1YW0A

Crystal structure of the tryptophan 2,3-dioxygenase from xanthomonas campestris. northeast structural genomics target xcr13.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
262
structure length
243
Chain Sequence
TYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords tryptophan 2,3-dioxygenase
publication title Crystal structure of the tryptophan 2,3-dioxygenase from Xanthomonas campestris. Northeast Structural Genomics Target XcR13.
rcsb
source organism Xanthomonas campestris pv. campestris str. atcc 33913
total genus 82
structure length 243
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yw0A00
4PW8A 4U72A 2V7MA 2X67A 5EK4A 2NWBA 2V7IA 4U74A 5EK3A 2NOXA 2V7LA 1ZEEA 2X66A 2D0TA 2V7JA 3E08A 4PK6A 2D0UA 4HKAA 2X68A 2NW9A 3BK9A 5ETWA 2V7KA 1YW0A 2NW7A 5EK2A 2NW8A 4PK5A
chains in the Genus database with same CATH superfamily
4U3CA 2WMNA 2WS3A 3OJAA 3C4WA 1X79A 5AQQB 1HX8A 4YY3T 1M62A 2LHRA 4CI3B 4HWDA 3LK3B 3VR9A 1KNRA 3TLWA 2UUBT 2UXNB 2Z6EA 1MIVA 2ODVA 4OYKA 2W63A 1KF6A 2LSIA 5L3CB 3B5MA 2IUBA 1OXZA 2PBIA 2UUAT 2BDEA 3HKEE 3FZMB 1D0XA 1YKEB 3RHWA 3G06A 3GA8A 4AXPA 3P4QA 3DJBA 3CX6B 3EDUA 5HXRA 4NXMT 2WZHA 5FKYA 3NVOA 3P4PA 4DUYT 3RKGA 1N32T 2YKSA 4EB6E 4H9NC 2V6YA 2UU9T 3UULA 2G0UA 1I94T 4DV5T 3TKLB 3ZLIA 3AXJA 5FYMA 2LRKA 4AKGA 4HN9A 1WR0A 5FP3A 3M3ZB 1JNRA 4KMCA 5LYJE 3TLUA 3FZHB 5ETWA 4MHCA 1W0BA 1HTJF 4QH4A 1NAFA 1XMOT 2L8KA 4IHJE 3C64A 2UUCT 5AQHB 4PJLA 3UT5E 4QHOA 4IDQA 3MZKB 3NBXX 4JBWF 4QXCB 4CZZB 3KVAA 3E08A 4BJMA 4DV0T 4AKRB 4ZHQE 4JEHB 4JI8T 4IE6A 4YSZA 2XAGB 2D5UA 5LP6E 4ANJA 5ABEA 3PJAA 3PTRB 4DR3T 5LNKA 4A97A 4JLEA 2V6XA 2XY8B 2Y48B 4UV9B 4B3TT 2FJDA 3W15B 4ILBA 4LMLA 3C4XA 2C0SA 5CGMA 2BS2A 4TX5A 4X1IE 4YJ3E 2LSGA 1HNXT 4ZZCA 4UR9A 2XAFB 4DNDA 1DU2A 1SA0E 4TNVA 3RRWA 4X1YE 3RH3A 4Z90A 2UXDT 3AAAB 3AE7A 5L2LA 2CEAA 2XHEB 3PV0F 4LF6T 2JIWA 1D1CA 3PUSA 4ASKA 5LMNT 4O4JE 4F6RC 2X9WA 4WW0A 5LG4A 1ZP0A 2VB6A 3EABA 3PDYA 5CA0E 4QXHB 4HFEA 3AVRA 3SFDA 3RC3A 2CA5A 1Z0PA 4CN6A 4DVDA 2DHRA 3N9LA 4WBOA 3PU3A 5CB4E 2BS3A 2WB5A 4JI2T 3K1SA 4GKJT 4IREA 2J62A 2HPLA 4ZS2A 3HR0A 3AEEA 4ZEYA 2X66A 4L9IA 3CMLA 1E7PA 2E2AA 4FJOA 5AQUB 2NR4A 4A56A 3RC8A 3QB5K 2JMHA 2X68A 3I0QA 3B57A 3J7Yq 4U2ZA 3AE4A 2JQQA 3EDVA 2XQ6A 2WM9A 4Z91A 3U3IA 1S94A 2WU5A 3RI5A 4QH1A 3HKCE 3RYHE 2BG9B 3D0TA 3ZT7A 3SS1A 3SRZA 1EZ3A 2I59A 4BJNA 3AA1B 2YDRA 3EAMA 4AIUA 2CCQA 3ZCIA 2WZIA 2BVLA 3NKZA 4GKKT 2ZMAA 3AA6B 2X9YA 3AAEB 1KNPA 3AEFA 1MMDA 3KBTA 3VRAA 3MXZA 1XNQT 3QUJA 3UU6A 2LEHA 2VVSA 4DMVA 2XQAA 4ADZA 2CRBA 3JC6D 3BK9A 4H9PC 2WDQA 2VKHA 1WYCA 3TLSA 2CWYA 4H9RC 2EHOB 1XDPA 4ISSA 5FXWA 2LE8A 4UELA 2X0YA 5HXEA 2YN6A 2JPFA 3PUVF 3VKGA 4PK6A 5LG3A 3HL6A 1YQ3A 1YKHB 2YINA 5LA6E 5HEUA 3CK6A 1UUSA 4YXDA 3ZMZB 3FZFB 1UK5A 2SPCA 4KHPT 4GK0E 3UQ4A 2KNDA 3Q2MA 5L3BB 4HWIB 4WNKA 2YDSA 2CMRA 3Q5EA 5AQNB 2W2UA 3AE9A 3GMIA 1IBMT 2CWOA 4KX6A 2A72A 3ZC0A 4NIQA 2X0HA 3ZPOA 1US7B 2CBJA 4UXNB 2OV9A 2M6BA 5JREA 5H6QB 4JYAT 3JC6C 1VRBA 5JRCB 4CN1A 4PNIA 2NOXA 4WBNE 3M65A 4X66T 3LSVA 5FVLA 1IJ6A 2H3RA 4ZI2D 2V7KA 3ANWB 2CHOA 3Q9DA 2BKPA 1FEWA 3U78A 5BR8T 5AQPB 1WRDA 2JQHA 3IBPA 4TUYE 3UU5A 3N9PA 3KBUA 2B76A 1Y64B 5JDQA 2KLQA 4OFZA 3LJCA 1ZOYA 4QH5A 2FJAA 5J2TE 4U33A 5CJ5A 3N9QA 2E5VA 2ZM8A 2YK0A 4MBQA 4B3ST 5JDHA 2RPAA 4E7ZA 3PUXF 4LMJA 4AQGA 5CA1E 3C51A 5L3FB 1U5PA 1BR0A 1T98A 4KUMB 3P4RA 1M7KA 3J9X1 2L9QA 1IAPA 3AB3B 4X64T 3A7MA 5J2UE 2BG9A 4YJ2E 3KFWX 4DV7T 1D1AA 3FBLA 2JMKA 3ZJ2A 1XWMA 4ZI2C 2BKOA 2VK9A 2BBHA 2V7LA 2K48A 2H88A 1HF8A 4MLKA 2E8IA 2V7JA 3CQXC 2NTYA 2V5CA 4YTMA 3PU8A 3F2EA 1MNDA 4IE0A 4AQFC 4JI0T 2M6IA 2XJ7A 2RA1A 3UFEA 2KMFA 2CXDA 5AQGB 5LHHB 1W0AA 4EZ4A 1UX5A 4HFDA 2IW5B 4DUZT 2ZM0A 4DV4T 2WY2A 2QVAA 5DQWA 4IT4A 2NTXA 3JADA 5L3EB 3FZKB 4COFA 2EHOA 4YTPA 4TZ4C 4QKNA 2DNXA 4ILAA 5AQFB 2CXFA 2H7OA 3AE3A 5J0ZA 3IHRA 4IIJE 4PAGA 1B7TA 2NW7A 2WMOA 2MAWA 5LMUT 2EHOC 1J1JA 1LKXA 4XAXB 4OX9T 2LJLA 4ZXLA 2A2FX 3RGLA 3ZCJA 4LFBT 4G63A 3AVSA 2KWHA 3AE8A 3CPZA 5IUXA 3SOLA 4JI3T 1E1HB 4OYJA 3VU7H 1D1BA 4IDPA 3ETUA 3UUXB 4FI5A 3ZYLA 4G2AA 4O2AE 1FMVA 2LT3A 2VKJA 4ZI3D 3PUZF 3AEBA 5JRCA 3ZEFB 3BQKA 3P50A 5IWAT 4DV2T 1YD8G 3VR8A 2HHHT 4LFAT 2LSKA 5L3GB 3FXEB 5F5WA 5IYZE 1ZEEA 2W67A 4PFPA 3C4ZA 4GOUA 4JI4T 5JTGA 5DQVA 3ANWA 1G73A 1YQ4A 5C3JA 3AEAA 4OHFA 2X51A 