4MLKA

3.05a resolution structure of ct584 from chlamydia trachomatis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
151
Chain Sequence
TFLLLEGNLKRIFATPIGYTTFREFQNVVFNCAQQELANFLFELINGKLKQSAQSLIVQFMMPIRVAKDIHERGEFINFITSDMLCVFLNRLSRVDGQEFLLMTDVQNTCHLIRHLLSRLLEAQKNPIGEKNLQEIQEDLDSLRAHFEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords CT584 protein
publication title Structure of CT584 from Chlamydia trachomatis refined to 3.05 angstrom resolution.
pubmed doi rcsb
source organism Chlamydia trachomatis
total genus 50
structure length 151
sequence length 167
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17435 DUF5414 Family of unknown function (DUF5414)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mlkA01
4MLKA 3Q9DA
chains in the Genus database with same CATH superfamily
5DABA 3B13A 1R8IA 5CGMA 5JDQA 3VKHA 1E1HB 3PUQA 5JREA 1NEKA 1W0AA 3F57A 4IDNA 4U72A 2WWUA 3P4QA 2VKOA 2YK0A 5AQMB 2LM9A 2HPJA 3NBXX 2UXXB 3UU8A 3UQ4A 1W9RA 3QOFA 4HE8A 1HNXT 4UIGA 4DBRA 2FJEA 1Y01A 5C8YE 2VWAA 2YN6A 4AKHA 5LB7B 3AB3B 4U33A 2YU1A 2XQ7A 4UVAB 1SA0E 3AAEB 5AQFB 4P0AA 3JAFA 2UXBT 4XBFB 2MPKA 4EEDA 2VKJA 2PFVA 4I55E 5J2TE 2VURA 4YT0A 4JBWF 4O2BE 4ZI2D 2NW8A 2IIUA 4JI1T 3E08A 1XNRT 4ZEYA 4YFSA 4CN4A 4YJ2E 4ZOLE 1OXZA 5LG3A 3N9LA 3GN5B 3HKDE 1NAFA 3RKOA 5AQKB 5ADXL 2Q9QD 4UVCB 1IBLT 5EZYE 1UX4A 3DJBA 1FEWA 2NP9A 3B57A 1YXRA 5HEGA 4IE5A 4JYAT 1UGOA 2CXDA 2CMRA 4UF0B 4F6RC 4A5XA 5KMGP 4YHHT 4EZ4A 2ZMAA 2BS4A 4KP3C 2NTXA 5F3JA 3AXJB 2LLYA 5TAOA 3EDVA 4EXTA 2V7MA 2KINB 2VVSA 1MMGA 4AQFA 3FZMB 5BMVE 3ZN1B 1J1JA 2PJQA 4CXWA 4DV3T 4ERRA 5CFBA 3AE7A 3UQ7A 2G0UA 3C64A 2WMOA 2UUAT 2VQET 5FXVA 2JQHA 2L9QA 3S4UA 1D1AA 4LMLA 4UXNB 4TWDA 4I50E 4U7YA 3CX6B 2LSGA 4KMCA 4OYKA 3HA4A 2CHNA 2WWVA 2VB6A 4ISSA 3JC6C 2WU2A 1J5WA 1D0ZA 3LJCA 4XZCA 1JNRA 1BR4A 4QHOA 1S35A 4LF9T 4XAXB 4O4IE 2FJAA 4P0BA 3P50A 2WS3A 3MA9A 2UU9T 2EHOA 2PBIA 2HN2A 4CN6A 2GK9A 3O1JA 2MTQA 4O8SA 3CPZA 1ZOYA 4MALA 4LMKA 4BAYB 2SPCA 3CQGB 2UUBT 3CQCB 5HWYA 4ZS3A 3N9MA 4CI3B 4FJOA 4UVBB 2L3LA 3VHLA 3W15B 3KDSE 5FVLA 4CXYA 4TX5A 2AXDS 3L3PA 4DR6T 4MBQA 2HPLA 1KK7A 2VL8A 3H3MA 2CM0A 4ILAA 5LGNB 2M6BA 5HXCA 4PJJA 2VL0A 5CA1E 3PV0F 2XQ4A 3EABA 4P1NA 3RQUA 1J5ET 2X9HA 2I0MA 4MLKA 4U3CA 4Z8XA 3E22E 1MNEA 3ZEFB 4YTNA 3GMIA 5EK2A 4PJLA 2MYSA 2BBHA 4ZZBA 4JEHB 3U3IA 4DO0A 4PAGA 3IF8B 4H9PC 3Q5DA 3ZLIA 3N2GE 4DR4T 3P8CD 3V5UA 5IWAT 2DCFA 4CXXA 5ABEA 3C4WA 3AE8A 4AQFC 2BBJA 1G73A 5JR9A 4K0UA 2CBIA 4OHFA 2D2SA 3BQIA 4K0KT 2VKDA 2K5BB 4YSZA 3TKLB 3KV6A 3SFEA 1YD8G 2W67A 5LG4A 3RLFF 3VRAA 2H89A 3SRZA 2R6GF 