1YW0A

Crystal structure of the tryptophan 2,3-dioxygenase from xanthomonas campestris. northeast structural genomics target xcr13.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
262
structure length
243
Chain Sequence
TYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophan 2,3-dioxygenase
publication title Crystal structure of the tryptophan 2,3-dioxygenase from Xanthomonas campestris. Northeast Structural Genomics Target XcR13.
rcsb
source organism Xanthomonas campestris pv. campestris str. atcc 33913
molecule tags Oxidoreductase
total genus 82
structure length 243
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yw0A00
5EK4A 3E08A 2V7LA 4HKAA 1ZEEA 2NW9A 4PW8A 2D0UA 2V7KA 2X66A 2X68A 3BK9A 4PK5A 5ETWA 2NWBA 2NW7A 2V7MA 5EK3A 2V7JA 1YW0A 2NOXA 2X67A 4U74A 2V7IA 4PK6A 5EK2A 2NW8A 4U72A 2D0TA
chains in the Genus database with same CATH superfamily
5EK4A 3PUYF 2JMHA 3NRXA 2XQ6A 4X5TA 2X0YA 3E0ZA 1JNRA 2YINA 1IBKT 2NW7A 3AE7A 1NENA 4A5XA 3CIRA 2M67A 2V7IA 3KBTA 4LMLA 3RHWA 3O1JA 3ANWA 2C5IT 1T7SA 1ZKEA 3P4RA 1D0ZA 4DR1T 4LF4T 3PUXF 5FL0A 5LBMA 1YD8G 4YHHT 4ILAA 4LF7T 2AE9A 5HEGA 4CN1A 5JR9C 2A9UA 3AEBA 2DCFA 5E0OA 3F57A 3V5UA 4CZZB 3E22E 4YXDA 3G06A 4YT0A 1MMAA 1WYCA 4EOZB 2FUPA 2P9BA 3UUBA 2QYWA 3ONJA 3MK7C 4A56A 5AQGB 5FXXA 3P4PA 3BQLA 1MMNA 3O1IA 4IE6A 3RYFE 2EHOA 2DLRA 5HEUA 3UFGA 2C0SA 2W67A 2OA5A 2C5KT 3B13A 1T72A 2EHOB 2HN2A 1YQ4A 2ACZA 1N32T 5HCMA 5LBQB 2I59A 2V1DB 4DO0A 3Q5DA 3AE3A 2CLYC 3CK6A 2UUBT 3EI0A 4JI2T 3PTRB 3D0TA 3FZLB 4IDPA 2X51A 1M62A 2E9XA 2KINB 3MZKB 4YTMA 4HFCA 1HR0T 3FB2A 4HFDA 4HWCA 2VKOA 2E9XB 3TLVA 2RA1A 1G8XA 2QVAA 4ZS3A 3DTOA 5A1LA 2X66A 4H9NC 4YLHA 4EYUA 4YFSA 2KWHA 3MXZA 4WZXA 3ONXA 5LNKA 5HWXA 2X0LB 3QB5K 2WY2A 2IC6A 4QH5A 3O4XE 3ETVA 2K24A 4IDOA 1BR1A 3AE9A 2V5DA 5L3DB 4QXCB 3BK9A 2ACXA 4HWDA 4AQYT 5KX5E 4H9RC 4LFCT 2HHHT 5JDFA 4DBRA 4CI2B 3S4UA 5FNVE 3RYHE 4YTPA 2J1DG 2CMRA 1DU2A 4CI3B 4B3MT 2BG9E 4CI1B 2ES0A 3L39A 3AEGA 3WI3A 5FVKA 4DNDA 4HGAA 1UURA 4IE5A 4QH1A 3PE0A 3IEEA 1Z8UA 4HFHA 3JC6D 3QOFA 5AQRB 2V7KA 3C4XA 2G0UA 2V7MA 2DNXA 4DV5T 3MJXA 3NZQA 5HXEA 2YK0A 5JDGA 4DV7T 4Z8XA 4YHJA 2YDRA 4PJLA 2I0MA 3N5LA 4KI0F 1YQ3A 4UIGA 4U3CA 4C90A 5IWAT 2LE8A 4ISTA 1SE7A 4Z91A 1YW0A 2XAQB 4AISA 2XQ8A 2ZM2A 3LSVA 2D9DA 4E7ZA 4OK0A 2KT9A 4U7YA 2M6BA 3ZT6A 4EXTA 4PNIA 2JQKA 1JNZA 5LG4A 5HXHA 4HKAA 4XAXB 1E7PA 4EIWA 2LM2A 2LRLA 5CA0E 2WQYA 4ZI2C 2VQET 5DQVA 3ZC1A 4IL9A 3RF1A 2XM2A 5LG3A 3Q2MA 2WS3A 1U4QA 2QA7A 2VASA 3VR9A 2L8KA 3AE4A 3ZN1B 3QB5A 5IYZE 4AKHA 2CHNA 1UGOA 3PUGA 4QXBB 3PUVF 3RGLA 3EDUA 4JI7T 3FZKB 4QXHB 1KNRA 3U78A 5CB4E 3KFWX 1E2AA 4TN7B 3W15B 4JI5T 5AQMB 4NUVA 4YSZA 1D1AA 3FZMB 2X9WA 2KMFA 4QKNA 2LOSA 1U5PA 4UR9A 4PAGA 1YKHB 3P4QA 2NR4A 5F3JA 3AECA 5LJNA 3OBVE 3UU5A 3IHRA 2UXCT 1FMVA 2CE7A 3PU3A 3ZC0A 4DV0T 3I1AA 3OKQA 3ZYMA 4DV3T 1IBLT 2D5UA 2PTFA 3M65A 3ZN0B 4H9SE 3ZPOA 2BVLA 3MACA 3EUHA 3RQWA 4U7IA 2MAWA 2W63A 4EEDA 3M3ZB 2LRKA 1XDPA 2N9DA 4G63A 3PUWF 4CN4A 2CBJA 2X9HA 3RI5A 3LK3B 3TLTA 3PJAJ 5ABGA 5LHIB 4DMVA 3VU7H 3K3QC 4UXNB 3ZMZB 1SA0E 4U2ZA 4MALA 4JV5T 1ZV4X 2LSIA 4TWHA 5LGUB 2L9QA 2OV9A 3JAFA 3NZPA 4DV2T 4HTEA 1WYBA 3N9LA 4GKKT 3ZYKA 4AQFC 4MHCA 3FZFB 2XQAA 2XM1A 4AQFA 1ZHCA 3N9NA 4TWFA 2CWYA 3P4WA 4I55E 2UUAT 5DABA 1V9DA 4YY3T 1WRDA 4EB6E 3GA8A 3AEDA 3OTOT 3AE8A 5EZYE 4I4TE 3I9YA 2ZM0A 4LF8T 1OEDE 2FJEA 5JREA 4OFZA 2PBIA 2CXDA 5LJMA 2SPCA 3ZMTB 5FXWA 1SHZC 2X67A 1NEKA 1WFDA 3TLWA 2VK9A 3E08A 1CUNA 4OHFA 4H9PC 2DI4A 4DIDB 4JEUB 1N34T 5H6QB 1KNZA 3CX6B 2UXBT 3ZEFB 5LXTE 3LFMA 3PU8A 2K3WA 3HA4A 4PK6A 3FBLA 2Y8DA 5HAXA 2GK9A 4JYAT 2NW9A 4CN6A 3NVOA 2ODVA 5AQTB 4YJ3E 4UELA 2XQYA 3HKEE 1XMOT 5HWYA 4HFBA 3KVBA 2XJ7A 3VR8A 4DR5T 3RC3A 3N2KE 3UU4A 3KV5A 3PUSA 2N2NA 5LGNB 4QH4A 3FZHB 3U3IA 2LKHA 2NWBA 5JDHA 4PFOA 1I6ZA 1FEWA 4DMWA 4H9QC 5H6RB 1D0YA 4TV8E 3PURA 3R6NA 4B3ST 4U72A 2XTLA 1VCSA 3ZMVB 3AXJA 1MNDA 5KDMC 1UK5A 3WAKA 4JI0T 3AXJB 4DV4T 5LOVE 2LT3A 3PUQA 5HYAA 2XY8B 1ZOYA 2H89A 1N33T 2ZLYA 2BKNA 5AQPB 2D0UA 3RQUA 3RKGA 3MA9A 4UVAB 2R6GF 4KHZF 2EHOC 5L47A 4DR7T 3I9WA 1M7KA 2XQ7A 3R84B 3UUNA 2LLYA 3H37A 2VKJA 3TLSA 2NTYA 2LSKA 3ZCJA 2XSBA 3UULA 5AQKB 2WMOA 2F4VT 5JR9B 3RRCA 2LJLA 4UVBB 4NXMT 2X9YA 2JQQA 3ZYLA 4N78D 3DJBA 2ZMAA 3ZCIA 2JJ9A 3IF8B 5BMVE 1YXRA 5FY7A 3A8YC 5LHGB 3UU8A 