1YW0A

Crystal structure of the tryptophan 2,3-dioxygenase from xanthomonas campestris. northeast structural genomics target xcr13.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
262
structure length
243
Chain Sequence
TYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophan 2,3-dioxygenase
publication title Crystal structure of the tryptophan 2,3-dioxygenase from Xanthomonas campestris. Northeast Structural Genomics Target XcR13.
rcsb
source organism Xanthomonas campestris pv. campestris str. atcc 33913
molecule tags Oxidoreductase
total genus 82
structure length 243
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yw0A00
2V7MA 2X67A 2NWBA 3E08A 4U74A 1ZEEA 2NW7A 4U72A 2D0TA 4PK6A 2V7KA 2NW8A 2D0UA 2NW9A 4PK5A 2X68A 3BK9A 2V7JA 1YW0A 2NOXA 2V7LA 5EK3A 2V7IA 4HKAA 4PW8A 5EK4A 5ETWA 5EK2A 2X66A
chains in the Genus database with same CATH superfamily
1BR4A 3ZC1A 1GQEA 1KEYA 3QNUA 3E0ZA 4DV5T 5LGUB 1KNPA 3MK7C 2LE8A 4BJMA 5FP3A 4J2CA 5IHYA 3ZSTA 5CA1E 4G2AA 4PJNA 1I94T 3E22E 4LFBT 2VL8A 3VRBA 2V7JA 2V7LA 5L4EA 3PUGA 3RI5A 1D0XA 4PW8A 2FJDA 1YKHB 4KUMB 3PUWF 3RYIE 1WCRA 2PJQA 4MFRA 5FNVE 4NUVA 5HCJA 3ZT5A 1V9DA 1FJGT 3FHNA 4LF7T 4YHHT 3SFDA 2UXCT 2QYWA 2DWKA 2CWOA 1XDOA 4MLKA 3JC6D 1EZ3A 4LF5T 1NENA 1IAPA 3B5MA 5L3DB 2MPKA 4ISSA 3C64A 4YTPA 4C90A 3EDVA 5AQKB 2V7IA 2V6YA 5IYZE 4A97A 2WU2A 4UV8B 2LSGA 5AQOB 4ADZA 4LF6T 4NUUA 1HX8A 4JI5T 2IW5B 2YU2A 4CI2B 3IA3A 4U33A 3Q5XA 2QA7A 4H63V 2WWVA 5AFUL 4BJNA 4I4TE 5AQRB 4LF9T 1SHZC 2XM1A 4KBMB 3UUBA 2JMKA 5C2TA 2BG9B 5EK4A 3UQ4A 4EYUA 3CK6A 4DR3T 5AQIB 3FB2A 3EI0A 2CHOA 1QSDA 2K3WA 3AE6A 4TX5A 1XMQT 1HG5A 1VCTA 5ABFA 3EDUA 5L3EB 3JAEA 2V6XA 4AIUA 3N9PA 4TN7B 2OA5A 5JDLA 2M67A 5ETWA 3VRAA 5AQPB 1Y01A 3TLUA 5JTGA 3ZYMA 4UVAB 2JIWA 4AQFA 3WI3A 2MOZA 2NW7A 2FBWA 4PK6A 5L3BB 5HEHA 4X20E 1MMNA 4ZXLA 2D9DA 1HFAA 1OWAA 4HWCA 2ZLYA 5IWAT 3CX8B 3OYZA 2VK9A 3JADA 4DNDA 2W67A 1QUUA 4X1KE 5JDQA 5FVKA 4IGUA 1HS7A 4ZS3A 5L47A 4DV2T 4GYRA 4ZZCA 2Y48B 3QUJA 4JLEA 1I6ZA 1VOMA 2AXDS 5LP6E 4WW0A 4X1YE 1OEDE 1D1BA 2EHOB 3MACA 1WRDA 4EOZB 4DV6T 2LRKA 2YDRA 3RKOA 5AQHB 3RLFF 5CB4E 4KX6A 3AAIA 3Q5WA 3P4SA 1YQ4A 3P4RA 4TV9E 4DV0T 5HXCA 3AVRA 3AEAA 1IBKT 2FJAA 5F8PA 3L09A 4IE0A 2BKPA 3UFEA 2WS3A 3I0QA 4YFSA 3UU8A 2UXDT 4HFEA 1X9BA 2XSAA 1VCSA 2L3LA 2PTFA 2V26A 2ZM2A 1D0ZA 3S4UA 1T98A 1HCIA 2CBJA 5JDNA 3T1HT 3RIUA 1OXZA 3UTKA 3CWZB 2XQYA 2UUBT 2XPKA 4JYAT 4A56A 3RYFE 4AKGA 1UURA 4PJLA 2W4XA 2N9DA 4HFBA 2Q9QC 4H9SE 5BR8T 4WBNE 4JEUB 4Z90A 3ZYKA 3QB5K 4ZI2C 4H9RC 3K8PC 4C91A 2YK0A 4L0RA 5CA0E 5FXWA 4DR1T 2KMFA 3PU3A 4Z91A 2ES0A 2YDQA 3ZSSA 3KV6A 2VKHA 2WDVA 4KP3C 4NIQA 2X51A 4PNIA 5L3GB 4M1PA 3HA4A 3P7IA 2J4GA 1WYCA 4CN4A 1SUMB 4A98A 4TNWA 4NPPA 5HYAA 3V5UA 2JJ9A 4XZCA 2CXLA 1E7PA 2W00A 2JQKA 5AQQB 3E08A 3PUYF 3PE0A 3VHLA 3SWHA 4H9PC 2C0SA 1E2AA 1W0BA 4F6RC 2CA5A 4JI6T 2IMLA 4NXNT 1Y64B 4AQGA 3LG7A 3AVSA 4EIWA 4HFVA 4E7SA 3EAMA 1N33T 4HE8A 4YSZA 1US7B 2CE7A 1WR0A 5LG4A 2V5DA 2SPCA 5M4YA 4AKHA 1SA0E 3AE8A 2VQFT 3AA7B 5LJMA 1U4QA 1IBLT 4FJOA 4IREA 5FYMA 5H6QB 3T8OA 5AQLB 4PJJA 5H6RB 2UXBT 1W9RA 4HN9A 1HR0T 2E9XA 3O1HA 2WSSV 4HTEA 2X67A 2KINB 4U31A 2XAFB 5FMNA 2NTYA 3RF1A 5LMUT 3KBUA 1UGOA 4UXNB 1J1JA 4OK0A 5CJ5A 3L8RA 1WYBA 5FKYA 3N2OA 4TUYE 1HG2A 4UF0A 3AEBA 5FY7A 3C98B 3KV4A 2V6YB 2Y8DA 3I9YA 1YW0A 4IDQA 3VR9A 1O3XA 3Q5DA 1ZP0A 3C4WA 5LB7B 3RKGA 4JV5T 1D1AA 4U72A 3O4XE 4PK4A 2I0MA 2UXXB 3AEFA 2HN1A 2VURA 2YEVC 5C8YE 2WZIA 1IBMT 1AJ3A 4YHJA 2CXDA 3AE9A 3T1YT 1G73A 2LOSA 4EGWA 3ZJ1A 5ABFB 2JMHA 4K0KT 3N2KE 2YU1A 3AAEB 3BK9A 4JUYA 2JQHA 1UK5A 2X66A 3FXEB 2BG9C 4YXDA 3IF8B 4HEAA 1XMOT 4H9OC 2XAGB 2DLRA 5JH7E 4X64T 4IIJE 4ANJA 3NKZA 2X68A 3UU3A 4O4JE 3ETUA 3F57A 4YTMA 3KFWX 4TZ4C 2JPFA 5LBMA 4ASKA 5LHGB 3LK2B 4V1Av 4N78D 2HHHT 2XQ9A 5LJNA 3LFMA 4LMLA 2XQ6A 2XJ7A 3AA1B 1ZKEA 2E9XD 4I55E 5LNKA 3UUMA 3N5LA 1KF6A 4HWFA 5L3CB 5JREA 1MNDA 2XAHB 3TLWA 2NR4A 3RYHE 2W2UA 3UU4A 2A3DA 2NW9A 2CHNA 3PJAJ 3R84B 4QX8B 5F3JA 3LK3B 3FBLA 2DI4A 4QX7B 4KHZF 3CMLA 5HXSA 4E7ZA 2PFVA 4P1NA 3AEDA 1D1CA 2EHOC 1MMDA 4PJMA 3UQ7A 3PURA 3N9QA 3VKHA 4GYSA 2PBIA 5EK2A 1MMGA 4LMKA 2XQ3A 5AQJB 4YSYA 4CXYA 3RYCE 2VQET 1IJ6A 3AA0B 3TLVA 4ISTA 3PUSA 3BQLA 3OKQA 4YTNA 4PFOA 3RRCA 3KVAA 2LSIA 3B13A 3FZMB 2XY8B 3QK6A 1H7CA 3VKGA 1CUNA 4EEBA 2HN2A 2YINA 