1M62A

Solution structure of the bag domain from bag4/sodd
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
GSPEFTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG-family molecular chaperone regulator-4
publication title BAG4/SODD protein contains a short BAG domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 27
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2002-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m62A00
5AQJB 3M3ZB 4HWCA 1T7SA 5AQSB 3FZMB 3LDQB 5AQIB 3FZLB 5AQUB 4HWDA 5AQPB 3A8YC 5AQNB 1UGOA 3FZHB 1HX1B 5AQLB 3FZKB 5AQFB 1UK5A 5AQHB 4HWFA 5AQGB 5AQTB 2D9DA 5AQKB 1M7KA 5AQMB 5AQRB 5AQOB 5AQQB 1M62A 1I6ZA 4HWIB 4HWHA 3FZFB 5AQVB
chains in the Genus database with same CATH superfamily
3J7Yq 3TKLB 2J47A 2RPAA 2XUEA 3W15B 3UULA 5LJNA 5L47A 3E0ZA 5JDGA 3OVUA 5ABHA 3TLUA 3CK6A 3C4XA 3FHNA 4JEHB 2WP9A 2WS3A 4ZS3A 3PUSA 1JNZA 1MNEA 5J2UE 2FJAA 1US7B 3AA6B 2Y8DA 2QYWA 4KHZF 4EZ4A 3NRXA 2V7IA 3CX6B 5JTGA 2K5BB 3P50A 2BG9E 3HKCE 4KHPT 4DR6T 2DHRA 1HCIA 4DV4T 5AFUL 3ZKRA 2CHNA 2A72A 4EIWA 5HWYA 4ZI3C 4H63H 2FJEA 3RQUA 3WAKA 4O4JE 3LDQB 2V7JA 3KVBA 4BJNA 2D2SA 3ANWB 1U5PA 3RI5A 3RQWA 5BMVE 3I0OA 4NUVA 5FY1A 3SRZA 1NAFA 2UU9T 3QB5A 2HN1A 4CZZB 5FXXA 4YJ2E 5AQJB 2LEHA 4B3MT 3ZCJA 3SS1A 5ABFA 2X0HA 4U33A 2W2UA 2WM9A 5AQNB 3CMLA 5EK3A 5EK2A 5HCJA 3MXZA 4ZOLE 4CI3B 4Q25A 2I6HA 2CHOA 5JREA 5L3BB 2BKOA 3DTOA 4E7SA 2LSYA 3ZYMA 5LMUT 4I55E 4TV8E 1HNXT 4JI8T 1QLBA 3L39A 3Q9DA 3VRBA 4IE4A 3ZJ2A 4QXBB 5DQVA 3K1SA 1HR0T 3PU8A 4YSZA 2W67A 2HH7A 4OX9T 2ES0A 3ZMZB 2Q9QB 3AA7B 3ZEFB 3WI3A 3GMIA 4OYKA 1NENA 3CWZB 3QOFA 4I0UA 4U72A 3QB5K 4JI0T 3FZLB 5JQGE 3EUHA 4MHCA 3KV5A 2CE7A 4IDNA 4EOZB 3HKDE 1VOMA 2XASB 3S4UA 2W61A 5ADXL 1ZP0A 2JMHA 3HI2A 3U78A 2DCFA 2MOZA 3AE7A 3UU5A 2IW5B 4YHJA 2JPFA 5L4HA 3HKBE 4WZXA 4EYUA 5HEHA 5FMNA 1YKHB 4ZZCA 5TAOA 2V8SV 3LK3B 4IE5A 3WAJA 1V9DA 4FI5A 4AQGA 4P1NA 4DIDB 4ILUA 1XMOT 3N9NA 2WDVA 4ZHQE 1YXRA 4DO0A 1N34T 3ANWA 2V6XA 2CBIA 2RA1A 5F3JA 4IIJE 4UF0B 2GK9A 4M1PA 4LMLA 4DV5T 3Q5EA 2KLQA 4TUYE 2WDRA 5J0ZA 3MA9A 3VU7H 2BG9B 1VCSA 3I0QA 3EVYA 1MMAA 4TN7B 4YSXA 1MIVA 5FYMA 3MKDA 4CXXA 3VRAA 3LBXA 3H3MA 3P7IA 4DBRA 1UCUA 4QHOA 5KX5E 5JDMA 5L3GB 5JDFA 3PUVF 5H6QB 4PAGA 3X1DA 2IC9A 4HFDA 4PJJA 5LBMA 2G0UA 3I9YA 1HG5A 3PUAA 4UV9B 4L9IA 4PK6A 4DR2T 2Q9QA 3BK9A 4XBFB 1OEDB 1UX5A 2WZHA 1T72A 3HR0A 4IHJE 2V1DB 4L5GA 5FNVE 4ILBA 3CKDA 1D1AA 3TLWA 4IGUA 1HX8A 4DV1T 4ZI2D 1UUSA 5HYAA 3VHLA 4FJOA 4CI2B 2NW8A 4YTNA 4C91A 1GQEA 1MMNA 1KF6A 2UUCT 2AXDS 4IDOA 4PJMA 3N5LA 3A7MA 2EHOD 2Q9QC 3AAAB 4X65T 3QNUA 4AQFA 3NWIA 2WWUA 1YQ3A 2PJQA 4HEAA 3P8CD 5J2TE 2XM2A 5LYJE 2L3LA 2A9UA 2VB6A 3AECA 4IE0A 4XAXB 2CRBA 4AKGA 1W0AA 4CI1B 1DU2A 3GWHA 4AXPA 3PURA 4UF0A 2W00A 1XDOA 1KEYA 4U7IA 3NZQA 5LHHB 2X9XA 4UV8B 4GK0E 2BG9A 5DJQC 