2K48A

Nmr structure of the n-terminal coiled coil domain of the andes hantavirus nucleocapsid protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTMSTLQELQENITAHEQQLVTARQKLKDAEKAVEVDPDDVNKSTLQNRRAAVSTLETKLGELKRQLADLVAAQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoprotein
publication title NMR Structure of the N-terminal Coiled Coil Domain of the Andes Hantavirus Nucleocapsid Protein.
pubmed doi rcsb
source organism Andes virus
molecule tags Viral protein
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2k48A01
2G0UA 3TKLB 1IJ5A 3QUJA 4CQIA 4B6XA 1QSDA 2K48A 3MXZA 2KWHA 2X9XA 2C5KT 3N5LA 4J2CA 4L0RA 4FI5A 2CA5A 1LRZA 3FXEB 1LVFA 2C5IT 2C5JA 3CKDA 3FXDB 2X9WA 1H7CA 3L3PA 1Z0PA 2XTLA 4DNDA 3S4UA 2IC9A 3CVRA 1IJ6A 2IC6A 3QK6A 1ZKEA 2MBGA 3P7IA 4EYYR 2KWIB 2X9YA
chains in the Genus database with same CATH superfamily
3AE5A 1L0VA 2XQ3A 4XAXB 3FXEB 1FJGT 3AAAB 3PUSA 3HKEE 3ZEFB 2MPKA 2YDQA 1UX5A 2VL0A 3LBXA 3JAFA 3PDYA 1W0AA 3W15B 2UXBT 4LFBT 4DR7T 4KBMB 3AEBA 4ISSA 2LSKA 4PJJA 2Z6EA 4DO0A 1NAFA 3RI5A 3NZPA 4H63H 5JVDE 4U7IA 2AXDS 1CHUA 1UK5A 4UVAB 5KDMC 3RYFE 4JBWF 4EZ4A 4PK4A 1OEDC 1U4QA 2C5JA 3VR9A 3V5UA 4DMVA 2Q9QA 2B1EA 2MYSA 5AQTB 3D0TA 5DQWA 3RLFF 1OEDB 2NW7A 1HCIA 3HKBE 2VK9A 4BJMA 4OX9T 3ZYMA 2CPTA 4YSZA 4LF7T 2CCQA 4DBQA 4AKRB 3CK6A 2M67A 1VRBA 1W9RA 2KNDA 1WYCA 3AE7A 5L3DB 1KNRA 2HN1A 3ZKRA 4NXNT 5L47A 1HG5A 3OJAA 4ZOLE 2ODVA 3C4ZA 1WR0A 1QSDA 4QHOA 5ADXL 3HI2A 3ANWB 4LFAT 4AQGA 2WZHA 5AQLB 5JREA 1G8XA 1H7CA 3GWHA 4PK5A 3RIAA 2E9XD 4EV6A 2CWYA 3RRWA 4JUYA 1D1CA 1SHZC 4EOZB 1US7B 4WBOA 4UVCB 5BMVE 2XQ7A 2KSRA 2LJLA 4IGUA 3N5LA 4YHHT 2IC6A 5HYAA 5EK4A 4WYVA 3L09A 1MMAA 3RC3A 2KWIB 1XZYA 3JCFA 2V26A 5HXSA 3ZPOA 4ANJA 3F31A 4KP3C 4HKAA 2PG8A 4GYSA 3N2OA 1S94A 1OEDE 2LT3A 3IBPA 5CB4E 3C98B 4EAHA 2Y48B 4JI2T 1DU2A 4H63V 2KWHA 1Y64B 2J47A 4PJLA 4AQYT 5JDNA 1LRZA 4DV6T 3B5MA 5FKYA 4A98A 1M7KA 4P1NA 2CMRA 4CZZB 2N2NA 3LFMA 3FZHB 3OYZA 3L39A 5AQVB 2E2AA 3TLWA 3WAKA 4JI5T 4MBQA 3P8CD 3AXJA 1Y01A 2XQ6A 5ABFB 4MFRA 4HEAA 4OHFA 1YXRA 3KINB 2XQ8A 4HFCA 5DABA 1HX1B 4YY3T 5HXRA 1O3XA 4DV2T 3N9LA 4Z91A 4CXYA 4ISTA 3KV4A 1D0ZA 4JI8T 4HFHA 3I9WA 3QB5K 2FJDA 3Q5WA 2W00A 4YJ2E 4P0AA 5JQGE 2LHRA 5KXJA 2V7MA 4TNWA 3MKDA 2I59A 4CXWA 4B3ST 4YXDA 4IE6A 3EHZA 3UQ7A 3L8RA 2JJ9A 4TNVA 2HH7A 5HAXA 1HF8A 2XM2A 2XY8B 2V5CA 2VVSA 4C90A 3JAEA 2VB6A 3RKGA 2LOPA 2EHOC 3PV0F 4KI0F 4ZI2C 4DV0T 3AE2A 3P7IA 5AQJB 2LKGA 3SWHA 2PJQA 2XSAA 4B3MT 2UUCT 3KV9A 1WCRA 1G73A 1NEKA 1VOMA 3ZMUB 4TWHA 2WS3A 4IDQA 5LXTE 2LHNA 3VU7H 3UUBA 4IE7A 3ZT5A 2A9UA 5HEJA 2JQKA 3T8OA 3K3OA 1W09A 5J1GA 2BG9B 1N36T 4O8SA 1UCUA 5FXZA 4UEMA 4CI3B 3UFEA 5L3FB 2XAGB 2XASB 1IZNB 4DV3T 3QK6A 4GKJT 1KNZA 4LF8T 4A56A 3PTRB 2BKOA 3A8YC 3AE3A 3TLSA 2LSGA 2XTLA 4X1IE 2DNXA 3BQLA 2I6HA 5LG3A 5HCJA 3ZCJA 3QNUA 5AQKB 4BJNA 3P4RA 3AEGA 5HWYA 2C5KT 2LOSA 3ABVA 2V5DA 3NWIA 3NKZA 2KZ7B 1T72A 5FMNA 1N32T 4BAYB 5ETWA 2F4VT 4JLEA 1XMQT 4CQIA 2B76A 4GKKT 5DQVA 5FVKA 3BQKA 4AKIA 1LKXA 3P4SA 2KINB 4ZZCA 3N9OA 4YT0A 4O2AE 2UUAT 3DP7A 3ZC0A 2XAHB 4IDZA 1Z0PA 5AFUL 2VWAA 5C2TA 2NTXA 2BS2A 2QGSA 4DR3T 4YSYA 3AEEA 4U2ZA 2ZM2A 2UUBT 4HE8A 2WBLA 1FMWA 4QXBB 4GYRA 4UF0A 3KBTA 1WRDA 4K0KT 2VASA 3AAEB 4N78D 3UT5E 4P09A 2BG9E 3ZJ1A 3FBLA 4PK6A 2FJEA 3C4WA 2L8KA 1NWMX 5L4EA 2DWKA 3Q5DA 5C8YE 3IHRA 4F8HA 4ILBA 1OEDA 2NP9A 4DBRA 2BKNA 1WLXA 3R6NA 2EHOD 1FIOA 4ZI2D 4EYYR 3U78A 2W0GA 4IDOA 2W61A 5F5WA 4JI1T 2YEVC 4U33A 4QX8B 3UUXB 3ONXA 1T8BA 4HTEA 3VRAA 2X9WA 5JDGA 2CHOA 3HR0A 3O9XA 3Q5XA 4X20E 1GQEA 2YDSA 3H37A 3SRZA 3HL6A 2LSYA 4GK0E 2SPCA 3G06A 2WB5A 4Z8XA 4HWFA 2LLYA 3ZSSA 4HWIB 5AQSB 4YSXA 2LKHA 5LP6E 4H9QC 3UU8A 3BQIA 5ABEA 1W0BA 3JADA 4UR9A 5LJNA 5LGTB 2IUBA 4IREA 1N34T 1SE7A 2Y6XA 4DR5T 4LF5T 3H3MA 5JDLA 5JDQA 1D1BA 2IIUA 4H9RC 2K48A 5LBMA 4AXPA 4FI5A 3P4WA 4UVBB 5FP3A 2H3RA 2JQQA 3T1YT 2HHHT 3S4UA 1BR4A 4ADZA 3ZMVB 5JR9B 4EYUA 1KFYA 2XAJB 4YHJA 4QH4A 2K24A 2C5IT 4CI1B 4AISA 1R8IA 2KXPB 3Q9DA 3AEAA 1J1JA 5AQQB 1HS7A 1XDPA 1FMVA 1OWAA 3RQWA 3UUMA 4PAGA 5JDFA 5IYZE 4A5XA 4BA9A 2CWOA 4I0UA 3CX7B 1SUMB 2YU2A 1QUUA 2WMOA 4X65T 4U31A 1MMGA 4DV1T 4NXMT 2WQYA 3AE4A 2FJAA 3T1HT 2D9DA 3H3AA 3TLVA 3N2KE 3AE8A 2X9HA 4JEUB 3CX8B 3N2GE 2Y8DA 2XAQB 4DUZT 5LHHB 2V6YB 5FNVE 3CWZB 3I0OA 4JI3T 4YTNA 4U3CA 2W2UA 4B3TT 1UGOA 3AE9A 2MOZA 