2W61A 3OVUA 3SFEA 4DIDB 3P4QA 2J47A 4AKLA 2KT9A 3RIAA 4U7YA 3PTRB 1N36T 2D0TA 2YOEA 4CXWA 3NVOA 4COFA 2VWAA 3DP7A 5FY0A 3UULA 3EVYA 4DBRA 3A7MA 3B57A 4ZEYA 2D5UA 1B7TA 2CRBA 2MAWA 4YLHA 3PUAA 3KDSE 2LOPA 3SRZA 3GWHA 1QLBA 3JC6C 4NXMT 5JR9A 1WR6A 1LKXA 5LA6E 3O1IA 2E5VA 2X9YA 3EABA 4EAHA 1J5WA 2XAQB 2WM9A 2I59A 2LM9A 2W62A 2IHR1 1LVKA 3NBXX 2A9UA 2X9HA 5LXTE 1XNRT 3Q2MA 5JQGE 5FL1A 5FXXA 2XASB 4O4HE 2UUCT 5EZYE 2A2FX 1MNEA 4PAGA 2CMRA 2WCAA 1J5ET 2BG9E 2J1DG 4IHJE 4EZ4A 3OPCA 3AECA 5AQMB 5LHIB 2F4VT 2WU5A 4HKAA 4DR6T 2K9AA 4OFZA 4B3RT 4JI4T 4HGAA 4DUYT 4AQYT 2DHRA 5DABA 3L3PA 4U7IA 2E9XB 3FZHB 3UFGA 3AXJA 3ZC0A 4XAXB 2X0LB 5F5WA 1OEDA 2ZM6T 5L3FB 2AE9A 2CCQA 4GKJT 3FXDB 4G63A 2CPTA 2LEHA 3CQCB 1T72A 5LG3A 3KV5A 5CFBA 2R6GF 5AQSB 3NRYA 2XM2A 4UF0B 4X62T 4P0BA 4LMJA 3A8YC 3HI2A 2X0HA 1ZEEA 2XQ8A 3ABVA 5DQWA 4GOUA 4EXTA 2M6IA 2LKHA 3UT5E 2W66A 3O9XA 5GONE 2KWIB 2XUEA 3F2EA 4OX9T 3AB3B 2E5LT 3LDQB 2IC6A 5A1LA 3IHRA 3FZFB 1MIYA 3MXZA 4JI2T 3AE3A 4ILUA 3ZJ2A 2MBGA 3NWIA 4U2YA 3R6NA 1E1HB 5JVDE 3IBPA 1BR1A 3SOLA 4LF8T 2E2AA 2LSYA 4QXBB 4L5GA 1YKEB 4ERRA 4A5XA 4B3MT 2YKSA 5BMVE 2LHNA 1ZHCA 2RP4A 2Y6XA 1S35A 3A5XA 3M3ZB 4DR2T 3ZPOA 1G8XA 3LJCA 5KX5E 3K1SA 4CQIA 3P50A 4ZI7E 5AQUB 3VR8A 3NRXA 4DMVA 1KK7A 4DR4T 2LT3A 1S94A 1MIVA 2KSRA 2FJEA 4ZS2A 4X66T 3N9LA 3C4ZA 1SE7A 3I1AA 3RC8A 5HXEA 1UX5A 3EUHA 3U78A 2V7MA 4F8HA 1FMWA 2XHEB 4AQFC 3N9MA 1IJ5A 4WNKA 3HKBE 2WZHA 1XZYA 4QKNA 4HFHA 4MBQA 3LBXA 4BA9A 1X79A 3KVBA 2WMNA 4IDNA 3SS1A 2LRLA 5HWXA 2MYSA 2NW8A 3GMIA 4LF4T 2L9QA 4X5TA 1M7KA 4X1IE 4CXXA 1MMAA 3AEGA 2B1EA 2VKJA 3AA6B 3I9WA 2I6HA 3N9NA 4DBQA 2QRXA 2FUPA 1W0AA 3W15B 1N34T 3U3IA 5KXJA 3UU5A 3ETVA 3HR0A 3RGLA 3I0OA 4EYYR 4JI3T 3UUNA 3RPUA 4KI0F 2CM0A 3MKDA 4HFIA 5JRCA 3ESLA 4O4IE 1UX4A 2CLYB 3C50A 5L2LA 5TAOA 3Q5EA 5J2TE 2K24A 2RPAA 3PUZF 5HWYA 3M65A 3ZMVB 2C5KT 2WAUA 5HXHA 4HFCA 3J7Yq 3K3QC 3RIUC 4YJ2E 3AE7A 4PK5A 1HNWT 1FEWA 2H3RA 2JQQA 3P4PA 3CPZA 5ADXL 2H7OA 2JQ9A 2BBHA 4EB6E 2P9BA 5AQFB 5JR9B 2C5JA 4IL4A 3ANWA 3ZMTB 3ONLC 2WB5A 2WMOA 3ZCJA 2QVAA 3H3AA 4K0UA 4WZXA 4CZZB 3C4XA 2QGSA 4EEDA 1W09A 2CWYA 2H7VC 2IC9A 2BS2A 3ZT6A 3OJAA 4TWHA 2WBLA 3PDYA 2NWBA 4IT4A 3FZKB 4JI8T 4UVBB 1XDPA 3K3OA 4QXHB 3MJXA 3PUXF 3H37A 2NTXA 4HFDA 2Q9QA 5CGMA 4P0AA 1T8BA 1YXRA 4IDZA 4IL9A 2UUAT 2BS4A 1BR0A 2LHRA 4UVCB 4H9QC 2HH7A 3AE1A 4ILBA 3WAJA 2K5BB 4JEHB 3AE2A 1T7SA 4OHFA 5HEUA 4UV9B 4I43B 1ZOYA 3H3MA 2K48A 4XBFB 3GN5A 1KNZA 5KMGP 2D0UA 2WWUA 3ZYLA 3AXJB 1HTJF 1OEDB 2GK9A 2ODUA 4TWFA 4TNVA 5C3JA 5J2UE 3ZN1B 4AISA 2BDEA 4PFPA 1WLXA 2X0YA 1HX1B 3AE4A 5FL0A 2W0GA 4JBWF 2UXNB 4TV8E 2CEAA 2LJLA 2KZ7B 4YSXA 5ABEA 2E9XC 3P4WA 4IE5A 1MIWA 4I50E 4ZI3D 3WAKA 1YQ3A 1Z0PA 4LFCT 2ODVA 1FMVA 4GKKT 3CQXC 3MZKB 2LKGA 4DMWA 3N2GE 3CX6B 4ZOLE 1NEKA 3PJAA 5JDGA 2NOXA 2KWHA 5FXZA 2XTLA 5LBQB 4UELA 4UIGA 4AI6A 3ZLIA 1HF8A 2Z6EA 4CN1A 3RQUA 4ZHQE 2ZM8A 3ZN0B 2NP9A 2VKOA 5LHHB 4ILAA 4O4LE 3QB5A 3KINB 5JDMA 3OYXA 2IDOB 3ONXA 2BS3A 4OYJA 5IUXA 3AEEA 2RA1A 1UCUA 4EV6A 4KMCA 4O2BE 2J62A 4FI5A 2Q9QD 4B6XA 2M6BA 4HWHA 3LSVA 2YN6A 3K3NA 4EZHA 4ZI2D 1Z8UA 1LRZA 2WDRA 4YY3T 2CXFA 4IE6A 2C5IT 4QH5A 2VL0A 5FXVA 3UU6A 4MHCA 1JNRA 2DNXA 3KBTA 4U3CA 2WDQA 3ZT7A 2XQ5A 4HWDA 4HWIB 4ZI3C 2OV9A 2PG8A 3P8CD 3F31A 1KNRA 2VKDA 3ONJA 5J1GA 2V7KA 3LBXB 4I0UA 5HXRA 3IEEA 1IZNB 1N32T 4B3ST 2X9WA 4ZZBA 5ABHA 3TLSA 5HEGA 3ZEFB 3Q9DA 2H89A 4UR9A 2BBJA 4MALA 3HKEE 3OBVE 5HEOA 3GA8A 4LFAT 4DR7T 1R8IA 3JCFA 5AQGB 3FZLB 2XQ4A 4JI7T 3QOFA 2XSBA 4GK0E 1U5PA 3ZMSB 2ZM0A 2BG9A 2DL1A 2V8SV 3O1JA 2HPLA 2W63A 3EHZA 2KLQA 2L8KA 2BKOA 4CI3B 2D2SA 2VVSA 3RC3A 4IE7A 4ILCA 5LGNB 2LSKA 2G0UA 2XZEA 3TLTA 5HAXA 5L4HA 5LGTB 4UEMA 2WQYA 1D0YA 2B76A 2CBIA 3RIFA 2E8IA 2IAKA 2V1DB 5JRCB 4JI1T 1BR2A 3CVRA 1ZV4X 3ZKRA 5FY1A 1L0VA 1KFYA 5LOVE 1NWMX 3L39A 1HNZT 4DV7T 3X1DA 3UUXB 3DJBA 4U74A 2LM2A 4WYVA 4O2AE 3RQWA 2N1GA 2A72A 3D0TA 2VASA 3DTOA 3HKDE 3PV0F 2H88A 2FJBA 4P09A 4QH1A 2LSJA 2CLYC 3PUQA 2JRKA 2EHOA 1WFDA 5AQTB 3KV9A 1M62A 1FIOA 1YD8G 2ACZA 3G06A 4CN6A 3V5SA 3ANWB 1XWMA 1NAFA 1HNXT 4DR5T 2XAJB 4B3TT 4CI1B 4YJ3E 2WP9A 4DVDA 3J9X1 1CHUA 5E0OA 4BAYB 4DUZT 4GK5E 2ACXA 5JDHA 2N2NA 5HEJA 4L9IA 2WY2A 4IE4A 4Q25A 4JI0T 3TKLB 5HCMA 1LVFA 2BVMA 5LYJE 3VU7H 1XNQT 2IUBA 4WBOA 5JR9C 4GIWA 1JNZA 2YDSA 3AAAB 3HKCE 5FVLA 4DO0A 3QC9A 5DQVA 2Q9QB 4Z8XA 2KXPB 4U2ZA 4DV3T 4AKRB 4H9NC 1DU2A 1UUSA 2KNDA 4QHOA 4TWDA 2VB6A 3FBZA 4DV1T 5J0ZA 3ZCIA 3JAFA 4OYKA 5AQVB 3N9OA 2VVNA 3CIRA 4DV4T 2MTQA 2DCFA 3GN5B 3OTOT 3BQKA 3PU8A 3ZMUB 3CKDA 5LCYA 2X9XA 4QH4A 2HPJA 2UU9T 3MA9A 2XQ7A 2BKNA 2ZMAA 2XQAA 5EK3A 4KHPT 2OLTA 3NZQA 4AXPA 4IDOA 3CQGB 4QXCB 3RRWA 3BQIA 4X65T 3NZPA 3LK42 3PUVF 3ZMZB 4AKIA 5DJQC 3RH3A 3C51A 2IIUA 3HL6A 1OEDC 4O8SA 2BVLA 5JDFA 3RX6A 4QWNB 2EHOD 4H63H 3CX7B 2LLYA 5ABGA 2BZBA 4IDPA 4YT0A 1VRBA 2DWGA 5LMNT 3RHWA 3AE5A 5AQNB 5KDMC 2V5CA