2W4XA 4HFCA 4U72A 4I0UA 5JR9C 3CIRA 5AQTB 3UUMA 3CQCB 3RF1A 3LDQB 4DR5T 3MACA 3UU3A 5HCJA 4QX7B 5ABFA 2I0MA 5AQKB 1UURA 1SE7A 5JDLA 1NENA 4HWFA 2XAHB 3X1DA 3KV5A 3WAJA 2H7VC 3KDSE 1SHZC 2BKNA 4WZXA 3ZMSB 4B3MT 4ZI3C 3N9MA 3UQ7A 3AE5A 1QLBA 4LF8T 4QXBB 1WLXA 3FHNA 2D0TA 3ZYKA 3K8PC 3Q5DA 4P0AA 2XQ4A 3KV4A 3MA9A 1MMAA 5TAOA 2X9HA 5AQLB 2MTQA 3NRYA 1ZHCA 4TWDA 3CVRA 1G8XA 4O4LE 3RIFA 3T8OA 2WP9A 2KWIB 5JDNA 3OTOT 3MK7C 4TV9E 5FL1A 3ONJA 4J2CA 2LLYA 2LKHA 4HE8A 2QA7A 4C90A 2XQ5A 1HS7A 4UVCB 2NW8A 2V5DA 3KINB 4DR1T 2LOPA 4X20E 2YOEA 3L3PA 5LHGB 3N2GE 3EUHA 3PUAA 1N36T 1MMGA 4O8SA 2DI4A 5FY0A 2XM1A 2FJBA 5IHYA 4EV6A 1LRZA 3RIUC 4HFVA 4P09A 4B3RT 4LF4T 3HKBE 2DLRA 2XQ9A 3ONLC 3I9YA 1QUUA 4HWCA 2C5IT 2XQ8A 2KZ7B 5JQGE 4EGWA 2XQ7A 2IHR1 5FXXA 5KXJA 4CXXA 1MNEA 1KK7A 2JRKA 3AE6A 3CKDA 3QK6A 5HAXA 2JQ9A 2CPTA 4YFSA 3CX8B 4ILUA 5HWYA 4DO0A 3OKQA 3H3AA 1CHUA 5FNVE 3FZLB 3NZQA 1WYBA 1VCSA 2D2SA 2ES0A 4HGAA 4JI1T 4CN4A 4U74A 1N34T 3VHLA 1MMNA 3OPCA 3JAEA 1UGOA 5HWXA 3H37A 4YSYA 4U31A 2ZLYA 3LBXB 5LOVE 5CFBA 4I4TE 2X9XA 1MIWA 3HKDE 4H9OC 4GYRA 3O1JA 4X62T 2W61A 2E9XD 2CXLA 3B13A 5FXVA 1O3XA 3ZMUB 2VL0A 2I6HA 2JQKA 3TLVA 4HWHA 3WI3A 3ONXA 2NWBA 3N9OA 5EK3A 1HG2A 3N2KE 2WSSV 3V5UA 5L47A 2V26A 5JR9B 5LJNA 4EAHA 1J5WA 3HA4A 4ZS3A 2VL8A 2GK9A 3GN5B 4NXNT 5LGTB 3I1AA 5E0OA 2ACXA 3NRXA 3UTKA 3IA3A 4Z8XA 1N33T 5HEHA 1S35A 3LK42 5ABGA 4DV3T 3FBZA 4UV8B 5HEOA 4P1NA 4LF7T 1Y01A 4N78D 4AISA 4U2YA 4YHJA 4B6XA 3MJXA 3Q5XA 5AQVB 2XZEA 3DTOA 4F8HA 2E9XC 5LJMA 3AECA 5HXCA 3O1IA 1IBKT 3RYIE 4YLHA 3I0OA 3RYCE 3WAKA 2WDRA 4L5GA 2XAQB 5JH7E 1IBLT 4K0KT 1FIOA 4AQFA 3ZC1A 3UUNA 3ZKRA 2UXBT 5JVDE 3AAIA 3ZN0B 2FJEA 3KVBA 3P4WA 3T1YT 2P9BA 3SWHA 1NEKA 3ZT6A 3QC9A 2AE9A 3P8CD 2WDVA 2VURA 4TV8E 1HNZT 5FMNA 4IDOA 3E22E 5LBQB 2LSYA 4UF0B 2BBJA 4ISTA 2UXCT 3RKOA 2D9DA 5DJQC 4PFOA 5L4EA 4IE7A 1WR6A 2IC6A 4I50E 5LB7B 2KXPB 1XDOA 5LBMA 1OEDE 2LM2A 4EXTA 4BA9A 2V1DB 2K24A 2A9UA 1Z8UA 2IC9A 2XSAA 2J1DG 4I55E 4UVBB 2A3DA 2XAJB 4XZCA 2D0UA 2W0GA 5JDGA 3ZSTA 1VCTA 1X9BA 2XASB 3K3OA 3N2OA 2VVNA 2WWVA 2KINB 5AQRB 1QSDA 3Q5WA 2WWUA 2L3LA 4EZHA 4PJNA 3LBXA 4LMKA 1OEDB 5M4YA 4UEMA 1V9DA 3O9XA 3O4XE 1AJ3A 4O4IE 3ZT5A 5EK4A 3PUGA 1D0ZA 4V1Av 3OYZA 5F3JA 5LGUB 4ZI7E 2H89A 5ADXL 4PJMA 4MFRA 2UXXB 2LSJA 2KT9A 2N2NA 3CX7B 2Y8DA 3A5XA 1BR4A 2BZBA 2WCAA 1FJGT 3IEEA 2WBLA 5C2TA 3RLFF 3JCFA 4O2BE 1LVFA 2HN1A 3AA0B 3JAFA 5JR9A 2VASA 2AXDS 2N9DA 3O1HA 3OYXA 2OLTA 3GN5A 3NZPA 4PW8A 4QX8B 1FMWA 4KI0F 4WYVA 1NWMX 4ILCA 3OBVE 4GYSA 4LF9T 2XUEA 4DR2T 4KBMB 3QB5A 1BR2A 4EYYR 3AA7B 4UVAB 4TN7B 1SUMB 2ACZA 3F31A 3FB2A 5EZYE 3RYFE 3UU4A 2V8SV 3VRBA 2DWKA 2MBGA 2ZM6T 2E5LT 2LKGA 1BR1A 4IE5A 2OA5A 5FY7A 1R8IA 4EIWA 3EI0A 1T7SA 3L8RA 5KMGP 2MYSA 5BMVE 2RP4A 4H9QC 2M67A 3R84B 2IIUA 2VKOA 4X1KE 4DBRA 4AKHA 2J4GA 5LCYA 4TWHA 5L3DB 2X0LB 1HNWT 5EK2A 2XPKA 4PK5A 5FXZA 4EOZB 2PFVA 5KX5E 3P4SA 2JJ9A 1KNZA 2K9AA 2ODUA 3BQIA 1HCIA 4YTNA 3CQGB 5AQMB 4TNWA 4E7SA 3S4UA 4A98A 4AKLA 3P7IA 1VOMA 3AE1A 4KP3C 5F8PA 4UF0A 4HFHA 4CI2B 2B1EA 4BAYB 5JDMA 4NUUA 5LXTE 4EEDA 2Y6XA 2E9XB 3LG7A 4NUVA 3ESLA 3N9NA 1W09A 2K3WA 2BS4A 1HFAA 1CUNA 3K3NA 2XM2A 4LF5T 4AI6A 1HX1B 2BG9E 4HKAA 4LFCT 1KFYA 2C5JA 1ZKEA 2CLYC 3RQWA 3V5SA 2YDQA 3BQLA 3E0ZA 4Q25A 5AQJB 2W62A 2QGSA 3LFMA 3OVUA 2LOSA 1LVKA 2N1GA 2R6GF 3A8YC 3RIUA 5FY1A 4PK4A 2C5KT 2FBWA 4DR4T 1KEYA 1YXRA 4I43B 1I6ZA 5AQSB 2YU2A 4DV6T 2HN2A 2Q9QB 4JEUB 4HTEA 5AQOB 3UU8A 3RX6A 4CXWA 4PJJA 1YW0A 2CHNA 1OEDA 2YU1A 4OK0A 3QNUA 4P0BA 5FVKA 3NWIA 4DR7T 3ZYMA 3ABVA 4YHHT 2QRXA 2ZM2A 4C91A 4H9SE 4KHZF 5FL0A 2MOZA 4HFBA 3I9WA 4H63H 3PURA 1OEDC 4DR6T 4GK5E 3KV6A 3PJAJ 1T8BA 4IL9A 3ZJ1A 1ZV4X 2PJQA 2VQFT 4AQYT 2DL1A 3CWZB 2IDOB 2K5BB 4DBQA 4IDNA 4DV1T 2NW9A 4NPPA 4ZZBA 2MPKA 5L4HA 2CBIA 5H6RB 4H63V 4ZOLE 5AFUL 3RRCA 4HEAA 2VWAA 5LGNB 2WU2A 3PE0A 1XNRT 3IF8B 5JDFA 5KDMC 4A5XA 4HFIA 2DCFA 2VKDA 1IJ5A 4MALA 3ZN1B 4DIDB 2XQ3A 3DP7A 3T1HT 5A1LA 2XSBA 1W9RA 5J1GA 3SFEA 3MKDA 2W00A 2PG8A 4EYUA 4UIGA 4JI6T 3EVYA 4IL4A 4L0RA 3TLTA 5AQIB 4DMWA 1J5ET 2V6YB 1HR0T 2J47A 4YT0A 2IAKA 2V7MA 2DWGA 1H7CA 2LM9A 3K3QC 1OWAA 2XTLA 3AXJB 4XBFB 4U7YA 1L0VA 1IZNB 2LRLA 2LHNA 3PUQA 3KV9A 1WCRA 3AEGA 2V7IA 3R6NA 4QWNB 5GONE 3RQUA 4JUYA 3PUYF 4U7IA 2Q9QD 2VQET 5C8YE 2HH7A 2NP9A 3ZMTB 5HXSA 2FUPA 3EHZA 1GQEA 3GWHA 1UX4A 1XZYA 2E9XA 2W66A 1U4QA 1T72A 3ZSSA 4CXYA 5HEGA 3QOFA 4AKIA 3HI2A 4JI5T 2HPJA 5HYAA 3LK2B 1E2AA 4GIWA 5HCMA 5HXHA 2CM0A 2XQYA 3L09A 5ABFB 3L39A 5HEJA 4CI1B 4JI7T 3N5LA 2KSRA 4K0UA 1HG5A 3UFGA 4CQIA 4O4HE 3ETVA 3C50A 3AEDA 4TWFA 1MIYA 3ZMVB 3C98B 2IMLA 4IE4A 2WQYA 4IGUA 3PUWF 2Q9QA 1WFDA 3RIAA 3AE2A 3H3MA 1D0YA 1XMQT 2EHOD 4IDZA 2CE7A 4JV5T 4M1PA 4ERRA 4X65T 3F57A 3RPUA 2Q9QC 1UCUA 4YSXA 5LHIB 2BVMA 2X67A 5ABHA 4X5TA 3UUBA 2YEVC 2CLYB 2F4VT 2WAUA 1JNZA 5DABA 2QYWA 3FXDB 2PTFA 2BG9C 3VKHA 4EEBA
