2K48A

Nmr structure of the n-terminal coiled coil domain of the andes hantavirus nucleocapsid protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTMSTLQELQENITAHEQQLVTARQKLKDAEKAVEVDPDDVNKSTLQNRRAAVSTLETKLGELKRQLADLVAAQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the N-terminal Coiled Coil Domain of the Andes Hantavirus Nucleocapsid Protein.
pubmed doi rcsb
molecule keywords Nucleoprotein
molecule tags Viral protein
source organism Andes virus
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2k48A01
3QK6A 3TKLB 4DNDA 1LVFA 2G0UA 2C5IT 3L3PA 2C5KT 3S4UA 2K48A 4FI5A 4B6XA 3FXDB 4J2CA 3MXZA 4L0RA 2C5JA 1LRZA 2X9YA 3CVRA 1QSDA 3QUJA 2CA5A 1H7CA 2X9XA 2KWIB 3P7IA 1IJ6A 2XTLA 3N5LA 4CQIA 1IJ5A 2MBGA 1Z0PA 3CKDA 2KWHA 3FXEB 4EYYR 1ZKEA 2IC9A 2X9WA 2IC6A
chains in the Genus database with same CATH superfamily
3TLUA 3ZSTA 4EGWA 2UUAT 1VOMA 4CN4A 1XDPA 2XQ3A 2J62A 5ETWA 2KNDA 1HX8A 2XQAA 2CHOA 1LRZA 2LJLA 4KP3C 5AQHB 3BQIA 1BR0A 5LJMA 1J1JA 2KWIB 3N5LA 5HXRA 3MACA 5LA6E 5HEUA 1YD8G 1X79A 4GK5E 1MMDA 3PUZF 1SHZC 4QKNA 2CXFA 2B1EA 3AE2A 5L2LA 5J2UE 4AI6A 4P0BA 5JDQA 5GONE 3PJAJ 5HXCA 2FBWA 3PDYA 3JAEA 2E8IA 2DI4A 4X64T 1HNWT 1KNZA 1MIYA 3GMIA 2XQ9A 4LF5T 3RKOA 3K8PC 3P7IA 4CQIA 4YTPA 5JRCB 4TWHA 1XMQT 4EEBA 4DIDB 2WM9A 2DNXA 3AECA 3JAFA 5AQFB 1FMVA 2BVLA 1Z0PA 2BS4A 2CBJA 5LG4A 4JEHB 3P8CD 1KNPA 4IE0A 3RQUA 4X5TA 4CXYA 1E1HB 4LF8T 4CI1B 4PNIA 2BBHA 1SUMB 2M6IA 3CX7B 3K1SA 2X67A 3EVYA 2JQKA 3ABVA 2BG9C 3UU6A 3LDQB 4FI5A 4Q25A 5LHIB 2WBLA 3RGLA 4AISA 4EV6A 4OYKA 3RLFF 4I0UA 2EHOB 3M65A 4HWDA 3AE1A 1GQEA 5LJNA 2A2FX 4P09A 4H63V 3ZJ1A 4YT0A 5AQPB 2D0UA 5LNKA 3Q5WA 3Q5DA 4HWHA 3K3NA 3V5UA 3RYFE 1R8IA 5FVKA 1T7SA 3K3OA 4EYYR 2XQ4A 5ABFA 2WAUA 1D0YA 3R6NA 4IE5A 2BKNA 4BJNA 2XJ7A 5TAOA 2Y48B 2XQ5A 4PK6A 1FMWA 3EAMA 2E5VA 2WS3A 5F8PA 4I4TE 4F8HA 3RF1A 4F6RC 3FBLA 2IIUA 2LRLA 3OTOT 5JDGA 4Z90A 1KFYA 4HFIA 4CZZB 1NEKA 2IC6A 2V7IA 3N9QA 4JI1T 2N1GA 4UR9A 4LF9T 4PK4A 3GN5B 4JI2T 1MMNA 3CK6A 4M1PA 3P4WA 5E0OA 5JDMA 3ONJA 3RYIE 2V6XA 4O8SA 1OXZA 3D0TA 5JR9B 2XQYA 2LM9A 5HCMA 4DV5T 3Q5XA 5EZYE 4L9IA 1LVFA 5FL0A 1HCIA 4H9QC 2OLTA 2K9AA 3NVOA 3RIFA 3KVAA 1UUSA 5F5WA 1W9RA 2RPAA 2LEHA 1W09A 3AE3A 4MLKA 3CIRA 4H9NC 1XNQT 1T8BA 5L3BB 4QHOA 2C5KT 5AQTB 5HCJA 4HKAA 5KDMC 3EABA 4NPPA 4ILUA 5CB4E 5HXSA 5H6QB 4H9RC 3A5XA 1MIVA 5AQGB 4DV1T 2JQHA 5LHHB 4KMCA 3VKGA 3R84B 2JIWA 2DWKA 1YXRA 4AKIA 2SPCA 1OEDB 3WAJA 1BR4A 2X9YA 3HI2A 4G2AA 4HGAA 4PFOA 3UUNA 3NWIA 1KNRA 1ZKEA 5EK2A 4TWFA 3OYXA 3SOLA 2W67A 3QK6A 1XNRT 2MPKA 2VKJA 4AQFC 3I9YA 3AEEA 4X1IE 5FXVA 1MNEA 2CPTA 2L9QA 4WW0A 5CFBA 2UU9T 3AXJB 3PUQA 5JR9C 3DJBA 3V5SA 4OFZA 1HNZT 3KV9A 3FZLB 5HEOA 4TZ4C 2E9XA 2Q9QD 2V8SV 4IDZA 3O1IA 4P1NA 4DR6T 3LG7A 4TWDA 1UURA 2K3WA 2JQ9A 1WYBA 4AIUA 4KHPT 4ZI2C 3ZC1A 2D2SA 2V5CA 2XAQB 2VWAA 1IBLT 4PJJA 1JNZA 4DV2T 5CA1E 3LFMA 5AQQB 3L8RA 2D9DA 4ZZBA 2YKSA 2W00A 3M3ZB 4PW8A 5EK3A 4GKJT 2JMHA 2VVSA 4PFPA 3H37A 5IWAT 4UVBB 3MXZA 1IBMT 1S35A 4LF6T 3LBXB 3FB2A 2LHNA 4ZI3D 3B13A 5FXXA 3KBUA 1D1AA 3TKLB 2DWGA 3FZFB 2JMKA 4KI0F 4HE8A 2NTYA 2XAFB 1HG2A 4N78D 1HNXT 1U4QA 3ZMVB 4KX6A 3KBTA 3P50A 3ZMTB 2I0MA 2VL0A 3KDSE 3RIUC 4CI3B 4DV3T 3L3PA 3U78A 2KMFA 3KINB 5FY0A 4LMLA 2DLRA 3BK9A 4X1KE 2ES0A 2H7OA 3AA7B 4JLEA 4B3ST 5A1LA 3PTRB 4AXPA 1HR0T 2CXLA 3ANWB 1X9BA 3ZMZB 3ZCIA 2K24A 4JBWF 3UTKA 5DQWA 2WB5A 3NZPA 2X0LB 1QSDA 4Z91A 3Q2MA 5HEJA 1U5PA 3EDVA 4I43B 3FXDB 4U3CA 3ETUA 4L5GA 4DR2T 3E08A 4WNKA 3AE7A 4HFEA 1IBKT 5LP6E 4UXNB 3PU8A 3CVRA 1MNDA 2N9DA 3E22E 3AVRA 3N9PA 3ZC0A 2RA1A 2BKOA 1MMGA 1QLBA 3OYZA 2MTQA 1S94A 4IT4A 3RPUA 4YTNA 2W66A 2H7VC 2YU1A 4Z8XA 4A98A 5HXEA 5LG3A 4ISTA 2QVAA 3RI5A 3LSVA 1Y64B 4UVCB 5FKYA 4EB6E 3VR8A 5FMNA 2V6YB 2H3RA 3S4UA 1Y01A 3MA9A 2MOZA 3ZN0B 2BG9A 4HFDA 4O2AE 4WYVA 3DTOA 3CWZB 2Q9QA 2XAHB 4QXBB 2FUPA 4ISSA 4IHJE 4BJMA 4IGUA 4AQYT 2FJDA 2CA5A 2L3LA 1L0VA 2GK9A 3AEAA 4DUYT 1YQ3A 4JI8T 2CEAA 1JNRA 5LYJE 3CX6B 4JI5T 4TX5A 5FVLA 3NKZA 1M62A 4QH4A 3AE9A 2I6HA 5JQGE 2HHHT 5HYAA 5LGTB 2VVNA 3JC6D 3SFDA 3MJXA 2D5UA 2XQ6A 1NENA 2XASB 4EOZB 3HR0A 3PJAA 4I55E 5JDHA 4YSZA 2DL1A 5AQNB 3RX6A 4QH1A 2JPFA 2XQ8A 4FJOA 3PUAA 2LLYA 3UU3A 5JREA 2VKDA 2FJBA 3I1AA 3PE0A 3ZPOA 3PUYF 4J2CA 2LOPA 1IAPA 2LRKA 2E9XD 4YJ2E 2X9HA 1G8XA 2M67A 3B5MA 4DR7T 2YINA 2NW9A 5LBQB 4H63H 4CI2B 1ZP0A 