  1WYC A;  1LRZ A;  3FZH B;  3HA4 A;  4IDZ A;  4DR7 T;  2V7K A;  5FXZ A;  5F8P A;  2M6I A;  4PNI A;  4XZC A;  2PBI A;  3O1I A;  4U74 A;  3KV6 A;  4JI4 T;  3UU8 A;  1NEN A;  3EDU A;  3BQK A;  2EHO C;  3HKE E;  4QH4 A;  2B76 A;  4GKJ T;  1UX4 A;  5LA6 E;  4ILC A;  5AFU L;  4EYU A;  2CHN A;  2NTX A;  4MHC A;  4XBF B;  2NR4 A;  3RH3 A;  1KF6 A;  2FJE A;  3AA1 B;  4IE7 A;  3VRA A;  3KBT A;  3O9X A;  4LF4 T;  2J1D G;  3F57 A;  5HCM A;  5ABF B;  3T1Y T;  4EGW A;  4JV5 T;  1YQ4 A;  2FUP A;  2CXF A;  3A7M A;  4HFI A;  2DI4 A;  4TNW A;  2WSS V;  2JIW A;  3MAC A;  4LMK A;  4I50 E;  4A97 A;  2HN2 A;  2XAS B;  5DAB A;  3ZCI A;  1X79 A;  2NOX A;  3KVB A;  5LXT E;  5AQV B;  4X62 T;  1UX5 A;  1XNR T;  3CPZ A;  1KNP A;  3K3N A;  4LF8 T;  3UUX B;  3RLF F;  2PJQ A;  4HWH A;  5L47 A;  3C4Z A;  4IE4 A;  2ACZ A;  2BS3 A;  1D0Y A;  2F4V T;  2ZMA A;  1M7K A;  5FNV E;  3SFE A;  3ABV A;  2RP4 A;  4QKN A;  5HYA A;  5JDF A;  1BR4 A;  4LMJ A;  3N9N A;  3P8C D;  3N2O A;  3FB2 A;  2QGS A;  2LSY A;  2X9X A;  2J47 A;  1T8B A;  1HG5 A;  3NRX A;  2D2S A;  3HI2 A;  1M62 A;  2ODU A;  4QXH B;  3VKH A;  5H6Q B;  2J4G A;  2Z6E A;  2ZM2 A;  4DVD A;  1S94 A;  1UCU A;  2BVL A;  2YKS A;  3JCF A;  5LBM A;  1OWA A;  4JBW F;  4HE8 A;  3PJA J;  4JEU B;  3PUV F;  5FVK A;  1Z8U A;  2N9D A;  2BBJ A;  1VRB A;  2CBI A;  4DBR A;  4HWD A;  2PFV A;  5JDL A;  1KEY A;  4ADZ A;  5LJN A;  5J2T E;  5ADX L;  4DV5 T;  3JAD A;  3J9X 1;  2MAW A;  4QX8 B;  2L9Q A;  4O4I E;  3ZC0 A;  1WLX A;  2E8I A;  2CXD A;  2LSJ A;  3E0Z A;  3L8R A;  3N5L A;  4EEB A;  5HWY A;  5CA0 E;  1X9B A;  3J7Y q;  4LF5 T;  3ANW B;  4TN7 B;  4QH5 A;  2VWA A;  2XJ7 A;  3I0O A;  4K0K T;  4AKL A;  4BAY B;  3SS1 A;  4EOZ B;  2Q9Q B;  3EHZ A;  2V26 A;  4HFH A;  4PW8 A;  3LK4 2;  5LCY A;  5LG3 A;  3RIU C;  5LGU B;  4JI8 T;  2NP9 A;  3FZF B;  3P4S A;  3TLT A;  2EHO A;  3LBX A;  3RF1 A;  4CI2 B;  2LLY A;  2K3W A;  1XZY A;  4JUY A;  4ZEY A;  2XAG B;  2W0G A;  3BQI A;  2CE7 A;  4CXX A;  1CUN A;  4B3T T;  2WZH A;  3NVO A;  1MIV A;  4KHZ F;  4C91 A;  4AQG