4MLKA

3.05a resolution structure of ct584 from chlamydia trachomatis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
151
Chain Sequence
TFLLLEGNLKRIFATPIGYTTFREFQNVVFNCAQQELANFLFELINGKLKQSAQSLIVQFMMPIRVAKDIHERGEFINFITSDMLCVFLNRLSRVDGQEFLLMTDVQNTCHLIRHLLSRLLEAQKNPIGEKNLQEIQEDLDSLRAHFEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CT584 protein
publication title Structure of CT584 from Chlamydia trachomatis refined to 3.05 angstrom resolution.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Unknown function
total genus 50
structure length 151
sequence length 167
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17435 DUF5414 Family of unknown function (DUF5414)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mlkA01
4MLKA 3Q9DA
chains in the Genus database with same CATH superfamily
1MMAA 4NUUA 4NXMT 2CHOA 3QNUA 2M6IA 2WWUA 2ODUA 3QB5K 5EK4A 1QLBA 5LYJE 4EGWA 3RC3A 2W66A 2IHR1 1D1BA 1IAPA 3RKOA 4X1YE 3OVUA 2ZMAA 4TNWA 3ZMUB 1UX5A 4AKRB 4UVCB 2K48A 4YFSA 2X9XA 3FZMB 1IJ5A 3MZKB 3RC8A 3Q5XA 3KBUA 1R8IA 3ABVA 1FIOA 3IA3A 5LJMA 4OX9T 2VKJA 4BAYB 1OEDB 4N78D 5KDMC 2A72A 4B3RT 4U7IA 3TLTA 3MKDA 3N2KE 4QXHB 5FP3A 4U3CA 3WAJA 4HTEA 4H9NC 2IMLA 2V26A 2XAFB 2LHRA 5JH7E 4DV2T 2CHNA 5L3BB 2Q9QB 2LKGA 3C98B 3PUXF 1VCSA 1NWMX 4H9QC 2V6XA 2L8KA 2WS3A 5FY1A 2K3WA 4DV6T 1MMGA 2JQQA 3ZYLA 3PUZF 2AE9A 5FY0A 2KWHA 1HS7A 5CA1E 2WQYA 3AE2A 5HCJA 2JQKA 3CQCB 2WSSV 1X9BA 1OXZA 3KFWX 3H3MA 1D0YA 2XY8B 5CB4E 2LKHA 2X9WA 5HEGA 2M6BA 4GYRA 4CN6A 2BVMA 4UXNB 4YXDA 2CEAA 2LOPA 4LF7T 2BKPA 3DJBA 4TN7B 2VVNA 4NPPA 3CWZB 1FEWA 1MIWA 2YINA 3ZYMA 1KFYA 2MPKA 3UQ7A 1VOMA 4WW0A 5J0ZA 3UUNA 4TWFA 3UULA 2W2UA 2XSAA 3EI0A 2CMRA 3P4SA 2VWAA 2CA5A 3V5UA 2BG9E 3P50A 4PJNA 3AEEA 2BG9A 3OTOT 2X0YA 5HAXA 4Z8XA 2R6GF 2CWOA 3L09A 4PNIA 2VKOA 4DV0T 2W0GA 3CVRA 4PJJA 3AXJB 3RI5A 3VR8A 1M7KA 3PUWF 3C4XA 4WNKA 4JI3T 1HTJF 2LRLA 4IL9A 4WBOA 4ZEYA 2XQ3A 3VKGA 2KSRA 4NUVA 1BR2A 2C5KT 3IHRA 2I59A 5L3CB 3IEEA 3JC6D 2WDVA 3JAEA 3RYCE 4KHPT 2YU2A 5LHIB 3RYHE 1Z8UA 1HNXT 3CX8B 4AISA 3EABA 5JDMA 2E9XD 2K5BB 2ODVA 4IDZA 2NW7A 4QH1A 2D0TA 3ZN0B 3ZT7A 1QSDA 3N9PA 5L4EA 5LGTB 2XPKA 2E5VA 5CA0E 4IREA 1XWMA 3HI2A 1SHZC 1D0ZA 3JAFA 4DR4T 4HFHA 5AQMB 4YTNA 2CM0A 5DQVA 3N2OA 2UUCT 3RLFF 2BZBA 3VR9A 2EHOC 2X0HA 3PDYA 1BR1A 3AEFA 2CPTA 2MYSA 5M4YA 2V6YA 4ZXLA 2DI4A 2UU9T 1X79A 1T72A 5C2TA 2J4GA 5HCMA 3ZCJA 2VVSA 3ESLA 1XMQT 4X1KE 3JC6C 1DU2A 2WDQA 4HFVA 4GK5E 2BBJA 2FJAA 4EEBA 1UURA 2LSIA 2V5DA 5LMNT 4IE0A 3KBTA 2E9XB 3AE8A 5LCYA 2LM2A 3KV6A 4PFOA 4IDOA 4E7SA 2ACZA 2BS3A 4JI4T 3G06A 4QXCB 4LF9T 5ABGA 2IC9A 4NIQA 2X67A 2UXCT 4WBNE 4UF0A 4OK0A 4X65T 3NZQA 4PJLA 1ZOYA 1JNZA 2VURA 3KDSE 4CN4A 4PJMA 3TLVA 1OEDE 4L0RA 1WLXA 4Q25A 4UR9A 3E22E 4YLHA 2CBIA 4UVBB 3LK42 4ISSA 3AAEB 3AA7B 1WR6A 3AE3A 3E08A 3PE0A 3J7Yq 3CKDA 3FXDB 5HXHA 2NW9A 4L5GA 2XJ7A 3MJXA 1D0XA 3FZLB 4JLEA 4ILUA 2RA1A 5HXRA 4B3MT 3UUBA 2XQ7A 4P0AA 1Y01A 4HFDA 2MTQA 3KVAA 4BJMA 2YN6A 3JADA 5E0OA 1ZEEA 5GONE 3UU4A 5HWYA 2WM9A 3RPUA 5ABEA 2LE8A 2W62A 5AQJB 3UU8A 3FB2A 5AQQB 1VRBA 4DMVA 3UU3A 1MNEA 3PUYF 2PBIA 4IGUA 2IUBA 1IBKT 1I6ZA 4EXTA 3RQWA 1LVKA 3NVOA 5KXJA 2CLYC 4DV1T 4BA9A 4O8SA 1ZHCA 3AEDA 1N36T 4HWIB 5JDNA 1U5PA 2G0UA 4CZZB 3FBLA 3FXEB 5LP6E 4LF4T 5IYZE 2LRKA 2X0LB 2A9UA 5AQUB 4IDQA 3P4RA 3B5MA 1YD8G 2DHRA 3TKLB 2FJEA 1KNPA 5AQPB 3BQLA 3Q5WA 4DR7T 5FVKA 3OBVE 3S4UA 4JI6T 1AJ3A 3TLUA 3K3QC 3PJAJ 4IIJE 2V6YB 1XDOA 2WBLA 2XM2A 5FL0A 3LJCA 3H37A 4JI0T 4PK6A 2LLYA 2OA5A 3F31A 3I9WA 3HKCE 4XZCA 3SFDA 4X62T 5JR9B 3I1AA 4MFRA 2YKSA 3QUJA 4DR1T 3P7IA 4O4LE 2Y8DA 4DV7T 3A7MA 2WDRA 2PG8A 3UFEA 2N1GA 4EZHA 3KV9A 2YK0A 1T8BA 4I4TE 4COFA 1WYBA 3RYFE 4B6XA 3AB3B 5CJ5A 5HXEA 3ZT5A 4HWHA 5FXXA 3HKBE 4QWNB 2JQ9A 3AAIA 5H6QB 2HN1A 2X9YA 2CBJA 5F3JA 4UF0B 4YSYA 4IE7A 3HKDE 1HX8A 1YQ3A 5FXVA 4IE6A 2J47A 2PTFA 3QC9A 4KP3C 3KV5A 2WMOA 3N9NA 4C91A 1YKEB 3N5LA 3ZMZB 4CI1B 3AE5A 3UQ4A 3K8PC 4EV6A 2BKNA 1LKXA 1HFAA 4H9SE 2IAKA 2OV9A 2H88A 5JRCB 3K1SA 5AQGB 1IJ6A 4I50E 1T7SA 1Y64B 2QYWA 5AQKB 4EIWA 5TAOA 5HEUA 4AQFC 3R6NA 5LGUB 3RX6A 4H9OC 4XAXB 4IT4A 3CX6B 2XQ9A 2XQ6A 2KNDA 2E9XA 1FMVA 3K3OA 2VQET 3WI3A 2NR4A 2J1DG 5C8YE 3RRCA 2DL1A 2H3RA 4O2BE 4KBMB 3AECA 4AQYT 2V7MA 4QXBB 2BBHA 5AQLB 4A97A 5FXWA 3LG7A 3LFMA 