1M62A

Solution structure of the bag domain from bag4/sodd
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
GSPEFTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords BAG-family molecular chaperone regulator-4
publication title BAG4/SODD protein contains a short BAG domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2002-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1m62A00
3FZFB 1M7KA 4HWHA 5AQMB 5AQRB 5AQVB 5AQJB 5AQTB 4HWDA 3FZMB 5AQHB 5AQLB 4HWCA 1HX1B 1I6ZA 5AQKB 5AQGB 3FZLB 5AQOB 3M3ZB 3A8YC 5AQUB 3FZHB 3LDQB 5AQNB 1M62A 3FZKB 4HWIB 5AQQB 1UK5A 5AQFB 4HWFA 5AQPB 5AQIB 2D9DA 5AQSB 1UGOA 1T7SA
chains in the Genus database with same CATH superfamily
2WZIA 3JADA 2X9YA 4IE6A 1S35A 4I43B 2WP9A 2A9UA 2UXXB 2DLRA 3LDQB 4A56A 5L3FB 2JMKA 4YJ3E 2CA5A 1M7KA 3HKCE 4ZOLE 2LE8A 4CI1B 3P7IA 3QUJA 3H3AA 3PJAJ 2XQ4A 3HKBE 4B3ST 5F8PA 4QHOA 1XMOT 1E7PA 5L4HA 1O3XA 3AE6A 5FY1A 1LVFA 3KBTA 3OYZA 1ZV4X 3F31A 3P50A 3FB2A 2E5VA 1H7CA 3DJBA 4CXXA 4A5XA 4HFEA 2E5LT 4O2AE 3JC6C 4UEMA 3UU6A 3NRYA 3NKZA 2LSYA 2XAFB 5LBMA 3PU3A 3C4ZA 3AE5A 5TAOA 2JQ9A 3AA1B 5JTGA 2XQAA 2ODUA 2RP4A 4Z8XA 5AQQB 4X62T 4CI2B 3UQ7A 3C50A 5LA6E 1N32T 3AEBA 4P0BA 3IA3A 3UT5E 3UUNA 1YKHB 3H37A 3C51A 2WS3A 2CM0A 3SWHA 5HXSA 3RHWA 2HHHT 2D0TA 2W61A 3UTKA 4U7YA 5DQVA 3LK2B 2XAHB 4I55E 4ZI3C 4KP3C 4DR3T 4AISA 3EI0A 2IMLA 2M67A 1VRBA 3RPUA 3O1IA 4EGWA 2N2NA 3P4WA 5C3JA 1WFDA 4JI0T 4JEUB 4YTNA 5KDMC 3D0TA 3MXZA 4O4JE 3RC3A 3CIRA 4JYAT 1HX1B 4C91A 3KFWX 2XQYA 1MIYA 1HNZT 2XQ6A 4NUVA 2K48A 5JRCA 5FXVA 2XASB 2KSRA 3W15B 1UCUA 3AB3B 5AQTB 3TLWA 2LHNA 3V5SA 1YXRA 4Z91A 5FMNA 4H9SE 3RIFA 1IAPA 3K8PC 2FJAA 2VQET 4O4IE 4KUMB 4QXHB 2UUAT 1D0YA 4DV2T 5L3BB 4LF7T 5HXHA 2QVAA 2NTXA 4QWNB 1R8IA 4JI7T 1B7TA 2VB6A 5LCYA 1E2AA 4ILUA 3RX6A 3MA9A 3F57A 5JDFA 3RLFF 4PAGA 5LJMA 2V5DA 3KINB 3T8OA 4YFSA 4H9QC 3EDUA 2P9BA 2KT9A 2VKDA 4ILCA 3KVAA 4WYVA 1ZEEA 2OV9A 4N78D 3SOLA 4IDPA 3LSVA 2CLYC 4KHPT 4I4TE 3P4SA 2X0LB 2BZBA 1Y01A 5JRCB 2W67A 3IEEA 1HG5A 1T72A 4OYKA 1HG2A 2XUEA 3O9XA 4YXDA 4YY3T 2HN1A 3P4RA 3UU4A 4YTMA 2BBJA 4ZS2A 2MBGA 1HNWT 2LOSA 3WAKA 2UXBT 2VVSA 5DQWA 3B13A 2A3DA 4IE5A 3KVBA 4IDZA 4L0RA 5AQIB 3UUXB 2XHEB 2VQFT 3FXEB 2WMNA 3QNUA 1ZOYA 4P0AA 4JI5T 5JVDE 2WMOA 2E9XD 1UX4A 2CXDA 4B3MT 2W4XA 4ANJA 2GK9A 2XY8B 1YQ3A 2PG8A 3AXJA 5AFUL 4PW8A 4F8HA 2FJEA 2JQQA 4IE0A 4HFCA 5L47A 3ZC1A 3FBLA 2KWHA 5ETWA 1MNDA 2CWOA 2YDSA 1I94T 1MIWA 2IW5B 2X67A 5H6QB 2BBHA 2CLYB 5KXJA 5CB4E 3CQXC 3R84B 4H9NC 2LSGA 1V9DA 5AQPB 1HR0T 2EHOD 4KI0F 4YT0A 1T7SA 1VOMA 4U31A 2I6HA 4YLHA 4LF4T 3ZPOA 5LG3A 2MOZA 4NUUA 4AKIA 4IE4A 5DJQC 4PFOA 1X9BA 4ZZCA 3CPZA 2BG9B 3RQUA 2VKHA 1LKXA 1N36T 2WM9A 4ZHQE 4PJMA 3RGLA 2D0UA 3WAJA 2BVLA 3AXJB 4UV9B 2LT3A 5DABA 3OKQA 3N9MA 3PUXF 2VURA 2Y48B 4UR9A 4DIDB 4JUYA 1WLXA 4ZI7E 