1M62A

Solution structure of the bag domain from bag4/sodd
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
b'GSPEFTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG-family molecular chaperone regulator-4
publication title BAG4/SODD protein contains a short BAG domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 27
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2002-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m62A00
4HWFA 1T7SA 4HWDA 4HWIB 5AQTB 5AQQB 5AQKB 3FZFB 3FZKB 4HWCA 5AQGB 3M3ZB 5AQJB 5AQRB 3FZHB 5AQNB 1M62A 3A8YC 5AQOB 5AQHB 5AQLB 4HWHA 3FZLB 3FZMB 1HX1B 5AQIB 1I6ZA 5AQPB 1M7KA 5AQSB 5AQVB 5AQFB 5AQMB 5AQUB 1UGOA 2D9DA 1UK5A 3LDQB
chains in the Genus database with same CATH superfamily
1HNWT 4ZEYA 3ZEFB 2LJLA 2VASA 1Y64B 3KVAA 2FJDA 3UFEA 5CA1E 2E8IA 3FHNA 4JUYA 3UU5A 2YINA 4LMKA 1JNRA 3ZCJA 4Q25A 4AKIA 2JMKA 1YKEB 5CA0E 4I55E 3J9X1 3AB3B 5J0ZA 2J62A 4KX6A 3UFGA 3ETUA 5CJ5A 2UU9T 4JI4T 4H9SE 1D0ZA 1WFDA 2CCQA 4JI3T 1IZNB 1L0VA 1YKHB 4AQFA 1WR0A 1YD8G 1WLXA 2J1DG 4DR6T 1FJGT 4TNVA 5JDFA 2CE7A 5IWAT 2D0TA 2EHOD 3A7MA 4B3TT 5AQRB 5HEJA 5AQOB 2CRBA 2LT3A 4DBRA 4HWHA 3ONJA 4A5XA 2CHOA 3OPCA 2FUPA 2LM9A 3RIAA 4X5TA 3X1DA 3WI3A 5L3FB 4I50E 2HN2A 1DU2A 2W62A 2WWVA 1MIYA 3OKQA 1LVKA 3ZYKA 4EIWA 2ZM0A 4DV3T 2X67A 2OLTA 4F8HA 2YDQA 2B1EA 4A97A 2PTFA 3KV9A 4GK0E 2CBJA 2VKHA 2W67A 4HTEA 4IDPA 5FY0A 2AE9A 4AKGA 1FEWA 3RIFA 4KHPT 4EV6A 3I9YA 3PTRB 2CWOA 2V7KA 1HS7A 1BR2A 1UURA 3EDUA 4E7ZA 4DUYT 2G0UA 5FL0A 1LRZA 4MFRA 2ACZA 2OA5A 3NZQA 3DJBA 4YTPA 4O2BE 2DL1A 1GQEA 1XMQT 2KZ7B 3AA7B 2VL8A 3A5XA 4CI1B 2HPJA 2Q9QA 3RRCA 3AE7A 1NEKA 4X66T 5LHHB 3ZYLA 4UVBB 5AQLB 5F5WA 5TAOA 4DR4T 4ZS2A 5LGUB 3UT5E 1G8XA 4X62T 3UUMA 3V5SA 4YT0A 2BZBA 3U78A 2BBJA 4YHHT 3AE5A 4HEAA 3I0OA 5LMUT 2DCFA 3TKLB 2A3DA 4P1NA 1BR4A 5AQPB 5AQMB 5ADXL 4WBNE 4U2YA 2E9XB 2VURA 3WAJA 4EEDA 2BDEA 2UUAT 2LE8A 2UXCT 2V5CA 1HG5A 5LA6E 3N2KE 4DV2T 5H6RB 4IDZA 2RA1A 3PUQA 5L3BB 2NTYA 3QUJA 4G2AA 4GKKT 2CHNA 2V7IA 5IYZE 3RYIE 3OTOT 3IHRA 4CN6A 3ZT7A 4ILUA 5LHIB 4UR9A 4EZ4A 2Y6XA 1WR6A 3JC6D 1ZEEA 5BMVE 5AQHB 2K9AA 4PK4A 3CMLA 4YSYA 4IL4A 1KNRA 1N36T 2EHOA 1IJ6A 2K5BB 2XQYA 4JV5T 3B57A 3NKZA 4LF7T 4IDQA 3SRZA 3CQCB 3A8YC 3IBPA 5A1LA 3NRYA 4KHZF 4IE4A 3UUXB 3Q5EA 5AQFB 3ZMVB 5C3JA 1U5PA 3LK42 2N9DA 2N2NA 2UUCT 3HKDE 4ZXLA 4EXTA 2IC9A 3RI5A 2CXDA 4Z8XA 5EK3A 3ZJ1A 3O1HA 1MMNA 3WAKA 3MA9A 4JBWF 4HFIA 5FXZA 2XY8B 5LP6E 3Q9DA 3UU8A 4IE0A 4FJOA 2LKGA 2X0YA 4YTMA 3LG7A 1HX8A 3AE3A 3PUAA 4N78D 5JR9A 1FMWA 4EB6E 1W0BA 1WYBA 5JDHA 1Z0PA 4HFCA 5IHYA 3E0ZA 2KT9A 1VCSA 4O8SA 4ANJA 2A9UA 1SA0E 4TV9E 2YU2A 3O9XA 1SUMB 4TNWA 3LBXA 5AQQB 5LXTE 2WB5A 2IDOB 1YQ4A 3ABVA 4EAHA 3T1YT 1QSDA 3E08A 3AAAB 4BJNA 3PV0F 3QOFA 3C64A 3ZMSB 3ZSSA 5JDQA 1UK5A 3EABA 4DMWA 2M6IA 3P4WA 2KWHA 2VL0A 