1YW0A

Crystal structure of the tryptophan 2,3-dioxygenase from xanthomonas campestris. northeast structural genomics target xcr13.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
262
structure length
243
Chain Sequence
TYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the tryptophan 2,3-dioxygenase from Xanthomonas campestris. Northeast Structural Genomics Target XcR13.
rcsb
source organism Xanthomonas campestris pv. campestris str. atcc 33913
molecule tags Oxidoreductase
molecule keywords tryptophan 2,3-dioxygenase
total genus 82
structure length 243
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yw0A00
2V7KA 1YW0A 2X66A 4U74A 3E08A 2NW9A 2V7LA 2V7IA 2X68A 5EK4A 4PW8A 2NW8A 2NW7A 4U72A 2NWBA 5EK3A 2V7MA 2D0UA 2V7JA 1ZEEA 3BK9A 2X67A 2NOXA 2D0TA 5ETWA 4PK5A 4HKAA 4PK6A 5EK2A
chains in the Genus database with same CATH superfamily
2JMKA 1W0BA 4M1PA 5LYJE 3EABA 1MMNA 4PNIA 5HXSA 2WP9A 5CA1E 3ZYMA 1NAFA 2IHR1 2DL1A 3IA3A 4TWHA 2FUPA 3NVOA 5DJQC 3AEFA 5H6QB 4CI2B 3NRXA 3AE2A 4MALA 5JH7E 2KT9A 2R6GF 4UVAB 5J2TE 4CN4A 5CGMA 3CKDA 4HFEA 3QC9A 2LKHA 1XMOT 3L8RA 2XHEB 3PV0F 3UFEA 4B6XA 4EB6E 2W4XA 4YHJA 3VR8A 4EYUA 2BG9E 3QNUA 1FMVA 1Z0PA 2MTQA 2NTXA 2WBLA 2XQ6A 4ZI3D 5JREA 3AA7B 2YU1A 1WYBA 5AQSB 4CI3B 5F8PA 3K3QC 4DMVA 3ZEFB 3J7Yq 5EZYE 4E7SA 3HA4A 4BAYB 2DWKA 3UU3A 2ZM8A 4COFA 4JI3T 1QSDA 2JIWA 2CXFA 2FJDA 1KNPA 4N78D 4CN6A 1MMGA 2D2SA 4UEMA 4UV8B 3LBXA 1FJGT 3K8PC 2W61A 4U74A 4P1NA 4L9IA 5C3JA 1N34T 5EK4A 3PJAJ 3ESLA 3ZMTB 5LMNT 2WCAA 3I9YA 3EUHA 3UUBA 1Z8UA 3B5MA 3BQIA 2CHOA 3O1HA 4HTEA 1SA0E 4O4JE 4UV9B 4LF8T 2NR4A 2DLRA 3U3IA 3SOLA 4B3RT 2IC9A 2E5VA 3OPCA 4YXDA 3FHNA 2XTLA 2CA5A 4JI4T 4IIJE 3V5UA 2C5JA 5HCMA 4DR4T 2FBWA 2UXDT 4ZZCA 2NP9A 4ZS3A 3CVRA 4DV2T 4DV3T 3PTRB 1OEDC 3KDSE 2UUCT 5ETWA 4PK5A 3SWHA 4DUYT 1HNXT 1WYCA 2LSYA 4DNDA 2X9WA 3CWZB 1HS7A 3ZCIA 5L4EA 4TV9E 3QOFA 1NWMX 2V7KA 3PUVF 5LBQB 2XAFB 1SHZC 1IZNB 4YTPA 3LDQB 3LK42 3RIFA 3AXJA 4LF5T 4TX5A 3UFGA 5FMNA 5AQGB 2YK0A 4HWFA 2CCQA 2VURA 1U4QA 4NUUA 5C2TA 1ZKEA 3I0QA 4DV7T 4H9QC 3N9PA 2K48A 2CWOA 4DR7T 1T98A 5JR9B 3F57A 4QXHB 4HWHA 3AA0B 3WAKA 2X0YA 4Z90A 4TV8E 4ZXLA 2UU9T 4K0UA 1VCTA 5AQNB 4UF0B 4UELA 5FY0A 3RRWA 3UULA 5F3JA 5LG4A 4LFAT 1BR0A 3TLVA 5ABHA 3UQ7A 3Q2MA 1S94A 3PUYF 5LNKA 2BG9C 3ZT7A 2H7VC 2M6BA 3VRAA 1Y01A 3N9NA 1M62A 2LT3A 1JNZA 5HYAA 5HEUA 4YTMA 2ZLYA 2V7IA 4KBMB 2KZ7B 5LHHB 1KNZA 5M4YA 2JQQA 2EHOB 4JI7T 4AQFC 3C51A 3E0ZA 2XSBA 4QWNB 4OFZA 2UXNB 3UTKA 2WWVA 2XY8B 4V1Av 2WU2A 1BR4A 3K3NA 4KP3C 3ETUA 1D0YA 2ZM0A 3PUQA 4TNVA 4U3CA 3UUXB 2H89A 4TWFA 3UU6A 1B7TA 2WQYA 5LHIB 2I59A 4H9OC 4P0AA 1WR6A 3P7IA 4AQGA 3Q5XA 4DR3T 3FB2A 2LRLA 3N2GE 2X51A 2LOSA 2LOPA 5HAXA 2HN1A 4I0UA 4DR1T 2MOZA 4P09A 3EI0A 4PJNA 3LSVA 5LB7B 4HWIB 4HN9A 2CPTA 2JQ9A 4JI2T 2GK9A 5AQUB 5FXWA 3H3MA 4NUVA 5L3CB 1FEWA 2LE8A 4QHOA 5LGNB 5AQTB 2CLYC 1NEKA 1HG2A 2CM0A 3AAEB 4UR9A 2PJQA 1V9DA 4J2CA 2BKOA 3ZJ2A 4ASKA 4O2AE 1MIVA 3U78A 4JYAT 1UUSA 2LM9A 5FVLA 3N9OA 5HXHA 3CIRA 1YQ4A 3EHZA 3O1JA 1OEDA 3Q5WA 2A2FX 4U7IA 3K3OA 3ZMSB 1HNWT 1MIWA 2V7MA 2BKPA 3RF1A 5KX5E 2LRKA 4DV0T 1W9RA 1HFAA 2XASB 4QH5A 3ZSSA 3KV5A 5AQIB 3L09A 4DR5T 3WAJA 4X64T 3JAEA 2E5LT 4O4IE 4UXNB 3CPZA 3Q5DA 1VOMA 4CXXA 3A5XA 5LJMA 2LM2A 3FZMB 4EV6A 4JI6T 3RIUA 1IJ5A 4KI0F 2MBGA 2WU5A 4AKHA 5AQJB 4X5TA 2VKOA 4IL9A 5HEHA 4AXPA 5HEJA 2BZBA 2WDVA 4WYVA 2J4GA 2JRKA 3TLUA 3ZKRA 3UT5E 3FZKB 5LMUT 3N2KE 2YEVC 3RIUC 2C5IT 2CBIA 4UVCB 4DO0A 2IUBA 2X0HA 3KBTA 1N36T 4OX9T 3R6NA 5LXTE 2CMRA 3DTOA 4YTNA 4CN1A 3KBUA 3C4ZA 3DJBA 4U2ZA 5L47A 3CQCB 4L5GA 4U7YA 5JDHA 2W0GA 2YOEA 4CI1B 5IWAT 3SS1A 2JPFA 3T8OA 4AISA 3QB5A 4ILAA 1UGOA 3ONXA 3ZC1A 1YQ3A 4YLHA 3RQWA 2JQHA 5JTGA 1OWAA 2J47A 2YN6A 4O2BE 5LHGB 2M67A 5J0ZA 1OEDE 5JRCB 4X66T 4FJOA 5TAOA 3OYXA 3AA1B 4ERRA 4DV1T 3Q5EA 2BS3A 3OYZA 4MLKA 2X9XA 3AE4A 4IT4A 1CHUA 3FXDB 1R8IA 2E2AA 3PUWF 4O4HE 4EIWA 3AAAB 5FL1A 5KMGP 3NZQA 3E08A 3M65A 4F8HA 3IHRA 1D0ZA 2CWYA 2XAJB 4ZOLE 5LP6E 4YHHT 3TKLB 3ZC0A 3C4XA 3AXJB 1IAPA 3PU8A 2NW7A 1T7SA 4U72A 5L4HA 3MJXA 2DI4A 1MMDA 4WW0A 5J2UE 5AFUL 5JDMA 5C8YE 2LEHA 2OLTA 3JC6D 4QX8B 2LHNA 2PFVA 3IBPA 1NENA 5HXCA 4CZZB 5LJNA 2JMHA 2XAHB 5E0OA 3OBVE 4CQIA 2ZM2A 3AEAA 4IHJE 4DR6T 3F2EA 2WZHA 2CRBA 3N5LA 4L0RA 2DWGA 4Q25A 2WAUA 5JR9A 3RYCE 4DVDA 1XZYA 2B76A 