3FZHB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzhB00
5AQFB 3FZMB 4HWDA 5AQMB 5AQSB 3LDQB 4HWFA 3A8YC 1M62A 4HWHA 4HWCA 5AQLB 5AQVB 5AQTB 5AQIB 4HWIB 1T7SA 5AQJB 1I6ZA 3M3ZB 1HX1B 5AQGB 2D9DA 5AQHB 3FZKB 3FZFB 1M7KA 5AQKB 5AQPB 5AQNB 5AQRB 5AQQB 5AQOB 5AQUB 3FZLB 1UK5A 1UGOA 3FZHB
chains in the Genus database with same CATH superfamily
2AXDS 3ZN1B 4Z90A 2W2UA 3UU6A 4F6RC 2WAUA 3L39A 1YD8G 3AB3B 5HEGA 5HXRA 3ZMTB 4MHCA 4AISA 5J0ZA 4DR3T 4IDOA 1XMQT 3FZKB 3ZLIA 4DV7T 3P4PA 4QXBB 3QB5K 2XM2A 3CKDA 3C4WA 3O9XA 2Q9QA 4ZI3D 3MA9A 5KX5E 2V8SV 2XM1A 2RA1A 2HH7A 3CK6A 3C51A 1V9DA 2LHNA 5HEOA 3CQXC 5AQPB 3PU3A 4GYRA 2LKGA 2V5CA 2CRBA 2JQKA 1H7CA 4UR9A 1B7TA 1MMAA 2QGSA 4AQYT 4HFEA 4TV9E 2F4VT 4MBQA 4DR7T 1E7PA 3BQIA 3E22E 3AEBA 3ZMVB 4ILUA 2K9AA 4YSZA 2W67A 3EDUA 2X9YA 3F31A 2QRXA 4A56A 5AQUB 3OJAA 2VL8A 3LK42 1N32T 1SA0E 4UEMA 2K5BB 1T7SA 3P4SA 2XQ8A 4TV8E 3RKOA 1LVKA 2LSGA 4YT0A 4X1IE 5FVKA 4H63V 4BA9A 4EIWA 2W61A 3LG7A 2QVAA 3K3NA 2EHOA 5LG3A 4AI6A 3QOFA 4LMKA 5FKYA 2WY2A 3H3AA 2I59A 1QLBA 1XNRT 4IL9A 2JRKA 2IIUA 2W66A 2OA5A 3TLVA 2EHOC 4H9QC 2WU5A 4HWCA 1T8BA 2H7VC 2C5JA 3K3OA 3RC3A 4CZZB 2MOZA 2LKHA 3DP7A 5CJ5A 3PUVF 2ACXA 2W4XA 3CQGB 4ADZA 3F57A 3RYCE 3V5SA 1T72A 4TN7B 3EVYA 5LJMA 4N78D 3SFDA 2L8KA 3PE0A 2UUCT 2YDQA 3PJAJ 3RQUA 4IE7A 5LMNT 2LM2A 2FJBA 3P4WA 4AIUA 4ZS2A 3PU8A 3BK9A 4DV4T 2CHOA 2CXFA 3UUNA 4O4LE 4IREA 5L2LA 3IHRA 3FXEB 3MJXA 3OTOT 3KV6A 4U2ZA 3WI3A 5ABFA 4ZZCA 4H63H 3ABVA 4JI0T 3HKCE 3N2KE 3AEFA 3HR0A 1I94T 4IDZA 1XZYA 4K0KT 1Z0PA 2NW9A 3ZJ1A 4ILBA 4AQFA 5ABEA 4JI4T 2ZM8A 2M67A 1N33T 5LGUB 2BBJA 4AXPA 4NPPA 3GA8A 3AA0B 3RRWA 3ONLC 1ZV4X 3PV0F 4I43B 1MIWA 2YU1A 1O3XA 2LSKA 2V6XA 4G63A 3AE6A 4O2BE 3NVOA 3AXJB 2BKNA 3RF1A 2V1DB 3HA4A 2XAGB 4YJ3E 3H37A 1NEKA 3ONXA 2VKHA 5BMVE 2H89A 5HYAA 5BR8T 3N9QA 3AE5A 3VR8A 3LBXB 1YQ4A 3AEGA 1HS7A 1LVFA 2N1GA 5LCYA 3JC6C 2XHEB 2JMHA 4ZI7E 1WFDA 5HCMA 4DIDB 1KNZA 2KSRA 2OLTA 2XQ5A 3M3ZB 4EZ4A 5FY1A 4JLEA 4PNIA 2XAHB 4EEBA 2CLYC 5FL0A 2W00A 5JDGA 4BJMA 1UUSA 1XMOT 2HPLA 4CN4A 2H3RA 2BVMA 2LM9A 4LMJA 5AQVB 4O2AE 2DI4A 2DWKA 5AQKB 3ZMZB 1X79A 4CI1B 1Y01A 4QH1A 4GKKT 3C4XA 4UXNB 3BQKA 3T1HT 5LYJE 2DNXA 2WSSV 5AQMB 4CXXA 3Q5XA 2CBJA 4DV1T 3SOLA 3AE7A 4NXNT 5ABGA 1CHUA 5JRCA 1XNQT 3VKGA 3HL6A 1WCRA 1J5ET 1HX8A 4IDQA 4GK0E 3KFWX 3RHWA 3KVBA 3ZPOA 4B6XA 2I6HA 4HGAA 4AQGA 1KEYA 2VVSA 2NW8A 3SRZA 4JI3T 1W9RA 3ANWB 2IHR1 4EYYR 2M6IA 2WWVA 1JNZA 5JR9B 4AKIA 1EZ3A 4KMCA 3FXDB 3O1HA 3WAJA 4IE4A 4TWDA 2WCAA 1J5WA 3WAKA 2BZBA 5AQIB 2CWYA 3J9X1 2E5VA 3N9MA 2WZHA 1AJ3A 4MFRA 4UV8B 4QWNB 4DR4T 2CCQA 5IHYA 2JQ9A 3GN5B 1IZNB 4JI7T 5C8YE 2VQFT 2CPTA 3RIFA 1YKHB 2PG8A 4WZXA 2VB6A 2M6BA 3AA7B 4QH4A 3RRCA 2YU2A 4H9RC 4ZI3C 5C2TA 3B57A 1YW0A 2LRLA 1M62A 2BS4A 4ZXLA 