1N32T 3FBLA 3K3QC 4PK5A 3NVOA 2XUEA 5J2UE 1T98A 2M6IA 3ZSTA 3MXZA 2VQFT 2WZIA 1O3XA 5FXXA 4ADZA 5L3CB 2H3RA 4V1Av 4H9QC 4X1IE 2X0YA 3IHRA 3MK7C 2CXFA 1WYBA 2EHOC 4X5TA 3OYXA 5DQWA 3Q2MA 4E7SA 2CRBA 3UFGA 3UU4A 1V9DA 1GQEA 2V26A 3RYIE 3KFWX 5LJMA 3LFMA 4I43B 4B3RT 3ZJ1A 1HNZT 5F8PA 3ZCJA 4H63V 4JI6T 3P4SA 3JADA 4DVDA 4TV8E 2X51A 2OLTA 2UUCT 3AEDA 3UU6A 4PK6A 2LJLA 1UCUA 1KEYA 4H9SE 2CCQA 4LFAT 5LP6E 5LXTE 3O9XA 2JQ9A 4CQIA 2EHOB 3Q9DA 2NW9A 2DI4A 4IREA 3J7Yq 4X20E 2XM1A 4X64T 3RYFE 4DV6T 2F4VT 1XDOA 5LGUB 5FY0A 1T7SA 4B3TT 3ONLC 1HF8A 4HFDA 5JDMA 5LYJE 1I6ZA 4PW8A 5IUXA 2IDOB 2LE8A 2VVNA 4HWIB 2YOEA 3RGLA 4JI5T 3ZMVB 3KV4A 5JR9C 4LF8T 2KMFA 3TLVA 2KZ7B 2XZEA 3LSVA 4L9IA 3UU3A 3PUXF 4AISA 3SOLA 3OJAA 3F2EA 4HWHA 4UV9B 5J0ZA 2KNDA 2K9AA 4QWNB 2YDSA 5FL1A 4JUYA 3ZT6A 3CKDA 1HFAA 1QLBA 3CIRA 4G2AA 1NENA 3CWZB 5LGTB 2BVMA 3A7MA 1HTJF 1FMWA 3QB5K 3RC3A 2C5IT 3EHZA 5HXSA 2DHRA 3ZKRA 2FJBA 5AQNB 3CK6A 5JR9B 4HFIA 2UXDT 2YEVC 1ZP0A 1ZHCA 3T1HT 3N9QA 3CVRA 4AKIA 4PFOA 3IEEA 3T8OA 5FNVE 1YQ4A 1XMOT 2ZM8A 4KUMB 4EAHA 3AEEA 2J62A 3RHWA 3SFDA 3Q5WA 2C0SA 2WDQA 1XDPA 3H3AA 2XSBA 2X66A 2X0LB 2FUPA 3M3ZB 2VK9A 3QNUA 3ZMSB 4DV5T 3EUHA 5HXHA 3BQLA 5LCYA 3WAJA 4ILUA 2QA7A 4YTPA 4F8HA 4HKAA 4B3ST 4QH5A 1WYCA 3ZMUB 2ACZA 3KVBA 3AEBA 4TN7B 5L47A 3PTRB 2WMNA 5EK4A 3HI2A 5FMNA 3HKCE 4OK0A 3FZLB 2M67A 1IAPA 2LOSA 1WLXA 4BA9A 4HEAA 1MMDA 2WCAA 4WBOA 5HEJA 3L8RA 4HWDA 2LSKA 3RI5A 2LOPA 2W62A 2BDEA 3OKQA 3V5SA 2HN1A 5FP3A 2W61A 4HGAA 4Q25A 4UV8B 3RF1A 1KNZA 5AQGB 4KHPT 2VKHA 5HAXA 4C90A 2W2UA 2LRKA 4DV2T 1H7CA 2Z6EA 5CB4E 3N9NA 2B76A 1BR2A 4NPPA 2MOZA 3AEFA 1KFYA 3I0QA 3UUXB 2WQYA 2X9XA 4EGWA 4TNWA 3CQXC 5E0OA 4DR2T 3A8YC 3L39A 3AEGA 3KBUA 3LK42 1UK5A 4YSXA 4JEUB 4AI6A 3HKEE 3RYCE 2MAWA 4YSYA 3I9YA 2CWOA 2C5JA 2BS2A 2FJDA 1KF6A 2A2FX 2BKOA 4X1KE 1Y64B 2B1EA 4AQGA 4QXBB 3PUYF 4X1YE 3P4RA 5JRCA 2E5LT 2EHOD 4CZZB 3J9X1 5AQIB 3LK2B 1IBMT 4LFCT 3OYZA 4YXDA 1D1BA 3VRBA 4TZ4C 3AVSA 1LRZA 5AQLB 2WSSV 3ZT7A 3UUBA 5AFUL 2XAGB 3VR8A 2Y8DA 4IDZA 1KNPA 5M4YA 2UXNB 2V6YA 2RPAA 5JQGE 5L3EB 3PU8A 2W4XA 2XAQB 1SHZC 4UELA 3TLSA 2YKSA 1QSDA 3I9WA 4Z91A 3ZYMA 1WFDA 1YQ3A 3RPUA 2ODUA 2JJ9A 4DBQA 4DR1T 2Y48B 2K3WA 3N9PA 2Y6XA 3ZN0B 1SE7A 1VRBA 3Q5EA 4ZZCA 4IGUA 4JI0T 1IJ6A 4NUUA 5L3BB 4DUYT 3C4ZA 4KHZF 3BQKA 2I59A 4U31A 1HG2A 1HCIA 2BS3A 5IHYA 4HTEA 5HXEA 4QH1A 5JTGA 5ABHA 2X9WA 5HEOA 1AJ3A 2OA5A 2WBLA 3ABVA 4L5GA 4LF6T 2E9XB 3FZHB 2KSRA 5LNKA 2V7IA 2WM9A 5HWXA 2MBGA 5J1GA 1L0VA 3FBZA 3QUJA 2K48A 3N2KE 3RC8A 4DV7T 4DV1T 3RX6A 3C51A 2IAKA 2I6HA 3C98B 3QB5A 3B5MA 4MHCA 1S94A 2XTLA 3U78A 2ES0A 