3LBXB 3ZPOA 4ZI2D 4OYKA 5FMNA 4JBWF 2VB6A 2XM1A 4G63A 4JI1T 1MIYA 3RHWA 5DQWA 3RIUC 4EYUA 2JPFA 3QB5A 2IC6A 5A1LA 5FVLA 4G2AA 3UU5A 3PJAA 3F57A 3RIAA 2D0UA 4WZXA 4L9IA 3CIRA 1CUNA 4X66T 4PAGA 4YTPA 2EHOD 2KZ7B 5L47A 2LJLA 4I55E 2KINB 3AVSA 4H63H 4IDNA 2WB5A 5BMVE 2XAJB 3LDQB 2XZEA 1KNRA 3HR0A 1GQEA 3L8RA 2CE7A 5AFUL 4EOZB 3CMLA 1SE7A 2UXXB 3B57A 4KI0F 2NOXA 5AQTB 4CXYA 4UIGA 5LG3A 2RP4A 3ZC1A 4FI5A 3IF8B 5AQIB 3EHZA 4PK5A 2CXLA 2NTXA 3EDVA 4ZI2C 2DWGA 1CHUA 4DV5T 1XMOT 1WR0A 5LNKA 1IZNB 1ZP0A 3Q5EA 3BQKA 4CXXA 5JDQA 2H89A 1LRZA 3BK9A 3MXZA 4O4IE 4KMCA 4DR2T 4JV5T 3ONJA 2VASA 3A5XA 1MIVA 5HEJA 4KX6A 5HXSA 2EHOB 3NZPA 4GK0E 3O9XA 4OFZA 3ZMSB 5EK2A 4EB6E 3ZCIA 4YY3T 2JIWA 2LM9A 4AKGA 3RH3A 3O1JA 2JQHA 4EZ4A 1FJGT 4ADZA 5HEOA 5L4HA 3LK3B 1MNDA 3NBXX 4J2CA 2BS2A 2W61A 4GKKT 4K0KT 2XQAA 1E2AA 2D2SA 4GYSA 2QVAA 5JR9A 4AXPA 3X1DA 2FBWA 3UTKA 3RGLA 5EK3A 3T1HT 4LFCT 3N9MA 2WP9A 1T98A 2Y48B 4B3TT 3HL6A 5F8PA 4YHHT 2W00A 4DUYT 4H9PC 2MAWA 4DBQA 3EVYA 3N9OA 2KMFA 4JI5T 2HHHT 1H7CA 3OJAA 4HFCA 4K0UA 5ETWA 4AKLA 3ONLC 4YJ3E 3AEBA 1SUMB 2E2AA 1D1CA 2LHNA 1XDPA 3AVRA 4JI8T 1KF6A 1YXRA 2W67A 2VK9A 2AXDS 3C51A 3PUAA 4HN9A 4H63V 5HWXA 4LMJA 1FMWA 1LVFA 5L3DB 3EAMA 5JRCA 4ZZBA 3PV0F 2L9QA 4P1NA 4GOUA 2BG9C 4P0BA 4HFEA 4HGAA 1XNQT 3OYXA 2V5CA 2MBGA 3CQGB 5L3FB 2J62A 2F4VT 3D0TA 2V7JA 2YDSA 2LT3A 5LB7B 3CK6A 5JDHA 2ZM0A 4IE4A 4I0UA 4ANJA 1I94T 4A5XA 2BDEA 1J5ET 1YKHB 5C3JA 4TNVA 1U4QA 1J5WA 4ZS2A 5FKYA 3LBXA 1UGOA 4HFIA 2CLYB 2WAUA 5ABFA 3VRAA 4QH4A 3DP7A 2LSKA 5L2LA 2H7OA 3UT5E 2UXNB 3EDUA 3ZC0A 2V7KA 3EUHA 1HR0T 3ZSTA 1HF8A 4CI3B 2KLQA 2JMKA 3GWHA 3RIUA 2IW5B 1ZV4X 3GMIA 4HWDA 2LSJA 4V1Av 3ETVA 4FJOA 4LFAT 4U2ZA 4U74A 3LSVA 2K24A 3RIFA 2MOZA 4U31A 2QA7A 2B1EA 1QUUA 5FYMA 3H3AA 3L39A 1UUSA 4EAHA 3Q9DA 2WZIA 5LBMA 2VL8A 4GIWA 3ZN1B 5LHHB 5LHGB 2X66A 5AQNB 4KUMB 3ANWB 4ZZCA 4WYVA 5HYAA 4C90A 4JI7T 3FHNA 3ZMVB 3U3IA 2YDRA 3W15B 5L3GB 5DJQC 5LA6E 2V7IA 3AA6B 3P8CD 3PUQA 4U33A 4AI6A 2ZM2A 4PK4A 4X5TA 4YTMA 4ZOLE 2LEHA 4ERRA 3Q2MA 3JCFA 2N2NA 2XSBA 2LSYA 1O3XA 5LBQB 2XQ5A 1HG5A 2Q9QD 1UCUA 2VL0A 3R84B 4DNDA 2XAQB 4DV3T 3PUVF 4DMWA 3M65A 4F6RC 4JUYA 4X20E 2DLRA 2XAHB 5L3EB 4ZI3D 2V8SV 4X1IE 2NP9A 1D1AA 1IBMT 2XQ8A 5AQFB 3SFEA 2RPAA 3OKQA 3AE9A 2BS4A 1WYCA 4DUZT 3U78A 5JQGE 4DR5T 2B76A 2EHOA 4MALA 3SWHA 2XUEA 5H6RB 4Z90A 1J1JA 3IBPA 2CCQA 2GK9A 3HA4A 4JYAT 3N9QA 1G8XA 5LMUT 3T8OA 1OEDC 3SRZA 3O1HA 2HH7A 3M3ZB 3OYZA 2ZM8A 2WU2A 4IHJE 3FBZA 2Q9QC 3FZKB 4DIDB 1HNZT 2NTYA 3AE4A 3CQXC 4YHJA 4O4JE 2Y6XA 4ZI3C 2XQ4A 3VRBA 4I43B 4CXWA 3N9LA 1E1HB 4YSZA 2E5LT 4XBFB 4Z91A 5KX5E 2NW8A 4MHCA 4ASKA 3OPCA 2E8IA 5LGNB 4KHZF 1KNZA 1KK7A 2JJ9A 2CWYA 4YJ2E 5ABFB 5ABHA 3NRXA 5KMGP 3A8YC 3J9X1 5F5WA 5JREA 3V5SA 4NXNT 1HX1B 3ZYKA 2M67A 2C5JA 2VKDA 4TWDA 4UVAB 4HEAA 3MACA 4OYJA 1JNRA 3ETUA 5J2TE 4YT0A 4AKHA 3UU6A 2XQYA 4LF8T 1YW0A 4IE5A 4LF6T 3UUMA 5JDLA 3PURA 1WRDA 3I0QA 5LOVE 4LMKA 2CXDA 3MK7C 3N2GE 3HKEE 2WY2A 2BKOA 4QKNA 3FZFB 2WZHA 1M62A 1N32T 3WAKA 3P4PA 2Z6EA 3ZMTB 3NWIA 2N9DA 5LG4A 2XASB 4ZI7E 3SS1A 1NEKA 4ZS3A 2I6HA 2XHEB 5JVDE 2OLTA 4DBRA 3PU8A 2UUBT 4TWHA 3MA9A 5J2UE 3AEGA 3GA8A 3AEAA 3ZEFB 3QK6A 3VKHA 2DCFA 4CQIA 3RKGA 4P09A 1WFDA 2I0MA 4H9RC 4ILAA 4HWFA 3DTOA 1BR0A 4QX8B 4UEMA 3BQIA 2W63A 4LMLA 3AE7A 1HCIA 4AKIA 4MBQA 4JEUB 2ACXA 3GN5A 4CI2B 3PU3A 2JRKA 2UXDT 2KXPB 4LFBT 1YQ4A 3K3NA 3LK2B 2WU5A 4X64T 4IL4A 3FZHB 4PW8A 4EEDA 1BR4A 3F2EA 2QRXA 1XZYA 2D5UA 2FUPA 3ANWA 1E7PA 4JEHB 1S94A 2VQFT 5BR8T 4UV9B 4BJNA 2UUAT 4M1PA 2FJBA 1IBLT 4GKJT 3NKZA 3AE6A 3C50A 3TLWA 3KINB 5JTGA 3PTRB 1W0BA 3KVBA 1Z0PA 3AA0B 3SOLA 5HXCA 4U72A 2WCAA 1N34T 1MMNA 2BVLA 2DWKA 2WWVA 1W0AA 3KV4A 1UX4A 3NRYA 5FNVE 3C64A 3PUSA 3UUXB 2E9XC 2CXFA 4AIUA 5JDFA 1VCTA 2A2FX 5CGMA 4U7YA 5IUXA 3RYIE 3I0OA 2UXBT 4DV4T 3RQUA 2H7VC 1SA0E 1HNWT 3E0ZA 4YSXA 2IIUA 2YDQA 5AQVB 4PFPA 3VHLA 5JDGA 1OEDA 2QGSA 2P9BA 5CFBA 2KWIB 4QHOA 3CX7B 3ONXA 4U2YA 1B7TA 2IDOB 1W09A 2BG9B 2XTLA 1N33T 5DABA 4AQFA 2CRBA 2K9AA 4DR3T 2Q9QA 1NENA 4B3ST 1L0VA 2C0SA 2C5IT 2SPCA 2XAGB 3ZJ1A 1G73A 2NWBA 2X68A 5AQRB 5AQOB 2V1DB 2ZLYA 4ZHQE 3O4XE 1UK5A 4DO0A 4HKAA 3PUGA 2D9DA 4QX7B 4E7ZA 3ZKRA 2YU1A 4HFBA 3C4ZA 4MLKA 2DNXA 3B13A 5FL1A 5HEHA 4DVDA 2ES0A 4TZ4C 2HPLA 5EZYE 3L3PA 4TX5A 3AA1B 5ADXL 4F8HA 5IWAT 4QH5A 3C4WA 4AQGA 2HN2A 3TLSA 3O1IA 3AE1A 2FJDA 4TV9E 2A3DA 2LOSA 5AQHB 4HE8A 5LXTE 2PJQA 2X9HA 4JI2T 1NAFA 3P4WA 4TUYE 1XNRT 4TV8E 3GN5B 4O2AE 3P4QA 3QOFA 2X51A 3UFGA 2YEVC 1MMDA 4EYYR 4CN1A 4ILCA 3RF1A 4ISTA 3ZSSA 4LF5T 3Q5DA 3AAAB 1HG2A 3AXJA 4O4HE 2YOEA 2ZM6T 3I9YA 2VKHA 1KEYA 4UV8B 1US7B 2L3LA 3RRWA 5AQSB 4ILBA 2HPJA 4DR6T 3VU7H 2W4XA 1EZ3A 5FXZA 1W9RA 5IHYA 4HWCA 2PFVA 1OWAA 1WCRA 3ZT6A 3CPZA 1ZKEA 3T1YT 4A98A 2WMNA 1V9DA 1S35A 5J1GA 4OHFA 3ZJ2A 4A56A 5JR9C 5FY7A 2LSGA 2V7LA 3ZLIA 2JMHA 2KT9A 4UELA 5LJNA 4IDPA