3MZKB 5LBQB 3F2EA 3SFDA 2VVSA 3M65A 4HKAA 4YY3T 2V26A 2WY2A 4WBOA 5L4EA 3KDSE 2WSSV 3FZHB 5CJ5A 5DABA 4DV7T 3R84B 4LFAT 3ZJ1A 1SE7A 5HEUA 2BVLA 1N36T 3JCFA 4JBWF 4TV9E 4KP3C 3C50A 3CX7B 2YDSA 1T98A 3ZMUB 2ACXA 3UQ4A 3AE8A 1U4QA 2I59A 3C4WA 4G2AA 4X1IE 1EZ3A 5C2TA 4HFBA 4OK0A 3ZC0A 2K24A 1OEDA 1YW0A 3L09A 2JQHA 5HEGA 2BG9C 4JI7T 3DJBA 1IJ5A 3N9QA 3RF1A 5L3FB 2XSAA 1OXZA 5AQVB 1D1CA 5EK4A 4COFA 2LSGA 2IHR1 4I43B 5F5WA 2VK9A 5AQPB 1N33T 4P0AA 3UUMA 5HXHA 2MBGA 4U2ZA 2YDQA 3V5UA 3RPUA 4EEDA 2IAKA 4GIWA 4CQIA 3M3ZB 5GONE 1KNPA 3UTKA 2H7VC 2Y48B 4CN6A 3PE0A 2M67A 1OEDC 5AQQB 4L0RA 3AA1B 1FEWA 2BVMA 2XQ8A 2OLTA 4U31A 3UFEA 4TWDA 5H6RB 3PDYA 4IREA 5L3EB 3LJCA 4X1YE 5KMGP 4JI3T 4B3ST 2H88A 3PJAJ 3JC6C 4KX6A 2WBLA 2LHRA 3BQKA 3AE2A 4O8SA 2VQET 5HXEA 5IUXA 4GYSA 4YTMA 5C8YE 5CA1E 2IC6A 3RYHE 4AISA 2CM0A 2XM1A 3RYFE 4IE6A 2E2AA 3RRCA 3U3IA 1UX4A 4GYRA 3ZMTB 2HPJA 3NRYA 2NR4A 5AQKB 4HTEA 4X5TA 3N2KE 4QX8B 4JEUB 4IE7A 4ISSA 5LP6E 1IBMT 1WR0A 3PU3A 1XMQT 3PV0F 3PUYF 2RP4A 2CMRA 3K3NA 2XQ4A 2E9XB 3KV6A 4AQYT 4U3CA 5LHIB 5JDQA 1W09A 5JRCB 2PFVA 3RC8A 5CFBA 3RYCE 2HN2A 3L8RA 5LG4A 1WCRA 3N9OA 3RHWA 3UT5E 3K8PC 4JI4T 4LF5T 4YHHT 3HA4A 4HE8A 3FZFB 4IT4A 5ETWA 3I9WA 2V7KA 2IUBA 1N32T 3AE3A 2XY8B 1YQ4A 4B6XA 2ZM0A 3AEBA 3SWHA 3VKHA 3I1AA 2L9QA 2UXBT 5CGMA 3AEAA 3ZT5A 4EEBA 4ADZA 3LK42 3ESLA 3UU3A 1BR0A 2KXPB 4F6RC 4Z8XA 2LRLA 3O1JA 5AQUB 3ZN1B 2BKPA 2SPCA 2WAUA 2KT9A 2C5JA 4DMWA 2QRXA 1XZYA 2CCQA 4DV0T 1XNRT 2P9BA 3AVRA 4DV6T 5AQSB 3RIFA 3T8OA 2UUBT 1SA0E 2ODUA 4H9NC 3P4PA 2XQ6A 2W0GA 3CIRA 3N9PA 4J2CA 5JDHA 1J1JA 2VQFT 2YKSA 1IJ6A 2QA7A 2MPKA 1WRDA 1UGOA 1HG2A 2NP9A 4LF6T 4O2AE 4TWFA 2CXDA 2W62A 2PBIA 4DBQA 3A5XA 1NWMX 2XPKA 3LK2B 5LG3A 5C3JA 3RX6A 2KWIB 5FY7A 3NVOA 3ZSSA 3ZLIA 4O4HE 2ODVA 4EXTA 4UXNB 2FJBA 2L8KA 3EI0A 4LMJA 2N9DA 2V6YB 2V7MA 4X1KE 4ILAA 3E08A 1NEKA 2E9XA 3UU4A 3UUBA 2LSKA 2YOEA 2JJ9A 3G06A 2KZ7B 2ZM2A 5AQTB 3IA3A 5JRCA 4O2BE 2UXDT 3TLSA 2LSIA 3VR8A 4OYJA 2MAWA 4EYYR 4DUYT 4HFHA 3F57A 2CLYB 5LMNT 4WBNE 4DR3T 3P4WA 4TNVA 3PUXF 3ZMSB 3NKZA 1Z8UA 4NPPA 1IBKT 1BR4A 1KNRA 2JQQA 4LF7T 4HFEA 4PNIA 2VKDA 1ZEEA 2YEVC 5HCMA 3ZSTA 2VWAA 3FXEB 4AKIA 4XZCA 2LOPA 2WU2A 3O9XA 5AQFB 4CN4A 4Z91A 2IIUA 4H9QC 3SFEA 3CQXC 5FXZA 2E9XC 1SUMB 3UU6A 1XDPA 3B57A 4GK5E 1HTJF 1X79A 1MNDA 5EZYE 1AJ3A 4DR4T 1UK5A 3Q5WA 2BZBA 3V5SA 2WCAA 3B5MA 3KFWX 3JC6D 1ZHCA 4ZI3D 4PJNA 2JQKA 3OKQA 4ZS2A 5LB7B 3UUXB 5AQIB 4UIGA 2XZEA 1E1HB 4QH1A 1CHUA 2XAFB 4OFZA 4ILCA 2H7OA 1I6ZA 3T1YT 4EAHA 4NUUA 4YT0A 4YFSA 2H89A 1CUNA 2K9AA 3LG7A 1LRZA 1VRBA 5FVLA 1IAPA 3UUNA 5JVDE 2EHOB 2DWKA 5ABGA 2BS3A 3K3QC 4U7YA 4IDZA 3AAIA 1HF8A 4K0UA 4I50E 3AA0B 5LCYA 1G73A 3ZYLA 4QH5A 4QWNB 2W66A 5LJMA 4ZEYA 4EV6A 3IF8B 2V6YA 4PFOA 3UU8A 1WYBA 1MIYA 3Q2MA 4HWIB 3GN5B 3RIAA 3CX8B 5JR9B 2BS4A 2LSJA 3AXJB 3RYIE 1QSDA 