3LG7A 3MK7C 3O4XE 5LBQB 2QA7A 2YDQA 2K5BB 4UELA 2Q9QC 2ACZA 2XM2A 3N5LA 5HCJA 4DMWA 2H88A 4QH5A 2WSSV 3FBZA 3SS1A 4ISSA 3RH3A 1SE7A 4QH4A 4ISTA 4G63A 4CQIA 4UV8B 3VU7H 4K0UA 1D0XA 2UXNB 4UXNB 5FP3A 4XBFB 2DCFA 2Q9QA 4JEHB 4CN1A 4GYRA 2HH7A 2CXFA 5IYZE 3QB5A 4Z90A 5HXEA 1N34T 3QK6A 4LF9T 1BR1A 3ONJA 4WZXA 1UK5A 2LLYA 3I9WA 3ZYKA 2WDVA 2L9QA 3EABA 4F6RC 3ZSSA 1UX5A 1YKEB 5L4EA 4AKLA 2F4VT 4OK0A 4AI6A 1XNQT 1OEDE 2YK0A 1D1BA 2EHOB 2V7IA 2J4GA 1KNRA 2XAGB 4GYSA 4EIWA 4IDOA 3AEDA 4JI4T 4B6XA 2HPLA 3UULA 4HWCA 4ILAA 4IIJE 2I59A 3TLUA 1CHUA 5LG4A 3AA6B 4YJ2E 4LFBT 2BS4A 4HN9A 5LHHB 2Z6EA 4U2ZA 4YSYA 4H9OC 2LM9A 2H7OA 2FJBA 2Q9QB 4DBRA 5LMUT 1KEYA 3NVOA 5CJ5A 4TWDA 4IREA 3GN5A 2JPFA 3EDVA 3QB5K 2DI4A 2YKSA 4GK5E 3ETVA 5BR8T 2IHR1 3I0OA 1UUSA 4DMVA 4PK6A 2A2FX 5AQKB 2IAKA 5FXZA 5H6RB 4U72A 5GONE 2L8KA 3AAEB 3PDYA 5LGNB 5FVKA 3AEFA 4LMJA 2X68A 5LB7B 5E0OA 2MPKA 1EZ3A 4U33A 1FMVA 4MLKA 2RPAA 4PK4A 5ABGA 1NWMX 2J62A 4B3RT 2H89A 3ETUA 3FZHB 4JI6T 3VRAA 2XSAA 1IZNB 5HWYA 3BQLA 2W66A 4IT4A 4U74A 3S4UA 4AKRB 4KX6A 2NOXA 5JREA 1W09A 3ZN0B 4GOUA 3DTOA 1WYBA 4AIUA 2JIWA 2J1DG 2HN2A 4HE8A 3GN5B 2WAUA 2CMRA 3KV5A 1HCIA 4ZI3D 2ZM0A 1KF6A 5AQLB 1MMNA 3AA7B 2L3LA 2LRLA 2W2UA 3B57A 3CQGB 5JDHA 2I0MA 4AKGA 2K3WA 3PJAA 4DR1T 3ZMSB 1MIVA 5FYMA 2XTLA 3HA4A 2PBIA 5EK3A 5AQSB 4I50E 3RRCA 3SRZA 5JDNA 3H3MA 4DR6T 4JLEA 1XWMA 2SPCA 2A72A 3PUWF 5L3EB 2UUCT 2VVNA 3M65A 4DR2T 5JDMA 2ZMAA 4IDQA 4GIWA 2XQ3A 5LGTB 2X9WA 2CBIA 1D1AA 2E2AA 4CZZB 2B1EA 3LK42 1QLBA 2ZM6T 2IDOB 2HPJA 3O1JA 4IGUA 5AQOB 3RKOA 1DU2A 2M6IA 3T1YT 5FXXA 3I1AA 2YEVC 2YU1A 2DWKA 4LMLA 2XSBA 3LFMA 5JQGE 3QC9A 4DR4T 3P8CD 1ZHCA 1XDOA 4LFCT 3VR8A 3G06A 4DR7T 3ZEFB 4O2BE 4DV6T 3Q5DA 4LF6T 1JNRA 4BA9A 4CXWA 4XZCA 5FY7A 3RRWA 2DHRA 2WU2A 2NTYA 4M1PA 4A97A 4X20E 4TV8E 3NBXX 5HYAA 2WDQA 4G2AA 1X79A 4PFPA 2V7LA 2KINB 3FZMB 1VCSA 3U78A 4GKKT 1I6ZA 4JBWF 2LKGA 1S94A 4WBOA 4AXPA 3OTOT 2DNXA 4I0UA 3N9NA 2BG9C 5AQMB 1Z0PA 2XQ9A 3CKDA 3KV9A 3C4XA 3ZMVB 2UU9T 5IWAT 3C98B 2FUPA 4H63V 1M62A 3RIAA 1WR6A 4EAHA 2QRXA 4HFHA 4ZZBA 3HI2A 5LGUB 3C64A 1FMWA 4DNDA 3ESLA 3RF1A 3RC8A 2BG9A 1KFYA 2KZ7B 2XZEA 1ZKEA 3M3ZB 2N1GA 4H9PC 3AECA 3JAFA 2LM2A 2BS2A 5FL1A 3CK6A 4HGAA 2AXDS 3VHLA 1W0AA 1E1HB 1US7B 2WZHA 3RYIE 5FVLA 3Q2MA 2MYSA 2Y8DA 3EAMA 2VWAA 2E9XC 3PUGA 3ZLIA 3K3QC 1HFAA 3A8YC 4MBQA 1W0BA 4DV3T 4U3CA 2MTQA 4HFIA 5EZYE 1HS7A 3IF8B 3RKGA 1HNXT 1WCRA 4L5GA 4YHHT 3CQCB 1MMAA 4HWDA 5IUXA 3N2KE 4A98A 3AE2A 4QXCB 2E9XA 4TWFA 3SFDA 3K3NA 3PUVF 3BK9A 2IUBA 4TNWA 1MMGA 1SA0E 2X0HA 3X1DA 2ODVA 1NEKA 3PUSA 5ABEA 1WRDA 3P4PA 4QX8B 5LNKA 2EHOC 1IJ5A 2K9AA 4JV5T 3I0QA 3RIUC 5IHYA 2KMFA 4L9IA 2WBLA 1IBLT 4CI3B 1U4QA 1XZYA 1OWAA 2VK9A 3PUAA 3ABVA 4QH1A 3ANWA 4AQGA 4QXBB 2EHOA 4HFBA 4NXNT 5FL0A 1Y64B 4PJJA 3RIUA 2R6GF 3ZT6A 3N9LA 2NWBA 2WDRA 