3LSVA 2V5DA 3N9PA 2X9WA 4OHFA 1HNWT 4LFAT 1WLXA 1Y64B 4HFHA 4YHJA 3C64A 2ZM6T 3ZEFB 2FJDA 2ODUA 5F5WA 3EI0A 2VKOA 2H7OA 4PK6A 4IDNA 2V7JA 4P0AA 5EK2A 3TLUA 4H9OC 4EOZB 4F8HA 2X0LB 4XZCA 4DUZT 2VASA 2YKSA 1XWMA 4IIJE 4DR2T 1HNZT 2C5IT 1NENA 4AKRB 1UX5A 2PJQA 1SE7A 4TUYE 3ETUA 3GWHA 2YOEA 4DV5T 5LBMA 3Q2MA 3A7MA 5LHHB 1D0ZA 2J62A 1LRZA 3HKDE 3RC8A 2X51A 4IDPA 3VR9A 4LF7T 4U31A 2V6YA 3GN5A 5FY7A 4AKLA 3NRXA 2DLRA 4DUYT 3AAIA 4JBWF 3AE9A 3A5XA 5CA1E 3FZMB 4U7YA 4U72A 5HEJA 1N36T 4HFVA 1LKXA 3ZCIA 1HTJF 3VRAA 4X1KE 2UXBT 5JQGE 3UFGA 2Q9QC 1BR2A 2CA5A 4OK0A 1BR1A 2CMRA 4LFCT 5FNVE 1BR4A 3UULA 5FXVA 4U74A 2XSAA 4QXHB 3ZMUB 1HG5A 3H3MA 5F8PA 3KV9A 4LFBT 1OEDE 1FMVA 4C91A 2LHRA 5A1LA 3AEDA 1ZOYA 4HFCA 3PUAA 5C3JA 3PUSA 3RX6A 4IT4A 5HEHA 3KBUA 1YXRA 3PUQA 2MYSA 3ZT7A 1CUNA 1HFAA 2JQHA 3L3PA 2HN1A 4ZS3A 4EZHA 5AQHB 1U4QA 5L3FB 2PFVA 2VVNA 4UVBB 3HKBE 5HWXA 3UU8A 5AQFB 2WBLA 3AAEB 4TZ4C 4NUUA 2NP9A 2LSIA 5CGMA 2VKDA 3OBVE 3CQCB 2X0HA 1M7KA 2Y48B 4LF9T 3K3QC 5AQOB 3PTRB 2CHNA 5DJQC 5LHGB 5DABA 1D1AA 2ZMAA 1OEDB 3FBLA 3RH3A 2VURA 2FBWA 2WMNA 1KF6A 1QSDA 2FJEA 4H9SE 4EB6E 5EZYE 4O4JE 1Z8UA 2D5UA 2CBIA 1G8XA 1NWMX 2V7KA 4QH5A 2KNDA 3P7IA 4EGWA 2XQ9A 4Q25A 2BG9E 2NWBA 4TNVA 1IBKT 4DR6T 2JPFA 1W0BA 3O1JA 2V26A 2RP4A 2XJ7A 5HXCA 4KP3C 3ZMSB 5L3CB 4LF8T 5L3GB 3N2OA 4L0RA 4NIQA 1VCSA 4XAXB 2LE8A 3PUGA 2OV9A 2K3WA 4IL4A 2XTLA 3E08A 1HX1B 4DO0A 4TWHA 5E0OA 3R84B 3Q5EA 3CIRA 2PBIA 3KDSE 3UU3A 4UV9B 4L5GA 3U78A 5JDHA 2Z6EA 4O4IE 4NUVA 4CXYA 2E2AA 4EV6A 3SFEA 3VU7H 3B13A 3E0ZA 5FMNA 2E9XB 2WDRA 2B1EA 2BG9B 3CX6B 1ZHCA 3N9NA 4UVCB 2D9DA 1UX4A 2UXNB 1E2AA 2BS3A 3RYIE 1X9BA 5LJNA 3NRYA 4AQFC 2KT9A 5FYMA 2Y8DA 2IC6A 3KBTA 1SHZC 2XY8B 2CXDA 3ZYKA 4ASKA 3ZYMA 4PAGA 4WBOA 2X67A 4DVDA 2XQ6A 4UIGA 4ZI2D 5L4HA 3OYZA 3AE2A 5GONE 1UK5A 4KI0F 3Q9DA 2YEVC 3BQLA 4EEDA 1GQEA 4HWHA 4CI2B 3PUZF 3AA6B 4YTPA 2WU2A 3ZSTA 3UU4A 2Y6XA 4X65T 5J2UE 2WZIA 3FHNA 2K24A 5LNKA 2DHRA 4JEUB 3AVSA 4X1YE 2FJAA 1FJGT 4PK4A 1J1JA 1KNRA 1ZKEA 2QYWA 2UUAT 4KX6A 3N9OA 4HEAA 3JADA 2L9QA 5L4EA 4PJMA 1HNXT 4IHJE 3AXJA 4V1Av 3IEEA 2VWAA 5H6QB 4B3MT 3AEEA 4JV5T 1WYBA 2RPAA 4GKJT 5LP6E 3LBXA 3RPUA 3JAEA 5ETWA 4P09A 4DV2T 4PJNA 3UQ7A 3NZPA 4E7SA 3CVRA 2IAKA 2LRKA 2WMOA 4JEHB 4JI1T 4HFIA 3MZKB 4YY3T 4E7ZA 3OVUA 4LF6T 4JYAT 4U3CA 1KFYA 2W62A 3PUWF 1NAFA 4X5TA 3NZQA 2IMLA 2CM0A 4PJJA 5LA6E 5LOVE 2KMFA 1UCUA 2J1DG 4UF0B 3ZKRA 2IUBA 5LG4A 2C0SA 2XQ3A 5M4YA 1N34T 3ZN0B 1SUMB 1MMGA 2ZM0A 4PFPA 4GOUA 4QX7B 2YN6A 4DR5T 4TWFA 4QHOA 1S35A 3I0QA 2E9XD 4HN9A 2SPCA 2NW7A 4J2CA 4X66T 5F3JA 3N9LA 2WWUA 5IUXA 3R6NA 4DBRA 5TAOA 1D0YA 2Q9QB 4CXWA 2KZ7B 2PTFA 2DWGA 3L09A 1ZP0A 2A2FX 3EDVA 4EXTA 4YSXA 2XQ7A 4B3TT 3OYXA 4GK5E 3X1DA 4ZEYA 3U3IA 3ANWA 2LOSA 3RI5A 1YQ3A 2X0YA 3MXZA 4YTMA 5JR9A 