3KBTA 3AA6B 3N5LA 3P4PA 5L4HA 4NXMT 3PJAJ 4GK5E 1HS7A 4H9RC 2CBJA 4ISTA 2V8SV 1XWMA 2A9UA 4EB6E 4O4LE 2X9YA 3RH3A 2CXLA 2RP4A 2BG9A 4FI5A 3K8PC 2VASA 4TWFA 5KDMC 3O4XE 5BR8T 5LOVE 3E0ZA 4AXPA 3A5XA 2V6XA 5FYMA 2N9DA 1US7B 4ZHQE 2LSJA 3PUAA 3CMLA 3AECA 1U5PA 3JAEA 4U2YA 5JRCB 4IDQA 2J47A 4ZXLA 5AQQB 1FIOA 2Q9QB 4EYUA 4IDPA 2UXCT 1IZNB 4GYRA 2XQ6A 2KLQA 3P4WA 2V7LA 5LMNT 2KXPB 2V6YB 4QX8B 2KWIB 1QUUA 4AQYT 3ANWA 4TNVA 2XAHB 1LVFA 2X0HA 1FJGT 4HFBA 4GIWA 2CHOA 4DR7T 4GKKT 4WZXA 4KI0F 4WNKA 3ZCIA 3ZT5A 1YKHB 2BKPA 5ABGA 3JCFA 1X9BA 4JI8T 2BZBA 3FZKB 5HCJA 1FMVA 3N9OA 4B3MT 3MZKB 1D1CA 4I0UA 2YDRA 3HR0A 3RRWA 3BK9A 2YU2A 5L3GB 4CI2B 4A56A 5C2TA 3H37A 4DIDB 4ILCA 4QXCB 4ZI3C 4WW0A 2IW5B 5L3DB 2BG9C 3C4XA 2DWGA 2QRXA 4EV6A 2LKGA 2KWHA 3PJAA 3N2OA 3FZFB 4AIUA 2IHR1 4EOZB 4LMJA 1LVKA 4HFCA 3TLWA 4JI3T 1WR0A 3EVYA 2XHEB 2WAUA 4U7IA 5HYAA 3NRYA 3F31A 1W0BA 3PURA 1G8XA 2AE9A 3JC6D 2JRKA 3PUZF 4Z90A 2BVLA 1MMAA 3ZYKA 4OYJA 4JV5T 4WBNE 3I0OA 1M62A 3AE4A 4IE7A 3ZMZB 1SUMB 2QGSA 2BG9B 2XM2A 4EEBA 3UUMA 3SWHA 5EK3A 1IJ5A 3MJXA 4IE0A 3ZPOA 2IC6A 5H6QB 5JDHA 5DJQC 4X62T 2PTFA 3DTOA 4U2ZA 5LA6E 3NRXA 2ZM6T 3QC9A 4JI4T 3ZJ2A 1MIYA 2IUBA 3LDQB 3LK3B 3I1AA 3AA7B 4H9NC 3RQWA 2CLYC 4BJNA 1T72A 2QVAA 2N2NA 4A98A 3LBXA 1XMQT 2LRLA 4H63H 5AQVB 1HR0T 1YW0A 5IYZE 4LF7T 3FXEB 3WI3A 1B7TA 1MIWA 2E9XA 3RIFA 4ZS2A 1NWMX 3AVRA 3ANWB 3MACA 4GKJT 4DV0T 4PJNA 5LHIB 3ONJA 4IL4A 4BJMA 4YTMA 5A1LA 2XPKA 4TWHA 3RIAA 2CA5A 2W63A 3MKDA 2C5KT 2JMHA 3Q5XA 2CLYB 4O4JE 5FVKA 2NW7A 2XY8B 2BG9E 1UUSA 2OV9A 1OEDE 2NWBA 2WB5A 3M65A 3KINB 3SS1A 3UTKA 4DMWA 4EIWA 5AQUB 2LHRA 3ZMTB 1VCTA 3DP7A 3ZYLA 4KX6A 5JVDE 3G06A 3KV5A 2V7KA 2WDRA 1YKEB 2LM2A 2V5DA 4PFPA 4ZI7E 2KT9A 4HN9A 4LFBT 1EZ3A 1XZYA 4AKRB 2V7JA 3UT5E 2JMKA 5H6RB 2IMLA 5LHHB 4HFVA 2LSIA 4JI2T 3LG7A 2Q9QA 3GA8A 2DWKA 4DMVA 5ABFA 4DR5T 1VOMA 3P7IA 3NWIA 2CEAA 4YJ3E 3AE1A 2D5UA 3OVUA 3AE2A 5LMUT 2XQ5A 2ZM0A 1IBKT 5AQSB 3AAIA 5JH7E 5HXRA 2XAJB 5FXZA 5FL0A 2L8KA 3QK6A 1BR1A 2WU5A 3AE5A 4ASKA 3AA1B 4J2CA 4NIQA 3AA0B 3UFEA 2E9XC 3PUWF 1ZEEA 1CHUA 3NKZA 1HX8A 1N34T 3NZQA 4LF4T 2CE7A 4PNIA 2P9BA 5DQVA 2V1DB 4C91A 4IT4A 4COFA 2NOXA 2DNXA 1DU2A 3R84B 2RA1A 1N36T 5FY1A 5JDLA 2DLRA 3VR9A 3LBXB 2YDQA 5AQRB 4TV9E 4QKNA 3VKGA 2ZM2A 2BKNA 1XNQT 3AE9A 1LKXA 4ZI3D 2NR4A 3CX7B 5AQOB 3EAMA 1UX5A 3HL6A 2PG8A 3OBVE 4DR3T 4MFRA 4G63A 3FHNA 1MIVA 4IHJE 4B6XA 4ANJA 3R6NA 2LSYA 4ZI2C 4X65T 2XQYA 5AQPB 2W0GA 4IE6A 3ZSSA 4PK4A 5HEHA 4P09A 2JIWA 4PJMA 4TUYE 1D0XA 2K24A 4DUZT 3T1YT 2ZLYA 4JI7T 4NXNT 1X79A 2Q9QC 1E2AA 4IIJE 2XQ9A 2QYWA 4GOUA 5C3JA 1OEDA 3K1SA 4CN1A 5KX5E 