3VRBA 2CRBA 3HKEE 1QUUA 3WI3A 2PTFA 3AE3A 4O8SA 4OYJA 5JDQA 2ZM2A 2E9XB 4EEBA 5ABHA 3NWIA 4P1NA 3IBPA 3PURA 1D0ZA 5C2TA 1FEWA 4TNVA 1AJ3A 3NZQA 2VL0A 3N2OA 3FZKB 3MACA 3PTRB 4HWIB 1L0VA 2H3RA 3LBXA 3UUBA 3J9X1 2BS3A 3FXDB 4ZI2D 4XAXB 5LXTE 2Y6XA 4TWHA 3AVSA 1N33T 4ASKA 1WYCA 2ES0A 4K0KT 3NZPA 4AKHA 4BJNA 2KLQA 4YHJA 4BJMA 3ZMZB 1Z8UA 4J2CA 3HR0A 2RA1A 3LK3B 3UQ4A 3N9QA 3ZCIA 3RI5A 4EZHA 4B3TT 4C90A 2V8SV 4UVAB 3I9YA 3R6NA 2JQKA 5JDGA 3ANWB 4TV9E 3OPCA 4CN4A 4QKNA 3P4QA 4UVBB 5ABFA 2ACXA 4UF0A 2VL8A 3E22E 4DV0T 1HTJF 3VKHA 2M6BA 4UIGA 2LRKA 3ZC0A 3OVUA 4GK0E 2E8IA 2CEAA 3LJCA 1XNRT 2G0UA 3BQKA 3KV6A 3LBXB 3PUYF 3K1SA 2LKHA 5C8YE 3UU5A 3VKGA 2CCQA 3ZT5A 4EV6A 4YSZA 3V5UA 5AQUB 4JI1T 2W63A 2C5IT 3DP7A 4OX9T 2V1DB 3AEGA 2CXLA 2D5UA 2LOPA 3AA0B 5AQJB 4HEAA 2WQYA 2OA5A 3CX7B 5BMVE 1IJ6A 1KK7A 3PE0A 5M4YA 5FXWA 4IL9A 3OJAA 3ZMTB 2UXDT 1T98A 2DWGA 5ADXL 1VCTA 1KNPA 3UU8A 3AVRA 4EOZB 4KHZF 2YU2A 3N9PA 4OHFA 3JC6D 2NW9A 2C0SA 3FHNA 2V26A 4IHJE 5ABFB 5L3GB 5JR9B 2CPTA 3UFGA 4TUYE 2KNDA 3Q5XA 5JDLA 4HKAA 4UF0B 4DV5T 5J0ZA 3ZMUB 2JQHA 1YD8G 1XMQT 2V7MA 2X0YA 3GMIA 2KWIB 5FNVE 4X66T 5FY0A 5HAXA 3MKDA 3Q5WA 3AE8A 4HTEA 5HEUA 5LOVE 4V1Av 3U3IA 5J1GA 2W00A 3TLVA 3PV0F 2BKOA 3RYCE 2JMHA 3JAEA 2NW7A 2QYWA 2V7JA 2YOEA 4YTPA 4Q25A 2IC9A 2C5KT 2LSKA 4LFAT 4U2YA 5HEOA 4EYYR 4HWFA 1IBKT 5L3CB 4GKJT 2XAJB 4P09A 3CX6B 5HEHA 1LVKA 3RYHE 4NIQA 2CE7A 2V7KA 4FJOA 3VR9A 1IBMT 4AQFC 2LSJA 2KXPB 5F3JA 2BVMA 2XQ5A 2XQ7A 4DO0A 4U7IA 2V6XA 2AE9A 1OXZA 4UVCB 2B76A 4HFVA 2WY2A 1J5ET 4KBMB 1D1CA 5LP6E 4AQFA 3CVRA 4AQYT 4ZXLA 4LF8T 1U5PA 3A7MA 2WWVA 3MJXA 3ONLC 2NW8A 4LMKA 2BKNA 3KBUA 4X1KE 2YINA 2V6YA 4EZ4A 4IL4A 3HKDE 3PU8A 5EK2A 2CBJA 3KDSE 5CA0E 3RQWA 3CWZB 3OBVE 2LJLA 3UFEA 1J5WA 4KMCA 1FIOA 4EB6E 4DV7T 3PUZF 2N9DA 4PK5A 5CFBA 2JJ9A 1UURA 3CMLA 4DBQA 5L2LA 3AE1A 1UGOA 3FZFB 4DUYT 1SHZC 2WWUA 2BDEA 5HXRA 4EXTA 3N9OA 4NPPA 2JRKA 2NP9A 4X64T 2IIUA 5AQVB 3K3OA 1YQ4A 2WU5A 4DR5T 3RYFE 2XPKA 2V6YB 2V5CA 3C4WA 2MAWA 3TLTA 3A5XA 2FJDA 2LSIA 3N2GE 2K24A 2WB5A 2D9DA 2X9XA 4HFDA 2D2SA 5LHGB 3BQIA 4ERRA 3CX8B 3GA8A 3ZN1B 1MNEA 4ADZA 4YSXA 4MALA 4WW0A 1ZP0A 4IE7A 3UUMA 5HCMA 4JI3T 5LYJE 4X5TA 1HX8A 3FZLB 5J2TE 3ZT7A 1BR2A 1MMDA 4CXYA 3JCFA 4JI2T 3TLSA 1BR0A 3ZJ2A 3ZCJA 3ONXA 1G73A 3E0ZA 3AEEA 4DV1T 3T1HT 2W0GA 2XJ7A 2CWYA 5CA1E 4X1YE 5CGMA 2DL1A 5LHIB 1BR4A 2ZLYA 1LRZA 3F2EA 2C5JA 5LMNT 3L09A 1YW0A 1XDPA 2W62A 4PJLA 3UU3A 5A1LA 3GWHA 4DV4T 2ZM8A 1KNZA 3AE7A 4NXMT 1OEDC 2WCAA 2YN6A 4EYUA 2UUBT 4LF5T 3NRXA 5J2UE 5LJNA 3ZYMA 5HEGA 5JH7E 3EHZA 2VKJA 4IDNA 2OLTA 3MZKB 4MHCA 5AQGB 4DUZT 5AQNB 3L39A 5FKYA 1OEDA 4FI5A 5KMGP 4X1IE 4OFZA 1T8BA 2BG9E 2LEHA 4HWHA 4TZ4C 5KX5E 3PUQA 1CUNA 3ZKRA 2BKPA 3AE4A 4X65T 5L3DB 2VKOA 4PJNA 2Q9QD 3L8RA 2UXCT 3QOFA 5HXCA 4PNIA 3ZSTA 4H9RC 5AQHB 1J1JA 2X66A 