3CX6B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
185
Chain Sequence
LIIGPEEESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanine nucleotide-binding protein alpha-13 subunit
publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 63
structure length 185
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx6B00
3AB3B 3QC9A 3T8OA 4WBOA 1ZV4X 2ACXA 3CX8B 1HTJF 4WNKA 4PNIA 2I59A 1IAPA 4YHJA 3CX7B 2ES0A 4L9IA 3CX6B 3C51A 3C4XA 3C50A 3C4ZA 2PBIA 4GOUA 4IGUA 1SHZC 2A72A 2DLRA 3C4WA
chains in the Genus database with same CATH superfamily
3ABVA 2PJQA 2CMRA 4ZI2D 3PUGA 2WQYA 5AQTB 3AAAB 3CX7B 4P0BA 4UVBB 2JQKA 3H3AA 3SOLA 3L8RA 4HFVA 4TZ4C 3VR9A 3HI2A 4P0AA 1NWMX 1N36T 4EV6A 1UK5A 2FJBA 4KMCA 3C4ZA 4JEHB 1OEDE 5LXTE 3DJBA 3IBPA 2R6GF 4FI5A 4X1YE 2V6YB 2KLQA 2W66A 3C4XA 1IBMT 2V1DB 3T1HT 2UUBT 5L2LA 2CRBA 3RIAA 4HWCA 2HN2A 2NR4A 1KEYA 3LBXB 4L0RA 3P4PA 5L47A 2JMHA 2NTXA 5FXVA 2V7LA 1MNDA 2V6YA 3ZT5A 3ZCJA 5CA0E 4JI4T 3L09A 1ZOYA 2HN1A 4JI3T 2WU5A 3LBXA 3UUMA 3FZFB 1OXZA 4OHFA 2WB5A 1AJ3A 4CXYA 3EAMA 2XASB 2W2UA 3RIUA 5C3JA 2WMNA 2YU1A 1ZHCA 2AE9A 1W0AA 3K3QC 3LK42 4ILBA 4AKHA 4IDOA 2VASA 2WDQA 3AXJB 5AQIB 3CVRA 3CQCB 2CBJA 3HR0A 4EZ4A 5GONE 3PURA 4ZS2A 1M7KA 4TV9E 2H7OA 3A5XA 1KF6A 2XHEB 2E9XD 2CXLA 1MIVA 3AXJA 5BR8T 5FYMA 5AQQB 4PNIA 4MFRA 5EZYE 4GYRA 3SFEA 4Z8XA 4A98A 1HX1B 2G0UA 4PW8A 4U7YA 4H9QC 2CXFA 2WDRA 2JIWA 4MHCA 1ZV4X 5AQLB 2LSKA 4TN7B 1L0VA 3WAJA 1VRBA 1ZKEA 3AEAA 4ISSA 4AKRB 1NENA 5L3BB 2IC9A 2V5CA 3RRCA 5JREA 1J1JA 2IAKA 2K3WA 3FZHB 5HEJA 4O2AE 3AB3B 4IDPA 4OYJA 4JI0T 4U72A 2BKPA 4NUVA 3WI3A 4LFBT 2WCAA 4QXBB 2KZ7B 5FY1A 1E7PA 4HFHA 2VVNA 4LFCT 4TWHA 4UIGA 3NRXA 5E0OA 4HFBA 2WWUA 5HYAA 5L3DB 4GYSA 3I9YA 4P09A 1HX8A 3FHNA 3I0OA 2X9YA 4EEDA 2XJ7A 4DR6T 3Q5DA 4JEUB 4YSZA 2DHRA 3T8OA 2LM2A 4P1NA 1D0YA 3N2GE 2BBHA 5JDQA 3ETVA 3VKGA 2IIUA 2DL1A 4TNWA 3FZKB 4KP3C 2BS3A 4TV8E 2BKNA 3TLTA 4YSXA 4ILUA 2HH7A 4PAGA 4UELA 3RHWA 1N32T 1WFDA 3UU4A 3PV0F 4PJLA 3AA0B 4B3RT 3TLVA 4YHHT 2YEVC 3UULA 4DO0A 3V5UA 3S4UA 3JAFA 3NZPA 2D5UA 2C5IT 4PK6A 3ZMUB 4DV3T 5LHHB 2BG9B 2XUEA 3HKEE 5TAOA 3UQ7A 4X1IE 4UV8B 5EK2A 3F2EA 1HF8A 3TKLB 4LMKA 3J9X1 5F5WA 4NXNT 2EHOB 2Q9QD 1QSDA 2CEAA 3EABA 2IHR1 2BG9A 4LF7T 4OK0A 4MBQA 1KNRA 3NRYA 3N9MA 3Q2MA 5F3JA 3EHZA 1SHZC 4EZHA 2LT3A 3HKCE 1IBKT 3UTKA 2OV9A 3AEEA 2WZIA 1ZP0A 3Q9DA 2YKSA 2EHOA 2ACZA 1IJ6A 2ES0A 3E08A 1HNXT 3RQWA 3KV6A 2HPJA 4XZCA 3AE7A 3RIFA 4H9RC 5LGTB 3P4SA 1KK7A 2BVLA 2D0TA 4ZI7E 3CIRA 3AE3A 4Z91A 4CZZB 2KINB 3U3IA 1HNZT 4AQFA 4KHZF 3ZMSB 2FJDA 4H9SE 1XMOT 4ZZBA 2LHRA 3E22E 5CB4E 2QA7A 1WLXA 4LF8T 3ZLIA 3ZMTB 2BG9E 4NPPA 4I50E 3PUXF 5JDFA 2UXDT 1KNPA 3N2KE 4AKGA 3RYHE 5L4HA 3SS1A 4UVAB 5LHGB 4ZI3C 1MIWA 2LSIA 2X68A 1WYCA 1N34T 1Y64B 3MZKB 4X65T 2JQ9A 3JCFA 4JUYA 2UXXB 2UU9T 2XQ6A 3CMLA 2IDOB 2JPFA 3NBXX 4HTEA 5KDMC 5AQOB 1U5PA 4DMVA 3OVUA 3HL6A 2H3RA 3ZYLA 2DCFA 3RYIE 2V26A 5LHIB 2M6BA 4HGAA 4U74A 3X1DA 3LK3B 3RI5A 2PG8A 2ZMAA 3H3MA 3R84B 3AE2A 3PE0A 4G63A 1JNZA 2BZBA 4MALA 2VKOA 3L3PA 1D0ZA 2JJ9A 5M4YA 4PFOA 3PU8A 2RPAA 4CI1B 2DI4A 3O1HA 4UV9B 2KWIB 1XNRT 4X1KE 1QUUA 1VOMA 4YY3T 2A3DA 4JI7T 3BK9A 3J7Yq 2MOZA 1R8IA 4DR2T 2XAGB 4IREA 4O4IE 2LEHA 5FL0A 3O9XA 1YQ3A 4BAYB 3RPUA 4KI0F 4YFSA 4M1PA 3SRZA 4EGWA 5LP6E 3OKQA 4QH5A 4DUZT 2X66A 5L3GB 1OEDC 4COFA 4ILAA 3AVSA 1X9BA 4ADZA 4HFIA 1NEKA 4DV7T 5FNVE 2WS3A 1B7TA 4LF9T 2SPCA 2BS2A 3MK7C 3KDSE 3NVOA 4DV2T 3AA1B 4O4JE 3KV4A 2LE8A 1XWMA 1N33T 4AISA 2VQFT 2NTYA 4TX5A 4NIQA 2CPTA 3AEGA 3KBTA 2H88A 3OBVE 4JV5T 4FJOA 3ZCIA 2M6IA 4OX9T 4HKAA 5L4EA 3UU8A 5C2TA 3N5LA 3ZEFB 4ZS3A 3AE5A 4QXCB 2YOEA 2XQ5A 2NOXA 4DR1T 2L8KA 4DUYT 5LNKA 1VCSA 4JI8T 4LMLA 2XY8B 2M67A 5JR9B 5HEGA 5F8PA 2XAJB 3QB5K 4YLHA 1D1AA 2VKDA 4LF6T 2KXPB 5LMNT 5AQNB 4X66T 4WYVA 1UCUA 2E9XB 2MYSA 3N9PA 1XNQT 3P4QA 4G2AA 4CN4A 2VK9A 3LJCA 3W15B 4H63H 3P7IA 5JR9A 4NUUA 5IWAT 3C50A 4CXWA 2NP9A 5LJMA 3ZT6A 2IW5B 4EOZB 4AXPA 2E9XA 4IHJE 2CWOA 3PU3A 5LJNA 1BR2A 3EUHA 4NXMT 4YT0A 1LVFA 3UUNA 2AXDS 4JI5T 3ETUA 2D0UA 4IGUA 2YDRA 4E7SA 4UEMA 5LB7B 5FL1A 5AQGB 1UUSA 4IDQA 4QHOA 2C5KT 5FY7A 5AFUL 2X51A 3CQGB 3B13A 3EI0A 5ABEA 4ZOLE 3LG7A 5LBQB 4HWHA 3EDUA 3LSVA 4PK5A 1MMAA 2J47A 4OFZA 4B3ST 4YJ3E 3HA4A 4JI6T 5IUXA 3RF1A 4ASKA 2YINA 2KNDA 2W0GA 2YK0A 4KHPT 