2K48A

Nmr structure of the n-terminal coiled coil domain of the andes hantavirus nucleocapsid protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTMSTLQELQENITAHEQQLVTARQKLKDAEKAVEVDPDDVNKSTLQNRRAAVSTLETKLGELKRQLADLVAAQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the N-terminal Coiled Coil Domain of the Andes Hantavirus Nucleocapsid Protein.
pubmed doi rcsb
source organism Andes virus
molecule tags Viral protein
molecule keywords Nucleoprotein
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2k48A01
1IJ5A 2K48A 4B6XA 1QSDA 2G0UA 1LVFA 2C5IT 2X9YA 3N5LA 2C5KT 3QUJA 1Z0PA 1LRZA 1IJ6A 4J2CA 2MBGA 3QK6A 4CQIA 2KWIB 3CVRA 4DNDA 3P7IA 2X9XA 3FXEB 4EYYR 4L0RA 2X9WA 2KWHA 4FI5A 1H7CA 3CKDA 3TKLB 2IC6A 3L3PA 3FXDB 2XTLA 3MXZA 2C5JA 3S4UA 2IC9A 1ZKEA 2CA5A
chains in the Genus database with same CATH superfamily
3EAMA 3N9PA 5HWXA 3DP7A 4P0BA 5AQHB 3GMIA 2JRKA 2VWAA 4V1Av 1QSDA 3PUVF 4AKRB 4YFSA 4CZZB 1SE7A 2UUAT 5JDMA 3V5SA 2UXDT 3JAFA 5HXEA 5LGUB 2JQQA 1Y64B 5HEUA 3RHWA 4HFEA 4L9IA 2WY2A 5HCMA 4JI5T 5E0OA 1XDOA 3ANWB 3ABVA 4ZOLE 2HH7A 2PTFA 3KFWX 3NBXX 4HFVA 2ODUA 2VB6A 2X9XA 2XAGB 2YINA 3NRXA 4ISSA 4TX5A 5GONE 3FZKB 3U78A 5JREA 4DMWA 3ZC1A 2BDEA 1HFAA 1UK5A 2V6YB 2YU2A 3EABA 2CLYC 2YOEA 2LSGA 2M67A 3PURA 5AQGB 3I1AA 5CGMA 2WCAA 2X0HA 1HG2A 3AE6A 2V5CA 4K0UA 4JI8T 5JDFA 3PUQA 2KZ7B 1UCUA 5JDHA 2M6BA 1L0VA 2VQFT 2WDRA 1S94A 3PUXF 5LGTB 3T1HT 4JEHB 3UUBA 2OLTA 3Q5DA 4DUZT 5JDGA 3ONXA 2K48A 2W0GA 5L3DB 3EUHA 1XMOT 1FMWA 1Z8UA 3EVYA 4GYRA 2C5IT 2CHOA 4TWFA 4QXHB 5KX5E 2XPKA 2LM2A 5A1LA 4LF5T 2ZM8A 3BQLA 3EDUA 3K3OA 5F8PA 3AE1A 4H9OC 5FYMA 1HS7A 3C4XA 3RQUA 4YJ2E 4P09A 3AE8A 1UGOA 1CUNA 5EZYE 4QXBB 4ZS3A 3PUGA 4DIDB 4EYYR 2XM1A 4DV7T 1VCTA 2X9WA 4UVBB 3LDQB 4EAHA 1H7CA 1FMVA 5J1GA 4DMVA 4PJMA 2QYWA 3PUYF 3AAEB 3ZT5A 3KV9A 4HWCA 5LJNA 1OEDC 2RPAA 3LK2B 4CN6A 2Q9QB 3MK7C 3PUSA 4YTNA 4KUMB 1QUUA 1QLBA 2VVSA 3S4UA 1I94T 4G2AA 2XUEA 2ZM6T 3RC8A 4ZI3D 4C90A 2FJAA 2OA5A 1IJ5A 2X66A 3KVAA 3EDVA 3MKDA 2FJDA 3CX6B 5EK3A 4AISA 4DR7T 1AJ3A 3ZYLA 2QVAA 2DI4A 3AE5A 4GIWA 4GK5E 2BKPA 4AQFC 4ZI2C 4K0KT 3ONLC 4O4HE 3LK42 2V1DB 5L4HA 3UQ7A 3LJCA 1UX5A 4U2YA 3AE9A 3UQ4A 5HEJA 3PDYA 3IBPA 4PK4A 3J9X1 3Q2MA 4BAYB 3CVRA 2Q9QA 2BVMA 4X65T 1HNWT 4H9NC 3RH3A 2JMHA 3AE7A 3LG7A 3M3ZB 4EOZB 3H3MA 4JV5T 2ES0A 2ZM2A 1ZEEA 1MMNA 4HWHA 5HXCA 5BMVE 4DV6T 1D1CA 3FHNA 3L3PA 2BS3A 2CBJA 2WM9A 3RX6A 3E22E 4I50E 5AQVB 3AEDA 2K24A 4PNIA 2C5JA 2WWUA 3FZLB 4LMLA 2WMOA 4COFA 4HE8A 2X0YA 2B1EA 4FJOA 5ABFA 2IIUA 3QB5K 3NZQA 2DHRA 2XQ6A 3X1DA 3HL6A 3N9LA 1E1HB 3JCFA 1U4QA 3PJAA 4JI6T 2KMFA 2H7VC 2KNDA 3KV6A 1T8BA 3QUJA 4WBOA 4CN4A 4WZXA 3UU8A 1XWMA 5F5WA 5CFBA 5L4EA 4DV2T 3RKOA 2M6IA 3ZT6A 3E08A 3JC6D 4NIQA 2CLYB 2VKDA 4ILAA 4ISTA 1DU2A 5F3JA 4JLEA 3N9NA 2WZIA 2NW9A 1ZP0A 3F2EA 4IT4A 2CXFA 3RIUA 3SS1A 3JAEA 4HFCA 2DLRA 2UXCT 2XY8B 2MPKA 2WMNA 1N33T 2WB5A 5LG3A 1OWAA 4OK0A 3RPUA 5L2LA 4B3RT 3ESLA 3ONJA 2CMRA 5LGNB 1I6ZA 3HKEE 3P50A 3OBVE 4EB6E 4DV1T 2YDQA 2MAWA 3RYIE 4OX9T 4UXNB 1U5PA 2NR4A 1VRBA 2V7JA 4QHOA 1Z0PA 2BBHA 1JNZA 5ABGA 3AEFA 3RQWA 3ZPOA 2BG9C 2CE7A 2D0TA 2UUBT 5KMGP 2CEAA 4TNWA 3ZMUB 2CXDA 2WZHA 5LMUT 2PFVA 3UU4A 3PUAA 4JBWF 1FEWA 2NTXA 3O9XA 1R8IA 2MTQA 2KXPB 2J47A 2V6XA 3N2GE 2CBIA 3UT5E 3ZCIA 2V7LA 1T98A 2J1DG 5LBMA 3RF1A 4U31A 2J62A 2L9QA 4LMJA 4A98A 2LSYA 1YQ3A 2BG9B 5FNVE 1NWMX 4EEDA 2BBJA 2LM9A 3AEBA 2DL1A 2OV9A 1HG5A 4OYKA 3LK3B 4B6XA 1X79A 2CCQA 3SRZA 5HWYA 5L3FB 4HFIA 1JNRA 5LYJE 3CQGB 1WR0A 3N5LA 2E5VA 5LNKA 5JVDE 4AIUA 4U7IA 4LMKA 5JRCB 4X1YE 3ZMSB 2V8SV 3CPZA 2VL8A 2VASA 3KBTA 2GK9A 4KI0F 4UV8B 5LBQB 2CWYA 5FL1A 1IBLT 2E9XA 3RYFE 5J2TE 3ZN1B 4EEBA 3G06A 2XHEB 4TNVA 1KFYA 2WDVA 3MA9A 3BQKA 1V9DA 3FB2A 2ZLYA 5JH7E 4IHJE 1YW0A 2Z6EA 4HEAA 2DCFA 5H6RB 4CXWA 4IGUA 2XQ5A 3LFMA 3B5MA 2VK9A 3J7Yq 2NW7A 1S35A 4PJLA 3AA0B 2D5UA 2LSIA 2JQ9A 2XQ3A 3A5XA 3LSVA 3OPCA 4IDNA 1MIVA 4Z90A 2D0UA 5CJ5A 2PJQA 4EGWA 2J4GA 3UULA 2L3LA 3ZYMA 1HF8A 1MIWA 5IUXA 4YJ3E 5ABFB 2MYSA 3AXJA 3IF8B 3ZN0B 5HCJA 4HFBA 4TWDA 3RC3A 2YK0A 5L3GB 3TLSA 2W4XA 4JI2T 4P0AA 2XQYA 2A3DA 4H63V 1XDPA 2CRBA 3I0QA 2A2FX 1IZNB 4CI2B 3P4PA 4M1PA 3CIRA 3HR0A 1D0ZA 2QRXA 3AB3B 1BR4A 3AAIA 2WU5A 3K3NA 4AKGA 5BR8T 1XNRT 2BS2A 1KK7A 3ZSTA 4HN9A 2YU1A 4XBFB 5ABHA 1WFDA 5FXXA 3C51A 3ZMVB 4JEUB 3NWIA 4NUUA 4WYVA 1ZKEA 