chains in the Genus database with same CATH topology
5GONE 1MMAA 2LM9A 4NUUA 4AKGA 1YW0A 4IE5A 3RH3A 2WWUA 3O1JA 5HWYA 3UUMA 4EZ4A 5JDLA 2ODUA 2WM9A 3PURA 3RPUA 4ADZA 1WRDA 3I0QA 2LE8A 2W62A 5EK4A 3LK3B 5LYJE 1MNDA 3NBXX 3RC3A 3FB2A 5LOVE 1D1BA 1IAPA 1VRBA 4J2CA 4X1YE 3RKOA 4DMVA 2W61A 2ZMAA 2CXDA 3MK7C 2D2SA 1MNEA 3N2GE 3HKEE 2PBIA 4GYSA 3ZMUB 4QKNA 1UX5A 4AKRB 4IGUA 4UVCB 5JR9A 4AXPA 4EXTA 1LVKA 2K48A 4YFSA 2X9XA 2CLYC 1IJ5A 4BA9A 3MZKB 4O8SA 1ZHCA 3RC8A 3Q5XA 3UTKA 3KBUA 3WAKA 5EK3A 1FIOA 3N9MA 1T98A 2Z6EA 5JDNA 5LJMA 2Y48B 1U5PA 3ZMTB 2G0UA 2VKJA 3FBLA 3HL6A 4N78D 5F8PA 4CZZB 5KDMC 2A72A 2N9DA 3FXEB 2XASB 5LG4A 5LP6E 2W00A 4ZI7E 3MKDA 5IYZE 3N2KE 4QXHB 5FP3A 3SS1A 2X0LB 4ZS3A 3WAJA 4HTEA 4H9NC 4H9PC 2V26A 2XAFB 2LHRA 4DBQA 5JH7E 3EVYA 3N9OA 1YD8G 2XHEB 5JVDE 2DHRA 2KMFA 5L3BB 3TKLB 1H7CA 3PU8A 4DBRA 3OJAA 2Q9QB 3C98B 3MA9A 4K0UA 5J2UE 1NWMX 4H9QC 5ETWA 4AKLA 2L8KA 4YJ3E 3GA8A 5FY1A 3BQLA 3ZEFB 3Q5WA 3QK6A 1D1CA 2LHNA 3VKHA 2DCFA 1MMGA 2JQQA 3AVRA 3ZYLA 3OBVE 5FY0A 3S4UA 4CQIA 1AJ3A 4P09A 2KWHA 1HS7A 4H9RC 3K3QC 3DTOA 1BR0A 2VK9A 5CA1E 4QX8B 4IIJE 3C51A 3PUAA 3CQCB 4UEMA 3BQIA 4HN9A 2WSSV 4H63V 2W63A 1OXZA 3KFWX 5HWXA 1HCIA 2WBLA 1D0YA 4AKIA 4MBQA 1FMWA 4JEUB 1LVFA 5L3DB 3LJCA 3H37A 5CB4E 2ACXA 3GN5A 4CI2B 2X9WA 5JRCA 4PK6A 3PU3A 2JRKA 4GYRA 2L9QA 2BVMA 2OA5A 4UXNB 2KXPB 4GOUA 3F31A 3K3NA 3LK2B 3I9WA 3HKCE 2CEAA 4P0BA 4XZCA 2LOPA 4HGAA 4PW8A 1BR4A 3OYXA 3DJBA 5JR9B 3F2EA 4TN7B 3I1AA 2MBGA 2D5UA 3CWZB 1FEWA 1MIWA 4MFRA 3ANWA 3QUJA 2YINA 3ZYMA 3CQGB 4JEHB 3P7IA 1S94A 1VOMA 4O4LE 4WW0A 2Y8DA 5L3FB 3UUNA 4UV9B 3UULA 3D0TA 4BJNA 4M1PA 2CMRA 2PG8A 2VWAA 2CA5A 2V7JA 3UFEA 3V5UA 2N1GA 4PJNA 2LT3A 4EZHA 3KV9A 2YK0A 4I4TE 1WYBA 3C50A 3RYFE 4B6XA 3AB3B 5JDHA 5HXEA 2ZM0A 4IE4A 3KINB 5FXXA 3HKBE 4ANJA 4QWNB 2BDEA 3AAIA 5H6QB 2X9YA 1YKHB 3PTRB 5HAXA 5F3JA 1U4QA 4UF0B 3KVBA 4Z8XA 1Z0PA 4IE7A 4ZS2A 3HKDE 1HX8A 3AA0B 2CWOA 3LBXA 3L09A 5FXVA 4PNIA 3SOLA 4IE6A 2CLYB 2VKOA 2WAUA 5HXCA 3QC9A 4U72A 2W0GA 4KP3C 3CVRA 4PJJA 3DP7A 3KV5A 2WMOA 3N9NA 4C91A 2LSKA 1MMNA 1YKEB 2H7OA 3UT5E 2BVLA 3N5LA 5L2LA 2UXNB 3EDUA 2DWKA 3ZC0A 2V7KA 3ZMZB 3EUHA 4CI1B 1HF8A 4CI3B 3C4XA 4WNKA 2KLQA 2JMKA 3GWHA 3KV4A 1UX4A 2IW5B 1ZV4X 3GMIA 2LSJA 3NRYA 4V1Av 1HTJF 3ETVA 4FJOA 5FNVE 3K8PC 3C64A 3PUSA 4U74A 3UUXB 2E9XC 4WBOA 1LKXA 2CXFA 1HFAA 3VKGA 4H9SE 2K24A 2IAKA 5JDFA 2MOZA 4NUVA 2QA7A 1BR2A 2C5KT 5LJNA 2B1EA 5JRCB 1QUUA 5FYMA 3IHRA 2I59A 5L3CB 3IEEA 3H3AA 3JC6D 2A2FX 1IJ6A 4I50E 4EAHA 1Y64B 3RYIE 3RYCE 3Q9DA 4EIWA 5TAOA 3I0OA 5LBMA 2VL8A 4GIWA 3ZN1B 5LHHB 5LHGB 4AQFC 2X66A 2YU2A 5LHIB 3R6NA 5LGUB 2H7VC 4KUMB 3RYHE 3RX6A 4H9OC 4XAXB 1SA0E 3ANWB 3CX8B 3CX6B 3E0ZA 4C90A 5HYAA 5JDMA 3FHNA 2E9XD 3ZMVB 3U3IA 2KNDA 4PFPA 3VHLA 2E9XA 3W15B 5JDGA 2K5BB 5DJQC 1FMVA 5LA6E 5L3GB 2V7IA 3K3OA 2ODVA 3AA6B 4IDZA 3WI3A 3P8CD 3PUQA 4AI6A 2ZM2A 2J1DG 2QGSA 2P9BA 4PK4A 2KWIB 5C8YE 3RRCA 2NW7A 2D0TA 4QHOA 3ZN0B 2H3RA 3CX7B 4O2BE 4ZOLE 4KBMB 3ONXA 1QSDA 3N9PA 5LGTB 2LEHA 1B7TA 4ERRA 3Q2MA 2XTLA 2N2NA 5CA0E 2V7MA 2LSYA 3HI2A 4QXBB 5FXWA 1SHZC 1O3XA 1D0ZA 5DABA 5LBQB 4AQFA 1HG5A 2K9AA 2Q9QD 1UCUA 3R84B 2CM0A 5DQVA 2Q9QA 3LG7A 4DNDA 3LFMA 2XAQB 3LBXB 4DMWA 3N2OA 2BZBA 2C0SA 3M65A 2C5IT 3ZPOA 4F6RC 2SPCA 2XAGB 4JUYA 3ZJ1A 4ZI2D 4OYKA 1G73A 2NWBA 5FMNA 4X20E 2X68A 2EHOC 2DLRA 2VB6A 2XAHB 5L3EB 4ZI3D 4G63A 3PDYA 2V1DB 1BR1A 2ZLYA 4ZHQE 1MIYA 5DQWA 4EYUA 2JPFA 3O4XE 2NP9A 1D1AA 4X1IE 4DO0A 2IC6A 4HKAA 3PUGA 4QX7B 4E7ZA 5A1LA 2YU1A 3OKQA 2MYSA 5M4YA 3C4ZA 4MLKA 2DNXA 4G2AA 3B13A 2DI4A 1X79A 4DVDA 2ES0A 4TZ4C 1WYCA 3F57A 3ZCJA 3U78A 2HPLA 5JQGE 2D0UA 3ESLA 5EZYE 3L3PA 4TX5A 3AA1B 4X1KE 4L9IA 5ADXL 3JC6C 1CUNA 4HFVA 4PAGA 2EHOD 2KZ7B 2LJLA 2EHOA 4I55E 4GK5E 4MALA 