5JDHA 4KUMB 3C64A 3EAMA 5JRCB 4O4IE 4M1PA 5L4HA 3NRXA 2VKJA 3AECA 4IL4A 3A7MA 3JC6D 5AQRB 2CE7A 4I50E 3UU3A 4O4JE 5CA1E 2IMLA 3O4XE 3Q2MA 2ZLYA 3MA9A 2DHRA 2BKPA 2EHOA 4TWDA 2QRXA 5L2LA 3KV6A 3KBUA 5CA0E 2X0YA 3VR8A 2QA7A 3TLTA 4LMLA 1D0YA 2VKHA 1YQ4A 5J0ZA 3LBXB 3SOLA 3ZSTA 3KDSE 2ES0A 5HEHA 1XNQT 4AI6A 2X9XA 2ZM0A 1LVFA 2CXFA 1KNPA 2RP4A 2GK9A 3ZN0B 5JTGA 4ERRA 5AQHB 2X66A 1XMOT 3GN5A 3OPCA 5LB7B 2DLRA 2CBIA 1I6ZA 3ONJA 2Q9QB 2WWVA 2KT9A 4ILUA 1UURA 4IE5A 4I4TE 3K3QC 3PUQA 5L3BB 5FXWA 4JV5T 1D0XA 3UTKA 2X51A 1HX8A 4U7YA 2IC9A 1ZKEA 3RIFA 2YINA 4IIJE 3ETUA 4DR6T 4IE4A 4H9NC 3OTOT 1E2AA 4YJ3E 2IAKA 4O2BE 2V7JA 3PURA 2A2FX 1HNWT 2E5VA 3FB2A 5LCYA 2W63A 4WZXA 5A1LA 2PBIA 2J1DG 2FBWA 3FHNA 4DMWA 4HFEA 2CHNA 4Q25A 5AQOB 2WP9A 2WDQA 4B3RT 3RKOA 2BBJA 4ILAA 3SFDA 1HTJF 1I94T 3IEEA 4U72A 3MK7C 1ZHCA 2JQHA 2DCFA 5EZYE 4I55E 3J9X1 3FZKB 3NBXX 1OXZA 2BG9C 4PNIA 3E08A 2J62A 4ZI7E 2LRLA 2ACZA 3SFEA 3RQUA 4UV9B 3QOFA 2ODUA 1YQ3A 3MJXA 5F3JA 3LG7A 4L5GA 3OKQA 4TV9E 3ONLC 2V1DB 1WYBA 4O4LE 5C3JA 2X9YA 3CQCB 2YN6A 1MNDA 4LF4T 2CEAA 2V8SV 4NIQA 3RGLA 5DJQC 3PE0A 4K0UA 4KMCA 3UU6A 4CN6A 3GA8A 4UELA 5LG4A 2XM1A 3LDQB 3ZMSB 2W62A 5FY7A 3CMLA 5FY0A 2L9QA 4DV5T 2CXDA 4PFPA 2M6IA 5AQGB 3AXJB 5FVLA 3QC9A 4X66T 4O4HE 1X79A 4HFIA 3OBVE 3C4XA 4JEHB 4HN9A 2NW8A 4UV8B 3RYCE 3ZJ2A 2D0UA 3U3IA 1JNZA 1M62A 3E22E 5L3EB 4TWFA 3ZCIA 3CPZA 2BS3A 2V7KA 3NVOA 4IE0A 3TLUA 1NENA 4X1YE 2VKOA 5LHIB 4DV4T 5HWXA 3K1SA 2VKDA 3AAIA 3ZN1B 4U74A 4COFA 2DWGA 4HWCA 5CGMA 3AB3B 4ZS3A 3AA1B 1ZV4X 5IHYA 3N9QA 3DJBA 1ZP0A 2XHEB 2LE8A 1SA0E 1VCTA 5KX5E 1S35A 2WWUA 2KLQA 2FJBA 1XNRT 3KVBA 1Z8UA 2X0HA 2N9DA 5AQUB 1IBLT 4X62T 2WU5A 5CJ5A 3CIRA 5F8PA 4AKGA 1FEWA 2LSIA 5HXEA 3A5XA 4WBNE 1HG2A 3MACA 4KX6A 2AE9A 1U5PA 3WAJA 1YD8G 3M65A 2ZMAA 1MIWA 3DTOA 4UIGA 4EIWA 2K3WA 5ABHA 3KFWX 3RF1A 1T98A 3K3NA 1BR1A 4DIDB 3PUYF 2JRKA 1X9BA 2K5BB 1MNEA 4JI4T 4YTMA 2XQ4A 3MZKB 3IF8B 2RA1A 4Z90A 2E9XC 3ANWA 2XJ7A 4H9OC 4EGWA 2BVMA 2IHR1 2JMHA 3R84B 2CM0A 2E9XB 4J2CA 3HKCE 3RYIE 3ZC1A 2YKSA 4ZS2A 3AA0B 2BZBA 4TN7B 2HN2A 2IDOB 1EZ3A 2CXLA 4TUYE 4MHCA 1UX4A 3NRYA 4GK5E 3CQXC 3N9MA 3EUHA 2D2SA 4AQFC 2D5UA 2XZEA 4L0RA 3LJCA 4ZI3C 2WM9A 4EEDA 2W67A 2C0SA 5JR9C 2PFVA 3ZYLA 2JIWA 2XQ5A 3RIUC 2N1GA 4OYKA 2HPLA 5J2TE 4ZZBA 4LF9T 4YFSA 4B6XA 4LF6T 4HFVA 3CQGB 2NOXA 5AQIB 3ZLIA 3ESLA 1KEYA 2H7OA 4IDPA 2KMFA 2XSBA 3LK3B 3LK2B 3EI0A 5FY1A 2FUPA 5LA6E 2MBGA 4UF0B 2BVLA 2UU9T 3C51A 4IT4A 1YKEB 2LRKA 4GOUA 2MTQA 4GIWA 5ABFA 2R6GF 4V1Av 5LGUB 5LYJE 2UXNB 2A72A 4X1KE 1QLBA 2LSJA 4PJMA 2V7LA 4AKHA 3F2EA 5JDMA 4HFBA 4A97A 5FYMA 2JQ9A 2ZM8A 5LMNT 4DR2T 1JNRA 2WAUA 2BS4A 4HFDA 4EXTA 4DR1T 2WCAA 3KV5A 3V5SA 3SS1A 1KK7A 1MMDA 3VHLA 4X64T 4JI6T 3UFGA 3PU3A 2OV9A 5LBQB 3RYHE 2VQFT 5M4YA 3AEDA 2D0TA 4JI7T 1XDOA 2JMKA 5H6QB 5EK3A 4QWNB 2WDRA 1IBMT 4XZCA 3UU5A 3FBZA 3EDVA 3ZMTB 5LHGB 4EZHA 2X0LB 3CX6B 2OLTA 3P4QA 1HNZT 2LM9A 3K8PC 2LEHA 1T7SA 3QB5A 5TAOA 3AE1A 2JPFA 2CA5A 3ZYKA 3VKHA 3PUXF 5FXXA 2WMNA 3CVRA 4EEBA 3F57A 2BG9A 5HXCA 3M3ZB 2H7VC 3UUNA 4ILCA 4OFZA 3FZFB 4ZEYA 5GONE 5H6RB 4CXXA 3UU4A 4ZI3D 2Q9QC 3PJAJ 5FL1A 4AIUA 4DR4T 4I43B 4AKLA 2LM2A 2YDRA 4LMJA 2UXCT 4H9PC 3AVRA 4PFOA 2M6BA 3KVAA 2V6XA 2YOEA 4LFCT 2UXDT 3L3PA 2XUEA 2CLYC 2A3DA 5KMGP 2J4GA 1WFDA 5L3GB 1IBKT 3LSVA 1YKHB 3AA6B 2E8IA 3UQ4A 3E0ZA 2CLYB 5J2UE 2UXXB 3EVYA 5L3CB 1KF6A 5LGNB 4E7ZA 2CRBA 2NW9A 2X67A 3BK9A 5HEGA 4HGAA 2V7IA 2VQET 1HFAA 2BBHA 3I9YA 2WDVA 1B7TA 3PU8A 2ZM6T 1E7PA 4QXCB 3P4PA 3WI3A 1MIVA 4HWDA 5ABGA 2E5LT 4QKNA 3FZMB 2WU2A 3PUAA 5FXVA 4MALA 1J5ET 4QH1A 4DNDA 2P9BA 2X68A 4H9SE 3RRCA 3IA3A 4G63A 5HEOA 4TZ4C 4IHJE 3ZT6A 5FL0A 5HEUA 2XAFB 1HR0T 1VCSA 5HXHA 5LMUT 2IW5B 1YW0A 1ZEEA 2EHOB 3OYXA 3OVUA 3ZT7A 4CI2B 3ZMZB 3O1IA 4TX5A 1BR2A 3AEFA 4CN4A 3C50A 3UULA 2YK0A 2K9AA 2W4XA 1E1HB 3B13A 3FXDB 5EK2A 3PUGA 4ZXLA 1AJ3A 3HA4A 3PUVF 2WSSV 1V9DA 3RH3A 4OYJA 3AE6A 4WNKA 4G2AA 3QUJA 2XPKA 2QVAA 2HPJA 3MXZA 3I1AA 5LOVE 3O1JA 3GN5B 2BDEA 4TV8E 1N33T 4L9IA 2Q9QD 3VRBA 4NUUA 2NTYA 4U2YA 4KHPT 2W66A 4X5TA 2E9XA 3I0QA 2DI4A 3B57A 5BR8T 4DV7T 2DL1A 4LMKA 5IWAT 5IUXA 2XQAA 2VVNA 4XBFB 4FJOA 1D1AA 2OA5A 2G0UA 2QYWA 4CN1A 4AQFA 3AVSA 4QX7B 2CBJA 2XQ9A 4PJNA 1WR6A 3J7Yq 2VL8A 5JR9A 2I0MA 5AQPB 5LNKA 1IAPA 1MIYA 3RIUA 4YLHA 2NR4A 5AQNB 3RPUA 4C91A 3N9PA 3P50A 4PW8A 3HKDE 3PUWF 3N9NA 5E0OA 4QXHB 4ZHQE 3RX6A 5AQMB 3X1DA 4NUVA 4ASKA 4P0BA 4KHZF 3O1HA 4DVDA 2NWBA 1IJ5A 4JI0T 2YU1A 2ACXA 3GMIA 3CKDA 4IDNA 2WZIA 1ZOYA 2H89A 1LVKA 3RHWA 1HNXT 4DUYT 4WW0A 4HWHA 1J5WA 3NZQA 5AQFB 4E7SA 3ETVA 3VKGA 4JYAT 2L3LA 1UUSA 2XQYA 3EDUA 4OK0A 1XWMA 3FZLB 3Q5EA 1MMNA 3PJAA 4IL9A 4MLKA 2V6YA 3LK42 5JH7E 5LJMA 1BR0A 4QH5A 3TKLB 4NPPA 3JC6C 4YTPA 4F6RC 2MAWA 3AA7B 2H88A 5JRCA 3EABA 2WY2A 3RC8A 3PUZF 1CUNA 2VURA 1IJ6A 4EB6E 2PTFA 2RPAA 5HCMA 5CFBA 4UXNB
