3CX6B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
185
Chain Sequence
LIIGPEEESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein alpha-13 subunit
total genus 63
structure length 185
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx6B00
2I59A 2DLRA 3AB3B 2ACXA 3C4ZA 4IGUA 4PNIA 3C50A 3C4XA 4YHJA 3C51A 4WNKA 3QC9A 2PBIA 3CX6B 2A72A 4L9IA 3CX7B 1SHZC 1IAPA 1ZV4X 3T8OA 3C4WA 1HTJF 3CX8B 4WBOA 2ES0A 4GOUA
chains in the Genus database with same CATH superfamily
2XQ5A 2I59A 2LE8A 3VHLA 2LSJA 3AEFA 1KK7A 1N33T 4YXDA 2WDRA 3A7MA 4IE5A 2JPFA 1VRBA 2X66A 1QSDA 1WCRA 2BKNA 2DWKA 2NW8A 2N1GA 2YOEA 3FZLB 5FNVE 3PURA 4DR2T 4QXHB 2BG9E 2PFVA 4Z8XA 1CHUA 4WW0A 3PJAA 4YHJA 3BQIA 1HS7A 1WR0A 4O2AE 5FY0A 5FYMA 4DUYT 2YEVC 1S94A 3AE8A 3OTOT 1I94T 3VR8A 3GN5A 4ISSA 4A97A 2W2UA 4OX9T 2BVLA 2IDOB 3GMIA 2HHHT 4IREA 3R6NA 1S35A 2UXBT 2A2FX 3B57A 1ZV4X 5JDMA 4EOZB 2LM9A 1US7B 2X68A 4P0BA 5C3JA 3C98B 2VWAA 2W63A 3CWZB 3VR9A 5LCYA 4EZHA 3H3AA 2H7OA 5LBQB 5J2TE 5EK4A 3K3NA 2WZIA 1UUSA 4O8SA 2MYSA 4YJ2E 2C0SA 2HPLA 3EDVA 2RA1A 2LOPA 1D0YA 5ABEA 2XQ6A 2L8KA 2MOZA 1J1JA 4HKAA 4KUMB 1M7KA 5JR9C 2OA5A 5LHHB 4ERRA 4TNWA 3FZHB 4LF5T 3PUZF 1W09A 4AQYT 2WWVA 4MLKA 4X66T 1YQ4A 3OYXA 3QC9A 4ZI2C 2V6XA 5LMNT 2Y8DA 2MBGA 1XZYA 4JI5T 3UUXB 4V1Av 4YSXA 4H9SE 2CXFA 5FXXA 2XQYA 2KWHA 2X9YA 3I0QA 5AQMB 4HFHA 2ZM0A 4XZCA 5EK3A 3RIUA 3L3PA 3LDQB 3LBXB 2HPJA 3RYCE 2MTQA 5L4EA 5L2LA 4DUZT 2LRKA 1E1HB 1BR4A 3N9MA 3ZMZB 3AE5A 1SUMB 2C5JA 2YDSA 5JTGA 3O1IA 1Y01A 2VK9A 4H63V 3RPUA 1D1CA 4TUYE 4B3MT 4JI1T 2X0HA 2CLYC 3BQLA 4IIJE 5IWAT 4HFVA 4TN7B 4JI0T 3RC8A 2CLYB 3FZKB 5BMVE 4LF9T 2PG8A 2H7VC 5LGTB 3IEEA 5FXWA 1ZOYA 2FUPA 1NENA 1OEDE 2WP9A 3AE1A 2PBIA 3SOLA 1OEDB 2QYWA 4F8HA 4CXYA 1ZKEA 2FBWA 2A72A 1FIOA 2IMLA 2LSYA 4GYRA 2OLTA 4KX6A 3RHWA 3ZYMA 4CZZB 5KMGP 5A1LA 3QOFA 2WMNA 3RC3A 2D0TA 2AXDS 4GKJT 3ETUA 2XASB 5LBMA 1FMVA 1MMAA 4DV3T 5AQVB 4O4HE 2LHNA 1LVFA 2NW7A 3RIFA 4GOUA 2E9XC 2A9UA 5HCMA 3ZSSA 4DBQA 4DO0A 4HFCA 5J2UE 4QXBB 1WFDA 1YKEB 4TNVA 1FEWA 2DL1A 3CK6A 3ZJ2A 4ZXLA 1D0XA 4Q25A 3P4RA 5H6RB 4AISA 2UXDT 4B3ST 2XAJB 2DI4A 3ZC0A 3QUJA 3RKOA 1UX4A 4G63A 5F5WA 1LKXA 5FXVA 4I50E 3AEBA 3RGLA 2H89A 3DJBA 2JQQA 5AFUL 1I6ZA 3EVYA 3AAEB 2RPAA 3LK42 2XSBA 4PK6A 4QHOA 4ZI7E 4X65T 3MA9A 4EAHA 3CX7B 4CN1A 2VKOA 1N32T 1IAPA 2D9DA 2LKGA 4HFIA 4HWIB 3T1YT 2XTLA 3CMLA 3RKGA 3SRZA 5JR9B 3AEEA 4DNDA 3KBTA 3QB5A 5AQHB 4DR3T 4DR1T 5DQVA 2LEHA 4JI7T 2NTYA 4GYSA 5CA0E 2NTXA 3UU4A 2EHOC 4NUUA 1WYCA 4AKLA 4LF6T 3AB3B 3ZT7A 4JI3T 3C4ZA 4KHZF 5LYJE 4HFDA 1ZHCA 4ILUA 4LFCT 3G06A 2V7IA 1FJGT 5LG4A 4H9NC 3AA1B 2BDEA 3A5XA 1UX5A 1Y64B 3PTRB 4N78D 4TV9E 2J47A 5AQOB 2KWIB 2QA7A 4XAXB 5HEGA 3TLSA 3AA6B 4DV2T 4DV5T 3AAIA 3TLWA 5JH7E 4ANJA 4U2ZA 3NRXA 3SFDA 4YTMA 5JDHA 4FI5A 4MFRA 2XUEA 5AQIB 3RRCA 1T98A 2NWBA 1MMGA 1D1AA 1MIYA 2V7KA 3CX8B 3Q9DA 2UUAT 1E2AA 3LK2B 2ES0A 2E2AA 2E9XD 3JCFA 4OYKA 3VU7H 2CWYA 4BJNA 3O1HA 4DMVA 5JDLA 5KXJA 4TV8E 3UU5A 3RF1A 2DHRA 3O4XE 4CI3B 4O4JE 2VASA 3PJAJ 5AQGB 3N9LA 2Q9QC 2DLRA 2L3LA 3HL6A 3RH3A 4ZZCA 2W62A 3F57A 3T1HT 3I1AA 3N9OA 3ZKRA 3VKGA 3K3OA 2HH7A 2HN1A 2JQKA 3M65A 3NBXX 4LF8T 3C51A 4EGWA 4AI6A 4TWFA 2IIUA 2CHNA 2JMKA 3EAMA 5L3GB 1DU2A 3ZT5A 3L09A 3TLTA 2D5UA 3ZMSB 3WAJA 3SWHA 5IHYA 2W4XA 3F31A 3RYFE 5C2TA 3L39A 5AQLB 1QUUA 5FY7A 1QLBA 3OJAA 3P50A 2WDVA 1R8IA 2B76A 2UXNB 5HXHA 2VQFT 1HNXT 2XQAA 4F6RC 5JRCB 4A5XA 1KNZA 3EDUA 2JRKA 3LG7A 4IT4A 3B13A 5AQSB 2W66A 2XY8B 2CWOA 1IZNB 4Z91A 5JDFA 3ZLIA 1HFAA 2YDRA 5FVLA 5IUXA 4XBFB 4AKGA 1T7SA 4GKKT 5FVKA 4QWNB 3VRAA 4AQFC 4YSZA 3P4WA 4LFAT 5F8PA 4AKHA 1IJ5A 3AA7B 3RQWA 4X5TA 4H63H 2ACXA 3E0ZA 2ZM2A 4PNIA 1IJ6A 2KNDA 3AA0B 4JBWF 1UGOA 5DABA 3UU6A 2LJLA 5HXSA 1MNDA 2JJ9A 2D2SA 4UF0A 4CXXA 3UT5E 2E9XB 2WDQA 5HEHA 4IE7A 1VOMA 3RIUC 2IHR1 4HWFA 2XAQB 3FB2A 1YQ3A 1JNRA 4CI2B 1W9RA 4UELA 3QB5K 4PFOA 3RX6A 3PUYF 4JI8T 1GQEA 2Z6EA 4U33A 1BR2A 2V6YA 3AE9A 3BQKA 2C5IT 4DV7T 4IHJE 2UUBT 4DR4T 5L47A 1WLXA 5FXZA 5JDNA 1X79A 2DWGA 3LFMA 5J0ZA 2FJBA 4Z90A 4TWDA 4U72A 1OWAA 1Z8UA 2BS4A 4QH1A 2CBJA 3ZYKA 4CN4A 2ACZA 2CEAA 3P7IA 2LSKA 3KV5A 3ABVA 3JC6D 3O1JA 3Q2MA 4OYJA 5HEJA 3CQXC 4H9RC 4I4TE 5FMNA 3ZJ1A 3HI2A 2M6BA 2C5KT 4U3CA 2J62A 2VL8A 2V7LA 3UQ4A 2QVAA 3N5LA 2E8IA 4U7IA 2EHOD 5JVDE 