4HFDA 2V5DA 3V5SA 2LLYA 2UUCT 3ZC0A 3UU5A 4XAXB 2L9QA 1UX4A 1UX5A 2K9AA 3ANWB 1LKXA 1J5ET 3PUVF 4BJNA 3C64A 3KV9A 4ZZCA 1YQ4A 3TLSA 4UXNB 1W0BA 5FXZA 4TWFA 4ILCA 1D1CA 4H9OC 4CN6A 3RKOA 1T98A 2WM9A 3T1YT 2CLYC 1MMNA 3ANWA 2JRKA 1GQEA 1NAFA 3QK6A 5AQFB 5JRCB 3UUXB 2YU2A 4IL4A 2WY2A 3R6NA 3UQ4A 5AQPB 3QOFA 4PJNA 2XTLA 4IL9A 2CCQA 3OTOT 1HTJF 5HXHA 1Y01A 4QKNA 4AIUA 2XM1A 2N2NA 2NW8A 2E8IA 4EYUA 5JRCA 1G8XA 5HXEA 1O3XA 3KFWX 2WSSV 3IEEA 5DJQC 1JNRA 4U2YA 3RRWA 2XSAA 2Q9QB 4F8HA 2XQAA 2BDEA 3F31A 2CHOA 3JC6D 1IBLT 3I1AA 4GOUA 3RYCE 3D0TA 4A56A 4YTPA 2Q9QA 1MMDA 2CA5A 2V7KA 4C90A 2D2SA 2CE7A 2WWVA 2RA1A 1BR4A 4QH1A 2C5JA 4WBOA 3ESLA 3AA6B 1YD8G 2P9BA 3SWHA 2UXNB 2QYWA 4ISTA 1LRZA 4L9IA 5LOVE 4U3CA 1WYBA 2XM2A 3RQUA 2VKJA 4MLKA 4LFAT 1FMWA 3Q5XA 5FY0A 3GN5B 3AE4A 3AVRA 5HWXA 1S35A 2YDQA 2MAWA 3RC8A 4CQIA 5IYZE 2LM9A 1J5WA 1XMQT 5AQMB 2XQ7A 2XQ9A 4YJ2E 2DWKA 4DR4T 4Z90A 4HN9A 3GN5A 4QX7B 3K3OA 2A2FX 1YKHB 2EHOC 1T72A 2CWYA 4GKKT 5H6RB 3IA3A 5LCYA 2FJAA 4K0UA 3ZMVB 4ZEYA 5J0ZA 1M62A 3FBZA 4TUYE 3JADA 1BR1A 3E0ZA 4DBQA 4AQFC 4B3MT 4GK5E 2X9WA 3ONJA 4Q25A 1I6ZA 5HXSA 3B5MA 2Y8DA 2F4VT 2Y48B 5H6QB 4AI6A 3MJXA 4H9NC 3IHRA 3N9OA 2W61A 3I9WA 3ZC1A 4ZI3D 4A97A 2N1GA 2V7MA 1W09A 1IZNB 3VHLA 2IUBA 3MKDA 3O1IA 4K0KT 4EAHA 1FJGT 4U31A 3OPCA 5HXRA 3O4XE 4IDNA 5DQVA 1V9DA 5LGNB 3ZJ1A 1G73A 2E5LT 4AQYT 2LKHA 3PUZF 3GMIA 4YTNA 2MBGA 2L3LA 1IJ5A 1HS7A 4LMJA 2PTFA 2B76A 2NW9A 4EXTA 5LG3A 5CFBA 5KX5E 5AQHB 3AE9A 5KXJA 3AA7B 2PBIA 1SA0E 2QRXA 1CHUA 4PJMA 4HEAA 3NWIA 4DR5T 3DP7A 5FVKA 3BQIA 1T7SA 3ZN1B 3PDYA 1FMVA 3A8YC 4GK0E 1MIYA 4IDZA 3FBLA 3FXDB 5ADXL 2FBWA 4C91A 4IE7A 4EEBA 4E7ZA 3OYXA 4I43B 2A72A 1U4QA 3RKGA 3NKZA 2XZEA 5LBMA 3RH3A 1WR6A 3PJAA 2VVSA 4QWNB 4WZXA 5HCJA 4UR9A 4KX6A 3ZJ2A 4ZI2C 2QVAA 4ZHQE 4IT4A 2BS4A 2JMKA 4BJMA 2K48A 4F6RC 4HFEA 2WAUA 2XQ8A 4DV4T 3KV5A 1HCIA 3MXZA 2X0HA 3WAKA 3UU3A 4HFCA 4HWIB 2WDVA 4WW0A 4JYAT 1SE7A 3BQKA 3N9NA 4PFPA 1W9RA 4ERRA 3PTRB 2E2AA 3JAEA 4PJJA 2E5VA 3VU7H 3ZPOA 2CM0A 5FKYA 3GWHA 5LG4A 3U78A 4ANJA 3VKHA 1MNEA 2X9HA 3RX6A 3KINB 2OLTA 3O1JA 2B1EA 4DV5T 3PUAA 5J2UE 2QGSA 2XQYA 1KFYA 2KSRA 1EZ3A 3N9LA 3FZMB 2LHNA 3ZMZB 1VCTA 3CX8B 3NZQA 5CGMA 3K1SA 3UFEA 4JBWF 4DV6T 2RP4A 4YTMA 5J2TE 4B3TT 3CPZA 4QX8B 4DR3T 3OYZA 3A7MA 2V8SV 3UT5E 5L3EB 4ZXLA 1HNWT 2CBIA 2BVMA 3M65A 2BBJA 2JQHA 1HG2A 4AKLA 3ZSTA 1Z0PA 2UXCT 2W63A 3ZKRA 2J1DG 5ABFB 2D9DA 2KT9A 4DMWA 5HEUA 1OWAA 4DV1T 4JLEA 5JR9C 2DNXA 3RIUC 2IC6A 1LVKA 2VKHA 3P50A 3L39A 3N2OA 2X67A 4N78D 2E9XC 4DBRA 4X62T 1QLBA 5CJ5A 5ABFA 4CN1A 4YXDA 2KWHA 3VRBA 1S94A 3C4WA 2J4GA 3KBUA 3PUSA 2VWAA 5FXWA 1UGOA 4X64T 2X0LB 2MTQA 2XAHB 4YHJA 4U7IA 2W62A 2V7IA 3FB2A 5KMGP 4QXHB 2WBLA 2FJEA 4AQGA 2CLYB 3Q5EA 2XPKA 1HFAA 3MA9A 4CI3B 3ONXA 2ODUA 3EVYA 3F57A 1XDOA 5DQWA 5BMVE 2HHHT 2A9UA 3UUBA 1ZEEA 5HEHA 3ZT7A 4DIDB 4B6XA 3LK2B 2JQQA 3KVBA 4PK4A 3CQXC 3AE6A 1WR0A 1WRDA 5ABGA 4YSYA 1WCRA 3AE8A 1KNZA 1HG5A 2BKOA 4UF0B 1MMGA 2UXBT 4HWDA 2UUAT 2VURA 1CUNA 4TWDA 3QUJA 3AE1A 5FP3A 5JDLA 3PUQA 5IHYA 1T8BA 5JTGA 4WBNE 5HWYA 2VL8A 4H63V 4UF0A 5JVDE 3AAIA 1XDPA 3K8PC 2V6XA 2YDSA 4BA9A 4U33A 1FIOA 1D0XA 2K5BB 1UURA 4UVCB 4J2CA 3FXEB 4IE4A 4CXXA 2ZLYA 3QC9A 2WZHA 5AQKB 4HE8A 5HAXA 4KUMB 2H7VC 4WNKA 5LGUB 1US7B 1Z8UA 3ZN0B 2XQ4A 1D1BA 2NW7A 1H7CA 3RGLA 4TNVA 3JC6C 2I0MA 2LOPA 2ZM8A 4IE5A 4X20E 2Z6EA 1IAPA 2XAFB 3P4RA 2ODVA 1DU2A 3SFDA 1FEWA 2IMLA 3RC3A 2ZM0A 4DVDA 2J62A 3AEDA 5JDGA 4A5XA 5AQSB 5C8YE 3HKBE 2LSGA 5FMNA 3CX6B 2Q9QC 3GA8A 2VB6A 2MPKA 5FXXA 4CI2B 3B57A 3AEFA 3TLUA 3AEBA 4AKIA 4O4LE 5EK4A 4OYKA 2WU2A 2ACXA 5LYJE 2I6HA 3K3NA 2I59A 2X9XA 3CK6A 1E2AA 3LDQB 4GKJT 3MACA 4JI2T 5AQVB 4XBFB 1YW0A 5LA6E 2BG9C 3AAEB 5JDNA 2K24A 2CHNA 4DV0T 4I55E 2LSJA 2DWGA 1YKEB 2VL0A 2CXDA 5ABHA 3P4WA 2DLRA 2LSYA 5FVLA 3LFMA 2Y6XA 3CWZB 2LJLA 2EHOD 2XAQB 5DABA 5CA1E 4I0UA 3HKDE 5JH7E 2WMOA 2X0YA 3TLWA 5L3FB 3PUWF 5AQUB 3ZYMA 5JDHA 4IE0A 3C98B 5HEOA 4O8SA 3FZLB 2VQET 1BR0A 2KMFA 4JI1T 2NWBA 3H37A 4IE6A 3C51A 4LF5T 4L5GA 2V7JA 5AQRB 4GIWA 5A1LA 3UFGA 4LF4T 3QB5A 4H9PC 4DR7T 2W4XA 5AQJB 1X79A 2ZM2A 3VRAA 2WP9A 5HCMA 1SUMB 3QNUA 2PFVA 1I94T 2LOSA 4HWFA 4DNDA 4EB6E 1E1HB 5JDMA 2FUPA 2LRLA 3DTOA 2XQ3A 3Q5WA 3PUYF 2W67A 1YXRA 2C0SA 3VR8A 4EYYR 1XZYA 3PJAJ 3ONLC 3RYFE 4I4TE 4KBMB 2YN6A 1OEDB 3BQLA 3RLFF 3IF8B 2W00A 3ZSSA 5JQGE 5HXCA 3P8CD 5J1GA 4X5TA 3M3ZB 4EIWA 3CKDA 2LKGA 4U2ZA 4QH4A 2LRKA 2GK9A 4O4HE 2N9DA 2XSBA 1OEDA 2OA5A 1HR0T 5EK3A 4O2BE 3G06A 4IIJE 2ZM6T 3AECA 4V1Av 2H89A 3I0QA 3ZYKA 3OJAA 5L3CB 3EDVA 5ETWA 2HPLA 5LMUT 3KVAA 3N9QA 3UU6A
