3FZHB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
111
Chain Sequence
b'GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzhB00
5AQHB 4HWHA 1HX1B 3A8YC 1M62A 5AQNB 1UGOA 4HWCA 4HWDA 5AQTB 3LDQB 5AQKB 3FZMB 5AQJB 5AQVB 3FZHB 1M7KA 5AQFB 1T7SA 3FZFB 5AQGB 5AQQB 4HWIB 5AQMB 2D9DA 3M3ZB 3FZKB 5AQUB 5AQRB 5AQLB 1UK5A 5AQPB 5AQOB 5AQIB 5AQSB 3FZLB 4HWFA 1I6ZA
chains in the Genus database with same CATH superfamily
2V8SV 4LF6T 5IWAT 4AKGA 2ZMAA 5HEJA 2EHOA 4DIDB 2HHHT 4TZ4C 4YLHA 5J1GA 2LE8A 4HFBA 2CHOA 3E22E 4ILCA 5ABGA 2XAGB 4O4LE 4F8HA 2CM0A 2IC6A 3NZQA 2A3DA 2WY2A 1MNEA 3GN5B 4JI0T 2I6HA 5HCMA 3M3ZB 1IAPA 2UXDT 3RIUC 4X5TA 3AEBA 4L5GA 2XQ5A 1BR0A 1HF8A 3CIRA 1V9DA 2CCQA 2KINB 2XM2A 4DVDA 2WWVA 4JI4T 5ABEA 1UX5A 4GYSA 1MMGA 1G8XA 1D1BA 3QB5A 1LVFA 1KNPA 3NBXX 3N9NA 4HFCA 2E5LT 1D0XA 4LMKA 2IUBA 2PJQA 4MBQA 1HX8A 1MIYA 1M62A 2NW8A 3ZYMA 1YW0A 4IREA 3ANWA 4EGWA 1HS7A 5BR8T 3RLFF 4B3MT 1SE7A 5HXHA 2VURA 3PURA 5EK3A 3UUXB 3Q5XA 3ZT6A 5HXEA 1EZ3A 3KBUA 5CFBA 4Z90A 3JAEA 4DV7T 3J7Yq 3A5XA 2XZEA 4HE8A 2NWBA 4CN4A 1XMQT 2XTLA 3RYFE 4B3RT 2GK9A 4CI2B 1J5WA 4AQFC 2K24A 4WW0A 3AA0B 3EVYA 2W61A 3UTKA 2XUEA 4JI5T 2FJAA 2JQQA 5F8PA 4JI6T 1MIVA 2YDQA 4P09A 2E9XA 2CXLA 4ERRA 4L0RA 4EB6E 3P4SA 3ETUA 2UU9T 4EZ4A 2XAJB 5KX5E 2J1DG 5FMNA 4DUYT 3OPCA 4LFBT 2VWAA 5M4YA 1J1JA 3E0ZA 2D5UA 3TKLB 4YSYA 2JIWA 3FXEB 2LSJA 2WDVA 3UU6A 2BVLA 4LF9T 2RP4A 3E08A 3AVRA 2LSKA 2W62A 4C91A 2W63A 3AE8A 1SUMB 5AQGB 3OJAA 1W0AA 3K3QC 4DR3T 2A9UA 2B76A 2W0GA 5JVDE 4PFPA 5AQHB 3C4XA 1HR0T 3F2EA 4CXYA 3UU4A 5FVLA 4P0AA 1X79A 4I55E 2ZLYA 2LOSA 3BK9A 3UFGA 5J2UE 4PNIA 4ZI2D 3OTOT 5LCYA 3ZN0B 3CQGB 5EK4A 5HWXA 5L3EB 3KINB 3PJAA 3U78A 3G06A 1UURA 3QK6A 4X1KE 5FP3A 3RIUA 1HX1B 3AEEA 4GK0E 2CPTA 2H7OA 4DO0A 3ZYKA 4OYKA 3O9XA 1IBLT 4CZZB 4F6RC 5HXRA 4KHPT 4I43B 3RH3A 2DCFA 2VQFT 2V7KA 3JCFA 3MKDA 3UFEA 4HFDA 5JDHA 1HG5A 4HWHA 3C4ZA 5LMNT 5L2LA 4IDNA 2QYWA 4IDOA 3TLWA 1KFYA 1OXZA 2D2SA 4NUVA 5ABFA 2NTXA 4HN9A 5LP6E 2KWHA 5IHYA 2FJEA 3AE4A 2LHNA 4UVAB 4X66T 2L8KA 2BKNA 3P7IA 4YTPA 4LF8T 2LRLA 2KSRA 3QOFA 4HWDA 3RGLA 4YJ3E 1I94T 2YDSA 3F31A 2Y8DA 4TX5A 2LKGA 1NENA 3CQXC 4JEHB 2PTFA 4AQFA 3V5UA 3I9YA 4DR1T 2BVMA 2KXPB 4JLEA 4U2YA 1KNRA 3ONXA 3FZHB 1YKEB 4AKHA 1HFAA 4I4TE 2DNXA 1JNZA 3NKZA 4ZI3C 1D0ZA 5JDGA 2QRXA 3PUAA 3PUVF 5L4HA 2JQHA 4OHFA 3LJCA 2ZM8A 2H3RA 2R6GF 2V7JA 5L3CB 4ILUA 4UVBB 3CPZA 2A72A 2X68A 2JMHA 3JAFA 3MJXA 3HL6A 4CI1B 3X1DA 1U5PA 2V6XA 5FKYA 2YDRA 5LA6E 1WCRA 4UXNB 3OKQA 3KBTA 5AQVB 4H9RC 4HFEA 3CK6A 3ZCIA 4A56A 3IA3A 4PJMA 2WS3A 3CX7B 2JQKA 3AVSA 4JUYA 3Q9DA 3K8PC 2NR4A 5JDLA 3RHWA 1WR0A 2LEHA 5LG3A 3B5MA 2LLYA 2XQ8A 4X62T 2LRKA 1N32T 3TLVA 2K9AA 1KF6A 3CVRA 4ZI7E 2MOZA 4DV2T 4A98A 2J4GA 4Z8XA 2WBLA 2UUCT 2OLTA 2FJDA 3WI3A 2YU2A 