2BZBA 1UX4A 2E9XC 1UCUA 4O4HE 2WDVA 1BR2A 4DV1T 5FMNA 2LM9A 1J1JA 3L8RA 2QRXA 2B76A 4ZI3C 5FYMA 2CLYB 5KXJA 4MBQA 3UU3A 1FJGT 2ZM6T 4ILBA 3TLUA 5FP3A 4H9OC 4AKRB 2PJQA 5TAOA 4ASKA 3H3MA 3ZT5A 4XBFB 3HKDE 5JH7E 2W4XA 5ABHA 4DR3T 3V5SA 2UXNB 4TUYE 2A2FX 2WU2A 2Q9QD 4AIUA 1G73A 2V26A 2WCAA 4X1KE 4LF5T 1H7CA 2JIWA 4JI8T 4AKGA 4U74A 1BR4A 2XQ9A 3IA3A 5CFBA 1VRBA 3CMLA 2XUEA 4JI4T 3AEEA 2WDRA 2V6XA 2JMKA 2CXLA 2BG9A 3HR0A 3GN5A 4TNWA 3ZMUB 3C51A 2BG9B 1KNPA 3GN5B 5KMGP 2HPJA 3AB3B 3Q5EA 5L3CB 4HWFA 4LFAT 3BQKA 4O2BE 3K8PC 4ZZBA 2XPKA 4JBWF 1W0AA 2JRKA 4AKLA 4AKIA 3KVAA 4GYSA 3PDYA 3RIUA 3KV4A 5JVDE 4EYYR 2FJDA 4I0UA 2E5LT 3RLFF 2W0GA 2YU1A 5AQIB 2LKGA 1HFAA 3PUAA 4DR6T 4UV9B 3C50A 3HL6A 1B7TA 4UF0A 2V8SV 3C4WA 4HN9A 2RP4A 2WMNA 2ODUA 3I0OA 4UF0B 5LYJE 4MFRA 1WR0A 1CHUA 4GK0E 1HTJF 5CJ5A 5HXSA 3VKGA 5AQOB 3CWZB 2CEAA 1MMDA 3KV6A 4X62T 1XWMA 3CQCB 4IT4A 2IAKA 2D2SA 2WDQA 3GMIA 2RPAA 2YEVC 3L09A 4IGUA 4CXXA 2WWVA 5AFUL 4FI5A 3UU6A 4LMJA 2YN6A 1LRZA 4HFVA 5CA1E 2CPTA 1XDOA 3EAMA 2KZ7B 3A5XA 4BJMA 4HWIB 2W62A 2WBLA 2JPFA 2XHEB 3OJAA 1L0VA 3T1YT 4WW0A 2N1GA 2FJBA 2K48A 2BDEA 1T98A 2XQ4A 3FBZA 3EABA 2CCQA 1MMGA 2J47A 2BS2A 2HN1A 4TX5A 3AVRA 1ZEEA 3RIFA 2XQ5A 2UU9T 2BBJA 3SFEA 1MIYA 2VQFT 3ZLIA 2E8IA 1D1CA 4LF9T 1S94A 3LJCA 2IMLA 4PK5A 1W0BA 3K3NA 1GQEA 3C98B 3CQXC 4IIJE 5FKYA 5EK2A 3SWHA 5F8PA 3ZJ2A 4O2AE 3ZSSA 3ABVA 2YDSA 2LSGA 5AQHB 3I0QA 1UUSA 3JCFA 2KNDA 4Z90A 4PFPA 3HKCE 3H3AA 2X0HA 2M6IA 3AAEB 4GK5E 2WZIA 3K3OA 2LHRA 3AAIA 4DV6T 5L3GB 2UXDT 5HEHA 3AA7B 2NTXA 1KK7A 5DQWA 2E2AA 3RPUA 1IBMT 3PUZF 4U31A 2IDOB 4ZHQE 4I50E 2V7LA 1MIVA 2W00A 1FIOA 3JAEA 3SRZA 2MBGA 3CQGB 3O9XA 3N2OA 3CX8B 2Y48B 4TNVA 1OEDA 2WSSV 4BJNA 1N36T 3UUXB 3C4ZA 5FXZA 3F2EA 1OEDB 3EVYA 2VVSA 3J7Yq 2CHOA 4ANJA 4IE7A 2XAHB 4O8SA 4X20E 4NIQA 2NW8A 3QNUA 5LMNT 2Q9QA 2H88A 5J2UE 1HG5A 3AA0B 5AQQB 4LMKA 3L3PA 3FXDB 5J2TE 2VKDA 3AAAB 2Q9QB 1LKXA 1BR0A 3AE1A 5L2LA 3A7MA 3RX6A 2A72A 2JQ9A 3OYZA 5LB7B 5L3FB 5LHHB 2DWGA 3KDSE 2BS4A 2MYSA 5JDLA 4X65T 4YTNA 4IE4A 4IREA 4PJJA 4ZS2A 3N2GE 3JC6C 3VRBA 4H63H 3NRYA 2D0TA 4EV6A 1LVFA 2IIUA 4ZI2D 4JI6T 4LFBT 5HCJA 2BS3A 4P0BA 4GKJT 2NP9A 3MKDA 3NBXX 4GYRA 4P1NA 4DR4T 5JDMA 4COFA 3QC9A 2WAUA 3T1HT 3NKZA 4DR2T 3IBPA 4YJ2E 2K9AA 1AJ3A 2XQ3A 5ADXL 1NAFA 3RYCE 5LGTB 1Y01A 2KLQA 4WYVA 3FXEB 1YKEB 4IL4A 4WNKA 5AQUB 3X1DA 3T8OA 3SFDA 3ANWB 4K0KT 3P4SA 2MPKA 4B3TT 4B3RT 5C8YE 5FL1A 2CRBA 1HX8A 2KXPB 3OVUA 4CQIA 1S35A 5JR9A 3EDVA 4PW8A 3WAJA 3ZKRA 2W66A 3AEFA 4L9IA 4TWDA 3KINB 4EZ4A 2BVMA 3AA6B 4X1YE 2WB5A 1HNXT 1FMWA 3N9OA 1W9RA 3O1HA 4C91A 2FJAA 2B1EA 4O4IE 1XNQT 3ZJ1A 4A97A 3P50A 4WBOA 5LP6E 2WM9A 2XAFB 3OYXA 3N9QA 2LEHA 4PJMA 4L5GA 4YSYA 2WP9A 3DP7A 3KBUA 3RIAA 4ILUA 2DWKA 3BQIA 2CXFA 3RRWA 4L0RA 3SOLA 5FXVA 5LCYA 2Z6EA 4WBNE 4EZHA 3AE2A 2E5VA 5M4YA 4X1IE 4DUZT 4AI6A 2YDQA 2UUCT 4A98A 4G2AA 1VOMA 5IHYA 3AA1B 2I6HA 2V5CA 3ONLC 1KEYA 3LBXA 4NUUA 2BG9C 3QK6A 4TZ4C 1HG2A 1XNRT 2H7VC 3LBXB 3RYIE 3KV9A 2X68A 4BAYB 4QX8B 3UQ4A 3CPZA 4IE0A 2LSYA 3TKLB 3LG7A 4IDZA 4PK4A 3N9PA 1EZ3A 5BR8T 5AQFB 4GIWA 1LVKA 1WLXA 4OYJA 4ZI7E 4KMCA 5ABEA 2VVNA 2BKOA 4V1Av 3P7IA 3UUMA 2W61A 2NOXA 1I94T 4YSXA 1J5WA 4CXWA 4Q25A 4NPPA 3RIUC 4ILCA 2AXDS 3Q5WA 1Z0PA 3AVSA 1VCTA 5JDNA 3PJAA 1HS7A 5L3EB 2UXXB 4DUYT 2CWOA 2XZEA 2CM0A 2WWUA 3LK2B 2MOZA 3AEAA 1SUMB 4UVCB 4E7SA 2A3DA 5EK3A 3K1SA 1WCRA 3NWIA 2VL8A 5FY0A 5JDQA 5AQLB 2IW5B 2CBIA 3ZMSB 1IJ6A 2YU2A 4ZOLE 1XZYA 1IJ5A 5J0ZA 1KFYA 3RC8A 4X64T 4O4LE 2XAGB 4TV9E 2J62A 2V7JA 3N9MA 5AQVB 4IHJE 5F5WA 4BA9A 1KF6A 4QX7B 3C64A 3UFEA 4U33A 2WU5A 2EHOD 2XSAA 3CKDA 4IDNA 2IC9A 2VURA 2C5JA 2VWAA 2X9XA 3VHLA 5AQNB 4FJOA 2J4GA 1OXZA 2QGSA 3P8CD 2OLTA 2VB6A 4KHPT 5L4EA 2KWIB 4ADZA 4UV8B 1US7B 5FVLA 4X66T 3Q5XA 1HCIA 2E9XD 5HXCA 1IZNB 4HFIA 3VKHA 3UT5E 4QHOA 4NXNT 1UX5A 3GWHA 1ZP0A 4KBMB 3HKBE 1MIWA 4K0UA 4JLEA 4ZEYA 4IDQA 4ERRA 4ZI3D 1NWMX 2PG8A 4EEBA 5ABFA 1D0XA 3PV0F 4DVDA 4JUYA 4F8HA 4O4JE 4KUMB 3ZSTA 5ABFB 1T8BA 4JI1T 2CA5A 4F6RC 5IUXA 3B57A 2HPLA 3AE5A 4ISSA 3ZT7A 4JI3T 2IUBA 5JRCA 2LHNA 2MTQA 2WZHA 5DJQC 3UQ7A 1R8IA 2H3RA 2K5BB 1QLBA 2BKPA 5JRCB 1XMQT 1WR6A 4U2YA 3VRAA 5GONE 5HEJA 2LOPA 5AQJB 4P09A 2DL1A 4GOUA 4H63V 4CXYA 1HNZT 1Y64B 2DHRA 2YKSA 2YOEA 3Q9DA 3ETUA 3RKOA 4DBQA 4LF6T 4KX6A 1OWAA 4JEHB 3RH3A 2HH7A 3CVRA 1X9BA 1OEDC 4B6XA 2XASB 3HI2A 1IAPA 1O3XA 3CX7B 5LA6E 4QWNB 5HXRA 5FY1A 2BBHA 5CGMA 5JQGE 3LDQB 3JADA 2Q9QC 2H7OA 1HX1B 5LMUT 4HE8A 3J9X1 2Y6XA 4M1PA 3UTKA 4ZZCA 4PJNA 2W2UA 5JTGA 2VKHA 2ZM8A 5L4HA 1X79A 4J2CA 4KP3C 2FBWA 2PFVA 1E1HB 4MLKA 1J5ET 1HNWT 4OX9T 2JQHA 4EGWA 4AQGA 4ZXLA 2V6YA 4P0AA 4EAHA 3OPCA 1W09A 3FHNA 2VL0A 4I43B 3QUJA 5ETWA 5C3JA 2L3LA 4UEMA 1QUUA 2V6YB 4OYKA 4HWHA 3SS1A 1QSDA 2XAJB 1HF8A 4AXPA 3EHZA 3F31A 5J1GA 1D1BA 4HFEA 3ESLA 1MNEA 5AQSB 3AE6A 3LK42 3B5MA 2KSRA 5C2TA 5L3BB 5HEOA 4XZCA 2IHR1 4HEAA 2LSJA