chains in the Genus database with same CATH topology
2QA7A 1WLXA 2PJQA 2IC6A 1LVKA 3ZLIA 3ZMTB 3RRWA 2CMRA 4I50E 5JDFA 4ZI2D 2Q9QB 3PUGA 2VKHA 3N2OA 2X67A 4N78D 2E9XC 4DBRA 3AAAB 3CX7B 3N2KE 4AKGA 2BDEA 3RYHE 3F31A 4P0BA 4UVBB 3SS1A 2KWHA 3H3AA 3JC6D 4UVAB 5LHGB 1S94A 3SOLA 3I1AA 4GOUA 4HFVA 4TZ4C 4ZI3C 3RYCE 3C4WA 3HI2A 3KBUA 3PUSA 1MIWA 2VWAA 3D0TA 5FXWA 2LSIA 4P0AA 2X0LB 2X68A 4A56A 5JR9C 2MTQA 2Q9QA 1WYCA 2XAHB 1MMDA 2CA5A 1Y64B 2V7KA 3MZKB 4C90A 4YHJA 1NWMX 2D2SA 2CE7A 2W62A 2RA1A 2V7IA 3FB2A 4KMCA 4JUYA 5KMGP 3C4ZA 4QXHB 2WBLA 2UXXB 4JEHB 3CMLA 5LXTE 1BR4A 2JPFA 3DJBA 3IBPA 4AQGA 3NBXX 4FI5A 2CLYB 4HTEA 5KDMC 2C5JA 1HFAA 1U5PA 3MA9A 4DMVA 4CI3B 4WBOA 3ONXA 3ESLA 2ODUA 3AA6B 3EVYA 3F57A 3HL6A 4X1YE 1YD8G 2P9BA 3SWHA 2UXNB 5DQWA 5BMVE 4ISTA 2H3RA 3ZYLA 1LRZA 2DCFA 3RYIE 4L9IA 2KLQA 5LOVE 1ZEEA 2V26A 5LHIB 3C4XA 4HGAA 4U74A 3LK3B 2V1DB 5L2LA 4B6XA 1WYBA 2PG8A 3LK2B 2ZMAA 2JQQA 3KVBA 4PK4A 2VKJA 3CQXC 3R84B 1WRDA 4MLKA 3LBXB 1KNZA 1HG5A 1FMWA 3PE0A 3Q5XA 4L0RA 2JMHA 4G63A 5FY0A 3GN5B 4UF0B 2NTXA 3AVRA 2BZBA 5FXVA 2V7LA 1MMGA 1MNDA 4MALA 2VKOA 5HWXA 1S35A 3ZCJA 3L3PA 3RC8A 5CA0E 1D0ZA 4CQIA 5IYZE 1CUNA 2JJ9A 3L09A 5M4YA 2LM9A 3QUJA 5FP3A 4PFOA 5JDLA 3PUQA 3PU8A 5IHYA 4WBNE 4CI1B 5HWYA 2DI4A 2VL8A 3LBXA 3UUMA 3O1HA 4YJ2E 4UV9B 2DWKA 4H63V 4HN9A 3GN5A 4UF0A 2KWIB 1OXZA 4OHFA 4X1KE 1QUUA 4QX7B 5JVDE 3AAIA 1VOMA 1AJ3A 3K8PC 4CXYA 2A3DA 3K3OA 2A2FX 2XASB 1YKHB 3BK9A 2EHOC 3J7Yq 2MOZA 4BA9A 2CWYA 1FIOA 1D0XA 5H6RB 2K5BB 2WMNA 2YU1A 1ZHCA 2XAGB 4O4IE 4UVCB 3K3QC 5LCYA 3LK42 2LEHA 4J2CA 3O9XA 3FXEB 4IE4A 4BAYB 4K0UA 4CXXA 3ZMVB 2ZLYA 4AKHA 3RPUA 3QC9A 2VASA 4YFSA 4M1PA 3FBZA 3SRZA 4HE8A 5HAXA 4KUMB 4TUYE 2H7VC 4WNKA 1BR1A 5LGUB 5LP6E 3OKQA 1US7B 2X66A 5L3GB 3E0ZA 3CVRA 3CQCB 3ZN0B 3AVSA 3HR0A 4EZ4A 1D1BA 5GONE 4ADZA 3PURA 2NW7A 1H7CA 4ZS2A 4DBQA 4TV9E 2H7OA 5FNVE 4AQFC 3A5XA 1B7TA 4GK5E 2SPCA 2X9WA 3JC6C 3KDSE 3MK7C 2XHEB 5HXSA 2E9XD 2CXLA 1MIVA 2LOPA 2ZM8A 4IE5A 4X20E 2Z6EA 2Y8DA 5FYMA 2Y48B 3AA1B 4PNIA 4MFRA 4O4JE 5H6QB 4AI6A 3MJXA 3KV4A 4GYRA 1IAPA 2LE8A 4H9NC 5EZYE 3IHRA 3N9OA 2W61A 3I9WA 4Z8XA 2NTYA 3ZC1A 4ZI3D 2N1GA 2V7MA 4TX5A 1IZNB 2G0UA 4PW8A 2XAFB 3VHLA 2ODVA 4H9QC 3MKDA 2CXFA 3O1IA 3KBTA 4EAHA 1FEWA 4MHCA 3OBVE 5HXRA 2ZM0A 3RC3A 4DVDA 1ZV4X 5JDGA 2LSKA 5C8YE 4TN7B 3HKBE 4FJOA 2LSGA 3O4XE 3WAJA 5FMNA 5DQVA 3ZCIA 1VRBA 1ZKEA 3CX6B 4HKAA 4ISSA 4AKRB 1V9DA 5LGNB 5L3BB 2Q9QC 3GA8A 3ZJ1A 2IC9A 1G73A 2VB6A 3RRCA 5FXXA 3N5LA 3GMIA 4CI2B 3B57A 5JREA 2MBGA 2IAKA 2L3LA 1IJ5A 3ZEFB 4ZS3A 1HS7A 4QXCB 4AKIA 4O2AE 3AB3B 4O4LE 5EK4A 4OYKA 2NOXA 4OYJA 2L8KA 4U72A 2ACXA 5LYJE 2NW9A 5LNKA 4NUVA 3WI3A 4EXTA 3K3NA 2I59A 4QXBB 2KZ7B 2X9XA 5KX5E 5FY1A 3MACA 2M67A 5JR9B 3AA7B 4XBFB 5F8PA 2PBIA 1SA0E 1YW0A 2XAJB 4UIGA 4PJMA 4YLHA 1D1AA 2VKDA 3NRXA 5E0OA 5LA6E 4HEAA 2WWUA 2KXPB 5HYAA 3AAEB 5L3DB 3DP7A 4GYSA 5JDNA 3BQIA 1UCUA 2E9XB 2MYSA 3I9YA 3N9PA 4P09A 3ZN1B 1HX8A 4G2AA 3FHNA 3I0OA 2K24A 2VK9A 1FMVA 3PDYA 4GK0E 3LJCA 3W15B 4H63H 1MIYA 4IDZA 4I55E 3FBLA 3P7IA 2LSJA 2DWGA 3FXDB 5ADXL 5JR9A 4NUUA 3C50A 4CXWA 4C91A 1YKEB 2NP9A 2X9YA 4IE7A 5LJMA 4E7ZA 3OYXA 2CXDA 4I43B 2A72A 2IW5B 1U4QA 4JEUB 2DLRA 4EOZB 2LSYA 4AXPA 2DHRA 3LFMA 2E9XA 2Y6XA 3T8OA 3CWZB 4IHJE 2CWOA 3PU3A 2LJLA 5LBMA 3RH3A 5LJNA 1WR6A 2EHOD 1BR2A 2XAQB 5DABA 5CA1E 4QWNB 3HKDE 3EUHA 1LVFA 1D0YA 3N2GE 3UUNA 5JH7E 2WMOA 5JDQA 3ZJ2A 3ETVA 4ZI2C 5L3FB 3VKGA 4ZHQE 3ETUA 2D0UA 4IGUA 2JMKA 3ZYMA 5JDHA 4IE0A 4BJMA 2K48A 3C98B 4KP3C 4F6RC 4O8SA 4E7SA 4UEMA 4TV8E 4ILUA 2WAUA 3KV5A 1HCIA 2HH7A 4PAGA 2C5KT 4QHOA 3MXZA 1BR0A 2KMFA 5FY7A 4UELA 3WAKA 2NWBA 3H37A 4IE6A 3C51A 5AFUL 4PJLA 3AA0B 2X51A 4L5GA 2V7JA 4WW0A 4GIWA 5A1LA 3CQGB 2YEVC 3B13A 3UULA 4DO0A 4ZOLE 3BQKA 3LG7A 3N9NA 3V5UA 4PFPA 5LBQB 3EDUA 4PK5A 3S4UA 4ERRA 1MMAA 3PTRB 4OFZA 4H9PC 3NZPA 2D5UA 2C5IT 4YJ3E 4PK6A 3HA4A 4PJJA 3ZMUB 1X79A 2ZM2A 5LHHB 4ASKA 2YINA 2XUEA 2KNDA 3HKEE 5TAOA 3VU7H 3ZPOA 4X1IE 4UV8B 2CM0A 2PFVA 5EK2A 2W0GA 3F2EA 2YK0A 2LOSA 