3FHNA 3PDYA 4QH5A 3U3IA 2NW7A 3VHLA 1UCUA 3ABVA 1D0YA 4ILAA 2DLRA 4E7SA 4QH4A 4H9NC 3RF1A 4FJOA 4JYAT 3HI2A 1ZKEA 1WR6A 2W66A 3RX6A 2LM9A 3ZN1B 1VOMA 3SOLA 5DABA 4GIWA 4X65T 2JMKA 3OYXA 4P1NA 4U31A 4X64T 5HAXA 3GN5A 2YU1A 4EEBA 3N9MA 4KP3C 1CHUA 2N2NA 1VRBA 4CXWA 4ILBA 3O1IA 3MACA 3FXDB 2X67A 1NWMX 3Q5EA 2CLYB 3CX6B 2CXFA 3ZJ1A 5L4EA 1R8IA 2LOPA 2CMRA 4HFIA 3P4QA 5LHIB 4DR7T 1QLBA 4X1IE 4TWHA 4COFA 3LK42 3EAMA 3L8RA 5LGNB 3L09A 1FMVA 2SPCA 2RA1A 5AQQB 2QA7A 4CI3B 4O4JE 3QUJA 2BG9B 3ONLC 1UUSA 2Y6XA 3AA6B 2X9YA 3FB2A 2BBHA 3FZMB 2W2UA 1T7SA 5FVKA 4JI3T 4NPPA 5AQOB 1BR2A 2VVNA 3MK7C 4PJNA 3A7MA 1S94A 4FI5A 5LHGB 4NXNT 5AQLB 3ZJ2A 5DQVA 1YQ4A 2BS2A 4EXTA 3PUQA 3T1HT 4HKAA 1DU2A 4YXDA 2VQET 3Q5DA 5AQJB 2YKSA 4M1PA 5JR9B 2YK0A 4N78D 2D9DA 2HN2A 4IE5A 2Q9QD 4EV6A 3S4UA 4DV1T 2P9BA 2YOEA 2BG9E 2N1GA 4PW8A 3AECA 3HKDE 5JDMA 4EYYR 2HH7A 3ZC0A 4ZHQE 1MNDA 3NVOA 3NRYA 5FL0A 3OYZA 3N2GE 2ZM0A 2FJBA 2VKHA 4XBFB 2XAFB 4IL9A 1E2AA 3N2KE 2HN1A 3C4WA 2RPAA 2ZM6T 1W09A 1BR1A 4B3TT 1ZV4X 4H9QC 4O2BE 5H6RB 2WZHA 4E7ZA 4U74A 1VCSA 2CRBA 2HPJA 2JJ9A 3DJBA 3OBVE 4UV8B 3PUSA 4TWDA 3HKBE 2DWGA 3PJAJ 1LKXA 2FUPA 2WQYA 2IMLA 3H3MA 2EHOD 2X51A 3RC3A 3KV9A 5KMGP 5H6QB 3ZLIA 2WB5A 3PTRB 3C50A 4CXXA 3RRWA 1E7PA 2XHEB 3AB3B 5EZYE 2D0TA 5A1LA 1WYCA 3N9LA 3ZCJA 4O4IE 2NTYA 2LSGA 3KFWX 5LYJE 3AXJB 2H7VC 3BQIA 2XQ6A 3AAAB 3IEEA 4TUYE 1SHZC 2AXDS 3UQ4A 4QWNB 4ISTA 4YHJA 2CLYC 1SA0E 4AI6A 2W4XA 2DWKA 3PV0F 2XQ9A 2CA5A 4ZOLE 1E1HB 3BQLA 2QGSA 4L9IA 4P0BA 1CUNA 3NWIA 3F57A 4AISA 2VL0A 3H3AA 4DR5T 5HYAA 2BG9C 4PAGA 3AA1B 2BZBA 4IE4A 2XAQB 5JDFA 5LHHB 2WCAA 4IE7A 4IGUA 4ZS2A 3IBPA 5JREA 2JQ9A 4U72A 2Y48B 4CN6A 5LNKA 5FXWA 3ZPOA 5C8YE 1BR4A 5L3GB 4NUUA 3RC8A 4H9OC 2H89A 4H9SE 2E9XD 4U33A 2VKJA 3AEAA 4UR9A 3TLTA 4KX6A 5E0OA 2V7MA 1IBKT 5HXCA 3VR8A 4QH1A 2LHRA 1HG2A 3JADA 5AQSB 4UF0A 2IW5B 1HNZT 4PJJA 3AA7B 1GQEA 1WYBA 2ZM2A 5L3BB 2WWUA 1T72A 4ZXLA 2L3LA 4BA9A 4EZHA 4MFRA 3JC6D 3T1YT 4YSXA 5JH7E 5LG4A 2X66A 4KI0F 3A8YC 4WYVA 3IHRA 2K5BB 2MYSA 2XPKA 3I0QA 4HFVA 2IDOB 3LK2B 5EK2A 3AE3A 3KV5A 3H37A 4HWFA 2V26A 1KK7A 4UEMA 3UU3A 2LM2A 3N5LA 4QXHB 5LXTE 3CMLA 4NXMT 3HA4A 2K48A 5ABFB 4ZZBA 2Z6EA 4HFHA 4KBMB 3VRAA 5LGTB 1Y64B 1I6ZA 5JDQA 3UQ7A 4DMWA 4JI7T 1KNZA 4LFAT 1HNXT 3P4RA 2WDQA 2OV9A 1XNQT 4A97A 4MALA 4LMJA 3VR9A 4TWFA 4JV5T 2D0UA 4OX9T 3PUXF 4WZXA 5JDNA 1W0BA 3NZPA 4U3CA 2VKOA 4TNWA 3QC9A 1ZP0A 4YT0A 5FL1A 3J9X1 2W00A 3AEDA 3UU5A 2XM1A 4O4HE 3CX8B 4Z91A 4TN7B 1US7B 1WLXA 4NIQA 2K3WA 2CWOA 3AAIA 4OFZA 4BJMA 1XNRT 2BG9A 2UXCT 3PUWF 5ADXL 5C2TA 1OWAA 2H88A 3B13A 2XQ4A 1WRDA 3CKDA 3N9PA 1XWMA 3ZSTA 3C51A 4KMCA 3KV4A 1IJ5A 2M6BA 2WAUA 4U7IA 2LKHA 5HCJA 5AQMB 4V1Av 4DV0T 3PUGA 5DJQC 2VVSA 2J62A 1HCIA 4H9PC 2C5KT 4TV9E 4H63V 5JRCB 2DL1A 4B6XA 1LRZA 2XQYA 