1HR0T 2BBHA 2D2SA 4HFDA 5DQWA 3MACA 2G0UA 4KBMB 4U2YA 4PW8A 2DL1A 2KINB 4CN1A 1MMNA 5HXHA 3OPCA 4IE5A 2KWIB 3CX7B 2IW5B 4IE0A 4DR1T 4HKAA 4OX9T 2V7MA 4YJ2E 4P0BA 1KNPA 1WR0A 4GYSA 1OXZA 2WM9A 1MNEA 5H6RB 2UXXB 3SS1A 4X64T 2D0TA 3UU5A 2X68A 3Q5DA 2N2NA 4WYVA 3G06A 3AE4A 4M1PA 4DBQA 3O1IA 2LSJA 4ILCA 4C90A 3V5UA 2XAJB 1MMDA 2XPKA 5KMGP 4A98A 4OFZA 5CA0E 2EHOB 3ETVA 4HTEA 5AQQB 5KXJA 3MK7C 3AAAB 3TLSA 4CQIA 3ZT6A 5FY0A 5L3EB 3KV5A 3ZC1A 2BS2A 3HI2A 3VKHA 3P50A 5LMUT 4U33A 2WS3A 1WR6A 4CN6A 4K0UA 2VKJA 3FZLB 1W09A 3FB2A 3GMIA 3IA3A 3LFMA 3DJBA 5IYZE 3VRBA 2C5KT 2KXPB 2LSYA 3IF8B 3LK2B 5L3BB 4LF5T 3RIUA 3D0TA 2VK9A 5LGTB 2ACZA 2CXLA 4TX5A 4COFA 1OWAA 1UGOA 4ERRA 2IC9A 3LJCA 4DMWA 2QA7A 1JNRA 2X66A 3EUHA 2BKOA 3RIUC 1D1BA 4JUYA 5AQLB 2V7IA 3UQ4A 3I0OA 1W0AA 2I0MA 3FZFB 4UVAB 3ZT5A 2ES0A 4JI2T 5AFUL 3ESLA 1XDPA 2MTQA 4ZHQE 3PUXF 5HAXA 1FEWA 5JH7E 3C98B 3PDYA 2VL0A 5AQSB 1YKEB 1L0VA 3J7Yq 1IBLT 4ZZBA 3RYFE 2MAWA 5ABFB 2BDEA 4EAHA 5JTGA 5FP3A 3QC9A 2E8IA 4IE6A 2Q9QD 2HN2A 3C50A 2E5LT 5J1GA 4H9PC 4DV3T 3AEAA 4FJOA 2W63A 5DQVA 4G2AA 4XBFB 4PK5A 1MNDA 2KWHA 4HWIB 1I6ZA 1FIOA 2DCFA 4FI5A 4PFOA 2XQYA 4WW0A 5JDQA 2WQYA 4ZI2C 5AQRB 2MBGA 1XDOA 4H9NC 3UT5E 4AKGA 4Z91A 2UUBT 2W0GA 5JVDE 3LDQB 3UUBA 4HWFA 5HEUA 1KK7A 2ZM2A 3AVRA 1IBMT 4UELA 2P9BA 4HWDA 3K8PC 2CLYB 3B5MA 2XQAA 3AA1B 3M65A 3Q5WA 2YDSA 4AKHA 2J47A 4ISSA 2ZLYA 1OEDA 4BJNA 2A72A 4U7IA 4JI8T 3LK3B 1HCIA 4MLKA 1WRDA 3ONJA 1IJ5A 2LLYA 2YDRA 2A3DA 4A5XA 4JI5T 2WP9A 4DMVA 3ZCJA 3C4ZA 2KLQA 1OEDC 2JJ9A 2YK0A 3P4QA 5LB7B 2XUEA 3ZYLA 5JDMA 2J4GA 2EHOD 5LGNB 4KHPT 1S94A 5CB4E 4IGUA 4ZOLE 3AECA 1MIVA 3JCFA 3JAFA 1FMWA 5L3DB 2CE7A 1VRBA 1ZEEA 4ILAA 5JRCB 3N5LA 4LMLA 2NTYA 2R6GF 1QUUA 3P4RA 3I9WA 1IJ6A 3W15B 3HKEE 5AQTB 2LOPA 3CMLA 3QNUA 3NWIA 2NR4A 3QUJA 5AQNB 2FUPA 3UUXB 3O4XE 3ZSSA 2NOXA 3N2GE 1VOMA 2B76A 4I55E 4B3RT 3NKZA 2X9HA 2ODVA 3QB5A 4YSYA 3I9YA 4LF4T 5AQJB 3RGLA 3ZC0A 2E9XA 4GIWA 3DTOA 2BG9A 4O4HE 2UXCT 2K48A 4TNWA 4I0UA 3A8YC 2MPKA 4DV6T 3I1AA 3TKLB 2VQET 1IAPA 2YINA 2E9XC 1D1CA 2BG9C 2HPJA 3MKDA 5JDFA 5HXEA 2XAQB 2GK9A 4DV0T 3KINB 3TLWA 1G73A 3AE3A 4KHZF 2A9UA 5CFBA 2XASB 3PJAA 4EYUA 3EHZA 2JQQA 4YFSA 3TLTA 4B3ST 4A97A 5AQGB 3PURA 3UTKA 4WNKA 4YLHA 4QKNA 5HWYA 3VHLA 3T8OA 1VCTA 5JDNA 1DU2A 3FBZA 5JDLA 3RYHE 1MIYA 2V7LA 3RKGA 1E1HB 4QXCB 2WDVA 2AE9A 5ADXL 2LT3A 5LBQB 4PJLA 2UXDT 3CPZA 3P8CD 4I4TE 1T98A 4WBNE 3EABA 4HFBA 4YHHT 3UUMA 3RQWA 2WB5A 2IDOB 3JC6D 3OKQA 1UURA 1R8IA 2N9DA 4X20E 1US7B 1WYCA 3FZHB 5J2TE 4JI6T 5EK4A 3SWHA 4X62T 4QX8B 5L47A 2NTXA 3UFEA 3T1YT 5FL1A 3AE1A 2LEHA 2XAFB 2H88A 2HHHT 4Z8XA 2CWOA 3RLFF 2JIWA 4BAYB 5IWAT 5KDMC 2V6YB 2LJLA 4DNDA 3NBXX 5JREA 3PUYF 1BR0A 2BKPA 5HCJA 3AE8A 3KV4A 5FXZA 2UU9T 3KVAA 2D0UA 5FXWA 5FXXA 2XSBA 1D0XA 3K1SA 4MALA 5LXTE 4KUMB 2XQ4A 4NXMT 5FVLA 4O8SA 2JMKA 5EK3A 2WDQA 4YTNA 4P1NA 3EAMA 3L8RA 3CWZB 2XZEA 4ISTA 2X9XA 5HXSA 5ABHA 5LHIB 4OYJA 2L3LA 5JR9C 3CX8B 4OYKA 1U5PA 3RIAA 2CEAA 4UF0A 4CI3B 3QK6A 3S4UA 1HF8A 1HG2A 4I50E 3F2EA 4ANJA 4YXDA 4HE8A 3ZJ2A 2BVLA 4L9IA 3IBPA