3RYHE 1XDPA 3EUHA 2BBHA 2IC6A 3EDVA 1BR0A 2P9BA 5JDGA 3NWIA 3AXJB 4ILCA 5HXHA 2QYWA 3GMIA 4U72A 2UXNB 5AQVB 2VKOA 1KEYA 3P4QA 5DABA 5AQKB 2XAQB 2E9XC 2E5LT 4JI2T 4DV6T 4C90A 4QKNA 2V7JA 3KV6A 3ZCIA 2XQ5A 4QXBB 2BS3A 4H9QC 3RKGA 5EK2A 4H9RC 3CX8B 3PUXF 4ISTA 5HYAA 5HWYA 2ZM8A 5FXXA 3TLSA 1VCTA 2XHEB 4OYKA 2Y8DA 4GIWA 4YSXA 4HKAA 1ZP0A 4PAGA 4DIDB 4NUUA 1D0XA 3L8RA 1MMDA 3DP7A 2L8KA 5AQJB 5JTGA 4NPPA 3UQ4A 3IEEA 4MBQA 2KNDA 4ZI3C 5HCJA 2W4XA 2KLQA 4IIJE 2JQQA 4YY3T 2CM0A 2CLYC 2I0MA 3M3ZB 2XUEA 5FXWA 2X66A 2L3LA 3HKBE 2YOEA 1HF8A 2IUBA 5AFUL 2L9QA 1T98A 3AAIA 2I59A 2H7VC 4AI6A 2NP9A 3EVYA 2QVAA 4NUVA 5ABFB 4J2CA 1M62A 4AQFC 2BG9B 3PUYF 1Y01A 3B13A 3PJAA 5JRCB 2RP4A 2WZIA 2LLYA 4Z91A 4DO0A 4AKHA 4H63V 4EGWA 2VKJA 4JEUB 2JIWA 4DVDA 5AQNB 3AEGA 4OYJA 4QH4A 3CX7B 1J5ET 4X64T 1XNQT 2VWAA 1OXZA 2WSSV 3AE4A 3FZKB 3ZLIA 2FJAA 3PURA 1ZHCA 2WWUA 2V8SV 3U3IA 2BS4A 4QH5A 1IJ5A 4TV8E 2MOZA 3PJAJ 2JQKA 2IMLA 2LHNA 2ODVA 4UEMA 2JQ9A 2WDVA 5HEGA 3KFWX 4AISA 3NZPA 2X9HA 3ZT5A 2BG9E 3V5UA 2XQ9A 3I9WA 2CMRA 4GYSA 1OEDB 5HXEA 2VQET 2YDRA 2VKDA 1LVFA 5JDLA 4EZHA 4L9IA 3VHLA 4CN1A 4TX5A 2KSRA 5CGMA 5HAXA 3LSVA 3LDQB 2FJBA 3QK6A 4X65T 4MHCA 4M1PA 2W61A 3I1AA 2JMHA 5GONE 1D1AA 1R8IA 2V6YA 1IBMT 3F2EA 4HN9A 2WDRA 4WZXA 2UXDT 2X0HA 4XAXB 5LYJE 1YW0A 2K3WA 4UF0B 3RHWA 3H37A 4YHJA 4EYYR 2X9WA 2XSBA 4PW8A 3QC9A 3N9MA 3CWZB 2OV9A 2NW9A 2JPFA 3M65A 1U4QA 2XPKA 3JADA 2X0LB 4WNKA 1ZV4X 2WP9A 2W63A 4ZHQE 5FMNA 3GWHA 3K8PC 4QXCB 2D5UA 1YQ3A 2X68A 2FJEA 2CPTA 1I94T 1AJ3A 4ZI7E 2WMOA 2C5JA 2BG9C 3PUSA 2NWBA 2A2FX 4QX7B 4JYAT 3AEFA 3ZMZB 5L3CB 3BQIA 2QA7A 2NW7A 4U33A 1UX5A 2SPCA 1OEDE 3UU6A 2LM2A 1N32T 4DR3T 2MAWA 1XZYA 2XZEA 4JI6T 4H9NC 1V9DA 2BKPA 2LHRA 4E7SA 4IGUA 1G73A 1HX1B 3AEAA 4YFSA 2W66A 5LGTB 5KXJA 3RRWA 5BR8T 3UU4A 4HWCA 5ETWA 4U7YA 1E2AA 4IREA 3PU3A 1MNDA 1D1BA 3ANWB 2MPKA 4LFAT 1N34T 4DV4T 1SE7A 2C5KT 3PDYA 2LSKA 3RLFF 3L39A 3H3AA 1WYCA 4DR5T 2V7MA 3N5LA 1SHZC 2NR4A 1B7TA 1KF6A 4ZOLE 3AVSA 3ZMUB 3GN5B 4DMVA 5EZYE 4UVAB 4DV7T 3K3OA 5HCMA 1FIOA 2A72A 2XAGB 5JREA 3IA3A 3K3QC 3ZC1A 2C0SA 1OEDC 4COFA 2Y48B 2DLRA 2D0UA 5HEHA 4GYRA 4GKJT 2LRKA 4CXXA 2ACXA 4L0RA 1EZ3A 2V26A 1NWMX 2F4VT 3HI2A 4NXMT 4AKRB 3AECA 2YEVC 3BQKA 3P4RA 4LMJA 4HWDA 3TLVA 3MJXA 2E9XD 3RC8A 4K0KT 2CLYB 3B5MA 1MNEA 4GK5E 5L3EB 3OBVE 4DR1T 2I6HA 3ESLA 4ZI2C 3HL6A 2NTXA 1UGOA 4ZZBA 2R6GF 2DWGA 3RIUA 4PJNA 1WRDA 2H89A 4YTNA 4DBQA 5L3GB 4UIGA 3SFDA 4XBFB 2PJQA 1I6ZA 3SWHA 3H3MA 4KI0F 4IL9A 4IE7A 4LF5T 2LSGA 3ZPOA 4Z90A 1ZKEA 3P50A 1LKXA 2XQ6A 3AAEB 2X9YA 4TWDA 4I43B 4ZI3D 3N9LA 4JI5T 1ZOYA 3QNUA 4KMCA 4BA9A 2ZM2A 3KINB 3PE0A 2UXBT 4DNDA 2JJ9A 3AE8A 1UX4A 3GA8A 2WMNA 3ZJ2A 4UELA 2IHR1 4CZZB 5CFBA 3L3PA 4LF4T 4IT4A 2JQHA 4JEHB 2HN1A 4O4LE 4XZCA 3VR9A 3AE2A 3HR0A 5LCYA 5FVKA 1XWMA 5JDNA 4BAYB 2ZM6T 4X20E 4B6XA 5LBMA 