chains in the Genus database with same CATH topology
4UVAB 2DI4A 4TN7B 5FY0A 2WMNA 4PNIA 3F31A 3FB2A 3OJAA 5EZYE 3C4WA 5IHYA 2NOXA 3RYFE 4WBNE 1X79A 3M65A 1HX8A 1LRZA 2DWKA 2MBGA 4HFVA 4P09A 2LHRA 1BR1A 1IJ6A 4IE5A 4CI3B 2H3RA 3HKBE 2DLRA 3LK3B 2OA5A 5FY7A 2V7KA 4ZI2D 3ANWB 3Q9DA 3I9YA 2UXNB 1QUUA 4EIWA 2Z6EA 1FEWA 1MIVA 2ODVA 4OYKA 2W63A 3U78A 2C5IT 2LSIA 5L3CB 2KZ7B 2MYSA 5KMGP 5JQGE 1WRDA 1OXZA 3IBPA 2PBIA 2RP4A 5BMVE 4TUYE 4H9QC 2M67A 3R84B 2VKOA 3N9PA 2BDEA 3KBUA 3HKEE 4X1KE 5FXXA 4DBRA 4AKHA 4CXXA 1MNEA 1KK7A 5LCYA 1D0XA 1YKEB 5L3DB 2X0LB 1Y64B 3GA8A 2JRKA 5EK2A 4AXPA 5JDQA 2KLQA 4PK5A 4OFZA 3CKDA 5FXZA 4EOZB 2PFVA 3DJBA 3QK6A 5HAXA 3LJCA 5KX5E 5J2TE 2JJ9A 4YFSA 3JC6C 3CX6B 1KNZA 2K9AA 3CX8B 2ODUA 3EDUA 3N9QA 5HXRA 4ILUA 5HWYA 3BQIA 2ZM8A 4DO0A 3OKQA 1HCIA 3H3AA 5FNVE 2YK0A 3CQGB 4MBQA 4E7SA 4E7ZA 5JDHA 3S4UA 3NZQA 4AKLA 4EB6E 3P7IA 4H9NC 1WYBA 4AQGA 5CA1E 1VOMA 4KP3C 5F8PA 3C51A 4UF0A 5L3FB 1U5PA 3UULA 2D2SA 4CI2B 2ES0A 2B1EA 1BR0A 4BAYB 1T98A 2G0UA 4HGAA 4NUUA 3TKLB 5JDMA 4KUMB 5LXTE 2Y6XA 2E9XB 4U74A 3LG7A 3ZLIA 4NUVA 3ESLA 3N9NA 5FYMA 3J9X1 4AKGA 4HN9A 2L9QA 1IAPA 5FP3A 1HFAA 1CUNA 3AB3B 3K3NA 4KMCA 3VHLA 1MMNA 5LYJE 4AI6A 4HKAA 5HWXA 5ETWA 5J2UE 3H37A 4MHCA 2C5JA 1ZKEA 2ZLYA 1HTJF 4YJ2E 3LBXB 5LOVE 1NAFA 3KFWX 2L8KA 4I4TE 4IHJE 1D1AA 3C64A 3FBLA 2JMKA 2X9XA 3ZJ2A 2CLYC 4ZI2C 1MIWA 3V5SA 2VK9A 4PJLA 3BQLA 3E0ZA 3HKDE 3UT5E 4H9OC 4QHOA 2V7LA 2K48A 1HF8A 3MZKB 2W62A 4GYRA 3O1JA 2QGSA 2W61A 3LFMA 2LOSA 3NBXX 4MLKA 1LVKA 2N1GA 4QXCB 4CZZB 2E8IA 2V7JA 3KVAA 3E08A 2E9XD 3CQXC 2CXLA 2NTYA 3B13A 5FXVA 3PU8A 5FY1A 4PK4A 2C5KT 3F2EA 1O3XA 1MNDA 3ZMUB 4BJMA 4AKRB 4IE0A 4ZHQE 4AQFC 4JEHB 4I43B 4IE6A 2RA1A 3UFEA 3WI3A 2YU2A 2KMFA 2XAGB 2CXDA 2D5UA 3ONXA 2NWBA 5LP6E 2Q9QB 5LHHB 3N9OA 4JEUB 5EK3A 1HG2A 4ANJA 3N2KE 2WSSV 3V5UA 4EZ4A 1UX5A 2V26A 3PTRB 4HTEA 5JR9B 2IW5B 5LNKA 5LJNA 2ZM0A 3RX6A 4CXWA 4JLEA 4PJJA 5DQWA 4EAHA 3HA4A 2NTXA 1YW0A 4ZS3A 2Y48B 2VL8A 2GK9A 2YU1A 3GN5B 5L3EB 4OK0A 4P0BA 4UV9B 2EHOA 3ZYMA 5LGTB 4TZ4C 3W15B 4QKNA 2DNXA 3I1AA 5E0OA 2ACXA 2ZM2A 4C91A 2CXFA 3C4XA 4H9SE 2C0SA 3NRXA 3UTKA 2H7OA 4TX5A 4Z8XA 4X1IE 4YJ3E 2LSGA 2MOZA 3IHRA 4IIJE 3I9WA 4H63H 3PURA 4PAGA 1S35A 2XAFB 4DNDA 1B7TA 2NW7A 3LK42 1SA0E 4O8SA 2WMOA 2EHOC 4GK5E 3KV6A 3FBZA 1LKXA 3RRWA 4UV8B 4X1YE 3ZJ1A 3RH3A 1ZV4X 4XAXB 2PJQA 2LJLA 2A2FX 3AAAB 5L2LA 2CEAA 3ZCJA 4N78D 2XHEB 1D1CA 3CWZB 4G63A 3AVSA 2KWHA 2K5BB 4YHJA 3CPZA 3MJXA 3Q5XA 3PUSA 4B6XA 4ASKA 4DBQA 3SOLA 1E1HB 4OYJA 4O4JE 2NW9A 4F6RC 2X9WA 3DTOA 3VU7H 1D1BA 5H6RB 3ETUA 4H63V 4ZOLE 5AFUL 4WW0A 3UUXB 2E9XC 5LG4A 2VB6A 3RRCA 5LJMA 3PDYA 4HEAA 2VWAA 5CA0E 4FI5A 4QXHB 5LGNB 5HXCA 3O1IA 3PE0A 3AVRA 3ZYLA 4G2AA 3IF8B 4O2AE 3I0OA 4YLHA 5JDFA 3RYCE 3RYIE 3RC3A 3WAKA 2CA5A 1Z0PA 1FMVA 2LT3A 5KDMC 2VKJA 2DHRA 4L5GA 3N9LA 4DVDA 4WBOA 2XAQB 4ZI3D 2DCFA 2VKDA 1IJ5A 4MALA 3ZN1B 5JH7E 3PU3A 5CB4E 5JRCA 3ZEFB 3BQKA 1YD8G 1FIOA 4AQFA 3ZC1A 3UUNA 2HPLA 2LSKA 4ZS2A 5JVDE 3DP7A 5L3GB 3FXEB 3HR0A 5A1LA 5IYZE 1ZEEA 4PFPA 2X66A 3AAIA 5J1GA 3C4ZA 4L9IA 3CMLA 3MKDA 3ZN0B 3KVBA 2W00A 4GOUA 2PG8A 4FJOA 2P9BA 3SWHA 4EYUA 4UIGA 4A56A 3RC8A 5DQVA 3QC9A 2JMHA 3P8CD 2X68A 3EVYA 3ANWA 3I0QA 4L0RA 1G73A 4TV8E 4DMWA 3B57A 5FMNA 3E22E 5LBQB 3J7Yq 2LSYA 4OHFA 2JQQA 2X51A 4UF0B 3EDVA 2IAKA 2V7MA 2DWGA 2WM9A 4U72A 1H7CA 2LM9A 3K3QC 5JR9C 4ISTA 3RKOA 1OWAA 5DJQC 4PFOA 2XTLA 4IE7A 3UUMA 1WR6A 2IC6A 4I50E 3U3IA 4XBFB 3CQCB 1S94A 2KXPB 3MACA 1IZNB 5LBMA 4QX7B 4EXTA 4BA9A 2V1DB 2K24A 2LHNA 3PUQA 3HKCE 5JDLA 3RYHE 3D0TA 2XAHB 3KV9A 3SS1A 3SRZA 1EZ3A 2IC9A 3KV5A 3WAJA 2I59A 2V7IA 3R6NA 2H7VC 4BJNA 2J1DG 4QWNB 3AA1B 4I55E 4UVBB 2A3DA 3KDSE 1SHZC 2CCQA 2XAJB 5GONE 3ZCIA 2BVLA 4JUYA 4XZCA 2Q9QD 2D0UA 2W0GA 2ZMAA 3AA6B 3ZMSB 5JDGA 2X9YA 3AAEB 2HH7A 5C8YE 2NP9A 3ZMTB 5HXSA 