4MLKA

3.05a resolution structure of ct584 from chlamydia trachomatis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
151
Chain Sequence
b'TFLLLEGNLKRIFATPIGYTTFREFQNVVFNCAQQELANFLFELINGKLKQSAQSLIVQFMMPIRVAKDIHERGEFINFITSDMLCVFLNRLSRVDGQEFLLMTDVQNTCHLIRHLLSRLLEAQKNPIGEKNLQEIQEDLDSLRAHFEELT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CT584 protein
publication title Structure of CT584 from Chlamydia trachomatis refined to 3.05 angstrom resolution.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Unknown function
total genus 50
structure length 151
sequence length 167
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17435 DUF5414 Family of unknown function (DUF5414)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mlkA01
4MLKA 3Q9DA
chains in the Genus database with same CATH superfamily
4QKNA 4UV9B 4DV0T 5LJMA 2ODVA 4OX9T 1OEDC 4IE0A 4DV2T 4B3ST 1BR0A 5L4EA 2W61A 2IC9A 4O2AE 2VASA 5FYMA 2N9DA 3CX6B 2JQ9A 4DR1T 3DJBA 3B13A 3M65A 2FJDA 2KWHA 3R84B 5CFBA 4CI3B 5FXXA 1QLBA 5JDNA 4P09A 4JI4T 2HN1A 1Z0PA 1XDPA 3CQGB 4X1KE 4IDZA 4BA9A 4E7ZA 1SUMB 2IAKA 2I6HA 1SE7A 3PUVF 4XAXB 2QVAA 5FL0A 5LHIB 2E9XA 3RC3A 3MXZA 1S94A 1ZKEA 4ISSA 3JADA 4DV3T 5HXSA 3GN5A 3Q5XA 3J7Yq 2A9UA 3QC9A 4ZS3A 3ZMTB 3GMIA 1D1BA 4GK0E 2X9WA 4C90A 2YDQA 2JQQA 2WB5A 5JQGE 4OYJA 3PUYF 5EK3A 5L3EB 4LF8T 4YJ2E 1W0AA 4G2AA 5LMUT 3V5SA 3L09A 2XY8B 3PURA 5AQMB 3Q5DA 3ZLIA 4GYRA 3QK6A 3NRXA 3IF8B 3F2EA 3P50A 3N2OA 3ZT6A 5JTGA 1MMNA 2KXPB 4A5XA 1NENA 2XUEA 5LG3A 1IZNB 5E0OA 2X68A 1LVKA 3FBZA 2LLYA 1HS7A 3BQLA 3C50A 4KUMB 3EUHA 1UK5A 3RYHE 1FEWA 2IIUA 5ETWA 4X65T 3JC6D 2IC6A 3AAAB 1M62A 5AFUL 2W00A 4PFOA 3UU4A 2R6GF 3AA6B 2KT9A 4O2BE 4QH4A 4DO0A 5AQHB 4DR2T 4IT4A 5J0ZA 5J1GA 2BDEA 1S35A 4P0BA 4NIQA 4GOUA 4DMWA 3RRCA 3AVSA 2L3LA 4DR6T 4I43B 2BG9B 4X64T 3AEBA 5KMGP 4E7SA 2UXDT 4CI1B 2EHOD 1Y64B 3F31A 4GYSA 3H37A 2HHHT 3A5XA 3PJAA 2VL0A 3C64A 3EVYA 5JVDE 2CLYB 2A2FX 3O4XE 2V7KA 2LE8A 5HWYA 2QYWA 4DUZT 3OYXA 2HPJA 2VKDA 4F8HA 5L3DB 1YXRA 3T8OA 4JBWF 2LSKA 5AQOB 2YKSA 5GONE 4X1YE 2CXLA 1KFYA 4WBNE 4HWDA 2LOSA 5AQUB 2LM2A 3O9XA 4BJNA 3OJAA 4Q25A 3P4SA 4KX6A 2CE7A 3AEEA 2XQ9A 3KVAA 4LFAT 3AEGA 2G0UA 3ZCJA 2DNXA 4BAYB 4DBQA 1ZV4X 3I1AA 4MFRA 2E2AA 3SFDA 1H7CA 2Y8DA 1HNXT 3JC6C 2H7OA 3AB3B 2DCFA 3ZMZB 5CB4E 2ZMAA 3OKQA 3UFGA 4PNIA 4M1PA 4AKGA 3IBPA 2CMRA 2YU1A 4A98A 3VU7H 4NXNT 3J9X1 4HN9A 3FZHB 3ZMSB 1IBKT 2CLYC 1HX1B 3TLTA 3RQWA 1XDOA 4JEHB 3BQKA 4HFCA 5LBQB 3N9OA 3SS1A 5L3BB 4A56A 3CKDA 3C4XA 4CXXA 2WY2A 4TUYE 3ZCIA 3ZN0B 5M4YA 3AA0B 2WDQA 1OEDE 3PE0A 5C8YE 4GK5E 3N2GE 2KWIB 3BK9A 4I50E 4UXNB 5HXHA 2NOXA 2QGSA 1T7SA 2JQKA 4JI2T 4AXPA 5F3JA 2VWAA 5C2TA 4HGAA 2XQ7A 1CUNA 4JI6T 4COFA 1V9DA 3C4WA 1KNRA 3RIFA 3AEFA 4IREA 4ZXLA 2K9AA 1NWMX 3VR8A 2VQFT 3L3PA 4ADZA 5JR9B 4QWNB 3AXJB 4QH5A 2JJ9A 3FXDB 3AE5A 3Q9DA 3UU8A 1WR0A 4H9SE 4U74A 1NEKA 2BG9A 3ZMVB 5JDHA 3PUZF 4YJ3E 4U31A 5IHYA 4HWIB 3C51A 1VRBA 2CBIA 4YTMA 2I0MA 2VVNA 4N78D 5KDMC 4PAGA 5HEOA 1X9BA 3VRBA 4AIUA 1N34T 2V1DB 4P0AA 4HFHA 3ZJ2A 5ADXL 4PK4A 2UU9T 2WMOA 1I94T 2FJEA 3KVBA 4AQYT 2BBJA 3QNUA 5JDMA 5AQFB 3ETUA 5BR8T 3E22E 3B57A 2KMFA 2B76A 1HX8A 3A8YC 1XNRT 1IJ5A 5FL1A 1OEDB 3VKGA 2CWOA 1BR1A 3O1HA 3UUBA 3N9LA 1KNPA 4UELA 2RA1A 4EZHA 4U33A 2E8IA 2WMNA 2BVMA 3UTKA 3OVUA 3G06A 4DV7T 1U5PA 4DUYT 4UR9A 4U7YA 3UULA 3C98B 4X66T 3RH3A 3R6NA 1D0XA 4DMVA 4TX5A 2X0LB 5LMNT 5HWXA 5LGNB 2YK0A 2BKOA 5F5WA 3KBTA 2Q9QB 3RC8A 2C5JA 4MBQA 2ACXA 1MNEA 2V5DA 3EAMA 4I4TE 2ZM8A 2VVSA 3X1DA 2CA5A 3N9PA 2YU2A 4A97A 2E5LT 4UVAB 3HR0A 4LF6T 2JMKA 5ABGA 4JEUB 3PU8A 2HPLA 2A3DA 2NWBA 5AQKB 5CJ5A 4H9QC 5LOVE 5HYAA 2IW5B 3AAEB 5JR9A 2IHR1 4EAHA 4K0KT 4X1IE 1HG5A 3FZFB 3HKDE 4U72A 1KEYA 5AQSB 1WCRA 2B1EA 3HL6A 5HXCA 1O3XA 2LEHA 4B3RT 5KX5E 3K3NA 3UU3A 1IAPA 3QOFA 2WQYA 5L4HA 3AE9A 3ZEFB 1MIWA 3FB2A 4I0UA 5IUXA 4XBFB 2YDSA 4EEBA 4ILAA 4WYVA 2N2NA 4PK6A 5HXEA 3QUJA 3PJAJ 2Q9QC 4AQGA 3UUNA 2WM9A 3LDQB 2YEVC 2BG9E 3N9NA 3RYIE 3NVOA 4IE5A 3I0OA 5AQVB 3OYZA 3CQXC 1GQEA 3ZSTA 2H88A 3ZPOA 1E1HB 3HA4A 4TWDA 4JI3T 3RIUC 4IDQA 1OEDA 5A1LA 3H3MA 2XQ3A 2JQHA 4WBOA 4AI6A 3RQUA 4LMLA 1D1AA 1WR6A 5LYJE 4GKKT 4O4LE 4V1Av 2L9QA 4U7IA 1WRDA 4B3TT 1T8BA 5AQQB 3PTRB 2IMLA 4PFPA 4AQFC 2V7JA 3HKBE 4DV1T 1YW0A 2FJAA 2LHRA 4WZXA 