3C98B 3RIFA 1J5ET 2CA5A 1SHZC 3ZT7A 4EYUA 3AVSA 2LT3A 3ETVA 3N9OA 1X9BA 2QA7A 3KBUA 4KX6A 4MHCA 4WW0A 1Y01A 1MMGA 1N34T 2Y48B 4KHPT 5FL0A 4OFZA 4PJNA 4A5XA 4I4TE 4A56A 2EHOD 2ACXA 3O4XE 3JC6C 3GWHA 2CXLA 5ADXL 4ADZA 2Q9QC 1HNZT 2LOSA 4DR1T 2XQ7A 3P8CD 4ZZCA 2CWOA 4GOUA 5ETWA 3ZYKA 5L3BB 2NW8A 4AKLA 3P7IA 4X62T 3ZJ1A 3N2KE 3SFDA 2WS3A 5KXJA 4MFRA 4X64T 2A72A 3OJAA 4B3ST 1D0YA 1HNXT 2H3RA 4U72A 3RYCE 1D1AA 4ILCA 3TKLB 1VCSA 4E7SA 2BVLA 2YEVC 3TLWA 4Q25A 4HWDA 4MALA 4AI6A 3KDSE 2SPCA 4OYJA 5JTGA 4DR4T 2HN1A 3AEAA 4H9RC 4KBMB 4PAGA 4DBQA 3SWHA 4UELA 1HX1B 1KNZA 3O1HA 5DJQC 2KSRA 1WLXA 1YKHB 4DV4T 1IBMT 2UU9T 2C5KT 1MNDA 3AE2A 3CK6A 5KDMC 4YSZA 1CHUA 2XQ9A 4X5TA 1OXZA 4IL9A 2BS4A 4TN7B 3OVUA 4IDOA 4QH1A 3L8RA 1OEDE 2XZEA 2MBGA 2I59A 5EK4A 5FVKA 1G8XA 1J1JA 1YD8G 2H7OA 2VKJA 4GYSA 1MIYA 2BKOA 3CQXC 4ILBA 4CN1A 4EZHA 5J0ZA 4EZ4A 4QWNB 1WYBA 3I0OA 1MMAA 2RA1A 3JADA 3KINB 3H37A 3HKBE 2FUPA 4U33A 2JQHA 4U2ZA 3PUZF 5AQUB 4AKIA 3AECA 3VKHA 2C0SA 3N2OA 5AQKB 5LOVE 2HHHT 5HYAA 3I9YA 1LKXA 4DR5T 3MXZA 2UUCT 4B3TT 3GN5B 4LFBT 5FVLA 1M7KA 4EXTA 1SA0E 5LHIB 3IEEA 2LOPA 2X68A 4ILUA 3FBZA 2CHNA 4OHFA 4YLHA 5AQPB 3B57A 5AQQB 5H6QB 2WQYA 4O8SA 4JUYA 5LCYA 3OYXA 3PU3A 3VRBA 4YXDA 2XAJB 2W2UA 3PV0F 4YSXA 3N9MA 2WBLA 5DQWA 2IW5B 2V26A 4I0UA 3ZEFB 2WU2A 1NEKA 3KV5A 4LF7T 2DNXA 4O2BE 4NUVA 3GA8A 2P9BA 3NVOA 1IJ6A 2LE8A 4IREA 4L5GA 2IMLA 2W67A 2XQ4A 4IE6A 4JYAT 2R6GF 3UU3A 1KNRA 2IAKA 3UUMA 3ZLIA 5LB7B 3P4WA 3IHRA 2KWHA 4FI5A 4GK0E 4UV9B 1HX8A 2ZMAA 3BQIA 4PK6A 5CB4E 2CM0A 3FXDB 3ZSSA 4YTPA 4DV5T 3UFGA 1ZOYA 3FBLA 4IE7A 2HPJA 2IC9A 5JR9C 3K8PC 2RP4A 1NENA 3AE4A 3I9WA 2IDOB 2LKGA 3K1SA 3ZKRA 3P4RA 2ZM0A 5FMNA 2DWKA 2JIWA 1XZYA 2WP9A 3LBXA 3NRYA 3NZPA 4HTEA 4QH5A 3VRAA 4LF4T 3CX8B 2LLYA 2X9YA 2WAUA 3CMLA 3LBXB 5DABA 4AQYT 1ZV4X 3SFEA 3VKGA 2NP9A 1KNPA 2CPTA 4QXCB 4ASKA 2X51A 3RKGA 4AKHA 4UR9A 5LHGB 2E5LT 4CI3B 2XSAA 3MZKB 4B3MT 1OEDA 2UXXB 5FXVA 3AA6B 5FY1A 2AXDS 5C8YE 3PJAJ 5IWAT 4LFCT 3GN5A 4ZI3C 1FJGT 4X66T 5HEGA 3ZMTB 2N9DA 2IC6A 2PBIA 3TLVA 5LHHB 1T72A 1KEYA 2X0LB 2XTLA 5AQJB 2W62A 3FZFB 1SUMB 4IDZA 2A9UA 3UU5A 2XASB 1O3XA 3PTRB 3H3AA 3O1IA 2LSKA 2KINB 4DBRA 4N78D 3HA4A 3ANWA 4GKJT 3NKZA 4KHZF 4DR6T 3AVRA 2VVNA 3C4WA 3RRCA 1HCIA 4DV0T 5L3EB 3QK6A 1WYCA 3D0TA 2I6HA 2VKOA 4CQIA 2LHNA 3AE3A 5HXRA 4ZI7E 1EZ3A 4LFAT 1UX4A 4HWIB 4JI0T 4BJMA 5FXZA 3KV4A 4UVCB 2WWVA 3P4SA 3Q5XA 5HAXA 4O4IE 3R84B 2V6YA 3IA3A 5HEHA 5IYZE 3F31A 5AQTB 4ZXLA 4YT0A 3QB5A 4PFPA 5AQMB 1YQ4A 2XQ8A 4JI3T 4YHHT 3HI2A 5JRCA 3UUXB 2K5BB 2LRKA 2N1GA 1VOMA 1D1BA 4QKNA 3T8OA 4ZZBA 2WSSV 2XSBA 3C50A 4U7YA 4C91A 3C4ZA 2UXBT 2JMKA 3TLUA 2XAFB 5IHYA 3R6NA 3QOFA 3UTKA 3HKDE 2LSJA 2W61A 1LVFA 3L09A 4UF0B 2W00A 1YXRA 2XM2A 5JR9A 1YKEB 2Q9QD 2ACZA 2JJ9A 1M62A 2E9XB 2BZBA 2FJEA 5AQSB 5TAOA 3RIAA 4O2AE 3B13A 2YDRA 2B76A 2KT9A 3Q5WA 4MBQA 4PW8A 3RYHE 4JI4T 4XAXB 2L8KA 1WR6A 1W0BA 4JI7T 4I43B 5FY0A 2EHOB 4TZ4C 4HGAA 4BJNA 4X1KE 4E7ZA 1B7TA 2E9XC 3CX7B 4HFHA 4LF6T 4UF0A 1BR1A 2W66A 2FBWA 3BK9A 2V7MA 4AXPA 2QGSA 5LMNT 4YTMA 4DR3T 4O4LE 4PJJA 4U3CA 4X1IE 3RGLA 4DV3T 2BG9A 4YHJA 2N2NA 4AQGA 1US7B 4CXYA 3C64A 3WAKA 3A7MA 4ZEYA 5CA1E 3TLTA 1D0XA 1MNEA 2YN6A 5HEOA 5LJMA 5AQOB 1XNQT 5EK2A 3OKQA 2UXNB 4IDQA 5LA6E 4NXNT 1BR0A 1KF6A 4HFDA 4IDPA 2AE9A 4HKAA 4J2CA 4G63A 4AQFA 2NWBA 3WAJA 5JDNA 1N36T 4JI1T 5HXHA 3EI0A 1ZHCA 3VR9A 4F8HA 2PG8A 2BKNA 1W0AA 2LKHA 4P1NA 4PK5A 4LF8T 3W15B 4DO0A 5LP6E 2ODVA 3PU8A 4IE4A 4F6RC 4TV8E 1E2AA 4WBNE 3FZMB 1N32T 4IIJE 4GKKT 2X67A 5FXWA 5JDQA 3L39A 2D2SA 4KP3C 4YY3T 2JPFA 4ERRA 1MMDA 4EIWA 4CXXA 1IBKT 4TV9E 2BG9E 2E9XD 3DTOA 4LF9T 2LEHA 3VU7H 4NPPA 5JQGE 3VHLA 3OYZA 4IE5A 3AEEA 3O1JA 4UIGA 4XZCA 3ZJ2A 3QNUA 2G0UA 1W09A 2KLQA 4IL4A 4ZI2D 3AXJB 2WDQA 4O4JE 2JQKA 3AA1B 5L3CB 4I55E 3DJBA 2D9DA 5AQRB 2LRLA 5FKYA 4DVDA 3T1YT 5C2TA 1LRZA 2MOZA 2VQET 3N9QA 2IHR1 5AQLB 4YSYA 4UVAB 3P4QA 3PUWF 3E0ZA 3MACA 2V5DA 2Y6XA 4TUYE 5DQVA 4DNDA 2X9HA 3K3QC 2V7KA 1GQEA 1LVKA 2HPLA 1J5WA 2XJ7A 3CWZB 1NAFA 4H9SE 2XQAA 4IE0A 4PFOA 2VL0A 4H63H 4TWHA 3OTOT 1FIOA 3VR8A 5FY7A 1WCRA 3CKDA 3F57A 2YKSA 1BR2A 4BA9A 2F4VT 1W9RA 3MJXA 3RLFF 4HWFA 2E2AA 2LJLA 4Z91A 1E7PA 5FP3A 2HN2A 4KMCA 3RIUC 3U3IA 3RI5A 2NTYA 3ZC0A 3UFEA 5JDLA 3FZHB 3PE0A 4MLKA 3QC9A 2V7IA 5L47A 5AQIB 2YDSA 1XMQT 4Z8XA 3ZMZB 5LG4A 5CA0E 4H9PC 3UU6A 2E8IA 2K3WA 2Y8DA 3HKCE 4ZS2A 3CQCB 2NOXA 2XAHB 3V5UA 5C3JA 5JR9B 5LXTE 2DWGA 4DR2T 5HXSA 2LHRA 1OEDB 4DUYT 2VURA 5AQNB 4A97A 2H88A 1UURA 2KWIB 2VKHA 3M65A 4UEMA 1IAPA 4WNKA 4EV6A 4ZHQE 2W63A 3A8YC 2H89A 2I0MA 3FXEB 4X20E 4QX7B 3Q9DA 2EHOC 3ZCJA 4L0RA 2XAQB 2EHOA 3AA7B 3KVBA 3Q5EA 3WI3A 2K9AA 3SOLA 1UUSA 2IUBA 1HTJF 4CI1B 1WRDA 3EHZA 3AEGA 4U74A 5ABEA 4NXMT 3AAAB 1T7SA 1G73A 4ANJA 3RRWA 3UUNA 5AQFB 1HR0T 4QH4A 4H9QC 3ETUA 5AFUL 4QX8B 5J2UE 5M4YA 2FJBA