4G63A 5L3DB 3RIFA 2G0UA 3R6NA 2XSAA 2E2AA 4DUZT 4ASKA 3RQUA 4AKIA 4AQYT 2E8IA 2NP9A 5J2TE 5LOVE 4JBWF 2X9XA 3RRCA 4EOZB 3LDQB 3SS1A 3HKCE 2CBJA 1T98A 4Q25A 3AAEB 3BQKA 3C98B 5ABHA 5F3JA 4O8SA 5LBMA 5FY0A 2ACXA 2PFVA 4GYRA 4PK6A 2V6YB 4ZZCA 3D0TA 2Q9QB 5AQUB 2XSBA 4MLKA 2WM9A 3EDVA 3RKOA 3C64A 3PU3A 3MXZA 4YTMA 4BJNA 3QB5K 4IDZA 1QUUA 1G73A 3R84B 3LBXB 3ZMSB 2X0YA 2LT3A 5LJNA 2V7IA 1MIWA 5HXSA 2YINA 4I50E 2WSSV 5L47A 1WFDA 2BKOA 4AIUA 2NOXA 4X20E 1N34T 1YD8G 2JPFA 4UELA 4IDPA 2C5IT 4LF7T 5AQTB 4DNDA 2VK9A 4DR4T 1D1CA 4UVCB 3ZYLA 4ADZA 2MTQA 5AQFB 1M7KA 1W9RA 4K0KT 3M65A 1JNRA 1YKHB 4GKJT 3O1JA 3FZLB 3GA8A 2JRKA 2PBIA 5KDMC 1OEDB 3P4PA 1UGOA 4EEDA 2IAKA 2OA5A 2EHOB 5AQRB 3EHZA 2ACZA 2VL8A 5LJMA 2CXDA 5AQIB 3P50A 4DR2T 3AXJA 3AE1A 2E5VA 3RYIE 4GK5E 3ZSSA 5CA1E 3HR0A 1S35A 4J2CA 3AE5A 4YTNA 2WMOA 3I1AA 3AEGA 4X1YE 1Z8UA 2XQ3A 3HKEE 1FJGT 4AKLA 4CN1A 3KV6A 5ETWA 4IL4A 3KVAA 3ZMUB 2V7LA 4MHCA 4EYUA 3TLUA 4DBQA 4WBOA 3ONJA 2ODVA 4DV6T 4IE6A 4YFSA 5AQPB 3AE6A 5AFUL 1QSDA 3PUZF 2ES0A 3K3OA 4ANJA 2CEAA 3PE0A 3I0OA 5TAOA 3VU7H 4QXCB 4LF4T 4ZI3D 1OEDE 2BS3A 4QKNA 2V5DA 5CB4E 2LSIA 4C90A 3ANWB 3UT5E 3UULA 3ZMTB 4CQIA 1LVKA 5FYMA 4KUMB 2M67A 4YHHT 3KVBA 5AQKB 5FXXA 3N9QA 4IIJE 2KNDA 5BMVE 3Q2MA 1FIOA 1UK5A 4U2ZA 3LFMA 2B1EA 2F4VT 2CE7A 3N9OA 1YXRA 1XDOA 3TLSA 4AKRB 1IJ6A 2MBGA 3WAKA 3ZC1A 3LG7A 4WNKA 4KHZF 2E9XB 2IIUA 2WU2A 1IZNB 3GMIA 2ODUA 1HTJF 4HGAA 4PK4A 2KLQA 2WP9A 5AQNB 4HWCA 1NEKA 3MZKB 4YJ2E 3AEFA 4IDQA 5JQGE 3V5SA 3NRXA 4BAYB 1NAFA 3EUHA 4JI2T 2WDRA 2BBJA 4XZCA 2KT9A 2CBIA 2Q9QC 4GKKT 4EIWA 1L0VA 2DI4A 2LJLA 3ZEFB 2UUAT 3FZFB 5LMUT 4JI1T 3MA9A 4WBNE 1X9BA 3VKGA 5LBQB 4DR6T 3K1SA 5FY7A 4DBRA 5HWYA 3RYHE 2CHNA 4IHJE 1FEWA 3RIAA 2XJ7A 4PFOA 2XAHB 4I0UA 1MMNA 3PU8A 2X9WA 1XMOT 5FY1A 3SFEA 2IC9A 4QX7B 1N33T 5JR9C 3FBZA 2VB6A 5LGUB 4OK0A 2XQAA 5IUXA 4ZS3A 4O2AE 1XZYA 2WZIA 4QXBB 1H7CA 5F5WA 4DV4T 5LB7B 1ZEEA 5HEHA 3EABA 4QHOA 1OEDC 2V1DB 4UV9B 5HEOA 4EAHA 3N2OA 3L3PA 3O1HA 2PG8A 3UU8A 3ZT7A 2EHOC 4LF5T 3RPUA 3B57A 4GOUA 2KWIB 2X9HA 3ZKRA 4TNVA 2WU5A 2IHR1 3W15B 3RYCE 3UUNA 3AE2A 3CWZB 3L39A 3P8CD 1HNWT 3EDUA 3SFDA 2QVAA 2CWYA 3Q5WA 4H63H 3O4XE 2J47A 2UXXB 3DP7A 5L3FB 5FXVA 1D1AA 3ZMZB 4AQGA 5CJ5A 3SRZA 1ZHCA 5CA0E 2A2FX 5FNVE 1KEYA 3FBLA 4YY3T 3UUMA 2DHRA 3AE7A 3OVUA 4DV5T 1ZOYA 4ZI2C 1N36T 3CQCB 3VRBA 5C3JA 1U4QA 2HPLA 2UUBT 4UF0B 5JRCA 4DV3T 2C5JA 2FBWA 4LMLA 1J5ET 2UXBT 4TV8E 4LFCT 4QX8B 1XDPA 3IF8B 4PJLA 1B7TA 4JEUB 2XY8B 3KDSE 4ZEYA 4XAXB 2KZ7B 1O3XA 1FMWA 4U7YA 2XQ7A 2BDEA 2V5CA 2W67A 4YSZA 3LK3B 2YN6A 5GONE 3ZMVB 4HWIB 1MMAA 3K3NA 3FZKB 3EI0A 2E9XC 4IE0A 2V6YA 3RQWA 4B3ST 1MMDA 3LSVA 3GWHA 3ZT5A 5JTGA 2MAWA 5HEUA 4PK5A 2Q9QA 3DTOA 2VKDA 3PUYF 1VCTA 2KMFA 4HEAA 3RKGA 4ISSA 1IBMT 3VKHA 3ESLA 3ETVA 2XASB 1AJ3A 3LBXA 5CGMA 2UXNB 5DQWA 4HTEA 3P4WA 4UIGA 2I59A 3SWHA 5KXJA 5FXZA 2X0LB 1UX4A 2MPKA 1Z0PA 2VASA 5HEGA 4DMVA 3RI5A 4G2AA 4A5XA 5J0ZA 1YQ3A 2I0MA 2X0HA 2C0SA 3QNUA 3T8OA 1Y01A 2WMNA 5IYZE 3JC6C 3UUBA 4K0UA 4IT4A 5JR9A 3AE9A 3I9WA 2N9DA 2L9QA 4OYJA 1T8BA 2BS4A 3WAJA 4JI8T 2LSYA 2YEVC 2M6IA 4AXPA 2AE9A 1OEDA 2BKPA 2NW9A