chains in the Genus database with same CATH topology
1BR4A 1U4QA 4I50E 4ZI3D 3ZC1A 3WAKA 4FJOA 1Z0PA 2CCQA 2ODVA 1FMVA 3FXDB 4G63A 3E0ZA 2LEHA 5LGUB 3CQCB 3CQXC 3MZKB 3KV5A 4DMWA 5FYMA 3MK7C 3N2GE 5H6QB 3T8OA 2LE8A 3CX6B 4ZOLE 4BJMA 4PJJA 5H6RB 2NOXA 5JDGA 3NRYA 5FP3A 2KWHA 4J2CA 5FXZA 4HN9A 5IHYA 4UF0B 2XTLA 5CA1E 2E9XA 3O1HA 4P0BA 5LBQB 4UELA 4UIGA 4AI6A 3HI2A 2WSSV 4HTEA 2X67A 3ZLIA 1HF8A 2KINB 4G2AA 2Z6EA 2XAFB 1ZEEA 4PJNA 5FMNA 2NTYA 5DQWA 4GOUA 4EXTA 4ZHQE 2ZM8A 3E22E 3UT5E 3ZN0B 3O9XA 3KBUA 5GONE 2NP9A 2VL8A 2KWIB 4UXNB 2XUEA 2VKOA 3F2EA 4OK0A 2V7JA 3AB3B 2V7LA 3PUGA 1D0XA 2IC6A 4PW8A 5LHHB 5A1LA 4O4LE 1WYBA 1YKHB 3N2OA 4KUMB 4TUYE 3KINB 3IHRA 5JDMA 3OYXA 1HG2A 1MIYA 3MXZA 4UF0A 3ONXA 3RYIE 4OYJA 5FY7A 2PJQA 4MFRA 2RA1A 1UCUA 3C98B 3KV4A 5FNVE 4KMCA 4ILUA 4NUVA 3ZJ2A 4O2BE 2MBGA 2Y8DA 1V9DA 4FI5A 2Q9QD 4B6XA 3I9YA 3FHNA 3R6NA 1YW0A 3K3NA 1E1HB 1O3XA 5JVDE 3IBPA 4EZHA 1BR1A 3SOLA 2DWKA 2CWOA 3C4WA 4MLKA 3JC6D 4ZI2D 1EZ3A 2LSYA 1LRZA 4QXBB 1D1AA 1IAPA 4L5GA 4U72A 1YKEB 3O4XE 4PK4A 4ERRA 5L3DB 2CXFA 4IE6A 5BMVE 2C5IT 4ISSA 5FXVA 2LHNA 1ZHCA 3C64A 2RP4A 4MHCA 4C90A 2UXXB 2Y6XA 1S35A 2DNXA 3EDVA 3A5XA 2V7IA 3ZPOA 3KBTA 2YEVC 5C8YE 1G8XA 3LJCA 5IYZE 5KX5E 4CQIA 4ZI7E 4UV8B 2LSGA 4ZI3C 4ADZA 1AJ3A 4YHJA 2PG8A 3NRXA 4DMVA 3P8CD 1HX8A 2CXDA 3F31A 4NUUA 2IW5B 2YU2A 1G73A 2LOSA 2VKDA 4CI2B 3ZJ1A 5J1GA 2V7KA 1KK7A 3LBXB 2JMHA 2LT3A 3Q5XA 3N2KE 2YU1A 2QA7A 1S94A 1MIVA 5HXRA 4H63V 3IEEA 4ZS2A 3AAEB 5AFUL 1IZNB 3BK9A 4BJNA 4I4TE 3N9LA 3C4ZA 2X9WA 1SHZC 4JUYA 4KBMB 3I1AA 2JMKA 3RC8A 5HXEA 5EK4A 3ZEFB 3Q9DA 1UX5A 2X66A 4MALA 3FXEB 4EYUA 3EUHA 3U78A 2V7MA 3HKEE 3OBVE 1FMWA 2XHEB 4AQFC 3FB2A 3N9MA 3IF8B 1IJ5A 3GA8A 4WNKA 1QSDA 4HEAA 3HKBE 4TX5A 4H9OC 2XAGB 2DLRA 5JH7E 4IIJE 4ANJA 4QKNA 1HG5A 2X68A 4MBQA 4O4JE 3LBXA 3EDUA 3ETUA 3F57A 5L3EB 3KFWX 3N9PA 4TN7B 4BA9A 1X79A 3KVBA 2OA5A 2WMNA 4TZ4C 5JDLA 2JPFA 2M67A 5ETWA 5LBMA 4ASKA 5LHGB 3LK2B 4V1Av 4GK0E 3SS1A 1U5PA 3ZMSB 4N78D 2ZM0A 3ZYMA 4UVAB 5HWXA 4AQFA 3WI3A 2MYSA 3O1JA 2HPLA 5LJNA 2MOZA 2NW7A 2W63A 4PK6A 2NW8A 3GMIA 3LFMA 5L3BB 2KLQA 4X20E 1MMNA 2L8KA 2L9QA 4X1IE 4CI3B 1HFAA 1OWAA 4CXXA 2D2SA 1MMAA 3RC3A 3AA1B 2ZLYA 4IE7A 1ZKEA 2E9XD 5LGNB 4I55E 5LNKA 3UUMA 2LSKA 3CX8B 2G0UA 2B1EA 3N5LA 3OYZA 2VKJA 2VK9A 5HAXA 3AA6B 5LGTB 4DNDA 5L3CB 5JREA 4UEMA 1QUUA 4X1KE 1MNDA 3I9WA 5JDQA 2XAHB 1D0YA 4IGUA 3RYHE 3N9NA 1HS7A 4ZS3A 4DBQA 2A3DA 2NW9A 2E8IA 4GYRA 2IAKA 2V1DB 5JRCB 2Y48B 3QUJA 4QX8B 3R84B 5F3JA 3LK3B 3FBLA 2DI4A 4JLEA 3W15B 3CVRA 1BR2A 3U3IA 4QX7B 1ZV4X 1VOMA 5FY1A 3ETVA 3CMLA 5LOVE 5LP6E 5HXSA 4WW0A 4X1YE 1NWMX 1D1BA 3HR0A 2EHOB 3MACA 1WRDA 3I0OA 4EOZB 4EYYR 2PFVA 4E7ZA 3UUXB 3DJBA 4U74A 1D1CA 2EHOC 1MMDA 4O2AE 3UUNA 4PJMA 3PURA 3N9QA 3VKHA 2N1GA 2A72A 3D0TA 3RPUA 2VASA 3RKOA 3DTOA 3HKDE 4GYSA 2PBIA 2CM0A 3MKDA 4P09A 5JRCA 3ESLA 4O4IE 1UX4A 2CLYB 3C50A 5CB4E 5EK2A 5L2LA 3AAIA 3Q5WA 1MMGA 5TAOA 2LSJA 2CLYC 5J2TE 3PUQA 4CXYA 2JRKA 3RYCE 2EHOA 4TV9E 5HXCA 2K24A 3KV9A 5HWYA 3AVRA 3M65A 1IJ6A 3AA0B 1FIOA 3ZMVB 1YD8G 2C5KT 5F8PA 3L09A 3V5SA 3ANWB 2WAUA 4IE0A 3UFEA 4ISTA 5HXHA 3PUSA 1NAFA 3I0QA 3J7Yq 2XAJB 3K3QC 4YFSA 3BQLA 3OKQA 4CI1B 4PFOA 4YJ2E 3RRCA 3KVAA 2LSIA 3B13A 4YJ3E 3QK6A 1H7CA 4PK5A 4DVDA 3VKGA 1CUNA 1FEWA 2H3RA 2JQQA 3J9X1 3CPZA 5E0OA 5ADXL 2L3LA 2H7OA 4BAYB 4GK5E 2YINA 2V26A 2ACXA 2W61A 4EB6E 2ZM2A 5JDHA 2N2NA 4L9IA 2P9BA 1D0ZA 4IE4A 3TKLB 3S4UA 5JR9B 1LVFA 2C5JA 2BVMA 4AKLA 5LYJE 3VU7H 1T98A 2KT9A 3ANWA 1HCIA 3ZMTB 5JDNA 5JR9C 4WBOA 4GIWA 2WMOA 1OXZA 3PTRB 3ZCJA 2D0TA 3AAAB 3HKCE 4IE5A 3UTKA 3CWZB 4DO0A 3QC9A 3H3AA 4K0UA 5DQVA 2XQYA 4CXWA 2Q9QB 4Z8XA 4A56A 2VWAA 3DP7A 5FY0A 3RYFE 3EVYA 3UULA 2KXPB 3C4XA 4CZZB 4DBRA 4AKGA 4PJLA 2QGSA 3B57A 2N9DA 4H9NC 4AKRB 2Q9QC 2KNDA 2CWYA 4H9SE 4WBNE 2H7VC 2IC9A 