A;  4IE0 A;  5FMN A;  2WP9 A;  3KV4 A;  4I55 E;  3ZC1 A;  3V5S A;  4B6X A;  4E7S A;  4YSZ A;  1XMQ T;  4L0R A;  2CBJ A;  2AE9 A;  3RX6 A;  4UXN B;  3UFE A;  3C4X A;  5HEU A;  2Y48 B;  4H9P C;  4KUM B;  5HXR A;  2HPJ A;  2MOZ A;  4L9I A;  3RRC A;  4AKR B;  4UIG A;  4H9R C;  4QHO A;  3CX8 B;  4YJ3 E;  4ZI3 D;  3JAE A;  5LJM A;  4PJM A;  2WMO A;  2VL8 A;  4WYV A;  1MMD A;  2KLQ A;  4QH1 A;  2Y6X A;  4LFB T;  5HEG A;  3UT5 E;  1KFY A;  1O3X A;  1D0Z A;  2VUR A;  3FZK B;  3MKD A;  3VU7 H;  4HN9 A;  4O2B E;  1QUU A;  3NRY A;  5JH7 E;  3O1H A;  3ESL A;  2XTL A;  5ABG A;  3AVS A;  4FJO A;  1HR0 T;  1OED A;  2VKO A;  4HGA A;  4GK0 E;  2VKJ A;  3AE6 A;  2EHO D;  2XSA A;  2WM9 A;  3HR0 A;  4ZS2 A;  3ZEF B;  4YSY A;  3QB5 K;  4UVC B;  3ZN1 B;  1HNW T;  4TV8 E;  4AIS A;  2NTY A;  2OLT A;  2VVS A;  2LOP A;  4IL4 A;  3FBZ A;  3OKQ A;  2WS3 A;  4A98 A;  3KDS E;  1MIW A;  5FL1 A;  4G63 A;  4QWN B;  4E7Z A;  2DCF A;  2YU2 A;  5AQR B;  2XUE A;  2Q9Q C;  3K8P C;  4O4J E;  4IDP A;  4ANJ A;  3FXD B;  3AXJ A;  5EZY E;  3H37 A;  3FZL B;  4H63 V;  4DV2 T;  3QC9 A;  4ILU A;  5AQG B;  2UUA T;  3RQU A;  3PUW F;  4MBQ A;  4J2C A;  1GQE A;  4HFC A;  4IDN A;  3RYH E;  3ZYM A;  1OED C;  3AAI A;  3E22 E;  3LK3 B;  4U33 A;  4A5X A;  4YY3 T;  4JI6 T;  5FXX A;  3NZQ A;  3PU3 A;  4B3M T;  3AED A;  2D5U A;  3VHL A;  1KK7 A;  2LT3 A;  4H9S E;  2G0U A;  2E9X B;  2M67 A;  1SHZ C;  3AEF A;  2XQ4 A;  2Y8D A;  3ONJ A;  5EK2 A;  4BJM A;  2Q9Q A;  4HKA A;  3AAE B;  3UTK A;  2K9A A;  1VCT A;  4IST A;  4G2A A;  4CXY A;  1SE7 A;  2H88 A;  2RPA A;  3AEC A;  2A72 A;  2BKN A;  4IIJ E;  3RI5 A;  2UXN B;  4M1P A;  4UVA B;  5HEJ A;  2HHH T;  4P1N A;  2H7V C;  3HKB E;  3AA0 B;  4X1K E;  4X5T A;  2ZM8 A;  5HCJ A;  3RKO A;  3N9Q A;  2JPF A;  3NKZ A;  3KIN B;  5EK3 A;  3R84 B;  3AAA B;  2LSI A;  3NWI A;  4WNK A;  3TLS A;  2UXC T;  3CQX C;  4YJ2 E;  4TWD A;  5FXW A;  1VOM A;  2LSK A;  4GYR A;  3VR8 A;  3SRZ A;  5CA1 E;  2YDQ A;  4EZ4 A;  3OTO T;  2YN6 A;  2VVN A;  2H7O A;  1FJG T;  1WYB A;  4PJL A;  2LJL A;  