1MMDA 4ZI3C 3GWHA 3KBTA 3N9MA 1UX4A 2E9XA 1U4QA 4QXBB 3MXZA 1WLXA 2XASB 3FHNA 3K3OA 4CXYA 4AKIA 3N2OA 3HI2A 3QUJA 2KINB 2HPJA 2LEHA 2D0TA 3ZYKA 5HYAA 4DMVA 3LK2B 4GIWA 3K8PC 4ADZA 3JC6D 1QSDA 5HXHA 4P0AA 3Q5WA 2CM0A 2XQYA 2WWUA 2L3LA 3BK9A 3KV4A 3L09A 3MA9A 4H9PC 4EZHA 4PJNA 1MMAA 3LBXA 4CI1B 5M4YA 5TAOA 4UEMA 1V9DA 2X9HA 3O9XA 3O4XE 1AJ3A 2VKHA 4O4IE 1WYCA 2MTQA 3N5LA 2CWYA 4H9RC 5EK4A 4K0UA 3NRYA 2EHOB 1HG5A 1D0ZA 3PUGA 1ZHCA 4ISSA 4V1Av 3OYZA 5F3JA 3CVRA 5FXWA 5LGUB 2LE8A 4UELA 4ZI7E 1G8XA 5HXEA 4CQIA 4O4HE 4O4LE 2JPFA 3ETVA 5ADXL 4PJMA 3VKGA 4MFRA 4PK6A 2UXXB 3C50A 3HL6A 3T8OA 1YKHB 2YINA 5LA6E 1MIYA 2KWIB 2LSJA 3ZMVB 5JDNA 2KT9A 3C98B 2N2NA 3CX7B 2Y8DA 4IE4A 3A5XA 4IGUA 1BR4A 3ZMZB 2BZBA 2Q9QA 3IEEA 2WBLA 3MK7C 4TV9E 2SPCA 4GK0E 4J2CA 4O2BE 1LVFA 2KNDA 3AA0B 5JR9A 1D0YA 2VASA 3Q2MA 4HE8A 2N9DA 3O1HA 2QA7A 4C90A 2EHOD 3OYXA 2CE7A 4IDZA 5L3BB 4M1PA 4ERRA 1HS7A 4UVCB 3F57A 4WNKA 2CMRA 3GN5A 3NZPA 3RPUA 2NW8A 2Q9QC 3KINB 1UCUA 3GMIA 4PW8A 5LHIB 2BVMA 2CWOA 2LOPA 2X67A 4X20E 2A72A 3ZC0A 4QX8B 2YEVC 3L3PA 2CLYB 1FMWA 3ZPOA 5LHGB 1US7B 2WAUA 5DABA 3N2GE 1NWMX 3EUHA 3OBVE 3FXDB 4UXNB 5JREA 4GYSA 3PUAA 5H6QB 3VKHA 2XUEA 1MMGA 4KBMB 1BR2A 4EYYR 1VRBA 5JRCB 3AA7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PW8 A;  4U72 A;  2V7M A;  2X67 A;  5EK4 A;  2NWB A;  2V7I A;  4U74 A;  5EK3 A;  2NOX A;  2V7L A;  1ZEE A;  2X66 A;  2D0T A;  2V7J A;  3E08 A;  4PK6 A;  2D0U A;  4HKA A;  2X68 A;  2NW9 A;  3BK9 A;  5ETW A;  2V7K A;  1YW0 A;  2NW7 A;  5EK2 A;  2NW8 A;  4PK5 A; 
#chains in the Genus database with same CATH topology
 4U3C A;  2WMN A;  2WS3 A;  3OJA A;  3C4W A;  1X79 A;  5AQQ B;  1HX8 A;  4YY3 T;  1M62 A;  2LHR A;  4CI3 B;  4HWD A;  3LK3 B;  3VR9 A;  1KNR A;  3TLW A;  2UUB T;  2UXN B;  2Z6E A;  1MIV A;  2ODV A;  4OYK A;  2W63 A;  1KF6 A;  2LSI A;  5L3C B;  3B5M A;  2IUB A;  1OXZ A;  2PBI A;  2UUA T;  2BDE A;  3HKE E;  3FZM B;  1D0X A;  1YKE B;  3RHW A;  3G06 A;  3GA8 A;  4AXP A;  3P4Q A;  3DJB A;  3CX6 B;  3EDU A;  5HXR A;  4NXM T;  2WZH A;  5FKY A;  3NVO A;  3P4P A;  4DUY T;  3RKG A;  1N32 T;  2YKS A;  4EB6 E;  4H9N C;  2V6Y A;  2UU9 T;  3UUL A;  2G0U A;  1I94 T;  4DV5 T;  3TKL B;  3ZLI A;  3AXJ A;  5FYM A;  2LRK A;  4AKG A;  4HN9 A;  1WR0 A;  5FP3 A;  3M3Z B;  1JNR A;  4KMC A;  5LYJ E;  3TLU A;  3FZH B;  5ETW A;  4MHC A;  1W0B A;  1HTJ F;  4QH4 A;  1NAF A;  1XMO T;  2L8K A;  4IHJ E;  3C64 A;  2UUC T;  5AQH B;  4PJL A;  3UT5 E;  4QHO A;  4IDQ A;  3MZK B;  3NBX X;  4JBW F;  4QXC B;  4CZZ B;  3KVA A;  3E08 A;  4BJM A;  4DV0 T;  4AKR B;  4ZHQ E;  4JEH B;  4JI8 T;  4IE6 A;  4YSZ A;  2XAG B;  2D5U A;  5LP6 E;  4ANJ A;  5ABE A;  3PJA A;  3PTR B;  4DR3 T;  5LNK A;  4A97 A;  4JLE A;  2V6X A;  2XY8 B;  2Y48 B;  4UV9 B;  4B3T T;  2FJD A;  3W15 B;  4ILB A;  4LML A;  3C4X A;  2C0S A;  5CGM A;  2BS2 A;  4TX5 A;  4X1I E;  4YJ3 E;  2LSG A;  1HNX T;  4ZZC A;  4UR9 A;  2XAF B;  4DND A;  1DU2 A;  1SA0 E;  4TNV A;  3RRW A;  4X1Y E;  3RH3 A;  4Z90 A;  2UXD T;  3AAA B;  3AE7 A;  5L2L A;  2CEA A;  2XHE B;  3PV0 F;  4LF6 T;  2JIW A;  1D1C A;  3PUS A;  4ASK A;  5LMN T;  4O4J E;  4F6R C;  2X9W A;  4WW0 A;  5LG4 A;  1ZP0 A;  2VB6 A;  3EAB A;  3PDY A;  5CA0 E;  4QXH B;  4HFE A;  3AVR A;  3SFD A;  3RC3 A;  2CA5 A;  1Z0P A;  4CN6 A;  4DVD A;  2DHR A;  3N9L A;  4WBO A;  3PU3 A;  5CB4 E;  2BS3 A;  2WB5 A;  4JI2 T;  3K1S A;  4GKJ T;  4IRE A;  2J62 A;  2HPL A;  4ZS2 A;  3HR0 A;  3AEE A;  4ZEY A;  2X66 A;  4L9I A;  3CML A;  1E7P A;  2E2A A;  4FJO A;  5AQU B;  2NR4 A;  4A56 A;  3RC8 A;  3QB5 K;  2JMH A;  2X68 A;  3I0Q A;  3B57 A;  3J7Y q;  4U2Z A;  3AE4 A;  2JQQ A;  3EDV A;  2XQ6 A;  2WM9 A;  4Z91 A;  3U3I A;  1S94 A;  2WU5 A;  3RI5 A;  4QH1 A;  3HKC E;  3RYH E;  2BG9 B;  3D0T A;  3ZT7 A;  3SS1 A;  3SRZ A;  1EZ3 A;  2I59 A;  4BJN A;  3AA1 B;  2YDR A;  3EAM A;  4AIU A;  2CCQ A;  3ZCI A;  2WZI A;  2BVL A;  3NKZ A;  4GKK T;  2ZMA A;  3AA6 B;  2X9Y A;  3AAE B;  1KNP A;  3AEF A;  1MMD A;  3KBT A;  3VRA A;  3MXZ A;  1XNQ T;  3QUJ A;  3UU6 A;  2LEH A;  2VVS A;  4DMV A;  2XQA A;  4ADZ A;  2CRB A;  3JC6 D;  3BK9 A;  4H9P C;  2WDQ A;  2VKH A;  1WYC A;  3TLS A;  2CWY A;  4H9R C;  2EHO B;  1XDP A;  4ISS A;  5FXW A;  2LE8 A;  4UEL A;  2X0Y A;  5HXE A;  2YN6 A;  2JPF A;  3PUV F;  