4DV4T 1IBMT 2F4VT 4JV5T 2X9YA 2CHNA 3C4WA 5FNVE 3RKGA 3ZMVB 2YDRA 3AE1A 4IE6A 4IDPA 4IL4A 3ZYKA 2C5KT 3RGLA 1I94T 4HWDA 4PK4A 1T72A 2A72A 5AQKB 5DABA 2W66A 5L3GB 1HNZT 3LK2B 2XQ5A 2V6XA 2N9DA 1KF6A 2WMOA 4I4TE 4U33A 4ZS2A 2ACXA 2X66A 4LF4T 1D0XA 4JI0T 2LHRA 2Q9QD 2V6YA 4ILCA 5IUXA 3VKGA 4DBQA 3QB5K 5AQVB 3P4WA 3ONLC 1WRDA 4YSXA 3AVSA 3DP7A 2QVAA 2W00A 1ZV4X 3ANWA 5ADXL 1IBKT 1T8BA 4I50E 2AXDS 3N2OA 3JCFA 4YJ2E 1ZEEA 2K24A 5FL0A 2BKNA 2CXDA 2VKHA 2VB6A 3MA9A 4GYRA 4IE7A 2X67A 1D1BA 4QH4A 2RP4A 2FJBA 2W63A 2X9HA 3P50A 2H3RA 3NRYA 2UXCT 3P4SA 2VASA 4ANJA 1UX5A 3HKEE 4YSYA 5HXEA 3AEBA 5CB4E 5FYMA 3TLWA 2QYWA 3VR9A 5HWXA 3ZMZB 3LG7A 1J1JA 2OV9A 5L3BB 2BVMA 2ODUA 5DQWA 3V5SA 4G63A 1S35A 2V5CA 2E9XD 2KINB 1O3XA 2P9BA 3PURA 1YW0A 4NIQA 4NPPA 2IMLA 3LBXB 4PAGA 3R84B 2LSGA 2V7LA 3P4QA 2EHOC 4ISTA 4LMLA 5LG3A 2V6YB 5JDFA 2E9XC 2IC6A 1HX1B 2BS4A 2IIUA 3H3AA 2UUAT 2NWBA 5AQLB 2QA7A 4EAHA 1HR0T 1WCRA 1JNRA 3UQ4A 1KK7A 2D0UA 2JJ9A 4IDNA 5HWYA 3RX6A 3T1HT 3N9MA 1DU2A 3M3ZB 1WLXA 2XQ8A 4TNWA 4A98A 5AQRB 4AIUA 1E2AA 2I0MA 2A9UA 4IE5A 5LCYA 1WFDA 2V26A 3AEDA 3ZN1B 2ZMAA 3RYIE 5CFBA 3OTOT 3GN5B 2D9DA 4WBNE 1AJ3A 2XQYA 3AECA 3S4UA 3X1DA 1H7CA 2KWIB 4H9NC 4AKRB 1G73A 4NXMT 4OYJA 3UUNA 4LFCT 4LF9T 2YDSA 2BBHA 1KNRA 2HPLA 4HKAA 5J1GA 3RYHE 5EK2A 3CK6A 3ONJA 1UURA 1XNQT 3RH3A 4ZI2D 1D1CA 3QK6A 2WSSV 2E9XA 2YU2A 4MBQA 1W09A 4OHFA 3CQXC 3RIAA 2Y8DA 2C0SA 1HX8A 2EHOA 2LSJA 4HFCA 4YT0A 4QXBB 4ZI2C 2Z6EA 3TLTA 2DNXA 2WMNA 1UCUA 1KEYA 4JBWF 4WBOA 1I6ZA 1D1AA 4FI5A 4P0BA 2WDQA 4EOZB 3ZYLA 1LVFA 1MNEA 5LGUB 4ILBA 4DR2T 4BJMA 4KX6A 4PJMA 2NOXA 3EVYA 5AQPB 1LRZA 4CXYA 1XDOA 2DCFA 3VU7H 4AKLA 2I6HA 5BR8T 4B3ST 2W2UA 4JLEA 2WDRA 3RI5A 3MKDA 3ZT5A 1FIOA 4H9RC 4I43B 2VKDA 2XPKA 2BBJA 2KNDA 2KXPB 4LMJA 3RC8A 2YKSA 5L3EB 3EAMA 2XAGB 2N1GA 3T1YT 2DHRA 4H9SE 3PE0A 4LMKA 4IE0A 3FXEB 5JQGE 2ACZA 4O4LE 3SRZA 3O1IA 2WWUA 4XZCA 4EGWA 3J9X1 4QKNA 4JI8T 4XBFB 2V8SV 1MNDA 2X68A 3A7MA 3HKBE 3PUAA 3I0OA 3ZPOA 4X20E 2N2NA 4IGUA 1US7B 4HFIA 1X9BA 2W62A 2LLYA 2KWHA 2NTYA 3MACA 1Y64B 3N9LA 3PU3A 4QXCB 4TZ4C 4E7ZA 1J5ET 3BQLA 2Y6XA 3KINB 2YDQA 1ZP0A 4HFHA 5ABFA 2VVSA 3RKOA 1MIYA 5FVKA 3AEEA 1J5WA 2K9AA 4BA9A 1UX4A 3O4XE 1YD8G 3RYFE 3MZKB 5A1LA 1LKXA 4YY3T 2RPAA 4B3TT 4XAXB 3PDYA 2A3DA 3HKCE 3FZHB 4H63H 3RHWA 3RQUA 4K0KT 4HFBA 5LA6E 5L3FB 4EEBA 3SFDA 3E22E 4PJJA 4UVBB 1GQEA 2ODVA 1IJ6A 2XQ9A 4ISSA 4X62T 2K3WA 1QLBA 3RPUA 4KMCA 2XQ7A 5HCJA 2NW9A 4WNKA 5FXZA 3GWHA 5FXXA 4DIDB 3UUMA 2BDEA 5AQFB 3SFEA 2X0LB 5HEOA 3UU5A 2BS2A 2QRXA 4GKKT 2V7JA 3KV9A 3ANWB 1G8XA 3PUGA 5IYZE 3EDUA 3CX7B 2RA1A 4HE8A 3RLFF 1WR0A 3IEEA 3BK9A 2WY2A 2L9QA 4ZI3C 2UUBT 3AE6A 3PUXF 3FZLB 2D0TA 4UF0A 4U31A 5FY1A 5JDLA 4TN7B 5KXJA 3P8CD 4NXNT 2G0UA 1XNRT 2H88A 4H63V 2BG9A 3CX6B 3VHLA 2ZM6T 2MYSA 5AQMB 4PK6A 3AB3B 3PUZF 3PUSA 4HWCA 1W0AA 2L3LA 1HTJF 2KMFA 3N9QA 3I1AA 2XJ7A 4YSZA 4X65T 2Y48B 3PJAA 2K5BB 2CLYB 4G2AA 1ZHCA 2XUEA 3KFWX 2Q9QC 1QUUA 3LK3B 4YFSA 3OKQA 5HXRA 3O9XA 4A5XA 1BR1A 3K1SA 5AQQB 1X79A 4GYSA 2ES0A 3GMIA 3C98B 4ZHQE 2PTFA 1UK5A 2VWAA 3AE9A 4X1KE 3H37A 4AQYT 3HR0A 4GOUA 3AAIA 4DV5T 2J1DG 3HKDE 4IREA 5LBMA 5JDQA 1M7KA 2CXLA 2LJLA 2OA5A 4PFOA 4UIGA 4AKIA 1HG5A 3AEGA 2VQFT 4YJ3E 5JVDE 2LSIA 3KVBA 4F6RC 1OXZA 2FJAA 2HH7A 5F5WA 2JQKA 3FZFB 4PJLA 4IDZA 2IW5B 4JI5T 3B13A 3TLSA 1E1HB 4LF7T 2LSKA 2IDOB 1MMAA 3JC6C 3ZJ1A 5L3DB 2Q9QA 4HGAA 1HF8A 1BR2A 2W67A 3ABVA 2XZEA 1L0VA 5CA0E 3D0TA 3ETVA 2E9XB 4JUYA 1YKHB 3NWIA 3I9WA 2PBIA 4JI1T 2WM9A 5AQOB 3FBZA 2UXXB 2VQET 5JDGA 4X1IE 2VKJA 2M6IA 3CMLA 3ZMUB 2L8KA 3P4PA 3RRCA 3IF8B 2V1DB 3L3PA 4OYKA 5HEGA 2VVNA 4TWDA 1FMWA 4KUMB 4GKJT 4EXTA 2VL8A 5JR9C 2IAKA 1KFYA 4GK0E 3AE7A 2VK9A 2D5UA 4H9PC 4EEDA 4U2YA 5LGTB 2WS3A 4Z91A 5JDNA 1U5PA 2XSAA 3CQGB 1LVKA 1E7PA 4I55E 4IDOA 2WB5A 5FY7A 3UU4A 4LF6T 5H6RB 4IE4A 4ZI7E 1VCSA 4C91A 1XMQT 4DV6T 2MAWA 2LKGA 1ZOYA 3KVAA 4EZHA 3VKHA 2UXBT 2Q9QB 2VL0A 3NZPA 3BQKA 5GONE 1HCIA 5FXVA 1XWMA 3W15B 2CBJA 2FJEA 4AQFA 2EHOD 4QH1A 4AKGA 3ZCJA 4B3MT 3HL6A 3C50A 2BVLA 3HI2A 3JADA 2KSRA 5IHYA 4JEUB 3NBXX 3A8YC 4EYYR 5EK3A 3ZSTA 5DQVA 1OEDB 2V5DA 3FBLA 2J62A 3OVUA 4CXWA 4O8SA 4ZEYA 2AE9A 2MPKA 4Z8XA 4A97A 2XM2A 3JAFA 3MK7C 2PG8A 3NKZA 1YKEB 4TUYE 4A56A 5ABFB 4BJNA 4HEAA 1CUNA 3C64A 3KV6A 2HHHT 3ZLIA 1YXRA 3P4RA 1N33T 5L2LA 1SUMB 2SPCA 3B57A 5LOVE 4OK0A 4DBRA 1N32T 4QX7B 5FKYA 3RC3A 3UU8A 2QGSA 4X1YE 4KHZF 1EZ3A 4JEHB 4ZZBA 3Q9DA 4EZ4A 3ZN0B 4ILUA 2XQAA 5AQHB 2KLQA 2XAQB 3LJCA 4PW8A 5KDMC 2HPJA 2NW8A 5ABGA 3AE3A 4HFDA 3F31A 3VRBA 3WI3A 4MHCA 2XQ4A 3GA8A 4WZXA 1VRBA 3ZT6A 2XM1A 4HFVA 3QUJA 5BMVE 4DMWA 4AI6A 2E8IA 4PFPA 4DUZT 3AE8A 2WZIA 4IDQA 5CJ5A 2XQ3A 3AVRA 3EDVA 2B1EA 3LFMA 3CX8B 3L39A 3MXZA 1XDPA 3GN5A 3KV4A 4KHPT 4ADZA 4LFBT 4C90A 5JRCA 4GK5E 4GIWA 2H7OA 2CE7A 1SE7A 3AE5A 2HN2A 2BG9B 2YINA 3AA6B 5FP3A 5ABEA 4MFRA 3OJAA 1IBLT 3G06A 2CEAA