1OEDC 4UVBB 2VKHA 3HKCE 2K24A 5LP6E 2I0MA 1UK5A 2VKDA 1AJ3A 1SHZC 4AQFA 2BKOA 3U78A 4LF4T 3FZMB 3OYZA 4CI1B 3UUBA 2VB6A 3TLVA 1EZ3A 1W0AA 2XQ7A 4IDOA 2LSIA 1YD8G 2XSAA 3X1DA 2Q9QA 2E5LT 3N2GE 3FBLA 4EYUA 5AQRB 2KINB 4G2AA 2V5CA 3NWIA 4IDPA 4ZOLE 2UUCT 3EI0A 4PK5A 3WI3A 5BR8T 3UQ7A 2CXLA 3F2EA 5ABGA 2BVMA 3ZSTA 3GA8A 4OHFA 1U5PA 2IC9A 3ZN1B 4HWDA 3K3QC 2CBIA 2IAKA 3KVAA 2CRBA 2JIWA 3KFWX 3CQGB 3AXJA 4H9PC 3Q5DA 4UR9A 3ETVA 2XAFB 4L0RA 4U31A 3PUQA 4LF7T 4DVDA 5FY1A 4HTEA 1WRDA 2WCAA 3CX6B 4EB6E 3ONXA 3HA4A 3QK6A 4ZS3A 3ZN0B 2VVSA 3AE6A 3UFEA 3BK9A 3RLFF 3ZCIA 5ABFB 3C4WA 3N9PA 2FJAA 2AE9A 2WU5A 2WMOA 4H9QC 1BR1A 4PAGA 5H6QB 5HXRA 4TWHA 5LHIB 4UF0B 1HX8A 3MKDA 3VKHA 4O2BE 2XQ4A 3AVSA 4KP3C 4X1KE 4BAYB 4U2YA 2ODVA 4EXTA 3MXZA 3PUXF 4UV9B 5ETWA 1XNRT 2QGSA 2CCQA 2RP4A 4OFZA 3RI5A 2VQET 2WAUA 1T8BA 2WM9A 2X0LB 3PV0F 4HWHA 4NUVA 3UULA 5FP3A 5CGMA 3P4PA 4DMWA 3AAAB 4ASKA 4K0UA 1E7PA 2M6IA 2R6GF 4E7ZA 1MIWA 2CMRA 3RQUA 4DIDB 3I9YA 3OKQA 1IBLT 1HNZT 5LHGB 3CPZA 1HNWT 2QRXA 3AEDA 2ZLYA 3PE0A 4X64T 4O4IE 4ZZBA 4YTPA 3UTKA 2VVNA 4ILCA 4X1IE 3KBUA 2Q9QB 3ZYLA 2E5VA 1LVKA 4NPPA 5CB4E 3RRWA 3MK7C 2YINA 4PK4A 3MJXA 3MACA 1V9DA 5JREA 3AVRA 2KMFA 1WYBA 2N9DA 2K5BB 4OK0A 4ZS2A 4YLHA 3DTOA 1SE7A 3PUWF 1WR6A 4DV4T 3CIRA 4DR7T 4AKIA 4JI4T 3AE4A 3ONLC 5JR9A 1L0VA 1XDPA 3C50A 2B1EA 5AQFB 4WZXA 5TAOA 3H37A 4X62T 2VL0A 2XQ3A 2W61A 3ONJA 3NRYA 5LOVE 2NOXA 5E0OA 2BBHA 5AQPB 4EEDA 3PDYA 2GK9A 3KV6A 4ZEYA 1T72A 5LNKA 3ZMUB 4L9IA 3ANWA 1HCIA 4LFBT 2WSSV 4HEAA 2ODUA 5AQJB 4MHCA 2Q9QD 4YHHT 3TLUA 4IE4A 1HTJF 1KEYA 2E9XA 2JMHA 3A8YC 3KVBA 5L4HA 3SFEA 3O9XA 4DV0T 4B3RT 2VURA 4A56A 2NR4A 4MALA 2W00A 2HN2A 1NWMX 3LK3B 1HR0T 4JV5T 1YXRA 1N36T 2IUBA 3OVUA 4HFEA 1KF6A 5HAXA 3FHNA 4CN6A 1IBMT 3KINB 2WU2A 2Y48B 5LB7B 2MPKA 2WS3A 5HXCA 2BBJA 2WQYA 5FL1A 2H88A 1B7TA 2XJ7A 2X9XA 3NZQA 4PW8A 3FXEB 3N9NA 2CE7A 4WNKA 4AIUA 4EEBA 2IW5B 2K3WA 2WB5A 5JQGE 2JQ9A 4IDZA 1MIVA 3AE7A 3SS1A 2X67A 3V5SA 1U4QA 5LJNA 4TX5A 4A98A 2MAWA 3N2KE 5ABFA 4DV1T 2KSRA 2N2NA 1ZP0A 5L3EB 4QX8B 1J5WA 3DP7A 4CXWA 4QH4A 2KLQA 3IF8B 3UUMA 2XQ8A 4ISTA 2JQHA 2X51A 3KV9A 4AKRB 4QXCB 3OBVE 1XMOT 3JAEA 2NP9A 3P4QA 3UUNA 5LG3A 2V1DB 2CHOA 3HR0A 1NAFA 3M3ZB 3P4SA 3PUAA 2I6HA 3J9X1 4ADZA 5JDGA 3AE3A 4QKNA 1OEDA 1UCUA 3LSVA 4PJLA 4I0UA 3WAKA 1CUNA 3IA3A 3NZPA 2X9HA 4IDQA 3JAFA 4J2CA 5AQUB 4U74A 1ZEEA 2V26A 2M67A 2FJEA 2V7MA 1FMWA 2XAGB 3CQCB 3LJCA 1W0BA 3PUVF 4JLEA 4L5GA 4HFBA 2YU2A 4MBQA 2DNXA 3C4XA 4JEHB 1NEKA 3E22E 4ILBA 4UVCB 5J1GA 3R84B 3Q5EA 1O3XA 4X20E 2BKPA 3EABA 2XPKA 2YK0A 1XMQT 3MZKB 2XQ9A 2NW9A 3ZMTB 1BR0A 5EZYE 3L8RA 4EZ4A 4YSYA 4ZI2D 2WY2A 2PJQA 2EHOB 2K9AA 2PTFA 2KT9A 1D1BA 4UVAB 5IYZE 5L3BB 4UV8B 4AXPA 2J1DG 4H9OC 5L3CB 1VCSA 4UXNB 2XM2A 3ZC1A 3JC6C 3OPCA 4U7YA 2BZBA 4QH5A 4JI2T 3PUGA 3ZMVB 4ZI3D 3W15B 4EYYR 3KDSE 4PJMA 5LGUB 3FZFB 3ESLA 1MMNA 1J5ET 4IDNA 4P1NA 4WYVA 4EIWA 4DR6T 4M1PA 2VKJA 2Y6XA 1YW0A 4LMJA 1UURA 3PU3A 2F4VT 3NKZA 2W67A 3AECA 5AQNB 4LMLA 2LHRA 4X1YE 2BG9B 2LT3A 2V8SV 5AQKB 3FXDB 3U3IA 2LKHA 3V5UA 5HYAA 1HX1B 2OV9A 2YKSA 4COFA 2ZM6T 5HEOA 2XZEA 1M62A 2LOSA 2WWUA 2ZM8A 3IBPA 4UIGA 5DQWA 5C8YE 5LGNB 4NXNT 4P0AA 2KXPB 3Q5XA 3E08A 5KX5E 3HKBE 3S4UA 3I9WA 5HEUA 1YKHB 2BS3A 2LLYA 4JI6T 2L9QA 3N9QA 4PFPA 4B3TT 2BS2A 1XDOA 4HE8A 2IC6A 4KMCA 3ZPOA 4YTNA 1G8XA 2J4GA 2P9BA 3UFGA 1KFYA 3PU8A 4BJMA 4JYAT 3C64A 5AQQB 1MMDA 2W0GA 5HXEA 3UU8A 3CKDA 3VRBA 1XNQT 5JRCA 3JADA 4JUYA 1SA0E 4UEMA 4IE0A 1HG5A 2A3DA 5HWYA 3TKLB 3GN5B 4C91A 3RYHE 4GIWA 2V6YB 5AQTB 3Q5WA 5LA6E 2UU9T 4ILAA 3AE2A 5EK2A 1HG2A 2G0UA 2YDQA 2UXCT 4NXMT 4KBMB 4I43B 2UXXB 1OXZA 2SPCA 1LRZA 5FL0A 3B5MA 2XAHB 4TZ4C 1IBKT 2BG9A 3K8PC 4GK0E 4IL9A 2D0UA 3HKDE 3UU3A 4C90A 5HWXA 3J7Yq 2CM0A 2DCFA 1X9BA 3CVRA 3HKEE 3QNUA 4QX7B 4CQIA 4ZHQE 5CFBA 5LMUT 1N34T 4BA9A 4O4LE 4HWCA 4B6XA 2BG9C 5FKYA 2YN6A 4GK5E 4AQGA 4DR5T 2XM1A 1VCTA 3AEAA 3T8OA 3EHZA 4ZI3C 1MNEA 2V5DA 4PJNA 4K0KT 2WZHA 5L3DB 3AXJB 4YFSA 4PJJA 5L3FB 4IL4A 3KV4A 5HCJA 4DBRA 3ANWB 5M4YA 4I55E 3EUHA 2YU1A 3ZT6A 2X0YA 4HN9A 4YY3T 5LXTE 2CA5A 2WBLA 3GWHA 3FBZA 2X9WA 2V7JA 2FJDA 1HF8A 3NVOA 2LRLA 3I0OA 5KDMC 3N2OA 4IGUA 4P09A 1Z0PA 4FJOA 1JNZA 3LBXA 4HGAA 5LJMA 5GONE 2CXDA 3RYIE 2EHOA 3IHRA 1KNRA 2H3RA 2XHEB 2LSGA 3K1SA 1XWMA 1G73A 3PUSA 1KNPA 5DJQC 4E7SA 4LMKA 3ZEFB 5CJ5A 2ZMAA 3D0TA 1H7CA 2CPTA 5ADXL 3P8CD 4YJ3E 4YT0A 5CA1E 4NIQA 2KZ7B 3AEGA 3H3MA 4KI0F 3ZCJA 4WBNE 5JDQA 4JEUB 5F3JA 3RIAA 5ABHA 2LM2A 4EV6A 4WBOA 4IE6A 1D0ZA 4DV6T 4KHPT 2K48A