2D5UA 4QHOA 1B7TA 2VB6A 4YLHA 3PUAA 3KDSE 2LOPA 3FBZA 3OJAA 3SRZA 4JEUB 2WBLA 3PDYA 2NWBA 3GWHA 3ZYKA 3JC6C 4ZI2C 4H9RC 5JR9A 3K8PC 1WR6A 1LKXA 4C91A 2YK0A 4L0RA 5CA0E 3ZCIA 4UVBB 5LJMA 3K3OA 4QXHB 5LA6E 4OYKA 3MJXA 5FXWA 3H37A 3N9OA 2NTXA 3O1IA 2KMFA 2Q9QA 2X9YA 2MTQA 2DCFA 3PU3A 4EAHA 3GN5B 2ES0A 4P0AA 3BQKA 3PU8A 3KV6A 2VKHA 2XAQB 2WM9A 2I59A 4IDZA 3ZMUB 3CKDA 2LM9A 2W62A 4KP3C 5LCYA 1LVKA 2X9XA 2X51A 4PNIA 5L3GB 4M1PA 3NBXX 3HA4A 2HPJA 3P7IA 1BR0A 2LHRA 4UVCB 4H9QC 1WYCA 3MA9A 2X9HA 2HH7A 5LXTE 3WAJA 2K5BB 3Q2MA 2ZMAA 5JQGE 5HYAA 4JEHB 3V5UA 5EK3A 2JJ9A 3NZQA 5FXXA 2XASB 4AXPA 4XZCA 4O4HE 2CXLA 3CQGB 5EZYE 4OHFA 2A2FX 1MNEA 4PAGA 4UV9B 4QXCB 2CMRA 4I43B 2W00A 3E08A 3RRWA 2K48A 4XBFB 3GN5A 3PE0A 3BQIA 1KNZA 5KMGP 3VHLA 3SWHA 2D0UA 2WWUA 3NZPA 3ZYLA 2J1DG 3LK42 1HTJF 4IHJE 4EZ4A 3ZMZB 5LHIB 4AKIA 2GK9A 4H9PC 5DJQC 2C0SA 2ODUA 3RH3A 4F6RC 2CA5A 4HKAA 3C51A 5J2UE 3HL6A 3ZN1B 2K9AA 4O8SA 1Y64B 2BVLA 4AQGA 3LG7A 3AVSA 4EIWA 4OFZA 4HFVA 2BDEA 5JDFA 3RX6A 4PFPA 4QWNB 2EHOD 1WLXA 4HGAA 4E7SA 4HE8A 2DHRA 4H63H 1US7B 2CE7A 3CX7B 5DABA 2BZBA 2W0GA 3L3PA 2UXNB 4TV8E 1VRBA 2DWGA 2CEAA 5LG4A 2E9XB 2LJLA 2SPCA 5M4YA 4AKHA 1SA0E 2KZ7B 3ZC0A 4XAXB 2X0LB 2E9XC 5KDMC 3AA7B 1MIWA 5L3FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7M A;  2X67 A;  2NWB A;  3E08 A;  4U74 A;  1ZEE A;  2NW7 A;  4U72 A;  2D0T A;  4PK6 A;  2V7K A;  2NW8 A;  2D0U A;  2NW9 A;  4PK5 A;  2X68 A;  3BK9 A;  2V7J A;  1YW0 A;  2NOX A;  2V7L A;  5EK3 A;  2V7I A;  4HKA A;  4PW8 A;  5EK4 A;  5ETW A;  5EK2 A;  2X66 A; 
#chains in the Genus database with same CATH topology
 1BR4 A;  3ZC1 A;  1GQE A;  1KEY A;  3QNU A;  3E0Z A;  4DV5 T;  5LGU B;  1KNP A;  3MK7 C;  2LE8 A;  4BJM A;  5FP3 A;  4J2C A;  5IHY A;  3ZST A;  5CA1 E;  4G2A A;  4PJN A;  1I94 T;  3E22 E;  4LFB T;  2VL8 A;  3VRB A;  2V7J A;  2V7L A;  5L4E A;  3PUG A;  3RI5 A;  1D0X A;  4PW8 A;  2FJD A;  1YKH B;  4KUM B;  3PUW F;  3RYI E;  1WCR A;  2PJQ A;  4MFR A;  5FNV E;  4NUV A;  5HCJ A;  3ZT5 A;  1V9D A;  1FJG T;  3FHN A;  4LF7 T;  4YHH T;  3SFD A;  2UXC T;  2QYW A;  2DWK A;  2CWO A;  1XDO A;  4MLK A;  3JC6 D;  1EZ3 A;  4LF5 T;  1NEN A;  1IAP A;  3B5M A;  5L3D B;  2MPK A;  4ISS A;  3C64 A;  4YTP A;  4C90 A;  3EDV A;  5AQK B;  2V7I A;  2V6Y A;  5IYZ E;  4A97 A;  2WU2 A;  4UV8 B;  2LSG A;  5AQO B;  4ADZ A;  4LF6 T;  4NUU A;  1HX8 A;  4JI5 T;  2IW5 B;  2YU2 A;  4CI2 B;  3IA3 A;  4U33 A;  3Q5X A;  2QA7 A;  4H63 V;  2WWV A;  5AFU L;  4BJN A;  4I4T E;  5AQR B;  4LF9 T;  1SHZ C;  2XM1 A;  4KBM B;  3UUB A;  2JMK A;  5C2T A;  2BG9 B;  5EK4 A;  3UQ4 A;  4EYU A;  3CK6 A;  4DR3 T;  5AQI B;  3FB2 A;  3EI0 A;  2CHO A;  1QSD A;  2K3W A;  3AE6 A;  4TX5 A;  1XMQ T;  1HG5 A;  1VCT A;  5ABF A;  3EDU A;  5L3E B;  3JAE A;  2V6X A;  4AIU A;  3N9P A;  4TN7 B;  2OA5 A;  5JDL A;  2M67 A;  5ETW A;  3VRA A;  5AQP B;  1Y01 A;  3TLU A;  5JTG A;  3ZYM A;  4UVA B;  2JIW A;  4AQF A;  3WI3 A;  2MOZ A;  2NW7 A;  2FBW A;  4PK6 A;  5L3B B;  5HEH A;  4X20 E;  1MMN A;  4ZXL A;  2D9D A;  1HFA A;  1OWA A;  4HWC A;  2ZLY A;  5IWA T;  3CX8 B;  3OYZ A;  2VK9 A;  3JAD A;  4DND A;  2W67 A;  1QUU A;  4X1K E;  5JDQ A;  5FVK A;  4IGU A;  1HS7 A;  4ZS3 A;  5L47 A;  4DV2 T;  4GYR A;  4ZZC A;  2Y48 B;  3QUJ A;  4JLE A;  1I6Z A;  1VOM A;  2AXD S;  5LP6 E;  4WW0 A;  4X1Y E;  1OED E;  1D1B A;  2EHO B;  3MAC A;  1WRD A;  4EOZ B;  4DV6 T;  2LRK A;  2YDR A;  3RKO A;  5AQH B;  3RLF F;  5CB4 E;  4KX6 A;  3AAI A;  3Q5W A;  3P4S A;  1YQ4 A;  3P4R A;  4TV9 E;  4DV0 T;  5HXC A;  3AVR A;  3AEA A;  1IBK T;  2FJA A;  5F8P A;  3L09 A;  4IE0 A;  2BKP A;  3UFE A;  2WS3 A;  3I0Q A;  4YFS A;  3UU8 A;  2UXD T;  4HFE A;  1X9B A;  2XSA A;  1VCS A;  2L3L A;  2PTF A;  2V26 A;  2ZM2 A;  1D0Z A;  3S4U A;  1T98 A;  1HCI A;  2CBJ A;  5JDN A;  3T1H T;  3RIU A;  1OXZ A;  3UTK A;  3CWZ B;  2XQY A;  2UUB T;  2XPK A;  4JYA T;  4A56 A;  3RYF E;  4AKG A;  1UUR A;  4PJL A;  2W4X A;  2N9D A;  4HFB A;  2Q9Q C;  4H9S E;  5BR8 T;  4WBN E;  4JEU B;  4Z90 A;  3ZYK A;  3QB5 K;  4ZI2 C;  4H9R C;  3K8P C;  4C91 A;  2YK0 A;  4L0R A;  5CA0 E;  5FXW A;  4DR1 T;  2KMF A;  3PU3 A;  4Z91 A;  2ES0 A;  2YDQ A;  3ZSS A;  3KV6 A;  2VKH A;  2WDV A;  4KP3 C;  4NIQ A;  2X51 A;  4PNI A;  5L3G B;  4M1P A;  3HA4 A;  3P7I A;  2J4G A;  