3P4PA 3FXEB 4ZS2A 4WW0A 4CXYA 4KI0F 3LJCA 3AECA 3RKOA 4LMKA 2JPFA 2W62A 4IDOA 4HEAA 4B3MT 2XM1A 4O4HE 5H6QB 1WYCA 3U3IA 2A72A 4ZI2C 4G63A 1KF6A 1T72A 2V7MA 4NXMT 2UUCT 2CPTA 2X67A 3Q5EA 3AEAA 2NW7A 3ZMUB 4MLKA 3L8RA 4DR7T 3RPUA 3OBVE 3RKGA 2CHOA 2WS3A 3LBXB 3MK7C 2NTYA 1HR0T 2FBWA 3UFEA 5FP3A 3PUSA 3RI5A 5H6RB 4IL4A 2WWUA 2LSYA 4UV8B 3OTOT 3P7IA 2XQ8A 4DIDB 3UU6A 3BQIA 4EEDA 3T1YT 3FZMB 3UUMA 1D0ZA 4JLEA 3AE3A 2DWKA 1UGOA 2VL8A 5EZYE 2VK9A 4P1NA 5LJNA 4OFZA 3ZC1A 3RYCE 4YT0A 3E08A 1EZ3A 1BR4A 3LK2B 2Z6EA 4EXTA 4ZOLE 4UVBB 1W09A 1QUUA 2ES0A 4QH1A 3GWHA 4QXHB 3N2KE 2XAGB 2CRBA 2LOPA 1FMWA 4EZ4A 3O1JA 4LMJA 4LF4T 4KHPT 2V8SV 2HN2A 3HKCE 1FJGT 3UQ4A 2W66A 3ANWB 4JYAT 2YINA 1MIVA 2K48A 2PFVA 4TN7B 4TZ4C 2BS4A 3AEDA 3JCFA 3AE7A 4QXBB 2CHNA 3U78A 4ZI3C 4CN6A 1XMOT 4GIWA 2X0YA 3K8PC 2WCAA 4DV4T 2C5KT 1SA0E 3LK42 4ZEYA 2MPKA 2OA5A 3TLUA 2LRLA 5JDGA 3TLSA 2XQAA 4HWHA 2WDVA 4DBRA 2W63A 4HFEA 4JI5T 3Q5WA 3ZYMA 4DV6T 2X9XA 2LT3A 3EI0A 1YD8G 3W15B 2YOEA 3KINB 3K3OA 2GK9A 1ZEEA 4H63V 1U4QA 4TNWA 3RRWA 3IEEA 2ZM2A 1BR2A 5ABFB 2JIWA 1E7PA 4JI1T 3HKEE 4ILCA 3TKLB 2KLQA 3NKZA 1UURA 3ZSSA 2DWGA 4X20E 5L47A 3UUXB 4X5TA 1WFDA 3RYFE 1UCUA 1US7B 2XSBA 3EHZA 4HFBA 4PJJA 1QSDA 3LBXA 2XAJB 5AQGB 2PBIA 4HFDA 2C5IT 2Y6XA 4UIGA 2BS3A 4PJNA 1N33T 4TNVA 1G73A 3N9MA 3ONLC 2XQ5A 2ACZA 4X62T 4IDPA 1N36T 5C3JA 2W67A 2DI4A 4C91A 3AE4A 4DR4T 3Q2MA 1E2AA 4OHFA 4L5GA 1LVFA 2J4GA 1LRZA 2XJ7A 3UT5E 1Y01A 3ZJ1A 5HEGA 2N1GA 3P8CD 1HNZT 1G8XA 3EDVA 2XAFB 4IL9A 5LBMA 2BS2A 4K0UA 3CK6A 4HWFA 4CZZB 4IE7A 4YXDA 4YSYA 5L3CB 1VCSA 5FMNA 3SRZA 4DNDA 3ANWA 5LB7B 1DU2A 2XQ6A 2WAUA 2Q9QD 3RGLA 1HNWT 5ABHA 3T1HT 5JRCB 2JMHA 3N5LA 3KV9A 4DR5T 4EYUA 3PUGA 2QA7A 4IIJE 1YQ3A 4YHJA 3GA8A 3ZYKA 2BVLA 3LG7A 5CA1E 5FVLA 3ONXA 5LP6E 2WSSV 3CQCB 5L2LA 4H9RC 4LF9T 4AKIA 2ZM6T 4Z91A 3SWHA 3CX7B 4AKRB 3S4UA 2J47A 2HH7A 5JDQA 4AISA 3QB5A 2P9BA 4PW8A 3NRYA 4UF0B 4YTPA 5DQVA 5ABFA 4L9IA 2XQYA 4YSXA 3KV5A 3CWZB 3LK3B 5L3GB 3IHRA 2CBJA 2D0UA 2DL1A 3AXJA 3N9QA 4ISTA 3NZQA 2CXDA 2DHRA 1JNZA 3VRAA 2V7IA 1HG2A 2XPKA 4ZI2D 2FUPA 2UXNB 3ZKRA 1MMAA 2WZHA 4L0RA 5HCMA 3FHNA 2OLTA 5F8PA 3MKDA 2WWVA 1HFAA 4U2ZA 4YLHA 1UUSA 2K5BB 2AE9A 5KXJA 3HI2A 3PUQA 3A7MA 2D0TA 1YKEB 4YY3T 4EOZB 3AAIA 2RPAA 4MHCA 3AA1B 3VR9A 3ZC0A 1IBMT 4KHZF 3RX6A 3TLWA 2X9HA 1AJ3A 2W2UA 3SFEA 2IDOB 5EK4A 2RP4A 1LKXA 3ZN1B 2XM2A 3ETVA 5LGUB 4H9OC 3AA7B 3TLVA 4O8SA 3AVRA 2BKNA 2ODUA 2X66A 1OWAA 4EV6A 4JI8T 2VQET 3MA9A 2PG8A 3KDSE 2NP9A 1MIYA 2LSJA 4ERRA 2MYSA 2PTFA 5JRCA 3CMLA 5AQTB 2UXCT 2M6BA 1XMQT 4UVCB 5L3FB 3FBLA 2XAQB 1HTJF 2V7LA 5BMVE 3ZT5A 3B5MA 4KBMB 4GKJT 4BJMA 2UXBT 2LSIA 3I0QA 1MMGA 3ZT7A 5FXWA 4ANJA 2SPCA 3M3ZB 2H3RA 4PJMA 5LXTE 2YDRA 4YSZA 2Q9QA 3AE2A 5DJQC 4ZI3D 3PUXF 4DVDA 2XAHB 2VKOA 3EDUA 3PV0F 1IBLT 2E5VA 4WNKA 3PUWF 5J2UE 2NTXA 5AQRB 2XHEB 1JNRA 2J62A 4YTNA 4ZZBA 4YFSA 3D0TA 5IYZE 1ZP0A 1J1JA 4UF0A 2PJQA 4IE4A 1Z8UA 1XZYA 3K3QC 2LJLA 4KMCA 3RIUA 5ABEA 4CI2B 2X0HA 3KV4A 5FNVE 2J1DG 1J5ET 3KBUA 4EGWA 3IA3A 1UX4A 3SOLA 5DQWA 5FY7A 3VKHA 3FZKB 5CA0E 3KV6A 2MBGA 1VCTA 1XWMA 3ONJA 4CN4A 5DABA 4AQFA 2QRXA 5HEHA 1FIOA 3CX8B 4HWCA 5FXVA 4EYYR 5LCYA 5FVKA 4DV5T 4TWFA 4TWHA 3PDYA 4IDNA 5LGTB 5FKYA 1UX5A 2MOZA 2NR4A 4F6RC 4H63H 2KZ7B 2KSRA 1CHUA 4NUVA 3OPCA 4YHHT 4CN1A 3DP7A 1NAFA 3I9YA 4QX7B 2WZIA 2FJBA 2K24A 2VB6A 2WBLA 5HAXA 2Y48B 1WLXA 2M67A 2EHOB 4QXCB 4IHJE 4JI7T 3ZYLA 2LKHA 3I9WA 2OV9A 4ILUA 3NBXX 1YKHB 3WI3A 3JAFA 4ZI7E 1J5WA 3L39A 3AE1A 2VKJA 3H3AA 5LA6E 1M7KA 3NWIA 3RF1A 2VURA 2AXDS 4PJLA 5JDFA 5IWAT 4H9PC 2UUBT 2XASB 4FI5A 3EABA 5HXRA 2L8KA 4Z8XA 2NW9A 4Z90A 2BG9C 1XNQT 1VOMA 2C0SA 1MNDA 2V6YB 1IJ6A 5HCJA 3V5UA 3K1SA 2XQ4A 4JV5T 2WU5A 3WAJA 3F57A 3RIAA 2V6XA 2V5CA 4HFVA 4AKLA 1D1CA 3WAKA 1HCIA 2MAWA 4NPPA 2IUBA 4ASKA 3LFMA 4LFBT 4IGUA 4QHOA 5AQNB 4JI0T 1HF8A 2EHOC 1ZOYA 3KFWX 4DR3T 3P4WA 1FMVA 4EIWA 3RLFF 2MTQA 2ZM0A 1WYBA 2K3WA 2H7VC 4TV9E 2BKPA 5LHHB 2CXFA 5JH7E 1KNZA 3ABVA 5J2TE 2D5UA 4HFIA 5CGMA 4PK5A 2E9XD 3CVRA 3RHWA 4OK0A 4U2YA 2CWYA 2WU2A 2CCQA 5AQJB 2M6IA 2KNDA 2WDRA 2JRKA 3CIRA 5LHGB 4CQIA 1B7TA 3C4ZA 2NW8A 2ZLYA 4O4IE 5EK2A 4HE8A 1OXZA 4LF7T 1KK7A 2E9XB 3PU3A 3UQ7A 3PUAA 4CXWA 3ESLA 4FJOA 1N32T 2YN6A 5HEUA 3GN5B 4NUUA 5FXZA 3VHLA 2CM0A 1YQ4A 3DTOA 2KINB 2EHOA 2XTLA 4HKAA 1SHZC 5JDLA 4IE6A 3E0ZA 2CEAA 3LSVA 1W0BA 4KP3C 2X9YA 3MACA 5FY1A 1L0VA 2W4XA 5TAOA 4MALA 4U3CA 3MJXA 4O4JE 5FY0A 4OYKA 4H9NC 1T98A 2LRKA 5JR9C 3FZLB 1ZHCA 3AE6A 2H89A 2XZEA 3O1IA 2F4VT 2BZBA 2D9DA 2VKHA 4LFCT 2V6YA 4AKHA 3MZKB 3NZPA 2LSGA 2I59A 2UUAT 4B6XA 1R8IA 2WP9A 5HEJA 1W9RA 5LG4A 3CPZA 2XSAA 1I6ZA 3AE8A 2V26A 2DLRA 1D0YA 2E9XC 2LM9A 4J2CA 3UU5A 4QX8B 1MMDA 2D2SA 4ZZCA 2BBHA 4HTEA 3QB5K 4ILBA 4I55E 4UEMA 1X79A 2LHNA 4JUYA 4XZCA 2LKGA 3JAEA 4LF5T 3P4RA 5LNKA 2W0GA 4ZHQE 5JREA 2X51A 5AQPB 5AQLB 3P4QA 5AQIB 4EB6E 2UXXB 4TV8E