5FL1A 2XAQB 1UURA 3EDUA 2XJ7A 3PUGA 2JQ9A 4LFBT 3K3OA 3RC3A 4P09A 1QUUA 2YK0A 4AKLA 4HN9A 2ZM8A 4DMVA 1T8BA 4ERRA 5M4YA 4EB6E 4IL9A 4GKKT 2LRKA 4O4IE 4HGAA 2J1DG 4UR9A 1BR2A 2XQ7A 4B3RT 1OWAA 4JI1T 4CN1A 3RGLA 3T1HT 4HFCA 2VL0A 3AEEA 2J62A 4P0BA 1ZKEA 3QUJA 3O4XE 3LSVA 4WW0A 1X9BA 3EDVA 2LLYA 4QXCB 2XTLA 4BA9A 3TLTA 3AE5A 1Z0PA 3KINB 4HFVA 2K48A 2BBJA 2XQ3A 3ZMVB 2VASA 1J5ET 3OBVE 4LMKA 4UELA 3IEEA 2UXNB 2CLYC 2X9HA 2X67A 2BBHA 2XAGB 3C51A 3EHZA 2E8IA 2HPLA 4YTPA 3UQ7A 2BKNA 2CWYA 2B1EA 2WMOA 4HWDA 1MMDA 1Y01A 2W4XA 3N9MA 2CXFA 2X0YA 5HWXA 4DR5T 3RLFF 3PJAA 2VKHA 3KV4A 4V1Av 4KMCA 4KI0F 2LOSA 4PW8A 5JDNA 3BQLA 4H9PC 3PUZF 2EHOA 3RKOA 4NXMT 5CA0E 3NBXX 4JLEA 3H3AA 2VKJA 4MFRA 2PTFA 2LJLA 4EGWA 2JIWA 3MJXA 4UVCB 3CPZA 4MALA 2X68A 4ZI7E 2BDEA 2Z6EA 2VURA 3HKEE 4X62T 3PUWF 2LM9A 4GKJT 2CPTA 2KSRA 4NXNT 2FBWA 5BR8T 3GA8A 5L3DB 3SOLA 4ZI2C 4U2YA 3GN5A 3ZC1A 1S35A 3JAEA 5JR9A 1VCTA 1J5WA 4DR1T 5IYZE 4U74A 1FMVA 3AXJA 2R6GF 3B13A 4HFIA 4X66T 3UFGA 5F8PA 2NTXA 2PG8A 3BQIA 3FBLA 1FMWA 1I94T 1HFAA 4YSYA 2V5CA 2EHOC 5AQGB 2IDOB 1E7PA 2N2NA 2LKGA 2XQ9A 1HNWT 2E9XD 4DV3T 4DR7T 3RIUA 3FZMB 4LF9T 1WLXA 1OEDE 3FXDB 4X64T 4JI2T 4H9RC 3ONXA 3ZN0B 4A97A 2DNXA 4DVDA 5E0OA 1M62A 5FVKA 3LBXB 4MLKA 4DNDA 2H3RA 4TWHA 4BAYB 1XNQT 5JR9C 2XQYA 1FIOA 2MTQA 1R8IA 4A56A 4KBMB 4IDQA 3ETVA 2NW9A 1B7TA 4UVAB 3AEDA 3OYXA 2J4GA 4HWCA 3O1HA 2Q9QD 1ZV4X 5JH7E 2UXCT 2ZLYA 3N2GE 3OTOT 4TZ4C 5AQLB 3R6NA 2AE9A 3AB3B 3QK6A 3RIUC 3AEGA 4GOUA 4JI6T 2N1GA 5LOVE 5FY0A 5LNKA 2M6IA 4X20E 4QXHB 2CBJA 3NZPA 5HXSA 3J9X1 2IMLA 5HEJA 4B3TT 3N2OA 5HXRA 4ANJA 5A1LA 2WQYA 2Y6XA 3OPCA 2XHEB 2WWVA 2X9YA 3C4ZA 3FZKB 4DV2T 3CQGB 4KUMB 4EZHA 2WB5A 4G63A 2X66A 2C5KT 3P4SA 2FUPA 4ISTA 3FBZA 2LT3A 3F31A 1MIWA 1JNRA 2C0SA 4MBQA 2JMKA 2WDQA 4A5XA 2LKHA 3Q5XA 2X9WA 2MYSA 2D9DA 3IBPA 1D0XA 3OJAA 3EABA 3CQCB 4F8HA 3ONJA 2CEAA 4ZXLA 1FJGT 4A98A 3JAFA 3KV9A 4O4LE 3ABVA 3IHRA 4BJMA 1D0ZA 2NTYA 2ZM6T 1O3XA 2LE8A 4LFCT 3VR9A 1WYCA 3D0TA 5HXCA 3N9LA 1HS7A 3P4QA 5AQRB 4DUZT 2XQ5A 2D0TA 1G8XA 4JV5T 2XQAA 5FKYA 3PTRB 4K0KT 4YXDA 1HX1B 2ACZA 5CB4E 3O1IA 1W0BA 5J1GA 3AE9A 3L3PA 1KNZA 1L0VA 4JUYA 3ZT6A 4E7ZA 1E2AA 4TX5A 3FB2A 4I4TE 4IDPA 5LGNB 1XWMA 3ZPOA 3QC9A 2K3WA 2ZMAA 4QH4A 2A3DA 4N78D 3A8YC 3ETUA 3MACA 2NOXA 3E22E 3DP7A 2YINA 4WYVA 1YD8G 2X51A 1M7KA 3HL6A 5FXVA 2E5LT 3RH3A 2VVNA 3LFMA 4ZZBA 3ZT7A 5LHGB 2YDRA 2HHHT 4AIUA 2D0UA 2DWGA 2XAJB 1YKEB 3KBTA 1WR6A 1KK7A 4PJLA 5DQWA 2CA5A 3RRWA 1ZOYA 2M6BA 5HEOA 2YU2A 4OHFA 3MK7C 3H37A 2VKOA 1LKXA 3P4RA 3C64A 2WZIA 5L2LA 4AKHA 5KDMC 1BR1A 2KNDA 5LGUB 2UUAT 1WFDA 3AEFA 2OA5A 1IBLT 5IHYA 1W9RA 1KFYA 2A2FX 2YU1A 4H9OC 2I0MA 4QKNA 3KBUA 5KXJA 2CXLA 3OYZA 5LXTE 4H63V 3AE6A 2NWBA 5JDLA 5LGTB 4PK5A 4TNWA 2V7LA 4AI6A 2C5IT 2BS2A 3AE4A 3JADA 1LVFA 4HWFA 3VKGA 4AKRB 2D5UA 3RKGA 2DI4A 