chains in the Genus database with same CATH topology
2JMKA 4M1PA 5LYJE 5HXSA 1MMNA 4PNIA 5CA1E 3ZYMA 1NAFA 5H6QB 4CI2B 5DJQC 5JH7E 3NRXA 4MALA 2KT9A 4UVAB 5J2TE 3CKDA 3QC9A 2XHEB 3UFEA 4EB6E 4B6XA 4YHJA 4EYUA 1FMVA 1Z0PA 2MTQA 2NTXA 2WBLA 4ZI3D 5JREA 3AA7B 2YU1A 1WYBA 4CI3B 4DMVA 5F8PA 3K3QC 3ZEFB 3J7Yq 5EZYE 4E7SA 3HA4A 4BAYB 2DWKA 2ZM8A 1QSDA 2CXFA 4N78D 1MMGA 2D2SA 4UEMA 4UV8B 3LBXA 3K8PC 2W61A 4U74A 4L9IA 5EK4A 3ZMTB 3ESLA 3I9YA 3EUHA 3BQIA 3O1HA 4HTEA 1SA0E 4O4JE 4UV9B 2DLRA 3U3IA 3SOLA 2IC9A 3FHNA 2XTLA 2CA5A 4IIJE 3V5UA 2C5JA 2NP9A 4ZS3A 3CVRA 3PTRB 3KDSE 5ETWA 4PK5A 3SWHA 1WYCA 2LSYA 4DNDA 2X9WA 3CWZB 1HS7A 3ZCIA 4TV9E 1NWMX 2V7KA 5LBQB 2XAFB 1SHZC 1IZNB 3LK42 4TX5A 5FMNA 2YK0A 2CCQA 1U4QA 4NUUA 1ZKEA 3I0QA 4H9QC 3N9PA 2K48A 2CWOA 1T98A 5JR9B 3F57A 4QXHB 3WAKA 3AA0B 4TV8E 4K0UA 4UF0B 4UELA 5FY0A 3RRWA 3UULA 5F3JA 5LG4A 1BR0A 3Q2MA 1S94A 5LNKA 2H7VC 3N9NA 2LT3A 5HYAA 2ZLYA 2V7IA 4KBMB 2KZ7B 5LHHB 1KNZA 5M4YA 2JQQA 2EHOB 4AQFC 3C51A 3E0ZA 4QWNB 4OFZA 2UXNB 3UTKA 4V1Av 3K3NA 1BR4A 4KP3C 3UUXB 3ETUA 1D0YA 2ZM0A 3PUQA 4P0AA 5LHIB 1B7TA 2I59A 4H9OC 1WR6A 3P7IA 4AQGA 3Q5XA 3FB2A 3N2GE 2X51A 2LOSA 2LOPA 5HAXA 2MOZA 4P09A 4PJNA 4HN9A 2GK9A 5FXWA 4NUVA 5L3CB 1FEWA 2LE8A 4QHOA 5LGNB 2CLYC 3AAEB 1HG2A 2CM0A 3ZJ2A 4CZZB 2PJQA 1V9DA 4J2CA 4ASKA 4O2AE 1MIVA 3U78A 2LM9A 3N9OA 5HXHA 3O1JA 4C90A 3Q5WA 2A2FX 3K3OA 1MIWA 2V7MA 5KX5E 1HFAA 2XASB 3KV5A 3L09A 3WAJA 4O4IE 4UXNB 3CPZA 4CXXA 1VOMA 3A5XA 5LJMA 1IJ5A 2MBGA 2VKOA 4AXPA 2BZBA 2JRKA 3UT5E 3N2KE 2YEVC 2C5IT 4UVCB 4DO0A 3KBTA 3R6NA 5LXTE 2CMRA 3DTOA 3KBUA 3C4ZA 3DJBA 3CQCB 4L5GA 5JDHA 2W0GA 4CI1B 3SS1A 2JPFA 3T8OA 3ONXA 3ZC1A 4YLHA 1OWAA 4O2BE 5LHGB 2M67A 5JRCB 4FJOA 5TAOA 3OYXA 3AA1B 4ERRA 3OYZA 4MLKA 2X9XA 3FXDB 4EIWA 4O4HE 5KMGP 3AAAB 3NZQA 3E08A 3M65A 3IHRA 1D0ZA 2CWYA 2XAJB 4ZOLE 5LP6E 3TKLB 3ZC0A 3C4XA 1IAPA 3PU8A 2NW7A 4U72A 5J2UE 3MJXA 2DI4A 1MMDA 4WW0A 5AFUL 5C8YE 2LEHA 3JC6D 4QX8B 2LHNA 2PFVA 3IBPA 5HXCA 5LJNA 2JMHA 2XAHB 5E0OA 3OBVE 4CQIA 2ZM2A 4IHJE 3F2EA 4L0RA 3N5LA 2DWGA 3RYCE 2WAUA 5JR9A 4DVDA 4AKHA 2X9YA 3C4WA 5FNVE 3ZYKA 4DBQA 3ZMVB 4IE6A 2C5KT 4PK4A 2A72A 5DABA 5L3GB 3LK2B 2N9DA 2WMOA 4I4TE 4ZS2A 2ACXA 2X66A 1D0XA 2LHRA 2Q9QD 3VKGA 1WRDA 3AVSA 3DP7A 2W00A 3ANWA 1ZV4X 5ADXL 4I50E 3N2OA 4YJ2E 1ZEEA 2K24A 2CXDA 2VKHA 2VB6A 3MA9A 4GYRA 4IE7A 2X67A 1D1BA 5JDMA 2RP4A 2W63A 2X9HA 2H3RA 3NRYA 2VASA 4ANJA 1UX5A 3HKEE 5HXEA 5CB4E 5FYMA 5HWXA 3ZMZB 3LG7A 2BVMA 2ODUA 5DQWA 3V5SA 4G63A 1S35A 3PURA 2E9XD 2KINB 1O3XA 2P9BA 1YW0A 4PAGA 3R84B 3LBXB 2LSGA 2V7LA 4ISTA 2EHOC 5JDFA 2E9XC 2IC6A 3H3AA 2NWBA 2QA7A 4EAHA 1KK7A 2D0UA 2JJ9A 5HWYA 3RX6A 3N9MA 1WLXA 4IE5A 5LCYA 2V26A 3ZN1B 2ZMAA 3RYIE 3GN5B 4WBNE 1AJ3A 2XQYA 3S4UA 4AKRB 1H7CA 2KWIB 4H9NC 1G73A 4OYJA 3UUNA 3RYHE 2HPLA 4HKAA 5J1GA 5EK2A 3RH3A 4ZI2D 1D1CA 3QK6A 2WSSV 2E9XA 2YU2A 4MBQA 4OHFA 3CQXC 2Y8DA 2C0SA 1HX8A 2EHOA 2LSJA 4QXBB 4ZI2C 2Z6EA 2DNXA 2WMNA 1UCUA 4WBOA 1D1AA 4FI5A 4P0BA 4EOZB 3ZYLA 1LVFA 1MNEA 5LGUB 4BJMA 4PJMA 2NOXA 3EVYA 1LRZA 4CXYA 2DCFA 3VU7H 4AKLA 4JLEA 3MKDA 1FIOA 4H9RC 4I43B 2VKDA 3RC8A 2KNDA 2KXPB 5L3EB 2XAGB 2N1GA 2DHRA 4H9SE 3PE0A 4IE0A 3FXEB 5JQGE 4O4LE 3SRZA 3O1IA 2WWUA 4XZCA 4XBFB 3J9X1 4QKNA 1MNDA 2X68A 3HKBE 3PUAA 3I0OA 3ZPOA 4X20E 2N2NA 4IGUA 1US7B 3ZMSB 2W62A 2KWHA 2NTYA 3MACA 1Y64B 3N9LA 3PU3A 4QXCB 4TZ4C 4E7ZA 3BQLA 2Y6XA 3KINB 3RKOA 1MIYA 4BA9A 2K9AA 1UX4A 3O4XE 1YD8G 3RYFE 3MZKB 5A1LA 1LKXA 4XAXB 3PDYA 2A3DA 3HKCE 4H63H 5LA6E 5L3FB 3E22E 4PJJA 4UVBB 2ODVA 1IJ6A 4ISSA 3RPUA 4KMCA 2NW9A 4WNKA 5FXZA 3GWHA 5FXXA 3UUMA 2BDEA 2X0LB 2V7JA 3KV9A 3ANWB 1G8XA 3PUGA 5IYZE 3EDUA 3CX7B 2RA1A 4HE8A 3IEEA 3BK9A 4ZI3C 2L9QA 2D0TA 4UF0A 5FY1A 5JDLA 4TN7B 3P8CD 2G0UA 4H63V 3CX6B 3VHLA 2MYSA 4PK6A 3AB3B 5L3BB 3PUSA 2L3LA 1HTJF 2KMFA 3N9QA 