chains in the Genus database with same CATH topology
4PJMA 4QKNA 4UV9B 5LXTE 5LJMA 2PFVA 4P0AA 2ODVA 4TN7B 4TZ4C 3ZJ2A 2Q9QA 5ADXL 4ZI3D 5DJQC 4QXBB 4IE0A 3U78A 4DVDA 2XAHB 4PK4A 4ZI3C 4GIWA 1BR0A 3K8PC 2VKOA 2WMOA 3EDUA 2C5KT 3KVBA 4WNKA 2W61A 5J2UE 2IC9A 2NTXA 2VASA 4O2AE 5FYMA 5JDMA 2XHEB 2N9DA 3CX6B 3DJBA 1SA0E 3B13A 3M65A 3LK42 2KWHA 4YFSA 3R84B 3D0TA 2OA5A 3ETUA 5IYZE 4CI3B 5FXXA 4UF0A 2PJQA 4IE4A 3E22E 3B57A 5JDNA 3K3QC 2KMFA 2LJLA 4KMCA 1HX8A 4P09A 1IJ5A 5JDGA 4CI2B 1Z0PA 3VKGA 3CQGB 3KV4A 2CWOA 5FNVE 4X1KE 4IDZA 4BA9A 4E7ZA 1BR1A 2J1DG 3O1HA 2UXXB 2IAKA 4DBRA 3KBUA 3N9LA 2W63A 1UX4A 4XAXB 3SOLA 5LHIB 4UELA 5DQWA 2E9XA 2RA1A 3Q5WA 5FY7A 3ZYMA 3VKHA 4EZHA 2X9XA 3RC3A 2LT3A 1YD8G 1S94A 3MXZA 2E8IA 3W15B 3KINB 5CA0E 1ZKEA 3K3OA 3KV6A 2GK9A 2MBGA 4ISSA 1ZEEA 4H63V 1U4QA 5HXSA 3GN5A 2WMNA 3Q5XA 2BVMA 3RRWA 3J7Yq 3IEEA 2ZM2A 3UTKA 1BR2A 5DABA 4AQFA 3HKEE 1U5PA 3QC9A 1FIOA 4ZS3A 3CX8B 3TKLB 3UULA 3ZMTB 3GMIA 1D1BA 3C98B 5FXVA 2KLQA 4EYYR 3RH3A 4GK0E 2X9WA 5LCYA 3R6NA 4C90A 1D0XA 4DMVA 2JQQA 2DWGA 4TX5A 4ANJA 2X0LB 5JQGE 3PDYA 4OYJA 4X20E 5LGTB 5EK3A 5L3EB 1UX5A 5HWXA 2MOZA 4F6RC 2YK0A 3UUXB 5LGNB 4H63H 2KZ7B 4NUVA 3RYFE 1UCUA 4YJ2E 3DP7A 1US7B 3KBTA 1NAFA 4G2AA 4PJJA 2Q9QB 3I9YA 3RC8A 1QSDA 3V5SA 4QX7B 3L09A 2C5JA 3PURA 4MBQA 3LBXA 2XAJB 2ACXA 2K24A 1MNEA 2VB6A 2WBLA 5HAXA 4I4TE 2PBIA 2Y48B 2ZM8A 3ZLIA 4GYRA 1WLXA 3QK6A 2M67A 3NRXA 3IF8B 3F2EA 2CA5A 2C5IT 2EHOB 2Y6XA 4QXCB 4IHJE 4UIGA 3N2OA 3N9PA 4PJNA 2YU2A 3ZYLA 1G73A 3N9MA 4UVAB 3HR0A 1MMNA 3I9WA 2KXPB 4ILUA 3NBXX 1YKHB 3WI3A 2XUEA 4ZI7E 2JMKA 4JEUB 3PU8A 2DI4A 2VKJA 3H3AA 4C91A 5LA6E 1IZNB 2A3DA 2HPLA 2NWBA 5E0OA 2X68A 1LVKA 3FBZA 4H9QC 5LOVE 5HYAA 4PJLA 5JDFA 1HS7A 4H9PC 3Q2MA 2IW5B 4OHFA 3BQLA 3AAEB 3C50A 4L5GA 4KUMB 3EUHA 5JR9A 2XASB 4FI5A 3RYHE 1LVFA 1FEWA 4EAHA 5ETWA 3JC6D 4X1IE 1HG5A 1LRZA 5HXRA 2L8KA 3HKDE 4U72A 4Z8XA 3UT5E 2NW9A 2IC6A 3ZJ1A 3AAAB 2N1GA 3P8CD 2W00A 5AFUL 1VOMA 4PFOA 2C0SA 2B1EA 1G8XA 3EDVA 3HL6A 2XAFB 5HXCA 1O3XA 3AA6B 5LBMA 2LEHA 4K0UA 5KX5E 1MNDA 2KT9A 3K3NA 4O2BE 1IJ6A 3V5UA 4CZZB 4DO0A 1IAPA 4IE7A 3WAJA 3F57A 5L3CB 5J1GA 2BDEA 1S35A 5FMNA 3SRZA 3ZEFB 4DNDA 4P0BA 3ANWA 4GOUA 4DMWA 1MIWA 3RRCA 3FB2A 3AVSA 4HFVA 4AKLA 4XBFB 2WAUA 2N2NA 4PK6A 1D1CA 5HXEA 3WAKA 1HCIA 2L3LA 3QUJA 2Q9QD 4I43B 2Q9QC 4AQGA 3UUNA 2WM9A 5JRCB 4ASKA 2JMHA 3N5LA 3LFMA 5KMGP 4IGUA 2YEVC 3KV9A 4QHOA 4E7SA 4CI1B 4EYUA 2EHOD 1Y64B 3N9NA 3RYIE 3F31A 1HF8A 2EHOC 3KFWX 3H37A 4GYSA 3PUGA 2QA7A 4IE5A 1FMVA 4IIJE 3A5XA 3I0OA 3C64A 3EVYA 5JVDE 4YHJA 3GA8A 3ZYKA 3OYZA 3CQXC 2CLYB 4EIWA 2A2FX 2BVLA 3O4XE 2V7KA 3LG7A 5CA1E 2LE8A 3ONXA 3ZPOA 5HWYA 1E1HB 2MTQA 3OYXA 5LP6E 2HPJA 2WSSV 2VKDA 2ZM0A 1WYBA 3HA4A 3CQCB 4TV9E 2H7VC 5L3DB 4H9RC 5L2LA 4AKIA 5LHHB 2CXFA 5JH7E 1KNZA 5A1LA 3SWHA 3T8OA 3CX7B 5J2TE 2LSKA 2D5UA 4AKRB 5GONE 3S4UA 4WBOA 4PK5A 4AI6A 2E9XD 1D1AA 1WR6A 3CVRA 2HH7A 4X1YE 5LYJE 2CXLA 4OK0A 2CWYA 5JDQA 4WBNE 2CCQA 2KNDA 2P9BA 2JRKA 4O4LE 4PW8A 5LHGB 3NRYA 4V1Av 2LOSA 4CQIA 2L9QA 4UF0B 1B7TA 3C4ZA 2NW8A 2ZLYA 1WRDA 3O9XA 4BJNA 3PTRB 4O4IE 5DQVA 5EK2A 3OJAA 4L9IA 4PFPA 4AQFC 2XQYA 2V7JA 3KV5A 3HKBE 2CE7A 1YW0A 2LHRA 3CWZB 4HE8A 3LK3B 1OXZA 3KVAA 5L3GB 3IHRA 2G0UA 3ZCJA 2D0UA 3FXEB 4ZS2A 4WW0A 2DNXA 4CXYA 4BAYB 1KK7A 3LJCA 3N9QA 2E9XB 1ZV4X 3I1AA 3PU3A 4ISTA 4MFRA 4DBQA 3NZQA 2CXDA 2DHRA 1H7CA 3PUAA 2Y8DA 3RKOA 2JPFA 3JC6C 4CXWA 2H7OA 2W62A 3ESLA 3AB3B 2DCFA 3ZMZB 4HEAA 4FJOA 5CB4E 2ZMAA 2V7IA 3OKQA 3GN5B 4PNIA 4NUUA 5FXZA 3VHLA 1HG2A 4O4HE 4M1PA 4AKGA 2CM0A 5H6QB 1WYCA 3U3IA 4ZI2D 3DTOA 2CMRA 2YU1A 2KINB 3IBPA 2A72A 4ZI2C 2EHOA 2XTLA 4G63A 4HKAA 3VU7H 2V7MA 3J9X1 2UXNB 1MMAA 4HN9A 3ZMSB 1SHZC 5JDLA 2X67A 4IE6A 4L0RA 3FHNA 2CLYC 3E0ZA 2CEAA 