3SWHA 2XUEA 2KINB 3C4WA 5H6RB 3AVSA 4AQGA 3O1IA 4H63H 5BMVE 2XAJB 3IBPA 2LSIA 4TV9E 2CCQA 2GK9A 3HA4A 4IE0A 2A3DA 2LOSA 4HE8A 3N9QA 5LXTE 3KBTA 2PJQA 3HR0A 1G8XA 2E9XB 5LCYA 3T8OA 3KV6A 4PFOA 2CE7A 5AFUL 4EOZB 2X9HA 3CMLA 1NAFA 4TUYE 2UXXB 3B57A 4E7SA 4TV8E 3SRZA 3GN5B 2NOXA 3O1HA 4O2AE 4CXYA 4UIGA 2HH7A 2X51A 2RP4A 3OYZA 4QXCB 2IC9A 3ZC1A 4FI5A 2X67A 2YEVC 2ZM8A 1MMDA 3IF8B 4WBNE 4UF0A 4OK0A 4EYYR 3NZQA 4PJLA 4IHJE 3FBZA 3KDSE 2Q9QC 4ISTA 4PJMA 4PK5A 2NTYA 4L0RA 1WLXA 2CXLA 2NTXA 3AAAB 1HG2A 3EDVA 3CQXC 3E22E 4YLHA 4YHJA 4ZI2C 4O4HE 4O4JE 3LK42 4UVBB 2DWGA 2Y6XA 4ISSA 3I9YA 2VKHA 4ZI3C 3AAEB 3AA7B 1WR6A 4UV8B 3E08A 5LNKA 3PE0A 3J7Yq 1IZNB 1US7B 4I43B 4CXWA 3N9LA 2L3LA 3CKDA 3RRWA 1E1HB 3FXDB 5HXHA 3BQKA 4CXXA 2NW9A 4L5GA 5JDQA 2HPJA 4XBFB 1LRZA 3MJXA 1D0XA 3BK9A 3VU7H 2NW8A 5KX5E 3MXZA 4O4IE 4KMCA 1EZ3A 5FXZA 4MHCA 4ASKA 5IHYA 2E8IA 4JLEA 5LGNB 1KNZA 2PFVA 4ILUA 1OWAA 2RA1A 5HXRA 3CPZA 1ZKEA 1KK7A 2JJ9A 2CWYA 2WMNA 4YJ2E 3NRXA 2VASA 5KMGP 3A5XA 1V9DA 1MIVA 1S35A 3J9X1 5J1GA 4P0AA 5JREA 4OHFA 3V5SA 2EHOB 5HXSA 3NZPA 4GK0E 3ZJ2A 4A56A 5JR9C 5FY7A 2MTQA 3O9XA 2LSGA 3ZYKA 2M67A 3KVAA 4OFZA 2C5JA 2VKDA 4BJMA 4UVAB 4HEAA 3ZMSB 3MACA 2V7LA 4OYJA 3ETUA 5J2TE 5EK2A 4EB6E 3ZLIA 5E0OA 2JMHA 3ZCIA 2KT9A 4AKHA 4UELA 4BAYB 2XQYA 1ZEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLK A;  3Q9D A; 
#chains in the Genus database with same CATH topology
 1MMA A;  4NUU A;  4NXM T;  2CHO A;  3QNU A;  2M6I A;  2WWU A;  2ODU A;  3QB5 K;  5EK4 A;  1QLB A;  5LYJ E;  4EGW A;  3RC3 A;  2W66 A;  2IHR 1;  1D1B A;  1IAP A;  3RKO A;  4X1Y E;  3OVU A;  2ZMA A;  4TNW A;  3ZMU B;  1UX5 A;  4AKR B;  4UVC B;  2K48 A;  4YFS A;  2X9X A;  3FZM B;  1IJ5 A;  3MZK B;  3RC8 A;  3Q5X A;  3KBU A;  1R8I A;  3ABV A;  1FIO A;  3IA3 A;  5LJM A;  4OX9 T;  2VKJ A;  4BAY B;  1OED B;  4N78 D;  5KDM C;  2A72 A;  4B3R T;  4U7I A;  3TLT A;  3MKD A;  3N2K E;  4QXH B;  5FP3 A;  4U3C A;  3WAJ A;  4HTE A;  4H9N C;  2IML A;  2V26 A;  2XAF B;  2LHR A;  5JH7 E;  4DV2 T;  2CHN A;  5L3B B;  2Q9Q B;  2LKG A;  3C98 B;  3PUX F;  1VCS A;  1NWM X;  4H9Q C;  2V6X A;  2L8K A;  2WS3 A;  5FY1 A;  2K3W A;  4DV6 T;  1MMG A;  2JQQ A;  3ZYL A;  3PUZ F;  2AE9 A;  5FY0 A;  2KWH A;  1HS7 A;  5CA1 E;  2WQY A;  3AE2 A;  5HCJ A;  2JQK A;  3CQC B;  2WSS V;  1X9B A;  1OXZ A;  3KFW X;  3H3M A;  1D0Y A;  2XY8 B;  5CB4 E;  2LKH A;  2X9W A;  5HEG A;  2M6B A;  4GYR A;  4CN6 A;  2BVM A;  4UXN B;  4YXD A;  2CEA A;  2LOP A;  4LF7 T;  2BKP A;  3DJB A;  4TN7 B;  2VVN A;  4NPP A;  3CWZ B;  1FEW A;  1MIW A;  2YIN A;  3ZYM A;  1KFY A;  2MPK A;  3UQ7 A;  1VOM A;  4WW0 A;  5J0Z A;  3UUN A;  4TWF A;  3UUL A;  2W2U A;  2XSA A;  3EI0 A;  2CMR A;  3P4S A;  2VWA A;  2CA5 A;  3V5U A;  2BG9 E;  3P50 A;  4PJN A;  3AEE A;  2BG9 A;  3OTO T;  2X0Y A;  5HAX A;  4Z8X A;  2R6G F;  2CWO A;  3L09 A;  4PNI A;  2VKO A;  4DV0 T;  2W0G A;  3CVR A;  4PJJ A;  3AXJ B;  3RI5 A;  3VR8 A;  1M7K A;  3PUW F;  3C4X A;  4WNK A;  4JI3 T;  1HTJ F;  2LRL A;  4IL9 A;  4WBO A;  4ZEY A;  2XQ3 A;  3VKG A;  2KSR A;  4NUV A;  1BR2 A;  2C5K T;  3IHR A;  2I59 A;  5L3C B;  3IEE A;  3JC6 D;  2WDV A;  3JAE A;  3RYC E;  4KHP T;  2YU2 A;  5LHI B;  3RYH E;  1Z8U A;  1HNX T;  3CX8 B;  4AIS A;  3EAB A;  5JDM A;  2E9X D;  2K5B B;  2ODV A;  4IDZ A;  2NW7 A;  4QH1 A;  2D0T A;  3ZN0 B;  3ZT7 A;  1QSD A;  3N9P A;  5L4E A;  5LGT B;  2XPK A;  2E5V A;  5CA0 E;  4IRE A;  1XWM A;  3HI2 A;  1SHZ C;  1D0Z A;  3JAF A;  4DR4 T;  4HFH A;  5AQM B;  4YTN A;  2CM0 A;  5DQV A;  3N2O A;  2UUC T;  3RLF F;  2BZB A;  3VR9 A;  2EHO C;  2X0H A;  3PDY A;  1BR1 A;  3AEF A;  2CPT A;  2MYS A;  5M4Y A;  2V6Y A;  4ZXL A;  2DI4 A;  2UU9 T;  1X79 A;  1T72 A;  5C2T A;  2J4G A;  5HCM A;  3ZCJ A;  2VVS A;  3ESL A;  1XMQ T;  4X1K E;  3JC6 C;  1DU2 A;  2WDQ A;  4HFV A;  4GK5 E;  2BBJ A;  2FJA A;  4EEB A;  1UUR A;  2LSI A;  2V5D A;  5LMN T;  4IE0 A;  3KBT A;  2E9X B;  3AE8 A;  5LCY A;  2LM2 A;  3KV6 A;  4PFO A;  4IDO A;  4E7S A;  2ACZ A;  2BS3 A;  4JI4 T;  3G06 A;  4QXC B;  4LF9 T;  5ABG A;  2IC9 A;  4NIQ A;  2X67 A;  2UXC T;  4WBN E;  4UF0 A;  4OK0 A;  4X65 T;  3NZQ A;  4PJL A;  1ZOY A;  1JNZ A;  2VUR A;  3KDS E;  4CN4 A;  4PJM A;  3TLV A;  1OED E;  4L0R A;  1WLX A;  4Q25 