3VKG A;  4PK6 A;  5LG3 A;  3HL6 A;  1YQ3 A;  1YKH B;  2YIN A;  5LA6 E;  5HEU A;  3CK6 A;  1UUS A;  4YXD A;  3ZMZ B;  3FZF B;  1UK5 A;  2SPC A;  4KHP T;  4GK0 E;  3UQ4 A;  2KND A;  3Q2M A;  5L3B B;  4HWI B;  4WNK A;  2YDS A;  2CMR A;  3Q5E A;  5AQN B;  2W2U A;  3AE9 A;  3GMI A;  1IBM T;  2CWO A;  4KX6 A;  2A72 A;  3ZC0 A;  4NIQ A;  2X0H A;  3ZPO A;  1US7 B;  2CBJ A;  4UXN B;  2OV9 A;  2M6B A;  5JRE A;  5H6Q B;  4JYA T;  3JC6 C;  1VRB A;  5JRC B;  4CN1 A;  4PNI A;  2NOX A;  4WBN E;  3M65 A;  4X66 T;  3LSV A;  5FVL A;  1IJ6 A;  2H3R A;  4ZI2 D;  2V7K A;  3ANW B;  2CHO A;  3Q9D A;  2BKP A;  1FEW A;  3U78 A;  5BR8 T;  5AQP B;  1WRD A;  2JQH A;  3IBP A;  4TUY E;  3UU5 A;  3N9P A;  3KBU A;  2B76 A;  1Y64 B;  5JDQ A;  2KLQ A;  4OFZ A;  3LJC A;  1ZOY A;  4QH5 A;  2FJA A;  5J2T E;  4U33 A;  5CJ5 A;  3N9Q A;  2E5V A;  2ZM8 A;  2YK0 A;  4MBQ A;  4B3S T;  5JDH A;  2RPA A;  4E7Z A;  3PUX F;  4LMJ A;  4AQG A;  5CA1 E;  3C51 A;  5L3F B;  1U5P A;  1BR0 A;  1T98 A;  4KUM B;  3P4R A;  1M7K A;  3J9X 1;  2L9Q A;  1IAP A;  3AB3 B;  4X64 T;  3A7M A;  5J2U E;  2BG9 A;  4YJ2 E;  3KFW X;  4DV7 T;  1D1A A;  3FBL A;  2JMK A;  3ZJ2 A;  1XWM A;  4ZI2 C;  2BKO A;  2VK9 A;  2BBH A;  2V7L A;  2K48 A;  2H88 A;  1HF8 A;  4MLK A;  2E8I A;  2V7J A;  3CQX C;  2NTY A;  2V5C A;  4YTM A;  3PU8 A;  3F2E A;  1MND A;  4IE0 A;  4AQF C;  4JI0 T;  2M6I A;  2XJ7 A;  2RA1 A;  3UFE A;  2KMF A;  2CXD A;  5AQG B;  5LHH B;  1W0A A;  4EZ4 A;  1UX5 A;  4HFD A;  2IW5 B;  4DUZ T;  2ZM0 A;  4DV4 T;  2WY2 A;  2QVA A;  5DQW A;  4IT4 A;  2NTX A;  3JAD A;  5L3E B;  3FZK B;  4COF A;  2EHO A;  4YTP A;  4TZ4 C;  4QKN A;  2DNX A;  4ILA A;  5AQF B;  2CXF A;  2H7O A;  3AE3 A;  5J0Z A;  3IHR A;  4IIJ E;  4PAG A;  1B7T A;  2NW7 A;  2WMO A;  2MAW A;  5LMU T;  2EHO C;  1J1J A;  1LKX A;  4XAX B;  4OX9 T;  2LJL A;  4ZXL A;  2A2F X;  3RGL A;  3ZCJ A;  4LFB T;  4G63 A;  3AVS A;  2KWH A;  3AE8 A;  3CPZ A;  5IUX A;  3SOL A;  4JI3 T;  1E1H B;  4OYJ A;  3VU7 H;  1D1B A;  4IDP A;  3ETU A;  3UUX B;  4FI5 A;  3ZYL A;  4G2A A;  4O2A E;  1FMV A;  2LT3 A;  2VKJ A;  4ZI3 D;  3PUZ F;  3AEB A;  5JRC A;  3ZEF B;  3BQK A;  3P50 A;  5IWA T;  4DV2 T;  1YD8 G;  3VR8 A;  2HHH T;  4LFA T;  2LSK A;  5L3G B;  3FXE B;  5F5W A;  5IYZ E;  1ZEE A;  2W67 A;  4PFP A;  3C4Z A;  4GOU A;  4JI4 T;  5JTG A;  5DQV A;  3ANW A;  1G73 A;  1YQ4 A;  5C3J A;  3AEA A;  4OHF A;  2X51 A;  2W4X A;  4HFC A;  4U72 A;  4I0U A;  5JR9 C;  3CIR A;  5AQT B;  3UUM A;  3CQC B;  3RF1 A;  3LDQ B;  4DR5 T;  3MAC A;  3UU3 A;  5HCJ A;  4QX7 B;  5ABF A;  2I0M A;  5AQK B;  1UUR A;  1SE7 A;  5JDL A;  1NEN A;  4HWF A;  2XAH B;  3X1D A;  3KV5 A;  3WAJ A;  2H7V C;  3KDS E;  1SHZ C;  2BKN A;  4WZX A;  3ZMS B;  4B3M T;  4ZI3 C;  3N9M A;  3UQ7 A;  3AE5 A;  1QLB A;  4LF8 T;  4QXB B;  1WLX A;  3FHN A;  2D0T A;  3ZYK A;  3K8P C;  3Q5D A;  4P0A A;  2XQ4 A;  3KV4 A;  3MA9 A;  1MMA A;  5TAO A;  2X9H A;  5AQL B;  2MTQ A;  3NRY A;  1ZHC A;  4TWD A;  3CVR A;  1G8X A;  4O4L E;  3RIF A;  3T8O A;  2WP9 A;  2KWI B;  5JDN A;  3OTO T;  3MK7 C;  4TV9 E;  5FL1 A;  3ONJ A;  4J2C A;  2LLY A;  2LKH A;  4HE8 A;  2QA7 A;  4C90 A;  2XQ5 A;  1HS7 A;  4UVC B;  2NW8 A;  2V5D A;  3KIN B;  4DR1 T;  2LOP A;  4X20 E;  2YOE A;  3L3P A;  5LHG B;  3N2G E;  3EUH A;  3PUA A;  1N36 T;  1MMG A;  4O8S A;  2DI4 A;  5FY0 A;  2XM1 A;  2FJB A;  5IHY A;  4EV6 A;  1LRZ A;  3RIU C;  4HFV A;  4P09 A;  4B3R T;  4LF4 T;  3HKB E;  2DLR A;  2XQ9 A;  3ONL C;  3I9Y A;  1QUU A;  4HWC A;  2C5I T;  2XQ8 A;  2KZ7 B;  5JQG E;  4EGW A;  2XQ7 A;  2IHR 1;  5FXX A;  5KXJ A;  4CXX A;  1MNE A;  1KK7 A;  2JRK A;  3AE6 A;  3CKD A;  3QK6 A;  5HAX A;  2JQ9 A;  2CPT A;  4YFS A;  3CX8 B;  4ILU A;  5HWY A;  4DO0 A;  3OKQ A;  3H3A A;  1CHU A;  5FNV E;  3FZL B;  3NZQ A;  1WYB A;  1VCS A;  2D2S A;  2ES0 A;  4HGA A;  4JI1 T;  4CN4 A;  4U74 A;  1N34 T;  3VHL A;  1MMN A;  3OPC A;  3JAE A;  1UGO A;  5HWX A;  3H37 A;  4YSY A;  4U31 A;  2ZLY A;  3LBX B;  5LOV E;  5CFB A;  4I4T E;  2X9X A;  1MIW A;  3HKD E;  4H9O C;  4GYR A;  3O1J A;  4X62 T;  2W61 A;  2E9X D;  2CXL A;  3B13 A;  5FXV A;  1O3X A;  3ZMU B;  2VL0 A;  2I6H A;  2JQK A;  3TLV A;  4HWH A;  3WI3 A;  3ONX A;  2NWB A;  3N9O A;  5EK3 A;  1HG2 A;  3N2K E;  2WSS V;  3V5U A;  5L47 A;  2V26 A;  5JR9 