2DHR A;  5FKY A;  3H3M A;  1J5E T;  2WDV A;  3LK2 B;  4IL9 A;  1UGO A;  2JRK A;  2XAF B;  3M65 A;  4HWF A;  5JDG A;  4HFB A;  1T7S A;  4X66 T;  3B57 A;  4P0A A;  3T1H T;  3PTR B;  3PJA A;  3TLU A;  3DP7 A;  2CPT A;  4TV9 E;  1QSD A;  4ZI2 D;  4DR3 T;  1HTJ F;  1KNR A;  2H3R A;  2W63 A;  3CKD A;  3IA3 A;  5LOV E;  4LF9 T;  1Y64 B;  2DL1 A;  2FJD A;  4U72 A;  2VQF T;  2H89 A;  3ZT6 A;  4EB6 E;  2AXD S;  3F31 A;  3CX7 B;  2LM2 A;  4XAX B;  2CMR A;  3RRW A;  4HEA A;  1Y01 A;  2NW7 A;  2ODV A;  5FP3 A;  5ABF A;  3PUQ A;  4PK5 A;  3UUB A;  2BVM A;  1UK5 A;  4AQF A;  3EDV A;  5KXJ A;  2X0Y A;  1HNZ T;  2E5V A;  2WB5 A;  4U3C A;  1ZKE A;  5FY0 A;  3RGL A;  5C3J A;  3QOF A;  2X9W A;  2XQ3 A;  1US7 B;  2K48 A;  2UXB T;  5CGM A;  3C51 A;  2BG9 A;  3AXJ B;  3AA7 B;  3JC6 D;  3M3Z B;  3K1S A;  4IDO A;  3C4W A;  5LBQ B;  3UU3 A;  5L3G B;  2SPC A;  2W66 A;  3AB3 B;  5JRE A;  4DR6 T;  1VCS A;  1MMG A;  2KXP B;  2A9U A;  4A56 A;  5DQW A;  5AQH B;  4YTN A;  1MNE A;  3L3P A;  3P4R A;  2RA1 A;  3SWH A;  1YQ3 A;  3AE1 A;  1XMO T;  1HG2 A;  1XDP A;  2WU2 A;  2QRX A;  5HEH A;  3CVR A;  3K3O A;  5HEO A;  5JDH A;  1IAP A;  2C5I T;  3G06 A;  3KV5 A;  3SOL A;  2WU5 A;  1N33 T;  4Z8X A;  3UUL A;  4TZ4 C;  3P7I A;  2IHR 1;  2QA7 A;  2KIN B;  3VRB A;  2HN1 A;  2ZM0 A;  4FI5 A;  2XHE B;  1ZEE A;  1QLB A;  3NZP A;  3RIF A;  3KVA A;  1V9D A;  2BG9 C;  2N1G A;  2WAU A;  4N78 D;  1S35 A;  2V1D B;  3HKC E;  4LML A;  5DJQ C;  2IUB A;  4P0B A;  1NAF A;  4X1Y E;  2XPK A;  3ZYK A;  2KWI B;  3CX6 B;  4BA9 A;  4CN1 A;  2XQ5 A;  5LYJ E;  4MAL A;  4JI7 T;  4WBN E;  5LHI B;  3I0Q A;  4O2A E;  2CHO A;  2XQ6 A;  2K5B B;  4GIW A;  2C5J A;  4YSX A;  3KBU A;  5FYM A;  2D9D A;  2V6Y B;  3V5U A;  3DJB A;  3FXE B;  4COF A;  4JEH B;  3PUR A;  4DR1 T;  2LHN A;  2C5K T;  5LHH B;  5A1L A;  4NXN T;  1YD8 G;  4CQI A;  4TWH A;  5LGT B;  5HXS A;  3CWZ B;  3ANW A;  4JYA T;  4UF0 B;  5BR8 T;  3U78 A;  5HAX A;  4JLE A;  3AEB A;  2XY8 B;  3OYX A;  1JNR A;  3RKG A;  1U5P A;  2DNX A;  5L4E A;  1HX1 B;  2EHO B;  4UEM