3NZPA 4HFHA 4O4HE 2N1GA 3PU3A 3RIUA 5AQHB 3ONXA 3PDYA 4IL9A 2D0TA 3L09A 5LHGB 2E8IA 3ZC0A 4QH4A 1UURA 5L3FB 2ODVA 3K3NA 3EI0A 2E5VA 3IA3A 2X68A 3PUVF 2WDVA 3IBPA 2JPFA 5ABFB 5FXWA 1BR0A 5CJ5A 3KV9A 3AE3A 1JNZA 4ILBA 1HNWT 2J1DG 1HG5A 4E7ZA 4GYSA 3X1DA 2LT3A 1N33T 2XJ7A 4H9OC 2NTYA 3AAAB 4GK0E 1U4QA 5LBMA 2CPTA 3O1IA 5GONE 5JDGA 1OWAA 3HKBE 1WR6A 2D9DA 4HFEA 2H88A 5HEUA 4QX7B 4IDOA 2XQAA 4HWFA 2WY2A 5KXJA 1D0YA 1ZV4X 2XQ8A 1MNDA 2W00A 4L0RA 4YLHA 4QXHB 5AQTB 3PE0A 3RYHE 4DV4T 4NUVA 1VCSA 5L2LA 2A72A 2LHNA 2D0UA 3ETUA 2CWYA 5HCMA 1CUNA 3GN5A 3GWHA 2E2AA 3UULA 4AKGA 1M7KA 5LBQB 1I94T 2XSAA 5AQJB 4O2AE 3TLTA 4IE4A 5CA0E 4YHJA 4CI1B 5JDFA 3CX8B 3TLUA 4U74A 2LKHA 2YINA 4UF0A 3ESLA 2JQKA 2WZHA 4I4TE 3K3OA 5FY7A 2FBWA 1OEDC 2IC9A 2DL1A 3FB2A 3EDUA 3AXJA 1HX1B 3RIUC 3C50A 4WYVA 3PUGA 2XAFB 2V5CA 4LF5T 3AEAA 3UUNA 3AE6A 3ZC1A 4X66T 4M1PA 5JDNA 2LEHA 4EYYR 2W66A 2H7VC 3PUSA 2XASB 2WP9A 2HHHT 3VU7H 3OTOT 3UU5A 4YY3T 1KNRA 5F5WA 4N78D 2X67A 1WCRA 2A3DA 3ETVA 2J4GA 2ACXA 4HWCA 4KBMB 2XQ3A 4OFZA 1OEDB 1Z0PA 4OX9T 3KVAA 3FXDB 3D0TA 1W09A 1Z8UA 3WAKA 5ETWA 4EZHA 4UEMA 1MMNA 1T8BA 4DNDA 4AKLA 2H7OA 3RKGA 5LJNA 1WRDA 2E9XD 5FKYA 5L4EA 2JQQA 3O1HA 2HH7A 4JLEA 1ZKEA 4UR9A 3OPCA 1E7PA 3RRCA 4A97A
chains in the Genus database with same CATH topology
5DABA 1HF8A 3B13A 3C51A 2IAKA 3LG7A 2Q9QA 3GA8A 3C98B 2DWKA 4DMVA 5JDMA 5JDQA 3VKHA 1E1HB 5LYJE 1VOMA 3PUQA 5JREA 3F57A 4U72A 2WWUA 4MHCA 1S94A 2VKOA 2YK0A 4PW8A 2XTLA 3P7IA 2LM9A 3U78A 2ES0A 3KBTA 2CEAA 2HPJA 3AA6B 3N5LA 4YJ3E 3NBXX 2LE8A 2UXXB 2D5UA 4HE8A 4GK5E 4UIGA 1HS7A 3ZMVB 4H9RC 2ZM0A 4DBRA 3KV4A 5JR9C 4ISTA 5C8YE 2VWAA 4AKHA 3AAIA 2KMFA 5JH7E 2KZ7B 3AB3B 4O4LE 2X9YA 4EB6E 3RH3A 5HXRA 2YU1A 2CXLA 2RP4A 4L9IA 2XAJB 4UVAB 3SOLA 1SA0E 3AAEB 3OJAA 3F2EA 5FXZA 4FI5A 3K8PC 2L8KA 3QK6A 1BR1A 2VASA 4UV9B 4P0AA 4XBFB 5KDMC 3O4XE 4ASKA 2KNDA 3AA1B 2K9AA 4J2CA 5LOVE 4QWNB 3AA0B 2VKJA 4JUYA 2PFVA 4I55E 3E0ZA 3UFEA 5J2TE 2E9XC 3CKDA 4AXPA 3A5XA 1HFAA 5FYMA 2N9DA 1US7B 4ZHQE 4G2AA 3CWZB 4O2BE 1ZEEA 5LGTB 1HX8A 2BVMA 1HTJF 4ZI2D 3NZQA 1FMWA 2NW8A 2LSJA 3PUAA 3CMLA 2CE7A 3RC3A 1U5PA 3E08A 5JRCB 2C5IT 4PNIA 2P9BA 4YFSA 4YJ2E 5DQVA 4ZOLE 5HXSA 1OXZA 2V1DB 2DHRA 3N9LA 4C91A 3GN5B 1FIOA 2Q9QB 3HKDE 4EYUA 1NAFA 2NOXA 5JR9B 2DNXA 3RKOA 1IZNB 5ADXL 3R84B 2RA1A 4GYRA 2Q9QD 4UVCB 5EZYE 2YEVC 1UX4A 3DJBA 1ZHCA 5FY1A 2KLQA 5JDLA 2DLRA 1FEWA 2V7LA 3LBXB 2NP9A 3B57A 2KXPB 3N9QA 3CVRA 4AKIA 4IE5A 4PFOA 4QX8B 3IEEA 2KWIB 3T8OA 5FNVE 4TV9E 2ZM8A 2CXDA 4KUMB 4EAHA 2CMRA 4QKNA 4UF0B 3VKGA 2ZM2A 1QUUA 4F6RC 3Q5WA 2C0SA 3H3AA 3ANWA 5KMGP 1LKXA 