chains in the Genus database with same CATH topology
5AQHB 4HWHA 1HX1B 3A8YC 1M62A 5AQNB 1UGOA 4HWCA 4HWDA 5AQTB 3LDQB 5AQKB 3FZMB 5AQJB 5AQVB 3FZHB 1M7KA 5AQFB 1T7SA 3FZFB 5AQGB 5AQQB 4HWIB 5AQMB 2D9DA 3M3ZB 3FZKB 5AQUB 5AQRB 5AQLB 1UK5A 5AQPB 5AQOB 5AQIB 5AQSB 3FZLB 4HWFA 1I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQH B;  4HWH A;  1HX1 B;  3A8Y C;  1M62 A;  5AQN B;  1UGO A;  4HWC A;  4HWD A;  5AQT B;  3LDQ B;  5AQK B;  3FZM B;  5AQJ B;  5AQV B;  3FZH B;  1M7K A;  5AQF B;  1T7S A;  3FZF B;  5AQG B;  5AQQ B;  4HWI B;  5AQM B;  2D9D A;  3M3Z B;  3FZK B;  5AQU B;  5AQR B;  5AQL B;  1UK5 A;  5AQP B;  5AQO B;  5AQI B;  5AQS B;  3FZL B;  4HWF A;  1I6Z A; 
#chains in the Genus database with same CATH topology
 2V8S V;  4LF6 T;  5IWA T;  4AKG A;  2ZMA A;  5HEJ A;  2EHO A;  4DID B;  2HHH T;  4TZ4 C;  4YLH A;  5J1G A;  2LE8 A;  4HFB A;  2CHO A;  3E22 E;  4ILC A;  5ABG A;  2XAG B;  4O4L E;  4F8H A;  2CM0 A;  2IC6 A;  3NZQ A;  2A3D A;  2WY2 A;  1MNE A;  3GN5 B;  4JI0 T;  2I6H A;  5HCM A;  3M3Z B;  1IAP A;  2UXD T;  3RIU C;  4X5T A;  3AEB A;  4L5G A;  2XQ5 A;  1BR0 A;  1HF8 A;  3CIR A;  1V9D A;  2CCQ A;  2KIN B;  2XM2 A;  4DVD A;  2WWV A;  4JI4 T;  5ABE A;  1UX5 A;  4GYS A;  1MMG A;  1G8X A;  1D1B A;  3QB5 A;  1LVF A;  1KNP A;  3NBX X;  3N9N A;  4HFC A;  2E5L T;  1D0X A;  4LMK A;  2IUB A;  2PJQ A;  4MBQ A;  1HX8 A;  1MIY A;  1M62 A;  2NW8 A;  3ZYM A;  1YW0 A;  4IRE A;  3ANW A;  4EGW A;  1HS7 A;  5BR8 T;  3RLF F;  4B3M T;  1SE7 A;  5HXH A;  2VUR A;  3PUR A;  5EK3 A;  3UUX B;  3Q5X A;  3ZT6 A;  5HXE A;  1EZ3 A;  3KBU A;  5CFB A;  4Z90 A;  3JAE A;  4DV7 T;  3J7Y q;  3A5X A;  2XZE A;  4HE8 A;  2NWB A;  4CN4 A;  1XMQ T;  2XTL A;  3RYF E;  4B3R T;  2GK9 A;  4CI2 B;  1J5W A;  4AQF C;  2K24 A;  4WW0 A;  3AA0 B;  3EVY A;  2W61 A;  3UTK A;  2XUE A;  4JI5 T;  2FJA A;  2JQQ A;  5F8P A;  4JI6 T;  1MIV A;  2YDQ A;  4P09 A;  2E9X A;  2CXL A;  4ERR A;  4L0R A;  4EB6 E;  3P4S A;  3ETU A;  2UU9 T;  4EZ4 A;  2XAJ B;  5KX5 E;  2J1D G;  5FMN A;  4DUY T;  3OPC A;  4LFB T;  2VWA A;  5M4Y A;  1J1J A;  3E0Z A;  2D5U A;  3TKL B;  4YSY A;  2JIW A;  3FXE B;  2LSJ A;  2WDV A;  3UU6 A;  2BVL A;  4LF9 T;  2RP4 A;  3E08 A;  3AVR A;  2LSK A;  2W62 A;  4C91 A;  2W63 A;  3AE8 A;  1SUM B;  5AQG B;  3OJA A;  1W0A A;  3K3Q C;  4DR3 T;  2A9U A;  2B76 A;  2W0G A;  5JVD E;  4PFP A;  5AQH B;  3C4X A;  1HR0 T;  3F2E A;  4CXY A;  3UU4 A;  