3I1AA 2Y48B 2K5BB 2CLYB 4G2AA 1ZHCA 2XUEA 3KFWX 2Q9QC 1QUUA 3LK3B 4YFSA 3OKQA 5HXRA 3O9XA 1BR1A 1X79A 4GYSA 2ES0A 3GMIA 3C98B 4ZHQE 2VWAA 4X1KE 3H37A 3HR0A 4GOUA 3AAIA 2J1DG 3HKDE 5LBMA 5JDQA 2CXLA 2LJLA 2OA5A 4PFOA 4UIGA 4AKIA 1HG5A 4YJ3E 5JVDE 2LSIA 3KVBA 4F6RC 1OXZA 2HH7A 4PJLA 4IDZA 2IW5B 3B13A 1E1HB 2LSKA 1MMAA 3JC6C 3ZJ1A 5L3DB 2Q9QA 4HGAA 1HF8A 1BR2A 5CA0E 3D0TA 3ETVA 2E9XB 4JUYA 1YKHB 3I9WA 2PBIA 2WM9A 3FBZA 2UXXB 5JDGA 4X1IE 2VKJA 3CMLA 3ZMUB 2L8KA 3RRCA 3IF8B 2V1DB 3L3PA 4OYKA 1FMWA 4KUMB 4EXTA 2VL8A 5JR9C 2IAKA 4GK0E 2VK9A 2D5UA 4H9PC 5LGTB 5JDNA 1U5PA 3CQGB 4I55E 1LVKA 5FY7A 5H6RB 4IE4A 4ZI7E 4C91A 3KVAA 4EZHA 3VKHA 2Q9QB 3W15B 3NZPA 3BQKA 5GONE 1HCIA 5FXVA 4AQFA 2EHOD 4AKGA 3ZCJA 3HL6A 3C50A 2BVLA 3HI2A 5IHYA 4JEUB 3NBXX 4EYYR 5EK3A 5DQVA 3FBLA 4CXWA 4O8SA 4Z8XA 3MK7C 2PG8A 1YKEB 4TUYE 4A56A 4BJNA 4HEAA 1CUNA 3C64A 3KV6A 3ZLIA 5L2LA 2SPCA 3B57A 5LOVE 4OK0A 4DBRA 4QX7B 3RC3A 2QGSA 4X1YE 1EZ3A 4JEHB 3Q9DA 4EZ4A 3ZN0B 4ILUA 2KLQA 2XAQB 3LJCA 4PW8A 5KDMC 2HPJA 2NW8A 3F31A 3WI3A 4MHCA 3GA8A 1VRBA 4HFVA 3QUJA 5BMVE 4DMWA 4AI6A 2E8IA 4PFPA 3AVRA 3EDVA 3LFMA 2B1EA 3CX8B 3MXZA 3GN5A 3KV4A 5JRCA 4ADZA 4GK5E 4GIWA 2H7OA 2CE7A 5FP3A 3AA6B 2YINA 4MFRA 3OJAA 2CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7K A;  1YW0 A;  2X66 A;  4U74 A;  3E08 A;  2NW9 A;  2V7L A;  2V7I A;  2X68 A;  5EK4 A;  4PW8 A;  2NW8 A;  2NW7 A;  4U72 A;  2NWB A;  5EK3 A;  2V7M A;  2D0U A;  2V7J A;  1ZEE A;  3BK9 A;  2X67 A;  2NOX A;  2D0T A;  5ETW A;  4PK5 A;  4HKA A;  4PK6 A;  5EK2 A; 
#chains in the Genus database with same CATH topology
 2JMK A;  1W0B A;  4M1P A;  5LYJ E;  3EAB A;  1MMN A;  4PNI A;  5HXS A;  2WP9 A;  5CA1 E;  3ZYM A;  1NAF A;  2IHR 1;  2DL1 A;  3IA3 A;  4TWH A;  2FUP A;  3NVO A;  5DJQ C;  3AEF A;  5H6Q B;  4CI2 B;  3NRX A;  3AE2 A;  4MAL A;  5JH7 E;  2KT9 A;  2R6G F;  4UVA B;  5J2T E;  4CN4 A;  5CGM A;  3CKD A;  4HFE A;  3QC9 A;  2LKH A;  1XMO T;  3L8R A;  2XHE B;  3PV0 F;  3UFE A;  4B6X A;  4EB6 E;  2W4X A;  4YHJ A;  3VR8 A;  4EYU A;  2BG9 E;  3QNU A;  1FMV A;  1Z0P A;  2MTQ A;  2NTX A;  2WBL A;  2XQ6 A;  4ZI3 D;  5JRE A;  3AA7 B;  2YU1 A;  1WYB A;  5AQS B;  4CI3 B;  5F8P A;  3K3Q C;  4DMV A;  3ZEF B;  3J7Y q;  5EZY E;  4E7S A;  3HA4 A;  4BAY B;  2DWK A;  3UU3 A;  2ZM8 A;  4COF A;  4JI3 T;  1QSD A;  2JIW A;  2CXF A;  2FJD A;  1KNP A;  4N78 D;  4CN6 A;  1MMG A;  2D2S A;  4UEM A;  4UV8 B;  3LBX A;  1FJG T;  3K8P C;  2W61 A;  4U74 A;  4P1N A;  4L9I A;  5C3J A;  1N34 T;  5EK4 A;  3PJA J;  3ESL A;  3ZMT B;  5LMN T;  2WCA A;  3I9Y A;  3EUH A;  3UUB A;  1Z8U A;  3B5M A;  3BQI A;  2CHO A;  3O1H A;  4HTE A;  1SA0 E;  4O4J E;  4UV9 B;  4LF8 T;  2NR4 A;  2DLR A;  3U3I A;  3SOL A;  4B3R T;  2IC9 A;  2E5V A;  3OPC A;  4YXD A;  3FHN A;  2XTL A;  2CA5 A;  4JI4 T;  4IIJ E;  3V5U A;  2C5J A;  5HCM A;  4DR4 T;  2FBW A;  2UXD T;  4ZZC A;  2NP9 A;  4ZS3 A;  3CVR A;  4DV2 T;  4DV3 T;  3PTR B;  1OED C;  3KDS E;  2UUC T;  5ETW A;  4PK5 A;  3SWH A;  4DUY T;  1HNX T;  1WYC A;  2LSY A;  4DND A;  2X9W A;  3CWZ B;  1HS7 A;  3ZCI A;  5L4E A;  4TV9 E;  3QOF A;  1NWM X;  2V7K A;  3PUV F;  5LBQ B;  2XAF B;  1SHZ C;  1IZN B;  4YTP A;  3LDQ B;  3LK4 2;  3RIF A;  3AXJ A;  4LF5 T;  4TX5 A;  3UFG A;  5FMN A;  5AQG B;  2YK0 A;  4HWF A;  2CCQ A;  2VUR A;  1U4Q A;  4NUU A;  5C2T A;  1ZKE A;  3I0Q A;  4DV7 T;  4H9Q C;  3N9P A;  2K48 A;  2CWO A;  4DR7 T;  1T98 A;  5JR9 B;  3F57 A;  4QXH B;  4HWH A;  3AA0 B;  3WAK A;  2X0Y A;  4Z90 A;  4TV8 E;  4ZXL A;  2UU9 T;  4K0U A;  1VCT A;  5AQN B;  4UF0 B;  4UEL A;  5FY0 A;  3RRW A;  3UUL A;  5F3J A;  5LG4 A;  4LFA T;  1BR0 A;  3TLV A;  5ABH A;  3UQ7 A;  3Q2M A;  1S94 A;  3PUY F;  5LNK A;  2BG9 C;  3ZT7 A;  2H7V C;  2M6B A;  3VRA A;  1Y01 A;  3N9N A;  1M62 A;  2LT3 A;  1JNZ A;  5HYA A;  5HEU A;  4YTM A;  2ZLY A;  2V7I A;  4KBM B;  2KZ7 B;  5LHH B;  1KNZ A;  5M4Y A;  2JQQ A;  2EHO B;  4JI7 T;  4AQF C;  3C51 A;  3E0Z A;  2XSB A;  4QWN B;  4OFZ A;  2UXN B;  3UTK A;  2WWV A;  2XY8 B;  4V1A v;  2WU2 A;  1BR4 A;  3K3N A;  4KP3 C;  3ETU A;  1D0Y A;  2ZM0 A;  3PUQ A;  4TNV A;  4U3C A;  3UUX B;  2H89 A;  4TWF A;  3UU6 A;  1B7T A;  2WQY A;  5LHI B;  2I59 A;  4H9O C;  4P0A A;  1WR6 A;  3P7I A;  4AQG A;  3Q5X A;  4DR3 T;  3FB2 A;  2LRL A;  3N2G