3TLTA 2MYSA 2PG8A 4LF6T 3MZKB 3C98B 2UXXB 2V5DA 1HG2A 4OX9T 5LJMA 2KWIB 4HFHA 5L2LA 3KVBA 4U31A 2DNXA 4LMLA 1X9BA 3RKOA 2YKSA 2E2AA 3AA0B 5LG4A 3CPZA 1YXRA 2H3RA 4DR2T 3P8CD 2Q9QB 5LHGB 1D0YA 3LK3B 3CQXC 2V7LA 4B3RT 2ZLYA 2RPAA 4EYUA 4TN7B 3W15B 2BKOA 3SS1A 1D1CA 1KFYA 4CQIA 4O4JE 2BS2A 3BQLA 5JQGE 2XQAA 2BVLA 3RQUA 4JI1T 3LK2B 4PJJA 3TLWA 1HNXT 3HKCE 1HR0T 5F3JA 4O2AE 2LEHA 1X79A 2C5IT 3ZC0A 1E1HB 2CBIA 2E9XA 4HWIB 2HPLA 4TUYE 5ABHA 3N9NA 2K24A 2V6XA 2FBWA 4OHFA 5LG3A 2D2SA 2ES0A 4JI7T 4YJ3E 1UUSA 2WU5A 1XMOT 1HNZT 3S4UA 4LFCT 5FY7A 4WYVA 3C4ZA 4BJMA 3P4SA 5AQUB 3DTOA 4OFZA 3P7IA 2PBIA 5HXRA 3N9OA 2VQFT 4HFEA 4CN4A 4ILAA 2M6BA 3O1IA 4PNIA 4KUMB 4H63H 4PJMA 3OJAA 1M7KA 4HFDA 3L09A 4ILBA 4ZZCA 3O4XE 1IAPA 2EHOB 4B3ST 2H88A 5FL1A 3HA4A 5C2TA 4UXNB 4QHOA 3CK6A 3F31A 2AXDS 3PUVF 3RYCE 1XDOA 2HH7A 4ASKA 4UVCB 1IBLT 2DHRA 3RX6A 3RPUA 1N33T 5JVDE 3ZMTB 3RGLA 2QRXA 1T72A 5L4HA 5EK4A 3JAEA 2LSIA 5LGNB 3LFMA 3AEDA 3HKEE 4P0BA 4IDNA 5J1GA 2KMFA 3G06A 4U3CA 3PUZF 5J2UE 2NW8A 1KK7A 5JR9B 3OYZA 3P4PA 2IIUA 2VK9A 2CXFA 4K0UA 4PFOA 2LSJA 1VOMA 3FXDB 4PK5A 4DV1T 3QB5A 3NVOA 2HHHT 2LSYA 3K3NA 3I0QA 3ONLC 2XSAA 3VKHA 2ZMAA 3QB5K 3UU3A 4LF8T 3LBXB 3ZSTA 2Q9QC 5L4EA 1E7PA 1W9RA 4JLEA 1HTJF 4KBMB 5LJNA 2KINB 4CI3B 2XTLA 4O4IE 4CXWA 3OVUA 4F6RC 5CB4E 3AXJA 5FKYA 5FP3A 4YJ2E 5FNVE 1NAFA 3VU7H 2LOSA 2UUBT 5HXCA 1MMAA 4H9OC 1S94A 3LJCA 1T7SA 3AE6A 1VRBA 3T8OA 2KXPB 2VVSA 3IF8B 2CA5A 2XASB 2XAHB 2WDQA 5LBQB 2BKNA 1J1JA 4LF9T 3CQGB 1KNPA 2H7OA 2QGSA 2WAUA 3C4XA 4I0UA 3AA1B 2MTQA 4ISSA 3VRBA 2PFVA 3JCFA 3PUGA 3AA6B 3N9PA 4U2ZA 2YK0A 3C50A 3FBLA 1HCIA 2IAKA 5DJQC 3KDSE 1W0AA 2EHOC 2XM2A 3UUNA 5IUXA 4JI8T 1H7CA 3N2GE 2W00A 4H9PC 4HE8A 4HGAA 1T8BA 5AQSB 4ZI2D 3VR8A 1XNRT 5FY1A 2XQ7A 4X1YE 3SOLA 2Z6EA 3VRAA 3JAFA 5JDMA 3FZLB 4AXPA 3KV4A 1HFAA 2VVNA 4A98A 3RIUC 1CHUA 1JNZA 3OYXA 4AIUA 4CXYA 5ABFA 4HFBA 5JR9C 2BG9A 4O4HE 3E22E 4U7IA 5JRCA 3K1SA 2XQ8A 1WCRA 3MACA 3CVRA 2WBLA 3C51A 3AEBA 2WCAA 5F8PA 2MBGA 4HFVA 4UV9B 5J2TE 3ZN0B 1O3XA 5KX5E 5L47A 5FVLA 4ADZA 1Z8UA 3ETVA 3Q2MA 3R84B 3FXEB 5JH7E 4AQYT 5LB7B 2E5VA 5FYMA 4MALA 5FXVA 3AE1A 4C91A 1W09A 3CIRA 3O1JA 3MXZA 4P09A 4UV8B 4AKLA 3RC3A 2WZHA 4JI0T 2LOPA 3UUBA 4EEBA 2XJ7A 5KDMC 2W0GA 2LKHA 5HEUA 3Q5XA 3ZN1B 1S35A 3MKDA 4YXDA 4LFBT 2DI4A 3NBXX 5E0OA 2X51A 5KMGP 2WQYA 2WM9A 4L5GA 3J7Yq 2XQ4A 3Q5DA 3EAMA 5AQTB 3FB2A 5AQGB 2LRLA 1UCUA 3FZHB 4ZS3A 4YLHA 1MIVA 1OEDA 3EI0A 1J5WA 2IW5B 5DQVA 2XAJB 4WBOA 4X1IE 3UULA 2JRKA 4NIQA 4ERRA 4A56A 3AE9A 5H6QB 4IHJE 3BK9A 3JC6C 3MK7C 2V6YB 2WS3A 2CWYA 2J4GA 4UF0A 3T1HT 5LOVE 2BVMA 3AVRA 5ABGA 4DV0T 5LMNT 4OK0A 5C8YE 4DR7T 2V1DB 4GOUA 4QX8B 3PU8A 2J47A 3ZKRA 5HWXA 4TZ4C 4IDOA 2XQ3A 1KNZA 4IE6A 2D9DA 3N9QA 2DWKA 3RYFE 2GK9A 4PJLA 1US7B 4TWHA 5LNKA 4PFPA 4NXNT 4TWFA 3KBTA 5HEOA 1OWAA 2WU2A 3UTKA 