5FVL A;  4P0A A;  1X79 A;  4I55 E;  2ZLY A;  2LOS A;  3BK9 A;  3UFG A;  5J2U E;  4PNI A;  4ZI2 D;  3OTO T;  5LCY A;  3ZN0 B;  3CQG B;  5EK4 A;  5HWX A;  5L3E B;  3KIN B;  3PJA A;  3U78 A;  3G06 A;  1UUR A;  3QK6 A;  4X1K E;  5FP3 A;  3RIU A;  1HX1 B;  3AEE A;  4GK0 E;  2CPT A;  2H7O A;  4DO0 A;  3ZYK A;  4OYK A;  3O9X A;  1IBL T;  4CZZ B;  4F6R C;  5HXR A;  4KHP T;  4I43 B;  3RH3 A;  2DCF A;  2VQF T;  2V7K A;  3JCF A;  3MKD A;  3UFE A;  4HFD A;  5JDH A;  1HG5 A;  4HWH A;  3C4Z A;  5LMN T;  5L2L A;  4IDN A;  2QYW A;  4IDO A;  3TLW A;  1KFY A;  1OXZ A;  2D2S A;  4NUV A;  5ABF A;  2NTX A;  4HN9 A;  5LP6 E;  2KWH A;  5IHY A;  2FJE A;  3AE4 A;  2LHN A;  4UVA B;  4X66 T;  2L8K A;  2BKN A;  3P7I A;  4YTP A;  4LF8 T;  2LRL A;  2KSR A;  3QOF A;  4HWD A;  3RGL A;  4YJ3 E;  1I94 T;  2YDS A;  3F31 A;  2Y8D A;  4TX5 A;  2LKG A;  1NEN A;  3CQX C;  4JEH B;  2PTF A;  4AQF A;  3V5U A;  3I9Y A;  4DR1 T;  2BVM A;  2KXP B;  4JLE A;  4U2Y A;  1KNR A;  3ONX A;  3FZH B;  1YKE B;  4AKH A;  1HFA A;  4I4T E;  2DNX A;  1JNZ A;  3NKZ A;  4ZI3 C;  1D0Z A;  5JDG A;  2QRX A;  3PUA A;  3PUV F;  5L4H A;  2JQH A;  4OHF A;  3LJC A;  2ZM8 A;  2H3R A;  2R6G F;  2V7J A;  5L3C B;  4ILU A;  4UVB B;  3CPZ A;  2A72 A;  2X68 A;  2JMH A;  3JAF A;  3MJX A;  3HL6 A;  4CI1 B;  3X1D A;  1U5P A;  2V6X A;  5FKY A;  2YDR A;  5LA6 E;  1WCR A;  4UXN B;  3OKQ A;  3KBT A;  5AQV B;  4H9R C;  4HFE A;  3CK6 A;  3ZCI A;  4A56 A;  3IA3 A;  4PJM A;  2WS3 A;  3CX7 B;  2JQK A;  3AVS A;  4JUY A;  3Q9D A;  3K8P C;  2NR4 A;  5JDL A;  3RHW A;  1WR0 A;  2LEH A;  5LG3 A;  3B5M A;  2LLY A;  2XQ8 A;  4X62 T;  2LRK A;  1N32 T;  3TLV A;  2K9A A;  1KF6 A;  3CVR A;  4ZI7 E;  2MOZ A;  4DV2 T;  4A98 A;  2J4G A;  4Z8X A;  2WBL A;  2UUC T;  2OLT A;  2FJD A;  3WI3 A;  2YU2 A;  3FHN A;  3PDY A;  4QH5 A;  3U3I A;  2NW7 A;  3VHL A;  1UCU A;  3ABV A;  1D0Y A;  4ILA A;  2DLR A;  4E7S A;  4QH4 A;  4H9N C;  3RF1 A;  4FJO A;  4JYA T;  3HI2 A;  1ZKE A;  1WR6 A;  2W66 A;  3RX6 A;  2LM9 A;  3ZN1 B;  1VOM A;  3SOL A;  5DAB A;  4GIW A;  4X65 T;  2JMK A;  3OYX A;  4P1N A;  4U31 A;  4X64 T;  5HAX A;  3GN5 A;  2YU1 A;  4EEB A;  3N9M A;  4KP3 C;  1CHU A;  2N2N A;  1VRB A;  4CXW A;  4ILB A;  3O1I A;  3MAC A;  3FXD B;  2X67 A;  1NWM X;  3Q5E A;  2CLY B;  3CX6 B;  2CXF A;  3ZJ1 A;  5L4E A;  1R8I A;  2LOP A;  2CMR A;  4HFI A;  3P4Q A;  5LHI B;  4DR7 T;  1QLB A;  4X1I E;  4TWH A;  4COF A;  3LK4 2;  3EAM A;  3L8R A;  5LGN B;  3L09 A;  1FMV A;  2SPC A;  2RA1 A;  5AQQ B;  2QA7 A;  4CI3 B;  4O4J E;  3QUJ A;  2BG9 B;  3ONL C;  1UUS A;  2Y6X A;  3AA6 B;  2X9Y A;  3FB2 A;  2BBH A;  3FZM B;  2W2U A;  1T7S A;  5FVK A;  4JI3 T;  4NPP A;  5AQO B;  1BR2 A;  2VVN A;  3MK7 C;  4PJN A;  3A7M A;  1S94 A;  4FI5 A;  5LHG