A;  5AQQ B;  5J1G A;  2W67 A;  3ZMS B;  2PTF A;  2B1E A;  2KZ7 B;  3L39 A;  4CN4 A;  4YHH T;  3A5X A;  3CML A;  3ZSS A;  2IC9 A;  2PG8 A;  4B3R T;  2CA5 A;  3QUJ A;  1ZOY A;  1OED E;  5LNK A;  2CEA A;  3HKD E;  5LMU T;  4HWC A;  2YEV C;  2XQ7 A;  5AQU B;  4DV0 T;  5AQM B;  5LGN B;  2E9X D;  2FJB A;  4U31 A;  1IBL T;  2X0H A;  4IHJ E;  4ZI7 E;  2BZB A;  4KBM B;  2KMF A;  4L5G A;  3AA6 B;  3C98 B;  4QXB B;  5ETW A;  5FVL A;  5JDN A;  4QXC B;  3HL6 A;  5E0O A;  5FY1 A;  5JR9 A;  3LBX B;  2V6X A;  4AQY T;  2CWY A;  3MJX A;  4YT0 A;  3EAM A;  5AQO B;  2BG9 B;  4YTP A;  2HH7 A;  2XQ8 A;  3A8Y C;  4PJN A;  1G73 A;  2CRB A;  3IF8 B;  3Q9D A;  3T8O A;  4AKG A;  3AE8 A;  5L3C B;  3N9L A;  3W15 B;  1Z0P A;  4WW0 A;  2FBW A;  4HFV A;  4OX9 T;  2WWU A;  2DLR A;  1N36 T;  4DMW A;  4EXT A;  4GK5 E;  4UV9 B;  1HFA A;  5AQT B;  3R6N A;  3RIU A;  3WI3 A;  4O4L E;  2QVA A;  3PU8 A;  4KHP T;  3C50 A;  3UQ4 A;  2XQA A;  3AE7 A;  3AEA A;  3AE5 A;  4U7I A;  4WBO A;  3ZMT B;  1FIO A;  3U3I A;  2W2U A;  3RC8 A;  2VK9 A;  3PUX F;  4DR5 T;  4CI3 B;  1W09 A;  2X9Y A;  2R6G F;  1NEK A;  2LEH A;  2V8S V;  1LVF A;  1WR0 A;  1WR6 A;  1UUR A;  1XWM A;  3C64 A;  4AIU A;  2IIU A;  5IYZ E;  3ZMV B;  3WAJ A;  4LF6 T;  4UEL A;  2IW5 B;  4X20 E;  1OED B;  2JQK A;  1D1C A;  2MPK A;  3ZST A;  3LSV A;  2E5L T;  3LFM A;  3PV0 F;  3RYF E;  5L2L A;  1HNX T;  2VKD A;  3RQW A;  3UUM A;  3GA8 A;  3QB5 A;  1L0V A;  4U2Y A;  3ZT7 A;  2LKH A;  5LG4 A;  5L3B B;  4DR4 T;  2CM0 A;  3GWH A;  1R8I A;  3ETV A;  5CB4 E;  4PFO A;  2XZE A;  1EZ3 A;  4TX5 A;  4AI6 A;  2YOE A;  4YLH A;  2WZI A;  1T98 A;  4P09 A;  2JQ9 A;  2XM2 A;  4I4T E;  4CZZ B;  3CQC B;  5H6R B;  3EAB A;  2MYS A;  2OA5 A;  1MMN A;  5FXV A;  4C90 A;  1W9R A;  4B3S T;  5JR9 C;  4U2Z A;  2M6B A;  3F2E A;  3OBV E;  3IEE A;  3UU5 A;  2X0L B;  4NUU A;  2UU9 T;  2LRL A;  3UQ7 A;  1N34 T;  3UFG A;  4ZZC A;  3P4Q A;  2IDO B;  2P9B A;  2QYW A;  2WDR A;  4EIW A;  5ABH A;  5JRC A;  2NW8 A;  2BKP A;  2L8K A;  3P4P A;  4LF7 T;  4F6R C;  2LHR A;  5AQL B;  