1MIWA 4CI2B 2YDSA 3ONXA 4DV5T 4QWNB 2NOXA 3KV5A 3AEEA 3FBZA 4DUZT 4QH1A 3CKDA 3C4WA 4KP3C 2N1GA 4B3MT 3RF1A 3UQ7A 3RQWA 1MMGA 3F57A 5ABEA 3NRXA 4FI5A 2XAFB 2B76A 2XM1A 3TLUA 5L3DB 3ZYMA 2M67A 3SFEA 3CX6B 2CXLA 5AQIB 5DQWA 5HXSA 3ANWA 1FMVA 4WW0A 4P0AA 1CUNA 4YSZA 1IBKT 2K48A 4QXHB 3ZT6A 2CEAA 3KBUA 4PK6A 1QLBA 4U74A 5M4YA 2VB6A 3D0TA 3N2OA 2ODUA 3VKGA 3EHZA 4IE5A 4X1KE 2W2UA 4HWFA 3GN5A 4G63A 3PUWF 3FZFB 3RH3A 1NENA 2Q9QD 3R6NA 4EOZB 4V1Av 1QUUA 3Q5WA 1BR1A 4MLKA 4I4TE 2YU1A 2X9XA 3FZMB 2WY2A 2YN6A 4AQGA
chains in the Genus database with same CATH topology
4HWFA 1T7SA 4HWDA 4HWIB 5AQTB 5AQQB 5AQKB 3FZFB 3FZKB 4HWCA 5AQGB 3M3ZB 5AQJB 5AQRB 3FZHB 5AQNB 1M62A 3A8YC 5AQOB 5AQHB 5AQLB 4HWHA 3FZLB 3FZMB 1HX1B 5AQIB 1I6ZA 5AQPB 1M7KA 5AQSB 5AQVB 5AQFB 5AQMB 5AQUB 1UGOA 2D9DA 1UK5A 3LDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWF A;  1T7S A;  4HWD A;  4HWI B;  5AQT B;  5AQQ B;  5AQK B;  3FZF B;  3FZK B;  4HWC A;  5AQG B;  3M3Z B;  5AQJ B;  5AQR B;  3FZH B;  5AQN B;  1M62 A;  3A8Y C;  5AQO B;  5AQH B;  5AQL B;  4HWH A;  3FZL B;  3FZM B;  1HX1 B;  5AQI B;  1I6Z A;  5AQP B;  1M7K A;  5AQS B;  5AQV B;  5AQF B;  5AQM B;  5AQU B;  1UGO A;  2D9D A;  1UK5 A;  3LDQ B; 
#chains in the Genus database with same CATH topology
 1HNW T;  4ZEY A;  3ZEF B;  2LJL A;  2VAS A;  1Y64 B;  3KVA A;  2FJD A;  3UFE A;  5CA1 E;  2E8I A;  3FHN A;  4JUY A;  3UU5 A;  2YIN A;  4LMK A;  1JNR A;  3ZCJ A;  4Q25 A;  4AKI A;  2JMK A;  1YKE B;  5CA0 E;  4I55 E;  3J9X 1;  3AB3 B;  5J0Z A;  2J62 A;  4KX6 A;  3UFG A;  3ETU A;  5CJ5 A;  2UU9 T;  4JI4 T;  4H9S E;  1D0Z A;  1WFD A;  2CCQ A;  4JI3 T;  1IZN B;  1L0V A;  1YKH B;  4AQF A;  1WR0 A;  1YD8 G;  1WLX A;  2J1D G;  4DR6 T;  1FJG T;  4TNV A;  5JDF A;  2CE7 A;  5IWA T;  2D0T A;  2EHO D;  3A7M A;  4B3T T;  5AQR B;  5HEJ A;  5AQO B;  2CRB A;  2LT3 A;  4DBR A;  4HWH A;  3ONJ A;  4A5X A;  2CHO A;  3OPC A;  2FUP A;  2LM9 A;  3RIA A;  4X5T A;  3X1D A;  3WI3 A;  5L3F B;  4I50 E;  2HN2 A;  1DU2 A;  2W62 A;  2WWV A;  1MIY A;  3OKQ A;  1LVK A;  3ZYK A;  4EIW A;  2ZM0 A;  4DV3 T;  2X67 A;  2OLT A;  4F8H A;  2YDQ A;  2B1E A;  4A97 A;  2PTF A;  3KV9 A;  4GK0 E;  2CBJ A;  2VKH A;  2W67 A;  4HTE A;  4IDP A;  5FY0 A;  2AE9 A;  4AKG A;  1FEW A;  3RIF A;  4KHP T;  4EV6 A;  3I9Y A;  3PTR B;  2CWO A;  2V7K A;  1HS7 A;  1BR2 A;  1UUR A;  3EDU A;  4E7Z A;  4DUY T;  2G0U A;  5FL0 A;  1LRZ A;  4MFR A;  2ACZ A;  2OA5 A;  3NZQ A;  3DJB A;  4YTP A;  4O2B E;  2DL1 A;  1GQE A;  1XMQ T;  2KZ7 B;  3AA7 B;  2VL8 A;  3A5X A;  4CI1 B;  2HPJ A;  2Q9Q A;  3RRC A;  3AE7 A;  1NEK A;  4X66 T;  5LHH B;  3ZYL A;  4UVB B;  5AQL B;  5F5W A;  5TAO A;  4DR4 T;  4ZS2 A;  5LGU B;  3UT5 E;  1G8X A;  4X62 T;  3UUM A;  3V5S A;  4YT0 A;  2BZB A;  3U78 A;  2BBJ A;  4YHH T;  3AE5 