chains in the Genus database with same CATH topology
5AQFB 3FZMB 4HWDA 5AQMB 5AQSB 3LDQB 4HWFA 3A8YC 1M62A 4HWHA 4HWCA 5AQLB 5AQVB 5AQTB 5AQIB 4HWIB 1T7SA 5AQJB 1I6ZA 3M3ZB 1HX1B 5AQGB 2D9DA 5AQHB 3FZKB 3FZFB 1M7KA 5AQKB 5AQPB 5AQNB 5AQRB 5AQQB 5AQOB 5AQUB 3FZLB 1UK5A 1UGOA 3FZHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQF B;  3FZM B;  4HWD A;  5AQM B;  5AQS B;  3LDQ B;  4HWF A;  3A8Y C;  1M62 A;  4HWH A;  4HWC A;  5AQL B;  5AQV B;  5AQT B;  5AQI B;  4HWI B;  1T7S A;  5AQJ B;  1I6Z A;  3M3Z B;  1HX1 B;  5AQG B;  2D9D A;  5AQH B;  3FZK B;  3FZF B;  1M7K A;  5AQK B;  5AQP B;  5AQN B;  5AQR B;  5AQQ B;  5AQO B;  5AQU B;  3FZL B;  1UK5 A;  1UGO A;  3FZH B; 
#chains in the Genus database with same CATH topology
 2AXD S;  3ZN1 B;  4Z90 A;  2W2U A;  3UU6 A;  4F6R C;  2WAU A;  3L39 A;  1YD8 G;  3AB3 B;  5HEG A;  5HXR A;  3ZMT B;  4MHC A;  4AIS A;  5J0Z A;  4DR3 T;  4IDO A;  1XMQ T;  3FZK B;  3ZLI A;  4DV7 T;  3P4P A;  4QXB B;  3QB5 K;  2XM2 A;  3CKD A;  3C4W A;  3O9X A;  2Q9Q A;  4ZI3 D;  3MA9 A;  5KX5 E;  2V8S V;  2XM1 A;  2RA1 A;  2HH7 A;  3CK6 A;  3C51 A;  1V9D A;  2LHN A;  5HEO A;  3CQX C;  5AQP B;  3PU3 A;  4GYR A;  2LKG A;  2V5C A;  2CRB A;  2JQK A;  1H7C A;  4UR9 A;  1B7T A;  1MMA A;  2QGS A;  4AQY T;  4HFE A;  4TV9 E;  2F4V T;  4MBQ A;  4DR7 T;  1E7P A;  3BQI A;  3E22 E;  3AEB A;  3ZMV B;  4ILU A;  2K9A A;  4YSZ A;  2W67 A;  3EDU A;  2X9Y A;  3F31 A;  2QRX A;  4A56 A;  5AQU B;  3OJA A;  2VL8 A;  3LK4 2;  1N32 T;  1SA0 E;  4UEM A;  2K5B B;  1T7S A;  3P4S A;  2XQ8 A;  4TV8 E;  3RKO A;  1LVK A;  2LSG A;  4YT0 A;  4X1I E;  5FVK A;  4H63 V;  4BA9 A;  4EIW A;  2W61 A;  3LG7 A;  2QVA A;  3K3N A;  2EHO A;  5LG3 A;  4AI6 A;  3QOF A;  4LMK A;  5FKY A;  2WY2 A;  3H3A A;  2I59 A;  1QLB A;  1XNR T;  4IL9 A;  2JRK A;  2IIU A;  2W66 A;  2OA5 A;  3TLV A;  2EHO C;  4H9Q C;  2WU5 A;  4HWC A;  1T8B A;  2H7V C;  2C5J A;  3K3O A;  3RC3 A;  4CZZ B;  2MOZ A;  2LKH A;  3DP7 A;  5CJ5 A;  3PUV F;  2ACX A;  2W4X A;  3CQG B;  4ADZ A;  3F57 A;  3RYC E;  3V5S A;  1T72 A;  4TN7 B;  3EVY A;  5LJM A;  4N78 D;  3SFD A;  2L8K A;  3PE0 A;  2UUC T;  2YDQ A;  3PJA J;  3RQU A;  4IE7 A;  5LMN T;  2LM2 A;  2FJB A;  3P4W A;  4AIU A;  4ZS2 A;  3PU8 A;  3BK9 A;  4DV4 T;  2CHO A;  2CXF A;  3UUN A;  4O4L E;  4IRE A;  5L2L A;  3IHR A;  3FXE B;  3MJX A;  3OTO T;  3KV6 A;  4U2Z A;  3WI3 A;  5ABF A;  4ZZC A;  4H63 H;  3ABV A;  4JI0 T;  3HKC E;  3N2K E;  3AEF A;  3HR0 A;  