2NW7A 4KP3C 2X9YA 3ZMUB 5F8PA 4MLKA 3MKDA 1HFAA 4JEHB 3MACA 3BQKA 5LBQB 5FY1A 4YLHA 2K5BB 3N9OA 3RPUA 3SS1A 5L3BB 4A56A 3HI2A 3CKDA 3OBVE 3PUQA 4MALA 3C4XA 3MJXA 5TAOA 4CXXA 4O4JE 3LBXB 4TUYE 2D0TA 3MK7C 3ZCIA 5FY0A 4OYKA 2NTYA 1YKEB 3ZN0B 5M4YA 3AA0B 4EOZB 4H9NC 3PE0A 5C8YE 3AAIA 1T98A 4MHCA 5JR9C 3UFEA 5FP3A 3AA1B 4GK5E 3N2GE 3PUSA 5H6RB 2WWUA 3ZC0A 2LSYA 2KWIB 1ZHCA 4UV8B 3RX6A 2X9HA 1AJ3A 3BK9A 4I50E 4UXNB 5HXHA 3O1IA 2NOXA 3P7IA 2QGSA 5EK4A 2BZBA 3BQIA 2RP4A 1LKXA 4AXPA 2VKHA 2VWAA 3ZN1B 5F3JA 3UUMA 1D0ZA 4HGAA 1CUNA 3ETVA 4AKHA 4JLEA 5LGUB 1V9DA 2DWKA 4H9OC 3AA7B 3C4WA 3MZKB 3NZPA 2LSGA 2VL8A 4O8SA 5EZYE 3AVRA 2I59A 2K9AA 1NWMX 2ODUA 2VK9A 4B6XA 2X66A 5LJNA 1OWAA 4OFZA 5LG4A 3CPZA 3L3PA 3ZC1A 4ADZA 5JR9B 3RYCE 4QWNB 3MA9A 2PG8A 2V26A 2DLRA 1D0YA 3KDSE 2E9XC 2JJ9A 3E08A 1EZ3A 2LM9A 1BR4A 3LK2B 3FXDB 4J2CA 2Z6EA 3Q9DA 4EXTA 4QX8B 1MMDA 2D2SA 4ZOLE 2NP9A 4H9SE 4U74A 4UVBB 1MIYA 1QUUA 2LSJA 4ERRA 4HTEA 2ES0A 2MYSA 5JRCA 3GWHA 4QXHB 3ZMVB 5JDHA 3CMLA 4I55E 4UEMA 3N2KE 2XAGB 1X79A 4YJ3E 2LOPA 5IHYA 3C51A 1VRBA 1FMWA 2LHNA 4JUYA 4XZCA 4EZ4A 3O1JA 4UVCB 5L3FB 3FBLA 2XAQB 4N78D 5LNKA 5JREA 2W0GA 4ZHQE 3HKCE 2X51A 1HTJF 2V7LA 5BMVE 5KDMC 3ANWB 4KBMB 4BJMA 2YINA 4PAGA 2LSIA 3I0QA 1MMGA 1MIVA 2K48A 4EB6E 5FXWA 2V1DB 2SPCA 4TV8E 2H3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLK A;  3Q9D A; 
#chains in the Genus database with same CATH topology
 4QKN A;  4UV9 B;  4DV0 T;  5LJM A;  2ODV A;  4OX9 T;  1OED C;  4IE0 A;  4DV2 T;  4B3S T;  1BR0 A;  5L4E A;  2W61 A;  2IC9 A;  4O2A E;  2VAS A;  5FYM A;  2N9D A;  3CX6 B;  2JQ9 A;  4DR1 T;  3DJB A;  3B13 A;  3M65 A;  2FJD A;  2KWH A;  3R84 B;  5CFB A;  4CI3 B;  5FXX A;  1QLB A;  5JDN A;  4P09 A;  4JI4 T;  2HN1 A;  1Z0P A;  1XDP A;  3CQG B;  4X1K E;  4IDZ A;  4BA9 A;  4E7Z A;  1SUM B;  2IAK A;  2I6H A;  1SE7 A;  3PUV F;  4XAX B;  2QVA A;  5FL0 A;  5LHI B;  2E9X A;  3RC3 A;  3MXZ A;  1S94 A;  1ZKE A;  4ISS A;  3JAD A;  4DV3 T;  5HXS A;  3GN5 A;  3Q5X A;  3J7Y q;  2A9U A;  3QC9 A;  4ZS3 A;  3ZMT B;  3GMI A;  1D1B A;  4GK0 E;  2X9W A;  4C90 A;  2YDQ A;  2JQQ A;  2WB5 A;  5JQG E;  4OYJ A;  3PUY F;  5EK3 A;  5L3E B;  4LF8 T;  4YJ2 E;  1W0A A;  4G2A A;  5LMU T;  3V5S A;  3L09 A;  2XY8 B;  3PUR A;  5AQM B;  3Q5D A;  3ZLI A;  4GYR A;  3QK6 A;  3NRX A;  3IF8 B;  3F2E A;  3P50 A;  3N2O A;  3ZT6 A;  5JTG A;  1MMN A;  2KXP B;  4A5X A;  1NEN A;  2XUE A;  5LG3 A;  1IZN B;  5E0O A;  2X68 A;  1LVK A;  3FBZ A;  2LLY A;  1HS7 A;  3BQL A;  3C50 A;  4KUM B;  3EUH A;  1UK5 A;  3RYH E;  1FEW A;  2IIU A;  5ETW A;  4X65 T;  3JC6 D;  2IC6 A;  3AAA B;  1M62 A;  5AFU L;  2W00 A;  4PFO A;  3UU4 A;  2R6G F;  3AA6 B;  2KT9 A;  4O2B E;  4QH4 A;  4DO0 A;  5AQH B;  4DR2 T;  4IT4 A;  5J0Z A;  5J1G A;  2BDE A;  1S35 A;  4P0B A;  4NIQ A;  4GOU A;  4DMW A;  3RRC A;  3AVS A;  2L3L A;  4DR6 T;  4I43 B;  2BG9 B;  4X64 T;  3AEB A;  5KMG P;  4E7S A;  2UXD T;  4CI1 B;  2EHO D;  1Y64 B;  3F31 A;  4GYS A;  3H37 A;  2HHH T;  3A5X A;  3PJA A;  2VL0 A;  3C64 A;  3EVY A;  5JVD E;  2CLY B;  2A2F X;  3O4X E;  2V7K A;  2LE8 A;  5HWY A;  2QYW A;  4DUZ T;  3OYX A;  2HPJ A;  2VKD A;  4F8H A;  5L3D B;  1YXR A;  3T8O A;  4JBW F;  2LSK A;  5AQO B;  2YKS A;  5GON E;  4X1Y E;  2CXL A;  1KFY A;  4WBN E;  4HWD A;  2LOS A;  5AQU B;  2LM2 A;  3O9X A;  4BJN A;  3OJA A;  4Q25 A;  3P4S A;  4KX6 A;  2CE7 A;  3AEE A;  2XQ9 A;  3KVA A;  4LFA T;  3AEG A;  2G0U A;  3ZCJ A;  2DNX A;  4BAY B;  4DBQ A;  1ZV4 X;  3I1A A;  4MFR A;  2E2A A;  3SFD A;  1H7C A;  2Y8D A;  1HNX T;  3JC6 C;  2H7O A;  3AB3 B;  2DCF A;  3ZMZ B;  5CB4 E;  2ZMA A;  3OKQ A;  3UFG A;  4PNI A;  4M1P A;  4AKG A;  3IBP A;  2CMR A;  2YU1 A;  4A98 A;  3VU7 H;  4NXN T;  3J9X 1;  4HN9 A;  3FZH B;  3ZMS B;  1IBK T;  2CLY C;  1HX1 B;  3TLT A;  3RQW A;  1XDO A;  4JEH B;  3BQK A;  4HFC A;  5LBQ B;  3N9O A;  3SS1 A;  5L3B B;  4A56 A;  3CKD A;  3C4X A;  4CXX A;  2WY2 A;  4TUY E;  3ZCI A;  3ZN0 B;  5M4Y A;  3AA0 B;  2WDQ A;  1OED E;  3PE0 A;  5C8Y E;  4GK5 E;  3N2G E;  2KWI B;  3BK9 A;  4I50 E;  4UXN B;  5HXH A;  2NOX A;  2QGS A;  1T7S A;  2JQK A;  4JI2 T;  4AXP A;  5F3J A;  2VWA A;  5C2T A;  4HGA A;  2XQ7 A;  1CUN A;  4JI6 T;  4COF A;  1V9D A;  3C4W A;  1KNR A;  3RIF A;  3AEF