chains in the Genus database with same CATH topology
5EK4A 4GK0E 5LCYA 2Z6EA 4DMVA 1HTJF 2JMHA 3VU7H 3NRXA 5HXSA 5LHIB 3VKGA 3K3QC 3CWZB 2CEAA 4WBNE 1MMDA 4UXNB 3KV6A 3E0ZA 3ZMZB 1SA0E 4EZHA 5M4YA 4X1IE 4MALA 4AI6A 2YINA 4G2AA 1ZV4X 3CQCB 2NW7A 1VOMA 2LSIA 2IAKA 5IHYA 2D2SA 5LGUB 2L9QA 2M67A 2V7IA 3AA1B 3GMIA 3NZPA 3LBXA 4HTEA 1WYBA 2YEVC 3KBTA 3L09A 3N9LA 4NUUA 3O1JA 4IGUA 3ANWA 4CXXA 3ZYKA 4AQFC 5AFUL 3QK6A 2C5IT 4FI5A 4MHCA 4TZ4C 1ZKEA 1HG2A 2H7VC 3LBXB 3RYIE 1LRZA 4HFVA 4AQFA 5CA1E 1ZHCA 1D0ZA 3KV9A 3N9NA 2X68A 4BAYB 4QX8B 5LBMA 1YD8G 3CPZA 2CWYA 4IE0A 2LSYA 4I55E 3TKLB 3LG7A 2KZ7B 4IDZA 4PK4A 3N9PA 5DABA 3A5XA 5JR9C 1EZ3A 1V9DA 2DCFA 5E0OA 3F57A 4GIWA 3V5UA 1WRDA 1LVKA 4BJMA 4CZZB 3E22E 4EB6E 2W62A 3GA8A 2WBLA 1MMAA 2JPFA 5EZYE 1WYCA 4I4TE 3I9YA 2ZM0A 4EOZB 1WLXA 2P9BA 2XHEB 3OJAA 4OYJA 5JREA 4ZI7E 4KMCA 4OFZA 2PBIA 4V1Av 3P7IA 2CXDA 4WW0A 3MK7C 3UUMA 4A56A 2N1GA 5LJMA 5FXXA 2K48A 2BDEA 2SPCA 3ZMTB 1T98A 1MMNA 3BQLA 5FXWA 2W61A 1SHZC 3FBZA 2NOXA 2X67A 3O1IA 4IE6A 3RYFE 2EHOA 2CCQA 1MMGA 2DLRA 2VK9A 3E08A 4TX5A 2C0SA 4CXWA 1CUNA 4OHFA 3AVRA 2OA5A 1ZEEA 4H9PC 2C5KT 2DI4A 3B13A 4JEUB 1MIYA 2EHOB 3ZLIA 2E8IA 1D1CA 5H6QB 1S94A 1KNZA 3LJCA 5LBQB 3CX6B 4PK5A 2I59A 3ZEFB 2V1DB 4DO0A 5LXTE 3K3NA 3Q5WA 2CLYC 3LFMA 3PU8A 1Z0PA 3AVSA 3C98B 3CQXC 3HA4A 4IIJE 4PK6A 5EK2A 3SWHA 3FBLA 2Y8DA 5F8PA 5JDNA 3ZJ2A 1HS7A 5L3EB 4O2AE 5HAXA 2GK9A 2UXXB 2CWOA 3PTRB 2NW9A 2CM0A 2WWUA 3D0TA 3LK2B 2MOZA 2LSGA 3I0QA 2ODVA 4YJ3E 4UVCB 2KNDA 4E7SA 2X51A 2A3DA 4UELA 2XQYA 2E9XA 2KINB 3HKEE 5EK3A 5HWYA 3MZKB 4PFPA 3KVBA 3FB2A 2VL8A 3HKCE 5FY0A 3H3AA 2VKOA 3RC3A 3N2KE 3AAEB 2E9XB 4GK5E 5JDQA 2IW5B 3K3OA 2RA1A 2LHRA 3KV5A 1IJ6A 3ZMSB 3PUSA 2N2NA 2YU2A 1G8XA 3AAIA 5LGNB 4ZOLE 4ZS3A 3DTOA 1IJ5A 5A1LA 2X66A 3U3IA 3RC8A 5L3GB 4O4LE 2NWBA 4H9NC 4PFOA 4YLHA 5JDHA 2XAGB 4TV9E 4EYUA 4YFSA 1FEWA 2KWHA 4DMWA 2V7JA 3AA7B 2NTXA 3MXZA 3N9MA 4H9QC 1KK7A 5H6RB 4IHJE 1D0YA 5DQWA 3ONXA 4TV8E 3RPUA 5LNKA 3PURA 3R6NA 4BA9A 4U72A 4QX7B 3C64A 3UFEA 4ZHQE 2X0LB 4I50E 2XTLA 5HWXA 3ZMVB 2EHOD 2V7LA 1MNDA 2IC6A 5KDMC 3O4XE 3ETVA 1MIVA 2K24A 2W00A 3WAKA 1BR1A 3CKDA 2IC9A 2C5JA 4QXCB 3BK9A 5L3DB 2ACXA 2VWAA 2X9XA 3VHLA 1FIOA 3SRZA 5LOVE 5KX5E 2MBGA 2LT3A 3CQGB 3O9XA 3N2OA 3CX8B 3PUQA 4H9RC 5HYAA 4FJOA 2Y48B 5JDFA 4DBRA 4CI2B 3S4UA 1OXZA 2QGSA 3P8CD 5FNVE 2ZLYA 2WSSV 2VB6A 4BJNA 3RYHE 3UUXB 3C4ZA 5FXZA 2J1DG 2CMRA 2D0UA 3F2EA 4CI3B 3MA9A 4UVAB 4CI1B 2KWIB 3EVYA 2EHOC 4ADZA 2ES0A 4UV8B 3J7Yq 3WI3A 1US7B 3Q5XA 4ANJA 4IE7A 2XAHB 1HCIA 3I9WA 4O8SA 2E9XD 4X20E 4DNDA 2NW8A 4HGAA 5HXCA 1IZNB 4IE5A 3R84B 3UUNA 3H37A 2VKJA 3PE0A 3VKHA 2NTYA 2LSKA 2Q9QA 3ZCJA 3IEEA 3UULA 5J2UE 1HG5A 3AA0B 3UT5E 4QHOA 2WMOA 1UX5A 3L3PA 3JC6D 3FXDB 5J2TE 2VKDA 3GWHA 4KBMB 3AAAB 2V7KA 3HKBE 1MIWA 2Q9QB 5JR9B 1LKXA 3RRCA 3C4XA 4K0UA 5L2LA 1BR0A 2LJLA 4UVBB 2G0UA 2V7MA 4JLEA 2X9YA 2JQQA 2DNXA 3ZYLA 4N78D 3MJXA 3RX6A 4ERRA 3DJBA 2A72A 1NWMX 4ZI3D 3NZQA 2ZMAA 3OYZA 2PG8A 3ZCIA 5HXEA 2YK0A 5JDGA 4Z8XA 4YHJA 1D0XA 2JJ9A 5L3FB 2DWGA 4DVDA 3IF8B 5LHHB 3KDSE 4PJLA 5BMVE 2MYSA 4JUYA 3N5LA 5FY7A 4O4JE 5JDLA 5LHGB 4UIGA 2BZBA 4KUMB 4IE4A 1UX4A 4PJJA 2E9XC 1UCUA 4O4HE 4C90A 1BR2A 2LE8A 4ISTA 2CA5A 4F6RC 4ZS2A 3B57A 5FMNA 2LM9A 1YW0A 3N2GE 3JC6C 2HPLA 2XAQB 4ISSA 4H63H 3NRYA 2D0TA 5JRCA 2ZM2A 1LVFA 2LHNA 2MTQA 4ZI2D 5DJQC 4E7ZA 4ZI3C 5FYMA 2H3RA 2K5BB 4OK0A 2CLYB 2KT9A 4P0BA 5JRCB 2NP9A 4MBQA 3MKDA 3NBXX 1WR6A 4GYRA 5FP3A 4H9OC 4EXTA 5GONE 4AKRB 2LOPA 5JDMA 2PJQA 5TAOA 4ASKA 3QC9A 2WAUA 4P09A 4PNIA 4GOUA 4XBFB 3HKDE 4H63V 5JH7E 4CXYA 1Y64B 2DHRA 5LG4A 5HXHA 3IBPA 2UXNB 3Q9DA 4HKAA 4XAXB 3V5SA 4YJ2E 3ETUA 4TUYE 2A2FX 2Q9QD 2K9AA 1AJ3A 1G73A 3RKOA 4DBQA 4EIWA 2V26A 5CA0E 5ADXL 1OWAA 4X1KE 4ZI2C 1NAFA 4JEHB 1H7CA 3RYCE 5LGTB 5DQVA 3ZC1A 4AKGA 3RH3A 