5FL0A 4LF8T 4JYAT 1S94A 3EAMA 1IZNB 2W63A 1H7CA 2NW7A 2QGSA 3AE1A 2VL8A 5LA6E 2CWOA 2KWHA 2XSBA 2FJDA 5AQMB 3PUQA 1HNZT 5IWAT 3AVSA 4PK4A 4Z90A 3AAEB 5FXWA 4YJ3E 2LHNA 2KMFA 3ZCIA 4ASKA 5ABFB 4C90A 3ZYKA 3KVAA 2F4VT 5L3CB 4LF4T 4AQFC 2DLRA 2WMNA 5AQHB 2QVAA 2XAHB 2V5DA 1T7SA 4WNKA 3C98B 4NIQA 4YLHA 2X0LB 3Q5DA 4H9SE 2DL1A 5FP3A 1D1BA 1MMGA 4JI5T 4UEMA 2E5VA 3ONLC 3TLVA 4UVBB 2UXXB 4IL4A 4QX7B 5HAXA 4HWHA 4CXWA 2KINB 1D0YA 1Y64B 2YN6A 5ABEA 1LVKA 1SHZC 3CVRA 2JRKA 2OV9A 4PFPA 2B76A 2LM2A 5AQOB 2WU5A 4CXYA
chains in the Genus database with same CATH topology
5AQJB 3M3ZB 4HWCA 1T7SA 5AQSB 3FZMB 3LDQB 5AQIB 3FZLB 5AQUB 4HWDA 5AQPB 3A8YC 5AQNB 1UGOA 3FZHB 1HX1B 5AQLB 3FZKB 5AQFB 1UK5A 5AQHB 4HWFA 5AQGB 5AQTB 2D9DA 5AQKB 1M7KA 5AQMB 5AQRB 5AQOB 5AQQB 1M62A 1I6ZA 4HWIB 4HWHA 3FZFB 5AQVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQJ B;  3M3Z B;  4HWC A;  1T7S A;  5AQS B;  3FZM B;  3LDQ B;  5AQI B;  3FZL B;  5AQU B;  4HWD A;  5AQP B;  3A8Y C;  5AQN B;  1UGO A;  3FZH B;  1HX1 B;  5AQL B;  3FZK B;  5AQF B;  1UK5 A;  5AQH B;  4HWF A;  5AQG B;  5AQT B;  2D9D A;  5AQK B;  1M7K A;  5AQM B;  5AQR B;  5AQO B;  5AQQ B;  1M62 A;  1I6Z A;  4HWI B;  4HWH A;  3FZF B;  5AQV B; 
#chains in the Genus database with same CATH topology
 3J7Y q;  3TKL B;  2J47 A;  2RPA A;  2XUE A;  3W15 B;  3UUL A;  5LJN A;  5L47 A;  3E0Z A;  5JDG A;  3OVU A;  5ABH A;  3TLU A;  3CK6 A;  3C4X A;  3FHN A;  4JEH B;  2WP9 A;  2WS3 A;  4ZS3 A;  3PUS A;  1JNZ A;  1MNE A;  5J2U E;  2FJA A;  1US7 B;  3AA6 B;  2Y8D A;  2QYW A;  4KHZ F;  4EZ4 A;  3NRX A;  2V7I A;  3CX6 B;  5JTG A;  2K5B B;  3P50 A;  2BG9 E;  3HKC E;  4KHP T;  4DR6 T;  2DHR A;  1HCI A;  4DV4 T;  5AFU L;  3ZKR A;  2CHN A;  2A72 A;  4EIW A;  5HWY A;  4ZI3 C;  4H63 H;  2FJE A;  3RQU A;  3WAK A;  4O4J E;  3LDQ B;  2V7J A;  3KVB A;  4BJN A;  2D2S A;  3ANW B;  1U5P A;  3RI5 A;  3RQW A;  5BMV E;  3I0O A;  4NUV A;  5FY1 A;  3SRZ A;  1NAF A;  2UU9 T;  3QB5 A;  2HN1 A;  4CZZ B;  5FXX A;  4YJ2 E;  5AQJ B;  2LEH A;  4B3M T;  3ZCJ A;  3SS1 A;  5ABF A;  2X0H A;  4U33 A;  2W2U A;  2WM9 A;  5AQN B;  3CML A;  5EK3 A;  5EK2 A;  5HCJ A;  3MXZ A;  4ZOL E;  4CI3 B;  4Q25 A;  2I6H A;  2CHO A;  5JRE A;  5L3B B;  2BKO A;  3DTO A;  4E7S A;  2LSY A;  3ZYM A;  5LMU T;  4I55 E;  4TV8 E;  1HNX T;  4JI8 T;  1QLB A;  3L39 A;  3Q9D A;  3VRB A;  4IE4 A;  3ZJ2 A;  4QXB B;  5DQV A;  3K1S A;  1HR0 T;  3PU8 A;  4YSZ A;  2W67 A;  2HH7 A;  4OX9 T;  2ES0 A;  3ZMZ B;  2Q9Q B;  3AA7 B;  3ZEF B;  3WI3 A;  3GMI A;  4OYK A;  1NEN A;  3CWZ B;  3QOF A;  4I0U A;  4U72 A;  3QB5 K;  4JI0 T;  3FZL B;  5JQG E;  3EUH A;  4MHC A;  3KV5 A;  2CE7 A;  4IDN A;  4EOZ B;  3HKD E;  1VOM A;  2XAS B;  3S4U A;  2W61 A;  5ADX L;  1ZP0 A;  2JMH A;  3HI2 A;  3U78 A;  2DCF A;  2MOZ A;  3AE7 A;  