chains in the Genus database with same CATH topology
2I59A 2LE8A 3VHLA 2LSJA 1KK7A 4IE5A 2JPFA 1VRBA 3E22E 1QSDA 2DWKA 2N1GA 2X66A 2NW8A 5M4YA 5FNVE 3PURA 4QXHB 2PFVA 4Z8XA 4WW0A 4YHJA 3BQIA 1HS7A 4O2AE 5FY0A 5FYMA 2YEVC 1S94A 3GN5A 4ISSA 2BVLA 3GMIA 3R6NA 1S35A 2A2FX 3B57A 1ZV4X 5JDMA 4EOZB 2LM9A 1US7B 2X68A 4P0BA 3C98B 2VWAA 2W63A 3CWZB 5LCYA 4EZHA 3H3AA 2H7OA 5LBQB 5J2TE 5EK4A 3K3NA 4O8SA 2MYSA 4YJ2E 2C0SA 2HPLA 3EDVA 2RA1A 2LOPA 1D0YA 2L8KA 2MOZA 4KUMB 4HKAA 5JR9C 2OA5A 5LHHB 4ERRA 4MLKA 3OYXA 3QC9A 4ZI2C 2Y8DA 2MBGA 3UUXB 4V1Av 4H9SE 2CXFA 5FXXA 2XQYA 2KWHA 2X9YA 3I0QA 4XZCA 2ZM0A 3RYCE 5EK3A 3L3PA 3LBXB 2HPJA 5L2LA 2MTQA 1E1HB 1BR4A 3N9MA 3ZMZB 2C5JA 3O1IA 4H63V 2VK9A 3RPUA 1D1CA 4TUYE 3BQLA 2CLYC 4IIJE 4HFVA 4TN7B 3RC8A 2CLYB 5BMVE 2PG8A 2H7VC 3IEEA 5FXWA 3SOLA 2PBIA 4CXYA 1ZKEA 2A72A 1FIOA 2LSYA 4GYRA 3ZYMA 4CZZB 5KMGP 5A1LA 2WMNA 3RC3A 2D0TA 3ETUA 2XASB 5LBMA 1FMVA 1MMAA 4O4HE 2LHNA 1LVFA 2NW7A 4GOUA 2E9XC 4DBQA 4DO0A 5J2UE 4QXBB 1YKEB 1FEWA 3ZJ2A 1D0XA 5H6RB 2XAJB 2DI4A 3QUJA 3RKOA 1UX4A 4G63A 5FXVA 1LKXA 4I50E 3DJBA 2JQQA 5AFUL 3EVYA 3AAEB 3LK42 4PK6A 4QHOA 4ZI7E 3MA9A 4EAHA 3CX7B 2VKOA 1IAPA 2XTLA 3CMLA 3SRZA 5JR9B 4DNDA 3KBTA 5DQVA 2LEHA 2NTYA 4GYSA 5CA0E 2NTXA 2EHOC 4NUUA 1WYCA 4AKLA 3AB3B 3C4ZA 5LYJE 4ILUA 1ZHCA 2V7IA 4H9NC 3AA1B 2BDEA 3A5XA 1UX5A 1Y64B 3PTRB 4N78D 4TV9E 5LG4A 2KWIB 2QA7A 4XAXB 3AA6B 3AAIA 5JH7E 4ANJA 3NRXA 5JDHA 4FI5A 4MFRA 2XUEA 3RRCA 1T98A 2NWBA 1MMGA 1D1AA 1MIYA 2V7KA 3CX8B 3Q9DA 3LK2B 2ES0A 2E9XD 4OYKA 3VU7H 5JDLA 2CWYA 4BJNA 3O1HA 4DMVA 4TV8E 2DHRA 3O4XE 4CI3B 4O4JE 2VASA 3N9LA 2Q9QC 2DLRA 2L3LA 3HL6A 3RH3A 2W62A 3F57A 3I1AA 3N9OA 3VKGA 3K3OA 2HH7A 3M65A 3NBXX 4AI6A 3C51A 2JMKA 5L3GB 3L09A 2D5UA 3ZMSB 3WAJA 3SWHA 5IHYA 3F31A 3RYFE 1QUUA 5FY7A 3OJAA 5HXHA 2UXNB 5JRCB 4F6RC 1KNZA 3EDUA 2JRKA 3LG7A 3B13A 2CWOA 1IZNB 5JDFA 4XBFB 3ZLIA 1HFAA 4AKGA 4AQFC 4QWNB 5F8PA 4AKHA 1IJ5A 3AA7B 4H63H 2ACXA 3E0ZA 2ZM2A 4PNIA 1IJ6A 2KNDA 3AA0B 5HXSA 5DABA 2LJLA 1MNDA 2JJ9A 2D2SA 4UF0A 4CXXA 3UT5E 2E9XB 4IE7A 1VOMA 2XAQB 3FB2A 4CI2B 4UELA 4PFOA 3RX6A 2Z6EA 1BR2A 3BQKA 2C5IT 4IHJE 1WLXA 5FXZA 5JDNA 1X79A 2DWGA 3LFMA 4U72A 1OWAA 3ZYKA 3P7IA 2CEAA 2LSKA 3KV5A 3JC6D 3O1JA 3Q2MA 4OYJA 3CQXC 4H9RC 4I4TE 5FMNA 3ZJ1A 3HI2A 2C5KT 2VL8A 2V7LA 3N5LA 2E8IA 2EHOD 5JVDE 4UVBB 2VKHA 3HKCE 2K24A 5LP6E 2VKDA 1AJ3A 1SHZC 4AQFA 3U78A 3OYZA 4CI1B 2VB6A 1EZ3A 2LSIA 1YD8G 2Q9QA 3N2GE 3FBLA 4EYUA 2KINB 4G2AA 4ZOLE 3WI3A 4PK5A 2CXLA 3F2EA 2BVMA 3GA8A 4OHFA 1U5PA 2IC9A 3ZN1B 3K3QC 2IAKA 3KVAA 4H9PC 3KFWX 3CQGB 3ETVA 2XAFB 4L0RA 3PUQA 4DVDA 5FY1A 4HTEA 1WRDA 3CX6B 4EB6E 3ONXA 3HA4A 3QK6A 4ZS3A 3ZN0B 3UFEA 3BK9A 3ZCIA 5L3BB 3C4WA 3N9PA 4PAGA 5LHIB 5H6QB 2WMOA 4H9QC 1BR1A 5LGTB 5HXRA 3VKHA 4UF0B 1HX8A 3MKDA 4O2BE 3AVSA 4KP3C 4X1KE 4BAYB 2ODVA 4EXTA 3MXZA 4UV9B 5ETWA 2QGSA 2CCQA 2RP4A 4OFZA 2WAUA 2WM9A 2X0LB 3UULA 4NUVA 5FP3A 4DMWA 3AAAB 4ASKA 4K0UA 4E7ZA 1MIWA 2CMRA 3I9YA 3OKQA 5LHGB 3CPZA 2ZLYA 3PE0A 4O4IE 3UTKA 4X1IE 3KBUA 2Q9QB 3ZYLA 1LVKA 5CB4E 3RRWA 3MK7C 2YINA 4PK4A 3MJXA 3MACA 1V9DA 5JREA 3AVRA 2KMFA 1WYBA 2N9DA 2K5BB 4OK0A 4ZS2A 4YLHA 3DTOA 1WR6A 4AKIA 5JR9A 3C50A 2B1EA 5TAOA 3H37A 5LOVE 2W61A 3NRYA 2NOXA 5E0OA 5LNKA 3PDYA 2GK9A 3KV6A 3ZMUB 4L9IA 3ANWA 1HCIA 2WSSV 4HEAA 2ODUA 4MHCA 2Q9QD 4IE4A 1HTJF 2JMHA 2E9XA 3O9XA 3KVBA 4A56A 4MALA 2W00A 1NWMX 3LK3B 5HAXA 3FHNA 3KINB 2Y48B 5HXCA 1B7TA 4PW8A 2X9XA 3NZQA 3FXEB 3N9NA 2CE7A 4WNKA 2IW5B 5JQGE 4IDZA 1MIVA 3SS1A 2X67A 3V5SA 1U4QA 5LJNA 4TX5A 3N2KE 2N2NA 5L3EB 4QX8B 3DP7A 4CXWA 2KLQA 3IF8B 3UUMA 4AKRB 4ISTA 3KV9A 2X51A 4QXCB 3OBVE 3UUNA 2NP9A 2V1DB 3ZC0A 3HR0A 1NAFA 5JDGA 4ADZA 3PUAA 3J9X1 4QKNA 1UCUA 4PJLA 3WAKA 1CUNA 3NZPA 2X9HA 4J2CA 4U74A 1ZEEA 2V26A 2M67A 2V7MA 1FMWA 2XAGB 3CQCB 3LJCA 4JLEA 4MBQA 4L5GA 2YU2A 2DNXA 3C4XA 4JEHB 4UVCB 5J1GA 3R84B 1O3XA 4X20E 1BR0A 2YK0A 3MZKB 2NW9A 3ZMTB 5EZYE 4EZ4A 4ZI2D 4UVAB 2PJQA 2EHOB 2K9AA 2KT9A 1D1BA 5IYZE 4UV8B 4AXPA 2J1DG 4H9OC 5L3CB 4UXNB 3ZC1A 3JC6C 2BZBA 3ZMVB 4ZI3D 3PUGA 3W15B 4EYYR 3KDSE 