A;  4IRE A;  4ZXL A;  2K9A A;  1NWM X;  3VR8 A;  2VQF T;  3L3P A;  4ADZ A;  5JR9 B;  4QWN B;  3AXJ B;  4QH5 A;  2JJ9 A;  3FXD B;  3AE5 A;  3Q9D A;  3UU8 A;  1WR0 A;  4H9S E;  4U74 A;  1NEK A;  2BG9 A;  3ZMV B;  5JDH A;  3PUZ F;  4YJ3 E;  4U31 A;  5IHY A;  4HWI B;  3C51 A;  1VRB A;  2CBI A;  4YTM A;  2I0M A;  2VVN A;  4N78 D;  5KDM C;  4PAG A;  5HEO A;  1X9B A;  3VRB A;  4AIU A;  1N34 T;  2V1D B;  4P0A A;  4HFH A;  3ZJ2 A;  5ADX L;  4PK4 A;  2UU9 T;  2WMO A;  1I94 T;  2FJE A;  3KVB A;  4AQY T;  2BBJ A;  3QNU A;  5JDM A;  5AQF B;  3ETU A;  5BR8 T;  3E22 E;  3B57 A;  2KMF A;  2B76 A;  1HX8 A;  3A8Y C;  1XNR T;  1IJ5 A;  5FL1 A;  1OED B;  3VKG A;  2CWO A;  1BR1 A;  3O1H A;  3UUB A;  3N9L A;  1KNP A;  4UEL A;  2RA1 A;  4EZH A;  4U33 A;  2E8I A;  2WMN A;  2BVM A;  3UTK A;  3OVU A;  3G06 A;  4DV7 T;  1U5P A;  4DUY T;  4UR9 A;  4U7Y A;  3UUL A;  3C98 B;  4X66 T;  3RH3 A;  3R6N A;  1D0X A;  4DMV A;  4TX5 A;  2X0L B;  5LMN T;  5HWX A;  5LGN B;  2YK0 A;  2BKO A;  5F5W A;  3KBT A;  2Q9Q B;  3RC8 A;  2C5J A;  4MBQ A;  2ACX A;  1MNE A;  2V5D A;  3EAM A;  4I4T E;  2ZM8 A;  2VVS A;  3X1D A;  2CA5 A;  3N9P A;  2YU2 A;  4A97 A;  2E5L T;  4UVA B;  3HR0 A;  4LF6 T;  2JMK A;  5ABG A;  4JEU B;  3PU8 A;  2HPL A;  2A3D A;  2NWB A;  5AQK B;  5CJ5 A;  4H9Q C;  5LOV E;  5HYA A;  2IW5 B;  3AAE B;  5JR9 A;  2IHR 1;  4EAH A;  4K0K T;  4X1I E;  1HG5 A;  3FZF B;  3HKD E;  4U72 A;  1KEY A;  5AQS B;  1WCR A;  2B1E A;  3HL6 A;  5HXC A;  1O3X A;  2LEH A;  4B3R T;  5KX5 E;  3K3N A;  3UU3 A;  1IAP A;  3QOF A;  2WQY A;  5L4H A;  3AE9 A;  3ZEF B;  1MIW A;  3FB2 A;  4I0U A;  5IUX A;  4XBF B;  2YDS A;  4EEB A;  4ILA A;  4WYV A;  2N2N A;  4PK6 A;  5HXE A;  3QUJ A;  3PJA J;  2Q9Q C;  4AQG A;  3UUN A;  2WM9 A;  3LDQ B;  2YEV C;  2BG9 E;  3N9N A;  3RYI E;  3NVO A;  4IE5 A;  3I0O A;  5AQV B;  3OYZ A;  3CQX C;  1GQE A;  3ZST A;  2H88 A;  3ZPO A;  1E1H B;  3HA4 A;  4TWD A;  4JI3 T;  3RIU C;  4IDQ A;  1OED A;  5A1L A;  3H3M A;  2XQ3 A;  2JQH A;  4WBO A;  4AI6 A;  3RQU A;  4LML A;  1D1A A;  1WR6 A;  5LYJ E;  4GKK T;  4O4L E;  4V1A v;  2L9Q A;  4U7I A;  1WRD A;  4B3T T;  1T8B A;  5AQQ B;  3PTR B;  2IML A;  4PFP A;  4AQF C;  2V7J A;  3HKB E;  4DV1 T;  1YW0 A;  2FJA A;  2LHR A;  4WZX A;  3P4P A;  3FXE B;  4ZS2 A;  4WW0 A;  4CXY A;  4KI0 F;  3LJC A;  3AEC A;  3RKO A;  4LMK A;  2JPF A;  2W62 A;  4IDO A;  4HEA A;  4B3M T;  2XM1 A;  4O4H E;  5H6Q B;  1WYC A;  3U3I A;  2A72 A;  4ZI2 C;  4G63 A;  1KF6 A;  1T72 A;  2V7M A;  4NXM T;  2UUC T;  2CPT A;  2X67 A;  3Q5E A;  3AEA A;  2NW7 A;  3ZMU B;  4MLK A;  3L8R A;  4DR7 T;  3RPU A;  3OBV E;  3RKG A;  2CHO A;  2WS3 A;  3LBX B;  3MK7 C;  2NTY A;  1HR0 T;  2FBW A;  3UFE A;  5FP3 A;  3PUS A;  3RI5 A;  5H6R B;  4IL4 A;  2WWU A;  2LSY A;  4UV8 B;  3OTO T;  3P7I A;  2XQ8 A;  4DID B;  3UU6 A;  3BQI A;  4EED A;  3T1Y T;  3FZM B;  3UUM A;  1D0Z A;  4JLE A;  3AE3 A;  2DWK A;  1UGO A;  2VL8 A;  5EZY E;  2VK9 A;  4P1N A;  5LJN A;  4OFZ A;  3ZC1 A;  3RYC E;  4YT0 A;  3E08 A;  1EZ3 A;  1BR4 A;  3LK2 B;  2Z6E A;  4EXT A;  4ZOL E;  4UVB B;  1W09 A;  1QUU A;  2ES0 A;  4QH1 A;  3GWH A;  4QXH B;  3N2K E;  2XAG B;  2CRB A;  2LOP A;  1FMW A;  4EZ4 A;  3O1J A;  4LMJ A;  4LF4 T;  4KHP T;  2V8S V;  2HN2 A;  3HKC E;  1FJG T;  3UQ4 A;  2W66 A;  3ANW B;  4JYA T;  2YIN A;  1MIV A;  2K48 A;  2PFV A;  4TN7 B;  4TZ4 C;  2BS4 A;  3AED A;  3JCF A;  3AE7 A;  4QXB B;  2CHN A;  3U78 A;  4ZI3 C;  4CN6 A;  1XMO T;  4GIW A;  2X0Y A;  3K8P C;  2WCA A;  4DV4 T;  2C5K T;  1SA0 E;  3LK4 2;  4ZEY A;  2MPK A;  2OA5 A;  3TLU A;  2LRL A;  5JDG A;  3TLS A;  2XQA A;  4HWH A;  2WDV A;  4DBR A;  2W63 A;  4HFE A;  4JI5 T;  3Q5W A;  3ZYM A;  4DV6 T;  2X9X A;  2LT3 A;  3EI0 A;  1YD8 G;  3W15 B;  2YOE A;  3KIN B;  3K3O A;  2GK9 A;  1ZEE A;  4H63 V;  1U4Q A;  4TNW A;  3RRW A;  3IEE A;  2ZM2 A;  1BR2 A;  5ABF B;  2JIW A;  1E7P A;  4JI1 T;  3HKE E;  4ILC A;  3TKL B;  2KLQ A;  3NKZ A;  1UUR A;  3ZSS A;  2DWG A;  4X20 E;  5L47 A;  3UUX B;  4X5T A;  1WFD A;  3RYF E;  1UCU A;  1US7 B;  2XSB A;  3EHZ A;  4HFB A;  4PJJ A;  1QSD A;  3LBX A;  2XAJ B;  5AQG B;  2PBI A;  4HFD A;  2C5I T;  2Y6X A;  4UIG A;  2BS3 A;  4PJN A;  1N33 T;  4TNV A;  1G73 A;  3N9M A;  3ONL C;  2XQ5 A;  