4U74A 1BR4A 2HH7A 3CVRA 2KLQA 4B6XA 2XASB 3Q2MA 1VRBA 1U4QA 3HI2A 1IAPA 2QA7A 3CMLA 3FXEB 2VASA 2XUEA 2L8KA 3ZN1B 1YKEB 4WNKA 5IYZE 2JMKA 2CXLA 4AKHA 1O3XA 3CX7B 3T8OA 5LA6E 3HR0A 4QWNB 3GN5A 5HXRA 3ANWB 3ZMUB 5FY1A 3PUGA 4QXBB 3C51A 5C8YE 5JQGE 3EDUA 1HX8A 3GN5B 2Q9QC 5KMGP 2KXPB 2HPJA 3AB3B 4QXHB 2H7OA 3U78A 4CQIA 5L3CB 5CB4E 1S35A 4HE8A 3KFWX 4TN7B 5JR9A 3J9X1 3W15B 2Y6XA 4M1PA 3UTKA 3EDVA 3BQKA 4NUVA 4PJNA 4PW8A 4O2BE 1D1AA 2VKHA 3WAJA 3K8PC 4L9IA 2X9WA 2KMFA 2ZM8A 1X79A 4J2CA 4KP3C 4QKNA 2PFVA 2LOSA 1E1HB 1U5PA 3KINB 4MLKA 4EZ4A 2BVMA 3AA6B 4X1YE 2JRKA 4PAGA 4AKLA 1YKHB 5F3JA 1FMWA 4AKIA 5LJNA 3N9OA 3KVAA 3OBVE 4AQGA 3IHRA 3O1HA 1FMVA 4C91A 4P0AA 2CE7A 4EAHA 4GYSA 3PU3A 3PDYA 3FHNA 3ZC0A 4I43B 3I1AA 3QUJA 5ETWA 2L3LA 3KV4A 5JVDE 4UEMA 2B1EA 1QUUA 3OKQA 4EYYR 4O4IE 4OYKA 3ZYMA 3ZJ1A 3SS1A 1QSDA 2W0GA 2D5UA 4WBOA 2XAJB 1HF8A 3M65A 2YU1A 5LP6E 3ZN0B 4AXPA 2WM9A 1HFAA 4H9SE 2XAFB 3ZPOA 3OYXA 3N9QA 3F31A 2BVLA 3MACA 2LEHA 3PUAA 4PJMA 4L5GA 4UV9B 3C50A 3EUHA 3HL6A 5J1GA 3DP7A 1B7TA 1D1BA 3ESLA 3KBUA 4ILUA 4UF0A 2DWKA 1MNEA 2W63A 3BQIA 2CXFA 3RRWA 3C4WA 4HN9A 4L0RA 3SOLA 5FXVA 2RP4A 2N9DA 4G63A 3LK42 2WMNA 2X9HA 2ODUA 5L3BB 3LK3B 3I0OA 4XZCA 4UF0B 4HEAA 5LYJE 4MFRA 2LSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EK4 A;  3E08 A;  2V7L A;  4HKA A;  1ZEE A;  2NW9 A;  4PW8 A;  2D0U A;  2V7K A;  2X66 A;  2X68 A;  3BK9 A;  4PK5 A;  5ETW A;  2NWB A;  2NW7 A;  2V7M A;  5EK3 A;  2V7J A;  1YW0 A;  2NOX A;  2X67 A;  4U74 A;  2V7I A;  4PK6 A;  5EK2 A;  2NW8 A;  4U72 A;  2D0T A; 
#chains in the Genus database with same CATH topology
 5EK4 A;  3PUY F;  2JMH A;  3NRX A;  2XQ6 A;  4X5T A;  2X0Y A;  3E0Z A;  1JNR A;  2YIN A;  1IBK T;  2NW7 A;  3AE7 A;  1NEN A;  4A5X A;  3CIR A;  2M67 A;  2V7I A;  3KBT A;  4LML A;  3RHW A;  3O1J A;  3ANW A;  2C5I T;  1T7S A;  1ZKE A;  3P4R A;  1D0Z A;  4DR1 T;  4LF4 T;  3PUX F;  5FL0 A;  5LBM A;  1YD8 G;  4YHH T;  4ILA A;  4LF7 T;  2AE9 A;  5HEG A;  4CN1 A;  5JR9 C;  2A9U A;  3AEB A;  2DCF A;  5E0O A;  3F57 A;  3V5U A;  4CZZ B;  3E22 E;  4YXD A;  3G06 A;  4YT0 A;  1MMA A;  1WYC A;  4EOZ B;  2FUP A;  2P9B A;  3UUB A;  2QYW A;  3ONJ A;  3MK7 C;  4A56 A;  5AQG B;  5FXX A;  3P4P A;  3BQL A;  1MMN A;  3O1I A;  4IE6 A;  3RYF E;  2EHO A;  2DLR A;  5HEU A;  3UFG A;  2C0S A;  2W67 A;  2OA5 A;  2C5K T;  3B13 A;  1T72 A;  2EHO B;  2HN2 A;  1YQ4 A;  2ACZ A;  1N32 T;  5HCM A;  5LBQ B;  2I59 A;  2V1D B;  4DO0 A;  3Q5D A;  3AE3 A;  2CLY C;  3CK6 A;  2UUB T;  3EI0 A;  4JI2 T;  3PTR B;  3D0T A;  3FZL B;  4IDP A;  2X51 A;  1M62 A;  2E9X A;  2KIN B;  3MZK B;  4YTM A;  4HFC A;  1HR0 T;  3FB2 A;  4HFD A;  4HWC A;  2VKO A;  2E9X B;  3TLV A;  2RA1 A;  1G8X A;  2QVA A;  4ZS3 A;  3DTO A;  5A1L A;  2X66 A;  4H9N C;  4YLH A;  4EYU A;  4YFS A;  2KWH A;  3MXZ A;  4WZX A;  3ONX A;  5LNK A;  5HWX A;  2X0L B;  3QB5 K;  2WY2 A;  2IC6 A;  4QH5 A;  3O4X E;  3ETV A;  2K24 A;  4IDO A;  1BR1 A;  3AE9 A;  2V5D A;  5L3D B;  4QXC B;  3BK9 A;  2ACX A;  4HWD A;  4AQY T;  5KX5 E;  4H9R C;  4LFC T;  2HHH T;  5JDF A;  4DBR A;  4CI2 B;  3S4U A;  5FNV E;  3RYH E;  4YTP A;  2J1D G;  2CMR A;  1DU2 A;  4CI3 B;  4B3M T;  2BG9 E;  4CI1 B;  2ES0 A;  3L39 A;  3AEG A;  3WI3 A;  5FVK A;  4DND A;  4HGA A;  1UUR A;  4IE5 A;  4QH1 A;  3PE0 A;  3IEE A;  1Z8U A;  4HFH A;  3JC6 D;  3QOF A;  5AQR B;  2V7K A;  3C4X A;  2G0U A;  2V7M A;  2DNX A;  4DV5 T;  3MJX A;  3NZQ A;  5HXE A;  2YK0 A;  5JDG A;  4DV7 T;  4Z8X A;  4YHJ A;  2YDR A;  4PJL A;  2I0M A;  3N5L A;  4KI0 F;  1YQ3 A;  4UIG A;  4U3C A;  4C90 A;  5IWA T;  2LE8 A;  4IST A;  1SE7 A;  4Z91 A;  1YW0 A;  2XAQ B;  4AIS A;  2XQ8 A;  2ZM2 A;  3LSV A;  2D9D A;  4E7Z A;  4OK0 A;  2KT9 A;  4U7Y A;  2M6B A;  3ZT6 A;  4EXT A;  4PNI A;  2JQK A;  1JNZ A;  5LG4 A;  5HXH A;  4HKA A;  4XAX B;  1E7P A;  4EIW A;  2LM2 A;  2LRL A;  5CA0 E;  2WQY A;  4ZI2 C;  2VQE T;  5DQV A;  3ZC1 A;  4IL9 A;  3RF1 A;  2XM2 A;  5LG3 A;  3Q2M A;  2WS3 A;  1U4Q A;  2QA7 A;  2VAS A;  3VR9 A;  2L8K A;  3AE4 A;  3ZN1 B;  3QB5 A;  5IYZ E;  4AKH A;  2CHN A;  1UGO A;  3PUG A;  4QXB B;  3PUV F;  3RGL A;  3EDU A;  4JI7 T;  3FZK B;  4QXH B;  1KNR A;  3U78 A;  5CB4 E;  3KFW X;  1E2A A;  4TN7 B;  3W15 B;  4JI5 T;  5AQM B;  4NUV A;  4YSZ A;  1D1A A;  3FZM B;  2X9W A;  