1WYC A;  4CN4 A;  1SUM B;  4A98 A;  4TNW A;  4NPP A;  5HYA A;  3V5U A;  2JJ9 A;  4XZC A;  2CXL A;  1E7P A;  2W00 A;  2JQK A;  5AQQ B;  3E08 A;  3PUY F;  3PE0 A;  3VHL A;  3SWH A;  4H9P C;  2C0S A;  1E2A A;  1W0B A;  4F6R C;  2CA5 A;  4JI6 T;  2IML A;  4NXN T;  1Y64 B;  4AQG A;  3LG7 A;  3AVS A;  4EIW A;  4HFV A;  4E7S A;  3EAM A;  1N33 T;  4HE8 A;  4YSZ A;  1US7 B;  2CE7 A;  1WR0 A;  5LG4 A;  2V5D A;  2SPC A;  5M4Y A;  4AKH A;  1SA0 E;  3AE8 A;  2VQF T;  3AA7 B;  5LJM A;  1U4Q A;  1IBL T;  4FJO A;  4IRE A;  5FYM A;  5H6Q B;  3T8O A;  5AQL B;  4PJJ A;  5H6R B;  2UXB T;  1W9R A;  4HN9 A;  1HR0 T;  2E9X A;  3O1H A;  2WSS V;  4HTE A;  2X67 A;  2KIN B;  4U31 A;  2XAF B;  5FMN A;  2NTY A;  3RF1 A;  5LMU T;  3KBU A;  1UGO A;  4UXN B;  1J1J A;  4OK0 A;  5CJ5 A;  3L8R A;  1WYB A;  5FKY A;  3N2O A;  4TUY E;  1HG2 A;  4UF0 A;  3AEB A;  5FY7 A;  3C98 B;  3KV4 A;  2V6Y B;  2Y8D A;  3I9Y A;  1YW0 A;  4IDQ A;  3VR9 A;  1O3X A;  3Q5D A;  1ZP0 A;  3C4W A;  5LB7 B;  3RKG A;  4JV5 T;  1D1A A;  4U72 A;  3O4X E;  4PK4 A;  2I0M A;  2UXX B;  3AEF A;  2HN1 A;  2VUR A;  2YEV C;  5C8Y E;  2WZI A;  1IBM T;  1AJ3 A;  4YHJ A;  2CXD A;  3AE9 A;  3T1Y T;  1G73 A;  2LOS A;  4EGW A;  3ZJ1 A;  5ABF B;  2JMH A;  4K0K T;  3N2K E;  2YU1 A;  3AAE B;  3BK9 A;  4JUY A;  2JQH A;  1UK5 A;  2X66 A;  3FXE B;  2BG9 C;  4YXD A;  3IF8 B;  4HEA A;  1XMO T;  4H9O C;  2XAG B;  2DLR A;  5JH7 E;  4X64 T;  4IIJ E;  4ANJ A;  3NKZ A;  2X68 A;  3UU3 A;  4O4J E;  3ETU A;  3F57 A;  4YTM A;  3KFW X;  4TZ4 C;  2JPF A;  5LBM A;  4ASK A;  5LHG B;  3LK2 B;  4V1A v;  4N78 D;  2HHH T;  2XQ9 A;  5LJN A;  3LFM A;  4LML A;  2XQ6 A;  2XJ7 A;  3AA1 B;  1ZKE A;  2E9X D;  4I55 E;  5LNK A;  3UUM A;  3N5L A;  1KF6 A;  4HWF A;  5L3C B;  5JRE A;  1MND A;  2XAH B;  3TLW A;  2NR4 A;  3RYH E;  2W2U A;  3UU4 A;  2A3D A;  2NW9 A;  2CHN A;  3PJA J;  3R84 B;  4QX8 B;  5F3J A;  3LK3 B;  3FBL A;  2DI4 A;  4QX7 B;  4KHZ F;  3CML A;  5HXS A;  4E7Z A;  2PFV A;  4P1N A;  3AED A;  1D1C A;  2EHO C;  1MMD A;  4PJM A;  3UQ7 A;  3PUR A;  3N9Q A;  3VKH A;  4GYS A;  2PBI A;  5EK2 A;  1MMG A;  4LMK A;  2XQ3 A;  5AQJ B;  4YSY A;  4CXY A;  3RYC E;  2VQE T;  1IJ6 A;  3AA0 B;  3TLV A;  4IST A;  3PUS A;  3BQL A;  3OKQ A;  4YTN A;  4PFO A;  3RRC A;  3KVA A;  2LSI A;  3B13 A;  3FZM B;  2XY8 B;  3QK6 A;  1H7C A;  3VKG A;  1CUN A;  4EEB A;  2HN2 A;  2YIN A;  2W61 A;  3OVU A;  3SFE A;  4DID B;  3P4Q A;  2J47 A;  4AKL A;  2KT9 A;  3RIA A;  4U7Y A;  3PTR B;  1N36 T;  2D0T A;  2YOE A;  4CXW A;  3NVO A;  4COF A;  2VWA A;  3DP7 A;  5FY0 A;  3UUL A;  3EVY A;  4DBR A;  3A7M A;  3B57 A;  4ZEY A;  2D5U A;  1B7T A;  2CRB A;  2MAW A;  4YLH A;  3PUA A;  3KDS E;  2LOP A;  3SRZ A;  3GWH A;  1QLB A;  3JC6 C;  4NXM T;  5JR9 A;  1WR6 A;  1LKX A;  5LA6 E;  3O1I A;  2E5V A;  2X9Y A;  3EAB A;  4EAH A;  1J5W A;  2XAQ B;  2WM9 A;  2I59 A;  2LM9 A;  2W62 A;  2IHR 1;  1LVK A;  3NBX X;  2A9U A;  2X9H A;  5LXT E;  1XNR T;  3Q2M A;  5JQG E;  5FL1 A;  5FXX A;  2XAS B;  4O4H E;  2UUC T;  5EZY E;  2A2F X;  1MNE A;  4PAG A;  2CMR A;  2WCA A;  1J5E T;  2BG9 E;  2J1D G;  4IHJ E;  4EZ4 A;  3OPC A;  3AEC A;  5AQM B;  5LHI B;  2F4V T;  2WU5 A;  4HKA A;  4DR6 T;  2K9A A;  4OFZ A;  4B3R T;  4JI4 T;  4HGA A;  4DUY T;  4AQY T;  2DHR A;  5DAB A;  3L3P A;  4U7I A;  2E9X B;  3FZH B;  3UFG A;  3AXJ A;  3ZC0 A;  4XAX B;  2X0L B;  5F5W A;  1OED A;  2ZM6 T;  5L3F B;  2AE9 A;  2CCQ A;  4GKJ T;  3FXD B;  4G63 A;  2CPT A;  2LEH A;  3CQC B;  1T72 A;  5LG3 A;  3KV5 A;  5CFB A;  2R6G F;  5AQS B;  3NRY A;  2XM2 A;  4UF0 B;  4X62 T;  4P0B A;  4LMJ A;  3A8Y C;  3HI2 A;  2X0H A;  1ZEE A;  2XQ8 A;  3ABV A;  5DQW A;  4GOU A;  4EXT A;  2M6I A;  2LKH A;  3UT5 E;  2W66 A;  3O9X A;  5GON E;  2KWI B;  2XUE A;  3F2E A;  4OX9 T;  3AB3 B;  2E5L T;  3LDQ B;  2IC6 A;  5A1L A;  3IHR A;  3FZF B;  1MIY A;  3MXZ A;  4JI2 T;  3AE3 A;  4ILU A;  3ZJ2 A;  2MBG A;  3NWI A;  4U2Y A;  3R6N A;  1E1H B;  5JVD E;  3IBP A;  1BR1 A;  3SOL A;  4LF8 T;  2E2A A;  2LSY A;  4QXB B;  4L5G A;  1YKE B;  4ERR A;  4A5X A;  4B3M T;  2YKS A;  5BMV E;  2LHN A;  1ZHC A;  2RP4 A;  2Y6X A;  1S35 A;  3A5X A;  3M3Z B;  4DR2 T;  3ZPO A;  1G8X A;  3LJC A;  5KX5 E;  3K1S A;  4CQI A;  3P50 A;  4ZI7 E;  5AQU B;  3VR8 A;  3NRX A;  4DMV A;  1KK7 