2ACZ A;  4X62 T;  4IDP A;  1N36 T;  5C3J A;  2W67 A;  2DI4 A;  4C91 A;  3AE4 A;  4DR4 T;  3Q2M A;  1E2A A;  4OHF A;  4L5G A;  1LVF A;  2J4G A;  1LRZ A;  2XJ7 A;  3UT5 E;  1Y01 A;  3ZJ1 A;  5HEG A;  2N1G A;  3P8C D;  1HNZ T;  1G8X A;  3EDV A;  2XAF B;  4IL9 A;  5LBM A;  2BS2 A;  4K0U A;  3CK6 A;  4HWF A;  4CZZ B;  4IE7 A;  4YXD A;  4YSY A;  5L3C B;  1VCS A;  5FMN A;  3SRZ A;  4DND A;  3ANW A;  5LB7 B;  1DU2 A;  2XQ6 A;  2WAU A;  2Q9Q D;  3RGL A;  1HNW T;  5ABH A;  3T1H T;  5JRC B;  2JMH A;  3N5L A;  3KV9 A;  4DR5 T;  4EYU A;  3PUG A;  2QA7 A;  4IIJ E;  1YQ3 A;  4YHJ A;  3GA8 A;  3ZYK A;  2BVL A;  3LG7 A;  5CA1 E;  5FVL A;  3ONX A;  5LP6 E;  2WSS V;  3CQC B;  5L2L A;  4H9R C;  4LF9 T;  4AKI A;  2ZM6 T;  4Z91 A;  3SWH A;  3CX7 B;  4AKR B;  3S4U A;  2J47 A;  2HH7 A;  5JDQ A;  4AIS A;  3QB5 A;  2P9B A;  4PW8 A;  3NRY A;  4UF0 B;  4YTP A;  5DQV A;  5ABF A;  4L9I A;  2XQY A;  4YSX A;  3KV5 A;  3CWZ B;  3LK3 B;  5L3G B;  3IHR A;  2CBJ A;  2D0U A;  2DL1 A;  3AXJ A;  3N9Q A;  4IST A;  3NZQ A;  2CXD A;  2DHR A;  1JNZ A;  3VRA A;  2V7I A;  1HG2 A;  2XPK A;  4ZI2 D;  2FUP A;  2UXN B;  3ZKR A;  1MMA A;  2WZH A;  4L0R A;  5HCM A;  3FHN A;  2OLT A;  5F8P A;  3MKD A;  2WWV A;  1HFA A;  4U2Z A;  4YLH A;  1UUS A;  2K5B B;  2AE9 A;  5KXJ A;  3HI2 A;  3PUQ A;  3A7M A;  2D0T A;  1YKE B;  4YY3 T;  4EOZ B;  3AAI A;  2RPA A;  4MHC A;  3AA1 B;  3VR9 A;  3ZC0 A;  1IBM T;  4KHZ F;  3RX6 A;  3TLW A;  2X9H A;  1AJ3 A;  2W2U A;  3SFE A;  2IDO B;  5EK4 A;  2RP4 A;  1LKX A;  3ZN1 B;  2XM2 A;  3ETV A;  5LGU B;  4H9O C;  3AA7 B;  3TLV A;  4O8S A;  3AVR A;  2BKN A;  2ODU A;  2X66 A;  1OWA A;  4EV6 A;  4JI8 T;  2VQE T;  3MA9 A;  2PG8 A;  3KDS E;  2NP9 A;  1MIY A;  2LSJ A;  4ERR A;  2MYS A;  2PTF A;  5JRC A;  3CML A;  5AQT B;  2UXC T;  2M6B A;  1XMQ T;  4UVC B;  5L3F B;  3FBL A;  2XAQ B;  1HTJ F;  2V7L A;  5BMV E;  3ZT5 A;  3B5M A;  4KBM B;  4GKJ T;  4BJM A;  2UXB T;  2LSI A;  3I0Q A;  1MMG A;  3ZT7 A;  5FXW A;  4ANJ A;  2SPC A;  3M3Z B;  2H3R A;  4PJM A;  5LXT E;  2YDR A;  4YSZ A;  2Q9Q A;  3AE2 A;  5DJQ C;  4ZI3 D;  3PUX F;  4DVD A;  2XAH B;  2VKO A;  3EDU A;  3PV0 F;  1IBL T;  2E5V A;  4WNK A;  3PUW F;  5J2U E;  2NTX A;  5AQR B;  2XHE B;  1JNR A;  2J62 A;  4YTN A;  4ZZB A;  4YFS A;  3D0T A;  5IYZ E;  1ZP0 A;  1J1J A;  4UF0 A;  2PJQ A;  4IE4 A;  1Z8U A;  1XZY A;  3K3Q C;  2LJL A;  4KMC A;  3RIU A;  5ABE A;  4CI2 B;  2X0H A;  3KV4 A;  5FNV E;  2J1D G;  1J5E T;  3KBU A;  4EGW A;  3IA3 A;  1UX4 A;  3SOL A;  5DQW A;  5FY7 A;  3VKH A;  3FZK B;  5CA0 E;  3KV6 A;  2MBG A;  1VCT A;  1XWM A;  3ONJ A;  4CN4 A;  5DAB A;  4AQF A;  2QRX A;  5HEH A;  1FIO A;  3CX8 B;  4HWC A;  5FXV A;  4EYY R;  5LCY A;  5FVK A;  4DV5 T;  4TWF A;  4TWH A;  3PDY A;  4IDN A;  5LGT B;  5FKY A;  1UX5 A;  2MOZ A;  2NR4 A;  4F6R C;  4H63 H;  2KZ7 B;  2KSR A;  1CHU A;  4NUV A;  3OPC A;  4YHH T;  4CN1 A;  3DP7 A;  1NAF A;  3I9Y A;  4QX7 B;  2WZI A;  2FJB A;  2K24 A;  2VB6 A;  2WBL A;  5HAX A;  2Y48 B;  1WLX A;  2M67 A;  2EHO B;  4QXC B;  4IHJ E;  4JI7 T;  3ZYL A;  2LKH A;  3I9W A;  2OV9 A;  4ILU A;  3NBX X;  1YKH B;  3WI3 A;  3JAF A;  4ZI7 E;  1J5W A;  3L39 A;  3AE1 A;  2VKJ A;  3H3A A;  5LA6 E;  1M7K A;  3NWI A;  3RF1 A;  2VUR A;  2AXD S;  4PJL A;  5JDF A;  5IWA T;  4H9P C;  2UUB T;  2XAS B;  4FI5 A;  3EAB A;  5HXR A;  2L8K A;  4Z8X A;  2NW9 A;  4Z90 A;  2BG9 C;  1XNQ T;  1VOM A;  2C0S A;  1MND A;  2V6Y B;  1IJ6 A;  5HCJ A;  3V5U A;  3K1S A;  2XQ4 A;  4JV5 T;  2WU5 A;  3WAJ A;  3F57 A;  3RIA A;  2V6X A;  2V5C A;  4HFV A;  4AKL A;  1D1C A;  3WAK A;  1HCI A;  2MAW A;  4NPP A;  2IUB A;  4ASK A;  3LFM A;  4LFB T;  4IGU A;  4QHO A;  5AQN B;  4JI0 T;  1HF8 A;  2EHO C;  1ZOY A;  3KFW X;  4DR3 T;  3P4W A;  1FMV A;  4EIW A;  3RLF F;  2MTQ A;  2ZM0 A;  1WYB A;  2K3W A;  2H7V C;  4TV9 E;  2BKP A;  5LHH B;  2CXF A;  5JH7 E;  1KNZ A;  3ABV A;  5J2T E;  2D5U A;  4HFI A;  5CGM A;  4PK5 A;  2E9X D;  3CVR A;  3RHW A;  4OK0 A;  4U2Y A;  2CWY A;  2WU2 A;  2CCQ A;  5AQJ B;  2M6I A;  2KND A;  2WDR A;  2JRK A;  3CIR A;  5LHG B;  4CQI A;  1B7T A;  3C4Z A;  2NW8 A;  2ZLY A;  4O4I E;  5EK2 A;  4HE8 A;  1OXZ A;  4LF7 T;  1KK7 A;  2E9X B;  3PU3 A;  3UQ7 A;  3PUA A;  4CXW A;  3ESL A;  4FJO A;  1N32 