3AAIA 2XQ8A 3L3PA 4ZS3A 2QGSA 4H63H 4CN6A 2XM1A 5F5WA 3EVYA 3AEAA 3J7Yq 2VASA 4ILBA 2IC6A 2PFVA 3TKLB 2NR4A 3AAAB 2X51A 3SFEA 4O4HE 1NAFA 1QSDA 4COFA 2J47A 1WR0A 3Q9DA 4WBNE 5JR9C 4ZEYA 2PJQA 2XAQB 3EUHA 4TX5A 2FBWA 5EK4A 3HL6A 4JI8T 5HWXA 3AE9A 4ZI2C 1OEDB 2H7VC 1JNZA 5AQRB 5HEJA 1G8XA 2CHOA 2X9HA 3OYXA 3B5MA 4TN7B 1HF8A 4BAYB 3KV4A 4DVDA 3ZJ1A 3E08A 5JR9A 2YDRA 1GQEA 1SUMB 1W9RA 4E7ZA 3IHRA 2LHRA 3ZYLA 4WNKA 4EEDA 1NENA 4QX7B 4E7SA 4MFRA 3O1HA 5AQFB 2CHNA 1FJGT 4O4LE 3Q5EA
chains in the Genus database with same CATH topology
3FZFB 1M7KA 4HWHA 5AQMB 5AQRB 5AQVB 5AQJB 5AQTB 4HWDA 3FZMB 5AQHB 5AQLB 4HWCA 1HX1B 1I6ZA 5AQKB 5AQGB 3FZLB 5AQOB 3M3ZB 3A8YC 5AQUB 3FZHB 3LDQB 5AQNB 1M62A 3FZKB 4HWIB 5AQQB 1UK5A 5AQFB 4HWFA 5AQPB 5AQIB 2D9DA 5AQSB 1UGOA 1T7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZF B;  1M7K A;  4HWH A;  5AQM B;  5AQR B;  5AQV B;  5AQJ B;  5AQT B;  4HWD A;  3FZM B;  5AQH B;  5AQL B;  4HWC A;  1HX1 B;  1I6Z A;  5AQK B;  5AQG B;  3FZL B;  5AQO B;  3M3Z B;  3A8Y C;  5AQU B;  3FZH B;  3LDQ B;  5AQN B;  1M62 A;  3FZK B;  4HWI B;  5AQQ B;  1UK5 A;  5AQF B;  4HWF A;  5AQP B;  5AQI B;  2D9D A;  5AQS B;  1UGO A;  1T7S A; 
#chains in the Genus database with same CATH topology
 2WZI A;  3JAD A;  2X9Y A;  4IE6 A;  1S35 A;  4I43 B;  2WP9 A;  2A9U A;  2UXX B;  2DLR A;  3LDQ B;  4A56 A;  5L3F B;  2JMK A;  4YJ3 E;  2CA5 A;  1M7K A;  3HKC E;  4ZOL E;  2LE8 A;  4CI1 B;  3P7I A;  3QUJ A;  3H3A A;  3PJA J;  2XQ4 A;  3HKB E;  4B3S T;  5F8P A;  4QHO A;  1XMO T;  1E7P A;  5L4H A;  1O3X A;  3AE6 A;  5FY1 A;  1LVF A;  3KBT A;  3OYZ A;  1ZV4 X;  3F31 A;  3P50 A;  3FB2 A;  2E5V A;  1H7C A;  3DJB A;  4CXX A;  4A5X A;  4HFE A;  2E5L T;  4O2A E;  3JC6 C;  4UEM A;  3UU6 A;  3NRY A;  3NKZ A;  2LSY A;  2XAF B;  5LBM A;  3PU3 A;  3C4Z A;  3AE5 A;  5TAO A;  2JQ9 A;  3AA1 B;  5JTG A;  2XQA A;  2ODU A;  2RP4 A;  4Z8X A;  5AQQ B;  4X62 T;  4CI2 B;  3UQ7 A;  3C50 A;  5LA6 E;  1N32 T;  3AEB A;  4P0B A;  3IA3 A;  3UT5 E;  3UUN A;  1YKH B;  3H37 A;  3C51 A;  2WS3 A;  2CM0 A;  3SWH A;  5HXS A;  3RHW A;  2HHH T;  2D0T A;  2W61 A;  3UTK A;  4U7Y A;  5DQV A;  3LK2 B;  2XAH B;  4I55 E;  4ZI3 C;  4KP3 C;  4DR3 T;  4AIS A;  3EI0 A;  2IML A;  2M67 A;  1VRB A;  3RPU A;  3O1I A;  4EGW A;  2N2N A;  3P4W A;  5C3J A;  1WFD A;  4JI0 T;  4JEU B;  4YTN A;  5KDM C;  3D0T A;  3MXZ A;  4O4J E;  3RC3 A;  3CIR A;  4JYA T;  1HX1 B;  4C91 A;  3KFW X;  2XQY A;  1MIY A;  1HNZ T;  2XQ6 A;  4NUV A;  2K48 A;  5JRC A;  5FXV A;  2XAS B;  2KSR A;  3W15 B;  1UCU A;  3AB3 B;  5AQT B;  3TLW A;  2LHN A;  3V5S A;  1YXR A;  4Z91 A;  5FMN A;  4H9S E;  3RIF A;  1IAP A;  3K8P C;  2FJA A;  2VQE T;  4O4I E;  4KUM B;  4QXH B;  2UUA T;  1D0Y A;  4DV2 T;  5L3B B;  4LF7 T;  5HXH A;  2QVA A;  2NTX A;  4QWN