1I94 T;  4IDZ A;  1XZY A;  4K0K T;  1Z0P A;  2NW9 A;  3ZJ1 A;  4ILB A;  4AQF A;  5ABE A;  4JI4 T;  2ZM8 A;  2M67 A;  1N33 T;  5LGU B;  2BBJ A;  4AXP A;  4NPP A;  3GA8 A;  3AA0 B;  3RRW A;  3ONL C;  1ZV4 X;  3PV0 F;  4I43 B;  1MIW A;  2YU1 A;  1O3X A;  2LSK A;  2V6X A;  4G63 A;  3AE6 A;  4O2B E;  3NVO A;  3AXJ B;  2BKN A;  3RF1 A;  2V1D B;  3HA4 A;  2XAG B;  4YJ3 E;  3H37 A;  1NEK A;  3ONX A;  2VKH A;  5BMV E;  2H89 A;  5HYA A;  5BR8 T;  3N9Q A;  3AE5 A;  3VR8 A;  3LBX B;  1YQ4 A;  3AEG A;  1HS7 A;  1LVF A;  2N1G A;  5LCY A;  3JC6 C;  2XHE B;  2JMH A;  4ZI7 E;  1WFD A;  5HCM A;  4DID B;  1KNZ A;  2KSR A;  2OLT A;  2XQ5 A;  3M3Z B;  4EZ4 A;  5FY1 A;  4JLE A;  4PNI A;  2XAH B;  4EEB A;  2CLY C;  5FL0 A;  2W00 A;  5JDG A;  4BJM A;  1UUS A;  1XMO T;  2HPL A;  4CN4 A;  2H3R A;  2BVM A;  2LM9 A;  4LMJ A;  5AQV B;  4O2A E;  2DI4 A;  2DWK A;  5AQK B;  3ZMZ B;  1X79 A;  4CI1 B;  1Y01 A;  4QH1 A;  4GKK T;  3C4X A;  4UXN B;  3BQK A;  3T1H T;  5LYJ E;  2DNX A;  2WSS V;  5AQM B;  4CXX A;  3Q5X A;  2CBJ A;  4DV1 T;  3SOL A;  3AE7 A;  4NXN T;  5ABG A;  1CHU A;  5JRC A;  1XNQ T;  3VKG A;  3HL6 A;  1WCR A;  1J5E T;  1HX8 A;  4IDQ A;  4GK0 E;  3KFW X;  3RHW A;  3KVB A;  3ZPO A;  4B6X A;  2I6H A;  4HGA A;  4AQG A;  1KEY A;  2VVS A;  2NW8 A;  3SRZ A;  4JI3 T;  1W9R A;  3ANW B;  2IHR 1;  4EYY R;  2M6I A;  2WWV A;  1JNZ A;  5JR9 B;  4AKI A;  1EZ3 A;  4KMC A;  3FXD B;  3O1H A;  3WAJ A;  4IE4 A;  4TWD A;  2WCA A;  1J5W A;  3WAK A;  2BZB A;  5AQI B;  2CWY A;  3J9X 1;  2E5V A;  3N9M A;  2WZH A;  1AJ3 A;  4MFR A;  4UV8 B;  4QWN B;  4DR4 T;  2CCQ A;  5IHY A;  2JQ9 A;  3GN5 B;  1IZN B;  4JI7 T;  5C8Y E;  2VQF T;  2CPT A;  3RIF A;  1YKH B;  2PG8 A;  4WZX A;  2VB6 A;  2M6B A;  3AA7 B;  4QH4 A;  3RRC A;  2YU2 A;  4H9R C;  4ZI3 C;  5C2T A;  3B57 A;  1YW0 A;  2LRL A;  1M62 A;  2BS4 A;  4ZXL A;  3LSV A;  2V5D A;  3N9P A;  2X9W A;  4OHF A;  1HNW T;  4LFA T;  1WLX A;  1Y64 B;  4HFH A;  4YHJ A;  3C64 A;  2ZM6 T;  3ZEF B;  2FJD A;  2ODU A;  5F5W A;  3EI0 A;  2VKO A;  2H7O A;  4PK6 A;  4IDN A;  2V7J A;  4P0A A;  5EK2 A;  3TLU A;  4H9O C;  4EOZ B;  4F8H A;  2X0L B;  4XZC A;  4DUZ T;  2VAS A;  2YKS A;  1XWM A;  4IIJ E;  4DR2 T;  1HNZ T;  2C5I T;  1NEN A;  4AKR B;  1UX5 A;  2PJQ A;  1SE7 A;  4TUY E;  3ETU A;  3GWH A;  2YOE A;  4DV5 T;  5LBM A;  3Q2M A;  3A7M A;  5LHH B;  1D0Z A;  2J62 A;  1LRZ A;  3HKD E;  3RC8 A;  2X51 A;  4IDP A;  3VR9 A;  4LF7 T;  4U31 A;  2V6Y A;  3GN5 A;  5FY7 A;  4AKL A;  3NRX A;  2DLR A;  4DUY T;  3AAI A;  4JBW F;  3AE9 A;  3A5X A;  5CA1 E;  3FZM B;  4U7Y A;  4U72 A;  5HEJ A;  1N36 T;  4HFV A;  1LKX A;  3ZCI A;  1HTJ F;  3VRA A;  4X1K E;  2UXB T;  5JQG E;  3UFG A;  2Q9Q C;  1BR2 A;  2CA5 A;  4OK0 A;  1BR1 A;  2CMR A;  