A;  4UR9 A;  3E22 E;  4YLH A;  2CBI A;  4UVB B;  3LK4 2;  4ISS A;  3AAE B;  3AA7 B;  1WR6 A;  3AE3 A;  3E08 A;  3PE0 A;  3J7Y q;  3CKD A;  3FXD B;  5HXH A;  2NW9 A;  4L5G A;  2XJ7 A;  3MJX A;  1D0X A;  3FZL B;  4JLE A;  4ILU A;  2RA1 A;  5HXR A;  4B3M T;  3UUB A;  2XQ7 A;  4P0A A;  1Y01 A;  4HFD A;  2MTQ A;  3KVA A;  4BJM A;  2YN6 A;  3JAD A;  5E0O A;  1ZEE A;  5GON E;  3UU4 A;  5HWY A;  2WM9 A;  3RPU A;  5ABE A;  2LE8 A;  2W62 A;  5AQJ B;  3UU8 A;  3FB2 A;  5AQQ B;  1VRB A;  4DMV A;  3UU3 A;  1MNE A;  3PUY F;  2PBI A;  4IGU A;  2IUB A;  1IBK T;  1I6Z A;  4EXT A;  3RQW A;  1LVK A;  3NVO A;  5KXJ A;  2CLY C;  4DV1 T;  4BA9 A;  4O8S A;  1ZHC A;  3AED A;  1N36 T;  4HWI B;  5JDN A;  1U5P A;  2G0U A;  4CZZ B;  3FBL A;  3FXE B;  5LP6 E;  4LF4 T;  5IYZ E;  2LRK A;  2X0L B;  2A9U A;  5AQU B;  4IDQ A;  3P4R A;  3B5M A;  1YD8 G;  2DHR A;  3TKL B;  2FJE A;  1KNP A;  5AQP B;  3BQL A;  3Q5W A;  4DR7 T;  5FVK A;  3OBV E;  3S4U A;  4JI6 T;  1AJ3 A;  3TLU A;  3K3Q C;  3PJA J;  4IIJ E;  2V6Y B;  1XDO A;  2WBL A;  2XM2 A;  5FL0 A;  3LJC A;  3H37 A;  4JI0 T;  4PK6 A;  2LLY A;  2OA5 A;  3F31 A;  3I9W A;  3HKC E;  4XZC A;  3SFD A;  4X62 T;  5JR9 B;  3I1A A;  4MFR A;  2YKS A;  3QUJ A;  4DR1 T;  3P7I A;  4O4L E;  2Y8D A;  4DV7 T;  3A7M A;  2WDR A;  2PG8 A;  3UFE A;  2N1G A;  4EZH A;  3KV9 A;  2YK0 A;  1T8B A;  4I4T E;  4COF A;  1WYB A;  3RYF E;  4B6X A;  3AB3 B;  5CJ5 A;  5HXE A;  3ZT5 A;  4HWH A;  5FXX A;  3HKB E;  4QWN B;  2JQ9 A;  3AAI A;  5H6Q B;  2HN1 A;  2X9Y A;  2CBJ A;  5F3J A;  4UF0 B;  4YSY A;  4IE7 A;  3HKD E;  1HX8 A;  1YQ3 A;  5FXV A;  4IE6 A;  2J47 A;  2PTF A;  3QC9 A;  4KP3 C;  3KV5 A;  2WMO A;  3N9N A;  4C91 A;  1YKE B;  3N5L A;  3ZMZ B;  4CI1 B;  3AE5 A;  3UQ4 A;  3K8P C;  4EV6 A;  2BKN A;  1LKX A;  1HFA A;  4H9S E;  2IAK A;  2OV9 A;  2H88 A;  5JRC B;  3K1S A;  5AQG B;  1IJ6 A;  4I50 E;  1T7S A;  1Y64 B;  2QYW A;  5AQK B;  4EIW A;  5TAO A;  5HEU A;  4AQF C;  3R6N A;  5LGU B;  3RX6 A;  4H9O C;  4XAX B;  4IT4 A;  3CX6 B;  2XQ9 A;  2XQ6 A;  2KND A;  2E9X A;  1FMV A;  3K3O A;  2VQE T;  3WI3 A;  2NR4 A;  2J1D G;  5C8Y E;  3RRC A;  2DL1 A;  2H3R A;  4O2B E;  4KBM B;  3AEC A;  4AQY T;  2V7M A;  4QXB B;  2BBH A;  5AQL B;  4A97 A;  5FXW A;  3LG7 A;  3LFM A;  3LBX B;  3ZPO A;  4ZI2 D;  4OYK A;  5FMN A;  4JBW F;  2VB6 A;  2XM1 A;  4G63 A;  4JI1 T;  1MIY A;  3RHW A;  5DQW A;  3RIU C;  4EYU A;  2JPF A;  3QB5 A;  2IC6 A;  5A1L A;  5FVL A;  4G2A A;  3UU5 A;  3PJA A;  3F57 A;  3RIA A;  2D0U A;  4WZX A;  4L9I A;  3CIR A;  1CUN A;  4X66 T;  4PAG A;  4YTP A;  2EHO D;  2KZ7 B;  5L47 A;  2LJL A;  4I55 E;  2KIN B;  3AVS A;  4H63 H;  4IDN A;  2WB5 A;  5BMV E;  2XAJ B;  3LDQ B;  2XZE A;  1KNR A;  3HR0 A;  1GQE A;  3L8R A;  2CE7 A;  5AFU L;  4EOZ B;  3CML A;  1SE7 A;  2UXX B;  3B57 A;  4KI0 F;  2NOX A;  5AQT B;  4CXY A;  4UIG A;  5LG3 A;  2RP4 A;  3ZC1 A;  4FI5 A;  3IF8 B;  5AQI B;  3EHZ A;  4PK5 A;  2CXL A;  2NTX A;  3EDV A;  4ZI2 C;  2DWG A;  1CHU A;  4DV5 T;  1XMO T;  1WR0 A;  5LNK A;  1IZN B;  1ZP0 A;  3Q5E A;  3BQK A;  4CXX A;  5JDQ A;  2H89 A;  1LRZ A;  3BK9 A;  3MXZ A;  4O4I E;  4KMC A;  4DR2 T;  4JV5 T;  3ONJ A;  2VAS A;  3A5X A;  1MIV A;  5HEJ A;  4KX6 A;  5HXS A;  2EHO B;  3NZP A;  4GK0 E;  3O9X A;  4OFZ A;  3ZMS B;  5EK2 A;  4EB6 E;  3ZCI A;  4YY3 T;  2JIW A;  2LM9 A;  4AKG A;  3RH3 A;  3O1J A;  2JQH A;  4EZ4 A;  1FJG T;  4ADZ A;  5HEO A;  5L4H A;  3LK3 B;  1MND A;  3NBX X;  4J2C A;  2BS2 A;  2W61 A;  4GKK T;  4K0K T;  2XQA A;  1E2A A;  2D2S A;  4GYS A;  2QVA A;  5JR9 A;  4AXP A;  3X1D A;  2FBW A;  3UTK A;  3RGL A;  5EK3 A;  3T1H T;  4LFC T;  3N9M A;  2WP9 A;  1T98 A;  2Y48 B;  4B3T T;  3HL6 A;  5F8P A;  4YHH T;  2W00 A;  4DUY T;  4H9P C;  2MAW A;  4DBQ A;  3EVY A;  3N9O A;  2KMF A;  4JI5 T;  2HHH T;  1H7C A;  3OJA A;  4HFC A;  4K0U A;  5ETW A;  4AKL A;  3ONL C;  4YJ3 E;  3AEB A;  1SUM B;  2E2A A;  1D1C A;  2LHN A;  1XDP A;  3AVR A;  4JI8 T;  1KF6 A;  1YXR A;  2W67 A;  2VK9 A;  2AXD S;  3C51 A;  3PUA A;  4HN9 A;  4H63 V;  5HWX A;  4LMJ A;  1FMW A;  1LVF A;  5L3D B;  3EAM A;  5JRC A;  4ZZB A;  3PV0 F;  2L9Q A;  4P1N A;  4GOU A;  2BG9 C;  4P0B A;  4HFE A;  4HGA A;  1XNQ T;  3OYX A;  2V5C A;  2MBG A;  3CQG B;  5L3F B;  