2KMF A;  4QKN A;  2LOS A;  1U5P A;  4UR9 A;  4PAG A;  1YKH B;  3P4Q A;  2NR4 A;  5F3J A;  3AEC A;  5LJN A;  3OBV E;  3UU5 A;  3IHR A;  2UXC T;  1FMV A;  2CE7 A;  3PU3 A;  3ZC0 A;  4DV0 T;  3I1A A;  3OKQ A;  3ZYM A;  4DV3 T;  1IBL T;  2D5U A;  2PTF A;  3M65 A;  3ZN0 B;  4H9S E;  3ZPO A;  2BVL A;  3MAC A;  3EUH A;  3RQW A;  4U7I A;  2MAW A;  2W63 A;  4EED A;  3M3Z B;  2LRK A;  1XDP A;  2N9D A;  4G63 A;  3PUW F;  4CN4 A;  2CBJ A;  2X9H A;  3RI5 A;  3LK3 B;  3TLT A;  3PJA J;  5ABG A;  5LHI B;  4DMV A;  3VU7 H;  3K3Q C;  4UXN B;  3ZMZ B;  1SA0 E;  4U2Z A;  4MAL A;  4JV5 T;  1ZV4 X;  2LSI A;  4TWH A;  5LGU B;  2L9Q A;  2OV9 A;  3JAF A;  3NZP A;  4DV2 T;  4HTE A;  1WYB A;  3N9L A;  4GKK T;  3ZYK A;  4AQF C;  4MHC A;  3FZF B;  2XQA A;  2XM1 A;  4AQF A;  1ZHC A;  3N9N A;  4TWF A;  2CWY A;  3P4W A;  4I55 E;  2UUA T;  5DAB A;  1V9D A;  4YY3 T;  1WRD A;  4EB6 E;  3GA8 A;  3AED A;  3OTO T;  3AE8 A;  5EZY E;  4I4T E;  3I9Y A;  2ZM0 A;  4LF8 T;  1OED E;  2FJE A;  5JRE A;  4OFZ A;  2PBI A;  2CXD A;  5LJM A;  2SPC A;  3ZMT B;  5FXW A;  1SHZ C;  2X67 A;  1NEK A;  1WFD A;  3TLW A;  2VK9 A;  3E08 A;  1CUN A;  4OHF A;  4H9P C;  2DI4 A;  4DID B;  4JEU B;  1N34 T;  5H6Q B;  1KNZ A;  3CX6 B;  2UXB T;  3ZEF B;  5LXT E;  3LFM A;  3PU8 A;  2K3W A;  3HA4 A;  4PK6 A;  3FBL A;  2Y8D A;  5HAX A;  2GK9 A;  4JYA T;  2NW9 A;  4CN6 A;  3NVO A;  2ODV A;  5AQT B;  4YJ3 E;  4UEL A;  2XQY A;  3HKE E;  1XMO T;  5HWY A;  4HFB A;  3KVB A;  2XJ7 A;  3VR8 A;  4DR5 T;  3RC3 A;  3N2K E;  3UU4 A;  3KV5 A;  3PUS A;  2N2N A;  5LGN B;  4QH4 A;  3FZH B;  3U3I A;  2LKH A;  2NWB A;  5JDH A;  4PFO A;  1I6Z A;  1FEW A;  4DMW A;  4H9Q C;  5H6R B;  1D0Y A;  4TV8 E;  3PUR A;  3R6N A;  4B3S T;  4U72 A;  2XTL A;  1VCS A;  3ZMV B;  3AXJ A;  1MND A;  5KDM C;  1UK5 A;  3WAK A;  4JI0 T;  3AXJ B;  4DV4 T;  5LOV E;  2LT3 A;  3PUQ A;  5HYA A;  2XY8 B;  1ZOY A;  2H89 A;  1N33 T;  2ZLY A;  2BKN A;  5AQP B;  2D0U A;  3RQU A;  3RKG A;  3MA9 A;  4UVA B;  2R6G F;  4KHZ F;  2EHO C;  5L47 A;  4DR7 T;  3I9W A;  1M7K A;  2XQ7 A;  3R84 B;  3UUN A;  2LLY A;  3H37 A;  2VKJ A;  3TLS A;  2NTY A;  2LSK A;  3ZCJ A;  2XSB A;  3UUL A;  5AQK B;  2WMO A;  2F4V T;  5JR9 B;  3RRC A;  2LJL A;  4UVB B;  4NXM T;  2X9Y A;  2JQQ A;  3ZYL A;  4N78 D;  3DJB A;  2ZMA A;  3ZCI A;  2JJ9 A;  3IF8 B;  5BMV E;  1YXR A;  5FY7 A;  3A8Y C;  5LHG B;  3UU8 A;  2BZB A;  1UX4 A;  2E9X C;  1UCU A;  4O4H E;  2WDV A;  1BR2 A;  4DV1 T;  5FMN A;  2LM9 A;  1J1J A;  3L8R A;  2QRX A;  2B76 A;  4ZI3 C;  5FYM A;  2CLY B;  5KXJ A;  4MBQ A;  3UU3 A;  1FJG T;  2ZM6 T;  4ILB A;  3TLU A;  5FP3 A;  4H9O C;  4AKR B;  2PJQ A;  5TAO A;  4ASK A;  3H3M A;  3ZT5 A;  4XBF B;  3HKD E;  5JH7 E;  2W4X A;  5ABH A;  4DR3 T;  3V5S A;  2UXN B;  4TUY E;  2A2F X;  2WU2 A;  2Q9Q D;  4AIU A;  1G73 A;  2V26 A;  2WCA A;  4X1K E;  4LF5 T;  1H7C A;  2JIW A;  4JI8 T;  4AKG A;  4U74 A;  1BR4 A;  2XQ9 A;  3IA3 A;  5CFB A;  1VRB A;  3CML A;  2XUE A;  4JI4 T;  3AEE A;  2WDR A;  2V6X A;  2JMK A;  2CXL A;  2BG9 A;  3HR0 A;  3GN5 A;  4TNW A;  3ZMU B;  3C51 A;  2BG9 B;  1KNP A;  3GN5 B;  5KMG P;  2HPJ A;  3AB3 B;  3Q5E A;  5L3C B;  4HWF A;  4LFA T;  3BQK A;  4O2B E;  3K8P C;  4ZZB A;  2XPK A;  4JBW F;  1W0A A;  2JRK A;  4AKL A;  4AKI A;  3KVA A;  4GYS A;  3PDY A;  3RIU A;  3KV4 A;  5JVD E;  4EYY R;  2FJD A;  4I0U A;  2E5L T;  3RLF F;  2W0G A;  2YU1 A;  5AQI B;  2LKG A;  1HFA A;  3PUA A;  4DR6 T;  4UV9 B;  3C50 A;  3HL6 A;  1B7T A;  4UF0 A;  2V8S V;  3C4W A;  4HN9 A;  2RP4 A;  2WMN A;  2ODU A;  3I0O A;  4UF0 B;  5LYJ E;  4MFR A;  1WR0 A;  1CHU A;  4GK0 E;  1HTJ F;  5CJ5 A;  5HXS A;  3VKG A;  5AQO B;  3CWZ B;  2CEA A;  1MMD A;  3KV6 A;  4X62 T;  1XWM A;  3CQC B;  4IT4 A;  2IAK A;  2D2S A;  2WDQ A;  3GMI A;  2RPA A;  2YEV C;  3L09 A;  4IGU A;  4CXX A;  2WWV A;  5AFU L;  4FI5 A;  3UU6 A;  4LMJ A;  2YN6 A;  1LRZ A;  4HFV A;  5CA1 E;  2CPT A;  1XDO A;  3EAM A;  2KZ7 B;  3A5X A;  4BJM A;  4HWI B;  2W62 A;  2WBL A;  2JPF A;  2XHE B;  3OJA A;  1L0V A;  3T1Y T;  4WW0 A;  2N1G A;  2FJB A;  2K48 A;  2BDE A;  1T98 A;  2XQ4 A;  3FBZ A;  3EAB A;  2CCQ A;  1MMG A;  2J47 A;  2BS2 A;  2HN1 A;  4TX5 A;  3AVR A;  1ZEE A;  3RIF A;  2XQ5 A;  2UU9 T;  2BBJ A;  3SFE A;  1MIY A;  2VQF T;  3ZLI A;  2E8I A;  1D1C