B;  4NXN T;  5AQL B;  3ZJ2 A;  5DQV A;  1YQ4 A;  2BS2 A;  4EXT A;  3PUQ A;  3T1H T;  4HKA A;  1DU2 A;  4YXD A;  2VQE T;  3Q5D A;  5AQJ B;  2YKS A;  4M1P A;  5JR9 B;  2YK0 A;  4N78 D;  2D9D A;  2HN2 A;  4IE5 A;  2Q9Q D;  4EV6 A;  3S4U A;  4DV1 T;  2P9B A;  2YOE A;  2BG9 E;  2N1G A;  4PW8 A;  3AEC A;  3HKD E;  5JDM A;  4EYY R;  2HH7 A;  3ZC0 A;  4ZHQ E;  1MND A;  3NVO A;  3NRY A;  5FL0 A;  3OYZ A;  3N2G E;  2ZM0 A;  2FJB A;  2VKH A;  4XBF B;  2XAF B;  4IL9 A;  1E2A A;  3N2K E;  2HN1 A;  3C4W A;  2RPA A;  2ZM6 T;  1W09 A;  1BR1 A;  4B3T T;  1ZV4 X;  4H9Q C;  4O2B E;  5H6R B;  2WZH A;  4E7Z A;  4U74 A;  1VCS A;  2CRB A;  2HPJ A;  2JJ9 A;  3DJB A;  3OBV E;  4UV8 B;  3PUS A;  4TWD A;  3HKB E;  2DWG A;  3PJA J;  1LKX A;  2FUP A;  2WQY A;  2IML A;  3H3M A;  2EHO D;  2X51 A;  3RC3 A;  3KV9 A;  5KMG P;  5H6Q B;  3ZLI A;  2WB5 A;  3PTR B;  3C50 A;  4CXX A;  3RRW A;  1E7P A;  2XHE B;  3AB3 B;  5EZY E;  2D0T A;  5A1L A;  1WYC A;  3N9L A;  3ZCJ A;  4O4I E;  2NTY A;  2LSG A;  3KFW X;  5LYJ E;  3AXJ B;  2H7V C;  3BQI A;  2XQ6 A;  3AAA B;  3IEE A;  4TUY E;  1SHZ C;  2AXD S;  3UQ4 A;  4QWN B;  4IST A;  4YHJ A;  2CLY C;  1SA0 E;  4AI6 A;  2W4X A;  2DWK A;  3PV0 F;  2XQ9 A;  2CA5 A;  4ZOL E;  1E1H B;  3BQL A;  2QGS A;  4L9I A;  4P0B A;  1CUN A;  3NWI A;  3F57 A;  4AIS A;  2VL0 A;  3H3A A;  4DR5 T;  5HYA A;  2BG9 C;  4PAG A;  3AA1 B;  2BZB A;  4IE4 A;  2XAQ B;  5JDF A;  5LHH B;  2WCA A;  4IE7 A;  4IGU A;  4ZS2 A;  3IBP A;  5JRE A;  2JQ9 A;  4U72 A;  2Y48 B;  4CN6 A;  5LNK A;  5FXW A;  3ZPO A;  5C8Y E;  1BR4 A;  5L3G B;  4NUU A;  3RC8 A;  4H9O C;  2H89 A;  4H9S E;  2E9X D;  4U33 A;  2VKJ A;  3AEA A;  4UR9 A;  3TLT A;  4KX6 A;  5E0O A;  2V7M A;  1IBK T;  5HXC A;  3VR8 A;  4QH1 A;  2LHR A;  1HG2 A;  3JAD A;  5AQS B;  4UF0 A;  2IW5 B;  1HNZ T;  4PJJ A;  3AA7 B;  1GQE A;  1WYB A;  2ZM2 A;  5L3B B;  2WWU A;  1T72 A;  4ZXL A;  2L3L A;  4BA9 A;  4EZH A;  4MFR A;  3JC6 D;  3T1Y T;  4YSX A;  5JH7 E;  5LG4 A;  2X66 A;  4KI0 F;  3A8Y C;  4WYV A;  3IHR A;  2K5B B;  2MYS A;  2XPK A;  3I0Q A;  4HFV A;  2IDO B;  3LK2 B;  5EK2 A;  3AE3 A;  3KV5 A;  3H37 A;  4HWF A;  2V26 A;  1KK7 A;  4UEM A;  3UU3 A;  2LM2 A;  3N5L A;  4QXH B;  5LXT E;  3CML A;  4NXM T;  3HA4 A;  2K48 A;  5ABF B;  4ZZB A;  2Z6E A;  4HFH A;  4KBM B;  3VRA A;  5LGT B;  1Y64 B;  1I6Z A;  5JDQ A;  3UQ7 A;  4DMW A;  4JI7 T;  1KNZ A;  4LFA T;  1HNX T;  3P4R A;  2WDQ A;  2OV9 A;  1XNQ T;  4A97 A;  4MAL A;  4LMJ A;  3VR9 A;  4TWF A;  4JV5 T;  2D0U A;  4OX9 T;  3PUX F;  4WZX A;  5JDN A;  1W0B A;  3NZP A;  4U3C A;  2VKO A;  4TNW A;  3QC9 A;  1ZP0 A;  4YT0 A;  5FL1 A;  3J9X 1;  2W00 A;  3AED A;  3UU5 A;  2XM1 A;  4O4H E;  3CX8 B;  4Z91 A;  4TN7 B;  1US7 B;  1WLX A;  4NIQ A;  2K3W A;  