3UU5 A;  2IW5 B;  4YHJ A;  2JPF A;  5L4H A;  3HKB E;  4WZX A;  4EYU A;  5HEH A;  5FMN A;  1YKH B;  4ZZC A;  5TAO A;  2V8S V;  3LK3 B;  4IE5 A;  3WAJ A;  1V9D A;  4FI5 A;  4AQG A;  4P1N A;  4DID B;  4ILU A;  1XMO T;  3N9N A;  2WDV A;  4ZHQ E;  1YXR A;  4DO0 A;  1N34 T;  3ANW A;  2V6X A;  2CBI A;  2RA1 A;  5F3J A;  4IIJ E;  4UF0 B;  2GK9 A;  4M1P A;  4LML A;  4DV5 T;  3Q5E A;  2KLQ A;  4TUY E;  2WDR A;  5J0Z A;  3MA9 A;  3VU7 H;  2BG9 B;  1VCS A;  3I0Q A;  3EVY A;  1MMA A;  4TN7 B;  4YSX A;  1MIV A;  5FYM A;  3MKD A;  4CXX A;  3VRA A;  3LBX A;  3H3M A;  3P7I A;  4DBR A;  1UCU A;  4QHO A;  5KX5 E;  5JDM A;  5L3G B;  5JDF A;  3PUV F;  5H6Q B;  4PAG A;  3X1D A;  2IC9 A;  4HFD A;  4PJJ A;  5LBM A;  2G0U A;  3I9Y A;  1HG5 A;  3PUA A;  4UV9 B;  4L9I A;  4PK6 A;  4DR2 T;  2Q9Q A;  3BK9 A;  4XBF B;  1OED B;  1UX5 A;  2WZH A;  1T72 A;  3HR0 A;  4IHJ E;  2V1D B;  4L5G A;  5FNV E;  4ILB A;  3CKD A;  1D1A A;  3TLW A;  4IGU A;  1HX8 A;  4DV1 T;  4ZI2 D;  1UUS A;  5HYA A;  3VHL A;  4FJO A;  4CI2 B;  2NW8 A;  4YTN A;  4C91 A;  1GQE A;  1MMN A;  1KF6 A;  2UUC T;  2AXD S;  4IDO A;  4PJM A;  3N5L A;  3A7M A;  2EHO D;  2Q9Q C;  3AAA B;  4X65 T;  3QNU A;  4AQF A;  3NWI A;  2WWU A;  1YQ3 A;  2PJQ A;  4HEA A;  3P8C D;  5J2T E;  2XM2 A;  5LYJ E;  2L3L A;  2A9U A;  2VB6 A;  3AEC A;  4IE0 A;  4XAX B;  2CRB A;  4AKG A;  1W0A A;  4CI1 B;  1DU2 A;  3GWH A;  4AXP A;  3PUR A;  4UF0 A;  2W00 A;  1XDO A;  1KEY A;  4U7I A;  3NZQ A;  5LHH B;  2X9X A;  4UV8 B;  4GK0 E;  2BG9 A;  5DJQ C;  3MZK B;  5LBQ B;  3F2E A;  3SFD A;  2VVS A;  3M65 A;  4HKA A;  4YY3 T;  2V26 A;  2WY2 A;  4WBO A;  5L4E A;  3KDS E;  2WSS V;  3FZH B;  5CJ5 A;  5DAB A;  4DV7 T;  3R84 B;  4LFA T;  3ZJ1 A;  1SE7 A;  5HEU A;  2BVL A;  1N36 T;  3JCF A;  4JBW F;  4TV9 E;  4KP3 C;  3C50 A;  3CX7 B;  2YDS A;  1T98 A;  3ZMU B;  2ACX A;  3UQ4 A;  3AE8 A;  1U4Q A;  2I59 A;  3C4W A;  4G2A A;  4X1I E;  1EZ3 A;  5C2T A;  4HFB A;  4OK0 A;  3ZC0 A;  2K24 A;  1OED A;  1YW0 A;  3L09 A;  2JQH A;  5HEG A;  2BG9 C;  4JI7 T;  3DJB A;  1IJ5 A;  3N9Q A;  3RF1 A;  5L3F B;  2XSA A;  1OXZ A;  5AQV B;  1D1C A;  5EK4 A;  4COF A;  2LSG A;  2IHR 1;  4I43 B;  5F5W A;  2VK9 A;  5AQP B;  1N33 T;  4P0A A;  3UUM A;  5HXH A;  2MBG A;  4U2Z A;  2YDQ A;  3V5U A;  3RPU A;  4EED A;  2IAK A;  4GIW A;  4CQI A;  3M3Z B;  5GON E;  1KNP A;  3UTK A;  2H7V C;  2Y48 B;  4CN6 A;  3PE0 A;  2M67 A;  1OED C;  5AQQ B;  4L0R A;  3AA1 B;  1FEW A;  2BVM A;  2XQ8 A;  2OLT A;  4U31 A;  3UFE A;  4TWD A;  5H6R B;  3PDY A;  4IRE A;  5L3E B;  3LJC A;  4X1Y E;  5KMG P;  4JI3 T;  4B3S T;  2H88 A;  3PJA J;  3JC6 C;  4KX6 A;  2WBL A;  2LHR A;  3BQK A;  3AE2 A;  4O8S A;  2VQE T;  5HXE A;  5IUX A;  4GYS A;  4YTM A;  5C8Y E;  5CA1 E;  2IC6 A;  3RYH E;  4AIS A;  2CM0 A;  2XM1 A;  