B;  5LJN A;  4EAH A;  1J5W A;  3HA4 A;  4ZS3 A;  2VL8 A;  2GK9 A;  3GN5 B;  4NXN T;  5LGT B;  3I1A A;  5E0O A;  2ACX A;  3NRX A;  3UTK A;  3IA3 A;  4Z8X A;  1N33 T;  5HEH A;  1S35 A;  3LK4 2;  5ABG A;  4DV3 T;  3FBZ A;  4UV8 B;  5HEO A;  4P1N A;  4LF7 T;  1Y01 A;  4N78 D;  4AIS A;  4U2Y A;  4YHJ A;  4B6X A;  3MJX A;  3Q5X A;  5AQV B;  2XZE A;  3DTO A;  4F8H A;  2E9X C;  5LJM A;  3AEC A;  5HXC A;  3O1I A;  1IBK T;  3RYI E;  4YLH A;  3I0O A;  3RYC E;  3WAK A;  2WDR A;  4L5G A;  2XAQ B;  5JH7 E;  1IBL T;  4K0K T;  1FIO A;  4AQF A;  3ZC1 A;  3UUN A;  3ZKR A;  2UXB T;  5JVD E;  3AAI A;  3ZN0 B;  2FJE A;  3KVB A;  3P4W A;  3T1Y T;  2P9B A;  3SWH A;  1NEK A;  3ZT6 A;  3QC9 A;  2AE9 A;  3P8C D;  2WDV A;  2VUR A;  4TV8 E;  1HNZ T;  5FMN A;  4IDO A;  3E22 E;  5LBQ B;  2LSY A;  4UF0 B;  2BBJ A;  4IST A;  2UXC T;  3RKO A;  2D9D A;  5DJQ C;  4PFO A;  5L4E A;  4IE7 A;  1WR6 A;  2IC6 A;  4I50 E;  5LB7 B;  2KXP B;  1XDO A;  5LBM A;  1OED E;  2LM2 A;  4EXT A;  4BA9 A;  2V1D B;  2K24 A;  2A9U A;  1Z8U A;  2IC9 A;  2XSA A;  2J1D G;  4I55 E;  4UVB B;  2A3D A;  2XAJ B;  4XZC A;  2D0U A;  2W0G A;  5JDG A;  3ZST A;  1VCT A;  1X9B A;  2XAS B;  3K3O A;  3N2O A;  2VVN A;  2WWV A;  2KIN B;  5AQR B;  1QSD A;  3Q5W A;  2WWU A;  2L3L A;  4EZH A;  4PJN A;  3LBX A;  4LMK A;  1OED B;  5M4Y A;  4UEM A;  1V9D A;  3O9X A;  3O4X E;  1AJ3 A;  4O4I E;  3ZT5 A;  5EK4 A;  3PUG A;  1D0Z A;  4V1A v;  3OYZ A;  5F3J A;  5LGU B;  4ZI7 E;  2H89 A;  5ADX L;  4PJM A;  4MFR A;  2UXX B;  2LSJ A;  2KT9 A;  2N2N A;  3CX7 B;  2Y8D A;  3A5X A;  1BR4 A;  2BZB A;  2WCA A;  1FJG T;  3IEE A;  2WBL A;  5C2T A;  3RLF F;  3JCF A;  4O2B E;  1LVF A;  2HN1 A;  3AA0 B;  3JAF A;  5JR9 A;  2VAS A;  2AXD S;  2N9D A;  3O1H A;  3OYX A;  2OLT A;  3GN5 A;  3NZP A;  4PW8 A;  4QX8 B;  1FMW A;  4KI0 F;  4WYV A;  1NWM X;  4ILC A;  3OBV E;  4GYS A;  4LF9 T;  2XUE A;  4DR2 T;  4KBM B;  3QB5 A;  1BR2 A;  4EYY R;  3AA7 B;  4UVA B;  4TN7 B;  1SUM B;  2ACZ A;  3F31 A;  3FB2 A;  5EZY E;  3RYF E;  3UU4 A;  2V8S V;  3VRB A;  2DWK A;  2MBG A;  2ZM6 T;  2E5L T;  2LKG A;  1BR1 A;  4IE5 A;  2OA5 A;  5FY7 A;  1R8I A;  4EIW A;  3EI0 A;  1T7S A;  3L8R A;  5KMG P;  2MYS A;  5BMV E;  2RP4 A;  4H9Q C;  2M67 A;  3R84 B;  2IIU A;  2VKO A;  4X1K E;  4DBR A;  4AKH A;  2J4G A;  5LCY A;  4TWH A;  5L3D B;  2X0L B;  1HNW T;  5EK2 A;  2XPK A;  4PK5 A;  5FXZ A;  4EOZ B;  2PFV A;  5KX5 E;  3P4S A;  2JJ9 A;  1KNZ A;  2K9A A;  2ODU A;  3BQI A;  1HCI A;  4YTN A;  3CQG B;  5AQM B;  4TNW A;  4E7S A;  3S4U A;  4A98 A;  4AKL A;  3P7I A;  1VOM A;  3AE1 A;  4KP3 C;  5F8P A;  4UF0 A;  4HFH A;  4CI2 B;  2B1E A;  4BAY B;  5JDM A;  4NUU A;  5LXT E;  4EED A;  2Y6X A;  2E9X B;  3LG7 A;  4NUV A;  3ESL A;  3N9N A;  1W09 A;  2K3W A;  2BS4 A;  1HFA A;  1CUN A;  3K3N A;  2XM2 A;  4LF5 T;  4AI6 A;  1HX1 B;  2BG9 E;  4HKA A;  4LFC T;  1KFY A;  2C5J A;  1ZKE A;  2CLY C;  3RQW A;  3V5S A;  2YDQ A;  3BQL A;  3E0Z A;  4Q25 A;  5AQJ B;  2W62 A;  2QGS A;  3LFM A;  3OVU A;  2LOS A;  1LVK A;  2N1G A;  2R6G F;  3A8Y C;  3RIU A;  5FY1 A;  4PK4 A;  2C5K T;  2FBW A;  4DR4 T;  1KEY A;  1YXR A;  4I43 B;  1I6Z A;  5AQS B;  2YU2 A;  4DV6 T;  2HN2 A;  2Q9Q B;  4JEU B;  4HTE A;  5AQO B;  3UU8 A;  3RX6 A;  4CXW A;  4PJJ A;  1YW0 A;  2CHN A;  1OED A;  2YU1 A;  4OK0 A;  3QNU A;  4P0B A;  5FVK A;  3NWI A;  4DR7 T;  3ZYM A;  3ABV A;  4YHH T;  2QRX A;  2ZM2 A;  4C91 A;  4H9S E;  4KHZ F;  5FL0 A;  2MOZ A;  4HFB A;  3I9W A;  4H63 H;  3PUR A;  1OED C;  4DR6 T;  4GK5 E;  3KV6 A;  3PJA J;  1T8B A;  4IL9 A;  3ZJ1 A;  1ZV4 X;  2PJQ A;  2VQF T;  4AQY T;  2DL1 A;  3CWZ B;  2IDO B;  2K5B B;  4DBQ A;  4IDN A;  4DV1 T;  2NW9 A;  4NPP A;  4ZZB A;  2MPK A;  5L4H A;  2CBI A;  5H6R B;  4H63 V;  4ZOL E;  5AFU L;  3RRC A;  4HEA A;  2VWA A;  5LGN B;  2WU2 A;  3PE0 A;  1XNR T;  3IF8 B;  5JDF A;  5KDM C;  4A5X A;  4HFI A;  2DCF A;  2VKD A;  1IJ5 A;  4MAL A;  3ZN1 B;  4DID B;  2XQ3 A;  3DP7 A;  3T1H T;  5A1L A;  2XSB A;  1W9R A;  5J1G A;  3SFE A;  3MKD A;  2W00 A;  2PG8 A;  4EYU A;  4UIG A;  4JI6 T;  3EVY A;  4IL4 A;  4L0R A;  3TLT A;  5AQI B;  4DMW A;  1J5E T;  2V6Y B;  1HR0 T;  2J47 A;  4YT0 A;  2IAK A;  2V7M A;  2DWG A;  1H7C A;  2LM9 A;  3K3Q C;  1OWA A;  2XTL A;  3AXJ B;  4XBF B;  4U7Y A;  1L0V A;  