4PJMA 5LGUB 3ESLA 1MMNA 4EIWA 4M1PA 2VKJA 2Y6XA 1YW0A 3PU3A 3U3IA 2LHRA 4X1YE 2LT3A 3V5UA 3FXDB 5HYAA 2ZM8A 2LOSA 2WWUA 4UIGA 3IBPA 5DQWA 5LGNB 5C8YE 4P0AA 2KXPB 3Q5XA 3E08A 5KX5E 3HKBE 3S4UA 3I9WA 1YKHB 2L9QA 3N9QA 4PFPA 4HE8A 2IC6A 4KMCA 3ZPOA 1G8XA 2P9BA 3PU8A 4BJMA 3C64A 5HXEA 1MMDA 2W0GA 5JRCA 3CKDA 4JUYA 1SA0E 4UEMA 4IE0A 1HG5A 2A3DA 5HWYA 3TKLB 3GN5B 4C91A 3RYHE 4GIWA 5LA6E 3Q5WA 5EK2A 1HG2A 2G0UA 4KBMB 4I43B 2UXXB 1OXZA 2SPCA 1LRZA 2XAHB 4TZ4C 4C90A 3K8PC 4GK0E 2D0UA 3HKDE 5HWXA 3J7Yq 2CM0A 2DCFA 3CVRA 3HKEE 4QX7B 4CQIA 4ZHQE 4BA9A 4O4LE 4B6XA 4GK5E 4AQGA 3T8OA 4ZI3C 1MNEA 4PJNA 5L3DB 4YFSA 4PJJA 5L3FB 3KV4A 4DBRA 3ANWB 4I55E 3EUHA 2YU1A 4HN9A 5LXTE 2CA5A 2WBLA 3GWHA 3FBZA 2X9WA 2V7JA 1HF8A 5KDMC 3I0OA 3N2OA 4IGUA 4P09A 1Z0PA 4FJOA 3LBXA 4HGAA 5LJMA 5GONE 2CXDA 3RYIE 2EHOA 3IHRA 2H3RA 2XHEB 2LSGA 4E7SA 3ZEFB 1G73A 3PUSA 5DJQC 2ZMAA 3D0TA 1H7CA 5ADXL 3P8CD 4YJ3E 5CA1E 2KZ7B 3ZCJA 5JDQA 4WBNE 4JEUB 5F3JA 4WBOA 4IE6A 1D0ZA 2K48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I59 A;  2DLR A;  3AB3 B;  2ACX A;  3C4Z A;  4IGU A;  4PNI A;  3C50 A;  3C4X A;  4YHJ A;  3C51 A;  4WNK A;  3QC9 A;  2PBI A;  3CX6 B;  2A72 A;  4L9I A;  3CX7 B;  1SHZ C;  1IAP A;  1ZV4 X;  3T8O A;  3C4W A;  1HTJ F;  3CX8 B;  4WBO A;  2ES0 A;  4GOU A; 
#chains in the Genus database with same CATH topology
 2XQ5 A;  2I59 A;  2LE8 A;  3VHL A;  2LSJ A;  3AEF A;  1KK7 A;  1N33 T;  4YXD A;  2WDR A;  3A7M A;  4IE5 A;  2JPF A;  1VRB A;  2X66 A;  1QSD A;  1WCR A;  2BKN A;  2DWK A;  2NW8 A;  2N1G A;  2YOE A;  3FZL B;  5FNV E;  3PUR A;  4DR2 T;  4QXH B;  2BG9 E;  2PFV A;  4Z8X A;  1CHU A;  4WW0 A;  3PJA A;  4YHJ A;  3BQI A;  1HS7 A;  1WR0 A;  4O2A E;  5FY0 A;  5FYM A;  4DUY T;  2YEV C;  1S94 A;  3AE8 A;  3OTO T;  1I94 T;  3VR8 A;  3GN5 A;  4ISS A;  4A97 A;  2W2U A;  4OX9 T;  2BVL A;  2IDO B;  3GMI A;  2HHH T;  4IRE A;  3R6N A;  1S35 A;  2UXB T;  2A2F X;  3B57 A;  1ZV4 X;  5JDM A;  4EOZ B;  2LM9 A;  1US7 B;  2X68 A;  4P0B A;  5C3J A;  3C98 B;  2VWA A;  2W63 A;  3CWZ B;  3VR9 A;  5LCY A;  4EZH A;  3H3A A;  2H7O A;  5LBQ B;  5J2T E;  5EK4 A;  3K3N A;  2WZI A;  1UUS A;  4O8S A;  2MYS A;  4YJ2 E;  2C0S A;  2HPL A;  3EDV A;  2RA1 A;  2LOP A;  1D0Y A;  5ABE A;  2XQ6 A;  2L8K A;  2MOZ A;  1J1J A;  4HKA A;  4KUM B;  1M7K A;  5JR9 C;  2OA5 A;  5LHH B;  4ERR A;  4TNW A;  3FZH B;  4LF5 T;  3PUZ F;  1W09 A;  4AQY T;  2WWV A;  4MLK A;  4X66 T;  1YQ4 A;  3OYX A;  3QC9 A;  4ZI2 C;  2V6X A;  5LMN T;  2Y8D A;  2MBG A;  1XZY A;  4JI5 T;  3UUX B;  4V1A v;  4YSX A;  4H9S E;  2CXF A;  5FXX A;  2XQY A;  2KWH A;  2X9Y A;  3I0Q A;  5AQM B;  4HFH A;  2ZM0 A;  4XZC A;  5EK3 A;  3RIU A;  3L3P A;  3LDQ B;  3LBX B;  2HPJ A;  3RYC E;  2MTQ A;  5L4E A;  5L2L A;  4DUZ T;  2LRK A;  1E1H B;  1BR4 A;  3N9M A;  3ZMZ B;  3AE5 A;  1SUM B;  2C5J A;  2YDS A;  5JTG A;  3O1I A;  1Y01 A;  2VK9 A;  4H63 V;  3RPU A;  1D1C A;  4TUY E;  4B3M T;  4JI1 T;  2X0H A;  2CLY C;  3BQL A;  4IIJ E;  5IWA T;  4HFV A;  4TN7 B;  4JI0 T;  3RC8 A;  2CLY B;  3FZK B;  5BMV E;  4LF9 T;  2PG8 A;  2H7V C;  5LGT B;  3IEE A;  5FXW A;  1ZOY A;  2FUP A;  1NEN A;  1OED E;  2WP9 A;  3AE1 A;  2PBI A;  3SOL A;  1OED B;  2QYW A;  4F8H A;  4CXY A;  1ZKE A;  2FBW A;  2A72 A;  1FIO A;  2IML A;  2LSY A;  4GYR A;  2OLT A;  4KX6 A;  3RHW A;  3ZYM A;  4CZZ B;  5KMG P;  5A1L A;  3QOF A;  2WMN A;  3RC3 A;  2D0T A;  2AXD S;  4GKJ T;  3ETU A;  2XAS B;  5LBM A;  1FMV A;  1MMA A;  4DV3 T;  5AQV B;  4O4H E;  2LHN A;  1LVF A;  2NW7 A;  3RIF A;  4GOU A;  2E9X C;  2A9U A;  5HCM A;  3ZSS A;  4DBQ A;  4DO0 A;  4HFC A;  5J2U E;  4QXB B;  1WFD A;  1YKE B;  4TNV A;  1FEW A;  2DL1 A;  3CK6 A;  3ZJ2 A;  4ZXL A;  1D0X A;  4Q25 A;  3P4R A;  5H6R B;  4AIS A;  2UXD T;  4B3S T;  2XAJ B;  2DI4 A;  3ZC0 A;  3QUJ A;  3RKO A;  1UX4 A;  4G63 A;  5F5W A;  1LKX A;  5FXV A;  4I50 E;  3AEB A;  3RGL A;  2H89 A;  3DJB A;  2JQQ A;  5AFU L;  1I6Z A;  3EVY A;  3AAE B;  2RPA A;  3LK4 2;  2XSB A;  4PK6 A;  4QHO A;  4ZI7 E;  4X65 T;  3MA9 A;  4EAH A;  3CX7 B;  4CN1 A;  2VKO A;  1N32 T;  1IAP A;  2D9D A;  2LKG A;  4HFI A;  4HWI B;  3T1Y T;  2XTL A;  3CML A;  3RKG A;  3SRZ A;  5JR9 B;  3AEE A;  4DND A;  3KBT A;  3QB5 A;  5AQH B;  4DR3 T;  