4ZI3D 2X66A 2XAHB 4EZ4A 2X0LB 2ZMAA 1LVFA 3CX7B 4KP3C 2NTXA 1UX5A 2VK9A 3HL6A 3ZMSB 5F3JA 2PG8A 3OBVE 4MFRA 5TAOA 4G63A 3EUHA 3EDVA 3FHNA 1MIVA 5HXHA 3BQLA 4GIWA 5LCYA 4EXTA 3WAJA 2V7MA 4ILUA 4IHJE 2KINB 2QA7A 4B6XA 1MMGA 4ANJA 4AQFA 3R6NA 2LSYA 4ZI2C 5BMVE 3ZN1B 2PJQA 2XQYA 4CXWA 4HKAA 4WNKA 3ZCIA 4ERRA 1WYCA 3ZMUB 2W0GA 3KVBA 2G0UA 1YKHB 4IE6A 3C64A 2WMOA 4PK4A 4TN7B 3PTRB 2WMNA 5EK4A 5FXVA 4P09A 2L9QA 3S4UA 1D1AA 3HI2A 2BZBA 4PJMA 4TUYE 4UXNB 5FMNA 3HKCE 4I50E 4OK0A 1D0XA 2K24A 2ZLYA 1FMVA 2M67A 1IAPA 2LOSA 1X79A 2Q9QC 3CX6B 3N9OA 2LSGA 4KMCA 4OYKA 1WLXA 3HA4A 4BA9A 2VB6A 4IIJE 4ISSA 3MZKB 3JC6C 1D1CA 4GOUA 4HEAA 3HR0A 1MMDA 3RRWA 3BK9A 4WBOA 2YU2A 1D0ZA 5L3GB 5KX5E 3LJCA 2LSKA 4XZCA 3NZPA 4CI2B 4A56A 2LOPA 1BR4A 3H37A 4O4HE 2N1GA 3PU3A 1S35A 4QHOA 4XAXB 4O4IE 4QXCB 4ZI3C 3ONXA 3PDYA 4P0BA 2W62A 2D0TA 4WW0A 2BDEA 3L09A 2IW5B 5L3DB 2E8IA 3MA9A 5LHGB 2EHOA 2PBIA 3ZC0A 5L3FB 2ODVA 2GK9A 3O1JA 3K3NA 2MTQA 3C4XA 2DWGA 3OKQA 4O8SA 3V5SA 3CPZA 4MALA 5FP3A 2W61A 2KWHA 4HGAA 4UV8B 4BAYB 2SPCA 2X68A 3N2OA 3CQGB 3IBPA 1KNZA 4EOZB 3CQCB 5HWYA 1LVKA 4ZS3A 2JPFA 3N9MA 2VKHA 4CI3B 3EVYA 2XHEB 4FJOA 5HAXA 4C90A 4UVBB 2WAUA 2L3LA 5FXWA 3VHLA 1H7CA 5HYAA 2Z6EA 3KDSE 3KV9A 3NRYA 5CB4E 3W15B 3N9NA 1BR0A 3F31A 1BR2A 4CXYA 2MOZA 3I0QA 3PURA 1G8XA 2J1DG 4TX5A 3UUXB 1HG5A 4E7ZA 2X9XA 3JC6D 2JRKA 4GYSA 2LT3A 3CQXC 2NTYA 2BVLA 3AAAB 1MMAA 3L3PA 4GK0E 1U4QA 2HPLA 4H9OC 1KK7A 4MBQA 4OYJA 3ZYKA 5E0OA 4WBNE 5LBMA 2VL8A 2CM0A 3I0OA 3O1IA 5GONE 5LGNB 3KBUA 5JDGA 1OWAA 3HKBE 1WR6A 5HXCA 4PJJA 4IE7A 3ZMZB 3LK42 2QGSA 4QX7B 5CA1E 4JEUB 4AI6A 3HKEE 3RYCE 1D0YA 3UUMA 3SWHA 5EK3A 1ZV4X 1IJ5A 3MJXA 4IE0A 1MNDA 2X9HA 3I9YA 2CWOA 4MLKA 4Z8XA 2C5JA 3E22E 1MNEA 3ZEFB 3GMIA 3ZPOA 2IC6A 2W00A 4L0RA 5EK2A 4PJLA 4YLHA 4QXHB 5H6QB 2A2FX 3PE0A 2MYSA 5JDHA 4JEHB 3RYHE 4X1KE 3U3IA 1Y64B 2B1EA 4DO0A 4AQGA 4NUVA 5DJQC 4PAGA 4QXBB 3IF8B 3DTOA 4H9PC 4X1YE 3ZLIA 3N2GE 2A72A 5L2LA 2EHOD 5JRCA 2LHNA 5LA6E 2D0UA 3P8CD 3NRXA 4CZZB 3QC9A 3J9X1 3ETUA 3V5UA 3ZJ2A 2CWYA 3LK2B 2DCFA 4CXXA 1MIYA 3OYZA 1D1BA 3C4WA 3LK3B 1CUNA 3GN5A 4TZ4C 3AVSA 1LRZA 4AQFC 3GWHA 3I1AA 1G73A 3AA7B 4H9NC 4K0UA 2CLYC 5JR9A 3UULA 4BJNA 4AKGA 2WSSV 4OHFA 5LBQB 2D2SA 4O2AE 5AFUL 3BQIA 2N2NA 2XAGB 2VKDA 2Y8DA 2K5BB 3LBXA 4IDZA 4IE4A 3TKLB 5M4YA 3KV6A 5CA0E 2UXNB 4YHJA 4H63H 1YD8G 4CI1B 5JDFA 3CX8B 5LG4A 4U74A 3SRZA 1YW0A 5IYZE 2YINA 3FBLA 3K3QC 3FXEB 4UF0A 4PK5A 3WI3A 5JQGE 1B7TA 2XUEA 5J2UE 1T98A 3ESLA 5L3EB 1MIWA 2E9XA 4I4TE 4ZS2A 1NWMX 3AVRA 3MXZA 3K3OA 3ANWB 3PU8A 3MACA 5FY7A 2XAQB 4PJNA 5LHIB 2IC9A 3FB2A 1O3XA 3EDUA 5FXXA 