chains in the Genus database with same CATH topology
2JMKA 2J1DG 4CQIA 5H6QB 3FHNA 5EK3A 4QWNB 4DMWA 5DQVA 3BQKA 4AKIA 1LKXA 2KINB 4XZCA 3N9OA 4XAXB 3FXEB 4O2AE 3FBZA 3EDVA 3DP7A 3ZC0A 3ZMTB 5LHGB 2XAHB 4IDZA 4EZHA 1Z0PA 2X0LB 3AAAB 3PUSA 3HKEE 5AFUL 3RKOA 3CX6B 2VWAA 2NTXA 2QGSA 3ZEFB 2LM9A 1HTJF 1UX5A 3PDYA 3LBXA 3IEEA 3W15B 3K8PC 2ZM2A 4U72A 3MK7C 2LEHA 4KBMB 4ISSA 5TAOA 2LSKA 4PJJA 1ZHCA 4HE8A 2JPFA 2CA5A 2WBLA 2Z6EA 4DO0A 2DCFA 1FMWA 4QXBB 1NAFA 4GYRA 3ZYKA 4UF0A 3VKHA 5EZYE 4I55E 3J9X1 3KBTA 3NZPA 5FXXA 3NBXX 1WRDA 2WMNA 1OXZA 3CVRA 4H63H 2VASA 3AAEB 4N78D 4PNIA 3UT5E 4P09A 3F57A 3E08A 5HXCA 3ZJ1A 5JVDE 3FBLA 2H7VC 3UUNA 4ZI7E 4OFZA 4PK6A 3C4WA 2L8KA 4UV9B 4UVAB 1NWMX 2DWKA 5KDMC 5GONE 5H6RB 3RYFE 5C8YE 3IHRA 4CXXA 4EZ4A 4PK4A 4ZI3D 1U4QA 2C5JA 2Q9QC 3V5UA 4DMVA 2NP9A 2ODUA 4DBRA 2Q9QA 2B1EA 2MYSA 3MJXA 4I43B 5F3JA 3D0TA 3LG7A 4L5GA 4AKLA 3OKQA 1WLXA 4TV9E 3R6NA 2EHOD 2V1DB 1WYBA 1FIOA 4O4LE 5DQWA 4ZI2D 4EYYR 2X9YA 3AVRA 4H9PC 3CQCB 4PFOA 3U78A 1MNDA 2W0GA 2NW7A 1HCIA 3KVAA 3HKBE 2CEAA 2W61A 2YEVC 5DJQC 4QX8B 3PE0A 3UUXB 3ONXA 4HTEA 4K0UA 2X9WA 2VK9A 3L3PA 4KMCA 4BJMA 2XUEA 5JDGA 2CLYC 3HR0A 3ZYMA 2A3DA 3O9XA 3Q5XA 4X20E 3GA8A 5KMGP 2CCQA 4DBQA 3H37A 4UELA 5LG4A 3SRZA 3HL6A 2LSYA 3ZMSB 2W62A 5L3GB 4GK0E 2SPCA 5FY7A 3CMLA 4AKRB 1YKHB 5FY0A 2L9QA 4Z8XA 3AA6B 2E8IA 2M67A 1VRBA 3E0ZA 2CXDA 2KNDA 1WYCA 4PFPA 5L3DB 2CLYB 5J2UE 2UXXB 3QC9A 3EVYA 5L3CB 5LGNB 4E7ZA 2NW9A 4O4HE 1X79A 4H9QC 5LP6E 2X67A 3BK9A 3OBVE 1HG5A 3OJAA 4ZOLE 3C4XA 4JEHB 4HN9A 4HGAA 2V7IA 2ODVA 3C4ZA 1HFAA 3BQIA 2NW8A 4UV8B 1QSDA 4QHOA 5ADXL 3HI2A 5LJNA 3I9YA 3RYCE 3ANWB 3ZJ2A 2D0UA 1B7TA 3U3IA 3PU8A 5L3EB 3E22E 5LGTB 4AQGA 3ZCIA 3CPZA 4QXCB 5JREA 1G8XA 1H7CA 3WI3A 2V7KA 3GWHA 4PK5A 2E9XD 1MIVA 2Y6XA 4IE0A 2CWYA 4QKNA 4JUYA 3RRWA 1D1CA 1SHZC 4EOZB 1US7B 4WBOA 4X1YE 5JDLA 4UVCB 5JDQA 2VKOA 3PUAA 5LHIB 1D1BA 4H9RC 5BMVE 5HWXA 2K48A 5FXVA 5LBMA 2VKDA 2LJLA 4IGUA 4MALA 3N5LA 4AXPA 3AAIA 4FI5A 3ZN1B 4U74A 4UVBB 2DWGA 5FP3A 4DNDA 3AB3B 4ZS3A 2H3RA 3AA1B 1ZV4X 2P9BA 2X68A 5IHYA 4H9SE 3N9QA 3RRCA 2IC6A 3DJBA 2JQQA 4G63A 5HYAA 4TZ4C 5EK4A 3RC3A 3L09A 1MMAA 2XHEB 2LE8A 2KWIB 3S4UA 4IHJE 1BR4A 1SA0E 2XAFB 4ADZA 3ZMVB 2V26A 5HXSA 5KX5E 1S35A 2WWUA 5JR9B 4EYUA 5HXHA 3ZPOA 2KLQA 2XAJB 2IW5B 4YHJA 3F31A 4ANJA 1YW0A 1ZEEA 3KVBA 4KP3C 2EHOB 2N9DA 2K24A 3OYXA 4HKAA 2C5IT 2PG8A 4GYSA 4CI1B 4CI2B 3ZMZB 3N2OA 1S94A 3O1IA 1BR2A 4TX5A 5F8PA 1FEWA 2LT3A 4AKGA 2KXPB 2LSIA 5HXEA 3Q9DA 3IBPA 5CB4E 3C98B 4EAHA 2Y48B 3A5XA 3C50A 1HS7A 4WBNE 3UULA 1FMVA 1HG2A 1OWAA 3MACA 4H63V 1U5PA 3UUMA 2YK0A 2K9AA 2KWHA 1Y64B 4PAGA 5JDFA 4PJLA 3WAJA 1YD8G 5IYZE 5JDNA 1LRZA 3M65A 2ZMAA 1MIWA 1E1HB 4BA9A 3DTOA 4UIGA 4EIWA 2CWOA 3B13A 2CMRA 3FXDB 4CZZB 5EK2A 3PUGA 2N2NA 3LFMA 3OYZA 1AJ3A 3CX7B 3HA4A 2WSSV 3KFWX 3WAKA 1V9DA 3RH3A 4MBQA 4OYJA 3P8CD 1T98A 1QUUA 2WMOA 2YU2A 3K3NA 4WNKA 4G2AA 1BR1A 4MFRA 1MMGA 4HEAA 4OHFA 3QUJA 3KINB 2HPJA 3MXZA 2JRKA 2K5BB 5DABA 1MNEA 3I1AA 5LOVE 3O1JA 3GN5B 5HXRA 2BDEA 1O3XA 4TV8E 3MZKB 3IF8B 2RA1A 3H3AA 4L9IA 2Q9QD 3N9LA 4NUUA 2NTYA 4CXYA 2E9XC 3N2KE 4ISTA 3KV4A 2X9HA 2E9XA 3ANWA 1D0ZA 2DI4A 3I0QA 4JEUB 3CX8B 3I9WA 4H9OC 3B57A 2BVMA 3Q5WA 2W00A 3N2GE 2JMHA 4YJ2E 3R84B 2Y8DA 4P0AA 5JQGE 2CM0A 2LHRA 2XAQB 2E9XB 4J2CA 2V7MA 3HKCE 5FNVE 3RYIE 3ZC1A 3CWZB 3I0OA 3MKDA 5LHHB 4ZS2A 3AA0B 2I59A 2BZBA 4TN7B 4CXWA 2MOZA 1EZ3A 2CXLA 4TUYE 4MHCA 5JDHA 1UX4A 4KUMB 4XBFB 3NRYA 3C64A 4GK5E 5JRCB 4FJOA 1D1AA 3CQXC 4M1PA 4IE6A 2OA5A 3NRXA 4O4IE 2VKJA 3N9MA 2G0UA 2JJ9A 3JC6D 3EUHA 2D2SA 4AQFC 2HH7A 2CE7A 2D5UA 4I50E 4L0RA 4AQFA 3LJCA 3AVSA 4O4JE 4QX7B 4ZI3C 5CA1E 5HAXA 1HF8A 2WM9A 4PJNA 2C0SA 3O4XE 1WR6A 3Q2MA 2ZLYA 5JR9C 2PFVA 4C90A 3J7Yq 2VL8A 3ZYLA 2VB6A 5JR9A 3MA9A 2DHRA 2LOPA 2N1GA 2EHOC 5LNKA 1IAPA 1MIYA 4OYKA 4ZI2C 2HPLA 5J2TE 2EHOA 4YLHA 3P7IA 5L2LA 3RPUA 4C91A 