E;  2X51 A;  2LOS A;  2LOP A;  5HAX A;  2HN1 A;  4I0U A;  4DR1 T;  2MOZ A;  4P09 A;  3EI0 A;  4PJN A;  3LSV A;  5LB7 B;  4HWI B;  4HN9 A;  2CPT A;  2JQ9 A;  4JI2 T;  2GK9 A;  5AQU B;  5FXW A;  3H3M A;  4NUV A;  5L3C B;  1FEW A;  2LE8 A;  4QHO A;  5LGN B;  5AQT B;  2CLY C;  1NEK A;  1HG2 A;  2CM0 A;  3AAE B;  4UR9 A;  2PJQ A;  1V9D A;  4J2C A;  2BKO A;  3ZJ2 A;  4ASK A;  4O2A E;  1MIV A;  3U78 A;  4JYA T;  1UUS A;  2LM9 A;  5FVL A;  3N9O A;  5HXH A;  3CIR A;  1YQ4 A;  3EHZ A;  3O1J A;  1OED A;  3Q5W A;  2A2F X;  4U7I A;  3K3O A;  3ZMS B;  1HNW T;  1MIW A;  2V7M A;  2BKP A;  3RF1 A;  5KX5 E;  2LRK A;  4DV0 T;  1W9R A;  1HFA A;  2XAS B;  4QH5 A;  3ZSS A;  3KV5 A;  5AQI B;  3L09 A;  4DR5 T;  3WAJ A;  4X64 T;  3JAE A;  2E5L T;  4O4I E;  4UXN B;  3CPZ A;  3Q5D A;  1VOM A;  4CXX A;  3A5X A;  5LJM A;  2LM2 A;  3FZM B;  4EV6 A;  4JI6 T;  3RIU A;  1IJ5 A;  4KI0 F;  2MBG A;  2WU5 A;  4AKH A;  5AQJ B;  4X5T A;  2VKO A;  4IL9 A;  5HEH A;  4AXP A;  5HEJ A;  2BZB A;  2WDV A;  4WYV A;  2J4G A;  2JRK A;  3TLU A;  3ZKR A;  3UT5 E;  3FZK B;  5LMU T;  3N2K E;  2YEV C;  3RIU C;  2C5I T;  2CBI A;  4UVC B;  4DO0 A;  2IUB A;  2X0H A;  3KBT A;  1N36 T;  4OX9 T;  3R6N A;  5LXT E;  2CMR A;  3DTO A;  4YTN A;  4CN1 A;  3KBU A;  3C4Z A;  3DJB A;  4U2Z A;  5L47 A;  3CQC B;  4L5G A;  4U7Y A;  5JDH A;  2W0G A;  2YOE A;  4CI1 B;  5IWA T;  3SS1 A;  2JPF A;  3T8O A;  4AIS A;  3QB5 A;  4ILA A;  1UGO A;  3ONX A;  3ZC1 A;  1YQ3 A;  4YLH A;  3RQW A;  2JQH A;  5JTG A;  1OWA A;  2J47 A;  2YN6 A;  4O2B E;  5LHG B;  2M67 A;  5J0Z A;  1OED E;  5JRC B;  4X66 T;  4FJO A;  5TAO A;  3OYX A;  3AA1 B;  4ERR A;  4DV1 T;  3Q5E A;  2BS3 A;  3OYZ A;  4MLK A;  2X9X A;  3AE4 A;  4IT4 A;  1CHU A;  3FXD B;  1R8I A;  2E2A A;  3PUW F;  4O4H E;  4EIW A;  3AAA B;  5FL1 A;  5KMG P;  3NZQ A;  3E08 A;  3M65 A;  4F8H A;  3IHR A;  1D0Z A;  2CWY A;  2XAJ B;  4ZOL E;  5LP6 E;  4YHH T;  3TKL B;  3ZC0 A;  3C4X A;  3AXJ B;  1IAP A;  3PU8 A;  2NW7 A;  1T7S A;  4U72 A;  5L4H A;  3MJX A;  2DI4 A;  1MMD A;  4WW0 A;  5J2U E;  5AFU L;  5JDM A;  5C8Y E;  2LEH A;  2OLT A;  3JC6 D;  4QX8 B;  2LHN A;  2PFV A;  3IBP A;  1NEN A;  5HXC A;  4CZZ B;  5LJN A;  2JMH A;  2XAH B;  5E0O A;  3OBV E;  4CQI A;  2ZM2 A;  3AEA A;  4IHJ E;  4DR6 T;  3F2E A;  2WZH A;  2CRB A;  3N5L A;  4L0R A;  2DWG A;  4Q25 A;  2WAU A;  5JR9 A;  3RYC E;  4DVD A;  1XZY A;  2B76 A;  4DV4 T;  1IBM T;  2F4V T;  4JV5 T;  2X9Y A;  2CHN A;  3C4W A;  5FNV E;  3RKG A;  3ZMV B;  2YDR A;  3AE1 A;  4IE6 A;  4IDP A;  4IL4 A;  3ZYK A;  2C5K T;  3RGL A;  1I94 T;  4HWD A;  4PK4 A;  1T72 A;  2A72 A;  5AQK B;  5DAB A;  2W66 A;  5L3G B;  1HNZ T;  3LK2 B;  2XQ5 A;  2V6X A;  2N9D A;  1KF6 A;  2WMO A;  4I4T E;  4U33 A;  4ZS2 A;  2ACX A;  2X66 A;  4LF4 T;  1D0X A;  4JI0 T;  2LHR A;  2Q9Q D;  2V6Y A;  4ILC A;  5IUX A;  3VKG A;  4DBQ A;  3QB5 K;  5AQV B;  3P4W A;  3ONL C;  1WRD A;  4YSX A;  3AVS A;  3DP7 A;  2QVA A;  2W00 A;  1ZV4 X;  3ANW A;  5ADX L;  1IBK T;  1T8B A;  4I50 E;  2AXD S;  3N2O A;  3JCF A;  4YJ2 E;  1ZEE A;  2K24 A;  5FL0 A;  2BKN A;  2CXD A;  2VKH A;  2VB6 A;  3MA9 A;  4GYR A;  4IE7 A;  2X67 A;  1D1B A;  4QH4 A;  2RP4 A;  2FJB A;  2W63 A;  2X9H A;  3P50 A;  2H3R A;  3NRY A;  2UXC T;  3P4S A;  2VAS A;  4ANJ A;  1UX5 A;  3HKE E;  4YSY A;  5HXE A;  3AEB A;  5CB4 E;  5FYM A;  3TLW A;  2QYW A;  3VR9 A;  5HWX A;  3ZMZ B;  3LG7 A;  1J1J A;  2OV9 A;  5L3B B;  2BVM A;  2ODU A;  5DQW A;  3V5S A;  4G63 A;  1S35 A;  2V5C A;  2E9X D;  2KIN B;  1O3X A;  2P9B A;  3PUR A;  1YW0 A;  4NIQ A;  4NPP A;  2IML A;  3LBX B;  4PAG A;  3R84 B;  2LSG A;  2V7L A;  3P4Q A;  2EHO C;  4IST A;  4LML A;  5LG3 A;  2V6Y B;  5JDF A;  2E9X C;  2IC6 A;  1HX1 B;  2BS4 A;  2IIU A;  3H3A A;  2UUA T;  2NWB A;  5AQL B;  2QA7 A;  4EAH A;  1HR0 T;  1WCR A;  1JNR A;  3UQ4 A;  1KK7 A;  2D0U A;  2JJ9 A;  4IDN A;  5HWY A;  3RX6 A;  3T1H T;  3N9M A;  1DU2 A;  3M3Z B;  1WLX A;  2XQ8 A;  4TNW A;  4A98 A;  5AQR B;  4AIU A;  1E2A A;  2I0M A;  2A9U A;  4IE5 A;  5LCY A;  1WFD A;  2V26 A;  3AED A;  3ZN1 B;  2ZMA A;  3RYI E;  5CFB A;  3OTO T;  3GN5 B;  2D9D A;  4WBN E;  1AJ3 A;  2XQY A;  3AEC A;  3S4U A;  3X1D A;  1H7C A;  2KWI B;  4H9N C;  4AKR B;  1G73 A;  4NXM T;  4OYJ A;  3UUN A;  4LFC T;  4LF9 T;  2YDS A;  