chains in the Genus database with same CATH topology
3N9PA 5HWXA 3DP7A 4P0BA 4AKRB 3GMIA 2JRKA 2VWAA 4V1Av 1QSDA 4CZZB 4YFSA 5JDMA 3V5SA 5HXEA 2JQQA 1Y64B 4L9IA 5E0OA 3ANWB 4ZOLE 2HH7A 3KFWX 3NBXX 4HFVA 2ODUA 2VB6A 2X9XA 2XAGB 2YINA 3NRXA 4ISSA 4TX5A 5GONE 3U78A 5JREA 4DMWA 3ZC1A 2BDEA 1HFAA 2YU2A 2CLYC 2LSGA 2M67A 3PURA 3I1AA 1HG2A 4K0UA 5JDFA 3PUQA 2KZ7B 1UCUA 5JDHA 5LGTB 1S94A 4JEHB 5JDGA 3ONXA 2K48A 2W0GA 5L3DB 3EUHA 1FMWA 4GYRA 3EVYA 5KX5E 2C5IT 4QXHB 5A1LA 2ZM8A 3BQLA 3EDUA 3K3OA 5F8PA 4H9OC 5FYMA 1HS7A 3C4XA 4YJ2E 4P09A 1CUNA 5EZYE 4QXBB 4ZS3A 3PUGA 4EYYR 2X9WA 4UVBB 4EAHA 1H7CA 1FMVA 5J1GA 4DMVA 4PJMA 3AAEB 3KV9A 5LJNA 3LK2B 2Q9QB 3MK7C 3PUSA 4KUMB 1QUUA 3S4UA 4G2AA 2XUEA 3RC8A 4ZI3D 4C90A 2X66A 2OA5A 1IJ5A 3KVAA 3MKDA 3EDVA 5EK3A 3CX6B 1AJ3A 3ZYLA 4GIWA 2DI4A 4AQFC 4GK5E 4ZI2C 4O4HE 3LK42 2V1DB 3LJCA 1UX5A 3PDYA 3IBPA 4PK4A 3J9X1 3Q2MA 4BAYB 3CVRA 2Q9QA 2BVMA 4H9NC 3RH3A 2JMHA 3LG7A 4EOZB 2ES0A 2ZM2A 1ZEEA 1MMNA 5HXCA 5BMVE 1D1CA 3FHNA 3L3PA 2WM9A 3RX6A 3E22E 4I50E 2K24A 4PNIA 2C5JA 2WWUA 2WMOA 4HE8A 2B1EA 4FJOA 3NZQA 2DHRA 3HL6A 3N9LA 1E1HB 1U4QA 2KMFA 2H7VC 2KNDA 3KV6A 3QUJA 4WBOA 3RKOA 3E08A 3JC6D 2CLYB 2VKDA 4ISTA 5F3JA 4JLEA 3N9NA 2NW9A 3F2EA 3SS1A 2CXFA 2DLRA 2WMNA 1OWAA 4OK0A 3RPUA 5L2LA 3ESLA 5LGNB 2CMRA 3HKEE 3OBVE 4EB6E 3RYIE 4UXNB 1U5PA 1VRBA 2V7JA 4QHOA 1Z0PA 3ZPOA 2CE7A 2D0TA 5KMGP 2CEAA 3ZMUB 2CXDA 2PFVA 3PUAA 1FEWA 2NTXA 3O9XA 2MTQA 2KXPB 3UT5E 3N2GE 3ZCIA 2V7LA 1T98A 2J1DG 5LBMA 2L9QA 2LSYA 5FNVE 1NWMX 2LM9A 1HG5A 4OYKA 3LK3B 4B6XA 1X79A 2CCQA 3SRZA 5HWYA 5L3FB 5LYJE 3CQGB 3N5LA 5LNKA 5JVDE 5JRCB 4X1YE 3ZMSB 3CPZA 2VL8A 2VASA 3KBTA 2GK9A 4UV8B 5LBQB 2CWYA 2E9XA 3RYFE 5J2TE 3ZN1B 2XHEB 3MA9A 3BQKA 1V9DA 3FB2A 2ZLYA 5JH7E 4IHJE 1YW0A 2Z6EA 4HEAA 2DCFA 5H6RB 3J7Yq 4IGUA 3LFMA 2VK9A 2NW7A 1S35A 4PJLA 3AA0B 2D5UA 2LSIA 3A5XA 1MIVA 2D0UA 2PJQA 3UULA 2L3LA 3ZYMA 1HF8A 1MIWA 4YJ3E 2MYSA 3IF8B 3ZN0B 3RC3A 2YK0A 5L3GB 4P0AA 2XQYA 2A3DA 4H63V 3I0QA 2A2FX 1IZNB 4CI2B 4M1PA 3HR0A 1D0ZA 3AB3B 1BR4A 3AAIA 3K3NA 4AKGA 1KK7A 4HN9A 2YU1A 5FXXA 3C51A 3ZMVB 4JEUB 4NUUA 1ZKEA 3C98B 2CA5A 1SHZC 4EYUA 3AVSA 2LT3A 3ETVA 3N9OA 2QA7A 3KBUA 4MHCA 4WW0A 1MMGA 2Y48B 4OFZA 4PJNA 4I4TE 4A56A 2EHOD 2ACXA 3O4XE 3JC6C 3GWHA 2CXLA 5ADXL 4ADZA 2Q9QC 2LOSA 3P8CD 2CWOA 4GOUA 5ETWA 3ZYKA 5L3BB 2NW8A 4AKLA 3P7IA 3ZJ1A 3N2KE 4MFRA 2A72A 3OJAA 1D0YA 2H3RA 4U72A 3RYCE 1D1AA 3TKLB 4E7SA 2BVLA 2YEVC 4MALA 4AI6A 3KDSE 2SPCA 4OYJA 4H9RC 4KBMB 4PAGA 4DBQA 3SWHA 4UELA 1KNZA 3O1HA 5DJQC 1WLXA 1YKHB 2C5KT 1MNDA 5KDMC 1OXZA 4TN7B 2MBGA 2I59A 5EK4A 1G8XA 1YD8G 2H7OA 2VKJA 4GYSA 1MIYA 3CQXC 4EZHA 4EZ4A 4QWNB 1WYBA 3I0OA 1MMAA 2RA1A 3KINB 3H37A 3HKBE 4AKIA 3VKHA 2C0SA 3N2OA 5LOVE 5HYAA 3I9YA 1LKXA 3MXZA 3GN5B 5LHIB 4EXTA 1SA0E 3IEEA 2LOPA 2X68A 4ILUA 3FBZA 4OHFA 5H6QB 4YLHA 5LCYA 3B57A 4O8SA 4JUYA 3OYXA 3PU3A 2XAJB 3N9MA 2WBLA 5DQWA 2IW5B 2V26A 3ZEFB 3KV5A 2DNXA 4O2BE 4NUVA 3GA8A 2P9BA 4L5GA 1IJ6A 2LE8A 4IE6A 2IAKA 3UUMA 3ZLIA 3IHRA 2KWHA 4FI5A 4GK0E 4UV9B 1HX8A 2ZMAA 3BQIA 4PK6A 5CB4E 2CM0A 3FXDB 3FBLA 4IE7A 2HPJA 2IC9A 5JR9C 3K8PC 2RP4A 3I9WA 2ZM0A 5FMNA 2DWKA 3LBXA 3NRYA 4HTEA 3NZPA 3CX8B 2X9YA 3CMLA 2WAUA 3LBXB 5DABA 1ZV4X 3VKGA 2NP9A 4QXCB 4ASKA 2X51A 4AKHA 5LHGB 4CI3B 3MZKB 2UXXB 5FXVA 3AA6B 5FY1A 5C8YE 3GN5A 4ZI3C 3ZMTB 2N9DA 2IC6A 2PBIA 5LHHB 2X0LB 2XTLA 2W62A 4IDZA 2XASB 1O3XA 3PTRB 3H3AA 3O1IA 2LSKA 2KINB 4DBRA 4N78D 3HA4A 3ANWA 3AVRA 3RRCA 3C4WA 1HCIA 5L3EB 3QK6A 1WYCA 3D0TA 2VKOA 4CQIA 4ZI7E 2LHNA 5HXRA 1EZ3A 1UX4A 4BJMA 5FXZA 3KV4A 4UVCB 5HAXA 3Q5XA 3R84B 4O4IE 5IYZE 3F31A 4PFPA 3HI2A 5JRCA 3UUXB 2K5BB 2N1GA 4QKNA 1VOMA 1D1BA 3T8OA 2WSSV 3C50A 4C91A 3C4ZA 2JMKA 2XAFB 5IHYA 3R6NA 3UTKA 3HKDE 2LSJA 2W61A 1LVFA 3L09A 4UF0B 2W00A 5JR9A 1YKEB 2Q9QD 2JJ9A 4CXWA 2E9XB 4XBFB 2BZBA 5TAOA 4O2AE 3B13A 2KT9A 3Q5WA 4MBQA 4PW8A 3RYHE 4XAXB 