4DR1 T;  5DQV A;  2LEH A;  4JI7 T;  2NTY A;  4GYS A;  5CA0 E;  2NTX A;  3UU4 A;  2EHO C;  4NUU A;  1WYC A;  4AKL A;  4LF6 T;  3AB3 B;  3ZT7 A;  4JI3 T;  3C4Z A;  4KHZ F;  5LYJ E;  4HFD A;  1ZHC A;  4ILU A;  4LFC T;  3G06 A;  2V7I A;  1FJG T;  5LG4 A;  4H9N C;  3AA1 B;  2BDE A;  3A5X A;  1UX5 A;  1Y64 B;  3PTR B;  4N78 D;  4TV9 E;  2J47 A;  5AQO B;  2KWI B;  2QA7 A;  4XAX B;  5HEG A;  3TLS A;  3AA6 B;  4DV2 T;  4DV5 T;  3AAI A;  3TLW A;  5JH7 E;  4ANJ A;  4U2Z A;  3NRX A;  3SFD A;  4YTM A;  5JDH A;  4FI5 A;  4MFR A;  2XUE A;  5AQI B;  3RRC A;  1T98 A;  2NWB A;  1MMG A;  1D1A A;  1MIY A;  2V7K A;  3CX8 B;  3Q9D A;  2UUA T;  1E2A A;  3LK2 B;  2ES0 A;  2E2A A;  2E9X D;  3JCF A;  4OYK A;  3VU7 H;  2CWY A;  4BJN A;  3O1H A;  4DMV A;  5JDL A;  5KXJ A;  4TV8 E;  3UU5 A;  3RF1 A;  2DHR A;  3O4X E;  4CI3 B;  4O4J E;  2VAS A;  3PJA J;  5AQG B;  3N9L A;  2Q9Q C;  2DLR A;  2L3L A;  3HL6 A;  3RH3 A;  4ZZC A;  2W62 A;  3F57 A;  3T1H T;  3I1A A;  3N9O A;  3ZKR A;  3VKG A;  3K3O A;  2HH7 A;  2HN1 A;  2JQK A;  3M65 A;  3NBX X;  4LF8 T;  3C51 A;  4EGW A;  4AI6 A;  4TWF A;  2IIU A;  2CHN A;  2JMK A;  3EAM A;  5L3G B;  1DU2 A;  3ZT5 A;  3L09 A;  3TLT A;  2D5U A;  3ZMS B;  3WAJ A;  3SWH A;  5IHY A;  2W4X A;  3F31 A;  3RYF E;  5C2T A;  3L39 A;  5AQL B;  1QUU A;  5FY7 A;  1QLB A;  3OJA A;  3P50 A;  2WDV A;  1R8I A;  2B76 A;  2UXN B;  5HXH A;  2VQF T;  1HNX T;  2XQA A;  4F6R C;  5JRC B;  4A5X A;  1KNZ A;  3EDU A;  2JRK A;  3LG7 A;  4IT4 A;  3B13 A;  5AQS B;  2W66 A;  2XY8 B;  2CWO A;  1IZN B;  4Z91 A;  5JDF A;  3ZLI A;  1HFA A;  2YDR A;  5FVL A;  5IUX A;  4XBF B;  4AKG A;  1T7S A;  4GKK T;  5FVK A;  4QWN B;  3VRA A;  4AQF C;  4YSZ A;  3P4W A;  4LFA T;  5F8P A;  4AKH A;  1IJ5 A;  3AA7 B;  3RQW A;  4X5T A;  4H63 H;  2ACX A;  3E0Z A;  2ZM2 A;  4PNI A;  1IJ6 A;  2KND A;  3AA0 B;  4JBW F;  1UGO A;  5DAB A;  3UU6 A;  2LJL A;  5HXS A;  1MND A;  2JJ9 A;  2D2S A;  4UF0 A;  4CXX A;  3UT5 E;  2E9X B;  2WDQ A;  5HEH A;  4IE7 A;  1VOM A;  3RIU C;  2IHR 1;  4HWF A;  2XAQ B;  3FB2 A;  1YQ3 A;  1JNR A;  4CI2 B;  1W9R A;  4UEL A;  3QB5 K;  4PFO A;  3RX6 A;  3PUY F;  4JI8 T;  1GQE A;  2Z6E A;  4U33 A;  1BR2 A;  2V6Y A;  3AE9 A;  3BQK A;  2C5I T;  4DV7 T;  4IHJ E;  2UUB T;  4DR4 T;  5L47 A;  1WLX A;  5FXZ A;  5JDN A;  1X79 A;  2DWG A;  3LFM A;  5J0Z A;  2FJB A;  4Z90 A;  4TWD A;  4U72 A;  1OWA A;  1Z8U A;  2BS4 A;  4QH1 A;  2CBJ A;  3ZYK A;  4CN4 A;  2ACZ A;  2CEA A;  3P7I A;  2LSK A;  3KV5 A;  3ABV A;  3JC6 D;  3O1J A;  3Q2M A;  4OYJ A;  5HEJ A;  3CQX C;  4H9R C;  4I4T E;  5FMN A;  3ZJ1 A;  3HI2 A;  2M6B A;  2C5K T;  4U3C A;  2J62 A;  2VL8 A;  2V7L A;  3UQ4 A;  2QVA A;  3N5L A;  2E8I A;  4U7I A;  2EHO D;  5JVD E;  1OED C;  4UVB B;  2VKH A;  3HKC E;  2K24 A;  5LP6 E;  2I0M A;  1UK5 A;  2VKD A;  1AJ3 A;  1SHZ C;  4AQF A;  2BKO A;  3U78 A;  4LF4 T;  3FZM B;  3OYZ A;  4CI1 B;  3UUB A;  2VB6 A;  3TLV A;  1EZ3 A;  1W0A A;  2XQ7 A;  4IDO A;  2LSI A;  1YD8 G;  2XSA A;  3X1D A;  2Q9Q A;  2E5L T;  3N2G E;  3FBL A;  4EYU A;  5AQR B;  2KIN B;  4G2A A;  2V5C A;  3NWI A;  4IDP A;  4ZOL E;  2UUC T;  3EI0 A;  4PK5 A;  3WI3 A;  5BR8 T;  3UQ7 A;  2CXL A;  3F2E A;  5ABG A;  2BVM A;  3ZST A;  3GA8 A;  4OHF A;  1U5P A;  2IC9 A;  3ZN1 B;  4HWD A;  3K3Q C;  2CBI A;  2IAK A;  3KVA A;  2CRB A;  2JIW A;  3KFW X;  3CQG B;  3AXJ A;  4H9P C;  3Q5D A;  4UR9 A;  3ETV A;  2XAF B;  4L0R A;  4U31 A;  3PUQ A;  4LF7 T;  4DVD A;  5FY1 A;  4HTE A;  1WRD A;  2WCA A;  3CX6 B;  4EB6 E;  3ONX A;  3HA4 A;  3QK6 A;  4ZS3 A;  3ZN0 B;  2VVS A;  3AE6 A;  3UFE A;  3BK9 A;  3RLF F;  3ZCI A;  5ABF B;  3C4W A;  3N9P A;  2FJA A;  2AE9 A;  2WU5 A;  2WMO A;  4H9Q C;  1BR1 A;  4PAG A;  5H6Q B;  5HXR A;  4TWH A;  5LHI B;  4UF0 B;  1HX8 A;  3MKD A;  3VKH A;  4O2B E;  2XQ4 A;  3AVS A;  4KP3 C;  4X1K E;  4BAY B;  4U2Y A;  2ODV A;  4EXT A;  3MXZ A;  3PUX F;  4UV9 B;  5ETW A;  1XNR T;  2QGS A;  2CCQ A;  2RP4 A;  4OFZ A;  3RI5 A;  2VQE T;  2WAU A;  1T8B A;  2WM9 A;  2X0L B;  3PV0 F;  4HWH A;  4NUV A;  3UUL A;  5FP3 A;  5CGM A;  3P4P A;  4DMW A;  3AAA B;  4ASK A;  4K0U A;  1E7P A;  2M6I A;  2R6G F;  4E7Z A;  1MIW A;  2CMR A;  3RQU A;  4DID B;  3I9Y A;  3OKQ A;  1IBL T;  1HNZ T;  5LHG B;  3CPZ A;  1HNW T;  2QRX A;  3AED A;  2ZLY A;  3PE0 A;  4X64 T;  4O4I E;  4ZZB A;  4YTP A;  3UTK A;  2VVN A;  4ILC A;  4X1I E;  3KBU A;  2Q9Q B;  3ZYL A;  2E5V A;  1LVK A;  4NPP A;  5CB4 E;  3RRW A;  3MK7 C;  2YIN A;  4PK4 A;  3MJX A;  3MAC A;  1V9D A;  5JRE A;  3AVR A;  2KMF A;  1WYB A;  2N9D A;  2K5B B;  4OK0 A;  4ZS2 A;  4YLH A;  3DTO A;  1SE7 A;  3PUW F;  1WR6 A;  4DV4 T;  3CIR A;  4DR7 T;  4AKI A;  4JI4 T;  3AE4 A;  3ONL C;  5JR9 A;  1L0V A;  1XDP A;  3C50 A;  2B1E A;  5AQF B;  4WZX A;  5TAO A;  3H37 A;  4X62 T;  2VL0 A;  2XQ3 A;  2W61 A;  3ONJ A;  3NRY A;  5LOV E;  2NOX A;  5E0O A;  2BBH A;  5AQP B;  4EED A;  3PDY A;  2GK9 A;  3KV6 A;  4ZEY A;  1T72 A;  5LNK A;  3ZMU B;  4L9I A;  3ANW A;  1HCI A;  4LFB T;  2WSS V;  4HEA A;  2ODU A;  5AQJ B;  4MHC A;  2Q9Q D;  4YHH T;  3TLU A;  4IE4 A;  1HTJ F;  1KEY A;  2E9X A;  2JMH A;  3A8Y C;  3KVB A;  5L4H A;  3SFE A;  3O9X A;  4DV0 T;  4B3R T;  2VUR A;  4A56 A;  2NR4 A;  4MAL A;  2W00 A;  2HN2 A;  1NWM X;  3LK3 B;  1HR0 T;  4JV5 T;  1YXR A;  1N36 T;  2IUB A;  3OVU A;  4HFE A;  1KF6 A;  5HAX A;  3FHN A;  4CN6 A;  1IBM T;  3KIN B;  2WU2 A;  2Y48 B;  5LB7 B;  2MPK A;  2WS3 A;  5HXC A;  2BBJ A;  2WQY A;  5FL1 A;  2H88 A;  1B7T A;  2XJ7 A;  2X9X A;  3NZQ A;  4PW8 A;  3FXE B;  3N9N A;  2CE7 A;  4WNK A;  4AIU A;  4EEB A;  2IW5 B;  2K3W A;  2WB5 A;  5JQG E;  2JQ9 A;  4IDZ A;  1MIV A;  3AE7 A;  3SS1 A;  2X67 A;  3V5S A;  1U4Q A;  5LJN A;  4TX5 A;  4A98 A;  2MAW A;  3N2K E;  5ABF A;  4DV1 T;  2KSR A;  2N2N A;  1ZP0 A;  5L3E B;  4QX8 B;  1J5W A;  3DP7 A;  4CXW A;  4QH4 A;  2KLQ A;  3IF8 B;  3UUM A;  2XQ8 A;  4IST A;  2JQH A;  2X51 A;  3KV9 A;  4AKR B;  4QXC B;  3OBV E;  1XMO T;  3JAE A;  2NP9 A;  3P4Q A;  3UUN A;  5LG3 A;  2V1D B;  2CHO A;  3HR0 A;  1NAF A;  3M3Z B;  3P4S A;  3PUA A;  2I6H A;  3J9X 1;  4ADZ A;  5JDG A;  3AE3 A;  4QKN A;  1OED A;  1UCU A;  3LSV A;  4PJL A;  4I0U A;  3WAK A;  1CUN A;  3IA3 A;  3NZP A;  2X9H A;  4IDQ A;  3JAF A;  4J2C A;  5AQU B;  4U74 A;  1ZEE A;  2V26 A;  2M67 A;  2FJE A;  2V7M A;  1FMW A;  2XAG B;  3CQC B;  3LJC A;  1W0B A;  3PUV F;  4JLE A;  4L5G A;  4HFB A;  2YU2 A;  4MBQ A;  2DNX A;  3C4X A;  4JEH B;  1NEK A;  3E22 E;  4ILB A;  4UVC B;  5J1G A;  3R84 B;  3Q5E A;  1O3X A;  4X20 E;  2BKP A;  3EAB A;  2XPK A;  2YK0 A;  1XMQ T;  3MZK B;  2XQ9 A;  2NW9 A;  3ZMT B;  1BR0 A;  5EZY E;  3L8R A;  4EZ4 A;  4YSY A;  4ZI2 D;  2WY2 A;  2PJQ A;  2EHO B;  2K9A A;  2PTF A;  2KT9 A;  1D1B A;  4UVA B;  5IYZ E;  5L3B B;  4UV8 B;  4AXP A;  2J1D G;  4H9O C;  5L3C B;  1VCS A;  4UXN B;  2XM2 A;  3ZC1 A;  3JC6 C;  3OPC A;  4U7Y A;  2BZB A;  4QH5 A;  4JI2 T;  3PUG A;  3ZMV B;  4ZI3 D;  3W15 B;  4EYY R;  3KDS E;  4PJM A;  5LGU B;  3FZF B;  3ESL A;  1MMN A;  1J5E T;  4IDN A;  4P1N A;  4WYV A;  4EIW A;  4DR6 T;  4M1P A;  2VKJ A;  2Y6X A;  1YW0 A;  4LMJ A;  1UUR A;  3PU3 A;  2F4V T;  3NKZ A;  2W67 A;  3AEC A;  5AQN B;  4LML A;  2LHR A;  4X1Y E;  2BG9 B;  2LT3 A;  2V8S V;  5AQK B;  3FXD B;  3U3I A;  2LKH A;  3V5U A;  5HYA A;  1HX1 B;  2OV9 A;  2YKS A;  4COF A;  2ZM6 T;  5HEO A;  2XZE A;  1M62 A;  2LOS A;  2WWU A;  2ZM8 A;  3IBP A;  4UIG A;  5DQW A;  5C8Y E;  5LGN B;  4NXN T;  4P0A A;  2KXP B;  3Q5X A;  3E08 A;  5KX5 E;  3HKB E;  3S4U A;  3I9W A;  5HEU A;  1YKH B;  2BS3 A;  2LLY A;  4JI6 T;  2L9Q A;  3N9Q A;  4PFP A;  4B3T T;  2BS2 A;  1XDO A;  4HE8 A;  2IC6 A;  4KMC A;  3ZPO A;  4YTN A;  1G8X A;  2J4G A;  2P9B A;  3UFG A;  1KFY A;  3PU8 A;  4BJM A;  4JYA T;  3C64 A;  5AQQ B;  1MMD A;  2W0G A;  5HXE A;  3UU8 A;  3CKD A;  3VRB A;  1XNQ T;  5JRC A;  3JAD A;  4JUY A;  1SA0 E;  4UEM A;  4IE0 A;  1HG5 A;  2A3D A;  5HWY A;  3TKL B;  3GN5 B;  4C91 A;  3RYH E;  4GIW A;  2V6Y B;  5AQT B;  3Q5W A;  5LA6 E;  2UU9 T;  4ILA A;  3AE2 A;  5EK2 A;  1HG2 A;  2G0U A;  2YDQ A;  2UXC T;  4NXM T;  4KBM B;  4I43 B;  2UXX B;  1OXZ A;  2SPC A;  1LRZ A;  5FL0 A;  3B5M A;  2XAH B;  4TZ4 C;  1IBK T;  2BG9 A;  3K8P C;  4GK0 E;  4IL9 A;  2D0U A;  3HKD E;  3UU3 A;  4C90 A;  5HWX A;  3J7Y q;  2CM0 A;  2DCF A;  1X9B A;  3CVR A;  3HKE E;  3QNU A;  4QX7 B;  4CQI A;  4ZHQ E;  5CFB A;  5LMU T;  1N34 T;  4BA9 A;  4O4L E;  4HWC A;  4B6X A;  2BG9 C;  5FKY A;  2YN6 A;  4GK5 E;  4AQG A;  4DR5 