3GWHA 5LG4A 4DNDA 3U78A 4EB6E 1E1HB 3V5SA 5JDMA 3ZC0A 4ANJA 1HF8A 3TKLB 3VKHA 1MNEA 4XAXB 3J9X1 2X9HA 2EHOB 2Q9QD 3RX6A 1QSDA 3DTOA 2CEAA 2L9QA 3KINB 1UX4A 1UX5A 2K9AA 3ANWB 3Q5WA 1LKXA 4BJNA 3C64A 3O1JA 3KV9A 4OK0A 2C0SA 4MBQA 3NRYA 2B1EA 3N9MA 4EYYR 3Q2MA 4UXNB 3RYFE 5FXZA 5F3JA 3PUAA 4I4TE 1SHZC 4EZHA 5J2UE 1D1CA 2LT3A 2QGSA 2XQYA 3HKCE 4H9OC 3UTKA 4KBMB 1EZ3A 3N9LA 3RKOA 1T98A 3BQLA 3Q9DA 2WM9A 5CB4E 3IF8B 2W00A 5JQGE 2LHNA 2EHOA 3ZMZB 3CX8B 5HXCA 3NZQA 2CLYC 1MMNA 1IJ6A 3ANWA 3P8CD 3UFEA 5J1GA 2JRKA 2ES0A 3E08A 1NAFA 4EIWA 3QK6A 3CKDA 2RP4A 5J2TE 5JRCB 3UUXB 2YU2A 3CPZA 3KV6A 4QX8B 2HPJA 4XZCA 3OYZA 3R6NA 4H9RC 5LGTB 2GK9A 3UT5E 4O4HE 2N9DA 5L3EB 4PJNA 2OA5A 1KK7A 2BVLA 2D0TA 2XTLA 2BVMA 2CCQA 3M65A 1HG2A 4AKLA 1HTJF 4ZI7E 5HXHA 5EK3A 4O2BE 1Z0PA 4IIJE 4CZZB 2KINB 2W63A 3U3IA 4QKNA 4AQFA 2N2NA 2NW8A 4V1Av 3ZMSB 2J1DG 2E8IA 4EYUA 5JRCA 4H9SE 3I0QA 3ZYKA 2KT9A 4DMWA 2LHRA 3OJAA 5L3CB 1G8XA 5HXEA 1O3XA 1OWAA 3E22E 3EDVA 3KFWX 2WSSV 3IEEA 5ETWA 2HPLA 3KVAA 4JLEA 2DNXA 3N9QA 5DJQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB3 B;  3QC9 A;  3T8O A;  4WBO A;  1ZV4 X;  2ACX A;  3CX8 B;  1HTJ F;  4WNK A;  4PNI A;  2I59 A;  1IAP A;  4YHJ A;  3CX7 B;  2ES0 A;  4L9I A;  3CX6 B;  3C51 A;  3C4X A;  3C50 A;  3C4Z A;  2PBI A;  4GOU A;  4IGU A;  1SHZ C;  2A72 A;  2DLR A;  3C4W A; 
#chains in the Genus database with same CATH topology
 3ABV A;  2PJQ A;  2CMR A;  4ZI2 D;  3PUG A;  2WQY A;  5AQT B;  3AAA B;  3CX7 B;  4P0B A;  4UVB B;  2JQK A;  3H3A A;  3SOL A;  3L8R A;  4HFV A;  4TZ4 C;  3VR9 A;  3HI2 A;  4P0A A;  1NWM X;  1N36 T;  4EV6 A;  1UK5 A;  2FJB A;  4KMC A;  3C4Z A;  4JEH B;  1OED E;  5LXT E;  3DJB A;  3IBP A;  2R6G F;  4FI5 A;  4X1Y E;  2V6Y B;  2KLQ A;  2W66 A;  3C4X A;  1IBM T;  2V1D B;  3T1H T;  2UUB T;  5L2L A;  2CRB A;  3RIA A;  4HWC A;  2HN2 A;  2NR4 A;  1KEY A;  3LBX B;  4L0R A;  3P4P A;  5L47 A;  2JMH A;  2NTX A;  5FXV A;  2V7L A;  1MND A;  2V6Y A;  3ZT5 A;  3ZCJ A;  5CA0 E;  4JI4 T;  3L09 A;  1ZOY A;  2HN1 A;  4JI3 T;  2WU5 A;  3LBX A;  3UUM A;  3FZF B;  1OXZ A;  4OHF A;  2WB5 A;  1AJ3 A;  4CXY A;  3EAM A;  2XAS B;  2W2U A;  3RIU A;  5C3J A;  2WMN A;  2YU1 A;  1ZHC A;  2AE9 A;  1W0A A;  3K3Q C;  3LK4 2;  4ILB A;  4AKH A;  4IDO A;  2VAS A;  2WDQ A;  3AXJ B;  5AQI B;  3CVR A;  3CQC B;  2CBJ A;  3HR0 A;  4EZ4 A;  5GON E;  3PUR A;  4ZS2 A;  1M7K A;  4TV9 E;  2H7O A;  3A5X A;  1KF6 A;  2XHE B;  2E9X D;  2CXL A;  1MIV A;  3AXJ A;  5BR8 T;  5FYM A;  5AQQ B;  4PNI A;  4MFR A;  5EZY E;  4GYR A;  3SFE A;  4Z8X A;  4A98 A;  1HX1 B;  2G0U A;  4PW8 A;  4U7Y A;  4H9Q C;  2CXF A;  2WDR A;  2JIW A;  4MHC A;  1ZV4 X;  5AQL B;  2LSK A;  4TN7 B;  1L0V A;  3WAJ A;  1VRB A;  1ZKE A;  3AEA A;  4ISS A;  4AKR B;  1NEN A;  5L3B B;  2IC9 A;  2V5C A;  3RRC A;  5JRE A;  1J1J A;  2IAK A;  2K3W A;  3FZH B;  5HEJ A;  4O2A E;  3AB3 B;  4IDP A;  4OYJ A;  4JI0 T;  4U72 A;  2BKP A;  4NUV A;  3WI3 A;  4LFB T;  2WCA A;  4QXB B;  2KZ7 B;  5FY1 A;  1E7P A;  4HFH A;  2VVN A;  4LFC T;  4TWH A;  4UIG A;  3NRX A;  5E0O A;  4HFB A;  2WWU A;  5HYA A;  5L3D B;  4GYS A;  3I9Y A;  4P09 A;  1HX8 A;  3FHN A;  3I0O A;  2X9Y A;  4EED A;  2XJ7 A;  4DR6 T;  3Q5D A;  4JEU B;  4YSZ A;  2DHR A;  3T8O A;  2LM2 A;  4P1N A;  1D0Y A;  3N2G E;  2BBH A;  5JDQ A;  3ETV A;  3VKG A;  2IIU A;  2DL1 A;  4TNW A;  3FZK B;  4KP3 C;  2BS3 A;  4TV8 E;  2BKN A;  3TLT A;  4YSX A;  4ILU A;  2HH7 A;  4PAG A;  4UEL A;  3RHW A;  1N32 T;  1WFD A;  3UU4 A;  3PV0 F;  4PJL A;  3AA0 B;  4B3R T;  3TLV A;  4YHH T;  2YEV C;  3UUL A;  4DO0 A;  3V5U A;  3S4U A;  3JAF A;  3NZP A;  2D5U A;  2C5I T;  4PK6 A;  3ZMU B;  4DV3 T;  5LHH B;  2BG9 B;  2XUE A;  3HKE E;  5TAO A;  3UQ7 A;  4X1I E;  4UV8 B;  5EK2 A;  3F2E A;  1HF8 A;  3TKL B;  4LMK A;  3J9X 1;  5F5W A;  4NXN T;  2EHO B;  2Q9Q D;  1QSD A;  2CEA A;  3EAB A;  2IHR 1;  2BG9 A;  4LF7 T;  4OK0 A;  4MBQ A;  1KNR A;  3NRY A;  3N9M A;  3Q2M A;  5F3J A;  3EHZ A;  1SHZ C;  4EZH A;  2LT3 A;  3HKC E;  1IBK T;  3UTK A;  2OV9 A;  3AEE A;  2WZI A;  1ZP0 A;  3Q9D A;  2YKS A;  2EHO A;  2ACZ A;  1IJ6 A;  2ES0 A;  3E08 A;  1HNX T;  3RQW A;  3KV6 A;  2HPJ A;  4XZC A;  3AE7 A;  3RIF A;  4H9R C;  5LGT B;  3P4S A;  1KK7 A;  2BVL A;  2D0T A;  