2V5C A;  4HFD A;  1HF8 A;  5AQF B;  2WWV A;  4O4H E;  3RC3 A;  4LFA T;  4HFE A;  5KX5 E;  4AQF C;  3BQL A;  5HXE A;  2YDS A;  3SFD A;  4GKK T;  4ZI2 C;  3IBP A;  1IJ6 A;  4TNV A;  1OXZ A;  3UU6 A;  2V7M A;  1BR1 A;  4KP3 C;  1ZV4 X;  2E2A A;  3NBX X;  2JJ9 A;  3ZJ1 A;  5ABE A;  5J0Z A;  4WZX A;  4UV8 B;  3RYI E;  4JI1 T;  3N2K E;  2UUC T;  1HS7 A;  3AE9 A;  2HPL A;  4CI1 B;  4DV3 T;  2W61 A;  4F8H A;  3H3A A;  3Q5D A;  1HX8 A;  3MA9 A;  5AQP B;  2XM1 A;  4IGU A;  5L3D B;  1IBK T;  2A3D A;  5LHG B;  1XNQ T;  4Z90 A;  2W62 A;  4ZXL A;  5CFB A;  2UXD T;  3I9Y A;  3ETU A;  3GMI A;  1MMA A;  3AEE A;  5HWX A;  4DV1 T;  5KDM C;  5IWA T;  4DUY T;  3EUH A;  4PFP A;  2JMH A;  4JI0 T;  3S4U A;  2E9X C;  3GN5 B;  2X68 A; 
#chains in the Genus database with same CATH homology
 2MTQ A;  4DND A;  4BJN A;  3N9O A;  2CLY C;  2UXX B;  3EVY A;  3RPU A;  1WRD A;  2VB6 A;  4K0U A;  1AJ3 A;  1FMW A;  3MXZ A;  4ZS3 A;  2WMN A;  2MBG A;  4EYY R;  3O4X E;  3K3Q C;  4AKI A;  2DWG A;  1LKX A;  1MND A;  3Q2M A;  3ZJ2 A;  2N2N A;  2Q9Q D;  2I59 A;  5KMG P;  3ZMZ B;  5M4Y A;  3PE0 A;  1IZN B;  3VKG A;  1U4Q A;  3PDY A;  3ZPO A;  4QX7 B;  3QK6 A;  2XQY A;  5F3J A;  3KV9 A;  2L3L A;  4YFS A;  2V7L A;  3ZYL A;  2K24 A;  3LJC A;  4GYS A;  4UF0 A;  4HTE A;  5JQG E;  2KT9 A;  5IHY A;  1YW0 A;  4OHF A;  4H9N C;  3I9W A;  2CLY B;  2YK0 A;  3PUG A;  2D0T A;  5TAO A;  2WBL A;  4ZI3 C;  3KFW X;  5JVD E;  5JDQ A;  5C8Y E;  4DO0 A;  1B7T A;  2X51 A;  3ONX A;  2XAH B;  3Q5X A;  4PJJ A;  4ASK A;  3N9M A;  3ZCJ A;  5LJN A;  4ZOL E;  3WAK A;  2E9X A;  2YIN A;  4DMV A;  4TUY E;  1H7C A;  1HCI A;  2DWK A;  4MLK A;  1NWM X;  1LVK A;  4PK6 A;  2CWO A;  4NUV A;  5DQV A;  3JC6 C;  4ZHQ E;  5JR9 B;  2V7J A;  5FY7 A;  3TKL B;  2KWH A;  1SA0 E;  4OYJ A;  4X1I E;  4H9Q C;  2ACX A;  4PAG A;  4C91 A;  1MIY A;  3GN5 A;  3D0T A;  3I1A A;  4CXY A;  2XAJ B;  2X66 A;  2CXL A;  1YKH B;  2BDE A;  3ZLI A;  3B13 A;  3DTO A;  3L09 A;  2VKH A;  4O8S A;  4OYK A;  1D1B A;  1YKE B;  2X9H A;  5EK4 A;  2LSG A;  3AVR A;  3N2G E;  