2CWO A;  3AAI A;  4OFZ A;  4BJM A;  1XNR T;  2BG9 A;  2UXC T;  3PUW F;  5ADX L;  5C2T A;  1OWA A;  2H88 A;  3B13 A;  2XQ4 A;  1WRD A;  3CKD A;  3N9P A;  1XWM A;  3ZST A;  3C51 A;  4KMC A;  3KV4 A;  1IJ5 A;  2M6B A;  2WAU A;  4U7I A;  2LKH A;  5HCJ A;  5AQM B;  4V1A v;  4DV0 T;  3PUG A;  5DJQ C;  2VVS A;  2J62 A;  1HCI A;  4H9P C;  2C5K T;  4TV9 E;  4H63 V;  5JRC B;  2DL1 A;  4B6X A;  1LRZ A;  2XQY A;  4G63 A;  5L3D B;  3RIF A;  2G0U A;  3R6N A;  2XSA A;  2E2A A;  4DUZ T;  4ASK A;  3RQU A;  4AKI A;  4AQY T;  2E8I A;  2NP9 A;  5J2T E;  5LOV E;  4JBW F;  2X9X A;  3RRC A;  4EOZ B;  3LDQ B;  3SS1 A;  3HKC E;  2CBJ A;  1T98 A;  4Q25 A;  3AAE B;  3BQK A;  3C98 B;  5ABH A;  5F3J A;  4O8S A;  5LBM A;  5FY0 A;  2ACX A;  2PFV A;  4GYR A;  4PK6 A;  2V6Y B;  4ZZC A;  3D0T A;  2Q9Q B;  5AQU B;  2XSB A;  4MLK A;  2WM9 A;  3EDV A;  3RKO A;  3C64 A;  3PU3 A;  3MXZ A;  4YTM A;  4BJN A;  3QB5 K;  4IDZ A;  1QUU A;  1G73 A;  3R84 B;  3LBX B;  3ZMS B;  2X0Y A;  2LT3 A;  5LJN A;  2V7I A;  1MIW A;  5HXS A;  2YIN A;  4I50 E;  2WSS V;  5L47 A;  1WFD A;  2BKO A;  4AIU A;  2NOX A;  4X20 E;  1N34 T;  1YD8 G;  2JPF A;  4UEL A;  4IDP A;  2C5I T;  4LF7 T;  5AQT B;  4DND A;  2VK9 A;  4DR4 T;  1D1C A;  4UVC B;  3ZYL A;  4ADZ A;  2MTQ A;  5AQF B;  1M7K A;  1W9R A;  4K0K T;  3M65 A;  1JNR A;  1YKH B;  4GKJ T;  3O1J A;  3FZL B;  3GA8 A;  2JRK A;  2PBI A;  5KDM C;  1OED B;  3P4P A;  1UGO A;  4EED A;  2IAK A;  2OA5 A;  2EHO B;  5AQR B;  3EHZ A;  2ACZ A;  2VL8 A;  5LJM A;  2CXD A;  5AQI B;  3P50 A;  4DR2 T;  3AXJ A;  3AE1 A;  2E5V A;  3RYI E;  4GK5 E;  3ZSS A;  5CA1 E;  3HR0 A;  1S35 A;  4J2C A;  3AE5 A;  4YTN A;  2WMO A;  3I1A A;  3AEG A;  4X1Y E;  1Z8U A;  2XQ3 A;  3HKE E;  1FJG T;  4AKL A;  4CN1 A;  3KV6 A;  5ETW A;  4IL4 A;  3KVA A;  3ZMU B;  2V7L A;  4MHC A;  4EYU A;  3TLU A;  4DBQ A;  4WBO A;  3ONJ A;  2ODV A;  4DV6 T;  4IE6 A;  4YFS A;  5AQP B;  3AE6 A;  5AFU L;  1QSD A;  3PUZ F;  2ES0 A;  3K3O A;  4ANJ A;  2CEA A;  3PE0 A;  3I0O A;  5TAO A;  3VU7 H;  4QXC B;  4LF4 T;  4ZI3 D;  1OED E;  2BS3 A;  4QKN A;  2V5D A;  5CB4 E;  2LSI A;  4C90 A;  3ANW B;  3UT5 E;  3UUL A;  3ZMT B;  4CQI A;  1LVK A;  5FYM A;  4KUM B;  2M67 A;  4YHH T;  3KVB A;  5AQK B;  5FXX A;  3N9Q A;  4IIJ E;  2KND A;  5BMV E;  3Q2M A;  1FIO A;  1UK5 A;  4U2Z A;  3LFM A;  2B1E A;  2F4V T;  2CE7 A;  3N9O A;  1YXR A;  1XDO A;  3TLS A;  4AKR B;  1IJ6 A;  2MBG A;  3WAK A;  3ZC1 A;  3LG7 A;  4WNK A;  4KHZ F;  2E9X B;  2IIU A;  2WU2 A;  1IZN B;  3GMI A;  2ODU A;  1HTJ F;  4HGA A;  4PK4 A;  2KLQ A;  2WP9 A;  5AQN B;  4HWC A;  1NEK A;  3MZK B;  4YJ2 E;  3AEF A;  4IDQ A;  5JQG E;  3V5S A;  3NRX A;  4BAY B;  1NAF A;  3EUH A;  4JI2 T;  2WDR A;  2BBJ A;  4XZC A;  2KT9 A;  2CBI A;  2Q9Q C;  