4LFC T;  5FNV E;  1BR4 A;  3UUL A;  5FXV A;  4U74 A;  2XSA A;  4QXH B;  3ZMU B;  1HG5 A;  3H3M A;  5F8P A;  3KV9 A;  4LFB T;  1OED E;  1FMV A;  4C91 A;  2LHR A;  5A1L A;  3AED A;  1ZOY A;  4HFC A;  3PUA A;  5C3J A;  3PUS A;  3RX6 A;  4IT4 A;  5HEH A;  3KBU A;  1YXR A;  3PUQ A;  2MYS A;  3ZT7 A;  1CUN A;  1HFA A;  2JQH A;  3L3P A;  2HN1 A;  4ZS3 A;  4EZH A;  5AQH B;  1U4Q A;  5L3F B;  2PFV A;  2VVN A;  4UVB B;  3HKB E;  5HWX A;  3UU8 A;  5AQF B;  2WBL A;  3AAE B;  4TZ4 C;  4NUU A;  2NP9 A;  2LSI A;  5CGM A;  2VKD A;  3OBV E;  3CQC B;  2X0H A;  1M7K A;  2Y48 B;  4LF9 T;  3K3Q C;  5AQO B;  3PTR B;  2CHN A;  5DJQ C;  5LHG B;  5DAB A;  1D1A A;  2ZMA A;  1OED B;  3FBL A;  3RH3 A;  2VUR A;  2FBW A;  2WMN A;  1KF6 A;  1QSD A;  2FJE A;  4H9S E;  4EB6 E;  5EZY E;  4O4J E;  1Z8U A;  2D5U A;  2CBI A;  1G8X A;  1NWM X;  2V7K A;  4QH5 A;  2KND A;  3P7I A;  4EGW A;  2XQ9 A;  4Q25 A;  2BG9 E;  2NWB A;  4TNV A;  1IBK T;  4DR6 T;  2JPF A;  1W0B A;  3O1J A;  2V26 A;  2RP4 A;  2XJ7 A;  5HXC A;  4KP3 C;  3ZMS B;  5L3C B;  4LF8 T;  5L3G B;  3N2O A;  4L0R A;  4NIQ A;  1VCS A;  4XAX B;  2LE8 A;  3PUG A;  2OV9 A;  2K3W A;  4IL4 A;  2XTL A;  3E08 A;  1HX1 B;  4DO0 A;  4TWH A;  5E0O A;  3R84 B;  3Q5E A;  3CIR A;  2PBI A;  3KDS E;  3UU3 A;  4UV9 B;  4L5G A;  3U78 A;  5JDH A;  2Z6E A;  4O4I E;  4NUV A;  4CXY A;  2E2A A;  4EV6 A;  3SFE A;  3VU7 H;  3B13 A;  3E0Z A;  5FMN A;  2E9X B;  2WDR A;  2B1E A;  2BG9 B;  3CX6 B;  1ZHC A;  3N9N A;  4UVC B;  2D9D A;  1UX4 A;  2UXN B;  1E2A A;  2BS3 A;  3RYI E;  1X9B A;  5LJN A;  3NRY A;  4AQF C;  2KT9 A;  5FYM A;  2Y8D A;  2IC6 A;  3KBT A;  1SHZ C;  2XY8 B;  2CXD A;  3ZYK A;  4ASK A;  3ZYM A;  4PAG A;  4WBO A;  2X67 A;  4DVD A;  2XQ6 A;  4UIG A;  4ZI2 D;  5L4H A;  3OYZ A;  3AE2 A;  5GON E;  1UK5 A;  4KI0 F;  3Q9D A;  2YEV C;  3BQL A;  4EED A;  1GQE A;  4HWH A;  4CI2 B;  3PUZ F;  3AA6 B;  4YTP A;  2WU2 A;  3ZST A;  3UU4 A;  2Y6X A;  4X65 T;  5J2U E;  2WZI A;  3FHN A;  2K24 A;  5LNK A;  2DHR A;  4JEU B;  3AVS A;  4X1Y E;  2FJA A;  1FJG T;  4PK4 A;  1J1J A;  1KNR A;  1ZKE A;  2QYW A;  2UUA T;  4KX6 A;  3N9O A;  4HEA A;  3JAD A;  2L9Q A;  5L4E A;  4PJM A;  1HNX T;  4IHJ E;  3AXJ A;  4V1A v;  3IEE A;  2VWA A;  5H6Q B;  4B3M T;  3AEE A;  4JV5 T;  1WYB A;  2RPA A;  4GKJ T;  5LP6 E;  3LBX A;  3RPU A;  3JAE A;  5ETW A;  4P09 A;  4DV2 T;  4PJN A;  3UQ7 A;  3NZP A;  4E7S A;  3CVR A;  2IAK A;  2LRK A;  2WMO A;  4JEH B;  4JI1 T;  4HFI A;  3MZK B;  4YY3 T;  4E7Z A;  3OVU A;  4LF6 T;  4JYA T;  4U3C A;  1KFY A;  2W62 A;  3PUW F;  1NAF A;  4X5T A;  3NZQ A;  2IML A;  2CM0 A;  4PJJ A;  5LA6 E;  5LOV E;  2KMF A;  1UCU A;  2J1D G;  4UF0 B;  3ZKR A;  2IUB A;  5LG4 A;  2C0S A;  2XQ3 A;  5M4Y A;  1N34 T;  3ZN0 