A;  4DR4 T;  2LT3 A;  1S94 A;  1MIV A;  2KSR A;  2FJE A;  4ZS2 A;  4X66 T;  3N9L A;  3C4Z A;  1SE7 A;  3I1A A;  3RC8 A;  5HXE A;  1UX5 A;  3EUH A;  3U78 A;  2V7M A;  4F8H A;  1FMW A;  2XHE B;  4AQF C;  3N9M A;  1IJ5 A;  4WNK A;  3HKB E;  2WZH A;  1XZY A;  4QKN A;  4HFH A;  4MBQ A;  3LBX A;  4BA9 A;  1X79 A;  3KVB A;  2WMN A;  4IDN A;  3SS1 A;  2LRL A;  5HWX A;  2MYS A;  2NW8 A;  3GMI A;  4LF4 T;  2L9Q A;  4X5T A;  1M7K A;  4X1I E;  4CXX A;  1MMA A;  3AEG A;  2B1E A;  2VKJ A;  3AA6 B;  3I9W A;  2I6H A;  3N9N A;  4DBQ A;  2QRX A;  2FUP A;  1W0A A;  3W15 B;  1N34 T;  3U3I A;  5KXJ A;  3UU5 A;  3ETV A;  3HR0 A;  3RGL A;  3I0O A;  4EYY R;  4JI3 T;  3UUN A;  3RPU A;  4KI0 F;  2CM0 A;  3MKD A;  4HFI A;  5JRC A;  3ESL A;  4O4I E;  1UX4 A;  2CLY B;  3C50 A;  5L2L A;  5TAO A;  3Q5E A;  5J2T E;  2K24 A;  2RPA A;  3PUZ F;  5HWY A;  3M65 A;  3ZMV B;  2C5K T;  2WAU A;  5HXH A;  4HFC A;  3J7Y q;  3K3Q C;  3RIU C;  4YJ2 E;  3AE7 A;  4PK5 A;  1HNW T;  1FEW A;  2H3R A;  2JQQ A;  3P4P A;  3CPZ A;  5ADX L;  2H7O A;  2JQ9 A;  2BBH A;  4EB6 E;  2P9B A;  5AQF B;  5JR9 B;  2C5J A;  4IL4 A;  3ANW A;  3ZMT B;  3ONL C;  2WB5 A;  2WMO A;  3ZCJ A;  2QVA A;  3H3A A;  4K0U A;  4WZX A;  4CZZ B;  3C4X A;  2QGS A;  4EED A;  1W09 A;  2CWY A;  2H7V C;  2IC9 A;  2BS2 A;  3ZT6 A;  3OJA A;  4TWH A;  2WBL A;  3PDY A;  2NWB A;  4IT4 A;  3FZK B;  4JI8 T;  4UVB B;  1XDP A;  3K3O A;  4QXH B;  3MJX A;  3PUX F;  3H37 A;  2NTX A;  4HFD A;  2Q9Q A;  5CGM A;  4P0A A;  1T8B A;  1YXR A;  4IDZ A;  4IL9 A;  2UUA T;  2BS4 A;  1BR0 A;  2LHR A;  4UVC B;  4H9Q C;  2HH7 A;  3AE1 A;  4ILB A;  3WAJ A;  2K5B B;  4JEH B;  3AE2 A;  1T7S A;  4OHF A;  5HEU A;  4UV9 B;  4I43 B;  1ZOY A;  3H3M A;  2K48 A;  4XBF B;  3GN5 A;  1KNZ A;  5KMG P;  2D0U A;  2WWU A;  3ZYL A;  3AXJ B;  1HTJ F;  1OED B;  2GK9 A;  2ODU A;  4TWF A;  4TNV A;  5C3J A;  5J2U E;  3ZN1 B;  4AIS A;  2BDE A;  4PFP A;  1WLX A;  2X0Y A;  1HX1 B;  3AE4 A;  5FL0 A;  2W0G A;  4JBW F;  2UXN B;  4TV8 E;  2CEA A;  2LJL A;  2KZ7 B;  4YSX A;  5ABE A;  2E9X C;  3P4W A;  4IE5 A;  1MIW A;  4I50 E;  4ZI3 D;  3WAK A;  1YQ3 A;  1Z0P A;  4LFC T;  2ODV A;  1FMV A;  4GKK T;  3CQX C;  3MZK B;  2LKG A;  4DMW A;  3N2G E;  3CX6 B;  4ZOL E;  1NEK A;  3PJA A;  5JDG A;  2NOX A;  2KWH A;  5FXZ A;  2XTL A;  5LBQ B;  4UEL A;  4UIG A;  4AI6 A;  3ZLI A;  1HF8 A;  2Z6E A;  4CN1 A;  3RQU A;  4ZHQ E;  2ZM8 A;  3ZN0 B;  2NP9 A;  2VKO A;  5LHH B;  4ILA A;  4O4L E;  3QB5 A;  3KIN B;  5JDM A;  3OYX A;  2IDO B;  3ONX A;  2BS3 A;  4OYJ A;  5IUX A;  3AEE A;  2RA1 A;  1UCU A;  4EV6 A;  4KMC A;  4O2B E;  2J62 A;  4FI5 A;  2Q9Q D;  4B6X A;  2M6B A;  4HWH A;  3LSV A;  2YN6 A;  3K3N A;  4EZH A;  4ZI2 D;  1Z8U A;  1LRZ A;  2WDR A;  4YY3 T;  2CXF A;  4IE6 A;  2C5I T;  4QH5 A;  2VL0 A;  5FXV A;  3UU6 A;  4MHC A;  1JNR A;  2DNX A;  3KBT A;  4U3C A;  2WDQ A;  3ZT7 A;  2XQ5 A;  4HWD A;  4HWI B;  4ZI3 C;  2OV9 A;  2PG8 A;  3P8C D;  3F31 A;  1KNR A;  2VKD A;  3ONJ A;  5J1G A;  2V7K A;  3LBX B;  4I0U A;  5HXR A;  3IEE A;  1IZN B;  1N32 T;  4B3S T;  2X9W A;  4ZZB A;  5ABH A;  3TLS A;  5HEG A;  3ZEF B;  3Q9D A;  2H89 A;  4UR9 A;  2BBJ A;  4MAL A;  3HKE E;  3OBV E;  5HEO A;  3GA8 A;  4LFA T;  4DR7 T;  1R8I A;  3JCF A;  5AQG B;  3FZL B;  2XQ4 A;  4JI7 T;  3QOF A;  2XSB A;  4GK0 E;  1U5P A;  3ZMS B;  2ZM0 A;  2BG9 A;  2DL1 A;  2V8S V;  3O1J A;  2HPL A;  2W63 A;  3EHZ A;  2KLQ A;  2L8K A;  2BKO A;  4CI3 B;  2D2S A;  2VVS A;  3RC3 A;  4IE7 A;  4ILC A;  5LGN B;  2LSK A;  2G0U A;  2XZE A;  3TLT A;  5HAX A;  5L4H A;  5LGT B;  4UEM A;  2WQY A;  1D0Y A;  2B76 A;  2CBI A;  3RIF A;  2E8I A;  2IAK A;  2V1D B;  5JRC B;  4JI1 T;  1BR2 A;  3CVR A;  1ZV4 X;  3ZKR A;  5FY1 A;  1L0V A;  1KFY A;  5LOV E;  1NWM X;  3L39 A;  1HNZ T;  4DV7 T;  3X1D A;  3UUX B;  3DJB A;  4U74 A;  2LM2 A;  4WYV A;  4O2A E;  3RQW A;  2N1G A;  2A72 A;  3D0T A;  2VAS A;  3DTO A;  3HKD E;  3PV0 F;  2H88 A;  2FJB A;  4P09 A;  4QH1 A;  2LSJ A;  2CLY C;  3PUQ A;  2JRK A;  2EHO A;  1WFD A;  5AQT B;  3KV9 A;  1M62 A;  1FIO A;  1YD8 G;  2ACZ A;  3G06 A;  4CN6 A;  3V5S A;  3ANW B;  1XWM A;  1NAF A;  1HNX T;  4DR5 T;  2XAJ B;  4B3T T;  4CI1 B;  4YJ3 E;  2WP9 A;  4DVD A;  3J9X 1;  1CHU A;  5E0O A;  4BAY B;  4DUZ T;  4GK5 E;  2ACX A;  5JDH A;  2N2N