4AXP A;  4YHJ A;  1BR0 A;  3MK7 C;  1IJ5 A;  2LM9 A;  1D0X A;  4ISS A;  4EAH A;  2KND A;  4KMC A;  5L3E B;  5GON E;  2ES0 A;  3MZK B;  3O1J A;  1FMV A;  2V7I A;  3ZMU B;  2IAK A;  2JMK A;  2GK9 A;  2D0U A;  3N9P A;  4EZH A;  5LP6 E;  2XAQ B;  4ERR A;  3PUS A;  4GOU A;  4PK4 A;  5JDM A;  4I43 B;  5J2U E;  2JQQ A;  3BK9 A;  4H9O C;  2NWB A;  1D1A A;  2X67 A;  3FBL A;  4IE6 A;  3OYZ A;  4H63 H;  5BMV E;  4DBQ A;  2YU1 A;  5HXH A;  1E1H B;  4UVB B;  3IHR A;  4AKH A;  5HXC A;  3Q5W A;  4OK0 A;  3FHN A;  4IE5 A;  1ZHC A;  1KNZ A;  3RYC E;  2ZLY A;  4OFZ A;  2CCQ A;  3PUA A;  3ZN0 B;  4V1A v;  5L3F B;  3OJA A;  1BR2 A;  5JRC B;  2LE8 A;  3CQG B;  3E08 A;  2W00 A;  3LG7 A;  1G8X A;  2NW9 A;  2VAS A;  2IC6 A;  4CXW A;  2A2F X;  1FEW A;  4MFR A;  3UUN A;  2C0S A;  2LOS A;  1WYC A;  1LRZ A;  4IDZ A;  3HA4 A;  2V7K A;  5FXZ A;  5F8P A;  4PNI A;  4XZC A;  2PBI A;  3O1I A;  4U74 A;  3KV6 A;  3EDU A;  3HKE E;  3BQK A;  2EHO C;  1UX4 A;  5LA6 E;  5AFU L;  4EYU A;  4MHC A;  2NTX A;  4XBF B;  3RH3 A;  3AA1 B;  3O9X A;  4IE7 A;  3KBT A;  2J1D G;  3F57 A;  2CXF A;  2DI4 A;  2WSS V;  3MAC A;  4I50 E;  2XAS B;  5DAB A;  3ZCI A;  5LXT E;  1X79 A;  2NOX A;  3KVB A;  1UX5 A;  3CPZ A;  3K3N A;  3UUX B;  2PJQ A;  3C4Z A;  4IE4 A;  1D0Y A;  2ZMA A;  5FNV E;  2RP4 A;  4QKN A;  5HYA A;  5JDF A;  1BR4 A;  3N9N A;  3P8C D;  3N2O A;  3FB2 A;  2QGS A;  2LSY A;  2X9X A;  1HG5 A;  3NRX A;  2D2S A;  3HI2 A;  2ODU A;  4QXH B;  3VKH A;  5H6Q B;  2Z6E A;  2ZM2 A;  4DVD A;  1S94 A;  1UCU A;  2BVL A;  5LBM A;  1OWA A;  4HE8 A;  4JEU B;  2N9D A;  1VRB A;  4DBR A;  2PFV A;  5JDL A;  4ADZ A;  5J2T E;  5ADX L;  3J9X 1;  4QX8 B;  2L9Q A;  4O4I E;  3ZC0 A;  1WLX A;  2E8I A;  2CXD A;  2LSJ A;  3E0Z A;  3N5L A;  5HWY A;  5CA0 E;  3J7Y q;  3ANW B;  4TN7 B;  2VWA A;  3I0O A;  4AKL A;  4BAY B;  3SS1 A;  4EOZ B;  2Q9Q B;  2V26 A;  4PW8 A;  5LCY A;  3LK4 2;  5LGU B;  2NP9 A;  2EHO A;  3LBX A;  4CI2 B;  4JUY A;  2XAG B;  3BQI A;  2W0G A;  2CE7 A;  4CXX A;  1CUN A;  1MIV A;  4AQG A;  4IE0 A;  5FMN A;  3KV4 