4GKK T;  4EIW A;  1L0V A;  2DI4 A;  2LJL A;  3ZEF B;  2UUA T;  3FZF B;  5LMU T;  4JI1 T;  3MA9 A;  4WBN E;  1X9B A;  3VKG A;  5LBQ B;  4DR6 T;  3K1S A;  5FY7 A;  4DBR A;  5HWY A;  3RYH E;  2CHN A;  4IHJ E;  1FEW A;  3RIA A;  2XJ7 A;  4PFO A;  2XAH B;  4I0U A;  1MMN A;  3PU8 A;  2X9W A;  1XMO T;  5FY1 A;  3SFE A;  2IC9 A;  4QX7 B;  1N33 T;  5JR9 C;  3FBZ A;  2VB6 A;  5LGU B;  4OK0 A;  2XQA A;  5IUX A;  4ZS3 A;  4O2A E;  1XZY A;  2WZI A;  4QXB B;  1H7C A;  5F5W A;  4DV4 T;  5LB7 B;  1ZEE A;  5HEH A;  3EAB A;  4QHO A;  1OED C;  2V1D B;  4UV9 B;  5HEO A;  4EAH A;  3N2O A;  3L3P A;  3O1H A;  2PG8 A;  3UU8 A;  3ZT7 A;  2EHO C;  4LF5 T;  3RPU A;  3B57 A;  4GOU A;  2KWI B;  2X9H A;  3ZKR A;  4TNV A;  2WU5 A;  2IHR 1;  3W15 B;  3RYC E;  3UUN A;  3AE2 A;  3CWZ B;  3L39 A;  3P8C D;  1HNW T;  3EDU A;  3SFD A;  2QVA A;  2CWY A;  3Q5W A;  4H63 H;  3O4X E;  2J47 A;  2UXX B;  3DP7 A;  5L3F B;  5FXV A;  1D1A A;  3ZMZ B;  4AQG A;  5CJ5 A;  3SRZ A;  1ZHC A;  5CA0 E;  2A2F X;  5FNV E;  1KEY A;  3FBL A;  4YY3 T;  3UUM A;  2DHR A;  3AE7 A;  3OVU A;  4DV5 T;  1ZOY A;  4ZI2 C;  1N36 T;  3CQC B;  3VRB A;  5C3J A;  1U4Q A;  2HPL A;  2UUB T;  4UF0 B;  5JRC A;  4DV3 T;  2C5J A;  2FBW A;  4LML A;  1J5E T;  2UXB T;  4TV8 E;  4LFC T;  4QX8 B;  1XDP A;  3IF8 B;  4PJL A;  1B7T A;  4JEU B;  2XY8 B;  3KDS E;  4ZEY A;  4XAX B;  2KZ7 B;  1O3X A;  1FMW A;  4U7Y A;  2XQ7 A;  2BDE A;  2V5C A;  2W67 A;  4YSZ A;  3LK3 B;  2YN6 A;  5GON E;  3ZMV B;  4HWI B;  1MMA A;  3K3N A;  3FZK B;  3EI0 A;  2E9X C;  4IE0 A;  2V6Y A;  3RQW A;  4B3S T;  1MMD A;  3LSV A;  3GWH A;  3ZT5 A;  5JTG A;  2MAW A;  5HEU A;  4PK5 A;  2Q9Q A;  3DTO A;  2VKD A;  3PUY F;  1VCT A;  2KMF A;  4HEA A;  3RKG A;  4ISS A;  1IBM T;  3VKH A;  3ESL A;  3ETV A;  2XAS B;  1AJ3 A;  3LBX A;  5CGM A;  2UXN B;  5DQW A;  4HTE A;  3P4W A;  4UIG A;  2I59 A;  3SWH A;  5KXJ A;  5FXZ A;  2X0L B;  1UX4 A;  2MPK A;  1Z0P A;  2VAS A;  5HEG A;  4DMV A;  3RI5 A;  4G2A A;  4A5X A;  5J0Z A;  1YQ3 A;  2I0M A;  2X0H A;  2C0S A;  3QNU A;  3T8O A;  1Y01 A;  2WMN A;  5IYZ E;  3JC6 C;  3UUB A;  4K0U A;  4IT4 A;  5JR9 A;  3AE9 A;  3I9W A;  2N9D A;  2L9Q A;  4OYJ A;  1T8B A;  2BS4 A;  3WAJ A;  4JI8 T;  2LSY A;  2YEV C;  2M6I A;  4AXP A;  2AE9 A;  1OED A;  2BKP A;  2NW9 A; 
#chains in the Genus database with same CATH homology
 5AQH B;  4HWH A;  1HX1 B;  3A8Y C;  1M62 A;  5AQN B;  1UGO A;  4HWC A;  4HWD A;  5AQT B;  3LDQ B;  5AQK B;  3FZM B;  5AQJ B;  5AQV B;  3FZH B;  1M7K A;  5AQF B;  1T7S A;  3FZF B;  5AQG B;  5AQQ B;  4HWI B;  5AQM B;  2D9D A;  3M3Z B;  3FZK B;  5AQU B;  5AQR B;  5AQL B;  1UK5 A;  5AQP B;  5AQO B;  5AQI B;  5AQS B;  3FZL B;  4HWF A;  1I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...