A;  4HEA A;  3I0O A;  5LMU T;  2DCF A;  3TKL B;  2A3D A;  4P1N A;  1BR4 A;  5AQP B;  5AQM B;  5ADX L;  4WBN E;  4U2Y A;  2E9X B;  2VUR A;  3WAJ A;  4EED A;  2BDE A;  2UUA T;  2LE8 A;  2UXC T;  2V5C A;  1HG5 A;  5LA6 E;  3N2K E;  4DV2 T;  5H6R B;  4IDZ A;  2RA1 A;  3PUQ A;  5L3B B;  2NTY A;  3QUJ A;  4G2A A;  4GKK T;  2CHN A;  2V7I A;  5IYZ E;  3RYI E;  3OTO T;  3IHR A;  4CN6 A;  3ZT7 A;  4ILU A;  5LHI B;  4UR9 A;  4EZ4 A;  2Y6X A;  1WR6 A;  3JC6 D;  1ZEE A;  5BMV E;  5AQH B;  2K9A A;  4PK4 A;  3CML A;  4YSY A;  4IL4 A;  1KNR A;  1N36 T;  2EHO A;  1IJ6 A;  2K5B B;  2XQY A;  4JV5 T;  3B57 A;  3NKZ A;  4LF7 T;  4IDQ A;  3SRZ A;  3CQC B;  3A8Y C;  3IBP A;  5A1L A;  3NRY A;  4KHZ F;  4IE4 A;  3UUX B;  3Q5E A;  5AQF B;  3ZMV B;  5C3J A;  1U5P A;  3LK4 2;  2N9D A;  2N2N A;  2UUC T;  3HKD E;  4ZXL A;  4EXT A;  2IC9 A;  3RI5 A;  2CXD A;  4Z8X A;  5EK3 A;  3ZJ1 A;  3O1H A;  1MMN A;  3WAK A;  3MA9 A;  4JBW F;  4HFI A;  5FXZ A;  2XY8 B;  5LP6 E;  3Q9D A;  3UU8 A;  4IE0 A;  4FJO A;  2LKG A;  2X0Y A;  4YTM A;  3LG7 A;  1HX8 A;  3AE3 A;  3PUA A;  4N78 D;  5JR9 A;  1FMW A;  4EB6 E;  1W0B A;  1WYB A;  5JDH A;  1Z0P A;  4HFC A;  5IHY A;  3E0Z A;  2KT9 A;  1VCS A;  4O8S A;  4ANJ A;  2A9U A;  1SA0 E;  4TV9 E;  2YU2 A;  3O9X A;  1SUM B;  4TNW A;  3LBX A;  5AQQ B;  5LXT E;  2WB5 A;  2IDO B;  1YQ4 A;  3ABV A;  4EAH A;  3T1Y T;  1QSD A;  3E08 A;  3AAA B;  4BJN A;  3PV0 F;  3QOF A;  3C64 A;  3ZMS B;  3ZSS A;  5JDQ A;  1UK5 A;  3EAB A;  4DMW A;  2M6I A;  3P4W A;  2KWH A;  2VL0 A;  3RYH E;  1XDP A;  3EUH A;  2BBH A;  2IC6 A;  3EDV A;  1BR0 A;  2P9B A;  5JDG A;  3NWI A;  3AXJ B;  4ILC A;  5HXH A;  2QYW A;  3GMI A;  4U72 A;  2UXN B;  5AQV B;  2VKO A;  1KEY A;  3P4Q A;  5DAB A;  5AQK B;  2XAQ B;  2E9X C;  2E5L T;  4JI2 T;  4DV6 T;  4C90 A;  4QKN A;  2V7J A;  3KV6 A;  3ZCI A;  2XQ5 A;  4QXB B;  2BS3 A;  4H9Q C;  3RKG A;  5EK2 A;  4H9R C;  3CX8 B;  3PUX F;  4IST A;  5HYA A;  5HWY A;  2ZM8 A;  5FXX A;  3TLS A;  1VCT A;  2XHE B;  4OYK A;  2Y8D A;  4GIW A;  4YSX A;  4HKA A;  1ZP0 A;  4PAG A;  4DID B;  4NUU A;  1D0X A;  3L8R A;  1MMD A;  3DP7 A;  2L8K A;  5AQJ B;  5JTG A;  4NPP A;  3UQ4 A;  3IEE A;  4MBQ A;  2KND A;  4ZI3 C;  5HCJ A;  2W4X A;  2KLQ A;  4IIJ E;  2JQQ A;  4YY3 T;  2CM0 A;  2CLY C;  2I0M A;  3M3Z B;  2XUE A;  5FXW A;  2X66 A;  2L3L A;  3HKB E;  2YOE A;  1HF8 A;  2IUB A;  5AFU L;  2L9Q A;  1T98 A;  3AAI A;  2I59 A;  2H7V C;  4AI6 A;  2NP9 A;  3EVY A;  2QVA A;  4NUV A;  5ABF B;  4J2C A;  1M62 A;  4AQF C;  2BG9 B;  3PUY F;  1Y01 A;  3B13 A;  3PJA A;  5JRC B;  2RP4 A;  2WZI A;  2LLY A;  4Z91 A;  4DO0 A;  4AKH A;  4H63 V;  4EGW A;  2VKJ A;  4JEU B;  2JIW A;  4DVD A;  5AQN B;  3AEG A;  4OYJ A;  4QH4 A;  3CX7 B;  1J5E T;  4X64 T;  1XNQ T;  2VWA A;  1OXZ A;  2WSS V;  3AE4 