T;  2XM1 A;  1VCT A;  3AEA A;  3T8O A;  3EHZ A;  4ZI3 C;  1MNE A;  2V5D A;  4PJN A;  4K0K T;  2WZH A;  5L3D B;  3AXJ B;  4YFS A;  4PJJ A;  5L3F B;  4IL4 A;  3KV4 A;  5HCJ A;  4DBR A;  3ANW B;  5M4Y A;  4I55 E;  3EUH A;  2YU1 A;  3ZT6 A;  2X0Y A;  4HN9 A;  4YY3 T;  5LXT E;  2CA5 A;  2WBL A;  3GWH A;  3FBZ A;  2X9W A;  2V7J A;  2FJD A;  1HF8 A;  3NVO A;  2LRL A;  3I0O A;  5KDM C;  3N2O A;  4IGU A;  4P09 A;  1Z0P A;  4FJO A;  1JNZ A;  3LBX A;  4HGA A;  5LJM A;  5GON E;  2CXD A;  3RYI E;  2EHO A;  3IHR A;  1KNR A;  2H3R A;  2XHE B;  2LSG A;  3K1S A;  1XWM A;  1G73 A;  3PUS A;  1KNP A;  5DJQ C;  4E7S A;  4LMK A;  3ZEF B;  5CJ5 A;  2ZMA A;  3D0T A;  1H7C A;  2CPT A;  5ADX L;  3P8C D;  4YJ3 E;  4YT0 A;  5CA1 E;  4NIQ A;  2KZ7 B;  3AEG A;  3H3M A;  4KI0 F;  3ZCJ A;  4WBN E;  5JDQ A;  4JEU B;  5F3J A;  3RIA A;  5ABH A;  2LM2 A;  4EV6 A;  4WBO A;  4IE6 A;  1D0Z A;  4DV6 T;  4KHP T;  2K48 A; 
#chains in the Genus database with same CATH homology
 2I59 A;  2LE8 A;  3VHL A;  2LSJ A;  1KK7 A;  4IE5 A;  2JPF A;  1VRB A;  3E22 E;  1QSD A;  2DWK A;  2N1G A;  2X66 A;  2NW8 A;  5M4Y A;  5FNV E;  3PUR A;  4QXH B;  2PFV A;  4Z8X A;  4WW0 A;  4YHJ A;  3BQI A;  1HS7 A;  4O2A E;  5FY0 A;  5FYM A;  2YEV C;  1S94 A;  3GN5 A;  4ISS A;  2BVL A;  3GMI A;  3R6N A;  1S35 A;  2A2F X;  3B57 A;  1ZV4 X;  5JDM A;  4EOZ B;  2LM9 A;  1US7 B;  2X68 A;  4P0B A;  3C98 B;  2VWA A;  2W63 A;  3CWZ B;  5LCY A;  4EZH A;  3H3A A;  2H7O A;  5LBQ B;  5J2T E;  5EK4 A;  3K3N A;  4O8S A;  2MYS A;  4YJ2 E;  2C0S A;  2HPL A;  3EDV A;  2RA1 A;  2LOP A;  1D0Y A;  2L8K A;  2MOZ A;  4KUM B;  4HKA A;  5JR9 C;  2OA5 A;  5LHH B;  4ERR A;  4MLK A;  3OYX A;  3QC9 A;  4ZI2 C;  2Y8D A;  2MBG A;  3UUX B;  4V1A v;  4H9S E;  2CXF A;  5FXX A;  2XQY A;  2KWH A;  2X9Y A;  3I0Q A;  4XZC A;  2ZM0 A;  3RYC E;  5EK3 A;  3L3P A;  3LBX B;  2HPJ A;  5L2L A;  2MTQ A;  1E1H B;  1BR4 A;  3N9M A;  3ZMZ B;  2C5J A;  3O1I A;  4H63 V;  2VK9 A;  3RPU A;  1D1C A;  4TUY E;  3BQL A;  2CLY C;  4IIJ E;  4HFV A;  4TN7 B;  3RC8 A;  2CLY B;  5BMV E;  2PG8 A;  2H7V C;  3IEE A;  5FXW A;  3SOL A;  2PBI A;  4CXY A;  1ZKE A;  2A72 A;  1FIO A;  2LSY A;  4GYR A;  3ZYM A;  4CZZ B;  5KMG P;  5A1L A;  2WMN A;  3RC3 A;  2D0T A;  3ETU A;  2XAS B;  5LBM A;  1FMV A;  1MMA A;  4O4H E;  2LHN A;  1LVF A;  2NW7 A;  4GOU A;  2E9X C;  4DBQ A;  4DO0 A;  5J2U E;  4QXB B;  1YKE B;  1FEW A;  3ZJ2 A;  1D0X A;  5H6R B;  2XAJ B;  2DI4 A;  3QUJ A;  3RKO A;  1UX4 A;  4G63 A;  5FXV A;  1LKX A;  4I50 E;  3DJB A;  2JQQ A;  5AFU L;  3EVY A;  3AAE B;  3LK4 2;  4PK6 A;  4QHO A;  4ZI7 E;  3MA9 A;  4EAH A;  3CX7 B;  2VKO A;  1IAP A;  2XTL A;  3CML A;  3SRZ A;  5JR9 B;  4DND A;  3KBT A;  5DQV A;  2LEH A;  2NTY A;  4GYS A;  5CA0 E;  2NTX A;  2EHO C;  4NUU A;  1WYC A;  4AKL A;  3AB3 B;  3C4Z A;  5LYJ E;  4ILU A;  1ZHC A;  2V7I A;  4H9N C;  3AA1 B;  2BDE A;  3A5X A;  1UX5 A;  1Y64 B;  3PTR B;  4N78 D;  4TV9 E;  5LG4 A;  2KWI B;  2QA7 A;  4XAX B;  3AA6 B;  3AAI A;  5JH7 E;  4ANJ A;  3NRX A;  5JDH A;  4FI5 A;  4MFR A;  2XUE A;  3RRC A;  1T98 A;  2NWB A;  1MMG A;  1D1A A;  1MIY A;  2V7K A;  3CX8 B;  3Q9D A;  3LK2 B;  2ES0 A;  2E9X D;  4OYK A;  3VU7 H;  5JDL A;  2CWY A;  4BJN A;  3O1H A;  4DMV A;  4TV8 E;  2DHR A;  3O4X E;  4CI3 B;  4O4J E;  2VAS A;  3N9L A;  2Q9Q C;  2DLR A;  2L3L A;  3HL6 A;  3RH3 A;  2W62 A;  3F57 A;  3I1A A;  3N9O A;  3VKG A;  3K3O A;  2HH7 A;  3M65 A;  3NBX X;  4AI6 A;  3C51 A;  2JMK A;  5L3G B;  3L09 A;  2D5U A;  3ZMS B;  3WAJ A;  3SWH A;  5IHY A;  3F31 A;  3RYF E;  1QUU A;  5FY7 A;  3OJA A;  5HXH A;  2UXN B;  5JRC B;  4F6R C;  1KNZ A;  3EDU A;  2JRK A;  3LG7 A;  3B13 A;  2CWO A;  1IZN B;  5JDF A;  4XBF B;  3ZLI A;  1HFA A;  4AKG A;  4AQF C;  4QWN B;  5F8P A;  4AKH A;  1IJ5 A;  3AA7 B;  4H63 H;  2ACX A;  3E0Z A;  2ZM2 A;  4PNI A;  1IJ6 A;  2KND A;  3AA0 B;  5HXS A;  5DAB A;  2LJL A;  1MND A;  2JJ9 A;  2D2S A;  4UF0 A;  4CXX A;  3UT5 E;  2E9X B;  4IE7 A;  1VOM A;  2XAQ B;  3FB2 A;  4CI2 B;  4UEL A;  4PFO A;  3RX6 A;  2Z6E A;  1BR2 A;  3BQK A;  2C5I T;  4IHJ E;  1WLX A;  5FXZ A;  5JDN A;  1X79 A;  2DWG A;  3LFM A;  4U72 A;  1OWA A;  3ZYK A;  3P7I A;  2CEA A;  2LSK A;  3KV5 A;  3JC6 D;  3O1J A;  3Q2M