B;  1SUM B;  1MMG A;  2ZM0 A;  4PFP A;  4GOU A;  4QX7 B;  2YN6 A;  4DR5 T;  4TWF A;  4QHO A;  1S35 A;  3I0Q A;  2E9X D;  4HN9 A;  2SPC A;  2NW7 A;  4J2C A;  4X66 T;  5F3J A;  3N9L A;  2WWU A;  5IUX A;  3R6N A;  4DBR A;  5TAO A;  1D0Y A;  2Q9Q B;  4CXW A;  2KZ7 B;  2PTF A;  2DWG A;  3L09 A;  1ZP0 A;  2A2F X;  3EDV A;  4EXT A;  4YSX A;  2XQ7 A;  4B3T T;  3OYX A;  4GK5 E;  3X1D A;  4ZEY A;  3U3I A;  3ANW A;  2LOS A;  3RI5 A;  1YQ3 A;  2X0Y A;  3MXZ A;  4YTM A;  5JR9 A;  1HR0 T;  2BBH A;  2D2S A;  4HFD A;  5DQW A;  3MAC A;  2G0U A;  4KBM B;  4U2Y A;  4PW8 A;  2DL1 A;  2KIN B;  4CN1 A;  1MMN A;  5HXH A;  3OPC A;  4IE5 A;  2KWI B;  3CX7 B;  2IW5 B;  4IE0 A;  4DR1 T;  4HKA A;  4OX9 T;  2V7M A;  4YJ2 E;  4P0B A;  1KNP A;  1WR0 A;  4GYS A;  1OXZ A;  2WM9 A;  1MNE A;  5H6R B;  2UXX B;  3SS1 A;  4X64 T;  2D0T A;  3UU5 A;  2X68 A;  3Q5D A;  2N2N A;  4WYV A;  3G06 A;  3AE4 A;  4M1P A;  4DBQ A;  3O1I A;  2LSJ A;  4ILC A;  4C90 A;  3V5U A;  2XAJ B;  1MMD A;  2XPK A;  5KMG P;  4A98 A;  4OFZ A;  5CA0 E;  2EHO B;  3ETV A;  4HTE A;  5AQQ B;  5KXJ A;  3MK7 C;  3AAA B;  3TLS A;  4CQI A;  3ZT6 A;  5FY0 A;  5L3E B;  3KV5 A;  3ZC1 A;  2BS2 A;  3HI2 A;  3VKH A;  3P50 A;  5LMU T;  4U33 A;  2WS3 A;  1WR6 A;  4CN6 A;  4K0U A;  2VKJ A;  3FZL B;  1W09 A;  3FB2 A;  3GMI A;  3IA3 A;  3LFM A;  3DJB A;  5IYZ E;  3VRB A;  2C5K T;  2KXP B;  2LSY A;  3IF8 B;  3LK2 B;  5L3B B;  4LF5 T;  3RIU A;  3D0T A;  2VK9 A;  5LGT B;  2ACZ A;  2CXL A;  4TX5 A;  4COF A;  1OWA A;  1UGO A;  4ERR A;  2IC9 A;  3LJC A;  4DMW A;  2QA7 A;  1JNR A;  2X66 A;  3EUH A;  2BKO A;  3RIU C;  1D1B A;  4JUY A;  5AQL B;  2V7I A;  3UQ4 A;  3I0O A;  1W0A A;  2I0M A;  3FZF B;  4UVA B;  3ZT5 A;  2ES0 A;  4JI2 T;  5AFU L;  3ESL A;  1XDP A;  2MTQ A;  4ZHQ E;  3PUX F;  5HAX A;  1FEW A;  5JH7 E;  3C98 B;  3PDY A;  2VL0 A;  5AQS B;  1YKE B;  1L0V A;  3J7Y q;  1IBL T;  4ZZB A;  3RYF E;  2MAW A;  5ABF B;  2BDE A;  4EAH A;  5JTG A;  5FP3 A;  3QC9 A;  2E8I A;  4IE6 A;  2Q9Q D;  2HN2 A;  3C50 A;  2E5L T;  5J1G A;  4H9P C;  4DV3 T;  3AEA A;  4FJO A;  2W63 A;  5DQV A;  4G2A A;  4XBF B;  4PK5 A;  1MND A;  2KWH A;  4HWI B;  1I6Z A;  1FIO A;  2DCF A;  4FI5 A;  4PFO A;  2XQY A;  4WW0 A;  5JDQ A;  2WQY A;  4ZI2 C;  5AQR B;  2MBG A;  1XDO A;  4H9N C;  3UT5 E;  4AKG A;  4Z91 A;  2UUB T;  2W0G A;  5JVD E;  3LDQ B;  3UUB A;  4HWF A;  5HEU A;  1KK7 A;  2ZM2 A;  3AVR A;  1IBM T;  4UEL A;  2P9B A;  4HWD A;  3K8P C;  2CLY B;  3B5M A;  2XQA A;  3AA1 B;  3M65 A;  3Q5W A;  2YDS A;  4AKH A;  2J47 A;  4ISS A;  2ZLY A;  1OED A;  4BJN A;  2A72 A;  4U7I A;  4JI8 T;  3LK3 B;  1HCI A;  4MLK A;  1WRD A;  3ONJ A;  1IJ5 A;  2LLY A;  2YDR A;  2A3D A;  4A5X A;  4JI5 T;  2WP9 A;  4DMV A;  3ZCJ A;  3C4Z A;  