A;  3FZK B;  3ZLI A;  2FJA A;  3PUR A;  1ZHC A;  2WWU A;  2V8S V;  3U3I A;  2BS4 A;  4QH5 A;  1IJ5 A;  4TV8 E;  2MOZ A;  3PJA J;  2JQK A;  2IML A;  2LHN A;  2ODV A;  4UEM A;  2JQ9 A;  2WDV A;  5HEG A;  3KFW X;  4AIS A;  3NZP A;  2X9H A;  3ZT5 A;  2BG9 E;  3V5U A;  2XQ9 A;  3I9W A;  2CMR A;  4GYS A;  1OED B;  5HXE A;  2VQE T;  2YDR A;  2VKD A;  1LVF A;  5JDL A;  4EZH A;  4L9I A;  3VHL A;  4CN1 A;  4TX5 A;  2KSR A;  5CGM A;  5HAX A;  3LSV A;  3LDQ B;  2FJB A;  3QK6 A;  4X65 T;  4MHC A;  4M1P A;  2W61 A;  3I1A A;  2JMH A;  5GON E;  1D1A A;  1R8I A;  2V6Y A;  1IBM T;  3F2E A;  4HN9 A;  2WDR A;  4WZX A;  2UXD T;  2X0H A;  4XAX B;  5LYJ E;  1YW0 A;  2K3W A;  4UF0 B;  3RHW A;  3H37 A;  4YHJ A;  4EYY R;  2X9W A;  2XSB A;  4PW8 A;  3QC9 A;  3N9M A;  3CWZ B;  2OV9 A;  2NW9 A;  2JPF A;  3M65 A;  1U4Q A;  2XPK A;  3JAD A;  2X0L B;  4WNK A;  1ZV4 X;  2WP9 A;  2W63 A;  4ZHQ E;  5FMN A;  3GWH A;  3K8P C;  4QXC B;  2D5U A;  1YQ3 A;  2X68 A;  2FJE A;  2CPT A;  1I94 T;  1AJ3 A;  4ZI7 E;  2WMO A;  2C5J A;  2BG9 C;  3PUS A;  2NWB A;  2A2F X;  4QX7 B;  4JYA T;  3AEF A;  3ZMZ B;  5L3C B;  3BQI A;  2QA7 A;  2NW7 A;  4U33 A;  1UX5 A;  2SPC A;  1OED E;  3UU6 A;  2LM2 A;  1N32 T;  4DR3 T;  2MAW A;  1XZY A;  2XZE A;  4JI6 T;  4H9N C;  1V9D A;  2BKP A;  2LHR A;  4E7S A;  4IGU A;  1G73 A;  1HX1 B;  3AEA A;  4YFS A;  2W66 A;  5LGT B;  5KXJ A;  3RRW A;  5BR8 T;  3UU4 A;  4HWC A;  5ETW A;  4U7Y A;  1E2A A;  4IRE A;  3PU3 A;  1MND A;  1D1B A;  3ANW B;  2MPK A;  4LFA T;  1N34 T;  4DV4 T;  1SE7 A;  2C5K T;  3PDY A;  2LSK A;  3RLF F;  3L39 A;  3H3A A;  1WYC A;  4DR5 T;  2V7M A;  3N5L A;  1SHZ C;  2NR4 A;  1B7T A;  1KF6 A;  4ZOL E;  3AVS A;  3ZMU B;  3GN5 B;  4DMV A;  5EZY E;  4UVA B;  4DV7 T;  3K3O A;  5HCM A;  1FIO A;  2A72 A;  2XAG B;  5JRE A;  3IA3 A;  3K3Q C;  3ZC1 A;  2C0S A;  1OED C;  4COF A;  2Y48 B;  2DLR A;  2D0U A;  5HEH A;  4GYR A;  4GKJ T;  2LRK A;  4CXX A;  2ACX A;  4L0R A;  1EZ3 A;  2V26 A;  1NWM X;  2F4V T;  3HI2 A;  4NXM T;  4AKR B;  3AEC A;  2YEV C;  3BQK A;  3P4R A;  4LMJ A;  4HWD A;  3TLV A;  3MJX A;  2E9X D;  3RC8 A;  4K0K T;  2CLY B;  3B5M A;  1MNE A;  4GK5 E;  5L3E B;  3OBV E;  4DR1 T;  2I6H A;  3ESL A;  4ZI2 C;  3HL6 A;  2NTX A;  1UGO A;  4ZZB A;  2R6G F;  2DWG A;  3RIU A;  4PJN A;  1WRD A;  2H89 A;  4YTN A;  4DBQ A;  5L3G B;  4UIG A;  3SFD A;  4XBF B;  2PJQ A;  1I6Z A;  3SWH A;  3H3M A;  4KI0 F;  4IL9 A;  4IE7 A;  4LF5 T;  2LSG A;  3ZPO A;  4Z90 A;  1ZKE A;  3P50 A;  1LKX A;  2XQ6 A;  3AAE B;  2X9Y A;  4TWD A;  4I43 B;  4ZI3 D;  3N9L A;  4JI5 T;  1ZOY A;  3QNU A;  4KMC A;  4BA9 A;  2ZM2 A;  3KIN B;  3PE0 A;  2UXB T;  4DND A;  2JJ9 A;  3AE8 A;  1UX4 A;  3GA8 A;  2WMN A;  3ZJ2 A;  4UEL A;  2IHR 1;  4CZZ B;  5CFB A;  3L3P A;  4LF4 T;  4IT4 A;  2JQH A;  4JEH