4ADZA 5L3CB 1SHZC 4UELA 2H3RA 4V1Av 1QSDA 3I9WA 4H9QC 4BJMA 3ZYMA 5A1LA 4X1IE 3RPUA 2CA5A 3C50A 3IHRA 2ODUA 2JJ9A 2W63A 4DBQA 3MKDA 3PUGA 2C5KT 2XAFB 2JMHA 2CXFA 1WYBA 3MK7C 2CLYB 3Q5XA 2EHOC 4O4JE 3OYXA 3UUNA 5DQWA 2Y48B 3Q2MA 2NW7A 4E7SA 3ZC1A 3N9PA 2Y6XA 3ZN0B 1VRBA 1V9DA 4M1PA 4IGUA 2V26A 3RYIE 2NWBA 5JDNA 3M65A 3KFWX 2LEHA 4EYYR 5LJMA 3LFMA 4I43B 1IJ6A 4NUUA 2H7VC 3PUSA 2XASB 3ZJ1A 3KINB 5L3BB 3SS1A 3VU7H 3C4ZA 3UTKA 4DMWA 4EIWA 2LHRA 3BQKA 2I59A 4N78D 5F8PA 3ZMTB 1HG2A 2X67A 1HCIA 5IHYA 3ZCJA 4H63V 2A3DA 4HTEA 3ETVA 3DP7A 3ZYLA 4TV8E 4DVDA 2X51A 2ACXA 4KBMB 5HXEA 4OFZA 5JVDE 1Z0PA 3KV5A 4PK6A 3KVAA 2V7KA 3FXDB 3D0TA 2X9WA 2LJLA 1YKEB 1UCUA 1AJ3A 2OA5A 2WBLA 3WAKA 5ETWA 4EZHA 4H9SE 4UEMA 2CCQA 4PFPA 4ZI7E 1MMNA 4L5GA 2KT9A 2E9XB 4HN9A 4DNDA 1EZ3A 5LP6E 5LXTE 4AKLA 2H7OA 5LNKA 3O9XA 4AKRB 5LJNA 2V7JA 4CQIA 1WRDA 2E9XD 2JMKA 2V7IA 2WM9A 2EHOB 5H6RB 3UT5E 5HWXA 3Q9DA 2NW9A 2MBGA 2DI4A 5J1GA 2JQQA 3J7Yq 3O1HA 4X20E 3FBZA 3QUJA 3RYFE 2K48A 2HH7A 4JLEA 1ZKEA 3N2KE 4HFVA 5LHHB 5LGUB 5FY0A 3RC8A 3RX6A 3RRCA 2LSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLK A;  3Q9D A; 
#chains in the Genus database with same CATH topology
 5DAB A;  3B13 A;  1R8I A;  5CGM A;  5JDQ A;  3VKH A;  1E1H B;  3PUQ A;  5JRE A;  1NEK A;  1W0A A;  3F57 A;  4IDN A;  4U72 A;  2WWU A;  3P4Q A;  2VKO A;  2YK0 A;  5AQM B;  2LM9 A;  2HPJ A;  3NBX X;  2UXX B;  3UU8 A;  3UQ4 A;  1W9R A;  3QOF A;  4HE8 A;  1HNX T;  4UIG A;  4DBR A;  2FJE A;  1Y01 A;  5C8Y E;  2VWA A;  2YN6 A;  4AKH A;  5LB7 B;  3AB3 B;  4U33 A;  2YU1 A;  2XQ7 A;  4UVA B;  1SA0 E;  3AAE B;  5AQF B;  4P0A A;  3JAF A;  2UXB T;  4XBF B;  2MPK A;  4EED A;  2VKJ A;  2PFV A;  4I55 E;  5J2T E;  2VUR A;  4YT0 A;  4JBW F;  4O2B E;  4ZI2 D;  2NW8 A;  2IIU A;  4JI1 T;  3E08 A;  1XNR T;  4ZEY A;  4YFS A;  4CN4 A;  4YJ2 E;  4ZOL E;  1OXZ A;  5LG3 A;  3N9L A;  3GN5 B;  3HKD E;  1NAF A;  3RKO A;  5AQK B;  5ADX L;  2Q9Q D;  4UVC B;  1IBL T;  5EZY E;  1UX4 A;  3DJB A;  1FEW A;  2NP9 A;  3B57 A;  1YXR A;  5HEG A;  4IE5 A;  4JYA T;  1UGO A;  2CXD A;  2CMR A;  4UF0 B;  4F6R C;  4A5X A;  5KMG P;  4YHH T;  4EZ4 A;  2ZMA A;  2BS4 A;  4KP3 C;  2NTX A;  5F3J A;  3AXJ B;  2LLY A;  5TAO A;  3EDV A;  4EXT A;  2V7M A;  2KIN B;  2VVS A;  1MMG A;  4AQF A;  3FZM B;  5BMV E;  3ZN1 B;  1J1J A;  2PJQ A;  4CXW A;  4DV3 T;  4ERR A;  5CFB A;  3AE7 A;  3UQ7 A;  2G0U A;  3C64 A;  2WMO A;  2UUA T;  2VQE T;  5FXV A;  2JQH A;  2L9Q A;  3S4U A;  1D1A A;  4LML A;  4UXN B;  4TWD A;  4I50 E;  4U7Y A;  3CX6 B;  2LSG A;  4KMC A;  4OYK A;  3HA4 A;  2CHN A;  