2J62 A;  2F4V T;  3D0T A;  2V7J A;  2YDS A;  2LT3 A;  5LB7 B;  3CK6 A;  5JDH A;  2ZM0 A;  4IE4 A;  4I0U A;  4ANJ A;  1I94 T;  4A5X A;  2BDE A;  1J5E T;  1YKH B;  5C3J A;  4TNV A;  1U4Q A;  1J5W A;  4ZS2 A;  5FKY A;  3LBX A;  1UGO A;  4HFI A;  2CLY B;  2WAU A;  5ABF A;  3VRA A;  4QH4 A;  3DP7 A;  2LSK A;  5L2L A;  2H7O A;  3UT5 E;  2UXN B;  3EDU A;  3ZC0 A;  2V7K A;  3EUH A;  1HR0 T;  3ZST A;  1HF8 A;  4CI3 B;  2KLQ A;  2JMK A;  3GWH A;  3RIU A;  2IW5 B;  1ZV4 X;  3GMI A;  4HWD A;  2LSJ A;  4V1A v;  3ETV A;  4FJO A;  4LFA T;  4U2Z A;  4U74 A;  3LSV A;  2K24 A;  3RIF A;  2MOZ A;  4U31 A;  2QA7 A;  2B1E A;  1QUU A;  5FYM A;  3H3A A;  3L39 A;  1UUS A;  4EAH A;  3Q9D A;  2WZI A;  5LBM A;  2VL8 A;  4GIW A;  3ZN1 B;  5LHH B;  5LHG B;  2X66 A;  5AQN B;  4KUM B;  3ANW B;  4ZZC A;  4WYV A;  5HYA A;  4C90 A;  4JI7 T;  3FHN A;  3ZMV B;  3U3I A;  2YDR A;  3W15 B;  5L3G B;  5DJQ C;  5LA6 E;  2V7I A;  3AA6 B;  3P8C D;  3PUQ A;  4U33 A;  4AI6 A;  2ZM2 A;  4PK4 A;  4X5T A;  4YTM A;  4ZOL E;  2LEH A;  4ERR A;  3Q2M A;  3JCF A;  2N2N A;  2XSB A;  2LSY A;  1O3X A;  5LBQ B;  2XQ5 A;  1HG5 A;  2Q9Q D;  1UCU A;  2VL0 A;  3R84 B;  4DND A;  2XAQ B;  4DV3 T;  3PUV F;  4DMW A;  3M65 A;  4F6R C;  4JUY A;  4X20 E;  2DLR A;  2XAH B;  5L3E B;  4ZI3 D;  2V8S V;  4X1I E;  2NP9 A;  1D1A A;  1IBM T;  2XQ8 A;  5AQF B;  3SFE A;  2RPA A;  3OKQ A;  3AE9 A;  2BS4 A;  1WYC A;  4DUZ T;  3U78 A;  5JQG E;  4DR5 T;  2B76 A;  2EHO A;  4MAL A;  3SWH A;  2XUE A;  5H6R B;  4Z90 A;  1J1J A;  3IBP A;  2CCQ A;  2GK9 A;  3HA4 A;  4JYA T;  3N9Q A;  1G8X A;  5LMU T;  3T8O A;  1OED C;  3SRZ A;  3O1H A;  2HH7 A;  3M3Z B;  3OYZ A;  2ZM8 A;  2WU2 A;  4IHJ E;  3FBZ A;  2Q9Q C;  3FZK B;  4DID B;  1HNZ T;  2NTY A;  3AE4 A;  3CQX C;  4YHJ A;  4O4J E;  2Y6X A;  4ZI3 C;  2XQ4 A;  3VRB A;  4I43 B;  4CXW A;  3N9L A;  1E1H B;  4YSZ A;  2E5L T;  4XBF B;  4Z91 A;  5KX5 E;  2NW8 A;  4MHC A;  4ASK A;  3OPC A;  2E8I A;  5LGN B;  4KHZ F;  1KNZ A;  1KK7 A;  2JJ9 A;  2CWY A;  4YJ2 E;  5ABF B;  5ABH A;  3NRX A;  5KMG P;  3A8Y C;  3J9X 1;  5F5W A;  5JRE A;  3V5S A;  4NXN T;  1HX1 B;  3ZYK A;  2M67 A;  2C5J A;  2VKD A;  4TWD A;  4UVA B;  4HEA A;  3MAC A;  4OYJ A;  1JNR A;  3ETU A;  5J2T E;  4YT0 A;  4AKH A;  3UU6 A;  2XQY A;  4LF8 T;  1YW0 A;  4IE5 A;  4LF6 T;  3UUM A;  5JDL A;  3PUR A;  1WRD A;  3I0Q A;  5LOV E;  4LMK A;  2CXD A;  3MK7 C;  3N2G E;  3HKE E;  2WY2 A;  2BKO A;  4QKN A;  3FZF B;  2WZH A;  1M62 A;  1N32 T;  3WAK A;  3P4P A;  2Z6E A;  3ZMT B;  3NWI A;  2N9D A;  5LG4 A;  2XAS B;  4ZI7 E;  3SS1 A;  1NEK A;  4ZS3 A;  2I6H A;  2XHE B;  5JVD E;  2OLT A;  4DBR A;  3PU8 A;  2UUB T;  4TWH A;  3MA9 A;  5J2U E;  3AEG A;  3GA8 A;  3AEA A;  3ZEF B;  3QK6 A;  3VKH A;  2DCF A;  4CQI A;  3RKG A;  4P09 A;  1WFD A;  2I0M A;  4H9R C;  4ILA A;  4HWF A;  3DTO A;  1BR0 A;  4QX8 B;  4UEM A;  3BQI A;  2W63 A;  4LML A;  3AE7 A;  1HCI A;  4AKI A;  4MBQ A;  4JEU B;  2ACX A;  3GN5 A;  4CI2 B;  3PU3 A;  2JRK A;  2UXD T;  2KXP B;  4LFB T;  1YQ4 A;  3K3N A;  3LK2 B;  2WU5 A;  4X64 T;  4IL4 A;  3FZH B;  4PW8 A;  4EED A;  1BR4 A;  3F2E A;  2QRX A;  1XZY A;  2D5U A;  2FUP A;  3ANW A;  1E7P A;  4JEH B;  1S94 A;  2VQF T;  5BR8 T;  4UV9 B;  4BJN A;  2UUA T;  4M1P A;  2FJB A;  1IBL T;  4GKJ T;  3NKZ A;  3AE6 A;  3C50 A;  3TLW A;  3KIN B;  5JTG A;  3PTR B;  1W0B A;  3KVB A;  1Z0P A;  3AA0 B;  3SOL A;  5HXC A;  4U72 A;  2WCA A;  1N34 T;  1MMN A;  2BVL A;  2DWK A;  2WWV A;  1W0A A;  3KV4 A;  1UX4 A;  3NRY A;  5FNV E;  3C64 A;  3PUS A;  3UUX B;  2E9X C;  2CXF A;  4AIU A;  5JDF A;  1VCT A;  2A2F X;  5CGM A;  4U7Y A;  5IUX A;  3RYI E;  3I0O A;  2UXB T;  4DV4 T;  3RQU A;  2H7V C;  1SA0 E;  1HNW T;  3E0Z A;  4YSX A;  2IIU A;  2YDQ A;  5AQV B;  4PFP A;  3VHL A;  5JDG A;  1OED A;  2QGS A;  2P9B A;  5CFB A;  2KWI B;  4QHO A;  3CX7 B;  3ONX A;  4U2Y A;  1B7T A;  2IDO B;  1W09 A;  2BG9 B;  2XTL A;  1N33 T;  5DAB A;  4AQF A;  2CRB A;  2K9A A;  4DR3 T;  2Q9Q A;  1NEN A;  4B3S T;  1L0V A;  2C0S A;  2C5I T;  2SPC A;  2XAG B;  3ZJ1 A;  1G73 A;  2NWB A;  2X68 A;  5AQR B;  5AQO B;  2V1D B;  2ZLY A;  4ZHQ E;  3O4X E;  1UK5 A;  4DO0 A;  4HKA A;  3PUG A;  2D9D A;  4QX7 B;  4E7Z A;  3ZKR A;  2YU1 A;  4HFB A;  3C4Z A;  4MLK