B;  2HN1 A;  4O4L E;  4XZC A;  3VR9 A;  3AE2 A;  3HR0 A;  5LCY A;  5FVK A;  1XWM A;  5JDN A;  4BAY B;  2ZM6 T;  4X20 E;  4B6X A;  5LBM A;  3TLT A;  2MYS A;  2PG8 A;  4LF6 T;  3MZK B;  3C98 B;  2UXX B;  2V5D A;  1HG2 A;  4OX9 T;  5LJM A;  2KWI B;  4HFH A;  5L2L A;  3KVB A;  4U31 A;  2DNX A;  4LML A;  1X9B A;  3RKO A;  2YKS A;  2E2A A;  3AA0 B;  5LG4 A;  3CPZ A;  1YXR A;  2H3R A;  4DR2 T;  3P8C D;  2Q9Q B;  5LHG B;  1D0Y A;  3LK3 B;  3CQX C;  2V7L A;  4B3R T;  2ZLY A;  2RPA A;  4EYU A;  4TN7 B;  3W15 B;  2BKO A;  3SS1 A;  1D1C A;  1KFY A;  4CQI A;  4O4J E;  2BS2 A;  3BQL A;  5JQG E;  2XQA A;  2BVL A;  3RQU A;  4JI1 T;  3LK2 B;  4PJJ A;  3TLW A;  1HNX T;  3HKC E;  1HR0 T;  5F3J A;  4O2A E;  2LEH A;  1X79 A;  2C5I T;  3ZC0 A;  1E1H B;  2CBI A;  2E9X A;  4HWI B;  2HPL A;  4TUY E;  5ABH A;  3N9N A;  2K24 A;  2V6X A;  2FBW A;  4OHF A;  5LG3 A;  2D2S A;  2ES0 A;  4JI7 T;  4YJ3 E;  1UUS A;  2WU5 A;  1XMO T;  1HNZ T;  3S4U A;  4LFC T;  5FY7 A;  4WYV A;  3C4Z A;  4BJM A;  3P4S A;  5AQU B;  3DTO A;  4OFZ A;  3P7I A;  2PBI A;  5HXR A;  3N9O A;  2VQF T;  4HFE A;  4CN4 A;  4ILA A;  2M6B A;  3O1I A;  4PNI A;  4KUM B;  4H63 H;  4PJM A;  3OJA A;  1M7K A;  4HFD A;  3L09 A;  4ILB A;  4ZZC A;  3O4X E;  1IAP A;  2EHO B;  4B3S T;  2H88 A;  5FL1 A;  3HA4 A;  5C2T A;  4UXN B;  4QHO A;  3CK6 A;  3F31 A;  2AXD S;  3PUV F;  3RYC E;  1XDO A;  2HH7 A;  4ASK A;  4UVC B;  1IBL T;  2DHR A;  3RX6 A;  3RPU A;  1N33 T;  5JVD E;  3ZMT B;  3RGL A;  2QRX A;  1T72 A;  5L4H A;  5EK4 A;  3JAE A;  2LSI A;  5LGN B;  3LFM A;  3AED A;  3HKE E;  4P0B A;  4IDN A;  5J1G A;  2KMF A;  3G06 A;  4U3C A;  3PUZ F;  5J2U E;  2NW8 A;  1KK7 A;  5JR9 B;  3OYZ A;  3P4P A;  2IIU A;  2VK9 A;  2CXF A;  4K0U A;  4PFO A;  2LSJ A;  1VOM A;  3FXD B;  4PK5 A;  4DV1 T;  3QB5 A;  3NVO A;  2HHH T;  2LSY A;  3K3N A;  3I0Q A;  3ONL C;  2XSA A;  3VKH A;  2ZMA A;  3QB5 K;  3UU3 A;  4LF8 T;  3LBX B;  3ZST A;  2Q9Q C;  5L4E A;  1E7P A;  1W9R A;  4JLE A;  1HTJ F;  4KBM B;  5LJN A;  2KIN B;  4CI3 B;  2XTL A;  4O4I E;  4CXW A;  3OVU A;  4F6R C;  5CB4 E;  3AXJ A;  5FKY A;  5FP3 A;  4YJ2 E;  5FNV E;  1NAF A;  3VU7 H;  2LOS A;  2UUB T;  5HXC A;  1MMA A;  4H9O C;  1S94 A;  3LJC A;  1T7S A;  3AE6 A;  1VRB A;  3T8O A;  2KXP B;  2VVS A;  3IF8 B;  2CA5 A;  2XAS B;  2XAH B;  2WDQ A;  5LBQ B;  2BKN A;  1J1J A;  4LF9 T;  3CQG B;  1KNP A;  2H7O A;  2QGS A;  2WAU A;  3C4X A;  4I0U A;  3AA1 B;  2MTQ A;  4ISS A;  3VRB A;  2PFV A;  3JCF A;  3PUG A;  3AA6 B;  3N9P A;  4U2Z A;  2YK0 A;  3C50 A;  3FBL A;  1HCI A;  2IAK A;  5DJQ C;  3KDS E;  1W0A A;  2EHO C;  2XM2 A;  3UUN A;  5IUX A;  4JI8 T;  1H7C A;  3N2G E;  2W00 A;  4H9P C;  4HE8 A;  4HGA A;  1T8B A;  5AQS B;  4ZI2 D;  3VR8 A;  1XNR T;  5FY1 A;  2XQ7 A;  4X1Y E;  3SOL A;  2Z6E A;  3VRA