A;  4LF9 T;  1S94 A;  3LJC A;  2IML A;  4PK5 A;  1W0B A;  3K3N A;  1GQE A;  3C98 B;  3CQX C;  4IIJ E;  5FKY A;  5EK2 A;  3SWH A;  5F8P A;  3ZJ2 A;  4O2A E;  3ZSS A;  3ABV A;  2YDS A;  2LSG A;  5AQH B;  3I0Q A;  1UUS A;  3JCF A;  2KND A;  4Z90 A;  4PFP A;  3HKC E;  3H3A A;  2X0H A;  2M6I A;  3AAE B;  4GK5 E;  2WZI A;  3K3O A;  2LHR A;  3AAI A;  4DV6 T;  5L3G B;  2UXD T;  5HEH A;  3AA7 B;  2NTX A;  1KK7 A;  5DQW A;  2E2A A;  3RPU A;  1IBM T;  3PUZ F;  4U31 A;  2IDO B;  4ZHQ E;  4I50 E;  2V7L A;  1MIV A;  2W00 A;  1FIO A;  3JAE A;  3SRZ A;  2MBG A;  3CQG B;  3O9X A;  3N2O A;  3CX8 B;  2Y48 B;  4TNV A;  1OED A;  2WSS V;  4BJN A;  1N36 T;  3UUX B;  3C4Z A;  5FXZ A;  3F2E A;  1OED B;  3EVY A;  2VVS A;  3J7Y q;  2CHO A;  4ANJ A;  4IE7 A;  2XAH B;  4O8S A;  4X20 E;  4NIQ A;  2NW8 A;  3QNU A;  5LMN T;  2Q9Q A;  2H88 A;  5J2U E;  1HG5 A;  3AA0 B;  5AQQ B;  4LMK A;  3L3P A;  3FXD B;  5J2T E;  2VKD A;  3AAA B;  2Q9Q B;  1LKX A;  1BR0 A;  3AE1 A;  5L2L A;  3A7M A;  3RX6 A;  2A72 A;  2JQ9 A;  3OYZ A;  5LB7 B;  5L3F B;  5LHH B;  2DWG A;  3KDS E;  2BS4 A;  2MYS A;  5JDL A;  4X65 T;  4YTN A;  4IE4 A;  4IRE A;  4PJJ A;  4ZS2 A;  3N2G E;  3JC6 C;  3VRB A;  4H63 H;  3NRY A;  2D0T A;  4EV6 A;  1LVF A;  2IIU A;  4ZI2 D;  4JI6 T;  4LFB T;  5HCJ A;  2BS3 A;  4P0B A;  4GKJ T;  2NP9 A;  3MKD A;  3NBX X;  4GYR A;  4P1N A;  4DR4 T;  5JDM A;  4COF A;  3QC9 A;  2WAU A;  3T1H T;  3NKZ A;  4DR2 T;  3IBP A;  4YJ2 E;  2K9A A;  1AJ3 A;  2XQ3 A;  5ADX L;  1NAF A;  3RYC E;  5LGT B;  1Y01 A;  2KLQ A;  4WYV A;  3FXE B;  1YKE B;  4IL4 A;  4WNK A;  5AQU B;  3X1D A;  3T8O A;  3SFD A;  3ANW B;  4K0K T;  3P4S A;  2MPK A;  4B3T T;  4B3R T;  5C8Y E;  5FL1 A;  2CRB A;  1HX8 A;  2KXP B;  3OVU A;  4CQI A;  1S35 A;  5JR9 A;  3EDV A;  4PW8 A;  3WAJ A;  3ZKR A;  2W66 A;  3AEF A;  4L9I A;  4TWD A;  3KIN B;  4EZ4 A;  2BVM A;  3AA6 B;  4X1Y E;  2WB5 A;  1HNX T;  1FMW A;  3N9O A;  1W9R A;  3O1H A;  4C91 A;  2FJA A;  2B1E A;  4O4I E;  1XNQ T;  3ZJ1 A;  4A97 A;  3P50 A;  4WBO A;  5LP6 E;  2WM9 A;  2XAF B;  3OYX A;  3N9Q A;  2LEH A;  4PJM A;  4L5G A;  4YSY A;  2WP9 A;  3DP7 A;  3KBU A;  3RIA A;  4ILU A;  2DWK A;  3BQI A;  2CXF A;  3RRW A;  4L0R A;  3SOL A;  5FXV A;  5LCY A;  2Z6E A;  4WBN E;  4EZH A;  3AE2 A;  2E5V A;  5M4Y A;  4X1I E;  4DUZ T;  4AI6 A;  2YDQ A;  2UUC T;  4A98 A;  4G2A A;  1VOM A;  5IHY A;  3AA1 B;  2I6H A;  2V5C A;  3ONL C;  1KEY A;  3LBX A;  4NUU A;  2BG9 C;  3QK6 A;  4TZ4 C;  1HG2 A;  1XNR T;  2H7V C;  3LBX B;  3RYI E;  3KV9 A;  2X68 A;  4BAY B;  4QX8 B;  3UQ4 A;  3CPZ A;  4IE0 A;  2LSY A;  3TKL B;  3LG7 A;  4IDZ A;  4PK4 A;  3N9P A;  1EZ3 A;  5BR8 T;  5AQF B;  4GIW A;  1LVK A;  1WLX A;  4OYJ A;  4ZI7 E;  4KMC A;  5ABE A;  2VVN A;  2BKO A;  4V1A v;  3P7I A;  3UUM A;  2W61 A;  2NOX A;  1I94 T;  4YSX A;  1J5W A;  4CXW A;  4Q25 A;  4NPP A;  3RIU C;  4ILC A;  2AXD S;  3Q5W A;  1Z0P A;  3AVS A;  1VCT A;  5JDN A;  3PJA A;  1HS7 A;  5L3E B;  2UXX B;  4DUY T;  2CWO A;  2XZE A;  2CM0 A;  2WWU A;  3LK2 B;  2MOZ A;  3AEA A;  1SUM B;  4UVC B;  4E7S A;  2A3D A;  5EK3 A;  3K1S A;  1WCR A;  3NWI A;  2VL8 A;  5FY0 A;  5JDQ A;  5AQL B;  2IW5 B;  2CBI A;  3ZMS B;  1IJ6 A;  2YU2 A;  4ZOL E;  1XZY A;  1IJ5 A;  5J0Z A;  1KFY A;  3RC8 A;  4X64 T;  4O4L E;  2XAG B;  4TV9 E;  2J62 A;  2V7J A;  3N9M A;  5AQV B;  4IHJ E;  5F5W A;  4BA9 A;  1KF6 A;  4QX7 B;  3C64 A;  3UFE A;  4U33 A;  2WU5 A;  2EHO D;  2XSA A;  3CKD A;  4IDN A;  2IC9 A;  2VUR A;  2C5J A;  2VWA A;  2X9X A;  3VHL A;  5AQN B;  4FJO A;  2J4G A;  1OXZ A;  2QGS A;  3P8C D;  2OLT A;  2VB6 A;  4KHP T;  5L4E A;  2KWI B;  4ADZ A;  4UV8 B;  1US7 B;  5FVL A;  4X66 T;  3Q5X A;  1HCI A;  2E9X D;  5HXC A;  1IZN B;  4HFI A;  3VKH A;  3UT5 E;  4QHO A;  4NXN T;  1UX5 A;  3GWH A;  1ZP0 A;  4KBM B;  3HKB E;  1MIW A;  4K0U A;  4JLE A;  4ZEY A;  4IDQ A;  4ERR A;  4ZI3 D;  1NWM X;  2PG8 A;  4EEB A;  5ABF A;  1D0X A;  3PV0 F;  4DVD A;  4JUY A;  4F8H A;  4O4J E;  4KUM B;  3ZST A;  5ABF B;  1T8B A;  4JI1 T;  2CA5 A;  4F6R C;  5IUX A;  3B57 A;  2HPL A;  3AE5 A;  4ISS A;  3ZT7 A;  4JI3 T;  2IUB A;  5JRC A;  2LHN A;  2MTQ A;  2WZH A;  5DJQ C;  3UQ7 A;  1R8I A;  2H3R A;  2K5B B;  1QLB A;  2BKP A;  5JRC B;  1XMQ T;  1WR6 A;  4U2Y A;  3VRA A;  5GON E;  5HEJ A;  2LOP A;  5AQJ B;  4P09 A;  2DL1 A;  4GOU A;  4H63 V;  4CXY A;  1HNZ T;  1Y64 B;  2DHR A;  2YKS A;  2YOE A;  3Q9D A;  3ETU A;  3RKO A;  4DBQ A;  4LF6 T;  4KX6 A;  1OWA A;  4JEH B;  3RH3 A;  2HH7 A;  3CVR A;  1X9B A;  1OED C;  4B6X A;  2XAS B;  3HI2 A;  1IAP A;  1O3X A;  3CX7 B;  5LA6 E;  4QWN B;  5HXR A;  5FY1 A;  2BBH A;  5CGM A;  5JQG E;  3LDQ B;  3JAD A;  2Q9Q C;  2H7O A;  1HX1 B;  5LMU T;  4HE8 A;  3J9X 1;  2Y6X A;  4M1P A;  3UTK A;  4ZZC A;  4PJN A;  2W2U A;  5JTG A;  2VKH A;  2ZM8 A;  5L4H A;  1X79 A;  4J2C A;  4KP3 C;  2FBW A;  2PFV A;  1E1H B;  4MLK A;  1J5E T;  1HNW T;  4OX9 T;  2JQH A;  4EGW A;  4AQG A;  4ZXL A;  2V6Y A;  4P0A A;  4EAH A;  3OPC A;  1W09 A;  3FHN A;  2VL0 A;  4I43 B;  3QUJ A;  5ETW A;  5C3J A;  2L3L A;  4UEM A;  1QUU A;  2V6Y B;  4OYK A;  4HWH A;  3SS1 A;  1QSD A;  2XAJ B;  1HF8 A;  4AXP A;  3EHZ A;  3F31 A;  5J1G A;  1D1B A;  4HFE A;  3ESL A;  1MNE A;  5AQS B;  3AE6 A;  3LK4 2;  3B5M A;  2KSR A;  5C2T A;  5L3B B;  5HEO A;  4XZC A;  2IHR 1;  4HEA A;  2LSJ A; 
#chains in the Genus database with same CATH homology
 5EK4 A;  4GK0 E;  5LCY A;  2Z6E A;  4DMV A;  1HTJ F;  2JMH A;  3VU7 H;  3NRX A;  5HXS A;  5LHI B;  3VKG A;  3K3Q C;  3CWZ B;  2CEA A;  4WBN E;  1MMD A;  4UXN B;  3KV6 A;  3E0Z A;  3ZMZ B;  1SA0 E;  4EZH A;  5M4Y A;  4X1I E;  4MAL A;  4AI6 A;  2YIN A;  4G2A A;  1ZV4 X;  3CQC B;  2NW7 A;  1VOM A;  2LSI A;  2IAK A;  5IHY A;  2D2S A;  5LGU B;  2L9Q A;  2M67 A;  2V7I A;  3AA1 B;  3GMI A;  3NZP A;  3LBX A;  4HTE A;  1WYB A;  2YEV C;  3KBT A;  3L09 A;  3N9L A;  4NUU A;  3O1J A;  4IGU A;  3ANW A;  4CXX A;  3ZYK A;  4AQF C;  5AFU L;  3QK6 A;  2C5I T;  4FI5 A;  4MHC A;  4TZ4 C;  1ZKE A;  1HG2 A;  2H7V C;  3LBX B;  3RYI E;  1LRZ A;  4HFV A;  4AQF A;  5CA1 E;  1ZHC A;  1D0Z A;  3KV9 A;  3N9N A;  2X68 A;  4BAY B;  4QX8 B;  5LBM A;  1YD8 G;  3CPZ A;  2CWY A;  4IE0 A;  2LSY A;  4I55 E;  3TKL B;  3LG7 A;  2KZ7 B;  4IDZ A;  4PK4 A;  3N9P A;  5DAB A;  3A5X A;  5JR9 C;  1EZ3 A;  1V9D A;  2DCF A;  5E0O A;  3F57 A;  4GIW A;  3V5U A;  1WRD A;  1LVK A;  4BJM A;  4CZZ B;  3E22 E;  4EB6 E;  2W62 A;  3GA8 A;  2WBL A;  1MMA A;  2JPF A;  5EZY E;  1WYC A;  4I4T E;  3I9Y A;  2ZM0 A;  4EOZ B;  1WLX A;  2P9B A;  2XHE B;  3OJA A;  4OYJ A;  5JRE A;  4ZI7 E;  4KMC A;  4OFZ A;  2PBI A;  4V1A v;  3P7I A;  2CXD A;  4WW0 A;  3MK7 C;  3UUM A;  4A56 A;  2N1G A;  5LJM A;  5FXX A;  2K48 A;  2BDE A;  2SPC A;  3ZMT B;  1T98 A;  1MMN A;  3BQL A;  5FXW A;  2W61 A;  1SHZ C;  3FBZ A;  2NOX A;  2X67 A;  3O1I A;  4IE6 A;  3RYF E;  2EHO A;  2CCQ A;  1MMG A;  2DLR A;  2VK9 A;  3E08 A;  4TX5 A;  2C0S A;  4CXW A;  1CUN A;  4OHF A;  3AVR A;  2OA5 A;  1ZEE A;  4H9P C;  2C5K T;  2DI4 A;  3B13 A;  4JEU B;  1MIY A;  2EHO B;  3ZLI A;  2E8I A;  1D1C A;  5H6Q B;  1S94 A;  1KNZ A;  3LJC A;  5LBQ B;  3CX6 B;  4PK5 A;  2I59 A;  3ZEF B;  2V1D B;  4DO0 A;  5LXT E;  3K3N A;  3Q5W A;  2CLY C;  3LFM A;  3PU8 A;  1Z0P A;  3AVS A;  3C98 B;  3CQX C;  3HA4 A;  4IIJ E;  4PK6 A;  5EK2 A;  3SWH A;  3FBL A;  2Y8D A;  5F8P A;  5JDN A;  3ZJ2 A;  1HS7 A;  5L3E B;  4O2A E;  5HAX A;  2GK9 A;  2UXX B;  2CWO A;  3PTR B;  2NW9 A;  2CM0 A;  2WWU A;  3D0T A;  3LK2 B;  2MOZ A;  2LSG A;  3I0Q A;  2ODV A;  4YJ3 E;  4UVC B;  2KND A;  4E7S A;  2X51 A;  2A3D A;  4UEL A;  2XQY A;  2E9X A;  2KIN B;  3HKE E;  5EK3 A;  5HWY A;  3MZK B;  4PFP A;  3KVB A;  3FB2 A;  2VL8 A;  3HKC E;  5FY0 A;  3H3A A;  2VKO A;  3RC3 A;  3N2K E;  3AAE B;  2E9X B;  4GK5 E;  5JDQ A;  2IW5 B;  3K3O A;  2RA1 A;  2LHR A;  3KV5 A;  1IJ6 A;  3ZMS B;  3PUS A;  2N2N A;  2YU2 A;  1G8X A;  3AAI A;  5LGN B;  4ZOL E;  4ZS3 A;  3DTO A;  1IJ5 A;  5A1L A;  2X66 A;  3U3I A;  3RC8 A;  5L3G B;  4O4L E;  2NWB A;  4H9N C;  4PFO A;  4YLH A;  5JDH A;  2XAG B;  4TV9 E;  4EYU A;  4YFS A;  1FEW A;  2KWH A;  4DMW A;  2V7J A;  3AA7 B;  2NTX A;  3MXZ A;  3N9M A;  4H9Q C;  1KK7 A;  5H6R B;  4IHJ E;  1D0Y A;  5DQW A;  3ONX A;  4TV8 E;  3RPU A;  5LNK A;  3PUR A;  3R6N A;  4BA9 A;  4U72 A;  4QX7 B;  3C64 A;  3UFE A;  4ZHQ E;  2X0L B;  4I50 E;  2XTL A;  5HWX A;  3ZMV B;  2EHO D;  2V7L A;  1MND A;  2IC6 A;  5KDM C;  3O4X E;  3ETV A;  1MIV A;  2K24 A;  2W00 A;  3WAK A;  1BR1 A;  3CKD A;  2IC9 A;  2C5J A;  4QXC B;  3BK9 A;  5L3D B;  2ACX A;  2VWA A;  2X9X A;  