A;  5HEJ A;  4L9I A;  2WY2 A;  4IE4 A;  4Q25 A;  4JI0 T;  3TKL B;  5HCM A;  1LVF A;  2BVM A;  5LYJ E;  3VU7 H;  1XNQ T;  2IUB A;  4WBO A;  5JR9 C;  4GIW A;  1JNZ A;  2YDS A;  3AAA B;  3HKC E;  5FVL A;  4DO0 A;  3QC9 A;  5DQV A;  2Q9Q B;  4Z8X A;  2KXP B;  4U2Z A;  4DV3 T;  4AKR B;  4H9N C;  1DU2 A;  1UUS A;  2KND A;  4QHO A;  4TWD A;  2VB6 A;  3FBZ A;  4DV1 T;  5J0Z A;  3ZCI A;  3JAF A;  4OYK A;  5AQV B;  3N9O A;  2VVN A;  3CIR A;  4DV4 T;  2MTQ A;  2DCF A;  3GN5 B;  3OTO T;  3BQK A;  3PU8 A;  3ZMU B;  3CKD A;  5LCY A;  2X9X A;  4QH4 A;  2HPJ A;  2UU9 T;  3MA9 A;  2XQ7 A;  2BKN A;  2ZMA A;  2XQA A;  5EK3 A;  4KHP T;  2OLT A;  3NZQ A;  4AXP A;  4IDO A;  3CQG B;  4QXC B;  3RRW A;  3BQI A;  4X65 T;  3NZP A;  3LK4 2;  3PUV F;  3ZMZ B;  4AKI A;  5DJQ C;  3RH3 A;  3C51 A;  2IIU A;  3HL6 A;  1OED C;  4O8S A;  2BVL A;  5JDF A;  3RX6 A;  4QWN B;  2EHO D;  4H63 H;  3CX7 B;  2LLY A;  5ABG A;  2BZB A;  4IDP A;  4YT0 A;  1VRB A;  2DWG A;  5LMN T;  3RHW A;  3AE5 A;  5AQN B;  5KDM C;  2V5C A; 
#chains in the Genus database with same CATH homology
 1BR4 A;  1U4Q A;  4I50 E;  4ZI3 D;  3ZC1 A;  3WAK A;  4FJO A;  1Z0P A;  2CCQ A;  2ODV A;  1FMV A;  3FXD B;  4G63 A;  3E0Z A;  2LEH A;  5LGU B;  3CQC B;  3CQX C;  3MZK B;  3KV5 A;  4DMW A;  5FYM A;  3MK7 C;  3N2G E;  5H6Q B;  3T8O A;  2LE8 A;  3CX6 B;  4ZOL E;  4BJM A;  4PJJ A;  5H6R B;  2NOX A;  5JDG A;  3NRY A;  5FP3 A;  2KWH A;  4J2C A;  5FXZ A;  4HN9 A;  5IHY A;  4UF0 B;  2XTL A;  5CA1 E;  2E9X A;  3O1H A;  4P0B A;  5LBQ B;  4UEL A;  4UIG A;  4AI6 A;  3HI2 A;  2WSS V;  4HTE A;  2X67 A;  3ZLI A;  1HF8 A;  2KIN B;  4G2A A;  2Z6E A;  2XAF B;  1ZEE A;  4PJN A;  5FMN A;  2NTY A;  5DQW A;  4GOU A;  4EXT A;  4ZHQ E;  2ZM8 A;  3E22 E;  3UT5 E;  3ZN0 B;  3O9X A;  3KBU A;  5GON E;  2NP9 A;  2VL8 A;  2KWI B;  4UXN B;  2XUE A;  2VKO A;  3F2E A;  4OK0 A;  2V7J A;  3AB3 B;  2V7L A;  3PUG A;  1D0X A;  2IC6 A;  4PW8 A;  5LHH B;  5A1L A;  4O4L E;  1WYB A;  1YKH B;  3N2O A;  4KUM B;  4TUY E;  3KIN B;  3IHR A;  5JDM A;  3OYX A;  1HG2 A;  1MIY A;  3MXZ A;  4UF0 A;  3ONX A;  3RYI E;  4OYJ A;  5FY7 A;  2PJQ A;  4MFR A;  2RA1 A;  1UCU A;  3C98 B;  3KV4 A;  5FNV E;  4KMC A;  4ILU A;  4NUV A;  3ZJ2 A;  4O2B E;  2MBG A;  2Y8D A;  1V9D A;  4FI5 A;  2Q9Q D;  4B6X A;  3I9Y A;  3FHN A;  3R6N A;  1YW0 A;  3K3N A;  1E1H B;  1O3X A;  5JVD E;  3IBP A;  4EZH A;  1BR1 A;  3SOL A;  2DWK A;  2CWO A;  3C4W A;  4MLK A;  3JC6 D;  4ZI2 D;  1EZ3 A;  2LSY A;  1LRZ A;  4QXB B;  1D1A A;  1IAP A;  4L5G A;  4U72 A;  1YKE B;  3O4X E;  4PK4 A;  4ERR A;  5L3D B;  2CXF A;  4IE6 A;  5BMV E;  2C5I T;  4ISS A;  5FXV A;  2LHN A;  1ZHC A;  3C64 A;  2RP4 A;  4MHC A;  4C90 A;  2UXX B;  2Y6X A;  1S35 A;  2DNX A;  3EDV A;  3A5X A;  2V7I A;  3ZPO A;  3KBT A;  2YEV C;  5C8Y E;  1G8X A;  3LJC A;  5IYZ E;  5KX5 E;  4CQI A;  4ZI7 E;  4UV8 B;  2LSG A;  4ZI3 C;  4ADZ A;  1AJ3 A;  4YHJ A;  2PG8 A;  3NRX A;  4DMV A;  3P8C D;  1HX8 A;  2CXD A;  3F31 A;  4NUU A;  2IW5 B;  2YU2 A;  1G73 A;  2LOS A;  2VKD A;  4CI2 B;  3ZJ1 A;  5J1G A;  2V7K A;  1KK7 A;  3LBX B;  2JMH A;  2LT3 A;  3Q5X A;  3N2K E;  2YU1 A;  2QA7 A;  1S94 A;  1MIV A;  5HXR A;  4H63 V;  3IEE A;  4ZS2 A;  3AAE B;  5AFU L;  1IZN B;  3BK9 A;  4BJN A;  4I4T E;  3N9L A;  3C4Z A;  2X9W A;  1SHZ C;  4JUY A;  4KBM B;  3I1A A;  2JMK A;  3RC8 A;  5HXE A;  5EK4 A;  3ZEF B;  3Q9D A;  1UX5 A;  2X66 A;  4MAL A;  3FXE B;  4EYU A;  3EUH A;  3U78 A;  2V7M A;  3HKE E;  3OBV E;  1FMW A;  2XHE B;  4AQF C;  3FB2 A;  3N9M A;  3IF8 B;  1IJ5 A;  3GA8 A;  4WNK A;  1QSD A;  4HEA A;  3HKB E;  4TX5 A;  4H9O C;  2XAG B;  2DLR A;  5JH7 E;  4IIJ E;  4ANJ A;  4QKN A;  1HG5 A;  2X68 A;  4MBQ A;  4O4J E;  3LBX A;  3EDU A;  3ETU A;  3F57 A;  5L3E B;  3KFW X;  3N9P A;  4TN7 B;  4BA9 A;  1X79 A;  3KVB A;  2OA5 A;  2WMN A;  4TZ4 C;  5JDL A;  2JPF A;  2M67 A;  5ETW A;  5LBM A;  4ASK A;  5LHG B;  3LK2 B;  4V1A v;  4GK0 E;  3SS1 A;  1U5P A;  3ZMS B;  4N78 D;  2ZM0 A;  3ZYM A;  4UVA B;  5HWX A;  4AQF A;  3WI3 A;  2MYS A;  3O1J A;  2HPL A;  5LJN A;  2MOZ A;  2NW7 A;  2W63 A;  4PK6 A;  2NW8 A;  3GMI A;  3LFM A;  5L3B B;  2KLQ A;  4X20 E;  1MMN A;  2L8K A;  2L9Q A;  4X1I E;  4CI3 B;  1HFA A;  1OWA A;  4CXX A;  2D2S A;  1MMA A;  3RC3 A;  3AA1 B;  2ZLY A;  