2WWV A;  2VB6 A;  4ISS A;  3JC6 C;  2WU2 A;  1J5W A;  1D0Z A;  3LJC A;  4XZC A;  1JNR A;  1BR4 A;  4QHO A;  1S35 A;  4LF9 T;  4XAX B;  4O4I E;  2FJA A;  4P0B A;  3P50 A;  2WS3 A;  3MA9 A;  2UU9 T;  2EHO A;  2PBI A;  2HN2 A;  4CN6 A;  2GK9 A;  3O1J A;  2MTQ A;  4O8S A;  3CPZ A;  1ZOY A;  4MAL A;  4LMK A;  4BAY B;  2SPC A;  3CQG B;  2UUB T;  3CQC B;  5HWY A;  4ZS3 A;  3N9M A;  4CI3 B;  4FJO A;  4UVB B;  2L3L A;  3VHL A;  3W15 B;  3KDS E;  5FVL A;  4CXY A;  4TX5 A;  2AXD S;  3L3P A;  4DR6 T;  4MBQ A;  2HPL A;  1KK7 A;  2VL8 A;  3H3M A;  2CM0 A;  4ILA A;  5LGN B;  2M6B A;  5HXC A;  4PJJ A;  2VL0 A;  5CA1 E;  3PV0 F;  2XQ4 A;  3EAB A;  4P1N A;  3RQU A;  1J5E T;  2X9H A;  2I0M A;  4MLK A;  4U3C A;  4Z8X A;  3E22 E;  1MNE A;  3ZEF B;  4YTN A;  3GMI A;  5EK2 A;  4PJL A;  2MYS A;  2BBH A;  4ZZB A;  4JEH B;  3U3I A;  4DO0 A;  4PAG A;  3IF8 B;  4H9P C;  3Q5D A;  3ZLI A;  3N2G E;  4DR4 T;  3P8C D;  3V5U A;  5IWA T;  2DCF A;  4CXX A;  5ABE A;  3C4W A;  3AE8 A;  4AQF C;  2BBJ A;  1G73 A;  5JR9 A;  4K0U A;  2CBI A;  4OHF A;  2D2S A;  3BQI A;  4K0K T;  2VKD A;  2K5B B;  4YSZ A;  3TKL B;  3KV6 A;  3SFE A;  1YD8 G;  2W67 A;  5LG4 A;  3RLF F;  3VRA A;  2H89 A;  3SRZ A;  2R6G F;  1N32 T;  3FBL A;  3K3Q C;  4PK5 A;  3NVO A;  2XUE A;  5J2U E;  1T98 A;  2M6I A;  3ZST A;  3MXZ A;  2VQF T;  2WZI A;  1O3X A;  5FXX A;  4ADZ A;  5L3C B;  2H3R A;  4V1A v;  4H9Q C;  4X1I E;  2X0Y A;  3IHR A;  3MK7 C;  2CXF A;  1WYB A;  2EHO C;  4X5T A;  3OYX A;  5DQW A;  3Q2M A;  4E7S A;  2CRB A;  3UFG A;  3UU4 A;  1V9D A;  1GQE A;  2V26 A;  3RYI E;  3KFW X;  5LJM A;  3LFM A;  4I43 B;  4B3R T;  3ZJ1 A;  1HNZ T;  5F8P A;  3ZCJ A;  4H63 V;  4JI6 T;  3P4S A;  3JAD A;  4DVD A;  4TV8 E;  2X51 A;  2OLT A;  2UUC T;  3AED A;  3UU6 A;  4PK6 A;  2LJL A;  1UCU A;  1KEY A;  4H9S E;  2CCQ A;  4LFA T;  5LP6 E;  5LXT E;  3O9X A;  2JQ9 A;  4CQI A;  2EHO B;  3Q9D A;  2NW9 A;  2DI4 A;  4IRE A;  3J7Y q;  4X20 E;  2XM1 A;  4X64 T;  3RYF E;  4DV6 T;  2F4V T;  1XDO A;  5LGU B;  5FY0 A;  1T7S A;  4B3T T;  3ONL C;  1HF8 A;  4HFD A;  5JDM A;  5LYJ E;  1I6Z A;  4PW8 A;  5IUX A;  2IDO B;  2LE8 A;  2VVN A;  4HWI B;  2YOE A;  3RGL A;  4JI5 T;  3ZMV B;  3KV4 A;  5JR9 C;  4LF8 T;  2KMF A;  3TLV A;  2KZ7 B;  2XZE A;  3LSV A;  4L9I A;  3UU3 A;  3PUX F;  4AIS A;  3SOL A;  3OJA A;  3F2E A;  4HWH A;  4UV9 B;  5J0Z A;  2KND A;  2K9A A;  4QWN B;  2YDS A;  5FL1 A;  4JUY A;  3ZT6 A;  3CKD A;  1HFA A;  1QLB A;  3CIR A;  4G2A A;  1NEN A;  3CWZ B;  5LGT B;  2BVM A;  3A7M A;  1HTJ F;  1FMW A;  3QB5 K;  3RC3 A;  2C5I T;  3EHZ A;  