B;  1R8I A;  4JI7 T;  1B7T A;  2VB6 A;  5LCY A;  1E2A A;  4ILU A;  3RX6 A;  3MA9 A;  3F57 A;  5JDF A;  3RLF F;  4PAG A;  5LJM A;  2V5D A;  3KIN B;  3T8O A;  4YFS A;  4H9Q C;  3EDU A;  2P9B A;  2KT9 A;  2VKD A;  4ILC A;  3KVA A;  4WYV A;  1ZEE A;  2OV9 A;  4N78 D;  3SOL A;  4IDP A;  3LSV A;  2CLY C;  4KHP T;  4I4T E;  3P4S A;  2X0L B;  2BZB A;  1Y01 A;  5JRC B;  2W67 A;  3IEE A;  1HG5 A;  1T72 A;  4OYK A;  1HG2 A;  2XUE A;  3O9X A;  4YXD A;  4YY3 T;  2HN1 A;  3P4R A;  3UU4 A;  4YTM A;  2BBJ A;  4ZS2 A;  2MBG A;  1HNW T;  2LOS A;  3WAK A;  2UXB T;  2VVS A;  5DQW A;  3B13 A;  2A3D A;  4IE5 A;  3KVB A;  4IDZ A;  4L0R A;  5AQI B;  3UUX B;  2XHE B;  2VQF T;  3FXE B;  2WMN A;  3QNU A;  1ZOY A;  4P0A A;  4JI5 T;  5JVD E;  2WMO A;  2E9X D;  1UX4 A;  2CXD A;  4B3M T;  2W4X A;  4ANJ A;  2GK9 A;  2XY8 B;  1YQ3 A;  2PG8 A;  3AXJ A;  5AFU L;  4PW8 A;  4F8H A;  2FJE A;  2JQQ A;  4IE0 A;  4HFC A;  5L47 A;  3ZC1 A;  3FBL A;  2KWH A;  5ETW A;  1MND A;  2CWO A;  2YDS A;  1I94 T;  1MIW A;  2IW5 B;  2X67 A;  5H6Q B;  2BBH A;  2CLY B;  5KXJ A;  5CB4 E;  3CQX C;  3R84 B;  4H9N C;  2LSG A;  1V9D A;  5AQP B;  1HR0 T;  2EHO D;  4KI0 F;  4YT0 A;  1T7S A;  1VOM A;  4U31 A;  2I6H A;  4YLH A;  4LF4 T;  3ZPO A;  5LG3 A;  2MOZ A;  4NUU A;  4AKI A;  4IE4 A;  5DJQ C;  4PFO A;  1X9B A;  4ZZC A;  3CPZ A;  2BG9 B;  3RQU A;  2VKH A;  1LKX A;  1N36 T;  2WM9 A;  4ZHQ E;  4PJM A;  3RGL A;  2D0U A;  3WAJ A;  2BVL A;  3AXJ B;  4UV9 B;  2LT3 A;  5DAB A;  3OKQ A;  3N9M A;  3PUX F;  2VUR A;  2Y48 B;  4UR9 A;  4DID B;  4JUY A;  1WLX A;  4ZI7 E;  3LG7 A;  3MK7 C;  3O4X E;  5LBQ B;  2QA7 A;  2YDQ A;  2K5B B;  4UEL A;  2Q9Q C;  2ACZ A;  2XM2 A;  3N5L A;  5HCJ A;  4DMW A;  2H88 A;  4QH5 A;  2WSS V;  3FBZ A;  3SS1 A;  4ISS A;  3RH3 A;  1SE7 A;  4QH4 A;  4IST A;  4G63 A;  4CQI A;  4UV8 B;  3VU7 H;  4K0U A;  1D0X A;  2UXN B;  4UXN B;  5FP3 A;  4XBF B;  2DCF A;  2Q9Q A;  4JEH B;  4CN1 A;  4GYR A;  2HH7 A;  2CXF A;  5IYZ E;  3QB5 A;  4Z90 A;  5HXE A;  1N34 T;  3QK6 A;  4LF9 T;  1BR1 A;  3ONJ A;  4WZX A;  1UK5 A;  2LLY A;  3I9W A;  3ZYK A;  2WDV A;  2L9Q A;  3EAB A;  4F6R C;  3ZSS A;  1UX5 A;  1YKE B;  5L4E A;  4AKL A;  2F4V T;  4OK0 A;  4AI6 A;  1XNQ T;  1OED E;  2YK0 A;  1D1B A;  2EHO B;  2V7I A;  2J4G A;  1KNR A;  2XAG B;  4GYS A;  4EIW A;  4IDO A;  3AED A;  4JI4 T;  4B6X A;  2HPL A;  3UUL A;  4HWC A;  4ILA A;  4IIJ E;  2I59 A;  3TLU A;  1CHU A;  5LG4 A;  3AA6 B;  4YJ2 E;  4LFB T;  2BS4 A;  4HN9 A;  5LHH B;  2Z6E A;  4U2Z A;  4YSY A;  4H9O C;  2LM9 A;  2H7O A;  2FJB A;  2Q9Q B;  4DBR A;  5LMU T;  1KEY A;  3NVO A;  5CJ5 A;  4TWD A;  4IRE A;  3GN5 A;  2JPF A;  3EDV A;  3QB5 K;  2DI4 A;  2YKS A;  4GK5 E;  3ETV A;  5BR8 T;  2IHR 1;  3I0O A;  1UUS A;  4DMV A;  4PK6 A;  2A2F X;  5AQK B;  2IAK A;  