2BBH A;  1KNR A;  2HPL A;  4HKA A;  5J1G A;  3RYH E;  5EK2 A;  3CK6 A;  3ONJ A;  1UUR A;  1XNQ T;  3RH3 A;  4ZI2 D;  1D1C A;  3QK6 A;  2WSS V;  2E9X A;  2YU2 A;  4MBQ A;  1W09 A;  4OHF A;  3CQX C;  3RIA A;  2Y8D A;  2C0S A;  1HX8 A;  2EHO A;  2LSJ A;  4HFC A;  4YT0 A;  4QXB B;  4ZI2 C;  2Z6E A;  3TLT A;  2DNX A;  2WMN A;  1UCU A;  1KEY A;  4JBW F;  4WBO A;  1I6Z A;  1D1A A;  4FI5 A;  4P0B A;  2WDQ A;  4EOZ B;  3ZYL A;  1LVF A;  1MNE A;  5LGU B;  4ILB A;  4DR2 T;  4BJM A;  4KX6 A;  4PJM A;  2NOX A;  3EVY A;  5AQP B;  1LRZ A;  4CXY A;  1XDO A;  2DCF A;  3VU7 H;  4AKL A;  2I6H A;  5BR8 T;  4B3S T;  2W2U A;  4JLE A;  2WDR A;  3RI5 A;  3MKD A;  3ZT5 A;  1FIO A;  4H9R C;  4I43 B;  2VKD A;  2XPK A;  2BBJ A;  2KND A;  2KXP B;  4LMJ A;  3RC8 A;  2YKS A;  5L3E B;  3EAM A;  2XAG B;  2N1G A;  3T1Y T;  2DHR A;  4H9S E;  3PE0 A;  4LMK A;  4IE0 A;  3FXE B;  5JQG E;  2ACZ A;  4O4L E;  3SRZ A;  3O1I A;  2WWU A;  4XZC A;  4EGW A;  3J9X 1;  4QKN A;  4JI8 T;  4XBF B;  2V8S V;  1MND A;  2X68 A;  3A7M A;  3HKB E;  3PUA A;  3I0O A;  3ZPO A;  4X20 E;  2N2N A;  4IGU A;  1US7 B;  4HFI A;  1X9B A;  2W62 A;  2LLY A;  2KWH A;  2NTY A;  3MAC A;  1Y64 B;  3N9L A;  3PU3 A;  4QXC B;  4TZ4 C;  4E7Z A;  1J5E T;  3BQL A;  2Y6X A;  3KIN B;  2YDQ A;  1ZP0 A;  4HFH A;  5ABF A;  2VVS A;  3RKO A;  1MIY A;  5FVK A;  3AEE A;  1J5W A;  2K9A A;  4BA9 A;  1UX4 A;  3O4X E;  1YD8 G;  3RYF E;  3MZK B;  5A1L A;  1LKX A;  4YY3 T;  2RPA A;  4B3T T;  4XAX B;  3PDY A;  2A3D A;  3HKC E;  3FZH B;  4H63 H;  3RHW A;  3RQU A;  4K0K T;  4HFB A;  5LA6 E;  5L3F B;  4EEB A;  3SFD A;  3E22 E;  4PJJ A;  4UVB B;  1GQE A;  2ODV A;  1IJ6 A;  2XQ9 A;  4ISS A;  4X62 T;  2K3W A;  1QLB A;  3RPU A;  4KMC A;  2XQ7 A;  5HCJ A;  2NW9 A;  4WNK A;  5FXZ A;  3GWH A;  5FXX A;  4DID B;  3UUM A;  2BDE A;  5AQF B;  3SFE A;  2X0L B;  5HEO A;  3UU5 A;  2BS2 A;  2QRX A;  4GKK T;  2V7J A;  3KV9 A;  3ANW B;  1G8X A;  3PUG A;  5IYZ E;  3EDU A;  3CX7 B;  2RA1 A;  4HE8 A;  3RLF F;  1WR0 A;  3IEE A;  3BK9 A;  2WY2 A;  2L9Q A;  4ZI3 C;  2UUB T;  3AE6 A;  3PUX F;  3FZL B;  2D0T A;  4UF0 A;  4U31 A;  5FY1 A;  5JDL A;  4TN7 B;  5KXJ A;  3P8C D;  4NXN T;  2G0U A;  1XNR T;  2H88 A;  4H63 V;  2BG9 A;  3CX6 B;  3VHL A;  2ZM6 T;  2MYS A;  5AQM B;  4PK6 A;  3AB3 B;  3PUZ F;  3PUS A;  4HWC A;  1W0A A;  2L3L A;  1HTJ F;  2KMF A;  3N9Q A;  3I1A A;  2XJ7 A;  4YSZ A;  4X65 T;  2Y48 B;  3PJA A;  2K5B B;  2CLY B;  4G2A A;  1ZHC A;  2XUE A;  3KFW X;  2Q9Q C;  1QUU A;  3LK3 B;  4YFS A;  3OKQ A;  5HXR A;  3O9X A;  4A5X A;  1BR1 A;  3K1S A;  5AQQ B;  1X79 A;  4GYS A;  2ES0 A;  3GMI A;  3C98 B;  4ZHQ E;  2PTF A;  1UK5 A;  2VWA A;  3AE9 A;  4X1K E;  3H37 A;  4AQY T;  3HR0 A;  4GOU A;  3AAI A;  4DV5 T;  2J1D G;  3HKD E;  4IRE A;  5LBM A;  5JDQ A;  1M7K A;  2CXL A;  2LJL A;  2OA5 A;  4PFO A;  4UIG A;  4AKI A;  1HG5 A;  3AEG A;  2VQF T;  4YJ3 E;  5JVD E;  2LSI A;  3KVB A;  4F6R C;  1OXZ A;  2FJA A;  2HH7 A;  5F5W A;  2JQK A;  3FZF B;  4PJL A;  4IDZ A;  2IW5 B;  4JI5 T;  3B13 A;  3TLS A;  1E1H B;  4LF7 T;  2LSK A;  2IDO B;  1MMA A;  3JC6 C;  3ZJ1 A;  5L3D B;  2Q9Q A;  4HGA A;  1HF8 A;  1BR2 A;  2W67 A;  3ABV A;  2XZE A;  1L0V A;  5CA0 E;  3D0T A;  3ETV A;  2E9X B;  4JUY A;  1YKH B;  3NWI A;  3I9W A;  2PBI A;  4JI1 T;  2WM9 A;  5AQO B;  3FBZ A;  2UXX B;  2VQE T;  5JDG A;  4X1I E;  2VKJ A;  2M6I A;  3CML A;  3ZMU B;  2L8K A;  3P4P A;  3RRC A;  3IF8 B;  2V1D B;  3L3P A;  4OYK A;  5HEG A;  2VVN A;  4TWD A;  1FMW A;  4KUM B;  4GKJ T;  4EXT A;  2VL8 A;  5JR9 C;  2IAK A;  1KFY A;  4GK0 E;  3AE7 A;  2VK9 A;  2D5U A;  4H9P C;  4EED A;  4U2Y A;  5LGT B;  2WS3 A;  4Z91 A;  5JDN A;  1U5P A;  2XSA A;  3CQG B;  1LVK A;  1E7P A;  4I55 E;  4IDO A;  2WB5 A;  5FY7 A;  3UU4 A;  4LF6 T;  5H6R B;  4IE4 A;  4ZI7 E;  1VCS A;  4C91 A;  1XMQ T;  4DV6 T;  2MAW A;  2LKG A;  1ZOY A;  3KVA A;  4EZH A;  3VKH A;  2UXB T;  2Q9Q B;  2VL0 A;  3NZP A;  3BQK A;  5GON E;  1HCI A;  5FXV A;  1XWM A;  3W15 B;  2CBJ A;  2FJE A;  4AQF A;  2EHO D;  4QH1 A;  4AKG A;  3ZCJ A;  4B3M T;  3HL6 A;  3C50 A;  2BVL A;  3HI2 A;  3JAD A;  2KSR A;  5IHY A;  4JEU B;  3NBX X;  3A8Y C;  4EYY R;  5EK3 A;  3ZST A;  5DQV A;  1OED B;  2V5D A;  3FBL A;  2J62 A;  3OVU A;  4CXW A;  4O8S A;  4ZEY A;  2AE9 A;  2MPK