1UCUA 1YQ4A 3VRBA 3O4XE 1MIWA 3ZYLA 4ZEYA 2OV9A 4KUMB 3IF8B 2CWYA 4HFHA 4U33A 5ABHA 5C3JA 3PUWF 1SA0E 2X51A 3ESLA 4TV9E 1YW0A 5ABFB 4HFBA 2YDRA 2W61A 2BBJA 5JTGA 1ZEEA 3F57A 4U72A 4OHFA 1V9DA 4AKGA 3QC9A 2CWOA 2X9WA 3X1DA 4YLHA 1D0XA 4IL4A 2JQQA 3L39A 4AKLA 3AE8A 5AQVB 3ZJ2A 3N9MA 4LFBT 2YOEA 3TLVA 3UFGA 5J1GA 2VK9A 1D1CA 1HS7A 3PUSA 2B76A 4O2BE 2ZLYA 4TN7B 3FHNA 3AE5A 3J7Yq 2PFVA 2WZIA 2WDVA 2P9BA 4DUZT 4U7IA 3PV0F 3A8YC 2ZM6T 2HPJA 1DU2A 4MFRA 5FXWA 5CJ5A 1WLXA 4HN9A 5FXZA 5FYMA 2YN6A 4ILCA 5EK4A 4AQFA 3GN5A 3CQXC 3N9LA 2EHOC 3GA8A 1XMOT 2C5IT 4NUVA 2LSKA 2HH7A 2IMLA 4IDNA 1ZHCA 2PTFA 4DR1T 5HWYA 3CX8B 4QH5A 5JR9A 4PAGA 3HKDE 4JI3T 5LMNT 4MALA 4DR3T 4XAXB 4BAYB 1ZV4X 4U31A 3RH3A 3ETVA 3MZKB 3C4XA 2QYWA 3EHZA 4O4LE 4KHZF 5FY1A 4XZCA 5JDLA 3AA0B 3QOFA 2YU2A 4YFSA 4NUUA 4YXDA 4H9PC 2VQET 4DO0A 2V7MA 3ZCJA 5AQMB 1AJ3A 4EAHA 3QB5A 3PURA 2HPLA 2H89A 4UEMA 4MHCA 5F3JA 3J9X1 3C51A 4P0AA 4U7YA 4YJ3E 4YSXA 1HX1B 2ZM8A 3PU3A 1BR1A 1LVKA 4LFAT 3H3AA 2JRKA 5AQLB 5CA0E 2XHEB 2XSAA 3ONLC 4UF0A 4DV7T 3LK2B 3B57A 2XY8B 3IEEA 1UK5A 2IHR1 4A5XA 1I94T 2VASA 2NP9A 4CXWA 4WBNE 3I0QA 2ACZA 5KX5E 3ZT6A 2UXDT 2WMNA 4ADZA 2IW5B 2E9XB 3RIUA 2W63A 4OK0A 1E7PA 1US7B 3OJAA 2IDOB 4CN6A 3CKDA 5IUXA 3UULA 4ERRA 1OWAA 2V5DA 3SWHA 4EEDA 1KK7A 4IDQA 4GK0E 3CPZA 4CN1A 2WU5A 2VKHA 4EXTA 3U3IA 3UUXB 3ONXA 3LJCA 4JI0T 4EIWA 3AAEB 3ZLIA 2NW7A 2RP4A 5JVDE 4BA9A 4TV8E 1D0ZA 3A7MA 1T72A 1NWMX 3F2EA 4X20E 2MAWA 2YDQA 2CLYB 2HN2A 2ZMAA 2F4VT 1OEDC 2ZM0A 2PBIA 4IDPA 4EYUA 5DABA 2W62A 3W15B 3CQCB 2N2NA 5L3CB 2LSJA 1HG5A 3UQ4A 4U2ZA 3AE6A 5LGNB 3IBPA 1D1BA 3IHRA 3LBXA 1E2AA 3AB3B 2KT9A 5BMVE 2KXPB 1J5ET 2UXNB 3RYCE 2KLQA 3RYHE 3C50A 4AKRB 1IJ5A 1QUUA 3CMLA 2PG8A 4DBRA 2ODVA 2CCQA 3TLWA 2A72A 2K5BB 4TNVA 5LOVE 2HN1A 2QA7A 1WCRA 2IAKA 3I0OA 3C98B 2LM2A 4HWFA 5HEGA 1G73A 3PUVF 5AQSB 4YSYA 4ZS2A 4DV4T 2EHOD 3NRXA 4DR5T 1N34T 5LXTE 2A3DA 1IZNB 3FBZA 4JV5T 3RC8A 2WDRA 3HKBE 3ZYKA 4QXCB 3PUGA 5L4HA 4IE6A 4LFCT 1W0AA 2DCFA 4QXHB 3UU5A 4NXMT 4NIQA 4ILBA 5AQJB 2CBIA 3ZEFB 1WFDA 3KV5A 4LF4T 1FEWA 2X0HA 5AQIB 4ILAA 2BKPA 4ZS3A 3H3MA 1HTJF 3N9NA 5JDNA 5FL1A 4HTEA 3QNUA 1J5WA 5KXJA 2BG9E 4YY3T 4DMVA 5LHGB 2WCAA 5AQRB 2VL8A 3AVSA 2J47A 3RKGA 1HFAA 5L4EA 5DJQC 4EZHA 3PUXF 3AAAB 3E0ZA 3FZMB 1MMAA 4DVDA 4ZI7E 4IREA 3IA3A 4LMJA 5JH7E 3UUBA 2IC9A 3KV6A 2NW8A 1YKEB 2YK0A 4JEUB 3RRCA 2BG9B 5FY7A 1Z8UA 1FIOA 2Q9QB 3UU4A 3KV4A 2BS3A 2V6YA 3TLTA 3Q5EA 2WDQA 2ODUA 4B3RT 1BR2A 2XM1A 2YEVC 5JDFA 2WWUA 3KVBA 3CQGB 4ZI2D 2WSSV 2UXBT 2WQYA 3C4ZA 4JYAT 3HA4A 1N32T 2XM2A 1N33T 4IE7A 4O4HE 3AEGA 1XDOA 4WZXA 3BQKA 4O4JE 2QRXA 4PJMA 4JI6T 5JRCA 1WRDA 3FXEB 5M4YA 3UFEA 3RHWA 3N9OA 4YHJA 5L3GB 3EDUA 4TUYE 4GOUA 3F31A 3WAKA 2NOXA 3OKQA 3P4PA 2XTLA 3LK3B 1VRBA 4K0UA 1CUNA 2W4XA 4I50E 3G06A 3N2GE 3ZYMA 5H6RB 3JADA 2LOSA 2ZM2A 4V1Av 3AA6B 1I6ZA 4HFVA 4OYJA 1CHUA 2LKHA 1FJGT 3ZN1B 3DP7A 5J2TE 2Q9QC 1XWMA 2LE8A 5KMGP 1WR0A 2EHOA 1KF6A 3BQLA 3UQ7A 2XAGB 2LSIA 4UVAB 4UELA 5LCYA 5J0ZA 2YDSA 1NAFA 4AQGA 3OPCA 2V7LA 4A97A 2BZBA 3FZKB 2X66A 2AE9A 4MBQA 3RQWA 2R6GF 5HXHA 1UGOA 2LSGA 2MYSA 2J1DG 4B3MT 2X68A 3N2OA 3O1JA 3HKEE 2G0UA 5C2TA 3VKHA 2C5JA 4U2YA 5HEHA 2CM0A 2WMOA 5L47A 2XSBA 2VURA 5L3FB 4ZI3C 3P4SA 2QGSA 2XPKA 2L8KA 3LK42 3TLSA 5AQUB 3ZKRA 2K48A 4PJNA 2NWBA 2W2UA 3QB5K 2PJQA 3MKDA 2UXCT 5FP3A 3RIAA 2CRBA 1T98A 1LKXA 4ZZCA 4HEAA 1M7KA 3NZQA 1HF8A 3RC3A 4NXNT 3AAIA 1XZYA 4HWIB 3FZHB 4EZ4A 4H9SE 3WI3A 4X62T 4ASKA 2VKOA 5ADXL 3VU7H 4YHHT 4GIWA 2H88A 4ZHQE 4ANJA 3C64A 1UX4A 4X65T 1WYCA 2LSYA 3SS1A 3EUHA 4QX8B 1OEDE 4HFCA 4LMKA 5HAXA 3AA1B 2MBGA 5L3EB 3JCFA 3UU8A 2I59A 3UT5E 4IDOA 4GKKT 5L3DB 4YTMA 1W0BA 4KBMB 4JI4T 2WU2A 1VCSA 2W0GA 1KEYA 2LKGA 5BR8T 4OX9T 2Z6EA 5LGUB 4JUYA 4GYSA 2J4GA 3SRZA 2BS2A 3KFWX 5ABEA 2X0YA 4UV9B 2JJ9A 2Y6XA 1SE7A 2NTXA 2WY2A 1OEDA 3O1HA 2ACXA 2DHRA 2BVMA 3N2KE 3VR9A 5AQOB 4UF0B 1WR6A 3GWHA 2VB6A 2WZHA 2FJAA 3NBXX 2X9XA 1ZOYA 5AFUL 3ZT7A 5CGMA 2M6BA 3I9WA 5IYZE 4AKHA 4ZXLA 2C0SA 4DV6T 4LF7T 1UX5A 1EZ3A 4XBFB 3AXJA 4WBOA 2E5LT 2CHNA 4UIGA 4QWNB 3K3QC 3NRYA 3OBVE 3AE4A 2Y8DA 4HWCA 3O9XA 3AEFA 2VQFT 4G63A 4ZOLE 4DNDA 3OVUA 3ZMUB 2AXDS 2V1DB 1IJ6A 2A9UA 4TNWA 4A56A 3SFEA 2XUEA 2UUCT 5HWXA 5LBMA 4UV8B 3RRWA 2KZ7B 2E2AA 2KSRA 4DR4T 5AQKB 1O3XA 4COFA 4C91A 4DBQA 3JC6C 5IHYA 5C8YE 2NR4A 4X66T 3ZMSB 2LT3A 2IUBA 3T8OA 4H9OC 4E7ZA 2BDEA 4X1YE 2CMRA 4IL9A 4U74A 2CXDA 4IE4A 2KWHA 4C90A 3T1YT 1B7TA 2XQ7A 4O4IE 2D0TA 4JI7T 3HL6A 1N36T 3ZSSA 1H7CA 5ABGA 3UUMA 2E9XC 4PK5A 4QX7B 2XAJB 3ZT5A 2V26A 3Q9DA 4PJLA 2CE7A 2LHRA 4L0RA 5DQVA 2WP9A 3MK7C 4DMWA 4DV0T 4IIJE 3ANWA 3L09A 4GYRA 2UXXB 2OA5A 5LMUT 3AEDA 2FJEA 3HKCE 4CXXA 4B6XA 2V7KA 2CLYC 3QUJA 2WWVA 2XZEA 3C4WA 3AEBA 3P4QA 5FNVE 2V7JA 3VHLA 2UUBT 1VCTA 3EI0A 4K0KT 4E7SA 5LB7B 3P4RA 2KINB 3VRAA 1YKHB 4B3TT 3T1HT