4ZI7 E;  3CIR A;  3AE3 A;  4Z91 A;  4CZZ B;  2KIN B;  3U3I A;  1HNZ T;  4AQF A;  4KHZ F;  3ZMS B;  2FJD A;  4H9S E;  1XMO T;  4ZZB A;  2LHR A;  3E22 E;  5CB4 E;  2QA7 A;  1WLX A;  4LF8 T;  3ZLI A;  3ZMT B;  2BG9 E;  4NPP A;  4I50 E;  3PUX F;  5JDF A;  2UXD T;  1KNP A;  3N2K E;  4AKG A;  3RYH E;  5L4H A;  3SS1 A;  4UVA B;  5LHG B;  4ZI3 C;  1MIW A;  2LSI A;  2X68 A;  1WYC A;  1N34 T;  1Y64 B;  3MZK B;  4X65 T;  2JQ9 A;  3JCF A;  4JUY A;  2UXX B;  2UU9 T;  2XQ6 A;  3CML A;  2IDO B;  2JPF A;  3NBX X;  4HTE A;  5KDM C;  5AQO B;  1U5P A;  4DMV A;  3OVU A;  3HL6 A;  2H3R A;  3ZYL A;  2DCF A;  3RYI E;  2V26 A;  5LHI B;  2M6B A;  4HGA A;  4U74 A;  3X1D A;  3LK3 B;  3RI5 A;  2PG8 A;  2ZMA A;  3H3M A;  3R84 B;  3AE2 A;  3PE0 A;  4G63 A;  1JNZ A;  2BZB A;  4MAL A;  2VKO A;  3L3P A;  1D0Z A;  2JJ9 A;  5M4Y A;  4PFO A;  3PU8 A;  2RPA A;  4CI1 B;  2DI4 A;  3O1H A;  4UV9 B;  2KWI B;  1XNR T;  4X1K E;  1QUU A;  1VOM A;  4YY3 T;  2A3D A;  4JI7 T;  3BK9 A;  3J7Y q;  2MOZ A;  1R8I A;  4DR2 T;  2XAG B;  4IRE A;  4O4I E;  2LEH A;  5FL0 A;  3O9X A;  1YQ3 A;  4BAY B;  3RPU A;  4KI0 F;  4YFS A;  4M1P A;  3SRZ A;  4EGW A;  5LP6 E;  3OKQ A;  4QH5 A;  4DUZ T;  2X66 A;  5L3G B;  1OED C;  4COF A;  4ILA A;  3AVS A;  1X9B A;  4ADZ A;  4HFI A;  1NEK A;  4DV7 T;  5FNV E;  2WS3 A;  1B7T A;  4LF9 T;  2SPC A;  2BS2 A;  3MK7 C;  3KDS E;  3NVO A;  4DV2 T;  3AA1 B;  4O4J E;  3KV4 A;  2LE8 A;  1XWM A;  1N33 T;  4AIS A;  2VQF T;  2NTY A;  4TX5 A;  4NIQ A;  2CPT A;  3AEG A;  3KBT A;  2H88 A;  3OBV E;  4JV5 T;  4FJO A;  3ZCI A;  2M6I A;  4OX9 T;  4HKA A;  5L4E A;  3UU8 A;  5C2T A;  3N5L A;  3ZEF B;  4ZS3 A;  3AE5 A;  4QXC B;  2YOE A;  2XQ5 A;  2NOX A;  4DR1 T;  2L8K A;  4DUY T;  5LNK A;  1VCS A;  4JI8 T;  4LML A;  2XY8 B;  2M67 A;  5JR9 B;  5HEG A;  5F8P A;  2XAJ B;  3QB5 K;  4YLH A;  1D1A A;  2VKD A;  4LF6 T;  2KXP B;  5LMN T;  5AQN B;  4X66 T;  4WYV A;  1UCU A;  2E9X B;  2MYS A;  3N9P A;  1XNQ T;  3P4Q A;  4G2A A;  4CN4 A;  2VK9 A;  3LJC A;  3W15 B;  4H63 H;  3P7I A;  5JR9 A;  4NUU A;  5IWA T;  3C50 A;  4CXW A;  2NP9 A;  5LJM A;  3ZT6 A;  2IW5 B;  4EOZ B;  4AXP A;  2E9X A;  4IHJ E;  2CWO A;  3PU3 A;  5LJN A;  1BR2 A;  3EUH A;  4NXM T;  4YT0 A;  1LVF A;  3UUN A;  2AXD S;  4JI5 T;  3ETU A;  2D0U A;  4IGU A;  2YDR A;  4E7S A;  4UEM A;  5LB7 B;  5FL1 A;  5AQG B;  1UUS A;  4IDQ A;  4QHO A;  2C5K T;  5FY7 A;  5AFU L;  2X51 A;  3CQG B;  3B13 A;  3EI0 A;  5ABE A;  4ZOL E;  3LG7 A;  5LBQ B;  4HWH A;  3EDU A;  3LSV A;  4PK5 A;  1MMA A;  2J47 A;  4OFZ A;  4B3S T;  4YJ3 E;  3HA4 A;  4JI6 T;  5IUX A;  3RF1 A;  4ASK A;  2YIN A;  2KND A;  2W0G A;  2YK0 A;  4KHP T;  4HFD A;  2V5D A;  3V5S A;  2LLY A;  2UUC T;  3ZC0 A;  3UU5 A;  4XAX B;  2L9Q A;  1UX4 A;  1UX5 A;  2K9A A;  3ANW B;  1LKX A;  1J5E T;  3PUV F;  4BJN A;  3C64 A;  3KV9 A;  4ZZC A;  1YQ4 A;  3TLS A;  4UXN B;  1W0B A;  5FXZ A;  4TWF A;  4ILC A;  1D1C A;  4H9O C;  4CN6 A;  3RKO A;  1T98 A;  2WM9 A;  3T1Y T;  2CLY C;  1MMN A;  3ANW A;  2JRK A;  1GQE A;  1NAF A;  3QK6 A;  5AQF B;  5JRC B;  3UUX B;  2YU2 A;  4IL4 A;  2WY2 A;  3R6N A;  3UQ4 A;  5AQP B;  3QOF A;  4PJN A;  2XTL A;  4IL9 A;  2CCQ A;  3OTO T;  1HTJ F;  5HXH A;  1Y01 A;  4QKN A;  4AIU A;  2XM1 A;  2N2N A;  2NW8 A;  2E8I A;  4EYU A;  5JRC A;  1G8X A;  5HXE A;  1O3X A;  3KFW X;  2WSS V;  3IEE A;  5DJQ C;  1JNR A;  4U2Y A;  3RRW A;  2XSA A;  2Q9Q B;  4F8H A;  2XQA A;  2BDE A;  3F31 A;  2CHO A;  3JC6 D;  1IBL T;  3I1A A;  4GOU A;  3RYC E;  3D0T A;  4A56 A;  4YTP A;  2Q9Q A;  1MMD A;  2CA5 A;  2V7K A;  4C90 A;  2D2S A;  2CE7 A;  2WWV A;  2RA1 A;  1BR4 A;  4QH1 A;  2C5J A;  4WBO A;  3ESL A;  3AA6 B;  1YD8 G;  2P9B A;  3SWH A;  2UXN B;  2QYW A;  4IST A;  1LRZ A;  4L9I A;  5LOV E;  4U3C A;  1WYB A;  2XM2 A;  3RQU A;  2VKJ A;  4MLK A;  4LFA T;  1FMW A;  3Q5X A;  5FY0 A;  3GN5 B;  3AE4 A;  3AVR A;  5HWX A;  1S35 A;  2YDQ A;  2MAW A;  3RC8 A;  4CQI A;  5IYZ E;  2LM9 A;  1J5W A;  1XMQ T;  5AQM B;  2XQ7 A;  2XQ9 A;  4YJ2 E;  2DWK A;  4DR4 T;  4Z90 A;  4HN9 A;  3GN5 A;  4QX7 B;  3K3O A;  2A2F X;  1YKH B;  2EHO C;  1T72 A;  2CWY A;  4GKK T;  5H6R B;  3IA3 A;  5LCY A;  2FJA A;  4K0U A;  3ZMV B;  4ZEY A;  5J0Z A;  1M62 A;  3FBZ A;  4TUY E;  3JAD A;  1BR1 