2L8KA 1WR6A 4I43B 5FY0A 2EHOB 4TZ4C 4HGAA 4BJNA 4X1KE 4E7ZA 1B7TA 2E9XC 3CX7B 4UF0A 1BR1A 3BK9A 2V7MA 4AXPA 2QGSA 4O4LE 4PJJA 4X1IE 4YHJA 2N2NA 4AQGA 1US7B 4CXYA 3C64A 3WAKA 5CA1E 1D0XA 1MNEA 5LJMA 5EK2A 3OKQA 2UXNB 5LA6E 1BR0A 4AQFA 3WAJA 4HKAA 4J2CA 4G63A 2NWBA 5JDNA 5HXHA 1ZHCA 2PG8A 3W15B 4PK5A 5LP6E 4DO0A 2ODVA 3PU8A 4IE4A 4F6RC 4TV8E 4WBNE 4IIJE 2X67A 5FXWA 5JDQA 2D2SA 4KP3C 2JPFA 4ERRA 1MMDA 4EIWA 4CXXA 4TV9E 2E9XD 3DTOA 2LEHA 3VU7H 5JQGE 3VHLA 3OYZA 4IE5A 3O1JA 4UIGA 4XZCA 3ZJ2A 2G0UA 2KLQA 4O4JE 5L3CB 5LGUB 3AA1B 4I55E 3DJBA 4DVDA 1LRZA 2MOZA 3N9QA 4UVAB 3E0ZA 3MACA 2Y6XA 4TUYE 5DQVA 4DNDA 2X9HA 3K3QC 2V7KA 1LVKA 2HPLA 3CWZB 4IE0A 4H9SE 4PFOA 1NAFA 4ZI2D 4H63H 1FIOA 5FY7A 3CKDA 3F57A 1BR2A 4BA9A 3MJXA 2LJLA 5FP3A 3U3IA 4KMCA 3ZC0A 2NTYA 3UFEA 5JDLA 3PE0A 4MLKA 3QC9A 2V7IA 4Z8XA 3ZMZB 5LG4A 5CA0E 4H9PC 2E8IA 2Y8DA 3HKCE 4ZS2A 3CQCB 2NOXA 2XAHB 3V5UA 5JR9B 5LXTE 2DWGA 5HXSA 2LHRA 2VKHA 2KWIB 3M65A 4UEMA 4WNKA 1IAPA 4ZHQE 2W63A 4X20E 3FXEB 4QX7B 3Q9DA 2EHOC 3ZCJA 4L0RA 2XAQB 2EHOA 3AA7B 3KVBA 3WI3A 2K9AA 3SOLA 1HTJF 4CI1B 1WRDA 4U74A 3AAAB 1G73A 4ANJA 3RRWA 3UUNA 4H9QC 3ETUA 5AFUL 4QX8B 5J2UE 5M4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  2K48 A;  4B6X A;  1QSD A;  2G0U A;  1LVF A;  2C5I T;  2X9Y A;  3N5L A;  2C5K T;  3QUJ A;  1Z0P A;  1LRZ A;  1IJ6 A;  4J2C A;  2MBG A;  3QK6 A;  4CQI A;  2KWI B;  3CVR A;  4DND A;  3P7I A;  2X9X A;  3FXE B;  4EYY R;  4L0R A;  2X9W A;  2KWH A;  4FI5 A;  1H7C A;  3CKD A;  3TKL B;  2IC6 A;  3L3P A;  3FXD B;  2XTL A;  3MXZ A;  2C5J A;  3S4U A;  2IC9 A;  1ZKE A;  2CA5 A; 
#chains in the Genus database with same CATH topology
 3EAM A;  3N9P A;  5HWX A;  3DP7 A;  4P0B A;  5AQH B;  3GMI A;  2JRK A;  2VWA A;  4V1A v;  1QSD A;  3PUV F;  4AKR B;  4YFS A;  4CZZ B;  1SE7 A;  2UUA T;  5JDM A;  3V5S A;  2UXD T;  3JAF A;  5HXE A;  5LGU B;  2JQQ A;  1Y64 B;  5HEU A;  3RHW A;  4HFE A;  4L9I A;  2WY2 A;  5HCM A;  4JI5 T;  5E0O A;  1XDO A;  3ANW B;  3ABV A;  4ZOL E;  2HH7 A;  2PTF A;  3KFW X;  3NBX X;  4HFV A;  2ODU A;  2VB6 A;  2X9X A;  2XAG B;  2YIN A;  3NRX A;  4ISS A;  4TX5 A;  5GON E;  3FZK B;  3U78 A;  5JRE A;  4DMW A;  3ZC1 A;  2BDE A;  1HFA A;  1UK5 A;  2V6Y B;  2YU2 A;  3EAB A;  2CLY C;  2YOE A;  2LSG A;  2M67 A;  3PUR A;  5AQG B;  3I1A A;  5CGM A;  2WCA A;  2X0H A;  1HG2 A;  3AE6 A;  2V5C A;  4K0U A;  4JI8 T;  5JDF A;  3PUQ A;  2KZ7 B;  1UCU A;  5JDH A;  2M6B A;  1L0V A;  2VQF T;  2WDR A;  1S94 A;  3PUX F;  5LGT B;  3T1H T;  4JEH B;  3UUB A;  2OLT A;  3Q5D A;  4DUZ T;  5JDG A;  3ONX A;  2K48 A;  2W0G A;  5L3D B;  3EUH A;  1XMO T;  1FMW A;  1Z8U A;  3EVY A;  4GYR A;  2C5I T;  2CHO A;  4TWF A;  4QXH B;  5KX5 E;  2XPK A;  2LM2 A;  5A1L A;  4LF5 T;  2ZM8 A;  3BQL A;  3EDU A;  3K3O A;  5F8P A;  3AE1 A;  4H9O C;  5FYM A;  1HS7 A;  3C4X A;  3RQU A;  4YJ2 E;  4P09 A;  3AE8 A;  1UGO A;  1CUN A;  5EZY E;  4QXB B;  4ZS3 A;  3PUG A;  4DID B;  4EYY R;  2XM1 A;  4DV7 T;  1VCT A;  2X9W A;  4UVB B;  3LDQ B;  4EAH A;  1H7C A;  1FMV A;  5J1G A;  4DMV A;  4PJM A;  2QYW A;  3PUY F;  3AAE B;  3ZT5 A;  3KV9 A;  4HWC A;  5LJN A;  1OED C;  2RPA A;  3LK2 B;  4CN6 A;  2Q9Q B;  3MK7 C;  3PUS A;  4YTN A;  4KUM B;  1QUU A;  1QLB A;  2VVS A;  3S4U A;  1I94 T;  4G2A A;  2XUE A;  2ZM6 T;  3RC8 A;  4ZI3 D;  4C90 A;  2FJA A;  2OA5 A;  1IJ5 A;  2X66 A;  3KVA A;  3EDV A;  3MKD A;  2FJD A;  3CX6 B;  5EK3 A;  4AIS A;  4DR7 T;  1AJ3 A;  3ZYL A;  2QVA A;  2DI4 A;  3AE5 A;  4GIW A;  4GK5 E;  2BKP A;  4AQF C;  4ZI2 C;  4K0K T;  3ONL C;  4O4H E;  3LK4 2;  2V1D B;  5L4H A;  3UQ7 A;  3LJC A;  1UX5 A;  4U2Y A;  3AE9 A;  3UQ4 A;  5HEJ A;  3PDY A;  3IBP A;  4PK4 A;  3J9X 1;  3Q2M A;  4BAY B;  3CVR A;  2Q9Q A;  2BVM A;  4X65 T;  1HNW T;  4H9N C;  3RH3 A;  2JMH A;  3AE7 A;  3LG7 A;  3M3Z B;  4EOZ B;  3H3M A;  4JV5 T;  2ES0 A;  2ZM2 A;  1ZEE A;  1MMN A;  4HWH A;  5HXC A;  5BMV E;  4DV6 T;  1D1C A;  3FHN A;  3L3P A;  2BS3 A;  2CBJ A;  2WM9 A;  3RX6 A;  3E22 E;  4I50 E;  5AQV B;  3AED A;  2K24 A;  4PNI A;  2C5J A;  2WWU A;  3FZL B;  4LML A;  2WMO A;  4COF A;  4HE8 A;  2X0Y A;  2B1E A;  4FJO A;  5ABF A;  2IIU A;  3QB5 K;  3NZQ A;  2DHR A;  2XQ6 A;  3X1D A;  3HL6 A;  3N9L A;  1E1H B;  3JCF A;  1U4Q A;  3PJA A;  4JI6 T;  2KMF A;  2H7V C;  2KND A;  3KV6 A;  