4YFSA 3N9PA 3SWHA 4B6XA 2PJQA 3KV6A 3KBUA 3HKDE 4PW8A 4HFVA 3N9NA 5E0OA 5CA0E 3KV9A 3CQGB 2QA7A 4QXHB 3RX6A 4ZHQE 2NOXA 3ZLIA 1D0YA 2VKHA 1G73A 3ESLA 1VOMA 3LBXB 2H7OA 2KMFA 3LK3B 3SOLA 3LK2B 3KDSE 4NUVA 3ZMUB 2ES0A 5FY1A 4ASKA 5LXTE 4P0BA 2LHNA 3O1HA 5LA6E 3VU7H 2MBGA 4UF0B 4DVDA 2NWBA 4IE7A 1IJ5A 2BVLA 2YU1A 3T8OA 4AI6A 3K3OA 3C51A 2X9XA 2ZM0A 1YKEB 5J1GA 1LVFA 2CXFA 4O8SA 1UCUA 2ACXA 2MTQA 3GMIA 4GIWA 2RP4A 3CKDA 4GOUA 4UEMA 5FXZA 2GK9A 4CI3B 3ZN0B 4V1Av 4ERRA 5LGUB 3UFEA 5LYJE 2UXNB 2X66A 2A72A 2XAGB 5L3FB 1LVKA 4X1KE 2XASB 4WW0A 1IZNB 3QK6A 3GN5A 2LSJA 4PJMA 2DLRA 1KNZA 2V7LA 4AKHA 3NZQA 4A56A 3F2EA 2Q9QB 5JDMA 2KT9A 4E7SA 3PTRB 3ETVA 5FYMA 3VKGA 4ILUA 2ZM8A 2L3LA 4IE5A 4I4TE 2XQYA 3K3QC 3PUQA 5L3BB 5FXWA 3EDUA 2LSGA 2WAUA 4OK0A 1D0XA 2XTLA 3UTKA 2X51A 4X1IE 1HX8A 4EXTA 1MMNA 2DNXA 3BQLA 2IC9A 4MLKA 1ZKEA 3LK42 3KV5A 3V5SA 2YINA 4IIJE 3SS1A 3ZCJA 4BJNA 5JH7E 5LJMA 1BR0A 3TKLB 3ETUA 1KK7A 4IE4A 4H9NC 1MMDA 3JC6C 3VHLA 4F6RC 5HWYA 2C5KT 3AA7B 2LOSA 4YJ3E 2IAKA 4O2BE 3PU3A 5JRCA 2V7JA 3PURA 2A2FX 2KZ7B 5LBQB 3RC8A 1CUNA 5FMNA 3RYHE 3FB2A 5LCYA 1IJ6A 2W63A 4EB6E 4BAYB 5A1LA 5M4YA 2PBIA 5ETWA 4UXNB 4JLEA 2D0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0U A;  3TKL B;  1IJ5 A;  3QUJ A;  4CQI A;  4B6X A;  1QSD A;  2K48 A;  3MXZ A;  2KWH A;  2X9X A;  2C5K T;  3N5L A;  4J2C A;  4L0R A;  4FI5 A;  2CA5 A;  1LRZ A;  3FXE B;  1LVF A;  2C5I T;  2C5J A;  3CKD A;  3FXD B;  2X9W A;  1H7C A;  3L3P A;  1Z0P A;  2XTL A;  4DND A;  3S4U A;  2IC9 A;  3CVR A;  1IJ6 A;  2IC6 A;  3QK6 A;  1ZKE A;  2MBG A;  3P7I A;  4EYY R;  2KWI B;  2X9Y A; 
#chains in the Genus database with same CATH topology
 3AE5 A;  1L0V A;  2XQ3 A;  4XAX B;  3FXE B;  1FJG T;  3AAA B;  3PUS A;  3HKE E;  3ZEF B;  2MPK A;  2YDQ A;  1UX5 A;  2VL0 A;  3LBX A;  3JAF A;  3PDY A;  1W0A A;  3W15 B;  2UXB T;  4LFB T;  4DR7 T;  4KBM B;  3AEB A;  4ISS A;  2LSK A;  4PJJ A;  2Z6E A;  4DO0 A;  1NAF A;  3RI5 A;  3NZP A;  4H63 H;  5JVD E;  4U7I A;  2AXD S;  1CHU A;  1UK5 A;  4UVA B;  5KDM C;  3RYF E;  4JBW F;  4EZ4 A;  4PK4 A;  1OED C;  1U4Q A;  2C5J A;  3VR9 A;  3V5U A;  4DMV A;  2Q9Q A;  2B1E A;  2MYS A;  5AQT B;  3D0T A;  5DQW A;  3RLF F;  1OED B;  2NW7 A;  1HCI A;  3HKB E;  2VK9 A;  4BJM A;  4OX9 T;  3ZYM A;  2CPT A;  4YSZ A;  4LF7 T;  2CCQ A;  4DBQ A;  4AKR B;  3CK6 A;  2M67 A;  1VRB A;  1W9R A;  2KND A;  1WYC A;  3AE7 A;  5L3D B;  1KNR A;  2HN1 A;  3ZKR A;  4NXN T;  5L47 A;  1HG5 A;  3OJA A;  4ZOL E;  2ODV A;  3C4Z A;  1WR0 A;  1QSD A;  4QHO A;  5ADX L;  3HI2 A;  3ANW B;  4LFA T;  4AQG A;  2WZH A;  5AQL B;  5JRE A;  1G8X A;  1H7C A;  3GWH A;  4PK5 A;  3RIA A;  2E9X D;  4EV6 A;  2CWY A;  3RRW A;  4JUY A;  1D1C A;  1SHZ C;  4EOZ B;  1US7 B;  4WBO A;  4UVC B;  5BMV E;  2XQ7 A;  2KSR A;  2LJL A;  4IGU A;  3N5L A;  4YHH T;  2IC6 A;  5HYA A;  5EK4 A;  4WYV A;  3L09 A;  1MMA A;  3RC3 A;  2KWI B;  1XZY A;  3JCF A;  2V26 A;  5HXS A;  3ZPO A;  4ANJ A;  3F31 A;  4KP3 C;  4HKA A;  2PG8 A;  4GYS A;  3N2O A;  1S94 A;  1OED E;  2LT3 A;  3IBP A;  5CB4 E;  3C98 B;  4EAH A;  2Y48 B;  4JI2 T;  1DU2 A;  4H63 V;  2KWH A;  1Y64 B;  2J47 A;  4PJL A;  4AQY T;  5JDN A;  1LRZ A;  4DV6 T;  3B5M A;  5FKY A;  4A98 A;  1M7K A;  4P1N A;  2CMR A;  4CZZ B;  2N2N A;  3LFM A;  3FZH B;  3OYZ A;  3L39 A;  5AQV B;  2E2A A;  3TLW A;  3WAK A;  4JI5 T;  4MBQ A;  3P8C D;  3AXJ A;  1Y01 A;  2XQ6 A;  5ABF B;  4MFR A;  4HEA A;  4OHF A;  1YXR A;  3KIN B;  2XQ8 A;  4HFC A;  5DAB A;  1HX1 B;  4YY3 T;  5HXR A;  1O3X A;  4DV2 T;  3N9L A;  4Z91 A;  4CXY A;  4IST A;  3KV4 A;  1D0Z A;  4JI8 T;  4HFH A;  3I9W A;  3QB5 K;  2FJD A;  3Q5W A;  2W00 A;  4YJ2 E;  4P0A A;  5JQG E;  2LHR A;  5KXJ A;  2V7M A;  4TNW A;  3MKD A;  2I59 A;  4CXW A;  4B3S T;  4YXD A;  4IE6 A;  3EHZ A;  3UQ7 A;  3L8R A;  2JJ9 A;  4TNV A;  2HH7 A;  5HAX A;  1HF8 A;  2XM2 A;  2XY8 B;  2V5C A;  2VVS A;  4C90 A;  3JAE A;  2VB6 A;  3RKG A;  2LOP A;  2EHO C;  3PV0 F;  4KI0 F;  4ZI2 C;  4DV0 T;  3AE2 A;  3P7I A;  5AQJ B;  2LKG A;  3SWH A;  2PJQ A;  2XSA A;  4B3M T;  2UUC T;  3KV9 A;  1WCR A;  1G73 A;  1NEK A;  1VOM A;  3ZMU B;  4TWH A;  2WS3 A;  4IDQ A;  5LXT E;  2LHN A;  3VU7 H;  3UUB A;  4IE7 A;  3ZT5 A;  2A9U A;  5HEJ A;  2JQK A;  3T8O A;  3K3O A;  1W09 A;  5J1G A;  2BG9 B;  1N36 T;  