4IE7 A;  1ZKE A;  2E9X D;  5LGN B;  4I55 E;  5LNK A;  3UUM A;  2LSK A;  3CX8 B;  2G0U A;  2B1E A;  3N5L A;  3OYZ A;  2VKJ A;  2VK9 A;  5HAX A;  3AA6 B;  5LGT B;  4DND A;  5L3C B;  5JRE A;  4UEM A;  1QUU A;  4X1K E;  1MND A;  3I9W A;  5JDQ A;  2XAH B;  1D0Y A;  4IGU A;  3RYH E;  3N9N A;  1HS7 A;  4ZS3 A;  4DBQ A;  2A3D A;  2NW9 A;  2E8I A;  4GYR A;  2IAK A;  2V1D B;  5JRC B;  2Y48 B;  3QUJ A;  4QX8 B;  3R84 B;  5F3J A;  3LK3 B;  3FBL A;  2DI4 A;  4JLE A;  3W15 B;  3CVR A;  1BR2 A;  3U3I A;  4QX7 B;  1ZV4 X;  1VOM A;  5FY1 A;  3ETV A;  3CML A;  5LOV E;  5LP6 E;  5HXS A;  4WW0 A;  4X1Y E;  1NWM X;  1D1B A;  3HR0 A;  2EHO B;  3MAC A;  1WRD A;  3I0O A;  4EOZ B;  4EYY R;  2PFV A;  4E7Z A;  3UUX B;  3DJB A;  4U74 A;  1D1C A;  2EHO C;  1MMD A;  4O2A E;  3UUN A;  4PJM A;  3PUR A;  3N9Q A;  3VKH A;  2N1G A;  2A72 A;  3D0T A;  3RPU A;  2VAS A;  3RKO A;  3DTO A;  3HKD E;  4GYS A;  2PBI A;  2CM0 A;  3MKD A;  4P09 A;  5JRC A;  3ESL A;  4O4I E;  1UX4 A;  2CLY B;  3C50 A;  5CB4 E;  5EK2 A;  5L2L A;  3AAI A;  3Q5W A;  1MMG A;  5TAO A;  2LSJ A;  2CLY C;  5J2T E;  3PUQ A;  4CXY A;  2JRK A;  3RYC E;  2EHO A;  4TV9 E;  5HXC A;  2K24 A;  3KV9 A;  5HWY A;  3AVR A;  3M65 A;  1IJ6 A;  3AA0 B;  1FIO A;  3ZMV B;  1YD8 G;  2C5K T;  5F8P A;  3L09 A;  3V5S A;  3ANW B;  2WAU A;  4IE0 A;  3UFE A;  4IST A;  5HXH A;  3PUS A;  1NAF A;  3I0Q A;  3J7Y q;  2XAJ B;  3K3Q C;  4YFS A;  3BQL A;  3OKQ A;  4CI1 B;  4PFO A;  4YJ2 E;  3RRC A;  3KVA A;  2LSI A;  3B13 A;  4YJ3 E;  3QK6 A;  1H7C A;  4PK5 A;  4DVD A;  3VKG A;  1CUN A;  1FEW A;  2H3R A;  2JQQ A;  3J9X 1;  3CPZ A;  5E0O A;  5ADX L;  2L3L A;  2H7O A;  4BAY B;  4GK5 E;  2YIN A;  2V26 A;  2ACX A;  2W61 A;  4EB6 E;  2ZM2 A;  5JDH A;  2N2N A;  4L9I A;  2P9B A;  1D0Z A;  4IE4 A;  3TKL B;  3S4U A;  5JR9 B;  1LVF A;  2C5J A;  2BVM A;  4AKL A;  5LYJ E;  3VU7 H;  1T98 A;  2KT9 A;  3ANW A;  1HCI A;  3ZMT B;  5JDN A;  5JR9 C;  4WBO A;  4GIW A;  2WMO A;  1OXZ A;  3PTR B;  3ZCJ A;  2D0T A;  3AAA B;  3HKC E;  4IE5 A;  3UTK A;  3CWZ B;  4DO0 A;  3QC9 A;  3H3A A;  4K0U A;  5DQV A;  2XQY A;  4CXW A;  2Q9Q B;  4Z8X A;  4A56 A;  2VWA A;  3DP7 A;  5FY0 A;  3RYF E;  3EVY A;  3UUL A;  2KXP B;  3C4X A;  4CZZ B;  4DBR A;  4AKG A;  4PJL A;  2QGS A;  3B57 A;  2N9D A;  4H9N C;  4AKR B;  2Q9Q C;  2KND A;  2CWY A;  4H9S E;  4WBN E;  2H7V C;  2IC9 A;  2D5U A;  4QHO A;  1B7T A;  2VB6 A;  4YLH A;  3PUA A;  3KDS E;  2LOP A;  3FBZ A;  3OJA A;  3SRZ A;  4JEU B;  2WBL A;  3PDY A;  2NWB A;  3GWH A;  3ZYK A;  3JC6 C;  4ZI2 C;  4H9R C;  5JR9 A;  3K8P C;  1WR6 A;  1LKX A;  4C91 A;  2YK0 A;  4L0R A;  5CA0 E;  3ZCI A;  4UVB B;  5LJM A;  3K3O A;  4QXH B;  5LA6 E;  4OYK A;  3MJX A;  5FXW A;  3H37 A;  3N9O A;  2NTX A;  3O1I A;  2KMF A;  2Q9Q A;  2X9Y A;  2MTQ A;  2DCF A;  3PU3 A;  4EAH A;  3GN5 B;  2ES0 A;  4P0A A;  3BQK A;  3PU8 A;  3KV6 A;  2VKH A;  2XAQ B;  2WM9 A;  2I59 A;  4IDZ A;  3ZMU B;  3CKD A;  2LM9 A;  2W62 A;  4KP3 C;  5LCY A;  1LVK A;  2X9X A;  2X51 A;  4PNI A;  5L3G B;  4M1P A;  3NBX X;  3HA4 A;  2HPJ A;  3P7I A;  1BR0 A;  2LHR A;  4UVC B;  4H9Q C;  1WYC A;  3MA9 A;  2X9H A;  2HH7 A;  5LXT E;  3WAJ A;  2K5B B;  3Q2M A;  2ZMA A;  5JQG E;  5HYA A;  4JEH B;  3V5U A;  5EK3 A;  2JJ9 A;  3NZQ A;  5FXX A;  2XAS B;  4AXP A;  4XZC A;  4O4H E;  2CXL A;  3CQG B;  5EZY E;  4OHF A;  2A2F X;  1MNE A;  4PAG A;  4UV9 B;  4QXC B;  2CMR A;  4I43 B;  2W00 A;  3E08 A;  3RRW A;  2K48 A;  4XBF B;  3GN5 A;  3PE0 A;  3BQI A;  1KNZ A;  5KMG P;  3VHL A;  3SWH A;  2D0U A;  2WWU A;  3NZP A;  3ZYL A;  2J1D G;  3LK4 2;  1HTJ F;  4IHJ E;  4EZ4 A;  3ZMZ B;  5LHI B;  4AKI A;  2GK9 A;  4H9P C;  5DJQ C;  2C0S A;  2ODU A;  3RH3 A;  4F6R C;  2CA5 A;  4HKA A;  3C51 A;  5J2U E;  3HL6 A;  3ZN1 B;  2K9A A;  4O8S A;  1Y64 B;  2BVL A;  4AQG A;  3LG7 A;  3AVS A;  4EIW A;  4OFZ A;  4HFV A;  2BDE A;  5JDF A;  3RX6 A;  4PFP A;  4QWN B;  2EHO D;  1WLX A;  4HGA A;  4E7S A;  4HE8 A;  2DHR A;  4H63 H;  1US7 B;  2CE7 A;  3CX7 B;  5DAB A;  2BZB A;  2W0G A;  3L3P A;  2UXN B;  4TV8 E;  1VRB A;  2DWG A;  2CEA A;  5LG4 A;  2E9X B;  2LJL A;  2SPC A;  5M4Y A;  4AKH A;  1SA0 E;  2KZ7 B;  3ZC0 A;  4XAX B;  2X0L B;  2E9X C;  5KDM C;  3AA7 B;  1MIW A;  5L3F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...