A;  4I55 E;  3ZC1 A;  4B6X A;  3V5S A;  4E7S A;  4L0R A;  3RX6 A;  4UXN B;  3UFE A;  3C4X A;  2Y48 B;  4H9P C;  4KUM B;  5HXR A;  2HPJ A;  2MOZ A;  4L9I A;  3RRC A;  4AKR B;  4UIG A;  4H9R C;  4QHO A;  3CX8 B;  4YJ3 E;  4ZI3 D;  5LJM A;  4PJM A;  2WMO A;  2VL8 A;  1MMD A;  2KLQ A;  2Y6X A;  3UT5 E;  1O3X A;  1D0Z A;  3MKD A;  3VU7 H;  4HN9 A;  4O2B E;  1QUU A;  3NRY A;  5JH7 E;  3O1H A;  3ESL A;  2XTL A;  3AVS A;  4FJO A;  2VKO A;  4HGA A;  4GK0 E;  2VKJ A;  3HR0 A;  2EHO D;  4ZS2 A;  2WM9 A;  3ZEF B;  4UVC B;  3ZN1 B;  4TV8 E;  2NTY A;  2LOP A;  3FBZ A;  3OKQ A;  3KDS E;  1MIW A;  4G63 A;  4QWN B;  4E7Z A;  2DCF A;  2YU2 A;  2XUE A;  2Q9Q C;  3K8P C;  4O4J E;  4ANJ A;  3FXD B;  5EZY E;  4AI6 A;  3H37 A;  4H63 V;  3QC9 A;  4ILU A;  4MBQ A;  4J2C A;  3RYH E;  3ZYM A;  3AAI A;  3E22 E;  3LK3 B;  5FXX A;  3NZQ A;  3PU3 A;  2D5U A;  3VHL A;  1KK7 A;  2LT3 A;  4H9S E;  2G0U A;  2E9X B;  2M67 A;  1SHZ C;  2Y8D A;  5EK2 A;  4BJM A;  2Q9Q A;  4HKA A;  3AAE B;  3UTK A;  2K9A A;  4IST A;  4G2A A;  4IIJ E;  2A72 A;  2UXN B;  4M1P A;  4UVA B;  2H7V C;  3HKB E;  3AA0 B;  4X1K E;  3RKO A;  2ZM8 A;  3N9Q A;  2JPF A;  3R84 B;  3KIN B;  5EK3 A;  3AAA B;  2LSI A;  4WNK A;  3CQX C;  4YJ2 E;  5FXW A;  1VOM A;  2LSK A;  4GYR A;  3SRZ A;  5CA1 E;  4EZ4 A;  2H7O A;  1WYB A;  4PJL A;  2LJL A;  2DHR A;  3LK2 B;  5JDG A;  2JRK A;  2XAF B;  3M65 A;  3B57 A;  4P0A A;  3PTR B;  4ZI2 D;  3DP7 A;  4TV9 E;  1QSD A;  1HTJ F;  2H3R A;  2W63 A;  3CKD A;  5LOV E;  1Y64 B;  4U72 A;  4EB6 E;  3F31 A;  3CX7 B;  4XAX B;  2CMR A;  3RRW A;  4HEA A;  2NW7 A;  5FP3 A;  2ODV A;  3PUQ A;  4PK5 A;  2BVM A;  4AQF A;  3EDV A;  1ZKE A;  5FY0 A;  2X9W A;  1US7 B;  2K48 A;  3C51 A;  3JC6 D;  5LBQ B;  3AA7 B;  5L3G B;  3C4W A;  2SPC A;  3AB3 B;  5JRE A;  1MMG A;  2KXP B;  4A56 A;  5HXS A;  5DQW A;  1MNE A;  3L3P A;  2RA1 A;  3SWH A;  1HG2 A;  5JDH A;  3CVR A;  3K3O A;  1IAP A;  2C5I T;  3KV5 A;  3SOL A;  4Z8X A;  3UUL A;  4TZ4 C;  3P7I A;  2QA7 A;  2KIN B;  2ZM0 A;  4FI5 A;  2XHE B;  1ZEE A;  3NZP A;  