5FXZ A;  5H6R B;  4U72 A;  5GON E;  2L8K A;  3AAE B;  3PDY A;  5LGN B;  5FVK A;  3AEF A;  4LMJ A;  2X68 A;  5LB7 B;  5E0O A;  2MPK A;  1EZ3 A;  4U33 A;  1FMV A;  4MLK A;  2RPA A;  4PK4 A;  5ABG A;  1NWM X;  2J62 A;  4B3R T;  2H89 A;  3ETU A;  3FZH B;  4JI6 T;  3VRA A;  2XSA A;  1IZN B;  5HWY A;  3BQL A;  2W66 A;  4IT4 A;  4U74 A;  3S4U A;  4AKR B;  4KX6 A;  2NOX A;  5JRE A;  1W09 A;  3ZN0 B;  4GOU A;  3DTO A;  1WYB A;  4AIU A;  2JIW A;  2J1D G;  2HN2 A;  4HE8 A;  3GN5 B;  2WAU A;  2CMR A;  3KV5 A;  1HCI A;  4ZI3 D;  2ZM0 A;  1KF6 A;  5AQL B;  1MMN A;  3AA7 B;  2L3L A;  2LRL A;  2W2U A;  3B57 A;  3CQG B;  5JDH A;  2I0M A;  4AKG A;  2K3W A;  3PJA A;  4DR1 T;  3ZMS B;  1MIV A;  5FYM A;  2XTL A;  3HA4 A;  2PBI A;  5EK3 A;  5AQS B;  4I50 E;  3RRC A;  3SRZ A;  5JDN A;  3H3M A;  4DR6 T;  4JLE A;  1XWM A;  2SPC A;  2A72 A;  3PUW F;  5L3E B;  2UUC T;  2VVN A;  3M65 A;  4DR2 T;  5JDM A;  2ZMA A;  4IDQ A;  4GIW A;  2XQ3 A;  5LGT B;  2X9W A;  2CBI A;  1D1A A;  2E2A A;  4CZZ B;  2B1E A;  3LK4 2;  1QLB A;  2ZM6 T;  2IDO B;  2HPJ A;  3O1J A;  4IGU A;  5AQO B;  3RKO A;  1DU2 A;  2M6I A;  3T1Y T;  5FXX A;  3I1A A;  2YEV C;  2YU1 A;  2DWK A;  4LML A;  2XSB A;  3LFM A;  5JQG E;  3QC9 A;  4DR4 T;  3P8C D;  1ZHC A;  1XDO A;  4LFC T;  3VR8 A;  3G06 A;  4DR7 T;  3ZEF B;  4O2B E;  4DV6 T;  3Q5D A;  4LF6 T;  1JNR A;  4BA9 A;  4CXW A;  4XZC A;  5FY7 A;  3RRW A;  2DHR A;  2WU2 A;  2NTY A;  4M1P A;  4A97 A;  4X20 E;  4TV8 E;  3NBX X;  5HYA A;  2WDQ A;  4G2A A;  1X79 A;  4PFP A;  2V7L A;  2KIN B;  3FZM B;  1VCS A;  3U78 A;  4GKK T;  1I6Z A;  4JBW F;  2LKG A;  1S94 A;  4WBO A;  4AXP A;  3OTO T;  2DNX A;  4I0U A;  3N9N A;  2BG9 C;  5AQM B;  1Z0P A;  2XQ9 A;  3CKD A;  3KV9 A;  3C4X A;  3ZMV B;  2UU9 T;  5IWA T;  3C98 B;  2FUP A;  4H63 V;  1M62 A;  3RIA A;  1WR6 A;  4EAH A;  2QRX A;  4HFH A;  4ZZB A;  3HI2 A;  5LGU B;  3C64 A;  1FMW A;  4DND A;  3ESL A;  3RF1 A;  3RC8 A;  2BG9 A;  1KFY A;  2KZ7 B;  2XZE A;  1ZKE A;  3M3Z B;  2N1G A;  4H9P C;  3AEC A;  3JAF A;  2LM2 A;  2BS2 A;  5FL1 A;  3CK6 A;  4HGA A;  2AXD S;  3VHL A;  1W0A A;  1E1H B;  1US7 B;  2WZH A;  3RYI E;  5FVL A;  3Q2M A;  2MYS A;  2Y8D A;  3EAM A;  2VWA A;  2E9X C;  3PUG A;  3ZLI A;  3K3Q C;  1HFA A;  3A8Y C;  4MBQ A;  1W0B A;  4DV3 T;  4U3C A;  2MTQ A;  4HFI A;  5EZY E;  1HS7 A;  3IF8 B;  3RKG A;  1HNX T;  1WCR A;  4L5G A;  4YHH T;  3CQC B;  1MMA A;  4HWD A;  5IUX A;  3N2K E;  4A98 A;  3AE2 A;  4QXC B;  2E9X A;  4TWF A;  3SFD A;  3K3N A;  3PUV F;  3BK9 A;  2IUB A;  4TNW A;  1MMG A;  1SA0 E;  2X0H A;  3X1D A;  2ODV A;  1NEK A;  3PUS A;  5ABE A;  1WRD A;  3P4P A;  4QX8 B;  5LNK A;  2EHO C;  1IJ5 A;  2K9A A;  4JV5 T;  3I0Q A;  3RIU C;  5IHY A;  2KMF A;  4L9I A;  2WBL A;  1IBL T;  4CI3 B;  1U4Q A;  1XZY A;  