chains in the Genus database with same CATH topology
2W00A 4PW8A 3MZKB 5EK3A 1VOMA 2JMHA 5ETWA 4PFPA 2KNDA 3H37A 3ZN1B 3DP7A 1HX8A 3C4XA 5J2TE 2Q9QC 4UVBB 3MXZA 1LRZA 2LJLA 4KP3C 4O4LE 5FY1A 4XZCA 3BQIA 2LE8A 5JDLA 5KMGP 1S35A 3AA0B 1BR0A 2YU2A 5LJMA 4YFSA 2EHOA 2KWIB 3LBXB 4NUUA 3N5LA 5HXRA 3FB2A 3MACA 2LHNA 5LA6E 3BQLA 4H9PC 3B13A 4ZI3D 4DO0A 2V7MA 1YD8G 5FXXA 3ZCJA 1AJ3A 4EAHA 1X79A 3KBUA 1D1AA 4GK5E 2XAGB 1MMDA 3TKLB 1SHZC 3PURA 2HPLA 2LSIA 2DWGA 4QKNA 4UEMA 4UELA 4UVAB 5LCYA 4MHCA 5F3JA 2JMKA 1NAFA 2CXFA 3J9X1 4AQGA 3C51A 2B1EA 2V7LA 4P0AA 4HE8A 2NTYA 2BZBA 4YJ3E 2X66A 5J2UE 5L2LA 2XAFB 4AI6A 4P0BA 5JDQA 4MBQA 1HG2A 4N78D 1U4QA 5GONE 5HXHA 2LSGA 2ZM8A 5HXCA 2MYSA 3PU3A 3ZMVB 3KBTA 1BR1A 1LVKA 3PDYA 2J1DG 3ZMTB 3H3AA 2JRKA 3KDSE 2X68A 4CI3B 3N2OA 5CA0E 2XHEB 2E8IA 2DI4A 3O1JA 4UF0A 3HKEE 2G0UA 3LK2B 3L3PA 3U78A 1KNZA 2KMFA 3B57A 3KINB 1MIYA 3GMIA 5FY0A 3VKHA 2C5JA 3RKOA 2DLRA 3K8PC 3BK9A 2CM0A 3IEEA 2WMOA 4X1KE 3P7IA 4CQIA 2VASA 2NP9A 4CXWA 2ES0A 2H7OA 3AA7B 4JLEA 4WBNE 3I0QA 5L3FB 4ZI3C 5A1LA 5JRCB 3PTRB 4AXPA 2CXLA 3ANWB 2QGSA 2L8KA 3LK42 5KX5E 3ZMZB 2WM9A 3ZCIA 2K24A 2K48A 2NWBA 2DNXA 4PJNA 2PJQA 3UTKA 3MKDA 5DQWA 3NZPA 2WMNA 4ADZA 2X0LB 1QSDA 5FP3A 2IW5B 3Q2MA 2E9XB 2W63A 1U5PA 3EDVA 4OK0A 4I43B 1US7B 3OJAA 1T98A 1FMVA 2BVLA 1LKXA 3CKDA 1Z0PA 3FXDB 4HEAA 3UULA 3ETUA 4L5GA 4ERRA 3E08A 4WNKA 1OWAA 5LG4A 4JEHB 3NZQA 1HF8A 3P8CD 3RC3A 3AAIA 3SWHA 4IE0A 5LP6E 4CXYA 1KK7A 1E1HB 4GK0E 4UXNB 3PU8A 4EZ4A 3CPZA 3CVRA 4H9SE 2VKHA 3WI3A 4PNIA 3U3IA 4EXTA 3UUXB 4CI1B 3ONXA 4ASKA 2VKOA 1MNDA 2N9DA 3LJCA 3E22E 4EIWA 5ADXL 3VU7H 3AAEB 4GIWA 3ZLIA 3AVRA 3N9PA 3ZC0A 3CX7B 4ZHQE 2NW7A 2RA1A 1MMGA 4ANJA 2X67A 3C64A 3OYZA 2RP4A 1UX4A 5JVDE 4BA9A 2MTQA 4TV8E 1D0ZA 3EVYA 1WYCA 2LSYA 1S94A 3SS1A 1NWMX 3EUHA 3F2EA 4FI5A 4X20E 3RPUA 4QX8B 2CLYB 2ZMAA 2H7VC 5LHIB 2WBLA 2ZM0A 2PBIA 2YU1A 4Z8XA 5HAXA 4EYUA 5DABA 3AA1B 2W62A 5HXEA 2MBGA 4OYKA 3W15B 3CQCB 2N2NA 5L3EB 5L3CB 2EHOB 2LSJA 1HG5A 2I59A 3M65A 4ISTA 3UT5E 5LGNB 5L3DB 5LJNA 2A2FX 3IBPA 4KBMB 4P09A 1D1BA 4H63V 3ZJ1A 2W0GA 3IHRA 2D0UA 1Y64B 5LNKA 3LBXA 4UVCB 3AB3B 3Q5WA 2KT9A 3K3NA 3V5UA 5BMVE 2KXPB 2Z6EA 2UXNB 3RYCE 4EB6E 2KLQA 5LGUB 3RYHE 3C50A 4JUYA 4GYSA 3RYFE 4AKRB 5FMNA 1IJ5A 2H3RA 3SRZA 3K3OA 3S4UA 3KFWX 4EYYR 3MA9A 1QUUA 2MOZA 3ZN0B 4UV9B 3CMLA 2JJ9A 2PG8A 4O2AE 3DTOA 3CWZB 4DBRA 2ODVA 2Y6XA 2Q9QA 2WAUA 2CCQA 2NTXA 2XAHB 1D0YA 3R6NA 2A72A 3O1HA 4IE5A 2ACXA 2DHRA 4QXBB 2BVMA 3N2KE 2K5BB 4BJNA 4ISSA 5LOVE 2QA7A 4IHJE 2IAKA 3I0OA 4BJMA 3C98B 4IGUA 5TAOA 2Y48B 4UF0B 1WR6A 3GWHA 2VB6A 4PK6A 1G73A 1FMWA 2L3LA 2CA5A 3NBXX 2X9XA 4ZS2A 2GK9A 5AFUL 5F8PA 2CEAA 4I4TE 2EHOD 3NRXA 3I9WA 5LXTE 2A3DA 5LYJE 1IZNB 3CX6B 3FBZA 5IYZE 4AKHA 4F6RC 3FBLA 3RC8A 4TX5A 2C0SA 3HKBE 3ZYKA 4QXCB 3PUGA 4IE6A 1UX5A 5JDGA 1EZ3A 4XBFB 4WBOA 5JQGE 4UIGA 5HYAA 4QWNB 4CZZB 3K3QC 5LGTB 2IC6A 3NRYA 2V7IA 2DCFA 3JC6D 3N9QA 3OBVE 4QXHB 3MJXA 2N1GA 2Y8DA 3O9XA 2D5UA 4G63A 2XASB 4ZOLE 4DNDA 4PK4A 3GN5B 3ZMUB 4EOZB 1MMNA 3HR0A 4I55E 4M1PA 5JDHA 3ZEFB 3KV5A 2V1DB 1FEWA 5E0OA 5JDMA 3RYIE 3RX6A 4ZS3A 1IJ6A 4O8SA 1OXZA 3D0TA 2JPFA 4A56A 1HTJF 3N9NA 5JDNA 2XUEA 4HTEA 5JR9B 4FJOA 2XQYA 2LM9A 3PUAA 5JREA 3Q5XA 5EZYE 2VKDA 4L9IA 1LVFA 3I1AA 5HWXA 3PE0A 1HCIA 4H9QC 5LBMA 3ZPOA 4DMVA 4UV8B 2K9AA 3RRWA 2KZ7B 4J2CA 5LHGB 2VL8A 3KVAA 2LOPA 3AVSA 1O3XA 1IAPA 2LEHA 1HFAA 2E9XD 4C91A 4YJ2E 2X9HA 1G8XA 2M67A 4DBQA 2YINA 4MLKA 4H9NC 5DJQC 2NW9A 3JC6C 5IHYA 5LBQB 4EZHA 4H63H 5C8YE 4CI2B 5L3BB 3ZMSB 3AAAB 2LT3A 4QHOA 1UCUA 2C5KT 3O4XE 3T8OA 3E0ZA 4H9OC 1MMAA 4HKAA 4E7ZA 1MIWA 5KDMC 2BDEA 3ZYLA 4DVDA 4ZI7E 4ILUA 4X1YE 2CMRA 5CB4E 4KUMB 4U74A 3IF8B 5HXSA 5H6QB 5JH7E 2CXDA 2CWYA 3A5XA 4H9RC 4IE4A 2KWHA 1MIVA 4C90A 2IC9A 3KV6A 2NW8A 5LHHB 1YKEB 4KMCA 2YK0A 4JEUB 3VKGA 1B7TA 3R84B 3RRCA 1SA0E 2X51A 3ESLA 2DWKA 4TV9E 1YW0A 5FY7A 4AKIA 