3RYF E;  4IE6 A;  2E2A A;  3RRC A;  3U3I A;  1UX4 A;  4GYR A;  3ZMT B;  2HPJ A;  3NRY A;  2NR4 A;  5AQK B;  4HTE A;  4X5T A;  3N2K E;  4QX8 B;  4JEU B;  4IE7 A;  4ISS A;  5LP6 E;  1IBM T;  1WR0 A;  3PU3 A;  1XMQ T;  3PV0 F;  3PUY F;  2RP4 A;  2CMR A;  3K3N A;  2XQ4 A;  2E9X B;  3KV6 A;  4AQY T;  4U3C A;  5LHI B;  5JDQ A;  1W09 A;  5JRC B;  2PFV A;  3RC8 A;  5CFB A;  3RYC E;  2HN2 A;  3L8R A;  5LG4 A;  1WCR A;  3N9O A;  3RHW A;  3UT5 E;  3K8P C;  4JI4 T;  4LF5 T;  4YHH T;  3HA4 A;  4HE8 A;  3FZF B;  4IT4 A;  5ETW A;  3I9W A;  2V7K A;  2IUB A;  1N32 T;  3AE3 A;  2XY8 B;  1YQ4 A;  4B6X A;  2ZM0 A;  3AEB A;  3SWH A;  3VKH A;  3I1A A;  2L9Q A;  2UXB T;  5CGM A;  3AEA A;  3ZT5 A;  4EEB A;  4ADZ A;  3LK4 2;  3ESL A;  3UU3 A;  1BR0 A;  2KXP B;  4F6R C;  4Z8X A;  2LRL A;  3O1J A;  5AQU B;  3ZN1 B;  2BKP A;  2SPC A;  2WAU A;  2KT9 A;  2C5J A;  4DMW A;  2QRX A;  1XZY A;  2CCQ A;  4DV0 T;  1XNR T;  2P9B A;  3AVR A;  4DV6 T;  5AQS B;  3RIF A;  3T8O A;  2UUB T;  1SA0 E;  2ODU A;  4H9N C;  3P4P A;  2XQ6 A;  2W0G A;  3CIR A;  3N9P A;  4J2C A;  5JDH A;  1J1J A;  2VQF T;  2YKS A;  1IJ6 A;  2QA7 A;  2MPK A;  1WRD A;  1UGO A;  1HG2 A;  2NP9 A;  4LF6 T;  4O2A E;  4TWF A;  2CXD A;  2W62 A;  2PBI A;  4DBQ A;  3A5X A;  1NWM X;  2XPK A;  3LK2 B;  5LG3 A;  5C3J A;  3RX6 A;  2KWI B;  5FY7 A;  3NVO A;  3ZSS A;  3ZLI A;  4O4H E;  2ODV A;  4EXT A;  4UXN B;  2FJB A;  2L8K A;  3EI0 A;  4LMJ A;  2N9D A;  2V6Y B;  2V7M A;  4X1K E;  4ILA A;  3E08 A;  1NEK A;  2E9X A;  3UU4 A;  3UUB A;  2LSK A;  2YOE A;  2JJ9 A;  3G06 A;  2KZ7 B;  2ZM2 A;  5AQT B;  3IA3 A;  5JRC A;  4O2B E;  2UXD T;  3TLS A;  2LSI A;  3VR8 A;  4OYJ A;  2MAW A;  4EYY R;  4DUY T;  4HFH A;  3F57 A;  2CLY B;  5LMN T;  4WBN E;  4DR3 T;  3P4W A;  4TNV A;  3PUX F;  3ZMS B;  3NKZ A;  1Z8U A;  4NPP A;  1IBK T;  1BR4 A;  1KNR A;  2JQQ A;  4LF7 T;  4HFE A;  4PNI A;  2VKD A;  1ZEE A;  2YEV C;  5HCM A;  3ZST A;  2VWA A;  3FXE B;  4AKI A;  4XZC A;  2LOP A;  2WU2 A;  3O9X A;  5AQF B;  4CN4 A;  4Z91 A;  2IIU A;  4H9Q C;  3SFE A;  3CQX C;  5FXZ A;  2E9X C;  1SUM B;  3UU6 A;  1XDP A;  3B57 A;  4GK5 E;  1HTJ F;  1X79 A;  1MND A;  5EZY E;  1AJ3 A;  4DR4 T;  1UK5 A;  3Q5W A;  2BZB A;  3V5S A;  2WCA A;  3B5M A;  3KFW X;  3JC6 D;  1ZHC A;  4ZI3 D;  4PJN A;  2JQK A;  3OKQ A;  4ZS2 A;  5LB7 B;  3UUX B;  5AQI B;  4UIG A;  2XZE A;  1E1H B;  4QH1 A;  1CHU A;  2XAF B;  4OFZ A;  4ILC A;  2H7O A;  1I6Z A;  3T1Y T;  4EAH A;  4NUU A;  4YT0 A;  4YFS A;  2H89 A;  1CUN A;  2K9A A;  3LG7 A;  1LRZ A;  1VRB A;  5FVL A;  1IAP A;  3UUN A;  5JVD E;  2EHO B;  2DWK A;  5ABG A;  2BS3 A;  3K3Q C;  4U7Y A;  4IDZ A;  3AAI A;  1HF8 A;  4K0U A;  4I50 E;  3AA0 B;  5LCY A;  1G73 A;  3ZYL A;  4QH5 A;  4QWN B;  2W66 A;  5LJM A;  4ZEY A;  4EV6 A;  3IF8 B;  2V6Y A;  