3KVA A;  1V9D A;  4N78 D;  2N1G A;  2WAU A;  1S35 A;  2V1D B;  3HKC E;  5DJQ C;  4P0B A;  1NAF A;  4X1Y E;  5LYJ E;  3ZYK A;  2KWI B;  3CX6 B;  4BA9 A;  4MAL A;  4WBN E;  5LHI B;  3I0Q A;  4O2A E;  4GIW A;  2K5B B;  2C5J A;  3KBU A;  5FYM A;  3V5U A;  3DJB A;  3FXE B;  4JEH B;  3PUR A;  2LHN A;  2C5K T;  5LHH B;  5A1L A;  1YD8 G;  4CQI A;  5LGT B;  3CWZ B;  3ANW A;  4UF0 B;  3U78 A;  5HAX A;  4JLE A;  3OYX A;  1U5P A;  2DNX A;  2EHO B;  4UEM A;  5J1G A;  3ZMS B;  2B1E A;  2KZ7 B;  3A5X A;  3CML A;  2IC9 A;  2PG8 A;  2CA5 A;  3QUJ A;  5LNK A;  2CEA A;  3HKD E;  2YEV C;  5LGN B;  2E9X D;  4IHJ E;  4ZI7 E;  2BZB A;  4KBM B;  2KMF A;  4L5G A;  3AA6 B;  3C98 B;  4QXB B;  5ETW A;  5JDN A;  4QXC B;  3HL6 A;  5E0O A;  5FY1 A;  5JR9 A;  3LBX B;  2CWY A;  3MJX A;  2HH7 A;  4PJN A;  1G73 A;  3IF8 B;  3T8O A;  3Q9D A;  4AKG A;  5L3C B;  3N9L A;  3W15 B;  1Z0P A;  4WW0 A;  4HFV A;  2WWU A;  2DLR A;  4DMW A;  4EXT A;  4GK5 E;  4UV9 B;  1HFA A;  3R6N A;  3WI3 A;  4O4L E;  3PU8 A;  3C50 A;  4WBO A;  3RC8 A;  3ZMT B;  1FIO A;  3U3I A;  2VK9 A;  4CI3 B;  2X9Y A;  3IEE A;  2LEH A;  3C64 A;  1LVF A;  1WR6 A;  3WAJ A;  5IYZ E;  3ZMV B;  4UEL A;  2IW5 B;  4X20 E;  1D1C A;  3LFM A;  3RYF E;  5L2L A;  2VKD A;  3UUM A;  3GA8 A;  5LG4 A;  5L3B B;  2CM0 A;  3GWH A;  3ETV A;  5CB4 E;  4PFO A;  1EZ3 A;  4TX5 A;  4YLH A;  1T98 A;  4P09 A;  4I4T E;  4CZZ B;  3CQC B;  5H6R B;  2MYS A;  2OA5 A;  1MMN A;  5FXV A;  4C90 A;  5JR9 C;  3F2E A;  3OBV E;  2X0L B;  4NUU A;  2P9B A;  5JRC A;  4EIW A;  2NW8 A;  2L8K A;  4F6R C;  2LHR A;  1HF8 A;  4O4H E;  3RC3 A;  5KX5 E;  4AQF C;  3BQL A;  5HXE A;  4ZI2 C;  3IBP A;  1IJ6 A;  1OXZ A;  2V7M A;  1BR1 A;  4KP3 C;  1ZV4 X;  3NBX X;  2JJ9 A;  3ZJ1 A;  4UV8 B;  3RYI E;  3N2K E;  1HS7 A;  2HPL A;  4CI1 B;  2W61 A;  3H3A A;  5L3D B;  1HX8 A;  3MA9 A;  4IGU A;  2A3D A;  5LHG B;  2W62 A;  3I9Y A;  3ETU A;  3GMI A;  1MMA A;  5HWX A;  5KDM C;  3EUH A;  4PFP A;  2JMH A;  3S4U A;  2E9X C;  3GN5 B;  2X68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...