4O4IE 1FIOA 2Q9QB 2SPCA 2W61A 3KV4A 2D0TA 1BR4A 3WAJA 1ZEEA 2X9YA 3F57A 2ODUA 3HI2A 4G2AA 1BR2A 4U72A 3HL6A 2YEVC 5JDFA 4OHFA 1V9DA 1H7CA 2WWUA 4HGAA 4AKGA 3UUMA 2E9XC 4PFOA 3UUNA 3KVBA 4PK5A 3QC9A 3CQGB 4ZI2D 2CWOA 1ZKEA 2WSSV 2X9WA 5EK2A 3OYXA 4YLHA 3SOLA 4QX7B 3C4ZA 1D0XA 2XAJB 2JQQA 2V26A 4AKLA 3QK6A 3Q9DA 3HA4A 4PJLA 2VKJA 3ZJ2A 4AQFC 2CE7A 2LHRA 3N9MA 4IE7A 3I9YA 4O4HE 4L0RA 4X1IE 3BQKA 4O4JE 5DQVA 5FXVA 1MNEA 3MK7C 4PJMA 4DMWA 5JRCA 1WRDA 5J1GA 4IIJE 2L9QA 3ANWA 3L09A 4GYRA 2VK9A 1D1CA 4WW0A 1HS7A 3PUSA 3FXEB 2UXXB 5M4YA 3PUQA 5JR9C 3DJBA 2OA5A 3UFEA 4O2BE 3V5SA 3N9OA 4OFZA 2ZLYA 4TN7B 3KV9A 3FHNA 4YHJA 3J7Yq 2PFVA 3HKCE 3EDUA 4TZ4C 5L3GB 4CXXA 2E9XA 2Q9QD 4IDZA 4B6XA 3O1IA 4TUYE 2P9BA 4GOUA 3F31A 3LG7A 2V7KA 3WAKA 2CLYC 2NOXA 3QUJA 3OKQA 2HPJA 4MFRA 5FXWA 1WLXA 4HN9A 5FXZA 2XTLA 1WYBA 5FYMA 3LK3B 5EK4A 1VRBA 4ZI2C 3ZC1A 2D2SA 4K0UA 4AQFA 3GN5A 3CQXC 1CUNA 3N9LA 2EHOC 3C4WA 4I50E 3GA8A 5FNVE 2XAQB 2V7JA 3VHLA 2C5IT 4NUVA 3N2GE 2LSKA 2VWAA 2HH7A 3ZYMA 1ZHCA 5H6RB 2LOSA 4E7SA 2ZM2A 3CX8B 5HWYA 4PJJA 4V1Av 3AA6B 5JR9A 4PAGA 2KINB 3HKDE 4MALA 4XAXB 4BAYB 1ZV4X 5CA1E 3LFMA 1YKHB 3RH3A 4HFVA 4OYJA 3ETVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK6 A;  3TKL B;  4DND A;  1LVF A;  2G0U A;  2C5I T;  3L3P A;  2C5K T;  3S4U A;  2K48 A;  4FI5 A;  4B6X A;  3FXD B;  4J2C A;  3MXZ A;  4L0R A;  2C5J A;  1LRZ A;  2X9Y A;  3CVR A;  1QSD A;  3QUJ A;  2CA5 A;  1H7C A;  2X9X A;  2KWI B;  3P7I A;  1IJ6 A;  2XTL A;  3N5L A;  4CQI A;  1IJ5 A;  2MBG A;  1Z0P A;  3CKD A;  2KWH A;  3FXE B;  4EYY R;  1ZKE A;  2IC9 A;  2X9W A;  2IC6 A; 
#chains in the Genus database with same CATH topology
 3TLU A;  3ZST A;  4EGW A;  2UUA T;  1VOM A;  4CN4 A;  1XDP A;  2XQ3 A;  2J62 A;  5ETW A;  2KND A;  1HX8 A;  2XQA A;  2CHO A;  1LRZ A;  2LJL A;  4KP3 C;  5AQH B;  3BQI A;  1BR0 A;  5LJM A;  1J1J A;  2KWI B;  3N5L A;  5HXR A;  3MAC A;  5LA6 E;  5HEU A;  1YD8 G;  1X79 A;  4GK5 E;  1MMD A;  3PUZ F;  1SHZ C;  4QKN A;  2CXF A;  2B1E A;  3AE2 A;  5L2L A;  5J2U E;  4AI6 A;  4P0B A;  5JDQ A;  5GON E;  3PJA J;  5HXC A;  2FBW A;  3PDY A;  3JAE A;  2E8I A;  2DI4 A;  4X64 T;  1HNW T;  1KNZ A;  1MIY A;  3GMI A;  2XQ9 A;  4LF5 T;  3RKO A;  3K8P C;  3P7I A;  4CQI A;  4YTP A;  5JRC B;  4TWH A;  1XMQ T;  4EEB A;  4DID B;  2WM9 A;  2DNX A;  3AEC A;  3JAF A;  5AQF B;  1FMV A;  2BVL A;  1Z0P A;  2BS4 A;  2CBJ A;  5LG4 A;  4JEH B;  3P8C D;  1KNP A;  4IE0 A;  3RQU A;  4X5T A;  4CXY A;  1E1H B;  4LF8 T;  4CI1 B;  4PNI A;  2BBH A;  1SUM B;  2M6I A;  3CX7 B;  3K1S A;  2X67 A;  3EVY A;  2JQK A;  3ABV A;  2BG9 C;  3UU6 A;  3LDQ B;  4FI5 A;  4Q25 A;  5LHI B;  2WBL A;  3RGL A;  4AIS A;  4EV6 A;  4OYK A;  3RLF F;  4I0U A;  2EHO B;  3M65 A;  4HWD A;  3AE1 A;  1GQE A;  5LJN A;  2A2F X;  4P09 A;  4H63 V;  3ZJ1 A;  4YT0 A;  5AQP B;  2D0U A;  5LNK A;  3Q5W A;  3Q5D A;  4HWH A;  3K3N A;  3V5U A;  3RYF E;  1R8I A;  5FVK A;  1T7S A;  3K3O A;  4EYY R;  2XQ4 A;  5ABF A;  2WAU A;  1D0Y A;  3R6N A;  4IE5 A;  2BKN A;  4BJN A;  2XJ7 A;  5TAO A;  2Y48 B;  2XQ5 A;  4PK6 A;  1FMW A;  3EAM A;  2E5V A;  2WS3 A;  5F8P A;  4I4T E;  4F8H A;  3RF1 A;  4F6R C;  3FBL A;  2IIU A;  2LRL A;  3OTO T;  5JDG A;  4Z90 A;  1KFY A;  4HFI A;  4CZZ B;  1NEK A;  2IC6 A;  2V7I A;  3N9Q A;  4JI1 T;  2N1G A;  4UR9 A;  4LF9 T;  4PK4 A;  3GN5 B;  4JI2 T;  1MMN A;  3CK6 A;  4M1P A;  3P4W A;  5E0O A;  5JDM A;  3ONJ A;  3RYI E;  2V6X A;  4O8S A;  1OXZ A;  3D0T A;  5JR9 B;  2XQY A;  2LM9 A;  5HCM A;  4DV5 T;  3Q5X A;  5EZY E;  4L9I A;  1LVF A;  5FL0 A;  1HCI A;  4H9Q C;  2OLT A;  2K9A A;  3NVO A;  3RIF A;  3KVA A;  1UUS A;  5F5W A;  1W9R A;  2RPA A;  2LEH A;  1W09 A;  3AE3 A;  4MLK A;  3CIR A;  4H9N C;  1XNQ T;  1T8B A;  5L3B B;  4QHO A;  2C5K T;  5AQT B;  5HCJ A;  4HKA A;  5KDM C;  3EAB A;  4NPP A;  4ILU A;  5CB4 E;  5HXS A;  5H6Q B;  4H9R C;  3A5X A;  1MIV A;  5AQG B;  4DV1 T;  2JQH A;  5LHH B;  4KMC A;  3VKG A;  3R84 B;  2JIW A;  2DWK A;  1YXR A;  4AKI A;  2SPC A;  1OED B;  3WAJ A;  1BR4 A;  2X9Y A;  3HI2 A;  4G2A A;  4HGA A;  4PFO A;  3UUN A;  3NWI A;  1KNR A;  1ZKE A;  5EK2 A;  4TWF A;  3OYX A;  3SOL A;  2W67 A;  3QK6 A;  1XNR T;  2MPK A;  2VKJ A;  4AQF C;  3I9Y A;  3AEE A;  4X1I E;  5FXV A;  1MNE A;  2CPT A;  2L9Q A;  4WW0 A;  5CFB A;  2UU9 T;  