T;  2YN6 A;  5HEU A;  3GN5 B;  4NUU A;  5FXZ A;  3VHL A;  2CM0 A;  1YQ4 A;  3DTO A;  2KIN B;  2EHO A;  2XTL A;  4HKA A;  1SHZ C;  5JDL A;  4IE6 A;  3E0Z A;  2CEA A;  3LSV A;  1W0B A;  4KP3 C;  2X9Y A;  3MAC A;  5FY1 A;  1L0V A;  2W4X A;  5TAO A;  4MAL A;  4U3C A;  3MJX A;  4O4J E;  5FY0 A;  4OYK A;  4H9N C;  1T98 A;  2LRK A;  5JR9 C;  3FZL B;  1ZHC A;  3AE6 A;  2H89 A;  2XZE A;  3O1I A;  2F4V T;  2BZB A;  2D9D A;  2VKH A;  4LFC T;  2V6Y A;  4AKH A;  3MZK B;  3NZP A;  2LSG A;  2I59 A;  2UUA T;  4B6X A;  1R8I A;  2WP9 A;  5HEJ A;  1W9R A;  5LG4 A;  3CPZ A;  2XSA A;  1I6Z A;  3AE8 A;  2V26 A;  2DLR A;  1D0Y A;  2E9X C;  2LM9 A;  4J2C A;  3UU5 A;  4QX8 B;  1MMD A;  2D2S A;  4ZZC A;  2BBH A;  4HTE A;  3QB5 K;  4ILB A;  4I55 E;  4UEM A;  1X79 A;  2LHN A;  4JUY A;  4XZC A;  2LKG A;  3JAE A;  4LF5 T;  3P4R A;  5LNK A;  2W0G A;  4ZHQ E;  5JRE A;  2X51 A;  5AQP B;  5AQL B;  3P4Q A;  5AQI B;  4EB6 E;  2UXX B;  4TV8 E; 
#chains in the Genus database with same CATH homology
 4PJM A;  4QKN A;  4UV9 B;  5LXT E;  5LJM A;  2PFV A;  4P0A A;  2ODV A;  4TN7 B;  4TZ4 C;  3ZJ2 A;  2Q9Q A;  5ADX L;  4ZI3 D;  5DJQ C;  4QXB B;  4IE0 A;  3U78 A;  4DVD A;  2XAH B;  4PK4 A;  4ZI3 C;  4GIW A;  1BR0 A;  3K8P C;  2VKO A;  2WMO A;  3EDU A;  2C5K T;  3KVB A;  4WNK A;  2W61 A;  5J2U E;  2IC9 A;  2NTX A;  2VAS A;  4O2A E;  5FYM A;  5JDM A;  2XHE B;  2N9D A;  3CX6 B;  3DJB A;  1SA0 E;  3B13 A;  3M65 A;  3LK4 2;  2KWH A;  4YFS A;  3R84 B;  3D0T A;  2OA5 A;  3ETU A;  5IYZ E;  4CI3 B;  5FXX A;  4UF0 A;  2PJQ A;  4IE4 A;  3E22 E;  3B57 A;  5JDN A;  3K3Q C;  2KMF A;  2LJL A;  4KMC A;  1HX8 A;  4P09 A;  1IJ5 A;  5JDG A;  4CI2 B;  1Z0P A;  3VKG A;  3CQG B;  3KV4 A;  2CWO A;  5FNV E;  4X1K E;  4IDZ A;  4BA9 A;  4E7Z A;  1BR1 A;  2J1D G;  3O1H A;  2UXX B;  2IAK A;  4DBR A;  3KBU A;  3N9L A;  2W63 A;  1UX4 A;  4XAX B;  3SOL A;  5LHI B;  4UEL A;  5DQW A;  2E9X A;  2RA1 A;  3Q5W A;  5FY7 A;  3ZYM A;  3VKH A;  4EZH A;  2X9X A;  3RC3 A;  2LT3 A;  1YD8 G;  1S94 A;  3MXZ A;  2E8I A;  3W15 B;  3KIN B;  5CA0 E;  1ZKE A;  3K3O A;  3KV6 A;  2GK9 A;  2MBG A;  4ISS A;  1ZEE A;  4H63 V;  1U4Q A;  5HXS A;  3GN5 A;  2WMN A;  3Q5X A;  2BVM A;  3RRW A;  3J7Y q;  3IEE A;  2ZM2 A;  3UTK A;  1BR2 A;  5DAB A;  4AQF A;  3HKE E;  1U5P A;  3QC9 A;  1FIO A;  4ZS3 A;  3CX8 B;  3TKL B;  3UUL A;  3ZMT B;  3GMI A;  1D1B A;  3C98 B;  5FXV A;  2KLQ A;  4EYY R;  3RH3 A;  4GK0 E;  2X9W A;  5LCY A;  3R6N A;  4C90 A;  1D0X A;  4DMV A;  2JQQ A;  2DWG A;  4TX5 A;  4ANJ A;  2X0L B;  5JQG E;  3PDY A;  4OYJ A;  4X20 E;  5LGT B;  5EK3 A;  5L3E B;  1UX5 A;  5HWX A;  2MOZ A;  4F6R C;  2YK0 A;  3UUX B;  5LGN B;  4H63 H;  2KZ7 B;  4NUV A;  3RYF E;  1UCU A;  4YJ2 E;  3DP7 A;  1US7 B;  3KBT A;  1NAF A;  4G2A A;  4PJJ A;  2Q9Q B;  3I9Y A;  3RC8 A;  1QSD A;  3V5S A;  4QX7 B;  3L09 A;  2C5J A;  3PUR A;  4MBQ A;  3LBX A;  2XAJ B;  2ACX A;  2K24 A;  1MNE A;  2VB6 A;  2WBL A;  5HAX A;  4I4T E;  2PBI A;  2Y48 B;  2ZM8 A;  3ZLI A;  4GYR A;  1WLX A;  3QK6 A;  2M67 A;  3NRX A;  3IF8 B;  3F2E A;  2CA5 A;  2C5I T;  2EHO B;  2Y6X A;  4QXC B;  4IHJ E;  4UIG A;  3N2O A;  3N9P A;  4PJN A;  2YU2 A;  3ZYL A;  1G73 A;  3N9M A;  4UVA B;  3HR0 A;  1MMN A;  3I9W A;  2KXP B;  4ILU A;  3NBX X;  1YKH B;  3WI3 A;  2XUE A;  4ZI7 E;  2JMK A;  4JEU B;  3PU8 A;  2DI4 A;  2VKJ A;  3H3A A;  4C91 A;  5LA6 E;  1IZN B;  2A3D A;  2HPL A;  2NWB A;  5E0O A;  2X68 A;  1LVK A;  3FBZ A;  4H9Q C;  5LOV E;  5HYA A;  4PJL A;  5JDF A;  1HS7 A;  4H9P C;  3Q2M A;  2IW5 B;  4OHF A;  3BQL A;  3AAE B;  3C50 A;  4L5G A;  4KUM B;  3EUH A;  5JR9 A;  2XAS B;  4FI5 A;  3RYH E;  1LVF A;  1FEW A;  4EAH A;  5ETW A;  3JC6 D;  4X1I E;  1HG5 A;  1LRZ A;  5HXR A;  2L8K A;  3HKD E;  4U72 A;  4Z8X A;  3UT5 E;  2NW9 A;  2IC6 A;  3ZJ1 A;  3AAA B;  2N1G A;  3P8C D;  2W00 A;  5AFU L;  1VOM A;  4PFO A;  2C0S A;  2B1E A;  1G8X A;  3EDV A;  3HL6 A;  2XAF B;  5HXC A;  1O3X A;  3AA6 B;  5LBM A;  2LEH A;  4K0U A;  5KX5 E;  1MND A;  2KT9 A;  3K3N A;  4O2B E;  1IJ6 A;  3V5U A;  4CZZ B;  4DO0 A;  1IAP A;  4IE7 A;  3WAJ A;  3F57 A;  5L3C B;  5J1G A;  2BDE A;  1S35 A;  5FMN A;  3SRZ A;  3ZEF B;  4DND A;  4P0B A;  3ANW A;  4GOU A;  4DMW A;  1MIW A;  3RRC A;  3FB2 A;  