A;  3E0Z A;  4DBQ A;  4AQF C;  4B3M T;  4GK5 E;  2X9W A;  3ONJ A;  4Q25 A;  1I6Z A;  5HXS A;  3B5M A;  2Y8D A;  2F4V T;  2Y48 B;  5H6Q B;  4AI6 A;  3MJX A;  4H9N C;  3IHR A;  3N9O A;  2W61 A;  3I9W A;  3ZC1 A;  4ZI3 D;  4A97 A;  2N1G A;  2V7M A;  1W09 A;  1IZN B;  3VHL A;  2IUB A;  3MKD A;  3O1I A;  4K0K T;  4EAH A;  1FJG T;  4U31 A;  3OPC A;  5HXR A;  3O4X E;  4IDN A;  5DQV A;  1V9D A;  5LGN B;  3ZJ1 A;  1G73 A;  2E5L T;  4AQY T;  2LKH A;  3PUZ F;  3GMI A;  4YTN A;  2MBG A;  2L3L A;  1IJ5 A;  1HS7 A;  4LMJ A;  2PTF A;  2B76 A;  2NW9 A;  4EXT A;  5LG3 A;  5CFB A;  5KX5 E;  5AQH B;  3AE9 A;  5KXJ A;  3AA7 B;  2PBI A;  1SA0 E;  2QRX A;  1CHU A;  4PJM A;  4HEA A;  3NWI A;  4DR5 T;  3DP7 A;  5FVK A;  3BQI A;  1T7S A;  3ZN1 B;  3PDY A;  1FMV A;  3A8Y C;  4GK0 E;  1MIY A;  4IDZ A;  3FBL A;  3FXD B;  5ADX L;  2FBW A;  4C91 A;  4IE7 A;  4EEB A;  4E7Z A;  3OYX A;  4I43 B;  2A72 A;  1U4Q A;  3RKG A;  3NKZ A;  2XZE A;  5LBM A;  3RH3 A;  1WR6 A;  3PJA A;  2VVS A;  4QWN B;  4WZX A;  5HCJ A;  4UR9 A;  4KX6 A;  3ZJ2 A;  4ZI2 C;  2QVA A;  4ZHQ E;  4IT4 A;  2BS4 A;  2JMK A;  4BJM A;  2K48 A;  4F6R C;  4HFE A;  2WAU A;  2XQ8 A;  4DV4 T;  3KV5 A;  1HCI A;  3MXZ A;  2X0H A;  3WAK A;  3UU3 A;  4HFC A;  4HWI B;  2WDV A;  4WW0 A;  4JYA T;  1SE7 A;  3BQK A;  3N9N A;  4PFP A;  1W9R A;  4ERR A;  3PTR B;  2E2A A;  3JAE A;  4PJJ A;  2E5V A;  3VU7 H;  3ZPO A;  2CM0 A;  5FKY A;  3GWH A;  5LG4 A;  3U78 A;  4ANJ A;  3VKH A;  1MNE A;  2X9H A;  3RX6 A;  3KIN B;  2OLT A;  3O1J A;  2B1E A;  4DV5 T;  3PUA A;  5J2U E;  2QGS A;  2XQY A;  1KFY A;  2KSR A;  1EZ3 A;  3N9L A;  3FZM B;  2LHN A;  3ZMZ B;  1VCT A;  3CX8 B;  3NZQ A;  5CGM A;  3K1S A;  3UFE A;  4JBW F;  4DV6 T;  2RP4 A;  4YTM A;  5J2T E;  4B3T T;  3CPZ A;  4QX8 B;  4DR3 T;  3OYZ A;  3A7M A;  2V8S V;  3UT5 E;  5L3E B;  4ZXL A;  1HNW T;  2CBI A;  2BVM A;  3M65 A;  2BBJ A;  2JQH A;  1HG2 A;  4AKL A;  3ZST A;  1Z0P A;  2UXC T;  2W63 A;  3ZKR A;  2J1D G;  5ABF B;  2D9D A;  2KT9 A;  4DMW A;  5HEU A;  1OWA A;  4DV1 T;  4JLE A;  5JR9 C;  2DNX A;  3RIU C;  2IC6 A;  1LVK A;  2VKH A;  3P50 A;  3L39 A;  3N2O A;  2X67 A;  4N78 D;  2E9X C;  4DBR A;  4X62 T;  1QLB A;  5CJ5 A;  5ABF A;  4CN1 A;  4YXD A;  2KWH A;  3VRB A;  1S94 A;  3C4W A;  2J4G A;  3KBU A;  3PUS A;  2VWA A;  5FXW A;  1UGO A;  4X64 T;  2X0L B;  2MTQ A;  2XAH B;  4YHJ A;  4U7I A;  2W62 A;  2V7I A;  3FB2 A;  5KMG P;  4QXH B;  2WBL A;  2FJE A;  4AQG A;  2CLY B;  3Q5E A;  2XPK A;  1HFA A;  3MA9 A;  4CI3 B;  3ONX A;  2ODU A;  3EVY A;  3F57 A;  1XDO A;  5DQW A;  5BMV E;  2HHH T;  2A9U A;  3UUB A;  1ZEE A;  5HEH A;  3ZT7 A;  4DID B;  4B6X A;  3LK2 B;  2JQQ A;  3KVB A;  4PK4 A;  3CQX C;  3AE6 A;  1WR0 A;  1WRD A;  5ABG A;  4YSY A;  1WCR A;  3AE8 A;  1KNZ A;  1HG5 A;  2BKO A;  4UF0 B;  1MMG A;  2UXB T;  4HWD A;  2UUA T;  2VUR A;  1CUN A;  4TWD A;  3QUJ A;  3AE1 A;  5FP3 A;  5JDL A;  3PUQ A;  5IHY A;  1T8B A;  5JTG A;  4WBN E;  5HWY A;  2VL8 A;  4H63 V;  4UF0 A;  5JVD E;  3AAI A;  1XDP A;  3K8P C;  2V6X A;  2YDS A;  4BA9 A;  4U33 A;  1FIO A;  1D0X A;  2K5B B;  1UUR A;  4UVC B;  4J2C A;  3FXE B;  4IE4 A;  4CXX A;  2ZLY A;  3QC9 A;  2WZH A;  5AQK B;  4HE8 A;  5HAX A;  4KUM B;  2H7V C;  4WNK A;  5LGU B;  1US7 B;  1Z8U A;  3ZN0 B;  2XQ4 A;  1D1B A;  2NW7 A;  1H7C A;  3RGL A;  4TNV A;  3JC6 C;  2I0M A;  2LOP A;  2ZM8 A;  4IE5 A;  4X20 E;  2Z6E A;  1IAP A;  2XAF B;  3P4R A;  2ODV A;  1DU2 A;  3SFD A;  1FEW A;  2IML A;  3RC3 A;  2ZM0 A;  4DVD A;  2J62 A;  3AED A;  5JDG A;  4A5X A;  5AQS B;  5C8Y E;  3HKB E;  2LSG A;  5FMN A;  3CX6 B;  2Q9Q C;  3GA8 A;  2VB6 A;  2MPK A;  5FXX A;  4CI2 B;  3B57 A;  3AEF A;  3TLU A;  3AEB A;  4AKI A;  4O4L E;  5EK4 A;  4OYK A;  2WU2 A;  2ACX A;  5LYJ E;  2I6H A;  3K3N A;  2I59 A;  2X9X A;  3CK6 A;  1E2A A;  3LDQ B;  4GKJ T;  3MAC A;  4JI2 T;  5AQV B;  4XBF B;  1YW0 A;  5LA6 E;  2BG9 C;  3AAE B;  5JDN A;  2K24 A;  2CHN A;  4DV0 T;  4I55 E;  2LSJ A;  2DWG A;  1YKE B;  2VL0 A;  2CXD A;  5ABH A;  3P4W A;  2DLR A;  2LSY A;  5FVL A;  3LFM A;  2Y6X A;  3CWZ B;  2LJL A;  2EHO D;  2XAQ B;  5DAB A;  5CA1 E;  4I0U A;  3HKD E;  5JH7 E;  2WMO A;  2X0Y A;  3TLW A;  5L3F B;  3PUW F;  5AQU B;  3ZYM A;  5JDH A;  4IE0 A;  3C98 