3AXJ B;  3PUQ A;  5JR9 C;  3DJB A;  3V5S A;  4OFZ A;  1HNZ T;  3KV9 A;  3FZL B;  5HEO A;  4TZ4 C;  2E9X A;  2Q9Q D;  2V8S V;  4IDZ A;  3O1I A;  4P1N A;  4DR6 T;  3LG7 A;  4TWD A;  1UUR A;  2K3W A;  2JQ9 A;  1WYB A;  4AIU A;  4KHP T;  4ZI2 C;  3ZC1 A;  2D2S A;  2V5C A;  2XAQ B;  2VWA A;  1IBL T;  4PJJ A;  1JNZ A;  4DV2 T;  5CA1 E;  3LFM A;  5AQQ B;  3L8R A;  2D9D A;  4ZZB A;  2YKS A;  2W00 A;  3M3Z B;  4PW8 A;  5EK3 A;  4GKJ T;  2JMH A;  2VVS A;  4PFP A;  3H37 A;  5IWA T;  4UVB B;  3MXZ A;  1IBM T;  1S35 A;  4LF6 T;  3LBX B;  3FB2 A;  2LHN A;  4ZI3 D;  3B13 A;  5FXX A;  3KBU A;  1D1A A;  3TKL B;  2DWG A;  3FZF B;  2JMK A;  4KI0 F;  4HE8 A;  2NTY A;  2XAF B;  1HG2 A;  4N78 D;  1HNX T;  1U4Q A;  3ZMV B;  4KX6 A;  3KBT A;  3P50 A;  3ZMT B;  2I0M A;  2VL0 A;  3KDS E;  3RIU C;  4CI3 B;  4DV3 T;  3L3P A;  3U78 A;  2KMF A;  3KIN B;  5FY0 A;  4LML A;  2DLR A;  3BK9 A;  4X1K E;  2ES0 A;  2H7O A;  3AA7 B;  4JLE A;  4B3S T;  5A1L A;  3PTR B;  4AXP A;  1HR0 T;  2CXL A;  3ANW B;  1X9B A;  3ZMZ B;  3ZCI A;  2K24 A;  4JBW F;  3UTK A;  5DQW A;  2WB5 A;  3NZP A;  2X0L B;  1QSD A;  4Z91 A;  3Q2M A;  5HEJ A;  1U5P A;  3EDV A;  4I43 B;  3FXD B;  4U3C A;  3ETU A;  4L5G A;  4DR2 T;  3E08 A;  4WNK A;  3AE7 A;  4HFE A;  1IBK T;  5LP6 E;  4UXN B;  3PU8 A;  3CVR A;  1MND A;  2N9D A;  3E22 E;  3AVR A;  3N9P A;  3ZC0 A;  2RA1 A;  2BKO A;  1MMG A;  1QLB A;  3OYZ A;  2MTQ A;  1S94 A;  4IT4 A;  3RPU A;  4YTN A;  2W66 A;  2H7V C;  2YU1 A;  4Z8X A;  4A98 A;  5HXE A;  5LG3 A;  4IST A;  2QVA A;  3RI5 A;  3LSV A;  1Y64 B;  4UVC B;  5FKY A;  4EB6 E;  3VR8 A;  5FMN A;  2V6Y B;  2H3R A;  3S4U A;  1Y01 A;  3MA9 A;  2MOZ A;  3ZN0 B;  2BG9 A;  4HFD A;  4O2A E;  4WYV A;  3DTO A;  3CWZ B;  2Q9Q A;  2XAH B;  4QXB B;  2FUP A;  4ISS A;  4IHJ E;  4BJM A;  4IGU A;  4AQY T;  2FJD A;  2CA5 A;  2L3L A;  1L0V A;  2GK9 A;  3AEA A;  4DUY T;  1YQ3 A;  4JI8 T;  2CEA A;  1JNR A;  5LYJ E;  3CX6 B;  4JI5 T;  4TX5 A;  5FVL A;  3NKZ A;  1M62 A;  4QH4 A;  3AE9 A;  2I6H A;  5JQG E;  2HHH T;  5HYA A;  5LGT B;  2VVN A;  3JC6 D;  3SFD A;  3MJX A;  2D5U A;  2XQ6 A;  1NEN A;  2XAS B;  4EOZ B;  3HR0 A;  3PJA A;  4I55 E;  5JDH A;  4YSZ A;  2DL1 A;  5AQN B;  3RX6 A;  4QH1 A;  2JPF A;  2XQ8 A;  4FJO A;  3PUA A;  2LLY A;  3UU3 A;  5JRE A;  2VKD A;  2FJB A;  3I1A A;  3PE0 A;  3ZPO A;  3PUY F;  4J2C A;  2LOP A;  1IAP A;  2LRK A;  2E9X D;  4YJ2 E;  2X9H A;  1G8X A;  2M67 A;  3B5M A;  4DR7 T;  2YIN A;  2NW9 A;  5LBQ B;  4H63 H;  4CI2 B;  1ZP0 A;  1UCU A;  1YQ4 A;  3VRB A;  3O4X E;  1MIW A;  3ZYL A;  4ZEY A;  2OV9 A;  4KUM B;  3IF8 B;  2CWY A;  4HFH A;  4U33 A;  5ABH A;  5C3J A;  3PUW F;  1SA0 E;  2X51 A;  3ESL A;  4TV9 E;  1YW0 A;  5ABF B;  4HFB A;  2YDR A;  2W61 A;  2BBJ A;  5JTG A;  1ZEE A;  3F57 A;  4U72 A;  4OHF A;  1V9D A;  4AKG A;  3QC9 A;  2CWO A;  2X9W A;  3X1D A;  4YLH A;  1D0X A;  4IL4 A;  2JQQ A;  3L39 A;  4AKL A;  3AE8 A;  5AQV B;  3ZJ2 A;  3N9M A;  4LFB T;  2YOE A;  3TLV A;  3UFG A;  5J1G A;  2VK9 A;  1D1C A;  1HS7 A;  3PUS A;  2B76 A;  4O2B E;  2ZLY A;  4TN7 B;  3FHN A;  3AE5 A;  3J7Y q;  2PFV A;  2WZI A;  2WDV A;  2P9B A;  4DUZ T;  4U7I A;  3PV0 F;  3A8Y C;  2ZM6 T;  2HPJ A;  1DU2 A;  4MFR A;  5FXW A;  5CJ5 A;  1WLX A;  4HN9 A;  5FXZ A;  5FYM A;  2YN6 A;  4ILC A;  5EK4 A;  4AQF A;  3GN5 A;  3CQX C;  3N9L A;  2EHO C;  3GA8 A;  1XMO T;  2C5I T;  4NUV A;  2LSK A;  2HH7 A;  2IML A;  4IDN A;  1ZHC A;  2PTF A;  4DR1 T;  5HWY A;  3CX8 B;  4QH5 A;  5JR9 A;  4PAG A;  3HKD E;  4JI3 T;  5LMN T;  4MAL A;  4DR3 T;  4XAX B;  4BAY B;  1ZV4 X;  4U31 A;  3RH3 A;  3ETV A;  3MZK B;  3C4X A;  2QYW A;  3EHZ A;  4O4L E;  4KHZ F;  5FY1 A;  4XZC A;  5JDL A;  3AA0 B;  3QOF A;  2YU2 A;  4YFS A;  4NUU A;  4YXD A;  4H9P C;  2VQE T;  4DO0 A;  2V7M A;  3ZCJ A;  5AQM B;  1AJ3 A;  4EAH A;  3QB5 A;  3PUR A;  2HPL A;  2H89 A;  4UEM A;  4MHC A;  5F3J A;  3J9X 1;  3C51 A;  4P0A A;  4U7Y A;  4YJ3 E;  4YSX A;  1HX1 B;  2ZM8 A;  3PU3 A;  1BR1 A;  1LVK A;  4LFA T;  3H3A A;  2JRK A;  5AQL B;  5CA0 E;  2XHE B;  2XSA A;  3ONL C;  4UF0 A;  4DV7 T;  3LK2 B;  3B57 A;  2XY8 B;  3IEE A;  1UK5 A;  2IHR 1;  4A5X A;  1I94 T;  2VAS A;  2NP9 A;  4CXW A;  4WBN E;  3I0Q A;  2ACZ A;  5KX5 E;  3ZT6 A;  2UXD T;  2WMN A;  4ADZ A;  2IW5 B;  2E9X B;  3RIU A;  2W63 