A;  2DNX A;  3B13 A;  5FL1 A;  5HEH A;  4DVD A;  2ES0 A;  4TZ4 C;  2HPL A;  5EZY E;  3L3P A;  4TX5 A;  3AA1 B;  5ADX L;  4F8H A;  5IWA T;  4QH5 A;  3C4W A;  4AQG A;  2HN2 A;  3TLS A;  3O1I A;  3AE1 A;  2FJD A;  4TV9 E;  2A3D A;  2LOS A;  5AQH B;  4HE8 A;  5LXT E;  2PJQ A;  2X9H A;  4JI2 T;  1NAF A;  3P4W A;  4TUY E;  1XNR T;  4TV8 E;  3GN5 B;  4O2A E;  3P4Q A;  3QOF A;  2X51 A;  3UFG A;  2YEV C;  1MMD A;  4EYY R;  4CN1 A;  4ILC A;  3RF1 A;  4IST A;  3ZSS A;  4LF5 T;  3Q5D A;  3AAA B;  1HG2 A;  3AXJ A;  4O4H E;  2YOE A;  2ZM6 T;  3I9Y A;  2VKH A;  1KEY A;  4UV8 B;  1US7 B;  2L3L A;  3RRW A;  5AQS B;  4ILB A;  2HPJ A;  4DR6 T;  3VU7 H;  2W4X A;  1EZ3 A;  5FXZ A;  1W9R A;  5IHY A;  4HWC A;  2PFV A;  1OWA A;  1WCR A;  3ZT6 A;  3CPZ A;  1ZKE A;  3T1Y T;  4A98 A;  2WMN A;  1V9D A;  1S35 A;  5J1G A;  4OHF A;  3ZJ2 A;  4A56 A;  5JR9 C;  5FY7 A;  2LSG A;  2V7L A;  3ZLI A;  2JMH A;  2KT9 A;  4UEL A;  5LJN A;  4IDP A; 
#chains in the Genus database with same CATH homology
 5GON E;  1MMA A;  2LM9 A;  4NUU A;  4AKG A;  1YW0 A;  4IE5 A;  3RH3 A;  2WWU A;  3O1J A;  5HWY A;  3UUM A;  4EZ4 A;  5JDL A;  2ODU A;  2WM9 A;  3PUR A;  3RPU A;  4ADZ A;  1WRD A;  3I0Q A;  2LE8 A;  2W62 A;  5EK4 A;  3LK3 B;  5LYJ E;  1MND A;  3NBX X;  3RC3 A;  3FB2 A;  5LOV E;  1D1B A;  1IAP A;  1VRB A;  4J2C A;  4X1Y E;  3RKO A;  4DMV A;  2W61 A;  2ZMA A;  2CXD A;  3MK7 C;  2D2S A;  1MNE A;  3N2G E;  3HKE E;  2PBI A;  4GYS A;  3ZMU B;  4QKN A;  1UX5 A;  4AKR B;  4IGU A;  4UVC B;  5JR9 A;  4AXP A;  4EXT A;  1LVK A;  2K48 A;  4YFS A;  2X9X A;  2CLY C;  1IJ5 A;  4BA9 A;  3MZK B;  4O8S A;  1ZHC A;  3RC8 A;  3Q5X A;  3UTK A;  3KBU A;  3WAK A;  5EK3 A;  1FIO A;  3N9M A;  1T98 A;  2Z6E A;  5JDN A;  5LJM A;  2Y48 B;  1U5P A;  3ZMT B;  2G0U A;  2VKJ A;  3FBL A;  3HL6 A;  4N78 D;  5F8P A;  4CZZ B;  5KDM C;  2A72 A;  2N9D A;  3FXE B;  2XAS B;  5LG4 A;  5LP6 E;  2W00 A;  4ZI7 E;  3MKD A;  5IYZ E;  3N2K E;  4QXH B;  5FP3 A;  3SS1 A;  2X0L B;  4ZS3 A;  3WAJ A;  4HTE A;  4H9N C;  4H9P C;  2V26 A;  2XAF B;  2LHR A;  4DBQ A;  5JH7 E;  3EVY A;  3N9O A;  1YD8 G;  2XHE B;  5JVD E;  2DHR A;  2KMF A;  5L3B B;  3TKL B;  1H7C A;  3PU8 A;  4DBR A;  3OJA A;  2Q9Q B;  3C98 B;  3MA9 A;  4K0U A;  5J2U E;  1NWM X;  4H9Q C;  5ETW A;  4AKL A;  2L8K A;  4YJ3 E;  3GA8 A;  5FY1 A;  3BQL A;  3ZEF B;  3Q5W A;  3QK6 A;  1D1C A;  2LHN A;  3VKH A;  2DCF A;  1MMG A;  2JQQ A;  3AVR A;  3ZYL A;  3OBV E;  5FY0 A;  3S4U A;  4CQI A;  1AJ3 A;  4P09 A;  2KWH A;  1HS7 A;  4H9R C;  3K3Q C;  3DTO A;  1BR0 A;  2VK9 A;  5CA1 E;  4QX8 B;  4IIJ E;  3C51 A;  3PUA A;  3CQC B;  4UEM A;  3BQI A;  4HN9 A;  2WSS V;  4H63 V;  2W63 A;  1OXZ A;  3KFW X;  5HWX A;  1HCI A;  2WBL A;  1D0Y A;  4AKI A;  4MBQ A;  1FMW A;  4JEU B;  1LVF A;  5L3D B;  3LJC A;  3H37 A;  5CB4 E;  2ACX A;  3GN5 A;  4CI2 B;  2X9W A;  5JRC A;  4PK6 A;  3PU3 A;  2JRK A;  4GYR A;  2L9Q A;  2BVM A;  2OA5 A;  4UXN B;  2KXP B;  4GOU A;  3F31 A;  3K3N A;  3LK2 B;  3I9W A;  3HKC E;  2CEA A;  4P0B A;  4XZC A;  2LOP A;  4HGA A;  4PW8 A;  1BR4 A;  3OYX A;  3DJB A;  5JR9 B;  3F2E A;  4TN7 B;  3I1A A;  2MBG A;  2D5U A;  3CWZ B;  1FEW A;  1MIW A;  4MFR A;  3ANW A;  3QUJ A;  2YIN A;  3ZYM A;  3CQG B;  4JEH B;  3P7I A;  1S94 A;  1VOM A;  4O4L E;  4WW0 A;  2Y8D A;  5L3F B;  3UUN A;  4UV9 B;  3UUL A;  3D0T A;  4BJN A;  4M1P A;  2CMR A;  2PG8 A;  2VWA A;  2CA5 A;  2V7J A;  3UFE A;  3V5U A;  2N1G A;  4PJN A;  2LT3 A;  4EZH A;  3KV9 A;  2YK0 A;  4I4T E;  1WYB A;  3C50 A;  3RYF E;  4B6X A;  3AB3 B;  5JDH A;  5HXE A;  2ZM0 A;  4IE4 A;  3KIN B;  5FXX A;  3HKB E;  4ANJ A;  4QWN B;  2BDE A;  3AAI A;  5H6Q B;  2X9Y A;  1YKH B;  3PTR B;  5HAX A;  5F3J A;  1U4Q A;  4UF0 B;  3KVB A;  4Z8X A;  1Z0P A;  4IE7 A;  4ZS2 A;  3HKD E;  1HX8 A;  3AA0 B;  2CWO A;  3LBX A;  3L09 A;  5FXV A;  4PNI A;  3SOL A;  4IE6 A;  2CLY B;  2VKO A;  2WAU A;  5HXC A;  3QC9 A;  4U72 A;  2W0G A;  4KP3 C;  3CVR A;  4PJJ A;  3DP7 A;  3KV5 A;  2WMO A;  3N9N A;  4C91 A;  2LSK A;  1MMN A;  1YKE B;  2H7O A;  3UT5 E;  2BVL A;  3N5L A;  5L2L A;  2UXN B;  3EDU A;  2DWK A;  3ZC0 A;  2V7K A;  3ZMZ B;  3EUH A;  4CI1 B;  1HF8 A;  4CI3 B;  3C4X A;  4WNK A;  2KLQ A;  2JMK A;  3GWH A;  3KV4 A;  1UX4 A;  