1T8B A;  3QUJ A;  4WBO A;  4CN4 A;  4WZX A;  3UU8 A;  1XWM A;  5F5W A;  5CFB A;  5L4E A;  4DV2 T;  3RKO A;  2M6I A;  3ZT6 A;  3E08 A;  3JC6 D;  4NIQ A;  2CLY B;  2VKD A;  4ILA A;  4IST A;  1DU2 A;  5F3J A;  4JLE A;  3N9N A;  2WZI A;  2NW9 A;  1ZP0 A;  3F2E A;  4IT4 A;  2CXF A;  3RIU A;  3SS1 A;  3JAE A;  4HFC A;  2DLR A;  2UXC T;  2XY8 B;  2MPK A;  2WMN A;  1N33 T;  2WB5 A;  5LG3 A;  1OWA A;  4OK0 A;  3RPU A;  5L2L A;  4B3R T;  3ESL A;  3ONJ A;  2CMR A;  5LGN B;  1I6Z A;  3HKE E;  3P50 A;  3OBV E;  4EB6 E;  4DV1 T;  2YDQ A;  2MAW A;  3RYI E;  4OX9 T;  4UXN B;  1U5P A;  2NR4 A;  1VRB A;  2V7J A;  4QHO A;  1Z0P A;  2BBH A;  1JNZ A;  5ABG A;  3AEF A;  3RQW A;  3ZPO A;  2BG9 C;  2CE7 A;  2D0T A;  2UUB T;  5KMG P;  2CEA A;  4TNW A;  3ZMU B;  2CXD A;  2WZH A;  5LMU T;  2PFV A;  3UU4 A;  3PUA A;  4JBW F;  1FEW A;  2NTX A;  3O9X A;  1R8I A;  2MTQ A;  2KXP B;  2J47 A;  2V6X A;  3N2G E;  2CBI A;  3UT5 E;  3ZCI A;  2V7L A;  1T98 A;  2J1D G;  5LBM A;  3RF1 A;  4U31 A;  2J62 A;  2L9Q A;  4LMJ A;  4A98 A;  2LSY A;  1YQ3 A;  2BG9 B;  5FNV E;  1NWM X;  4EED A;  2BBJ A;  2LM9 A;  3AEB A;  2DL1 A;  2OV9 A;  1HG5 A;  4OYK A;  3LK3 B;  4B6X A;  1X79 A;  2CCQ A;  3SRZ A;  5HWY A;  5L3F B;  4HFI A;  1JNR A;  5LYJ E;  3CQG B;  1WR0 A;  3N5L A;  2E5V A;  5LNK A;  5JVD E;  4AIU A;  4U7I A;  4LMK A;  5JRC B;  4X1Y E;  3ZMS B;  2V8S V;  3CPZ A;  2VL8 A;  2VAS A;  3KBT A;  2GK9 A;  4KI0 F;  4UV8 B;  5LBQ B;  2CWY A;  5FL1 A;  1IBL T;  2E9X A;  3RYF E;  5J2T E;  3ZN1 B;  4EEB A;  3G06 A;  2XHE B;  4TNV A;  1KFY A;  2WDV A;  3MA9 A;  3BQK A;  1V9D A;  3FB2 A;  2ZLY A;  5JH7 E;  4IHJ E;  1YW0 A;  2Z6E A;  4HEA A;  2DCF A;  5H6R B;  4CXW A;  4IGU A;  2XQ5 A;  3LFM A;  3B5M A;  2VK9 A;  3J7Y q;  2NW7 A;  1S35 A;  4PJL A;  3AA0 B;  2D5U A;  2LSI A;  2JQ9 A;  2XQ3 A;  3A5X A;  3LSV A;  3OPC A;  4IDN A;  1MIV A;  4Z90 A;  2D0U A;  5CJ5 A;  2PJQ A;  4EGW A;  2J4G A;  3UUL A;  2L3L A;  3ZYM A;  1HF8 A;  1MIW A;  5IUX A;  4YJ3 E;  5ABF B;  2MYS A;  3AXJ A;  3IF8 B;  3ZN0 B;  5HCJ A;  4HFB A;  4TWD A;  3RC3 A;  2YK0 A;  5L3G B;  3TLS A;  2W4X A;  4JI2 T;  4P0A A;  2XQY A;  2A3D A;  4H63 V;  1XDP A;  2CRB A;  3I0Q A;  2A2F X;  1IZN B;  4CI2 B;  3P4P A;  4M1P A;  3CIR A;  3HR0 A;  1D0Z A;  2QRX A;  3AB3 B;  1BR4 A;  3AAI A;  2WU5 A;  3K3N A;  4AKG A;  5BR8 T;  1XNR T;  2BS2 A;  1KK7 A;  3ZST A;  4HN9 A;  2YU1 A;  4XBF B;  5ABH A;  1WFD A;  5FXX A;  3C51 A;  3ZMV B;  4JEU B;  3NWI A;  4NUU A;  4WYV A;  1ZKE A;  3C98 B;  3RIF A;  1J5E T;  2CA5 A;  1SHZ C;  3ZT7 A;  4EYU A;  3AVS A;  2LT3 A;  3ETV A;  3N9O A;  1X9B A;  2QA7 A;  3KBU A;  4KX6 A;  4MHC A;  4WW0 A;  1Y01 A;  1MMG A;  1N34 T;  2Y48 B;  4KHP T;  5FL0 A;  4OFZ A;  4PJN A;  4A5X A;  4I4T E;  4A56 A;  2EHO D;  2ACX A;  3O4X E;  3JC6 C;  3GWH A;  2CXL A;  5ADX L;  4ADZ A;  2Q9Q C;  1HNZ T;  2LOS A;  4DR1 T;  2XQ7 A;  3P8C D;  4ZZC A;  2CWO A;  4GOU A;  5ETW A;  3ZYK A;  5L3B B;  2NW8 A;  4AKL A;  3P7I A;  4X62 T;  3ZJ1 A;  3N2K E;  3SFD A;  2WS3 A;  5KXJ A;  4MFR A;  4X64 T;  2A72 A;  3OJA A;  4B3S T;  1D0Y A;  1HNX T;  2H3R A;  4U72 A;  3RYC E;  1D1A A;  4ILC A;  3TKL B;  1VCS A;  4E7S A;  2BVL A;  2YEV C;  3TLW A;  4Q25 A;  4HWD A;  4MAL A;  4AI6 A;  3KDS E;  2SPC A;  4OYJ A;  5JTG A;  4DR4 T;  2HN1 A;  3AEA A;  4H9R C;  4KBM B;  4PAG A;  4DBQ A;  3SWH A;  4UEL A;  1HX1 B;  1KNZ A;  3O1H A;  5DJQ C;  2KSR A;  1WLX A;  1YKH B;  4DV4 T;  1IBM T;  2UU9 T;  2C5K T;  1MND A;  3AE2 A;  3CK6 A;  5KDM C;  4YSZ A;  1CHU A;  2XQ9 A;  4X5T A;  1OXZ A;  4IL9 A;  2BS4 A;  4TN7 B;  3OVU A;  4IDO A;  4QH1 A;  3L8R A;  1OED E;  2XZE A;  2MBG A;  2I59 A;  5EK4 A;  5FVK A;  1G8X A;  1J1J A;  1YD8 G;  2H7O A;  2VKJ A;  4GYS A;  1MIY A;  2BKO A;  3CQX C;  4ILB A;  4CN1 A;  4EZH A;  5J0Z A;  4EZ4 A;  4QWN B;  1WYB A;  3I0O A;  1MMA A;  2RA1 A;  3JAD A;  3KIN B;  3H37 A;  3HKB E;  2FUP A;  4U33 A;  2JQH A;  4U2Z A;  3PUZ F;  5AQU B;  4AKI A;  3AEC A;  3VKH A;  2C0S A;  3N2O A;  5AQK B;  5LOV E;  2HHH T;  5HYA A;  3I9Y A;  1LKX A;  4DR5 T;  3MXZ A;  2UUC T;  4B3T T;  3GN5 B;  4LFB T;  5FVL A;  1M7K A;  4EXT A;  1SA0 E;  5LHI B;  3IEE A;  2LOP A;  2X68 A;  4ILU A;  3FBZ A;  2CHN A;  4OHF A;  4YLH A;  5AQP B;  3B57 A;  5AQQ B;  5H6Q B;  2WQY A;  4O8S