A;  4OK0 A;  1E7P A;  1US7 B;  3OJA A;  2IDO B;  4CN6 A;  3CKD A;  5IUX A;  3UUL A;  4ERR A;  1OWA A;  2V5D A;  3SWH A;  4EED A;  1KK7 A;  4IDQ A;  4GK0 E;  3CPZ A;  4CN1 A;  2WU5 A;  2VKH A;  4EXT A;  3U3I A;  3UUX B;  3ONX A;  3LJC A;  4JI0 T;  4EIW A;  3AAE B;  3ZLI A;  2NW7 A;  2RP4 A;  5JVD E;  4BA9 A;  4TV8 E;  1D0Z A;  3A7M A;  1T72 A;  1NWM X;  3F2E A;  4X20 E;  2MAW A;  2YDQ A;  2CLY B;  2HN2 A;  2ZMA A;  2F4V T;  1OED C;  2ZM0 A;  2PBI A;  4IDP A;  4EYU A;  5DAB A;  2W62 A;  3W15 B;  3CQC B;  2N2N A;  5L3C B;  2LSJ A;  1HG5 A;  3UQ4 A;  4U2Z A;  3AE6 A;  5LGN B;  3IBP A;  1D1B A;  3IHR A;  3LBX A;  1E2A A;  3AB3 B;  2KT9 A;  5BMV E;  2KXP B;  1J5E T;  2UXN B;  3RYC E;  2KLQ A;  3RYH E;  3C50 A;  4AKR B;  1IJ5 A;  1QUU A;  3CML A;  2PG8 A;  4DBR A;  2ODV A;  2CCQ A;  3TLW A;  2A72 A;  2K5B B;  4TNV A;  5LOV E;  2HN1 A;  2QA7 A;  1WCR A;  2IAK A;  3I0O A;  3C98 B;  2LM2 A;  4HWF A;  5HEG A;  1G73 A;  3PUV F;  5AQS B;  4YSY A;  4ZS2 A;  4DV4 T;  2EHO D;  3NRX A;  4DR5 T;  1N34 T;  5LXT E;  2A3D A;  1IZN B;  3FBZ A;  4JV5 T;  3RC8 A;  2WDR A;  3HKB E;  3ZYK A;  4QXC B;  3PUG A;  5L4H A;  4IE6 A;  4LFC T;  1W0A A;  2DCF A;  4QXH B;  3UU5 A;  4NXM T;  4NIQ A;  4ILB A;  5AQJ B;  2CBI A;  3ZEF B;  1WFD A;  3KV5 A;  4LF4 T;  1FEW A;  2X0H A;  5AQI B;  4ILA A;  2BKP A;  4ZS3 A;  3H3M A;  1HTJ F;  3N9N A;  5JDN A;  5FL1 A;  4HTE A;  3QNU A;  1J5W A;  5KXJ A;  2BG9 E;  4YY3 T;  4DMV A;  5LHG B;  2WCA A;  5AQR B;  2VL8 A;  3AVS A;  2J47 A;  3RKG A;  1HFA A;  5L4E A;  5DJQ C;  4EZH A;  3PUX F;  3AAA B;  3E0Z A;  3FZM B;  1MMA A;  4DVD A;  4ZI7 E;  4IRE A;  3IA3 A;  4LMJ A;  5JH7 E;  3UUB A;  2IC9 A;  3KV6 A;  2NW8 A;  1YKE B;  2YK0 A;  4JEU B;  3RRC A;  2BG9 B;  5FY7 A;  1Z8U A;  1FIO A;  2Q9Q B;  3UU4 A;  3KV4 A;  2BS3 A;  2V6Y A;  3TLT A;  3Q5E A;  2WDQ A;  2ODU A;  4B3R T;  1BR2 A;  2XM1 A;  2YEV C;  5JDF A;  2WWU A;  3KVB A;  3CQG B;  4ZI2 D;  2WSS V;  2UXB T;  2WQY A;  3C4Z A;  4JYA T;  3HA4 A;  1N32 T;  2XM2 A;  1N33 T;  4IE7 A;  4O4H E;  3AEG A;  1XDO A;  4WZX A;  3BQK A;  4O4J E;  2QRX A;  4PJM A;  4JI6 T;  5JRC A;  1WRD A;  3FXE B;  5M4Y A;  3UFE A;  3RHW A;  3N9O A;  4YHJ A;  5L3G B;  3EDU A;  4TUY E;  4GOU A;  3F31 A;  3WAK A;  2NOX A;  3OKQ A;  3P4P A;  2XTL A;  3LK3 B;  1VRB A;  4K0U A;  1CUN A;  2W4X A;  4I50 E;  3G06 A;  3N2G E;  3ZYM A;  5H6R B;  3JAD A;  2LOS A;  2ZM2 A;  4V1A v;  3AA6 B;  1I6Z A;  4HFV A;  4OYJ A;  1CHU A;  2LKH A;  1FJG T;  3ZN1 B;  3DP7 A;  5J2T E;  2Q9Q C;  1XWM A;  2LE8 A;  5KMG P;  1WR0 A;  2EHO A;  1KF6 A;  3BQL A;  3UQ7 A;  2XAG B;  2LSI A;  4UVA B;  4UEL A;  5LCY A;  5J0Z A;  2YDS A;  1NAF A;  4AQG A;  3OPC A;  2V7L A;  4A97 A;  2BZB A;  3FZK B;  2X66 A;  2AE9 A;  4MBQ A;  3RQW A;  2R6G F;  5HXH A;  1UGO A;  2LSG A;  2MYS A;  2J1D G;  4B3M T;  2X68 A;  3N2O A;  3O1J A;  3HKE E;  2G0U A;  5C2T A;  3VKH A;  2C5J A;  4U2Y A;  5HEH A;  2CM0 A;  2WMO A;  5L47 A;  2XSB A;  2VUR A;  5L3F B;  4ZI3 C;  3P4S A;  2QGS A;  2XPK A;  2L8K A;  3LK4 2;  3TLS A;  5AQU B;  3ZKR A;  2K48 A;  4PJN A;  2NWB A;  2W2U A;  3QB5 K;  2PJQ A;  3MKD A;  2UXC T;  5FP3 A;  3RIA A;  2CRB A;  1T98 A;  1LKX A;  4ZZC A;  4HEA A;  1M7K A;  3NZQ A;  1HF8 A;  3RC3 A;  4NXN T;  3AAI A;  1XZY A;  4HWI B;  3FZH B;  4EZ4 A;  4H9S E;  3WI3 A;  4X62 T;  4ASK A;  2VKO A;  5ADX L;  3VU7 H;  4YHH T;  4GIW A;  2H88 A;  4ZHQ E;  4ANJ A;  3C64 A;  1UX4 A;  4X65 T;  1WYC A;  2LSY A;  3SS1 A;  3EUH A;  4QX8 B;  1OED E;  4HFC A;  4LMK A;  5HAX A;  3AA1 B;  2MBG A;  5L3E B;  3JCF A;  3UU8 A;  2I59 A;  3UT5 E;  4IDO A;  4GKK T;  5L3D B;  4YTM A;  1W0B A;  4KBM B;  4JI4 T;  2WU2 A;  1VCS A;  2W0G A;  1KEY A;  2LKG A;  5BR8 T;  4OX9 T;  2Z6E A;  5LGU B;  4JUY A;  4GYS A;  2J4G A;  3SRZ A;  2BS2 A;  3KFW X;  5ABE A;  2X0Y A;  4UV9 B;  2JJ9 A;  2Y6X A;  1SE7 A;  2NTX A;  2WY2 A;  1OED A;  3O1H A;  2ACX A;  2DHR A;  2BVM A;  3N2K E;  3VR9 A;  5AQO B;  4UF0 B;  1WR6 A;  3GWH A;  2VB6 A;  2WZH A;  2FJA A;  3NBX X;  2X9X A;  1ZOY A;  5AFU L;  3ZT7 A;  5CGM A;  2M6B A;  3I9W A;  5IYZ E;  4AKH A;  4ZXL A;  2C0S A;  4DV6 T;  4LF7 T;  1UX5 A;  1EZ3 A;  4XBF B;  3AXJ A;  4WBO A;  2E5L T;  2CHN A;  4UIG A;  4QWN B;  3K3Q C;  3NRY A;  3OBV E;  3AE4 A;  2Y8D A;  4HWC A;  3O9X