4O8S A;  1UCU A;  5FXZ A;  4UEM A;  4CI3 B;  3UFE A;  5L3F B;  2XAG B;  2XAS B;  1IZN B;  4DV3 T;  3QK6 A;  4GKJ T;  1KNZ A;  4LF8 T;  4A56 A;  3PTR B;  2BKO A;  3A8Y C;  3AE3 A;  3TLS A;  2LSG A;  2XTL A;  4X1I E;  2DNX A;  3BQL A;  2I6H A;  5LG3 A;  5HCJ A;  3ZCJ A;  3QNU A;  5AQK B;  4BJN A;  3P4R A;  3AEG A;  5HWY A;  2C5K T;  2LOS A;  3ABV A;  2V5D A;  3NWI A;  3NKZ A;  2KZ7 B;  1T72 A;  5FMN A;  1N32 T;  4BAY B;  5ETW A;  2F4V T;  4JLE A;  1XMQ T;  4CQI A;  2B76 A;  4GKK T;  5DQV A;  5FVK A;  3BQK A;  4AKI A;  1LKX A;  3P4S A;  2KIN B;  4ZZC A;  3N9O A;  4YT0 A;  4O2A E;  2UUA T;  3DP7 A;  3ZC0 A;  2XAH B;  4IDZ A;  1Z0P A;  5AFU L;  2VWA A;  5C2T A;  2NTX A;  2BS2 A;  2QGS A;  4DR3 T;  4YSY A;  3AEE A;  4U2Z A;  2ZM2 A;  2UUB T;  4HE8 A;  2WBL A;  1FMW A;  4QXB B;  4GYR A;  4UF0 A;  3KBT A;  1WRD A;  4K0K T;  2VAS A;  3AAE B;  4N78 D;  3UT5 E;  4P09 A;  2BG9 E;  3ZJ1 A;  3FBL A;  4PK6 A;  2FJE A;  3C4W A;  2L8K A;  1NWM X;  5L4E A;  2DWK A;  3Q5D A;  5C8Y E;  3IHR A;  4F8H A;  4ILB A;  1OED A;  2NP9 A;  4DBR A;  2BKN A;  1WLX A;  3R6N A;  2EHO D;  1FIO A;  4ZI2 D;  4EYY R;  3U78 A;  2W0G A;  4IDO A;  2W61 A;  5F5W A;  4JI1 T;  2YEV C;  4U33 A;  4QX8 B;  3UUX B;  3ONX A;  1T8B A;  4HTE A;  3VRA A;  2X9W A;  5JDG A;  2CHO A;  3HR0 A;  3O9X A;  3Q5X A;  4X20 E;  1GQE A;  2YDS A;  3H37 A;  3SRZ A;  3HL6 A;  2LSY A;  4GK0 E;  2SPC A;  3G06 A;  2WB5 A;  4Z8X A;  4HWF A;  2LLY A;  3ZSS A;  4HWI B;  5AQS B;  4YSX A;  2LKH A;  5LP6 E;  4H9Q C;  3UU8 A;  3BQI A;  5ABE A;  1W0B A;  3JAD A;  4UR9 A;  5LJN A;  5LGT B;  2IUB A;  4IRE A;  1N34 T;  1SE7 A;  2Y6X A;  4DR5 T;  4LF5 T;  3H3M A;  5JDL A;  5JDQ A;  1D1B A;  2IIU A;  4H9R C;  2K48 A;  5LBM A;  4AXP A;  4FI5 A;  3P4W A;  4UVB B;  5FP3 A;  2H3R A;  2JQQ A;  3T1Y T;  2HHH T;  3S4U A;  1BR4 A;  4ADZ A;  3ZMV B;  5JR9 B;  4EYU A;  1KFY A;  2XAJ B;  4YHJ A;  4QH4 A;  2K24 A;  2C5I T;  4CI1 B;  4AIS A;  1R8I A;  2KXP B;  3Q9D A;  3AEA A;  1J1J A;  5AQQ B;  1HS7 A;  1XDP A;  1FMV A;  1OWA A;  3RQW A;  3UUM A;  4PAG A;  5JDF A;  5IYZ E;  4A5X A;  4BA9 A;  2CWO A;  4I0U A;  3CX7 B;  1SUM B;  2YU2 A;  1QUU A;  2WMO A;  4X65 T;  4U31 A;  1MMG A;  4DV1 T;  4NXM T;  2WQY A;  3AE4 A;  2FJA A;  3T1H T;  2D9D A;  3H3A A;  3TLV A;  3N2K E;  3AE8 A;  2X9H A;  4JEU B;  3CX8 B;  3N2G E;  2Y8D A;  2XAQ B;  4DUZ T;  5LHH B;  2V6Y B;  5FNV E;  3CWZ B;  3I0O A;  4JI3 T;  4YTN A;  4U3C A;  2W2U A;  4B3T T;  1UGO A;  3AE9 A;  2MOZ A;  5JDH A;  4KUM B;  3C64 A;  3EAM A;  5JRC B;  4O4I E;  4M1P A;  5L4H A;  3NRX A;  2VKJ A;  3AEC A;  4IL4 A;  3A7M A;  3JC6 D;  5AQR B;  2CE7 A;  4I50 E;  3UU3 A;  4O4J E;  5CA1 E;  2IML A;  3O4X E;  3Q2M A;  2ZLY A;  3MA9 A;  2DHR A;  2BKP A;  2EHO A;  4TWD A;  2QRX A;  5L2L A;  3KV6 A;  3KBU A;  5CA0 E;  2X0Y A;  3VR8 A;  2QA7 A;  3TLT A;  4LML A;  1D0Y A;  2VKH A;  1YQ4 A;  5J0Z A;  3LBX B;  3SOL A;  3ZST A;  3KDS E;  2ES0 A;  5HEH A;  1XNQ T;  4AI6 A;  2X9X A;  2ZM0 A;  1LVF A;  2CXF A;  1KNP A;  2RP4 A;  2GK9 A;  3ZN0 B;  5JTG A;  4ERR A;  5AQH B;  2X66 A;  1XMO T;  3GN5 A;  3OPC A;  5LB7 B;  2DLR A;  2CBI A;  1I6Z A;  3ONJ A;  2Q9Q B;  2WWV A;  2KT9 A;  4ILU A;  1UUR A;  4IE5 A;  4I4T E;  3K3Q C;  3PUQ A;  5L3B B;  5FXW A;  4JV5 T;  1D0X A;  3UTK A;  2X51 A;  1HX8 A;  4U7Y A;  2IC9 A;  1ZKE A;  3RIF A;  2YIN A;  4IIJ E;  3ETU A;  4DR6 T;  4IE4 A;  4H9N C;  3OTO T;  1E2A A;  4YJ3 E;  2IAK A;  4O2B E;  2V7J A;  3PUR A;  2A2F X;  1HNW T;  2E5V A;  3FB2 A;  5LCY A;  2W63 A;  4WZX A;  5A1L A;  2PBI A;  2J1D G;  2FBW A;  3FHN A;  4DMW A;  4HFE A;  2CHN A;  4Q25 A;  5AQO B;  2WP9 A;  2WDQ A;  4B3R T;  3RKO A;  2BBJ A;  4ILA A;  3SFD A;  1HTJ F;  1I94 T;  3IEE A;  4U72 A;  3MK7 C;  1ZHC A;  2JQH A;  2DCF A;  5EZY E;  4I55 E;  3J9X 1;  3FZK B;  3NBX X;  1OXZ A;  2BG9 C;  4PNI A;  3E08 A;  2J62 A;  4ZI7 E;  2LRL A;  2ACZ A;  3SFE A;  3RQU A;  4UV9 B;  3QOF A;  2ODU A;  1YQ3 A;  3MJX A;  5F3J A;  3LG7 A;  4L5G A;  3OKQ A;  4TV9 E;  3ONL C;  2V1D B;  1WYB A;  4O4L E;  5C3J A;  2X9Y A;  3CQC B;  2YN6 A;  1MND A;  4LF4 T;  2CEA A;  2V8S V;  4NIQ A;  3RGL A;  5DJQ C;  3PE0 A;  4K0U A;  4KMC A;  3UU6 A;  4CN6 A;  3GA8 A;  4UEL A;  5LG4 A;  2XM1 A;  3LDQ B;  3ZMS B;  2W62 A;  5FY7 A;  3CML A;  5FY0 A;  