1OWA A;  2VK9 A;  3PUA A;  3ABV A;  4QH1 A;  3ANW A;  4AQG A;  4QXB B;  2EHO A;  4HFB A;  4NXN T;  5FL0 A;  1Y64 B;  4PJJ A;  3RIU A;  2R6G F;  3ZT6 A;  3N9L A;  2NWB A;  2WDR A;  3VRB A;  2CRB A;  3HKE E;  1QUU A;  3WI3 A;  2PTF A;  3AE3 A;  4O8S A;  4OYJ A;  5JDQ A;  2ZM2 A;  2E9X B;  4EEB A;  5ABH A;  3NWI A;  4P1N A;  3IBP A;  3PUR A;  1D0Z A;  5C2T A;  1FEW A;  4TNV A;  1AJ3 A;  3NZQ A;  2VL0 A;  3N2O A;  3FZK B;  3MAC A;  3PTR B;  4HWI B;  1L0V A;  2H3R A;  3LBX A;  3UUB A;  3J9X 1;  2BS3 A;  3FXD B;  4ZI2 D;  4XAX B;  5LXT E;  2Y6X A;  4TWH A;  3AVS A;  1N33 T;  4ASK A;  1WYC A;  2ES0 A;  4K0K T;  3NZP A;  4AKH A;  4BJN A;  2KLQ A;  4YHJ A;  4BJM A;  3ZMZ B;  1Z8U A;  4J2C A;  3HR0 A;  2RA1 A;  3LK3 B;  3UQ4 A;  3N9Q A;  3ZCI A;  3RI5 A;  4EZH A;  4B3T T;  4C90 A;  2V8S V;  4UVA B;  3I9Y A;  3R6N A;  2JQK A;  5JDG A;  3ANW B;  4TV9 E;  3OPC A;  4CN4 A;  4QKN A;  3P4Q A;  4UVB B;  5ABF A;  2ACX A;  4UF0 A;  2VL8 A;  3E22 E;  4DV0 T;  1HTJ F;  3VKH A;  2M6B A;  4UIG A;  2LRK A;  3ZC0 A;  3OVU A;  4GK0 E;  2E8I A;  2CEA A;  3LJC A;  1XNR T;  2G0U A;  3BQK A;  3KV6 A;  3LBX B;  3PUY F;  3K1S A;  2LKH A;  5C8Y E;  3UU5 A;  3VKG A;  2CCQ A;  3ZT5 A;  4EV6 A;  4YSZ A;  3V5U A;  5AQU B;  4JI1 T;  2W63 A;  2C5I T;  3DP7 A;  4OX9 T;  2V1D B;  3AEG A;  2CXL A;  2D5U A;  2LOP A;  3AA0 B;  5AQJ B;  4HEA A;  2WQY A;  2OA5 A;  3CX7 B;  5BMV E;  1IJ6 A;  1KK7 A;  3PE0 A;  5M4Y A;  5FXW A;  4IL9 A;  3OJA A;  3ZMT B;  2UXD T;  1T98 A;  2DWG A;  5ADX L;  1VCT A;  1KNP A;  3UU8 A;  3AVR A;  4EOZ B;  4KHZ F;  2YU2 A;  3N9P A;  4OHF A;  3JC6 D;  2NW9 A;  2C0S A;  3FHN A;  2V26 A;  4IHJ E;  5ABF B;  5L3G B;  5JR9 B;  2CPT A;  3UFG A;  4TUY E;  2KND A;  3Q5X A;  5JDL A;  4HKA A;  4UF0 B;  4DV5 T;  5J0Z A;  3ZMU B;  2JQH A;  1YD8 G;  1XMQ T;  2V7M A;  2X0Y A;  3GMI A;  2KWI B;  5FNV E;  4X66 T;  5FY0 A;  5HAX A;  3MKD A;  3Q5W A;  3AE8 A;  4HTE A;  5HEU A;  5LOV E;  4V1A v;  3U3I A;  5J1G A;  2W00 A;  3TLV A;  3PV0 F;  2BKO A;  3RYC E;  2JMH A;  3JAE A;  2NW7 A;  2QYW A;  2V7J A;  2YOE A;  4YTP A;  4Q25 A;  2IC9 A;  2C5K T;  2LSK A;  4LFA T;  4U2Y A;  5HEO A;  4EYY R;  4HWF A;  1IBK T;  5L3C B;  4GKJ T;  2XAJ B;  4P09 A;  3CX6 B;  5HEH A;  1LVK A;  3RYH E;  4NIQ A;  2CE7 A;  2V7K A;  4FJO A;  3VR9 A;  1IBM T;  4AQF C;  2LSJ A;  2KXP B;  5F3J A;  2BVM A;  2XQ5 A;  2XQ7 A;  4DO0 A;  4U7I A;  2V6X A;  2AE9 A;  1OXZ A;  4UVC B;  2B76 A;  4HFV A;  2WY2 A;  1J5E T;  4KBM B;  1D1C A;  5LP6 E;  4AQF A;  3CVR A;  4AQY T;  4ZXL A;  4LF8 T;  1U5P A;  3A7M A;  2WWV A;  3MJX A;  3ONL C;  2NW8 A;  4LMK A;  2BKN A;  3KBU A;  4X1K E;  2YIN A;  2V6Y A;  4EZ4 A;  4IL4 A;  3HKD E;  3PU8 A;  5EK2 A;  2CBJ A;  3KDS E;  5CA0 E;  3RQW A;  3CWZ B;  3OBV E;  2LJL A;  3UFE A;  1J5W