A;  4Z8X A;  4A97 A;  2XM2 A;  3JAF A;  3MK7 C;  2PG8 A;  3NKZ A;  1YKE B;  4TUY E;  4A56 A;  5ABF B;  4BJN A;  4HEA A;  1CUN A;  3C64 A;  3KV6 A;  2HHH T;  3ZLI A;  1YXR A;  3P4R A;  1N33 T;  5L2L A;  1SUM B;  2SPC A;  3B57 A;  5LOV E;  4OK0 A;  4DBR A;  1N32 T;  4QX7 B;  5FKY A;  3RC3 A;  3UU8 A;  2QGS A;  4X1Y E;  4KHZ F;  1EZ3 A;  4JEH B;  4ZZB A;  3Q9D A;  4EZ4 A;  3ZN0 B;  4ILU A;  2XQA A;  5AQH B;  2KLQ A;  2XAQ B;  3LJC A;  4PW8 A;  5KDM C;  2HPJ A;  2NW8 A;  5ABG A;  3AE3 A;  4HFD A;  3F31 A;  3VRB A;  3WI3 A;  4MHC A;  2XQ4 A;  3GA8 A;  4WZX A;  1VRB A;  3ZT6 A;  2XM1 A;  4HFV A;  3QUJ A;  5BMV E;  4DMW A;  4AI6 A;  2E8I A;  4PFP A;  4DUZ T;  3AE8 A;  2WZI A;  4IDQ A;  5CJ5 A;  2XQ3 A;  3AVR A;  3EDV A;  2B1E A;  3LFM A;  3CX8 B;  3L39 A;  3MXZ A;  1XDP A;  3GN5 A;  3KV4 A;  4KHP T;  4ADZ A;  4LFB T;  4C90 A;  5JRC A;  4GK5 E;  4GIW A;  2H7O A;  2CE7 A;  1SE7 A;  3AE5 A;  2HN2 A;  2BG9 B;  2YIN A;  3AA6 B;  5FP3 A;  5ABE A;  4MFR A;  3OJA A;  1IBL T;  3G06 A;  2CEA A; 
#chains in the Genus database with same CATH homology
 2JMK A;  4M1P A;  5LYJ E;  5HXS A;  1MMN A;  4PNI A;  5CA1 E;  3ZYM A;  1NAF A;  5H6Q B;  4CI2 B;  5DJQ C;  5JH7 E;  3NRX A;  4MAL A;  2KT9 A;  4UVA B;  5J2T E;  3CKD A;  3QC9 A;  2XHE B;  3UFE A;  4EB6 E;  4B6X A;  4YHJ A;  4EYU A;  1FMV A;  1Z0P A;  2MTQ A;  2NTX A;  2WBL A;  4ZI3 D;  5JRE A;  3AA7 B;  2YU1 A;  1WYB A;  4CI3 B;  4DMV A;  5F8P A;  3K3Q C;  3ZEF B;  3J7Y q;  5EZY E;  4E7S A;  3HA4 A;  4BAY B;  2DWK A;  2ZM8 A;  1QSD A;  2CXF A;  4N78 D;  1MMG A;  2D2S A;  4UEM A;  4UV8 B;  3LBX A;  3K8P C;  2W61 A;  4U74 A;  4L9I A;  5EK4 A;  3ZMT B;  3ESL A;  3I9Y A;  3EUH A;  3BQI A;  3O1H A;  4HTE A;  1SA0 E;  4O4J E;  4UV9 B;  2DLR A;  3U3I A;  3SOL A;  2IC9 A;  3FHN A;  2XTL A;  2CA5 A;  4IIJ E;  3V5U A;  2C5J A;  2NP9 A;  4ZS3 A;  3CVR A;  3PTR B;  3KDS E;  5ETW A;  4PK5 A;  3SWH A;  1WYC A;  2LSY A;  4DND A;  2X9W A;  3CWZ B;  1HS7 A;  3ZCI A;  4TV9 E;  1NWM X;  2V7K A;  5LBQ B;  2XAF B;  1SHZ C;  1IZN B;  3LK4 2;  4TX5 A;  5FMN A;  2YK0 A;  2CCQ A;  1U4Q A;  4NUU A;  1ZKE A;  3I0Q A;  4H9Q C;  3N9P A;  2K48 A;  2CWO A;  1T98 A;  5JR9 B;  3F57 A;  4QXH B;  3WAK A;  3AA0 B;  4TV8 E;  4K0U A;  4UF0 B;  4UEL A;  5FY0 A;  3RRW A;  3UUL A;  5F3J A;  5LG4 A;  1BR0 A;  3Q2M A;  1S94 A;  5LNK A;  2H7V C;  3N9N A;  2LT3 A;  5HYA A;  2ZLY A;  2V7I A;  4KBM B;  2KZ7 B;  5LHH B;  1KNZ A;  5M4Y A;  2JQQ A;  2EHO B;  4AQF C;  3C51 A;  3E0Z A;  4QWN B;  4OFZ A;  2UXN B;  3UTK A;  4V1A v;  3K3N A;  1BR4 A;  4KP3 C;  3UUX B;  3ETU A;  1D0Y A;  2ZM0 A;  3PUQ A;  4P0A A;  5LHI B;  1B7T A;  2I59 A;  4H9O C;  1WR6 A;  3P7I A;  4AQG A;  3Q5X A;  3FB2 A;  3N2G E;  2X51 A;  2LOS A;  2LOP A;  5HAX A;  2MOZ A;  4P09 A;  4PJN A;  4HN9 A;  2GK9 A;  5FXW A;  4NUV A;  5L3C B;  1FEW A;  2LE8 A;  4QHO A;  5LGN B;  2CLY C;  3AAE B;  1HG2 A;  2CM0 A;  3ZJ2 A;  4CZZ B;  2PJQ A;  1V9D A;  4J2C A;  4ASK A;  4O2A E;  1MIV A;  3U78 A;  2LM9 A;  3N9O A;  5HXH A;  3O1J A;  4C90 A;  3Q5W A;  2A2F X;  3K3O A;  1MIW A;  2V7M A;  5KX5 E;  1HFA A;  2XAS B;  3KV5 A;  3L09 A;  3WAJ A;  4O4I E;  4UXN B;  3CPZ A;  4CXX A;  1VOM A;  3A5X A;  5LJM A;  1IJ5 A;  2MBG A;  2VKO A;  4AXP A;  2BZB A;  2JRK A;  3UT5 E;  3N2K E;  2YEV C;  2C5I T;  4UVC B;  4DO0 A;  3KBT A;  3R6N A;  5LXT E;  2CMR A;  3DTO A;  3KBU A;  3C4Z A;  3DJB A;  3CQC B;  4L5G A;  5JDH A;  2W0G A;  4CI1 B;  3SS1 A;  2JPF A;  3T8O A;  3ONX A;  3ZC1 A;  4YLH A;  1OWA A;  4O2B E;  5LHG B;  2M67 A;  5JRC B;  4FJO A;  5TAO A;  3OYX A;  3AA1 B;  4ERR A;  3OYZ A;  4MLK A;  2X9X A;  3FXD B;  4EIW A;  4O4H E;  5KMG P;  3AAA B;  3NZQ A;  3E08 A;  3M65 A;  3IHR A;  1D0Z A;  2CWY A;  2XAJ B;  4ZOL E;  5LP6 E;  3TKL B;  3ZC0 A;  3C4X A;  1IAP A;  3PU8 A;  2NW7 A;  4U72 A;  5J2U E;  3MJX A;  2DI4 A;  1MMD A;  4WW0 A;  5AFU L;  5C8Y E;  2LEH A;  3JC6 D;  4QX8 B;  2LHN A;  2PFV A;  3IBP A;  5HXC A;  5LJN A;  2JMH A;  2XAH B;  5E0O A;  3OBV E;  4CQI A;  2ZM2 A;  4IHJ E;  3F2E A;  4L0R A;  3N5L A;  2DWG A;  3RYC E;  2WAU A;  5JR9 A;  4DVD A;  4AKH A;  2X9Y A;  3C4W A;  5FNV E;  3ZYK A;  4DBQ A;  3ZMV B;  4IE6 A;  2C5K T;  4PK4 A;  2A72 A;  5DAB A;  5L3G B;  3LK2 B;  2N9D A;  2WMO A;  4I4T E;  4ZS2 A;  