2L9Q A;  4DV5 T;  2CXD A;  4PFP A;  2M6I A;  5AQG B;  3AXJ B;  5FVL A;  3QC9 A;  4X66 T;  4O4H E;  1X79 A;  4HFI A;  3OBV E;  3C4X A;  4JEH B;  4HN9 A;  2NW8 A;  4UV8 B;  3RYC E;  3ZJ2 A;  2D0U A;  3U3I A;  1JNZ A;  1M62 A;  3E22 E;  5L3E B;  4TWF A;  3ZCI A;  3CPZ A;  2BS3 A;  2V7K A;  3NVO A;  4IE0 A;  3TLU A;  1NEN A;  4X1Y E;  2VKO A;  5LHI B;  4DV4 T;  5HWX A;  3K1S A;  2VKD A;  3AAI A;  3ZN1 B;  4U74 A;  4COF A;  2DWG A;  4HWC A;  5CGM A;  3AB3 B;  4ZS3 A;  3AA1 B;  1ZV4 X;  5IHY A;  3N9Q A;  3DJB A;  1ZP0 A;  2XHE B;  2LE8 A;  1SA0 E;  1VCT A;  5KX5 E;  1S35 A;  2WWU A;  2KLQ A;  2FJB A;  1XNR T;  3KVB A;  1Z8U A;  2X0H A;  2N9D A;  5AQU B;  1IBL T;  4X62 T;  2WU5 A;  5CJ5 A;  3CIR A;  5F8P A;  4AKG A;  1FEW A;  2LSI A;  5HXE A;  3A5X A;  4WBN E;  1HG2 A;  3MAC A;  4KX6 A;  2AE9 A;  1U5P A;  3WAJ A;  1YD8 G;  3M65 A;  2ZMA A;  1MIW A;  3DTO A;  4UIG A;  4EIW A;  2K3W A;  5ABH A;  3KFW X;  3RF1 A;  1T98 A;  3K3N A;  1BR1 A;  4DID B;  3PUY F;  2JRK A;  1X9B A;  2K5B B;  1MNE A;  4JI4 T;  4YTM A;  2XQ4 A;  3MZK B;  3IF8 B;  2RA1 A;  4Z90 A;  2E9X C;  3ANW A;  2XJ7 A;  4H9O C;  4EGW A;  2BVM A;  2IHR 1;  2JMH A;  3R84 B;  2CM0 A;  2E9X B;  4J2C A;  3HKC E;  3RYI E;  3ZC1 A;  2YKS A;  4ZS2 A;  3AA0 B;  2BZB A;  4TN7 B;  2HN2 A;  2IDO B;  1EZ3 A;  2CXL A;  4TUY E;  4MHC A;  1UX4 A;  3NRY A;  4GK5 E;  3CQX C;  3N9M A;  3EUH A;  2D2S A;  4AQF C;  2D5U A;  2XZE A;  4L0R A;  3LJC A;  4ZI3 C;  2WM9 A;  4EED A;  2W67 A;  2C0S A;  5JR9 C;  2PFV A;  3ZYL A;  2JIW A;  2XQ5 A;  3RIU C;  2N1G A;  4OYK A;  2HPL A;  5J2T E;  4ZZB A;  4LF9 T;  4YFS A;  4B6X A;  4LF6 T;  4HFV A;  3CQG B;  2NOX A;  5AQI B;  3ZLI A;  3ESL A;  1KEY A;  2H7O A;  4IDP A;  2KMF A;  2XSB A;  3LK3 B;  3LK2 B;  3EI0 A;  5FY1 A;  2FUP A;  5LA6 E;  2MBG A;  4UF0 B;  2BVL A;  2UU9 T;  3C51 A;  4IT4 A;  1YKE B;  2LRK A;  4GOU A;  2MTQ A;  4GIW A;  5ABF A;  2R6G F;  4V1A v;  5LGU B;  5LYJ E;  2UXN B;  2A72 A;  4X1K E;  1QLB A;  2LSJ A;  4PJM A;  2V7L A;  4AKH A;  3F2E A;  5JDM A;  4HFB A;  4A97 A;  5FYM A;  2JQ9 A;  2ZM8 A;  5LMN T;  4DR2 T;  1JNR A;  2WAU A;  2BS4 A;  4HFD A;  4EXT A;  4DR1 T;  2WCA A;  3KV5 A;  3V5S A;  3SS1 A;  1KK7 A;  1MMD A;  3VHL A;  4X64 T;  4JI6 T;  3UFG A;  3PU3 A;  2OV9 A;  5LBQ B;  3RYH E;  2VQF T;  5M4Y A;  3AED A;  2D0T A;  4JI7 T;  1XDO A;  2JMK A;  5H6Q B;  5EK3 A;  4QWN B;  2WDR A;  1IBM T;  4XZC A;  3UU5 A;  3FBZ A;  3EDV A;  3ZMT B;  5LHG B;  4EZH A;  2X0L B;  3CX6 B;  2OLT A;  3P4Q A;  1HNZ T;  2LM9 A;  3K8P C;  2LEH A;  1T7S A;  3QB5 A;  5TAO A;  3AE1 A;  2JPF A;  2CA5 A;  3ZYK A;  3VKH A;  3PUX F;  5FXX A;  2WMN A;  3CVR A;  4EEB A;  3F57 A;  2BG9 A;  5HXC A;  3M3Z B;  2H7V C;  3UUN A;  4ILC A;  4OFZ A;  3FZF B;  4ZEY A;  5GON E;  5H6R B;  4CXX A;  3UU4 A;  4ZI3 D;  2Q9Q C;  3PJA J;  5FL1 A;  4AIU A;  4DR4 T;  4I43 B;  4AKL A;  2LM2 A;  2YDR A;  4LMJ A;  2UXC T;  4H9P C;  3AVR A;  4PFO A;  2M6B A;  3KVA A;  2V6X A;  2YOE A;  4LFC T;  2UXD T;  3L3P A;  2XUE A;  2CLY C;  2A3D A;  5KMG P;  2J4G A;  1WFD A;  5L3G B;  1IBK T;  3LSV A;  1YKH B;  3AA6 B;  2E8I A;  3UQ4 A;  3E0Z A;  2CLY B;  5J2U E;  2UXX B;  3EVY A;  5L3C B;  1KF6 A;  5LGN B;  4E7Z A;  2CRB A;  2NW9 A;  2X67 A;  3BK9 A;  5HEG A;  4HGA A;  2V7I A;  2VQE T;  1HFA A;  2BBH A;  3I9Y A;  2WDV A;  1B7T A;  3PU8 A;  2ZM6 T;  1E7P A;  4QXC B;  3P4P A;  3WI3 A;  1MIV A;  4HWD A;  5ABG A;  2E5L T;  4QKN A;  3FZM B;  2WU2 A;  3PUA A;  5FXV A;  4MAL A;  1J5E T;  4QH1 A;  4DND A;  2P9B A;  2X68 A;  4H9S E;  3RRC A;  3IA3 A;  4G63 A;  5HEO A;  4TZ4 C;  4IHJ E;  3ZT6 A;  5FL0 A;  5HEU A;  2XAF B;  1HR0 T;  1VCS A;  5HXH A;  5LMU T;  2IW5 B;  1YW0 A;  1ZEE A;  2EHO B;  3OYX A;  3OVU A;  3ZT7 A;  4CI2 B;  3ZMZ B;  3O1I A;  4TX5 A;  1BR2 A;  3AEF A;  4CN4 A;  3C50 A;  3UUL A;  2YK0 A;  2K9A A;  2W4X A;  1E1H B;  3B13 A;  3FXD B;  5EK2 A;  3PUG A;  4ZXL A;  1AJ3 A;  3HA4 A;  3PUV F;  2WSS V;  1V9D A;  3RH3 A;  4OYJ A;  3AE6 A;  4WNK A;  4G2A A;  3QUJ A;  2XPK A;  2QVA A;  2HPJ A;  3MXZ A;  3I1A A;  5LOV E;  3O1J A;  3GN5 B;  2BDE A;  4TV8 E;  1N33 T;  4L9I A;  2Q9Q D;  3VRB A;  4NUU A;  2NTY A;  4U2Y A;  4KHP T;  2W66 A;  4X5T A;  2E9X A;  3I0Q A;  2DI4 A;  3B57 A;  5BR8 T;  4DV7 T;  2DL1 A;  4LMK A;  5IWA T;  