A;  4JUY A;  5LCY A;  3OYX A;  3PU3 A;  3VRB A;  4YXD A;  2XAJ B;  2W2U A;  3PV0 F;  4YSX A;  3N9M A;  2WBL A;  5DQW A;  2IW5 B;  2V26 A;  4I0U A;  3ZEF B;  2WU2 A;  1NEK A;  3KV5 A;  4LF7 T;  2DNX A;  4O2B E;  4NUV A;  3GA8 A;  2P9B A;  3NVO A;  1IJ6 A;  2LE8 A;  4IRE A;  4L5G A;  2IML A;  2W67 A;  2XQ4 A;  4IE6 A;  4JYA T;  2R6G F;  3UU3 A;  1KNR A;  2IAK A;  3UUM A;  3ZLI A;  5LB7 B;  3P4W A;  3IHR A;  2KWH A;  4FI5 A;  4GK0 E;  4UV9 B;  1HX8 A;  2ZMA A;  3BQI A;  4PK6 A;  5CB4 E;  2CM0 A;  3FXD B;  3ZSS A;  4YTP A;  4DV5 T;  3UFG A;  1ZOY A;  3FBL A;  4IE7 A;  2HPJ A;  2IC9 A;  5JR9 C;  3K8P C;  2RP4 A;  1NEN A;  3AE4 A;  3I9W A;  2IDO B;  2LKG A;  3K1S A;  3ZKR A;  3P4R A;  2ZM0 A;  5FMN A;  2DWK A;  2JIW A;  1XZY A;  2WP9 A;  3LBX A;  3NRY A;  3NZP A;  4HTE A;  4QH5 A;  3VRA A;  4LF4 T;  3CX8 B;  2LLY A;  2X9Y A;  2WAU A;  3CML A;  3LBX B;  5DAB A;  4AQY T;  1ZV4 X;  3SFE A;  3VKG A;  2NP9 A;  1KNP A;  2CPT A;  4QXC B;  4ASK A;  2X51 A;  3RKG A;  4AKH A;  4UR9 A;  5LHG B;  2E5L T;  4CI3 B;  2XSA A;  3MZK B;  4B3M T;  1OED A;  2UXX B;  5FXV A;  3AA6 B;  5FY1 A;  2AXD S;  5C8Y E;  3PJA J;  5IWA T;  4LFC T;  3GN5 A;  4ZI3 C;  1FJG T;  4X66 T;  5HEG A;  3ZMT B;  2N9D A;  2IC6 A;  2PBI A;  3TLV A;  5LHH B;  1T72 A;  1KEY A;  2X0L B;  2XTL A;  5AQJ B;  2W62 A;  3FZF B;  1SUM B;  4IDZ A;  2A9U A;  3UU5 A;  2XAS B;  1O3X A;  3PTR B;  3H3A A;  3O1I A;  2LSK A;  2KIN B;  4DBR A;  4N78 D;  3HA4 A;  3ANW A;  4GKJ T;  3NKZ A;  4KHZ F;  4DR6 T;  3AVR A;  2VVN A;  3C4W A;  3RRC A;  1HCI A;  4DV0 T;  5L3E B;  3QK6 A;  1WYC A;  3D0T A;  2I6H A;  2VKO A;  4CQI A;  2LHN A;  3AE3 A;  5HXR A;  4ZI7 E;  1EZ3 A;  4LFA T;  1UX4 A;  4HWI B;  4JI0 T;  4BJM A;  5FXZ A;  3KV4 A;  4UVC B;  2WWV A;  3P4S A;  3Q5X A;  5HAX A;  4O4I E;  3R84 B;  2V6Y A;  3IA3 A;  5HEH A;  5IYZ E;  3F31 A;  5AQT B;  4ZXL A;  4YT0 A;  3QB5 A;  4PFP A;  5AQM B;  1YQ4 A;  2XQ8 A;  4JI3 T;  4YHH T;  3HI2 A;  5JRC A;  3UUX B;  2K5B B;  2LRK A;  2N1G A;  1VOM A;  1D1B A;  4QKN A;  3T8O A;  4ZZB A;  2WSS V;  2XSB A;  3C50 A;  4U7Y A;  4C91 A;  3C4Z A;  2UXB T;  2JMK A;  3TLU A;  2XAF B;  5IHY A;  3R6N A;  3QOF A;  3UTK A;  3HKD E;  2LSJ A;  2W61 A;  1LVF A;  3L09 A;  4UF0 B;  2W00 A;  1YXR A;  2XM2 A;  5JR9 A;  1YKE B;  2Q9Q D;  2ACZ A;  2JJ9 A;  1M62 A;  2E9X B;  2BZB A;  2FJE A;  5AQS B;  5TAO A;  3RIA A;  4O2A E;  3B13 A;  2YDR A;  2B76 A;  2KT9 A;  3Q5W A;  4MBQ A;  4PW8 A;  3RYH E;  4JI4 T;  4XAX B;  2L8K A;  1WR6 A;  1W0B A;  4JI7 T;  4I43 B;  5FY0 A;  2EHO B;  4TZ4 C;  4HGA A;  4BJN A;  4X1K E;  4E7Z A;  1B7T A;  2E9X C;  3CX7 B;  4HFH A;  4LF6 T;  4UF0 A;  1BR1 A;  2W66 A;  2FBW A;  3BK9 A;  2V7M A;  4AXP A;  2QGS A;  5LMN T;  4YTM A;  4DR3 T;  4O4L E;  4PJJ A;  4U3C A;  4X1I E;  3RGL A;  4DV3 T;  2BG9 A;  4YHJ A;  2N2N A;  4AQG A;  1US7 B;  4CXY A;  3C64 A;  3WAK A;  3A7M A;  4ZEY A;  5CA1 E;  3TLT A;  1D0X A;  1MNE A;  2YN6 A;  5HEO A;  5LJM A;  5AQO B;  1XNQ T;  5EK2 A;  3OKQ A;  2UXN B;  4IDQ A;  5LA6 E;  4NXN T;  1BR0 A;  1KF6 A;  4HFD A;  4IDP A;  2AE9 A;  4HKA A;  4J2C A;  4G63 A;  4AQF A;  2NWB A;  3WAJ A;  5JDN A;  1N36 T;  4JI1 T;  5HXH A;  3EI0 A;  1ZHC A;  3VR9 A;  4F8H A;  2PG8 A;  2BKN A;  1W0A A;  2LKH A;  4P1N A;  4PK5 A;  4LF8 T;  3W15 B;  4DO0 A;  5LP6 E;  2ODV A;  3PU8 A;  4IE4 A;  4F6R C;  4TV8 E;  1E2A A;  4WBN E;  3FZM B;  1N32 T;  4IIJ E;  4GKK T;  2X67 A;  5FXW A;  5JDQ A;  3L39 A;  2D2S A;  4KP3 C;  4YY3 T;  2JPF A;  4ERR A;  1MMD A;  4EIW A;  4CXX A;  1IBK T;  4TV9 E;  2BG9 E;  2E9X D;  3DTO A;  4LF9 T;  2LEH A;  3VU7 H;  4NPP A;  5JQG E;  3VHL A;  3OYZ A;  4IE5 A;  3AEE A;  3O1J A;  4UIG A;  4XZC A;  3ZJ2 A;  3QNU A;  2G0U A;  1W09 A;  2KLQ A;  4IL4 A;  4ZI2 D;  3AXJ B;  2WDQ A;  4O4J E;  2JQK A;  3AA1 B;  5L3C B;  4I55 E;  3DJB A;  2D9D A;  5AQR B;  2LRL A;  5FKY A;  4DVD A;  3T1Y T;  5C2T A;  1LRZ A;  2MOZ A;  2VQE T;  3N9Q A;  2IHR 1;  5AQL B;  4YSY A;  4UVA B;  3P4Q A;  3PUW F;  3E0Z A;  3MAC A;  2V5D A;  2Y6X A;  4TUY E;  5DQV A;  4DND A;  2X9H A;  3K3Q C;  2V7K A;  1GQE A;  1LVK A;  2HPL A;  1J5W A;  2XJ7 A;  3CWZ B;  1NAF A;  4H9S E;  2XQA A;  4IE0 A;  4PFO A;  2VL0 A;  4H63 H;  4TWH A;  3OTO T;  1FIO A;  3VR8 A;  5FY7 A;  1WCR A;  3CKD A;  3F57 A;  2YKS