1IZN B;  2LRL A;  2LHN A;  3PUQ A;  3KV9 A;  1WCR A;  3AEG A;  2V7I A;  3R6N A;  4QWN B;  5GON E;  3RQU A;  4JUY A;  3PUY F;  4U7I A;  2Q9Q D;  2VQE T;  5C8Y E;  2HH7 A;  2NP9 A;  3ZMT B;  5HXS A;  2FUP A;  3EHZ A;  1GQE A;  3GWH A;  1UX4 A;  1XZY A;  2E9X A;  2W66 A;  1U4Q A;  1T72 A;  3ZSS A;  4CXY A;  5HEG A;  3QOF A;  4AKI A;  3HI2 A;  4JI5 T;  2HPJ A;  5HYA A;  3LK2 B;  1E2A A;  4GIW A;  5HCM A;  5HXH A;  2CM0 A;  2XQY A;  3L09 A;  5ABF B;  3L39 A;  5HEJ A;  4CI1 B;  4JI7 T;  3N5L A;  2KSR A;  4K0U A;  1HG5 A;  3UFG A;  4CQI A;  4O4H E;  3ETV A;  3C50 A;  3AED A;  4TWF A;  1MIY A;  3ZMV B;  3C98 B;  2IML A;  4IE4 A;  2WQY A;  4IGU A;  3PUW F;  2Q9Q A;  1WFD A;  3RIA A;  3AE2 A;  3H3M A;  1D0Y A;  1XMQ T;  2EHO D;  4IDZ A;  2CE7 A;  4JV5 T;  4M1P A;  4ERR A;  4X65 T;  3F57 A;  3RPU A;  2Q9Q C;  1UCU A;  4YSX A;  5LHI B;  2BVM A;  2X67 A;  5ABH A;  4X5T A;  3UUB A;  2YEV C;  2CLY B;  2F4V T;  2WAU A;  1JNZ A;  5DAB A;  2QYW A;  3FXD B;  2PTF A;  2BG9 C;  3VKH A;  4EEB A; 
#chains in the Genus database with same CATH homology
 4UVA B;  2DI4 A;  4TN7 B;  5FY0 A;  2WMN A;  4PNI A;  3F31 A;  3FB2 A;  3OJA A;  5EZY E;  3C4W A;  5IHY A;  2NOX A;  3RYF E;  4WBN E;  1X79 A;  3M65 A;  1HX8 A;  1LRZ A;  2DWK A;  2MBG A;  4HFV A;  4P09 A;  2LHR A;  1BR1 A;  1IJ6 A;  4IE5 A;  4CI3 B;  2H3R A;  3HKB E;  2DLR A;  3LK3 B;  2OA5 A;  5FY7 A;  2V7K A;  4ZI2 D;  3ANW B;  3Q9D A;  3I9Y A;  2UXN B;  1QUU A;  4EIW A;  2Z6E A;  1FEW A;  1MIV A;  2ODV A;  4OYK A;  2W63 A;  3U78 A;  2C5I T;  2LSI A;  5L3C B;  2KZ7 B;  2MYS A;  5KMG P;  5JQG E;  1WRD A;  1OXZ A;  3IBP A;  2PBI A;  2RP4 A;  5BMV E;  4TUY E;  4H9Q C;  2M67 A;  3R84 B;  2VKO A;  3N9P A;  2BDE A;  3KBU A;  3HKE E;  4X1K E;  5FXX A;  4DBR A;  4AKH A;  4CXX A;  1MNE A;  1KK7 A;  5LCY A;  1D0X A;  1YKE B;  5L3D B;  2X0L B;  1Y64 B;  3GA8 A;  2JRK A;  5EK2 A;  4AXP A;  5JDQ A;  2KLQ A;  4PK5 A;  4OFZ A;  3CKD A;  5FXZ A;  4EOZ B;  2PFV A;  3DJB A;  3QK6 A;  5HAX A;  3LJC A;  5KX5 E;  5J2T E;  2JJ9 A;  4YFS A;  3JC6 C;  3CX6 B;  1KNZ A;  2K9A A;  3CX8 B;  2ODU A;  3EDU A;  3N9Q A;  5HXR A;  4ILU A;  5HWY A;  3BQI A;  2ZM8 A;  4DO0 A;  3OKQ A;  1HCI A;  3H3A A;  5FNV E;  2YK0 A;  3CQG B;  4MBQ A;  4E7S A;  4E7Z A;  5JDH A;  3S4U A;  3NZQ A;  4AKL A;  4EB6 E;  3P7I A;  4H9N C;  1WYB A;  4AQG A;  5CA1 E;  1VOM A;  4KP3 C;  5F8P A;  3C51 A;  4UF0 A;  5L3F B;  1U5P A;  3UUL A;  2D2S A;  4CI2 B;  2ES0 A;  2B1E A;  1BR0 A;  4BAY B;  1T98 A;  2G0U A;  4HGA A;  4NUU A;  3TKL B;  5JDM A;  4KUM B;  5LXT E;  2Y6X A;  2E9X B;  4U74 A;  3LG7 A;  3ZLI A;  4NUV A;  3ESL A;  3N9N A;  5FYM A;  3J9X 1;  4AKG A;  4HN9 A;  2L9Q A;  1IAP A;  5FP3 A;  1HFA A;  1CUN A;  3AB3 B;  3K3N A;  4KMC A;  3VHL A;  1MMN A;  5LYJ E;  4AI6 A;  4HKA A;  5HWX A;  5ETW A;  5J2U E;  3H37 A;  4MHC A;  2C5J A;  1ZKE A;  2ZLY A;  1HTJ F;  4YJ2 E;  3LBX B;  5LOV E;  1NAF A;  3KFW X;  2L8K A;  4I4T E;  4IHJ E;  1D1A A;  3C64 A;  3FBL A;  2JMK A;  2X9X A;  3ZJ2 A;  2CLY C;  4ZI2 C;  1MIW A;  3V5S A;  2VK9 A;  4PJL A;  3BQL A;  3E0Z A;  3HKD E;  3UT5 E;  4H9O C;  4QHO A;  2V7L A;  2K48 A;  1HF8 A;  3MZK B;  2W62 A;  4GYR A;  3O1J A;  2QGS A;  2W61 A;  3LFM A;  2LOS A;  3NBX X;  4MLK A;  1LVK A;  2N1G A;  4QXC B;  4CZZ B;  2E8I A;  2V7J A;  3KVA A;  3E08 A;  2E9X D;  3CQX C;  2CXL A;  2NTY A;  3B13 A;  5FXV A;  3PU8 A;  5FY1 A;  4PK4 A;  2C5K T;  3F2E A;  1O3X A;  1MND A;  3ZMU B;  4BJM A;  4AKR B;  4IE0 A;  4ZHQ E;  4AQF C;  4JEH B;  4I43 B;  4IE6 A;  2RA1 A;  3UFE A;  3WI3 A;  2YU2 A;  2KMF A;  2XAG B;  2CXD A;  2D5U A;  3ONX A;  2NWB A;  5LP6 E;  2Q9Q B;  5LHH B;  3N9O A;  4JEU B;  5EK3 A;  1HG2 A;  4ANJ A;  3N2K E;  2WSS V;  3V5U A;  4EZ4 A;  1UX5 A;  2V26 A;  3PTR B;  4HTE A;  5JR9 B;  2IW5 B;  5LNK A;  5LJN A;  2ZM0 A;  3RX6 A;  4CXW A;  4JLE A;  4PJJ A;  5DQW A;  4EAH A;  3HA4 A;  2NTX A;  1YW0 A;  4ZS3 A;  2Y48 B;  2VL8 A;  2GK9 A;  2YU1 A;  3GN5 B;  5L3E B;  4OK0 A;  4P0B A;  4UV9 B;  2EHO A;  3ZYM A;  5LGT B;  4TZ4 C;  3W15 B;  4QKN A;  2DNX A;  3I1A A;  5E0O A;  2ACX A;  2ZM2 A;  4C91 A;  2CXF A;  3C4X A;  4H9S E;  2C0S A;  3NRX A;  3UTK A;  2H7O A;  4TX5 A;  4Z8X A;  4X1I E;  4YJ3 E;  2LSG A;  2MOZ A;  3IHR A;  4IIJ E;  3I9W A;  