A;  4OYJ A;  3CQX C;  4H9R C;  4I4T E;  5FMN A;  3ZJ1 A;  3HI2 A;  2C5K T;  2VL8 A;  2V7L A;  3N5L A;  2E8I A;  2EHO D;  5JVD E;  4UVB B;  2VKH A;  3HKC E;  2K24 A;  5LP6 E;  2VKD A;  1AJ3 A;  1SHZ C;  4AQF A;  3U78 A;  3OYZ A;  4CI1 B;  2VB6 A;  1EZ3 A;  2LSI A;  1YD8 G;  2Q9Q A;  3N2G E;  3FBL A;  4EYU A;  2KIN B;  4G2A A;  4ZOL E;  3WI3 A;  4PK5 A;  2CXL A;  3F2E A;  2BVM A;  3GA8 A;  4OHF A;  1U5P A;  2IC9 A;  3ZN1 B;  3K3Q C;  2IAK A;  3KVA A;  4H9P C;  3KFW X;  3CQG B;  3ETV A;  2XAF B;  4L0R A;  3PUQ A;  4DVD A;  5FY1 A;  4HTE A;  1WRD A;  3CX6 B;  4EB6 E;  3ONX A;  3HA4 A;  3QK6 A;  4ZS3 A;  3ZN0 B;  3UFE A;  3BK9 A;  3ZCI A;  5L3B B;  3C4W A;  3N9P A;  4PAG A;  5LHI B;  5H6Q B;  2WMO A;  4H9Q C;  1BR1 A;  5LGT B;  5HXR A;  3VKH A;  4UF0 B;  1HX8 A;  3MKD A;  4O2B E;  3AVS A;  4KP3 C;  4X1K E;  4BAY B;  2ODV A;  4EXT A;  3MXZ A;  4UV9 B;  5ETW A;  2QGS A;  2CCQ A;  2RP4 A;  4OFZ A;  2WAU A;  2WM9 A;  2X0L B;  3UUL A;  4NUV A;  5FP3 A;  4DMW A;  3AAA B;  4ASK A;  4K0U A;  4E7Z A;  1MIW A;  2CMR A;  3I9Y A;  3OKQ A;  5LHG B;  3CPZ A;  2ZLY A;  3PE0 A;  4O4I E;  3UTK A;  4X1I E;  3KBU A;  2Q9Q B;  3ZYL A;  1LVK A;  5CB4 E;  3RRW A;  3MK7 C;  2YIN A;  4PK4 A;  3MJX A;  3MAC A;  1V9D A;  5JRE A;  3AVR A;  2KMF A;  1WYB A;  2N9D A;  2K5B B;  4OK0 A;  4ZS2 A;  4YLH A;  3DTO A;  1WR6 A;  4AKI A;  5JR9 A;  3C50 A;  2B1E A;  5TAO A;  3H37 A;  5LOV E;  2W61 A;  3NRY A;  2NOX A;  5E0O A;  5LNK A;  3PDY A;  2GK9 A;  3KV6 A;  3ZMU B;  4L9I A;  3ANW A;  1HCI A;  2WSS V;  4HEA A;  2ODU A;  4MHC A;  2Q9Q D;  4IE4 A;  1HTJ F;  2JMH A;  2E9X A;  3O9X A;  3KVB A;  4A56 A;  4MAL A;  2W00 A;  1NWM X;  3LK3 B;  5HAX A;  3FHN A;  3KIN B;  2Y48 B;  5HXC A;  1B7T A;  4PW8 A;  2X9X A;  3NZQ A;  3FXE B;  3N9N A;  2CE7 A;  4WNK A;  2IW5 B;  5JQG E;  4IDZ A;  1MIV A;  3SS1 A;  2X67 A;  3V5S A;  1U4Q A;  5LJN A;  4TX5 A;  3N2K E;  2N2N A;  5L3E B;  4QX8 B;  3DP7 A;  4CXW A;  2KLQ A;  3IF8 B;  3UUM A;  4AKR B;  4IST A;  3KV9 A;  2X51 A;  4QXC B;  3OBV E;  3UUN A;  2NP9 A;  2V1D B;  3ZC0 A;  3HR0 A;  1NAF A;  5JDG A;  4ADZ A;  3PUA A;  3J9X 1;  4QKN A;  1UCU A;  4PJL A;  3WAK A;  1CUN A;  3NZP A;  2X9H A;  4J2C A;  4U74 A;  1ZEE A;  2V26 A;  2M67 A;  2V7M A;  1FMW A;  2XAG B;  3CQC B;  3LJC A;  4JLE A;  4MBQ A;  4L5G A;  2YU2 A;  2DNX A;  3C4X A;  4JEH B;  4UVC B;  5J1G A;  3R84 B;  1O3X A;  4X20 E;  1BR0 A;  2YK0 A;  3MZK B;  2NW9 A;  3ZMT B;  5EZY E;  4EZ4 A;  4ZI2 D;  4UVA B;  2PJQ A;  2EHO B;  2K9A A;  2KT9 A;  1D1B A;  5IYZ E;  4UV8 B;  4AXP A;  2J1D G;  4H9O C;  5L3C B;  4UXN B;  3ZC1 A;  3JC6 C;  2BZB A;  3ZMV B;  4ZI3 D;  3PUG A;  3W15 B;  4EYY R;  3KDS E;  4PJM A;  5LGU B;  3ESL A;  1MMN A;  4EIW A;  4M1P A;  2VKJ A;  2Y6X A;  1YW0 A;  3PU3 A;  3U3I A;  2LHR A;  4X1Y E;  2LT3 A;  3V5U A;  3FXD B;  5HYA A;  2ZM8 A;  2LOS A;  2WWU A;  4UIG A;  3IBP A;  5DQW A;  5LGN B;  5C8Y E;  4P0A A;  2KXP B;  3Q5X A;  3E08 A;  5KX5 E;  3HKB E;  3S4U A;  3I9W A;  1YKH B;  2L9Q A;  3N9Q A;  4PFP A;  4HE8 A;  2IC6 A;  4KMC A;  3ZPO A;  1G8X A;  2P9B A;  3PU8 A;  4BJM A;  3C64 A;  5HXE A;  1MMD A;  2W0G A;  5JRC A;  3CKD A;  4JUY A;  1SA0 E;  4UEM A;  4IE0 A;  1HG5 A;  2A3D A;  5HWY A;  3TKL B;  3GN5 B;  4C91 A;  3RYH E;  4GIW A;  5LA6 E;  3Q5W A;  5EK2 A;  1HG2 A;  2G0U A;  4KBM B;  4I43 B;  2UXX B;  1OXZ A;  2SPC A;  1LRZ A;  2XAH B;  4TZ4 C;  4C90 A;  3K8P C;  4GK0 E;  2D0U A;  3HKD E;  5HWX A;  3J7Y q;  2CM0 A;  2DCF A;  3CVR A;  3HKE E;  4QX7 B;  4CQI A;  4ZHQ E;  4BA9 A;  4O4L E;  4B6X A;  4GK5 E;  4AQG A;  3T8O A;  4ZI3 C;  1MNE A;  4PJN A;  5L3D B;  4YFS A;  4PJJ A;  5L3F B;  3KV4 A;  4DBR A;  3ANW B;  4I55 E;  3EUH A;  2YU1 A;  4HN9 A;  5LXT E;  2CA5 A;  2WBL A;  3GWH A;  3FBZ A;  2X9W A;  2V7J A;  1HF8 A;  5KDM C;  3I0O A;  3N2O A;  4IGU A;  4P09 A;  1Z0P A;  4FJO A;  3LBX A;  4HGA A;  5LJM A;  5GON E;  2CXD A;  3RYI E;  2EHO A;  3IHR A;  2H3R A;  2XHE B;  2LSG A;  4E7S A;  3ZEF B;  1G73 A;  3PUS A;  5DJQ C;  2ZMA A;  3D0T A;  1H7C A;  5ADX L;  3P8C D;  4YJ3 E;  5CA1 E;  2KZ7 B;  3ZCJ A;  5JDQ A;  4WBN E;  4JEU B;  5F3J A;  4WBO A;  4IE6 A;  1D0Z A;  2K48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...