3VHL A;  1FIO A;  3SRZ A;  5LOV E;  5KX5 E;  2MBG A;  2LT3 A;  3CQG B;  3O9X A;  3N2O A;  3CX8 B;  3PUQ A;  4H9R C;  5HYA A;  4FJO A;  2Y48 B;  5JDF A;  4DBR A;  4CI2 B;  3S4U A;  1OXZ A;  2QGS A;  3P8C D;  5FNV E;  2ZLY A;  2WSS V;  2VB6 A;  4BJN A;  3RYH E;  3UUX B;  3C4Z A;  5FXZ A;  2J1D G;  2CMR A;  2D0U A;  3F2E A;  4CI3 B;  3MA9 A;  4UVA B;  4CI1 B;  2KWI B;  3EVY A;  2EHO C;  4ADZ A;  2ES0 A;  4UV8 B;  3J7Y q;  3WI3 A;  1US7 B;  3Q5X A;  4ANJ A;  4IE7 A;  2XAH B;  1HCI A;  3I9W A;  4O8S A;  2E9X D;  4X20 E;  4DND A;  2NW8 A;  4HGA A;  5HXC A;  1IZN B;  4IE5 A;  3R84 B;  3UUN A;  3H37 A;  2VKJ A;  3PE0 A;  3VKH A;  2NTY A;  2LSK A;  2Q9Q A;  3ZCJ A;  3IEE A;  3UUL A;  5J2U E;  1HG5 A;  3AA0 B;  3UT5 E;  4QHO A;  2WMO A;  1UX5 A;  3L3P A;  3JC6 D;  3FXD B;  5J2T E;  2VKD A;  3GWH A;  4KBM B;  3AAA B;  2V7K A;  3HKB E;  1MIW A;  2Q9Q B;  5JR9 B;  1LKX A;  3RRC A;  3C4X A;  4K0U A;  5L2L A;  1BR0 A;  2LJL A;  4UVB B;  2G0U A;  2V7M A;  4JLE A;  2X9Y A;  2JQQ A;  2DNX A;  3ZYL A;  4N78 D;  3MJX A;  3RX6 A;  4ERR A;  3DJB A;  2A72 A;  1NWM X;  4ZI3 D;  3NZQ A;  2ZMA A;  3OYZ A;  2PG8 A;  3ZCI A;  5HXE A;  2YK0 A;  5JDG A;  4Z8X A;  4YHJ A;  1D0X A;  2JJ9 A;  5L3F B;  2DWG A;  4DVD A;  3IF8 B;  5LHH B;  3KDS E;  4PJL A;  5BMV E;  2MYS A;  4JUY A;  3N5L A;  5FY7 A;  4O4J E;  5JDL A;  5LHG B;  4UIG A;  2BZB A;  4KUM B;  4IE4 A;  1UX4 A;  4PJJ A;  2E9X C;  1UCU A;  4O4H E;  4C90 A;  1BR2 A;  2LE8 A;  4IST A;  2CA5 A;  4F6R C;  4ZS2 A;  3B57 A;  5FMN A;  2LM9 A;  1YW0 A;  3N2G E;  3JC6 C;  2HPL A;  2XAQ B;  4ISS A;  4H63 H;  3NRY A;  2D0T A;  5JRC A;  2ZM2 A;  1LVF A;  2LHN A;  2MTQ A;  4ZI2 D;  5DJQ C;  4E7Z A;  4ZI3 C;  5FYM A;  2H3R A;  2K5B B;  4OK0 A;  2CLY B;  2KT9 A;  4P0B A;  5JRC B;  2NP9 A;  4MBQ A;  3MKD A;  3NBX X;  1WR6 A;  4GYR A;  5FP3 A;  4H9O C;  4EXT A;  5GON E;  4AKR B;  2LOP A;  5JDM A;  2PJQ A;  5TAO A;  4ASK A;  3QC9 A;  2WAU A;  4P09 A;  4PNI A;  4GOU A;  4XBF B;  3HKD E;  4H63 V;  5JH7 E;  4CXY A;  1Y64 B;  2DHR A;  5LG4 A;  5HXH A;  3IBP A;  2UXN B;  3Q9D A;  4HKA A;  4XAX B;  3V5S A;  4YJ2 E;  3ETU A;  4TUY E;  2A2F X;  2Q9Q D;  2K9A A;  1AJ3 A;  1G73 A;  3RKO A;  4DBQ A;  4EIW A;  2V26 A;  5CA0 E;  5ADX L;  1OWA A;  4X1K E;  4ZI2 C;  1NAF A;  4JEH B;  1H7C A;  3RYC E;  5LGT B;  5DQV A;  3ZC1 A;  4AKG A;  3RH3 A;  4U74 A;  1BR4 A;  2HH7 A;  3CVR A;  2KLQ A;  4B6X A;  2XAS B;  3Q2M A;  1VRB A;  1U4Q A;  3HI2 A;  1IAP A;  2QA7 A;  3CML A;  3FXE B;  2VAS A;  2XUE A;  2L8K A;  3ZN1 B;  1YKE B;  4WNK A;  5IYZ E;  2JMK A;  2CXL A;  4AKH A;  1O3X A;  3CX7 B;  3T8O A;  5LA6 E;  3HR0 A;  4QWN B;  3GN5 A;  5HXR A;  3ANW B;  3ZMU B;  5FY1 A;  3PUG A;  4QXB B;  3C51 A;  5C8Y E;  5JQG E;  3EDU A;  1HX8 A;  3GN5 B;  2Q9Q C;  5KMG P;  2KXP B;  2HPJ A;  3AB3 B;  4QXH B;  2H7O A;  3U78 A;  4CQI A;  5L3C B;  5CB4 E;  1S35 A;  4HE8 A;  3KFW X;  4TN7 B;  5JR9 A;  3J9X 1;  3W15 B;  2Y6X A;  4M1P A;  3UTK A;  3EDV A;  3BQK A;  4NUV A;  4PJN A;  4PW8 A;  4O2B E;  1D1A A;  2VKH A;  3WAJ A;  3K8P C;  4L9I A;  2X9W A;  2KMF A;  2ZM8 A;  1X79 A;  4J2C A;  4KP3 C;  4QKN A;  2PFV A;  2LOS A;  1E1H B;  1U5P A;  3KIN B;  4MLK A;  4EZ4 A;  2BVM A;  3AA6 B;  4X1Y E;  2JRK A;  4PAG A;  4AKL A;  1YKH B;  5F3J A;  1FMW A;  4AKI A;  5LJN A;  3N9O A;  3KVA A;  3OBV E;  4AQG A;  3IHR A;  3O1H A;  1FMV A;  4C91 A;  4P0A A;  2CE7 A;  4EAH A;  4GYS A;  3PU3 A;  3PDY A;  3FHN A;  3ZC0 A;  4I43 B;  3I1A A;  3QUJ A;  5ETW A;  2L3L A;  3KV4 A;  5JVD E;  4UEM A;  2B1E A;  1QUU A;  3OKQ A;  4EYY R;  4O4I E;  4OYK A;  3ZYM A;  3ZJ1 A;  3SS1 A;  1QSD A;  2W0G A;  2D5U A;  4WBO A;  2XAJ B;  1HF8 A;  3M65 A;  2YU1 A;  5LP6 E;  3ZN0 B;  4AXP A;  2WM9 A;  1HFA A;  4H9S E;  2XAF B;  3ZPO A;  3OYX A;  3N9Q A;  3F31 A;  2BVL A;  3MAC A;  2LEH A;  3PUA A;  4PJM A;  4L5G A;  4UV9 B;  3C50 A;  3EUH A;  3HL6 A;  5J1G A;  3DP7 A;  1B7T A;  1D1B A;  3ESL A;  3KBU A;  4ILU A;  4UF0 A;  2DWK A;  1MNE A;  2W63 A;  3BQI A;  2CXF A;  3RRW A;  3C4W A;  4HN9 A;  4L0R A;  3SOL A;  5FXV A;  2RP4 A;  2N9D A;  4G63 A;  3LK4 2;  2WMN A;  2X9H A;  2ODU A;  5L3B B;  3LK3 B;  3I0O A;  4XZC A;  4UF0 B;  4HEA A;  5LYJ E;  4MFR A;  2LSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...