2KLQ A;  1OED C;  2JJ9 A;  2YK0 A;  3P4Q A;  5LB7 B;  2XUE A;  3ZYL A;  5JDM A;  2J4G A;  2EHO D;  5LGN B;  4KHP T;  1S94 A;  5CB4 E;  4IGU A;  4ZOL E;  3AEC A;  1MIV A;  3JCF A;  3JAF A;  1FMW A;  5L3D B;  2CE7 A;  1VRB A;  1ZEE A;  4ILA A;  5JRC B;  3N5L A;  4LML A;  2NTY A;  2R6G F;  1QUU A;  3P4R A;  3I9W A;  1IJ6 A;  3W15 B;  3HKE E;  5AQT B;  2LOP A;  3CML A;  3QNU A;  3NWI A;  2NR4 A;  3QUJ A;  5AQN B;  2FUP A;  3UUX B;  3O4X E;  3ZSS A;  2NOX A;  3N2G E;  1VOM A;  2B76 A;  4I55 E;  4B3R T;  3NKZ A;  2X9H A;  2ODV A;  3QB5 A;  4YSY A;  3I9Y A;  4LF4 T;  5AQJ B;  3RGL A;  3ZC0 A;  2E9X A;  4GIW A;  3DTO A;  2BG9 A;  4O4H E;  2UXC T;  2K48 A;  4TNW A;  4I0U A;  3A8Y C;  2MPK A;  4DV6 T;  3I1A A;  3TKL B;  2VQE T;  1IAP A;  2YIN A;  2E9X C;  1D1C A;  2BG9 C;  2HPJ A;  3MKD A;  5JDF A;  5HXE A;  2XAQ B;  2GK9 A;  4DV0 T;  3KIN B;  3TLW A;  1G73 A;  3AE3 A;  4KHZ F;  2A9U A;  5CFB A;  2XAS B;  3PJA A;  4EYU A;  3EHZ A;  2JQQ A;  4YFS A;  3TLT A;  4B3S T;  4A97 A;  5AQG B;  3PUR A;  3UTK A;  4WNK A;  4YLH A;  4QKN A;  5HWY A;  3VHL A;  3T8O A;  1VCT A;  5JDN A;  1DU2 A;  3FBZ A;  5JDL A;  3RYH E;  1MIY A;  2V7L A;  3RKG A;  1E1H B;  4QXC B;  2WDV A;  2AE9 A;  5ADX L;  2LT3 A;  5LBQ B;  4PJL A;  2UXD T;  3CPZ A;  3P8C D;  4I4T E;  1T98 A;  4WBN E;  3EAB A;  4HFB A;  4YHH T;  3UUM A;  3RQW A;  2WB5 A;  2IDO B;  3JC6 D;  3OKQ A;  1UUR A;  1R8I A;  2N9D A;  4X20 E;  1US7 B;  1WYC A;  3FZH B;  5J2T E;  4JI6 T;  5EK4 A;  3SWH A;  4X62 T;  4QX8 B;  5L47 A;  2NTX A;  3UFE A;  3T1Y T;  5FL1 A;  3AE1 A;  2LEH A;  2XAF B;  2H88 A;  2HHH T;  4Z8X A;  2CWO A;  3RLF F;  2JIW A;  4BAY B;  5IWA T;  5KDM C;  2V6Y B;  2LJL A;  4DND A;  3NBX X;  5JRE A;  3PUY F;  1BR0 A;  2BKP A;  5HCJ A;  3AE8 A;  3KV4 A;  5FXZ A;  2UU9 T;  3KVA A;  2D0U A;  5FXW A;  5FXX A;  2XSB A;  1D0X A;  3K1S A;  4MAL A;  5LXT E;  4KUM B;  2XQ4 A;  4NXM T;  5FVL A;  4O8S A;  2JMK A;  5EK3 A;  2WDQ A;  4YTN A;  4P1N A;  3EAM A;  3L8R A;  3CWZ B;  2XZE A;  4IST A;  2X9X A;  5HXS A;  5ABH A;  5LHI B;  4OYJ A;  2L3L A;  5JR9 C;  3CX8 B;  4OYK A;  1U5P A;  3RIA A;  2CEA A;  4UF0 A;  4CI3 B;  3QK6 A;  3S4U A;  1HF8 A;  1HG2 A;  4I50 E;  3F2E A;  4ANJ A;  4YXD A;  4HE8 A;  3ZJ2 A;  2BVL A;  4L9I A;  3IBP A; 
#chains in the Genus database with same CATH homology
 5AQF B;  3FZM B;  4HWD A;  5AQM B;  5AQS B;  3LDQ B;  4HWF A;  3A8Y C;  1M62 A;  4HWH A;  4HWC A;  5AQL B;  5AQV B;  5AQT B;  5AQI B;  4HWI B;  1T7S A;  5AQJ B;  1I6Z A;  3M3Z B;  1HX1 B;  5AQG B;  2D9D A;  5AQH B;  3FZK B;  3FZF B;  1M7K A;  5AQK B;  5AQP B;  5AQN B;  5AQR B;  5AQQ B;  5AQO B;  5AQU B;  3FZL B;  1UK5 A;  1UGO A;  3FZH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...