5IUX A;  2XQA A;  2VVN A;  4XBF B;  4FJO A;  1D1A A;  2OA5 A;  2G0U A;  2QYW A;  4CN1 A;  4AQF A;  3AVS A;  4QX7 B;  2CBJ A;  2XQ9 A;  4PJN A;  1WR6 A;  3J7Y q;  2VL8 A;  5JR9 A;  2I0M A;  5AQP B;  5LNK A;  1IAP A;  1MIY A;  3RIU A;  4YLH A;  2NR4 A;  5AQN B;  3RPU A;  4C91 A;  3N9P A;  3P50 A;  4PW8 A;  3HKD E;  3PUW F;  3N9N A;  5E0O A;  4QXH B;  4ZHQ E;  3RX6 A;  5AQM B;  3X1D A;  4NUV A;  4ASK A;  4P0B A;  4KHZ F;  3O1H A;  4DVD A;  2NWB A;  1IJ5 A;  4JI0 T;  2YU1 A;  2ACX A;  3GMI A;  3CKD A;  4IDN A;  2WZI A;  1ZOY A;  2H89 A;  1LVK A;  3RHW A;  1HNX T;  4DUY T;  4WW0 A;  4HWH A;  1J5W A;  3NZQ A;  5AQF B;  4E7S A;  3ETV A;  3VKG A;  4JYA T;  2L3L A;  1UUS A;  2XQY A;  3EDU A;  4OK0 A;  1XWM A;  3FZL B;  3Q5E A;  1MMN A;  3PJA A;  4IL9 A;  4MLK A;  2V6Y A;  3LK4 2;  5JH7 E;  5LJM A;  1BR0 A;  4QH5 A;  3TKL B;  4NPP A;  3JC6 C;  4YTP A;  4F6R C;  2MAW A;  3AA7 B;  2H88 A;  5JRC A;  3EAB A;  2WY2 A;  3RC8 A;  3PUZ F;  1CUN A;  2VUR A;  1IJ6 A;  4EB6 E;  2PTF A;  2RPA A;  5HCM A;  5CFB A;  4UXN B; 
#chains in the Genus database with same CATH homology
 2JMK A;  2J1D G;  4CQI A;  5H6Q B;  3FHN A;  5EK3 A;  4QWN B;  4DMW A;  5DQV A;  3BQK A;  4AKI A;  1LKX A;  2KIN B;  4XZC A;  3N9O A;  4XAX B;  3FXE B;  4O2A E;  3FBZ A;  3EDV A;  3DP7 A;  3ZC0 A;  3ZMT B;  5LHG B;  2XAH B;  4IDZ A;  4EZH A;  1Z0P A;  2X0L B;  3AAA B;  3PUS A;  3HKE E;  5AFU L;  3RKO A;  3CX6 B;  2VWA A;  2NTX A;  2QGS A;  3ZEF B;  2LM9 A;  1HTJ F;  1UX5 A;  3PDY A;  3LBX A;  3IEE A;  3W15 B;  3K8P C;  2ZM2 A;  4U72 A;  3MK7 C;  2LEH A;  4KBM B;  4ISS A;  5TAO A;  2LSK A;  4PJJ A;  1ZHC A;  4HE8 A;  2JPF A;  2CA5 A;  2WBL A;  2Z6E A;  4DO0 A;  2DCF A;  1FMW A;  4QXB B;  1NAF A;  4GYR A;  3ZYK A;  4UF0 A;  3VKH A;  5EZY E;  4I55 E;  3J9X 1;  3KBT A;  3NZP A;  5FXX A;  3NBX X;  1WRD A;  2WMN A;  1OXZ A;  3CVR A;  4H63 H;  2VAS A;  3AAE B;  4N78 D;  4PNI A;  3UT5 E;  4P09 A;  3F57 A;  3E08 A;  5HXC A;  3ZJ1 A;  5JVD E;  3FBL A;  2H7V C;  3UUN A;  4ZI7 E;  4OFZ A;  4PK6 A;  3C4W A;  2L8K A;  4UV9 B;  4UVA B;  1NWM X;  2DWK A;  5KDM C;  5GON E;  5H6R B;  3RYF E;  5C8Y E;  3IHR A;  4CXX A;  4EZ4 A;  4PK4 A;  4ZI3 D;  1U4Q A;  2C5J A;  2Q9Q C;  3V5U A;  4DMV A;  2NP9 A;  2ODU A;  4DBR A;  2Q9Q A;  2B1E A;  2MYS A;  3MJX A;  4I43 B;  5F3J A;  3D0T A;  3LG7 A;  4L5G A;  4AKL A;  3OKQ A;  1WLX A;  4TV9 E;  3R6N A;  2EHO D;  2V1D B;  1WYB A;  1FIO A;  4O4L E;  5DQW A;  4ZI2 D;  4EYY R;  2X9Y A;  3AVR A;  4H9P C;  3CQC B;  4PFO A;  3U78 A;  1MND A;  2W0G A;  2NW7 A;  1HCI A;  3KVA A;  3HKB E;  2CEA A;  2W61 A;  2YEV C;  5DJQ C;  4QX8 B;  3PE0 A;  3UUX B;  3ONX A;  4HTE A;  4K0U A;  2X9W A;  2VK9 A;  3L3P A;  4KMC A;  4BJM A;  2XUE A;  5JDG A;  2CLY C;  3HR0 A;  3ZYM A;  2A3D A;  3O9X A;  3Q5X A;  4X20 E;  3GA8 A;  5KMG P;  2CCQ A;  4DBQ A;  3H37 A;  4UEL A;  5LG4 A;  3SRZ A;  3HL6 A;  2LSY A;  3ZMS B;  2W62 A;  5L3G B;  4GK0 E;  2SPC A;  5FY7 A;  3CML A;  4AKR B;  1YKH B;  5FY0 A;  2L9Q A;  4Z8X A;  3AA6 B;  2E8I A;  2M67 A;  1VRB A;  3E0Z A;  2CXD A;  2KND A;  1WYC A;  4PFP A;  5L3D B;  2CLY B;  5J2U E;  2UXX B;  3QC9 A;  3EVY A;  5L3C B;  5LGN B;  4E7Z A;  2NW9 A;  4O4H E;  1X79 A;  4H9Q C;  5LP6 E;  2X67 A;  3BK9 A;  3OBV E;  1HG5 A;  3OJA A;  4ZOL E;  3C4X A;  4JEH B;  4HN9 A;  4HGA A;  2V7I A;  2ODV A;  3C4Z A;  1HFA A;  3BQI A;  2NW8 A;  4UV8 B;  1QSD A;  4QHO A;  5ADX L;  3HI2 A;  5LJN A;  3I9Y A;  3RYC E;  3ANW B;  3ZJ2 A;  2D0U A;  1B7T A;  3U3I A;  3PU8 A;  5L3E B;  3E22 E;  5LGT B;  4AQG A;  3ZCI A;  3CPZ A;  4QXC B;  5JRE A;  1G8X A;  1H7C A;  3WI3 A;  2V7K A;  3GWH A;  4PK5 A;  2E9X D;  1MIV A;  2Y6X A;  4IE0 A;  2CWY A;  4QKN A;  4JUY A;  3RRW A;  1D1C A;  1SHZ C;  4EOZ B;  1US7 B;  4WBO A;  4X1Y E;  5JDL A;  4UVC B;  5JDQ A;  2VKO A;  3PUA A;  5LHI B;  1D1B A;  4H9R C;  5BMV E;  5HWX A;  2K48 A;  5FXV A;  5LBM A;  2VKD A;  2LJL A;  4IGU A;  4MAL A;  3N5L A;  4AXP A;  3AAI A;  4FI5 A;  3ZN1 B;  4U74 A;  4UVB B;  2DWG A;  5FP3 A;  4DND A;  3AB3 B;  4ZS3 A;  2H3R A;  3AA1 B;  1ZV4 X;  2P9B A;  2X68 A;  5IHY A;  4H9S E;  3N9Q A;  3RRC A;  2IC6 A;  3DJB A;  2JQQ A;  4G63 A;  5HYA A;  4TZ4 C;  5EK4 A;  3RC3 A;  3L09 A;  1MMA A;  2XHE B;  2LE8 A;  2KWI B;  3S4U A;  4IHJ E;  1BR4 