B;  5HEO A;  4O8S A;  3FZL B;  2VQE T;  1BR0 A;  2KMF A;  4JI1 T;  2NWB A;  3H37 A;  4IE6 A;  3C51 A;  4LF5 T;  4L5G A;  2V7J A;  5AQR B;  4GIW A;  5A1L A;  3UFG A;  4LF4 T;  3QB5 A;  4H9P C;  4DR7 T;  2W4X A;  5AQJ B;  1X79 A;  2ZM2 A;  3VRA A;  2WP9 A;  5HCM A;  1SUM B;  3QNU A;  2PFV A;  1I94 T;  2LOS A;  4HWF A;  4DND A;  4EB6 E;  1E1H B;  5JDM A;  2FUP A;  2LRL A;  3DTO A;  2XQ3 A;  3Q5W A;  3PUY F;  2W67 A;  1YXR A;  2C0S A;  3VR8 A;  4EYY R;  1XZY A;  3PJA J;  3ONL C;  3RYF E;  4I4T E;  4KBM B;  2YN6 A;  1OED B;  3BQL A;  3RLF F;  3IF8 B;  2W00 A;  3ZSS A;  5JQG E;  5HXC A;  3P8C D;  5J1G A;  4X5T A;  3M3Z B;  4EIW A;  3CKD A;  2LKG A;  4U2Z A;  4QH4 A;  2LRK A;  2GK9 A;  4O4H E;  2N9D A;  2XSB A;  1OED A;  2OA5 A;  1HR0 T;  5EK3 A;  4O2B E;  3G06 A;  4IIJ E;  2ZM6 T;  3AEC A;  4V1A v;  2H89 A;  3I0Q A;  3ZYK A;  3OJA A;  5L3C B;  3EDV A;  5ETW A;  2HPL A;  5LMU T;  3KVA A;  3N9Q A;  3UU6 A; 
#chains in the Genus database with same CATH homology
 2QA7 A;  1WLX A;  2PJQ A;  2IC6 A;  1LVK A;  3ZLI A;  3ZMT B;  3RRW A;  2CMR A;  4I50 E;  5JDF A;  4ZI2 D;  2Q9Q B;  3PUG A;  2VKH A;  3N2O A;  2X67 A;  4N78 D;  2E9X C;  4DBR A;  3AAA B;  3CX7 B;  3N2K E;  4AKG A;  2BDE A;  3RYH E;  3F31 A;  4P0B A;  4UVB B;  3SS1 A;  2KWH A;  3H3A A;  3JC6 D;  4UVA B;  5LHG B;  1S94 A;  3SOL A;  3I1A A;  4GOU A;  4HFV A;  4TZ4 C;  4ZI3 C;  3RYC E;  3C4W A;  3HI2 A;  3KBU A;  3PUS A;  1MIW A;  2VWA A;  3D0T A;  5FXW A;  2LSI A;  4P0A A;  2X0L B;  2X68 A;  4A56 A;  5JR9 C;  2MTQ A;  2Q9Q A;  1WYC A;  2XAH B;  1MMD A;  2CA5 A;  1Y64 B;  2V7K A;  3MZK B;  4C90 A;  4YHJ A;  1NWM X;  2D2S A;  2CE7 A;  2W62 A;  2RA1 A;  2V7I A;  3FB2 A;  4KMC A;  4JUY A;  5KMG P;  3C4Z A;  4QXH B;  2WBL A;  2UXX B;  4JEH B;  3CML A;  5LXT E;  1BR4 A;  2JPF A;  3DJB A;  3IBP A;  4AQG A;  3NBX X;  4FI5 A;  2CLY B;  4HTE A;  5KDM C;  2C5J A;  1HFA A;  1U5P A;  3MA9 A;  4DMV A;  4CI3 B;  4WBO A;  3ONX A;  3ESL A;  2ODU A;  3AA6 B;  3EVY A;  3F57 A;  3HL6 A;  4X1Y E;  1YD8 G;  2P9B A;  3SWH A;  2UXN B;  5DQW A;  5BMV E;  4IST A;  2H3R A;  3ZYL A;  1LRZ A;  2DCF A;  3RYI E;  4L9I A;  2KLQ A;  5LOV E;  1ZEE A;  2V26 A;  5LHI B;  3C4X A;  4HGA A;  4U74 A;  3LK3 B;  2V1D B;  5L2L A;  4B6X A;  1WYB A;  2PG8 A;  3LK2 B;  2ZMA A;  2JQQ A;  3KVB A;  4PK4 A;  2VKJ A;  3CQX C;  3R84 B;  1WRD A;  4MLK A;  3LBX B;  1KNZ A;  1HG5 A;  1FMW A;  3PE0 A;  3Q5X A;  4L0R A;  2JMH A;  4G63 A;  5FY0 A;  3GN5 B;  4UF0 B;  2NTX A;  3AVR A;  2BZB A;  5FXV A;  2V7L A;  1MMG A;  1MND A;  4MAL A;  2VKO A;  5HWX A;  1S35 A;  3ZCJ A;  3L3P A;  3RC8 A;  5CA0 E;  1D0Z A;  4CQI A;  5IYZ E;  1CUN A;  2JJ9 A;  3L09 A;  5M4Y A;  2LM9 A;  3QUJ A;  5FP3 A;  4PFO A;  5JDL A;  3PUQ A;  3PU8 A;  5IHY A;  4WBN E;  4CI1 B;  5HWY A;  2DI4 A;  2VL8 A;  3LBX A;  3UUM A;  3O1H A;  4YJ2 E;  4UV9 B;  2DWK A;  4H63 V;  4HN9 A;  3GN5 A;  4UF0 A;  2KWI B;  1OXZ A;  4OHF A;  4X1K E;  1QUU A;  4QX7 B;  5JVD E;  3AAI A;  1VOM A;  1AJ3 A;  3K8P C;  4CXY A;  2A3D A;  3K3O A;  2A2F X;  2XAS B;  1YKH B;  3BK9 A;  2EHO C;  3J7Y q;  2MOZ A;  4BA9 A;  2CWY A;  1FIO A;  1D0X A;  5H6R B;  2K5B B;  2WMN A;  2YU1 A;  1ZHC A;  2XAG B;  4O4I E;  4UVC B;  3K3Q C;  5LCY A;  3LK4 2;  2LEH A;  4J2C A;  3O9X A;  3FXE B;  4IE4 A;  4BAY B;  4K0U A;  4CXX A;  3ZMV B;  2ZLY A;  4AKH A;  3RPU A;  3QC9 A;  2VAS A;  4YFS A;  4M1P A;  3FBZ A;  3SRZ A;  4HE8 A;  5HAX A;  4KUM B;  4TUY E;  2H7V C;  4WNK A;  1BR1 A;  5LGU B;  5LP6 E;  3OKQ A;  1US7 B;  2X66 A;  5L3G B;  3E0Z A;  3CVR A;  3CQC B;  3ZN0 B;  3AVS A;  3HR0 A;  4EZ4 A;  1D1B A;  5GON E;  4ADZ A;  3PUR A;  2NW7 A;  1H7C A;  4ZS2 A;  4DBQ A;  4TV9 E;  2H7O A;  5FNV E;  4AQF C;  3A5X A;  1B7T A;  4GK5 E;  2SPC A;  2X9W A;  3JC6 C;  3KDS E;  3MK7 C;  2XHE B;  5HXS A;  2E9X D;  2CXL A;  1MIV A;  2LOP A;  2ZM8 A;  4IE5 A;  4X20 E;  2Z6E A;  2Y8D A;  5FYM A;  2Y48 B;  3AA1 B;  4PNI A;  4MFR A;  4O4J E;  5H6Q B;  4AI6 A;  3MJX A;  3KV4 A;  4GYR A;  1IAP A;  2LE8 A;  4H9N C;  5EZY E;  3IHR A;  3N9O A;  2W61 A;  3I9W A;  4Z8X A;  2NTY A;  3ZC1 A;  4ZI3 D;  2N1G A;  2V7M A;  4TX5 A;  1IZN B;  2G0U A;  4PW8 A;  2XAF B;  3VHL A;  2ODV A;  4H9Q C;  3MKD A;  2CXF A;  3O1I