A;  1BR2 A;  4BA9 A;  2F4V T;  1W9R A;  3MJX A;  3RLF F;  4HWF A;  2E2A A;  2LJL A;  4Z91 A;  1E7P A;  5FP3 A;  2HN2 A;  4KMC A;  3RIU C;  3U3I A;  3RI5 A;  2NTY A;  3ZC0 A;  3UFE A;  5JDL A;  3FZH B;  3PE0 A;  4MLK A;  3QC9 A;  2V7I A;  5L47 A;  5AQI B;  2YDS A;  1XMQ T;  4Z8X A;  3ZMZ B;  5LG4 A;  5CA0 E;  4H9P C;  3UU6 A;  2E8I A;  2K3W A;  2Y8D A;  3HKC E;  4ZS2 A;  3CQC B;  2NOX A;  2XAH B;  3V5U A;  5C3J A;  5JR9 B;  5LXT E;  2DWG A;  4DR2 T;  5HXS A;  2LHR A;  1OED B;  4DUY T;  2VUR A;  5AQN B;  4A97 A;  2H88 A;  1UUR A;  2KWI B;  2VKH A;  3M65 A;  4UEM A;  1IAP A;  4WNK A;  4EV6 A;  4ZHQ E;  2W63 A;  3A8Y C;  2H89 A;  2I0M A;  3FXE B;  4X20 E;  4QX7 B;  3Q9D A;  2EHO C;  3ZCJ A;  4L0R A;  2XAQ B;  2EHO A;  3AA7 B;  3KVB A;  3Q5E A;  3WI3 A;  2K9A A;  3SOL A;  1UUS A;  2IUB A;  1HTJ F;  4CI1 B;  1WRD A;  3EHZ A;  3AEG A;  4U74 A;  5ABE A;  4NXM T;  3AAA B;  1T7S A;  1G73 A;  4ANJ A;  3RRW A;  3UUN A;  5AQF B;  1HR0 T;  4QH4 A;  4H9Q C;  3ETU A;  5AFU L;  4QX8 B;  5J2U E;  5M4Y A;  2FJB A; 
#chains in the Genus database with same CATH homology
 3N9P A;  5HWX A;  3DP7 A;  4P0B A;  4AKR B;  3GMI A;  2JRK A;  2VWA A;  4V1A v;  1QSD A;  4CZZ B;  4YFS A;  5JDM A;  3V5S A;  5HXE A;  2JQQ A;  1Y64 B;  4L9I A;  5E0O A;  3ANW B;  4ZOL E;  2HH7 A;  3KFW X;  3NBX X;  4HFV A;  2ODU A;  2VB6 A;  2X9X A;  2XAG B;  2YIN A;  3NRX A;  4ISS A;  4TX5 A;  5GON E;  3U78 A;  5JRE A;  4DMW A;  3ZC1 A;  2BDE A;  1HFA A;  2YU2 A;  2CLY C;  2LSG A;  2M67 A;  3PUR A;  3I1A A;  1HG2 A;  4K0U A;  5JDF A;  3PUQ A;  2KZ7 B;  1UCU A;  5JDH A;  5LGT B;  1S94 A;  4JEH B;  5JDG A;  3ONX A;  2K48 A;  2W0G A;  5L3D B;  3EUH A;  1FMW A;  4GYR A;  3EVY A;  5KX5 E;  2C5I T;  4QXH B;  5A1L A;  2ZM8 A;  3BQL A;  3EDU A;  3K3O A;  5F8P A;  4H9O C;  5FYM A;  1HS7 A;  3C4X A;  4YJ2 E;  4P09 A;  1CUN A;  5EZY E;  4QXB B;  4ZS3 A;  3PUG A;  4EYY R;  2X9W A;  4UVB B;  4EAH A;  1H7C A;  1FMV A;  5J1G A;  4DMV A;  4PJM A;  3AAE B;  3KV9 A;  5LJN A;  3LK2 B;  2Q9Q B;  3MK7 C;  3PUS A;  4KUM B;  1QUU A;  3S4U A;  4G2A A;  2XUE A;  3RC8 A;  4ZI3 D;  4C90 A;  2X66 A;  2OA5 A;  1IJ5 A;  3KVA A;  3MKD A;  3EDV A;  5EK3 A;  3CX6 B;  1AJ3 A;  3ZYL A;  4GIW A;  2DI4 A;  4AQF C;  4GK5 E;  4ZI2 C;  4O4H E;  3LK4 2;  2V1D B;  3LJC A;  1UX5 A;  3PDY A;  3IBP A;  4PK4 A;  3J9X 1;  3Q2M A;  4BAY B;  3CVR A;  2Q9Q A;  2BVM A;  4H9N C;  3RH3 A;  2JMH A;  3LG7 A;  4EOZ B;  2ES0 A;  2ZM2 A;  1ZEE A;  1MMN A;  5HXC A;  5BMV E;  1D1C A;  3FHN A;  3L3P A;  2WM9 A;  3RX6 A;  3E22 E;  4I50 E;  2K24 A;  4PNI A;  2C5J A;  2WWU A;  2WMO A;  4HE8 A;  2B1E A;  4FJO A;  3NZQ A;  2DHR A;  3HL6 A;  3N9L A;  1E1H B;  1U4Q A;  2KMF A;  2H7V C;  2KND A;  3KV6 A;  3QUJ A;  4WBO A;  3RKO A;  3E08 A;  3JC6 D;  2CLY B;  2VKD A;  4IST A;  5F3J A;  4JLE A;  3N9N A;  2NW9 A;  3F2E A;  3SS1 A;  2CXF A;  2DLR A;  2WMN A;  1OWA A;  4OK0 A;  3RPU A;  5L2L A;  3ESL A;  5LGN B;  2CMR A;  3HKE E;  3OBV E;  4EB6 E;  3RYI E;  4UXN B;  1U5P A;  1VRB A;  2V7J A;  4QHO A;  1Z0P A;  3ZPO A;  2CE7 A;  2D0T A;  5KMG P;  2CEA A;  3ZMU B;  2CXD A;  2PFV A;  3PUA A;  1FEW A;  2NTX A;  3O9X A;  2MTQ A;  2KXP B;  3UT5 E;  3N2G E;  3ZCI A;  2V7L A;  1T98 A;  2J1D G;  5LBM A;  2L9Q A;  2LSY A;  5FNV E;  1NWM X;  2LM9 A;  1HG5 A;  4OYK A;  3LK3 B;  4B6X A;  1X79 A;  2CCQ A;  3SRZ A;  5HWY A;  5L3F B;  5LYJ E;  3CQG B;  3N5L A;  5LNK A;  5JVD E;  5JRC B;  4X1Y E;  3ZMS B;  3CPZ A;  2VL8 A;  2VAS A;  3KBT A;  2GK9 A;  4UV8 B;  5LBQ B;  2CWY A;  2E9X A;  3RYF E;  5J2T E;  3ZN1 B;  2XHE B;  3MA9 A;  3BQK A;  1V9D A;  3FB2 A;  2ZLY A;  5JH7 E;  4IHJ E;  1YW0 A;  2Z6E A;  4HEA A;  2DCF A;  5H6R B;  3J7Y q;  4IGU A;  3LFM A;  2VK9 A;  2NW7 A;  1S35 A;  4PJL A;  3AA0 B;  2D5U A;  2LSI A;  3A5X A;  1MIV A;  2D0U A;  2PJQ A;  3UUL A;  2L3L A;  3ZYM A;  1HF8 A;  1MIW A;  4YJ3 E;  2MYS A;  3IF8 B;  3ZN0 B;  3RC3 A;  2YK0 A;  5L3G B;  4P0A A;  2XQY A;  2A3D A;  4H63 V;  3I0Q A;  2A2F X;  1IZN B;  4CI2 B;  4M1P A;  3HR0 A;  1D0Z A;  3AB3 B;  1BR4 A;  3AAI A;  3K3N A;  4AKG A;  1KK7 A;  4HN9 A;  2YU1 A;  5FXX A;  3C51 A;  3ZMV B;  4JEU B;  4NUU A;  1ZKE A;  3C98 B;  2CA5 A;  1SHZ C;  4EYU A;  3AVS A;  2LT3 A;  3ETV A;  3N9O A;  2QA7 A;  3KBU A;  4MHC A;  4WW0 A;  