2ACX A;  2X66 A;  1D0X A;  2LHR A;  2Q9Q D;  3VKG A;  1WRD A;  3AVS A;  3DP7 A;  2W00 A;  3ANW A;  1ZV4 X;  5ADX L;  4I50 E;  3N2O A;  4YJ2 E;  1ZEE A;  2K24 A;  2CXD A;  2VKH A;  2VB6 A;  3MA9 A;  4GYR A;  4IE7 A;  2X67 A;  1D1B A;  5JDM A;  2RP4 A;  2W63 A;  2X9H A;  2H3R A;  3NRY A;  2VAS A;  4ANJ A;  1UX5 A;  3HKE E;  5HXE A;  5CB4 E;  5FYM A;  5HWX A;  3ZMZ B;  3LG7 A;  2BVM A;  2ODU A;  5DQW A;  3V5S A;  4G63 A;  1S35 A;  3PUR A;  2E9X D;  2KIN B;  1O3X A;  2P9B A;  1YW0 A;  4PAG A;  3R84 B;  3LBX B;  2LSG A;  2V7L A;  4IST A;  2EHO C;  5JDF A;  2E9X C;  2IC6 A;  3H3A A;  2NWB A;  2QA7 A;  4EAH A;  1KK7 A;  2D0U A;  2JJ9 A;  5HWY A;  3RX6 A;  3N9M A;  1WLX A;  4IE5 A;  5LCY A;  2V26 A;  3ZN1 B;  2ZMA A;  3RYI E;  3GN5 B;  4WBN E;  1AJ3 A;  2XQY A;  3S4U A;  4AKR B;  1H7C A;  2KWI B;  4H9N C;  1G73 A;  4OYJ A;  3UUN A;  3RYH E;  2HPL A;  4HKA A;  5J1G A;  5EK2 A;  3RH3 A;  4ZI2 D;  1D1C A;  3QK6 A;  2WSS V;  2E9X A;  2YU2 A;  4MBQ A;  4OHF A;  3CQX C;  2Y8D A;  2C0S A;  1HX8 A;  2EHO A;  2LSJ A;  4QXB B;  4ZI2 C;  2Z6E A;  2DNX A;  2WMN A;  1UCU A;  4WBO A;  1D1A A;  4FI5 A;  4P0B A;  4EOZ B;  3ZYL A;  1LVF A;  1MNE A;  5LGU B;  4BJM A;  4PJM A;  2NOX A;  3EVY A;  1LRZ A;  4CXY A;  2DCF A;  3VU7 H;  4AKL A;  4JLE A;  3MKD A;  1FIO A;  4H9R C;  4I43 B;  2VKD A;  3RC8 A;  2KND A;  2KXP B;  5L3E B;  2XAG B;  2N1G A;  2DHR A;  4H9S E;  3PE0 A;  4IE0 A;  3FXE B;  5JQG E;  4O4L E;  3SRZ A;  3O1I A;  2WWU A;  4XZC A;  4XBF B;  3J9X 1;  4QKN A;  1MND A;  2X68 A;  3HKB E;  3PUA A;  3I0O A;  3ZPO A;  4X20 E;  2N2N A;  4IGU A;  1US7 B;  3ZMS B;  2W62 A;  2KWH A;  2NTY A;  3MAC A;  1Y64 B;  3N9L A;  3PU3 A;  4QXC B;  4TZ4 C;  4E7Z A;  3BQL A;  2Y6X A;  3KIN B;  3RKO A;  1MIY A;  4BA9 A;  2K9A A;  1UX4 A;  3O4X E;  1YD8 G;  3RYF E;  3MZK B;  5A1L A;  1LKX A;  4XAX B;  3PDY A;  2A3D A;  3HKC E;  4H63 H;  5LA6 E;  5L3F B;  3E22 E;  4PJJ A;  4UVB B;  2ODV A;  1IJ6 A;  4ISS A;  3RPU A;  4KMC A;  2NW9 A;  4WNK A;  5FXZ A;  3GWH A;  5FXX A;  3UUM A;  2BDE A;  2X0L B;  2V7J A;  3KV9 A;  3ANW B;  1G8X A;  3PUG A;  5IYZ E;  3EDU A;  3CX7 B;  2RA1 A;  4HE8 A;  3IEE A;  3BK9 A;  4ZI3 C;  2L9Q A;  2D0T A;  4UF0 A;  5FY1 A;  5JDL A;  4TN7 B;  3P8C D;  2G0U A;  4H63 V;  3CX6 B;  3VHL A;  2MYS A;  4PK6 A;  3AB3 B;  5L3B B;  3PUS A;  2L3L A;  1HTJ F;  2KMF A;  3N9Q A;  3I1A A;  2Y48 B;  2K5B B;  2CLY B;  4G2A A;  1ZHC A;  2XUE A;  3KFW X;  2Q9Q C;  1QUU A;  3LK3 B;  4YFS A;  3OKQ A;  5HXR A;  3O9X A;  1BR1 A;  1X79 A;  4GYS A;  2ES0 A;  3GMI A;  3C98 B;  4ZHQ E;  2VWA A;  4X1K E;  3H37 A;  3HR0 A;  4GOU A;  3AAI A;  2J1D G;  3HKD E;  5LBM A;  5JDQ A;  2CXL A;  2LJL A;  2OA5 A;  4PFO A;  4UIG A;  4AKI A;  1HG5 A;  4YJ3 E;  5JVD E;  2LSI A;  3KVB A;  4F6R C;  1OXZ A;  2HH7 A;  4PJL A;  4IDZ A;  2IW5 B;  3B13 A;  1E1H B;  2LSK A;  1MMA A;  3JC6 C;  3ZJ1 A;  5L3D B;  2Q9Q A;  4HGA A;  1HF8 A;  1BR2 A;  5CA0 E;  3D0T A;  3ETV A;  2E9X B;  4JUY A;  1YKH B;  3I9W A;  2PBI A;  2WM9 A;  3FBZ A;  2UXX B;  5JDG A;  4X1I E;  2VKJ A;  3CML A;  3ZMU B;  2L8K A;  3RRC A;  3IF8 B;  2V1D B;  3L3P A;  4OYK A;  1FMW A;  4KUM B;  4EXT A;  2VL8 A;  5JR9 C;  2IAK A;  4GK0 E;  2VK9 A;  2D5U A;  4H9P C;  5LGT B;  5JDN A;  1U5P A;  3CQG B;  4I55 E;  1LVK A;  5FY7 A;  5H6R B;  4IE4 A;  4ZI7 E;  4C91 A;  3KVA A;  4EZH A;  3VKH A;  2Q9Q B;  3W15 B;  3NZP A;  3BQK A;  5GON E;  1HCI A;  5FXV A;  4AQF A;  2EHO D;  4AKG A;  3ZCJ A;  3HL6 A;  3C50 A;  2BVL A;  3HI2 A;  5IHY A;  4JEU B;  3NBX X;  4EYY R;  5EK3 A;  5DQV A;  3FBL A;  4CXW A;  4O8S A;  4Z8X A;  3MK7 C;  2PG8 A;  1YKE B;  4TUY E;  4A56 A;  4BJN A;  4HEA A;  1CUN A;  3C64 A;  3KV6 A;  3ZLI A;  5L2L A;  2SPC A;  3B57 A;  5LOV E;  4OK0 A;  4DBR A;  4QX7 B;  3RC3 A;  2QGS A;  4X1Y E;  1EZ3 A;  4JEH B;  3Q9D A;  4EZ4 A;  3ZN0 B;  4ILU A;  2KLQ A;  2XAQ B;  3LJC A;  4PW8 A;  5KDM C;  2HPJ A;  2NW8 A;  3F31 A;  3WI3 A;  4MHC A;  3GA8 A;  1VRB A;  4HFV A;  3QUJ A;  5BMV E;  4DMW A;  4AI6 A;  2E8I A;  4PFP A;  3AVR A;  3EDV A;  3LFM A;  2B1E A;  3CX8 B;  3MXZ A;  3GN5 A;  3KV4 A;  5JRC A;  4ADZ A;  4GK5 E;  4GIW A;  2H7O A;  2CE7 A;  5FP3 A;  3AA6 B;  2YIN A;  4MFR A;  3OJA A;  2CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...