2IW5 B;  1ZV4 X;  3GMI A;  2LSJ A;  3NRY A;  4V1A v;  1HTJ F;  3ETV A;  4FJO A;  5FNV E;  3K8P C;  3C64 A;  3PUS A;  4U74 A;  3UUX B;  2E9X C;  4WBO A;  1LKX A;  2CXF A;  1HFA A;  3VKG A;  4H9S E;  2K24 A;  2IAK A;  5JDF A;  2MOZ A;  4NUV A;  2QA7 A;  1BR2 A;  2C5K T;  5LJN A;  2B1E A;  5JRC B;  1QUU A;  5FYM A;  3IHR A;  2I59 A;  5L3C B;  3IEE A;  3H3A A;  3JC6 D;  2A2F X;  1IJ6 A;  4I50 E;  4EAH A;  1Y64 B;  3RYI E;  3RYC E;  3Q9D A;  4EIW A;  5TAO A;  3I0O A;  5LBM A;  2VL8 A;  4GIW A;  3ZN1 B;  5LHH B;  5LHG B;  4AQF C;  2X66 A;  2YU2 A;  5LHI B;  3R6N A;  5LGU B;  2H7V C;  4KUM B;  3RYH E;  3RX6 A;  4H9O C;  4XAX B;  1SA0 E;  3ANW B;  3CX8 B;  3CX6 B;  3E0Z A;  4C90 A;  5HYA A;  5JDM A;  3FHN A;  2E9X D;  3ZMV B;  3U3I A;  2KND A;  4PFP A;  3VHL A;  2E9X A;  3W15 B;  5JDG A;  2K5B B;  5DJQ C;  1FMV A;  5LA6 E;  5L3G B;  2V7I A;  3K3O A;  2ODV A;  3AA6 B;  4IDZ A;  3WI3 A;  3P8C D;  3PUQ A;  4AI6 A;  2ZM2 A;  2J1D G;  2QGS A;  2P9B A;  4PK4 A;  2KWI B;  5C8Y E;  3RRC A;  2NW7 A;  2D0T A;  4QHO A;  3ZN0 B;  2H3R A;  3CX7 B;  4O2B E;  4ZOL E;  4KBM B;  3ONX A;  1QSD A;  3N9P A;  5LGT B;  2LEH A;  1B7T A;  4ERR A;  3Q2M A;  2XTL A;  2N2N A;  5CA0 E;  2V7M A;  2LSY A;  3HI2 A;  4QXB B;  5FXW A;  1SHZ C;  1O3X A;  1D0Z A;  5DAB A;  5LBQ B;  4AQF A;  1HG5 A;  2K9A A;  2Q9Q D;  1UCU A;  3R84 B;  2CM0 A;  5DQV A;  2Q9Q A;  3LG7 A;  4DND A;  3LFM A;  2XAQ B;  3LBX B;  4DMW A;  3N2O A;  2BZB A;  2C0S A;  3M65 A;  2C5I T;  3ZPO A;  4F6R C;  2SPC A;  2XAG B;  4JUY A;  3ZJ1 A;  4ZI2 D;  4OYK A;  1G73 A;  2NWB A;  5FMN A;  4X20 E;  2X68 A;  2EHO C;  2DLR A;  2VB6 A;  2XAH B;  5L3E B;  4ZI3 D;  4G63 A;  3PDY A;  2V1D B;  1BR1 A;  2ZLY A;  4ZHQ E;  1MIY A;  5DQW A;  4EYU A;  2JPF A;  3O4X E;  2NP9 A;  1D1A A;  4X1I E;  4DO0 A;  2IC6 A;  4HKA A;  3PUG A;  4QX7 B;  4E7Z A;  5A1L A;  2YU1 A;  3OKQ A;  2MYS A;  5M4Y A;  3C4Z A;  4MLK A;  2DNX A;  4G2A A;  3B13 A;  2DI4 A;  1X79 A;  4DVD A;  2ES0 A;  4TZ4 C;  1WYC A;  3F57 A;  3ZCJ A;  3U78 A;  2HPL A;  5JQG E;  2D0U A;  3ESL A;  5EZY E;  3L3P A;  4TX5 A;  3AA1 B;  4X1K E;  4L9I A;  5ADX L;  3JC6 C;  1CUN A;  4HFV A;  4PAG A;  2EHO D;  2KZ7 B;  2LJL A;  2EHO A;  4I55 E;  4GK5 E;  4MAL A;  3SWH A;  2XUE A;  2KIN B;  3C4W A;  5H6R B;  3AVS A;  4AQG A;  3O1I A;  4H63 H;  5BMV E;  2XAJ B;  3IBP A;  2LSI A;  4TV9 E;  2CCQ A;  2GK9 A;  3HA4 A;  4IE0 A;  2A3D A;  2LOS A;  4HE8 A;  3N9Q A;  5LXT E;  3KBT A;  2PJQ A;  3HR0 A;  1G8X A;  2E9X B;  5LCY A;  3T8O A;  3KV6 A;  4PFO A;  2CE7 A;  5AFU L;  4EOZ B;  2X9H A;  3CML A;  1NAF A;  4TUY E;  2UXX B;  3B57 A;  4E7S A;  4TV8 E;  3SRZ A;  3GN5 B;  2NOX A;  3O1H A;  4O2A E;  4CXY A;  4UIG A;  2HH7 A;  2X51 A;  2RP4 A;  3OYZ A;  4QXC B;  2IC9 A;  3ZC1 A;  4FI5 A;  2X67 A;  2YEV C;  2ZM8 A;  1MMD A;  3IF8 B;  4WBN E;  4UF0 A;  4OK0 A;  4EYY R;  3NZQ A;  4PJL A;  4IHJ E;  3FBZ A;  3KDS E;  2Q9Q C;  4IST A;  4PJM A;  4PK5 A;  2NTY A;  4L0R A;  1WLX A;  2CXL A;  2NTX A;  3AAA B;  1HG2 A;  3EDV A;  3CQX C;  3E22 E;  4YLH A;  4YHJ A;  4ZI2 C;  4O4H E;  4O4J E;  3LK4 2;  4UVB B;  2DWG A;  2Y6X A;  4ISS A;  3I9Y A;  2VKH A;  4ZI3 C;  3AAE B;  3AA7 B;  1WR6 A;  4UV8 B;  3E08 A;  5LNK A;  3PE0 A;  3J7Y q;  1IZN B;  1US7 B;  4I43 B;  4CXW A;  3N9L A;  2L3L A;  3CKD A;  3RRW A;  1E1H B;  3FXD B;  5HXH A;  3BQK A;  4CXX A;  2NW9 A;  4L5G A;  5JDQ A;  2HPJ A;  4XBF B;  1LRZ A;  3MJX A;  1D0X A;  3BK9 A;  3VU7 H;  2NW8 A;  5KX5 E;  3MXZ A;  4O4I E;  4KMC A;  1EZ3 A;  5FXZ A;  4MHC A;  4ASK A;  5IHY A;  2E8I A;  4JLE A;  5LGN B;  1KNZ A;  2PFV A;  4ILU A;  1OWA A;  2RA1 A;  5HXR A;  3CPZ A;  1ZKE A;  1KK7 A;  2JJ9 A;  2CWY A;  2WMN A;  4YJ2 E;  3NRX A;  2VAS A;  5KMG P;  3A5X A;  1V9D A;  1MIV A;  1S35 A;  3J9X 1;  5J1G A;  4P0A A;  5JRE A;  4OHF A;  3V5S A;  2EHO B;  5HXS A;  3NZP A;  4GK0 E;  3ZJ2 A;  4A56 A;  5JR9 C;  5FY7 A;  2MTQ A;  3O9X A;  2LSG A;  3ZYK A;  2M67 A;  3KVA A;  4OFZ A;  2C5J A;  2VKD A;  4BJM A;  4UVA B;  4HEA A;  3ZMS B;  3MAC A;  2V7L A;  4OYJ A;  3ETU A;  5J2T E;  5EK2 A;  4EB6 E;  3ZLI A;  5E0O A;  2JMH A;  3ZCI A;  2KT9 A;  4AKH A;  4UEL A;  4BAY B;  2XQY A;  1ZEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...