A;  3KBT A;  4EAH A;  1FEW A;  4MHC A;  3OBV E;  5HXR A;  2ZM0 A;  3RC3 A;  4DVD A;  1ZV4 X;  5JDG A;  2LSK A;  5C8Y E;  4TN7 B;  3HKB E;  4FJO A;  2LSG A;  3O4X E;  3WAJ A;  5FMN A;  5DQV A;  3ZCI A;  1VRB A;  1ZKE A;  3CX6 B;  4HKA A;  4ISS A;  4AKR B;  1V9D A;  5LGN B;  5L3B B;  2Q9Q C;  3GA8 A;  3ZJ1 A;  2IC9 A;  1G73 A;  2VB6 A;  3RRC A;  5FXX A;  3N5L A;  3GMI A;  4CI2 B;  3B57 A;  5JRE A;  2MBG A;  2IAK A;  2L3L A;  1IJ5 A;  3ZEF B;  4ZS3 A;  1HS7 A;  4QXC B;  4AKI A;  4O2A E;  3AB3 B;  4O4L E;  5EK4 A;  4OYK A;  2NOX A;  4OYJ A;  2L8K A;  4U72 A;  2ACX A;  5LYJ E;  2NW9 A;  5LNK A;  4NUV A;  3WI3 A;  4EXT A;  3K3N A;  2I59 A;  4QXB B;  2KZ7 B;  2X9X A;  5KX5 E;  5FY1 A;  3MAC A;  2M67 A;  5JR9 B;  3AA7 B;  4XBF B;  5F8P A;  2PBI A;  1SA0 E;  1YW0 A;  2XAJ B;  4UIG A;  4PJM A;  4YLH A;  1D1A A;  2VKD A;  3NRX A;  5E0O A;  5LA6 E;  4HEA A;  2WWU A;  2KXP B;  5HYA A;  3AAE B;  5L3D B;  3DP7 A;  4GYS A;  5JDN A;  3BQI A;  1UCU A;  2E9X B;  2MYS A;  3I9Y A;  3N9P A;  4P09 A;  3ZN1 B;  1HX8 A;  4G2A A;  3FHN A;  3I0O A;  2K24 A;  2VK9 A;  1FMV A;  3PDY A;  4GK0 E;  3LJC A;  3W15 B;  4H63 H;  1MIY A;  4IDZ A;  4I55 E;  3FBL A;  3P7I A;  2LSJ A;  2DWG A;  3FXD B;  5ADX L;  5JR9 A;  4NUU A;  3C50 A;  4CXW A;  4C91 A;  1YKE B;  2NP9 A;  2X9Y A;  4IE7 A;  5LJM A;  4E7Z A;  3OYX A;  2CXD A;  4I43 B;  2A72 A;  2IW5 B;  1U4Q A;  4JEU B;  2DLR A;  4EOZ B;  2LSY A;  4AXP A;  2DHR A;  3LFM A;  2E9X A;  2Y6X A;  3T8O A;  3CWZ B;  4IHJ E;  2CWO A;  3PU3 A;  2LJL A;  5LBM A;  3RH3 A;  5LJN A;  1WR6 A;  2EHO D;  1BR2 A;  2XAQ B;  5DAB A;  5CA1 E;  4QWN B;  3HKD E;  3EUH A;  1LVF A;  1D0Y A;  3N2G E;  3UUN A;  5JH7 E;  2WMO A;  5JDQ A;  3ZJ2 A;  3ETV A;  4ZI2 C;  5L3F B;  3VKG A;  4ZHQ E;  3ETU A;  2D0U A;  4IGU A;  2JMK A;  3ZYM A;  5JDH A;  4IE0 A;  4BJM A;  2K48 A;  3C98 B;  4KP3 C;  4F6R C;  4O8S A;  4E7S A;  4UEM A;  4TV8 E;  4ILU A;  2WAU A;  3KV5 A;  1HCI A;  2HH7 A;  4PAG A;  2C5K T;  4QHO A;  3MXZ A;  1BR0 A;  2KMF A;  5FY7 A;  4UEL A;  3WAK A;  2NWB A;  3H37 A;  4IE6 A;  3C51 A;  5AFU L;  4PJL A;  3AA0 B;  2X51 A;  4L5G A;  2V7J A;  4WW0 A;  4GIW A;  5A1L A;  3CQG B;  2YEV C;  3B13 A;  3UUL A;  4DO0 A;  4ZOL E;  3BQK A;  3LG7 A;  3N9N A;  3V5U A;  4PFP A;  5LBQ B;  3EDU A;  4PK5 A;  3S4U A;  4ERR A;  1MMA A;  3PTR B;  4OFZ A;  4H9P C;  3NZP A;  2D5U A;  2C5I T;  4YJ3 E;  4PK6 A;  3HA4 A;  4PJJ A;  3ZMU B;  1X79 A;  2ZM2 A;  5LHH B;  4ASK A;  2YIN A;  2XUE A;  2KND A;  3HKE E;  5TAO A;  3VU7 H;  3ZPO A;  4X1I E;  4UV8 B;  2CM0 A;  2PFV A;  5EK2 A;  2W0G A;  3F2E A;  2YK0 A;  2LOS A;  3GWH A;  5LG4 A;  4DND A;  3U78 A;  4EB6 E;  1E1H B;  3V5S A;  5JDM A;  3ZC0 A;  4ANJ A;  1HF8 A;  3TKL B;  3VKH A;  1MNE A;  4XAX B;  3J9X 1;  2X9H A;  2EHO B;  2Q9Q D;  3RX6 A;  1QSD A;  3DTO A;  2CEA A;  2L9Q A;  3KIN B;  1UX4 A;  1UX5 A;  2K9A A;  3ANW B;  3Q5W A;  1LKX A;  4BJN A;  3C64 A;  3O1J A;  3KV9 A;  4OK0 A;  2C0S A;  4MBQ A;  3NRY A;  2B1E A;  3N9M A;  4EYY R;  3Q2M A;  4UXN B;  3RYF E;  5FXZ A;  5F3J A;  3PUA A;  4I4T E;  1SHZ C;  4EZH A;  5J2U E;  1D1C A;  2LT3 A;  2QGS A;  2XQY A;  3HKC E;  4H9O C;  3UTK A;  4KBM B;  1EZ3 A;  3N9L A;  3RKO A;  1T98 A;  3BQL A;  3Q9D A;  2WM9 A;  5CB4 E;  3IF8 B;  2W00 A;  5JQG E;  2LHN A;  2EHO A;  3ZMZ B;  3CX8 B;  5HXC A;  3NZQ A;  2CLY C;  1MMN A;  1IJ6 A;  3ANW A;  3P8C D;  3UFE A;  5J1G A;  2JRK A;  2ES0 A;  3E08 A;  1NAF A;  4EIW A;  3QK6 A;  3CKD A;  2RP4 A;  5J2T E;  5JRC B;  3UUX B;  2YU2 A;  3CPZ A;  3KV6 A;  4QX8 B;  2HPJ A;  4XZC A;  3OYZ A;  3R6N A;  4H9R C;  5LGT B;  2GK9 A;  3UT5 E;  4O4H E;  2N9D A;  5L3E B;  4PJN A;  2OA5 A;  1KK7 A;  2BVL A;  2D0T A;  2XTL A;  2BVM A;  2CCQ A;  3M65 A;  1HG2 A;  4AKL A;  1HTJ F;  4ZI7 E;  5HXH A;  5EK3 A;  4O2B E;  1Z0P A;  4IIJ E;  4CZZ B;  2KIN B;  2W63 A;  3U3I A;  4QKN A;  4AQF A;  2N2N A;  2NW8 A;  4V1A v;  3ZMS B;  2J1D G;  2E8I A;  4EYU A;  5JRC A;  4H9S E;  3I0Q A;  3ZYK A;  2KT9 A;  4DMW A;  2LHR A;  3OJA A;  5L3C B;  1G8X A;  5HXE A;  1O3X A;  1OWA A;  3E22 E;  3EDV A;  3KFW X;  2WSS V;  3IEE A;  5ETW A;  2HPL A;  3KVA A;  4JLE A;  2DNX A;  3N9Q A;  5DJQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...