4PFO A;  3UU8 A;  1WYB A;  1MIY A;  3Q2M A;  4HWI B;  3GN5 B;  3RIA A;  3CX8 B;  5JR9 B;  2BS4 A;  2LSJ A;  3AXJ B;  3RYI E;  1QSD A;  5FL1 A;  2XAQ B;  1UUR A;  3EDU A;  2XJ7 A;  3PUG A;  2JQ9 A;  4LFB T;  3K3O A;  3RC3 A;  4P09 A;  1QUU A;  2YK0 A;  4AKL A;  4HN9 A;  2ZM8 A;  4DMV A;  1T8B A;  4ERR A;  5M4Y A;  4EB6 E;  4IL9 A;  4GKK T;  2LRK A;  4O4I E;  4HGA A;  2J1D G;  4UR9 A;  1BR2 A;  2XQ7 A;  4B3R T;  1OWA A;  4JI1 T;  4CN1 A;  3RGL A;  3T1H T;  4HFC A;  2VL0 A;  3AEE A;  2J62 A;  4P0B A;  1ZKE A;  3QUJ A;  3O4X E;  3LSV A;  4WW0 A;  1X9B A;  3EDV A;  2LLY A;  4QXC B;  2XTL A;  4BA9 A;  3TLT A;  3AE5 A;  1Z0P A;  3KIN B;  4HFV A;  2K48 A;  2BBJ A;  2XQ3 A;  3ZMV B;  2VAS A;  1J5E T;  3OBV E;  4LMK A;  4UEL A;  3IEE A;  2UXN B;  2CLY C;  2X9H A;  2X67 A;  2BBH A;  2XAG B;  3C51 A;  3EHZ A;  2E8I A;  2HPL A;  4YTP A;  3UQ7 A;  2BKN A;  2CWY A;  2B1E A;  2WMO A;  4HWD A;  1MMD A;  1Y01 A;  2W4X A;  3N9M A;  2CXF A;  2X0Y A;  5HWX A;  4DR5 T;  3RLF F;  3PJA A;  2VKH A;  3KV4 A;  4V1A v;  4KMC A;  4KI0 F;  2LOS A;  4PW8 A;  5JDN A;  3BQL A;  4H9P C;  3PUZ F;  2EHO A;  3RKO A;  4NXM T;  5CA0 E;  3NBX X;  4JLE A;  3H3A A;  2VKJ A;  4MFR A;  2PTF A;  2LJL A;  4EGW A;  2JIW A;  3MJX A;  4UVC B;  3CPZ A;  4MAL A;  2X68 A;  4ZI7 E;  2BDE A;  2Z6E A;  2VUR A;  3HKE E;  4X62 T;  3PUW F;  2LM9 A;  4GKJ T;  2CPT A;  2KSR A;  4NXN T;  2FBW A;  5BR8 T;  3GA8 A;  5L3D B;  3SOL A;  4ZI2 C;  4U2Y A;  3GN5 A;  3ZC1 A;  1S35 A;  3JAE A;  5JR9 A;  1VCT A;  1J5W A;  4DR1 T;  5IYZ E;  4U74 A;  1FMV A;  3AXJ A;  2R6G F;  3B13 A;  4HFI A;  4X66 T;  3UFG A;  5F8P A;  2NTX A;  2PG8 A;  3BQI A;  3FBL A;  1FMW A;  1I94 T;  1HFA A;  4YSY A;  2V5C A;  2EHO C;  5AQG B;  2IDO B;  1E7P A;  2N2N A;  2LKG A;  2XQ9 A;  1HNW T;  2E9X D;  4DV3 T;  4DR7 T;  3RIU A;  3FZM B;  4LF9 T;  1WLX A;  1OED E;  3FXD B;  4X64 T;  4JI2 T;  4H9R C;  3ONX A;  3ZN0 B;  4A97 A;  2DNX A;  4DVD A;  5E0O A;  1M62 A;  5FVK A;  3LBX B;  4MLK A;  4DND A;  2H3R A;  4TWH A;  4BAY B;  1XNQ T;  5JR9 C;  2XQY A;  1FIO A;  2MTQ A;  1R8I A;  4A56 A;  4KBM B;  4IDQ A;  3ETV A;  2NW9 A;  1B7T A;  4UVA B;  3AED A;  3OYX A;  2J4G A;  4HWC A;  3O1H A;  2Q9Q D;  1ZV4 X;  5JH7 E;  2UXC T;  2ZLY A;  3N2G E;  3OTO T;  4TZ4 C;  5AQL B;  3R6N A;  2AE9 A;  3AB3 B;  3QK6 A;  3RIU C;  3AEG A;  4GOU A;  4JI6 T;  2N1G A;  5LOV E;  5FY0 A;  5LNK A;  2M6I A;  4X20 E;  4QXH B;  2CBJ A;  3NZP A;  5HXS A;  3J9X 1;  2IML A;  5HEJ A;  4B3T T;  3N2O A;  5HXR A;  4ANJ A;  5A1L A;  2WQY A;  2Y6X A;  3OPC A;  2XHE B;  2WWV A;  2X9Y A;  3C4Z A;  3FZK B;  4DV2 T;  3CQG B;  4KUM B;  4EZH A;  2WB5 A;  4G63 A;  2X66 A;  2C5K T;  3P4S A;  2FUP A;  4IST A;  3FBZ A;  2LT3 A;  3F31 A;  1MIW A;  1JNR A;  2C0S A;  4MBQ A;  2JMK A;  2WDQ A;  