A;  4KMC A;  1FIO A;  4EB6 E;  4DV7 T;  3PUZ F;  2N9D A;  4PK5 A;  5CFB A;  2JJ9 A;  1UUR A;  3CML A;  4DBQ A;  5L2L A;  3AE1 A;  1UGO A;  3FZF B;  4DUY T;  1SHZ C;  2WWU A;  2BDE A;  5HXR A;  4EXT A;  3N9O A;  4NPP A;  2JRK A;  2NP9 A;  4X64 T;  2IIU A;  5AQV B;  3K3O A;  1YQ4 A;  2WU5 A;  4DR5 T;  3RYF E;  2XPK A;  2V6Y B;  2V5C A;  3C4W A;  2MAW A;  3TLT A;  3A5X A;  2FJD A;  2LSI A;  3N2G E;  2K24 A;  2WB5 A;  2D9D A;  2X9X A;  4HFD A;  2D2S A;  5LHG B;  3BQI A;  4ERR A;  3CX8 B;  3GA8 A;  3ZN1 B;  1MNE A;  4ADZ A;  4YSX A;  4MAL A;  4WW0 A;  1ZP0 A;  4IE7 A;  3UUM A;  5HCM A;  4JI3 T;  5LYJ E;  4X5T A;  1HX8 A;  3FZL B;  5J2T E;  3ZT7 A;  1BR2 A;  1MMD A;  4CXY A;  3JCF A;  4JI2 T;  3TLS A;  1BR0 A;  3ZJ2 A;  3ZCJ A;  3ONX A;  1G73 A;  3E0Z A;  3AEE A;  4DV1 T;  3T1H T;  2W0G A;  2XJ7 A;  2CWY A;  5CA1 E;  4X1Y E;  5CGM A;  2DL1 A;  5LHI B;  1BR4 A;  2ZLY A;  1LRZ A;  3F2E A;  2C5J A;  5LMN T;  3L09 A;  1YW0 A;  1XDP A;  2W62 A;  4PJL A;  3UU3 A;  5A1L A;  3GWH A;  4DV4 T;  2ZM8 A;  1KNZ A;  3AE7 A;  4NXM T;  1OED C;  2WCA A;  2YN6 A;  4EYU A;  2UUB T;  4LF5 T;  3NRX A;  5J2U E;  5LJN A;  3ZYM A;  5HEG A;  5JH7 E;  3EHZ A;  2VKJ A;  4IDN A;  2OLT A;  3MZK B;  4MHC A;  5AQG B;  4DUZ T;  5AQN B;  3L39 A;  5FKY A;  1OED A;  4FI5 A;  5KMG P;  4X1I E;  4OFZ A;  1T8B A;  2BG9 E;  2LEH A;  4HWH A;  4TZ4 C;  5KX5 E;  3PUQ A;  1CUN A;  3ZKR A;  2BKP A;  3AE4 A;  4X65 T;  5L3D B;  2VKO A;  4PJN A;  2Q9Q D;  3L8R A;  2UXC T;  3QOF A;  5HXC A;  4PNI A;  3ZST A;  4H9R C;  5AQH B;  1J1J A;  2X66 A;  3AAI A;  2XQ8 A;  3L3P A;  4ZS3 A;  2QGS A;  4H63 H;  4CN6 A;  2XM1 A;  5F5W A;  3EVY A;  3AEA A;  3J7Y q;  2VAS A;  4ILB A;  2IC6 A;  2PFV A;  3TKL B;  2NR4 A;  3AAA B;  2X51 A;  3SFE A;  4O4H E;  1NAF A;  1QSD A;  4COF A;  2J47 A;  1WR0 A;  3Q9D A;  4WBN E;  5JR9 C;  4ZEY A;  2PJQ A;  2XAQ B;  3EUH A;  4TX5 A;  2FBW A;  5EK4 A;  3HL6 A;  4JI8 T;  5HWX A;  3AE9 A;  4ZI2 C;  1OED B;  2H7V C;  1JNZ A;  5AQR B;  5HEJ A;  1G8X A;  2CHO A;  2X9H A;  3OYX A;  3B5M A;  4TN7 B;  1HF8 A;  4BAY B;  3KV4 A;  4DVD A;  3ZJ1 A;  3E08 A;  5JR9 A;  2YDR A;  1GQE A;  1SUM B;  1W9R A;  4E7Z A;  3IHR A;  2LHR A;  3ZYL A;  4WNK A;  4EED A;  1NEN A;  4QX7 B;  4E7S A;  4MFR A;  3O1H A;  5AQF B;  2CHN A;  1FJG T;  4O4L E;  3Q5E A; 
#chains in the Genus database with same CATH homology
 3FZF B;  1M7K A;  4HWH A;  5AQM B;  5AQR B;  5AQV B;  5AQJ B;  5AQT B;  4HWD A;  3FZM B;  5AQH B;  5AQL B;  4HWC A;  1HX1 B;  1I6Z A;  5AQK B;  5AQG B;  3FZL B;  5AQO B;  3M3Z B;  3A8Y C;  5AQU B;  3FZH B;  3LDQ B;  5AQN B;  1M62 A;  3FZK B;  4HWI B;  5AQQ B;  1UK5 A;  5AQF B;  4HWF A;  5AQP B;  5AQI B;  2D9D A;  5AQS B;  1UGO A;  1T7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...