A;  3AEF A;  2VQF T;  4G63 A;  4ZOL E;  4DND A;  3OVU A;  3ZMU B;  2AXD S;  2V1D B;  1IJ6 A;  2A9U A;  4TNW A;  4A56 A;  3SFE A;  2XUE A;  2UUC T;  5HWX A;  5LBM A;  4UV8 B;  3RRW A;  2KZ7 B;  2E2A A;  2KSR A;  4DR4 T;  5AQK B;  1O3X A;  4COF A;  4C91 A;  4DBQ A;  3JC6 C;  5IHY A;  5C8Y E;  2NR4 A;  4X66 T;  3ZMS B;  2LT3 A;  2IUB A;  3T8O A;  4H9O C;  4E7Z A;  2BDE A;  4X1Y E;  2CMR A;  4IL9 A;  4U74 A;  2CXD A;  4IE4 A;  2KWH A;  4C90 A;  3T1Y T;  1B7T A;  2XQ7 A;  4O4I E;  2D0T A;  4JI7 T;  3HL6 A;  1N36 T;  3ZSS A;  1H7C A;  5ABG A;  3UUM A;  2E9X C;  4PK5 A;  4QX7 B;  2XAJ B;  3ZT5 A;  2V26 A;  3Q9D A;  4PJL A;  2CE7 A;  2LHR A;  4L0R A;  5DQV A;  2WP9 A;  3MK7 C;  4DMW A;  4DV0 T;  4IIJ E;  3ANW A;  3L09 A;  4GYR A;  2UXX B;  2OA5 A;  5LMU T;  3AED A;  2FJE A;  3HKC E;  4CXX A;  4B6X A;  2V7K A;  2CLY C;  3QUJ A;  2WWV A;  2XZE A;  3C4W A;  3AEB A;  3P4Q A;  5FNV E;  2V7J A;  3VHL A;  2UUB T;  1VCT A;  3EI0 A;  4K0K T;  4E7S A;  5LB7 B;  3P4R A;  2KIN B;  3VRA A;  1YKH B;  4B3T T;  3T1H T; 
#chains in the Genus database with same CATH homology
 2W00 A;  4PW8 A;  3MZK B;  5EK3 A;  1VOM A;  2JMH A;  5ETW A;  4PFP A;  2KND A;  3H37 A;  3ZN1 B;  3DP7 A;  1HX8 A;  3C4X A;  5J2T E;  2Q9Q C;  4UVB B;  3MXZ A;  1LRZ A;  2LJL A;  4KP3 C;  4O4L E;  5FY1 A;  4XZC A;  3BQI A;  2LE8 A;  5JDL A;  5KMG P;  1S35 A;  3AA0 B;  1BR0 A;  2YU2 A;  5LJM A;  4YFS A;  2EHO A;  2KWI B;  3LBX B;  4NUU A;  3N5L A;  5HXR A;  3FB2 A;  3MAC A;  2LHN A;  5LA6 E;  3BQL A;  4H9P C;  3B13 A;  4ZI3 D;  4DO0 A;  2V7M A;  1YD8 G;  5FXX A;  3ZCJ A;  1AJ3 A;  4EAH A;  1X79 A;  3KBU A;  1D1A A;  4GK5 E;  2XAG B;  1MMD A;  3TKL B;  1SHZ C;  3PUR A;  2HPL A;  2LSI A;  2DWG A;  4QKN A;  4UEM A;  4UEL A;  4UVA B;  5LCY A;  4MHC A;  5F3J A;  2JMK A;  1NAF A;  2CXF A;  3J9X 1;  4AQG A;  3C51 A;  2B1E A;  2V7L A;  4P0A A;  4HE8 A;  2NTY A;  2BZB A;  4YJ3 E;  2X66 A;  5J2U E;  5L2L A;  2XAF B;  4AI6 A;  4P0B A;  5JDQ A;  4MBQ A;  1HG2 A;  4N78 D;  1U4Q A;  5GON E;  5HXH A;  2LSG A;  2ZM8 A;  5HXC A;  2MYS A;  3PU3 A;  3ZMV B;  3KBT A;  1BR1 A;  1LVK A;  3PDY A;  2J1D G;  3ZMT B;  3H3A A;  2JRK A;  3KDS E;  2X68 A;  4CI3 B;  3N2O A;  5CA0 E;  2XHE B;  2E8I A;  2DI4 A;  3O1J A;  4UF0 A;  3HKE E;  2G0U A;  3LK2 B;  3L3P A;  3U78 A;  1KNZ A;  2KMF A;  3B57 A;  3KIN B;  1MIY A;  3GMI A;  5FY0 A;  3VKH A;  2C5J A;  3RKO A;  2DLR A;  3K8P C;  3BK9 A;  2CM0 A;  3IEE A;  2WMO A;  4X1K E;  3P7I A;  4CQI A;  2VAS A;  2NP9 A;  4CXW A;  2ES0 A;  2H7O A;  3AA7 B;  4JLE A;  4WBN E;  3I0Q A;  5L3F B;  4ZI3 C;  5A1L A;  5JRC B;  3PTR B;  4AXP A;  2CXL A;  3ANW B;  2QGS A;  2L8K A;  3LK4 2;  5KX5 E;  3ZMZ B;  2WM9 A;  3ZCI A;  2K24 A;  2K48 A;  2NWB A;  2DNX A;  4PJN A;  2PJQ A;  3UTK A;  3MKD A;  5DQW A;  3NZP A;  2WMN A;  4ADZ A;  2X0L B;  1QSD A;  5FP3 A;  2IW5 B;  3Q2M A;  2E9X B;  2W63 A;  1U5P A;  3EDV A;  4OK0 A;  4I43 B;  1US7 B;  3OJA A;  1T98 A;  1FMV A;  2BVL A;  1LKX A;  3CKD A;  1Z0P A;  3FXD B;  4HEA A;  3UUL A;  3ETU A;  4L5G A;  4ERR A;  3E08 A;  4WNK A;  1OWA A;  5LG4 A;  4JEH B;  3NZQ A;  1HF8 A;  3P8C D;  3RC3 A;  3AAI A;  3SWH A;  4IE0 A;  5LP6 E;  4CXY A;  1KK7 A;  1E1H B;  4GK0 E;  4UXN B;  3PU8 A;  4EZ4 A;  3CPZ A;  3CVR A;  4H9S E;  2VKH A;  3WI3 A;  4PNI A;  3U3I A;  4EXT A;  3UUX B;  4CI1 B;  3ONX A;  4ASK A;  2VKO A;  1MND A;  2N9D A;  3LJC A;  3E22 E;  4EIW A;  5ADX L;  3VU7 H;  3AAE B;  4GIW A;  3ZLI A;  3AVR A;  3N9P A;  3ZC0 A;  3CX7 B;  4ZHQ E;  2NW7 A;  2RA1 A;  1MMG A;  4ANJ A;  2X67 A;  3C64 A;  3OYZ A;  2RP4 A;  1UX4 A;  5JVD E;  4BA9 A;  2MTQ A;  4TV8 E;  1D0Z A;  3EVY A;  1WYC A;  2LSY A;  1S94 A;  3SS1 A;  1NWM X;  3EUH A;  3F2E A;  4FI5 A;  4X20 E;  3RPU A;  4QX8 B;  2CLY B;  2ZMA A;  2H7V C;  5LHI B;  2WBL A;  2ZM0 A;  2PBI A;  2YU1 A;  4Z8X A;  5HAX A;  4EYU A;  5DAB A;  3AA1 B;  2W62 A;  5HXE A;  2MBG A;  4OYK A;  3W15 B;  3CQC B;  2N2N A;  5L3E B;  5L3C B;  2EHO B;  2LSJ A;  1HG5 A;  2I59 A;  3M65 A;  4IST A;  3UT5 E;  5LGN B;  5L3D B;  5LJN A;  2A2F X;  3IBP A;  4KBM B;  4P09 A;  1D1B A;  4H63 V;  3ZJ1 A;  2W0G A;  3IHR A;  2D0U A;  1Y64 B;  5LNK A;  3LBX A;  4UVC B;  3AB3 B;  3Q5W A;  2KT9 A;  3K3N A;  3V5U A;  5BMV E;  2KXP B;  2Z6E A;  2UXN B;  3RYC E;  