4A5X A;  2LKH A;  3Q5X A;  2X9W A;  2MYS A;  2D9D A;  3IBP A;  1D0X A;  3OJA A;  3EAB A;  3CQC B;  4F8H A;  3ONJ A;  2CEA A;  4ZXL A;  1FJG T;  4A98 A;  3JAF A;  3KV9 A;  4O4L E;  3ABV A;  3IHR A;  4BJM A;  1D0Z A;  2NTY A;  2ZM6 T;  1O3X A;  2LE8 A;  4LFC T;  3VR9 A;  1WYC A;  3D0T A;  5HXC A;  3N9L A;  1HS7 A;  3P4Q A;  5AQR B;  4DUZ T;  2XQ5 A;  2D0T A;  1G8X A;  4JV5 T;  2XQA A;  5FKY A;  3PTR B;  4K0K T;  4YXD A;  1HX1 B;  2ACZ A;  5CB4 E;  3O1I A;  1W0B A;  5J1G A;  3AE9 A;  3L3P A;  1KNZ A;  1L0V A;  4JUY A;  3ZT6 A;  4E7Z A;  1E2A A;  4TX5 A;  3FB2 A;  4I4T E;  4IDP A;  5LGN B;  1XWM A;  3ZPO A;  3QC9 A;  2K3W A;  2ZMA A;  4QH4 A;  2A3D A;  4N78 D;  3A8Y C;  3ETU A;  3MAC A;  2NOX A;  3E22 E;  3DP7 A;  2YIN A;  4WYV A;  1YD8 G;  2X51 A;  1M7K A;  3HL6 A;  5FXV A;  2E5L T;  3RH3 A;  2VVN A;  3LFM A;  4ZZB A;  3ZT7 A;  5LHG B;  2YDR A;  2HHH T;  4AIU A;  2D0U A;  2DWG A;  2XAJ B;  1YKE B;  3KBT A;  1WR6 A;  1KK7 A;  4PJL A;  5DQW A;  2CA5 A;  3RRW A;  1ZOY A;  2M6B A;  5HEO A;  2YU2 A;  4OHF A;  3MK7 C;  3H37 A;  2VKO A;  1LKX A;  3P4R A;  3C64 A;  2WZI A;  5L2L A;  4AKH A;  5KDM C;  1BR1 A;  2KND A;  5LGU B;  2UUA T;  1WFD A;  3AEF A;  2OA5 A;  1IBL T;  5IHY A;  1W9R A;  1KFY A;  2A2F X;  2YU1 A;  4H9O C;  2I0M A;  4QKN A;  3KBU A;  5KXJ A;  2CXL A;  3OYZ A;  5LXT E;  4H63 V;  3AE6 A;  2NWB A;  5JDL A;  5LGT B;  4PK5 A;  4TNW A;  2V7L A;  4AI6 A;  2C5I T;  2BS2 A;  3AE4 A;  3JAD A;  1LVF A;  4HWF A;  3VKG A;  4AKR B;  2D5U A;  3RKG A;  2DI4 A;  5FL0 A;  4LF8 T;  4JYA T;  1S94 A;  3EAM A;  1IZN B;  2W63 A;  1H7C A;  2NW7 A;  2QGS A;  3AE1 A;  2VL8 A;  5LA6 E;  2CWO A;  2KWH A;  2XSB A;  2FJD A;  5AQM B;  3PUQ A;  1HNZ T;  5IWA T;  3AVS A;  4PK4 A;  4Z90 A;  3AAE B;  5FXW A;  4YJ3 E;  2LHN A;  2KMF A;  3ZCI A;  4ASK A;  5ABF B;  4C90 A;  3ZYK A;  3KVA A;  2F4V T;  5L3C B;  4LF4 T;  4AQF C;  2DLR A;  2WMN A;  5AQH B;  2QVA A;  2XAH B;  2V5D A;  1T7S A;  4WNK A;  3C98 B;  4NIQ A;  4YLH A;  2X0L B;  3Q5D A;  4H9S E;  2DL1 A;  5FP3 A;  1D1B A;  1MMG A;  4JI5 T;  4UEM A;  2E5V A;  3ONL C;  3TLV A;  4UVB B;  2UXX B;  4IL4 A;  4QX7 B;  5HAX A;  4HWH A;  4CXW A;  2KIN B;  1D0Y A;  1Y64 B;  2YN6 A;  5ABE A;  1LVK A;  1SHZ C;  3CVR A;  2JRK A;  2OV9 A;  4PFP A;  2B76 A;  2LM2 A;  5AQO B;  2WU5 A;  4CXY A; 
#chains in the Genus database with same CATH homology
 5AQJ B;  3M3Z B;  4HWC A;  1T7S A;  5AQS B;  3FZM B;  3LDQ B;  5AQI B;  3FZL B;  5AQU B;  4HWD A;  5AQP B;  3A8Y C;  5AQN B;  1UGO A;  3FZH B;  1HX1 B;  5AQL B;  3FZK B;  5AQF B;  1UK5 A;  5AQH B;  4HWF A;  5AQG B;  5AQT B;  2D9D A;  5AQK B;  1M7K A;  5AQM B;  5AQR B;  5AQO B;  5AQQ B;  1M62 A;  1I6Z A;  4HWI B;  4HWH A;  3FZF B;  5AQV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...