A;  1SA0 E;  2XAF B;  4ADZ A;  3ZMV B;  2V26 A;  5HXS A;  5KX5 E;  1S35 A;  2WWU A;  5JR9 B;  4EYU A;  5HXH A;  3ZPO A;  2KLQ A;  2XAJ B;  2IW5 B;  4YHJ A;  3F31 A;  4ANJ A;  1YW0 A;  1ZEE A;  3KVB A;  4KP3 C;  2EHO B;  2N9D A;  2K24 A;  3OYX A;  4HKA A;  2C5I T;  2PG8 A;  4GYS A;  4CI1 B;  4CI2 B;  3ZMZ B;  3N2O A;  1S94 A;  3O1I A;  1BR2 A;  4TX5 A;  5F8P A;  1FEW A;  2LT3 A;  4AKG A;  2KXP B;  2LSI A;  5HXE A;  3Q9D A;  3IBP A;  5CB4 E;  3C98 B;  4EAH A;  2Y48 B;  3A5X A;  3C50 A;  1HS7 A;  4WBN E;  3UUL A;  1FMV A;  1HG2 A;  1OWA A;  3MAC A;  4H63 V;  1U5P A;  3UUM A;  2YK0 A;  2K9A A;  2KWH A;  1Y64 B;  4PAG A;  5JDF A;  4PJL A;  3WAJ A;  1YD8 G;  5IYZ E;  5JDN A;  1LRZ A;  3M65 A;  2ZMA A;  1MIW A;  1E1H B;  4BA9 A;  3DTO A;  4UIG A;  4EIW A;  2CWO A;  3B13 A;  2CMR A;  3FXD B;  4CZZ B;  5EK2 A;  3PUG A;  2N2N A;  3LFM A;  3OYZ A;  1AJ3 A;  3CX7 B;  3HA4 A;  2WSS V;  3KFW X;  3WAK A;  1V9D A;  3RH3 A;  4MBQ A;  4OYJ A;  3P8C D;  1T98 A;  1QUU A;  2WMO A;  2YU2 A;  3K3N A;  4WNK A;  4G2A A;  1BR1 A;  4MFR A;  1MMG A;  4HEA A;  4OHF A;  3QUJ A;  3KIN B;  2HPJ A;  3MXZ A;  2JRK A;  2K5B B;  5DAB A;  1MNE A;  3I1A A;  5LOV E;  3O1J A;  3GN5 B;  5HXR A;  2BDE A;  1O3X A;  4TV8 E;  3MZK B;  3IF8 B;  2RA1 A;  3H3A A;  4L9I A;  2Q9Q D;  3N9L A;  4NUU A;  2NTY A;  4CXY A;  2E9X C;  3N2K E;  4IST A;  3KV4 A;  2X9H A;  2E9X A;  3ANW A;  1D0Z A;  2DI4 A;  3I0Q A;  4JEU B;  3CX8 B;  3I9W A;  4H9O C;  3B57 A;  2BVM A;  3Q5W A;  2W00 A;  3N2G E;  2JMH A;  4YJ2 E;  3R84 B;  2Y8D A;  4P0A A;  5JQG E;  2CM0 A;  2LHR A;  2XAQ B;  2E9X B;  4J2C A;  2V7M A;  3HKC E;  5FNV E;  3RYI E;  3ZC1 A;  3CWZ B;  3I0O A;  3MKD A;  5LHH B;  4ZS2 A;  3AA0 B;  2I59 A;  2BZB A;  4TN7 B;  4CXW A;  2MOZ A;  1EZ3 A;  2CXL A;  4TUY E;  4MHC A;  5JDH A;  1UX4 A;  4KUM B;  4XBF B;  3NRY A;  3C64 A;  4GK5 E;  5JRC B;  4FJO A;  1D1A A;  3CQX C;  4M1P A;  4IE6 A;  2OA5 A;  3NRX A;  4O4I E;  2VKJ A;  3N9M A;  2G0U A;  2JJ9 A;  3JC6 D;  3EUH A;  2D2S A;  4AQF C;  2HH7 A;  2CE7 A;  2D5U A;  4I50 E;  4L0R A;  4AQF A;  3LJC A;  3AVS A;  4O4J E;  4QX7 B;  4ZI3 C;  5CA1 E;  5HAX A;  1HF8 A;  2WM9 A;  4PJN A;  2C0S A;  3O4X E;  1WR6 A;  3Q2M A;  2ZLY A;  5JR9 C;  2PFV A;  4C90 A;  3J7Y q;  2VL8 A;  3ZYL A;  2VB6 A;  5JR9 A;  3MA9 A;  2DHR A;  2LOP A;  2N1G A;  2EHO C;  5LNK A;  1IAP A;  1MIY A;  4OYK A;  4ZI2 C;  2HPL A;  5J2T E;  2EHO A;  4YLH A;  3P7I A;  5L2L A;  3RPU A;  4C91 A;  4YFS A;  3N9P A;  3SWH A;  4B6X A;  2PJQ A;  3KV6 A;  3KBU A;  3HKD E;  4PW8 A;  4HFV A;  3N9N A;  5E0O A;  5CA0 E;  3KV9 A;  3CQG B;  2QA7 A;  4QXH B;  3RX6 A;  4ZHQ E;  2NOX A;  3ZLI A;  1D0Y A;  2VKH A;  1G73 A;  3ESL A;  1VOM A;  3LBX B;  2H7O A;  2KMF A;  3LK3 B;  3SOL A;  3LK2 B;  3KDS E;  4NUV A;  3ZMU B;  2ES0 A;  5FY1 A;  4ASK A;  5LXT E;  4P0B A;  2LHN A;  3O1H A;  5LA6 E;  3VU7 H;  2MBG A;  4UF0 B;  4DVD A;  2NWB A;  4IE7 A;  1IJ5 A;  2BVL A;  2YU1 A;  3T8O A;  4AI6 A;  3K3O A;  3C51 A;  2X9X A;  2ZM0 A;  1YKE B;  5J1G A;  1LVF A;  2CXF A;  4O8S A;  1UCU A;  2ACX A;  2MTQ A;  3GMI A;  4GIW A;  2RP4 A;  3CKD A;  4GOU A;  4UEM A;  5FXZ A;  2GK9 A;  4CI3 B;  3ZN0 B;  4V1A v;  4ERR A;  5LGU B;  3UFE A;  5LYJ E;  2UXN B;  2X66 A;  2A72 A;  2XAG B;  5L3F B;  1LVK A;  4X1K E;  2XAS B;  4WW0 A;  1IZN B;  3QK6 A;  3GN5 A;  2LSJ A;  4PJM A;  2DLR A;  1KNZ A;  2V7L A;  4AKH A;  3NZQ A;  4A56 A;  3F2E A;  2Q9Q B;  5JDM A;  2KT9 A;  4E7S A;  3PTR B;  3ETV A;  5FYM A;  3VKG A;  4ILU A;  2ZM8 A;  2L3L A;  4IE5 A;  4I4T E;  2XQY A;  3K3Q C;  3PUQ A;  5L3B B;  5FXW A;  3EDU A;  2LSG A;  2WAU A;  4OK0 A;  1D0X A;  2XTL A;  3UTK A;  2X51 A;  4X1I E;  1HX8 A;  4EXT A;  1MMN A;  2DNX A;  3BQL A;  2IC9 A;  4MLK A;  1ZKE A;  3LK4 2;  3KV5 A;  3V5S A;  2YIN A;  4IIJ E;  3SS1 A;  3ZCJ A;  4BJN A;  5JH7 E;  5LJM A;  1BR0 A;  3TKL B;  3ETU A;  1KK7 A;  4IE4 A;  4H9N C;  1MMD A;  3JC6 C;  3VHL A;  4F6R C;  5HWY A;  2C5K T;  3AA7 B;  2LOS A;  4YJ3 E;  2IAK A;  4O2B E;  3PU3 A;  5JRC A;  2V7J A;  3PUR A;  2A2F X;  2KZ7 B;  5LBQ B;  3RC8 A;  1CUN A;  5FMN A;  3RYH E;  3FB2 A;  5LCY A;  1IJ6 A;  2W63 A;  4EB6 E;  4BAY B;  5A1L A;  5M4Y A;  2PBI A;  5ETW A;  4UXN B;  4JLE A;  2D0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...