1MMG A;  2Y48 B;  4OFZ A;  4PJN A;  4I4T E;  4A56 A;  2EHO D;  2ACX A;  3O4X E;  3JC6 C;  3GWH A;  2CXL A;  5ADX L;  4ADZ A;  2Q9Q C;  2LOS A;  3P8C D;  2CWO A;  4GOU A;  5ETW A;  3ZYK A;  5L3B B;  2NW8 A;  4AKL A;  3P7I A;  3ZJ1 A;  3N2K E;  4MFR A;  2A72 A;  3OJA A;  1D0Y A;  2H3R A;  4U72 A;  3RYC E;  1D1A A;  3TKL B;  4E7S A;  2BVL A;  2YEV C;  4MAL A;  4AI6 A;  3KDS E;  2SPC A;  4OYJ A;  4H9R C;  4KBM B;  4PAG A;  4DBQ A;  3SWH A;  4UEL A;  1KNZ A;  3O1H A;  5DJQ C;  1WLX A;  1YKH B;  2C5K T;  1MND A;  5KDM C;  1OXZ A;  4TN7 B;  2MBG A;  2I59 A;  5EK4 A;  1G8X A;  1YD8 G;  2H7O A;  2VKJ A;  4GYS A;  1MIY A;  3CQX C;  4EZH A;  4EZ4 A;  4QWN B;  1WYB A;  3I0O A;  1MMA A;  2RA1 A;  3KIN B;  3H37 A;  3HKB E;  4AKI A;  3VKH A;  2C0S A;  3N2O A;  5LOV E;  5HYA A;  3I9Y A;  1LKX A;  3MXZ A;  3GN5 B;  5LHI B;  4EXT A;  1SA0 E;  3IEE A;  2LOP A;  2X68 A;  4ILU A;  3FBZ A;  4OHF A;  5H6Q B;  4YLH A;  5LCY A;  3B57 A;  4O8S A;  4JUY A;  3OYX A;  3PU3 A;  2XAJ B;  3N9M A;  2WBL A;  5DQW A;  2IW5 B;  2V26 A;  3ZEF B;  3KV5 A;  2DNX A;  4O2B E;  4NUV A;  3GA8 A;  2P9B A;  4L5G A;  1IJ6 A;  2LE8 A;  4IE6 A;  2IAK A;  3UUM A;  3ZLI A;  3IHR A;  2KWH A;  4FI5 A;  4GK0 E;  4UV9 B;  1HX8 A;  2ZMA A;  3BQI A;  4PK6 A;  5CB4 E;  2CM0 A;  3FXD B;  3FBL A;  4IE7 A;  2HPJ A;  2IC9 A;  5JR9 C;  3K8P C;  2RP4 A;  3I9W A;  2ZM0 A;  5FMN A;  2DWK A;  3LBX A;  3NRY A;  4HTE A;  3NZP A;  3CX8 B;  2X9Y A;  3CML A;  2WAU A;  3LBX B;  5DAB A;  1ZV4 X;  3VKG A;  2NP9 A;  4QXC B;  4ASK A;  2X51 A;  4AKH A;  5LHG B;  4CI3 B;  3MZK B;  2UXX B;  5FXV A;  3AA6 B;  5FY1 A;  5C8Y E;  3GN5 A;  4ZI3 C;  3ZMT B;  2N9D A;  2IC6 A;  2PBI A;  5LHH B;  2X0L B;  2XTL A;  2W62 A;  4IDZ A;  2XAS B;  1O3X A;  3PTR B;  3H3A A;  3O1I A;  2LSK A;  2KIN B;  4DBR A;  4N78 D;  3HA4 A;  3ANW A;  3AVR A;  3RRC A;  3C4W A;  1HCI A;  5L3E B;  3QK6 A;  1WYC A;  3D0T A;  2VKO A;  4CQI A;  4ZI7 E;  2LHN A;  5HXR A;  1EZ3 A;  1UX4 A;  4BJM A;  5FXZ A;  3KV4 A;  4UVC B;  5HAX A;  3Q5X A;  3R84 B;  4O4I E;  5IYZ E;  3F31 A;  4PFP A;  3HI2 A;  5JRC A;  3UUX B;  2K5B B;  2N1G A;  4QKN A;  1VOM A;  1D1B A;  3T8O A;  2WSS V;  3C50 A;  4C91 A;  3C4Z A;  2JMK A;  2XAF B;  5IHY A;  3R6N A;  3UTK A;  3HKD E;  2LSJ A;  2W61 A;  1LVF A;  3L09 A;  4UF0 B;  2W00 A;  5JR9 A;  1YKE B;  2Q9Q D;  2JJ9 A;  4CXW A;  2E9X B;  4XBF B;  2BZB A;  5TAO A;  4O2A E;  3B13 A;  2KT9 A;  3Q5W A;  4MBQ A;  4PW8 A;  3RYH E;  4XAX B;  2L8K A;  1WR6 A;  4I43 B;  5FY0 A;  2EHO B;  4TZ4 C;  4HGA A;  4BJN A;  4X1K E;  4E7Z A;  1B7T A;  2E9X C;  3CX7 B;  4UF0 A;  1BR1 A;  3BK9 A;  2V7M A;  4AXP A;  2QGS A;  4O4L E;  4PJJ A;  4X1I E;  4YHJ A;  2N2N A;  4AQG A;  1US7 B;  4CXY A;  3C64 A;  3WAK A;  5CA1 E;  1D0X A;  1MNE A;  5LJM A;  5EK2 A;  3OKQ A;  2UXN B;  5LA6 E;  1BR0 A;  4AQF A;  3WAJ A;  4HKA A;  4J2C A;  4G63 A;  2NWB A;  5JDN A;  5HXH A;  1ZHC A;  2PG8 A;  3W15 B;  4PK5 A;  5LP6 E;  4DO0 A;  2ODV A;  3PU8 A;  4IE4 A;  4F6R C;  4TV8 E;  4WBN E;  4IIJ E;  2X67 A;  5FXW A;  5JDQ A;  2D2S A;  4KP3 C;  2JPF A;  4ERR A;  1MMD A;  4EIW A;  4CXX A;  4TV9 E;  2E9X D;  3DTO A;  2LEH A;  3VU7 H;  5JQG E;  3VHL A;  3OYZ A;  4IE5 A;  3O1J A;  4UIG A;  4XZC A;  3ZJ2 A;  2G0U A;  2KLQ A;  4O4J E;  5L3C B;  5LGU B;  3AA1 B;  4I55 E;  3DJB A;  4DVD A;  1LRZ A;  2MOZ A;  3N9Q A;  4UVA B;  3E0Z A;  3MAC A;  2Y6X A;  4TUY E;  5DQV A;  4DND A;  2X9H A;  3K3Q C;  2V7K A;  1LVK A;  2HPL A;  3CWZ B;  4IE0 A;  4H9S E;  4PFO A;  1NAF A;  4ZI2 D;  4H63 H;  1FIO A;  5FY7 A;  3CKD A;  3F57 A;  1BR2 A;  4BA9 A;  3MJX A;  2LJL A;  5FP3 A;  3U3I A;  4KMC A;  3ZC0 A;  2NTY A;  3UFE A;  5JDL A;  3PE0 A;  4MLK A;  3QC9 A;  2V7I A;  4Z8X A;  3ZMZ B;  5LG4 A;  5CA0 E;  4H9P C;  2E8I A;  2Y8D A;  3HKC E;  4ZS2 A;  3CQC B;  2NOX A;  2XAH B;  3V5U A;  5JR9 B;  5LXT E;  2DWG A;  5HXS A;  2LHR A;  2VKH A;  2KWI B;  3M65 A;  4UEM A;  4WNK A;  1IAP A;  4ZHQ E;  2W63 A;  4X20 E;  3FXE B;  4QX7 B;  3Q9D A;  2EHO C;  3ZCJ A;  4L0R A;  2XAQ B;  2EHO A;  3AA7 B;  3KVB A;  3WI3 A;  2K9A A;  3SOL A;  1HTJ F;  4CI1 B;  1WRD A;  4U74 A;  3AAA B;  1G73 A;  4ANJ A;  3RRW A;  3UUN A;  4H9Q C;  3ETU A;  5AFU L;  4QX8 B;  5J2U E;  5M4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...