4EB6 E;  2KLQ A;  5LGU B;  3RYH E;  3C50 A;  4JUY A;  4GYS A;  3RYF E;  4AKR B;  5FMN A;  1IJ5 A;  2H3R A;  3SRZ A;  3K3O A;  3S4U A;  3KFW X;  4EYY R;  3MA9 A;  1QUU A;  2MOZ A;  3ZN0 B;  4UV9 B;  3CML A;  2JJ9 A;  2PG8 A;  4O2A E;  3DTO A;  3CWZ B;  4DBR A;  2ODV A;  2Y6X A;  2Q9Q A;  2WAU A;  2CCQ A;  2NTX A;  2XAH B;  1D0Y A;  3R6N A;  2A72 A;  3O1H A;  4IE5 A;  2ACX A;  2DHR A;  4QXB B;  2BVM A;  3N2K E;  2K5B B;  4BJN A;  4ISS A;  5LOV E;  2QA7 A;  4IHJ E;  2IAK A;  3I0O A;  4BJM A;  3C98 B;  4IGU A;  5TAO A;  2Y48 B;  4UF0 B;  1WR6 A;  3GWH A;  2VB6 A;  4PK6 A;  1G73 A;  1FMW A;  2L3L A;  2CA5 A;  3NBX X;  2X9X A;  4ZS2 A;  2GK9 A;  5AFU L;  5F8P A;  2CEA A;  4I4T E;  2EHO D;  3NRX A;  3I9W A;  5LXT E;  2A3D A;  5LYJ E;  1IZN B;  3CX6 B;  3FBZ A;  5IYZ E;  4AKH A;  4F6R C;  3FBL A;  3RC8 A;  4TX5 A;  2C0S A;  3HKB E;  3ZYK A;  4QXC B;  3PUG A;  4IE6 A;  1UX5 A;  5JDG A;  1EZ3 A;  4XBF B;  4WBO A;  5JQG E;  4UIG A;  5HYA A;  4QWN B;  4CZZ B;  3K3Q C;  5LGT B;  2IC6 A;  3NRY A;  2V7I A;  2DCF A;  3JC6 D;  3N9Q A;  3OBV E;  4QXH B;  3MJX A;  2N1G A;  2Y8D A;  3O9X A;  2D5U A;  4G63 A;  2XAS B;  4ZOL E;  4DND A;  4PK4 A;  3GN5 B;  3ZMU B;  4EOZ B;  1MMN A;  3HR0 A;  4I55 E;  4M1P A;  5JDH A;  3ZEF B;  3KV5 A;  2V1D B;  1FEW A;  5E0O A;  5JDM A;  3RYI E;  3RX6 A;  4ZS3 A;  1IJ6 A;  4O8S A;  1OXZ A;  3D0T A;  2JPF A;  4A56 A;  1HTJ F;  3N9N A;  5JDN A;  2XUE A;  4HTE A;  5JR9 B;  4FJO A;  2XQY A;  2LM9 A;  3PUA A;  5JRE A;  3Q5X A;  5EZY E;  2VKD A;  4L9I A;  1LVF A;  3I1A A;  5HWX A;  3PE0 A;  1HCI A;  4H9Q C;  5LBM A;  3ZPO A;  4DMV A;  4UV8 B;  2K9A A;  3RRW A;  2KZ7 B;  4J2C A;  5LHG B;  2VL8 A;  3KVA A;  2LOP A;  3AVS A;  1O3X A;  1IAP A;  2LEH A;  1HFA A;  2E9X D;  4C91 A;  4YJ2 E;  2X9H A;  1G8X A;  2M67 A;  4DBQ A;  2YIN A;  4MLK A;  4H9N C;  5DJQ C;  2NW9 A;  3JC6 C;  5IHY A;  5LBQ B;  4EZH A;  4H63 H;  5C8Y E;  4CI2 B;  5L3B B;  3ZMS B;  3AAA B;  2LT3 A;  4QHO A;  1UCU A;  2C5K T;  3O4X E;  3T8O A;  3E0Z A;  4H9O C;  1MMA A;  4HKA A;  4E7Z A;  1MIW A;  5KDM C;  2BDE A;  3ZYL A;  4DVD A;  4ZI7 E;  4ILU A;  4X1Y E;  2CMR A;  5CB4 E;  4KUM B;  4U74 A;  3IF8 B;  5HXS A;  5H6Q B;  5JH7 E;  2CXD A;  2CWY A;  3A5X A;  4H9R C;  4IE4 A;  2KWH A;  1MIV A;  4C90 A;  2IC9 A;  3KV6 A;  2NW8 A;  5LHH B;  1YKE B;  4KMC A;  2YK0 A;  4JEU B;  3VKG A;  1B7T A;  3R84 B;  3RRC A;  1SA0 E;  2X51 A;  3ESL A;  2DWK A;  4TV9 E;  1YW0 A;  5FY7 A;  4AKI A;  4O4I E;  1FIO A;  2Q9Q B;  2SPC A;  2W61 A;  3KV4 A;  2D0T A;  1BR4 A;  3WAJ A;  1ZEE A;  2X9Y A;  3F57 A;  2ODU A;  3HI2 A;  4G2A A;  1BR2 A;  4U72 A;  3HL6 A;  2YEV C;  5JDF A;  4OHF A;  1V9D A;  1H7C A;  2WWU A;  4HGA A;  4AKG A;  3UUM A;  2E9X C;  4PFO A;  3UUN A;  3KVB A;  4PK5 A;  3QC9 A;  3CQG B;  4ZI2 D;  2CWO A;  1ZKE A;  2WSS V;  2X9W A;  5EK2 A;  3OYX A;  4YLH A;  3SOL A;  4QX7 B;  3C4Z A;  1D0X A;  2XAJ B;  2JQQ A;  2V26 A;  4AKL A;  3QK6 A;  3Q9D A;  3HA4 A;  4PJL A;  2VKJ A;  3ZJ2 A;  4AQF C;  2CE7 A;  2LHR A;  3N9M A;  4IE7 A;  3I9Y A;  4O4H E;  4L0R A;  4X1I E;  3BQK A;  4O4J E;  5DQV A;  5FXV A;  1MNE A;  3MK7 C;  4PJM A;  4DMW A;  5JRC A;  1WRD A;  5J1G A;  4IIJ E;  2L9Q A;  3ANW A;  3L09 A;  4GYR A;  2VK9 A;  1D1C A;  4WW0 A;  1HS7 A;  3PUS A;  3FXE B;  2UXX B;  5M4Y A;  3PUQ A;  5JR9 C;  3DJB A;  2OA5 A;  3UFE A;  4O2B E;  3V5S A;  3N9O A;  4OFZ A;  2ZLY A;  4TN7 B;  3KV9 A;  3FHN A;  4YHJ A;  3J7Y q;  2PFV A;  3HKC E;  3EDU A;  4TZ4 C;  5L3G B;  4CXX A;  2E9X A;  2Q9Q D;  4IDZ A;  4B6X A;  3O1I A;  4TUY E;  2P9B A;  4GOU A;  3F31 A;  3LG7 A;  2V7K A;  3WAK A;  2CLY C;  2NOX A;  3QUJ A;  3OKQ A;  2HPJ A;  4MFR A;  5FXW A;  1WLX A;  4HN9 A;  5FXZ A;  2XTL A;  1WYB A;  5FYM A;  3LK3 B;  5EK4 A;  1VRB A;  4ZI2 C;  3ZC1 A;  2D2S A;  4K0U A;  4AQF A;  3GN5 A;  3CQX C;  1CUN A;  3N9L A;  2EHO C;  3C4W A;  4I50 E;  3GA8 A;  5FNV E;  2XAQ B;  2V7J A;  3VHL A;  2C5I T;  4NUV A;  3N2G E;  2LSK A;  2VWA A;  2HH7 A;  3ZYM A;  1ZHC A;  5H6R B;  2LOS A;  4E7S A;  2ZM2 A;  3CX8 B;  5HWY A;  4PJJ A;  4V1A v;  3AA6 B;  5JR9 A;  4PAG A;  2KIN B;  3HKD E;  4MAL A;  4XAX B;  4BAY B;  1ZV4 X;  5CA1 E;  3LFM A;  1YKH B;  3RH3 A;  4HFV A;  4OYJ A;  3ETV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...