A;  3JAF A;  5JDM A;  3FZL B;  4AXP A;  3KV4 A;  1HFA A;  2VVN A;  4A98 A;  3RIU C;  1CHU A;  1JNZ A;  3OYX A;  4AIU A;  4CXY A;  5ABF A;  4HFB A;  5JR9 C;  2BG9 A;  4O4H E;  3E22 E;  4U7I A;  5JRC A;  3K1S A;  2XQ8 A;  1WCR A;  3MAC A;  3CVR A;  2WBL A;  3C51 A;  3AEB A;  2WCA A;  5F8P A;  2MBG A;  4HFV A;  4UV9 B;  5J2T E;  3ZN0 B;  1O3X A;  5KX5 E;  5L47 A;  5FVL A;  4ADZ A;  1Z8U A;  3ETV A;  3Q2M A;  3R84 B;  3FXE B;  5JH7 E;  4AQY T;  5LB7 B;  2E5V A;  5FYM A;  4MAL A;  5FXV A;  3AE1 A;  4C91 A;  1W09 A;  3CIR A;  3O1J A;  3MXZ A;  4P09 A;  4UV8 B;  4AKL A;  3RC3 A;  2WZH A;  4JI0 T;  2LOP A;  3UUB A;  4EEB A;  2XJ7 A;  5KDM C;  2W0G A;  2LKH A;  5HEU A;  3Q5X A;  3ZN1 B;  1S35 A;  3MKD A;  4YXD A;  4LFB T;  2DI4 A;  3NBX X;  5E0O A;  2X51 A;  5KMG P;  2WQY A;  2WM9 A;  4L5G A;  3J7Y q;  2XQ4 A;  3Q5D A;  3EAM A;  5AQT B;  3FB2 A;  5AQG B;  2LRL A;  1UCU A;  3FZH B;  4ZS3 A;  4YLH A;  1MIV A;  1OED A;  3EI0 A;  1J5W A;  2IW5 B;  5DQV A;  2XAJ B;  4WBO A;  4X1I E;  3UUL A;  2JRK A;  4NIQ A;  4ERR A;  4A56 A;  3AE9 A;  5H6Q B;  4IHJ E;  3BK9 A;  3JC6 C;  3MK7 C;  2V6Y B;  2WS3 A;  2CWY A;  2J4G A;  4UF0 A;  3T1H T;  5LOV E;  2BVM A;  3AVR A;  5ABG A;  4DV0 T;  5LMN T;  4OK0 A;  5C8Y E;  4DR7 T;  2V1D B;  4GOU A;  4QX8 B;  3PU8 A;  2J47 A;  3ZKR A;  5HWX A;  4TZ4 C;  4IDO A;  2XQ3 A;  1KNZ A;  4IE6 A;  2D9D A;  3N9Q A;  2DWK A;  3RYF E;  2GK9 A;  4PJL A;  1US7 B;  4TWH A;  5LNK A;  4PFP A;  4NXN T;  4TWF A;  3KBT A;  5HEO A;  1OWA A;  2WU2 A;  3UTK A;  1MIW A;  4CI2 B;  2YDS A;  3ONX A;  4DV5 T;  4QWN B;  2NOX A;  3KV5 A;  3AEE A;  3FBZ A;  4DUZ T;  4QH1 A;  3CKD A;  3C4W A;  4KP3 C;  2N1G A;  4B3M T;  3RF1 A;  3UQ7 A;  3RQW A;  1MMG A;  3F57 A;  5ABE A;  3NRX A;  4FI5 A;  2XAF B;  2B76 A;  2XM1 A;  3TLU A;  5L3D B;  3ZYM A;  2M67 A;  3SFE A;  3CX6 B;  2CXL A;  5AQI B;  5DQW A;  5HXS A;  3ANW A;  1FMV A;  4WW0 A;  4P0A A;  1CUN A;  4YSZ A;  1IBK T;  2K48 A;  4QXH B;  3ZT6 A;  2CEA A;  3KBU A;  4PK6 A;  1QLB A;  4U74 A;  5M4Y A;  2VB6 A;  3D0T A;  3N2O A;  2ODU A;  3VKG A;  3EHZ A;  4IE5 A;  4X1K E;  2W2U A;  4HWF A;  3GN5 A;  4G63 A;  3PUW F;  3FZF B;  3RH3 A;  1NEN A;  2Q9Q D;  3R6N A;  4EOZ B;  4V1A v;  1QUU A;  3Q5W A;  1BR1 A;  4MLK A;  4I4T E;  2YU1 A;  2X9X A;  3FZM B;  2WY2 A;  2YN6 A;  4AQG A; 
#chains in the Genus database with same CATH homology
 4HWF A;  1T7S A;  4HWD A;  4HWI B;  5AQT B;  5AQQ B;  5AQK B;  3FZF B;  3FZK B;  4HWC A;  5AQG B;  3M3Z B;  5AQJ B;  5AQR B;  3FZH B;  5AQN B;  1M62 A;  3A8Y C;  5AQO B;  5AQH B;  5AQL B;  4HWH A;  3FZL B;  3FZM B;  1HX1 B;  5AQI B;  1I6Z A;  5AQP B;  1M7K A;  5AQS B;  5AQV B;  5AQF B;  5AQM B;  5AQU B;  1UGO A;  2D9D A;  1UK5 A;  3LDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...