3AVS A;  4HFV A;  4AKL A;  4XBF B;  2WAU A;  2N2N A;  4PK6 A;  1D1C A;  5HXE A;  3WAK A;  1HCI A;  2L3L A;  3QUJ A;  2Q9Q D;  4I43 B;  2Q9Q C;  4AQG A;  3UUN A;  2WM9 A;  5JRC B;  4ASK A;  2JMH A;  3N5L A;  3LFM A;  5KMG P;  4IGU A;  2YEV C;  3KV9 A;  4QHO A;  4E7S A;  4CI1 B;  4EYU A;  2EHO D;  1Y64 B;  3N9N A;  3RYI E;  3F31 A;  1HF8 A;  2EHO C;  3KFW X;  3H37 A;  4GYS A;  3PUG A;  2QA7 A;  4IE5 A;  1FMV A;  4IIJ E;  3A5X A;  3I0O A;  3C64 A;  3EVY A;  5JVD E;  4YHJ A;  3GA8 A;  3ZYK A;  3OYZ A;  3CQX C;  2CLY B;  4EIW A;  2A2F X;  2BVL A;  3O4X E;  2V7K A;  3LG7 A;  5CA1 E;  2LE8 A;  3ONX A;  3ZPO A;  5HWY A;  1E1H B;  2MTQ A;  3OYX A;  5LP6 E;  2HPJ A;  2WSS V;  2VKD A;  2ZM0 A;  1WYB A;  3HA4 A;  3CQC B;  4TV9 E;  2H7V C;  5L3D B;  4H9R C;  5L2L A;  4AKI A;  5LHH B;  2CXF A;  5JH7 E;  1KNZ A;  5A1L A;  3SWH A;  3T8O A;  3CX7 B;  5J2T E;  2LSK A;  2D5U A;  4AKR B;  5GON E;  3S4U A;  4WBO A;  4PK5 A;  4AI6 A;  2E9X D;  1D1A A;  1WR6 A;  3CVR A;  2HH7 A;  4X1Y E;  5LYJ E;  2CXL A;  4OK0 A;  2CWY A;  5JDQ A;  4WBN E;  2CCQ A;  2KND A;  2P9B A;  2JRK A;  4O4L E;  4PW8 A;  5LHG B;  3NRY A;  4V1A v;  2LOS A;  4CQI A;  2L9Q A;  4UF0 B;  1B7T A;  3C4Z A;  2NW8 A;  2ZLY A;  1WRD A;  3O9X A;  4BJN A;  3PTR B;  4O4I E;  5DQV A;  5EK2 A;  3OJA A;  4L9I A;  4PFP A;  4AQF C;  2XQY A;  2V7J A;  3KV5 A;  3HKB E;  2CE7 A;  1YW0 A;  2LHR A;  3CWZ B;  4HE8 A;  3LK3 B;  1OXZ A;  3KVA A;  5L3G B;  3IHR A;  2G0U A;  3ZCJ A;  2D0U A;  3FXE B;  4ZS2 A;  4WW0 A;  2DNX A;  4CXY A;  4BAY B;  1KK7 A;  3LJC A;  3N9Q A;  2E9X B;  1ZV4 X;  3I1A A;  3PU3 A;  4IST A;  4MFR A;  4DBQ A;  3NZQ A;  2CXD A;  2DHR A;  1H7C A;  3PUA A;  2Y8D A;  3RKO A;  2JPF A;  3JC6 C;  4CXW A;  2H7O A;  2W62 A;  3ESL A;  3AB3 B;  2DCF A;  3ZMZ B;  4HEA A;  4FJO A;  5CB4 E;  2ZMA A;  2V7I A;  3OKQ A;  3GN5 B;  4PNI A;  4NUU A;  5FXZ A;  3VHL A;  1HG2 A;  4O4H E;  4M1P A;  4AKG A;  2CM0 A;  5H6Q B;  1WYC A;  3U3I A;  4ZI2 D;  3DTO A;  2CMR A;  2YU1 A;  2KIN B;  3IBP A;  2A72 A;  4ZI2 C;  2EHO A;  2XTL A;  4G63 A;  4HKA A;  3VU7 H;  2V7M A;  3J9X 1;  2UXN B;  1MMA A;  4HN9 A;  3ZMS B;  1SHZ C;  5JDL A;  2X67 A;  4IE6 A;  4L0R A;  3FHN A;  2CLY C;  3E0Z A;  2CEA A;  2NW7 A;  4KP3 C;  2X9Y A;  3ZMU B;  5F8P A;  4MLK A;  3MKD A;  1HFA A;  4JEH B;  3MAC A;  3BQK A;  5LBQ B;  5FY1 A;  4YLH A;  2K5B B;  3N9O A;  3RPU A;  3SS1 A;  5L3B B;  4A56 A;  3HI2 A;  3CKD A;  3OBV E;  3PUQ A;  4MAL A;  3C4X A;  3MJX A;  5TAO A;  4CXX A;  4O4J E;  3LBX B;  4TUY E;  2D0T A;  3MK7 C;  3ZCI A;  5FY0 A;  4OYK A;  2NTY A;  1YKE B;  3ZN0 B;  5M4Y A;  3AA0 B;  4EOZ B;  4H9N C;  3PE0 A;  5C8Y E;  3AAI A;  1T98 A;  4MHC A;  5JR9 C;  3UFE A;  5FP3 A;  3AA1 B;  4GK5 E;  3N2G E;  3PUS A;  5H6R B;  2WWU A;  3ZC0 A;  2LSY A;  2KWI B;  1ZHC A;  4UV8 B;  3RX6 A;  2X9H A;  1AJ3 A;  3BK9 A;  4I50 E;  4UXN B;  5HXH A;  3O1I A;  2NOX A;  3P7I A;  2QGS A;  5EK4 A;  2BZB A;  3BQI A;  2RP4 A;  1LKX A;  4AXP A;  2VKH A;  2VWA A;  3ZN1 B;  5F3J A;  3UUM A;  1D0Z A;  4HGA A;  1CUN A;  3ETV A;  4AKH A;  4JLE A;  5LGU B;  1V9D A;  2DWK A;  4H9O C;  3AA7 B;  3C4W A;  3MZK B;  3NZP A;  2LSG A;  2VL8 A;  4O8S A;  5EZY E;  3AVR A;  2I59 A;  2K9A A;  1NWM X;  2ODU A;  2VK9 A;  4B6X A;  2X66 A;  5LJN A;  1OWA A;  4OFZ A;  5LG4 A;  3CPZ A;  3L3P A;  3ZC1 A;  4ADZ A;  5JR9 B;  3RYC E;  4QWN B;  3MA9 A;  2PG8 A;  2V26 A;  2DLR A;  1D0Y A;  3KDS E;  2E9X C;  2JJ9 A;  3E08 A;  1EZ3 A;  2LM9 A;  1BR4 A;  3LK2 B;  3FXD B;  4J2C A;  2Z6E A;  3Q9D A;  4EXT A;  4QX8 B;  1MMD A;  2D2S A;  4ZOL E;  2NP9 A;  4H9S E;  4U74 A;  4UVB B;  1MIY A;  1QUU A;  2LSJ A;  4ERR A;  4HTE A;  2ES0 A;  2MYS A;  5JRC A;  3GWH A;  4QXH B;  3ZMV B;  5JDH A;  3CML A;  4I55 E;  4UEM A;  3N2K E;  2XAG B;  1X79 A;  4YJ3 E;  2LOP A;  5IHY A;  3C51 A;  1VRB A;  1FMW A;  2LHN A;  4JUY A;  4XZC A;  4EZ4 A;  3O1J A;  4UVC B;  5L3F B;  3FBL A;  2XAQ B;  4N78 D;  5LNK A;  5JRE A;  2W0G A;  4ZHQ E;  3HKC E;  2X51 A;  1HTJ F;  2V7L A;  5BMV E;  5KDM C;  3ANW B;  4KBM B;  4BJM A;  2YIN A;  4PAG A;  2LSI A;  3I0Q A;  1MMG A;  1MIV A;  2K48 A;  4EB6 E;  5FXW A;  2V1D B;  2SPC A;  4TV8 E;  2H3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...