4H63 H;  3PUR A;  4PAG A;  1S35 A;  2XAF B;  4DND A;  1B7T A;  2NW7 A;  3LK4 2;  1SA0 E;  4O8S A;  2WMO A;  2EHO C;  4GK5 E;  3KV6 A;  3FBZ A;  1LKX A;  3RRW A;  4UV8 B;  4X1Y E;  3ZJ1 A;  3RH3 A;  1ZV4 X;  4XAX B;  2PJQ A;  2LJL A;  2A2F X;  3AAA B;  5L2L A;  2CEA A;  3ZCJ A;  4N78 D;  2XHE B;  1D1C A;  3CWZ B;  4G63 A;  3AVS A;  2KWH A;  2K5B B;  4YHJ A;  3CPZ A;  3MJX A;  3Q5X A;  3PUS A;  4B6X A;  4ASK A;  4DBQ A;  3SOL A;  1E1H B;  4OYJ A;  4O4J E;  2NW9 A;  4F6R C;  2X9W A;  3DTO A;  3VU7 H;  1D1B A;  5H6R B;  3ETU A;  4H63 V;  4ZOL E;  5AFU L;  4WW0 A;  3UUX B;  2E9X C;  5LG4 A;  2VB6 A;  3RRC A;  5LJM A;  3PDY A;  4HEA A;  2VWA A;  5CA0 E;  4FI5 A;  4QXH B;  5LGN B;  5HXC A;  3O1I A;  3PE0 A;  3AVR A;  3ZYL A;  4G2A A;  3IF8 B;  4O2A E;  3I0O A;  4YLH A;  5JDF A;  3RYC E;  3RYI E;  3RC3 A;  3WAK A;  2CA5 A;  1Z0P A;  1FMV A;  2LT3 A;  5KDM C;  2VKJ A;  2DHR A;  4L5G A;  3N9L A;  4DVD A;  4WBO A;  2XAQ B;  4ZI3 D;  2DCF A;  2VKD A;  1IJ5 A;  4MAL A;  3ZN1 B;  5JH7 E;  3PU3 A;  5CB4 E;  5JRC A;  3ZEF B;  3BQK A;  1YD8 G;  1FIO A;  4AQF A;  3ZC1 A;  3UUN A;  2HPL A;  2LSK A;  4ZS2 A;  5JVD E;  3DP7 A;  5L3G B;  3FXE B;  3HR0 A;  5A1L A;  5IYZ E;  1ZEE A;  4PFP A;  2X66 A;  3AAI A;  5J1G A;  3C4Z A;  4L9I A;  3CML A;  3MKD A;  3ZN0 B;  3KVB A;  2W00 A;  4GOU A;  2PG8 A;  4FJO A;  2P9B A;  3SWH A;  4EYU A;  4UIG A;  4A56 A;  3RC8 A;  5DQV A;  3QC9 A;  2JMH A;  3P8C D;  2X68 A;  3EVY A;  3ANW A;  3I0Q A;  4L0R A;  1G73 A;  4TV8 E;  4DMW A;  3B57 A;  5FMN A;  3E22 E;  5LBQ B;  3J7Y q;  2LSY A;  4OHF A;  2JQQ A;  2X51 A;  4UF0 B;  3EDV A;  2IAK A;  2V7M A;  2DWG A;  2WM9 A;  4U72 A;  1H7C A;  2LM9 A;  3K3Q C;  5JR9 C;  4IST A;  3RKO A;  1OWA A;  5DJQ C;  4PFO A;  2XTL A;  4IE7 A;  3UUM A;  1WR6 A;  2IC6 A;  4I50 E;  3U3I A;  4XBF B;  3CQC B;  1S94 A;  2KXP B;  3MAC A;  1IZN B;  5LBM A;  4QX7 B;  4EXT A;  4BA9 A;  2V1D B;  2K24 A;  2LHN A;  3PUQ A;  3HKC E;  5JDL A;  3RYH E;  3D0T A;  2XAH B;  3KV9 A;  3SS1 A;  3SRZ A;  1EZ3 A;  2IC9 A;  3KV5 A;  3WAJ A;  2I59 A;  2V7I A;  3R6N A;  2H7V C;  4BJN A;  2J1D G;  4QWN B;  3AA1 B;  4I55 E;  4UVB B;  2A3D A;  3KDS E;  1SHZ C;  2CCQ A;  2XAJ B;  5GON E;  3ZCI A;  2BVL A;  4JUY A;  4XZC A;  2Q9Q D;  2D0U A;  2W0G A;  2ZMA A;  3AA6 B;  3ZMS B;  5JDG A;  2X9Y A;  3AAE B;  2HH7 A;  5C8Y E;  2NP9 A;  3ZMT B;  5HXS A;  1MMD A;  4ZI3 C;  3GWH A;  3KBT A;  3N9M A;  1UX4 A;  2E9X A;  1U4Q A;  4QXB B;  3MXZ A;  1WLX A;  2XAS B;  3FHN A;  3K3O A;  4CXY A;  4AKI A;  3N2O A;  3HI2 A;  3QUJ A;  2KIN B;  2HPJ A;  2LEH A;  2D0T A;  3ZYK A;  5HYA A;  4DMV A;  3LK2 B;  4GIW A;  3K8P C;  4ADZ A;  3JC6 D;  1QSD A;  5HXH A;  4P0A A;  3Q5W A;  2CM0 A;  2XQY A;  2WWU A;  2L3L A;  3BK9 A;  3KV4 A;  3L09 A;  3MA9 A;  4H9P C;  4EZH A;  4PJN A;  1MMA A;  3LBX A;  4CI1 B;  5M4Y A;  5TAO A;  4UEM A;  1V9D A;  2X9H A;  3O9X A;  3O4X E;  1AJ3 A;  2VKH A;  4O4I E;  1WYC A;  2MTQ A;  3N5L A;  2CWY A;  4H9R C;  5EK4 A;  4K0U A;  3NRY A;  2EHO B;  1HG5 A;  1D0Z A;  3PUG A;  1ZHC A;  4ISS A;  4V1A v;  3OYZ A;  5F3J A;  3CVR A;  5FXW A;  5LGU B;  2LE8 A;  4UEL A;  4ZI7 E;  1G8X A;  5HXE A;  4CQI A;  4O4H E;  4O4L E;  2JPF A;  3ETV A;  5ADX L;  4PJM A;  3VKG A;  4MFR A;  4PK6 A;  2UXX B;  3C50 A;  3HL6 A;  3T8O A;  1YKH B;  2YIN A;  5LA6 E;  1MIY A;  2KWI B;  2LSJ A;  3ZMV B;  5JDN A;  2KT9 A;  3C98 B;  2N2N A;  3CX7 B;  2Y8D A;  4IE4 A;  3A5X A;  4IGU A;  1BR4 A;  3ZMZ B;  2BZB A;  2Q9Q A;  3IEE A;  2WBL A;  3MK7 C;  4TV9 E;  2SPC A;  4GK0 E;  4J2C A;  4O2B E;  1LVF A;  2KND A;  3AA0 B;  5JR9 A;  1D0Y A;  2VAS A;  3Q2M A;  4HE8 A;  2N9D A;  3O1H A;  2QA7 A;  4C90 A;  2EHO D;  3OYX A;  2CE7 A;  4IDZ A;  5L3B B;  4M1P A;  4ERR A;  1HS7 A;  4UVC B;  3F57 A;  4WNK A;  2CMR A;  3GN5 A;  3NZP A;  3RPU A;  2NW8 A;  2Q9Q C;  3KIN B;  1UCU A;  3GMI A;  4PW8 A;  5LHI B;  2BVM A;  2CWO A;  2LOP A;  2X67 A;  4X20 E;  2A72 A;  3ZC0 A;  4QX8 B;  2YEV C;  3L3P A;  2CLY B;  1FMW A;  3ZPO A;  5LHG B;  1US7 B;  2WAU A;  5DAB A;  3N2G E;  1NWM X;  3EUH A;  3OBV E;  3FXD B;  4UXN B;  5JRE A;  4GYS A;  3PUA A;  5H6Q B;  3VKH A;  2XUE A;  1MMG A;  4KBM B;  1BR2 A;  4EYY R;  1VRB A;  5JRC B;  3AA7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...