5HXS A;  2DHR A;  3ZKR A;  2FJB A;  5AQN B;  3CK6 A;  5JR9 B;  4HFI A;  2UXD T;  2YEV C;  1ZP0 A;  1ZHC A;  3T1H T;  3N9Q A;  3CVR A;  4AKI A;  4PFO A;  3IEE A;  3T8O A;  5FNV E;  1YQ4 A;  1XMO T;  2ZM8 A;  4KUM B;  4EAH A;  3AEE A;  2J62 A;  3RHW A;  3SFD A;  3Q5W A;  2C0S A;  2WDQ A;  1XDP A;  3H3A A;  2XSB A;  2X66 A;  2X0L B;  2FUP A;  3M3Z B;  2VK9 A;  3QNU A;  3ZMS B;  4DV5 T;  3EUH A;  5HXH A;  3BQL A;  5LCY A;  3WAJ A;  4ILU A;  2QA7 A;  4YTP A;  4F8H A;  4HKA A;  4B3S T;  4QH5 A;  1WYC A;  3ZMU B;  2ACZ A;  3KVB A;  3AEB A;  4TN7 B;  5L47 A;  3PTR B;  2WMN A;  5EK4 A;  3HI2 A;  5FMN A;  3HKC E;  4OK0 A;  3FZL B;  2M67 A;  1IAP A;  2LOS A;  1WLX A;  4BA9 A;  4HEA A;  1MMD A;  2WCA A;  4WBO A;  5HEJ A;  3L8R A;  4HWD A;  2LSK A;  3RI5 A;  2LOP A;  2W62 A;  2BDE A;  3OKQ A;  3V5S A;  2HN1 A;  5FP3 A;  2W61 A;  4HGA A;  4Q25 A;  4UV8 B;  3RF1 A;  1KNZ A;  5AQG B;  4KHP T;  2VKH A;  5HAX A;  4C90 A;  2W2U A;  2LRK A;  4DV2 T;  1H7C A;  2Z6E A;  5CB4 E;  3N9N A;  2B76 A;  1BR2 A;  4NPP A;  2MOZ A;  3AEF A;  1KFY A;  3I0Q A;  3UUX B;  2WQY A;  2X9X A;  4EGW A;  4TNW A;  3CQX C;  5E0O A;  4DR2 T;  3A8Y C;  3L39 A;  3AEG A;  3KBU A;  3LK4 2;  1UK5 A;  4YSX A;  4JEU B;  4AI6 A;  3HKE E;  3RYC E;  2MAW A;  4YSY A;  3I9Y A;  2CWO A;  2C5J A;  2BS2 A;  2FJD A;  1KF6 A;  2A2F X;  2BKO A;  4X1K E;  1Y64 B;  2B1E A;  4AQG A;  4QXB B;  3PUY F;  4X1Y E;  3P4R A;  5JRC A;  2E5L T;  2EHO D;  4CZZ B;  3J9X 1;  5AQI B;  3LK2 B;  1IBM T;  4LFC T;  3OYZ A;  4YXD A;  1D1B A;  3VRB A;  4TZ4 C;  3AVS A;  1LRZ A;  5AQL B;  2WSS V;  3ZT7 A;  3UUB A;  5AFU L;  2XAG B;  3VR8 A;  2Y8D A;  4IDZ A;  1KNP A;  5M4Y A;  2UXN B;  2V6Y A;  2RPA A;  5JQG E;  5L3E B;  3PU8 A;  2W4X A;  2XAQ B;  1SHZ C;  4UEL A;  3TLS A;  2YKS A;  1QSD A;  3I9W A;  4Z91 A;  3ZYM A;  1WFD A;  1YQ3 A;  3RPU A;  2ODU A;  2JJ9 A;  4DBQ A;  4DR1 T;  2Y48 B;  2K3W A;  3N9P A;  2Y6X A;  3ZN0 B;  1SE7 A;  1VRB A;  3Q5E A;  4ZZC A;  4IGU A;  4JI0 T;  1IJ6 A;  4NUU A;  5L3B B;  4DUY T;  3C4Z A;  4KHZ F;  3BQK A;  2I59 A;  4U31 A;  1HG2 A;  1HCI A;  2BS3 A;  5IHY A;  4HTE A;  5HXE A;  4QH1 A;  5JTG A;  5ABH A;  2X9W A;  5HEO A;  1AJ3 A;  2OA5 A;  2WBL A;  3ABV A;  4L5G A;  4LF6 T;  2E9X B;  3FZH B;  2KSR A;  5LNK A;  2V7I A;  2WM9 A;  5HWX A;  2MBG A;  5J1G A;  1L0V A;  3FBZ A;  3QUJ A;  2K48 A;  3N2K E;  3RC8 A;  4DV7 T;  4DV1 T;  3RX6 A;  3C51 A;  2IAK A;  2I6H A;  3C98 B;  3QB5 A;  3B5M A;  4MHC A;  1S94 A;  2XTL A;  3U78 A;  2ES0 A;  3KBT A;  3AA6 B;  3N5L A;  3P4P A;  5L4H A;  4NXM T;  3PJA J;  4GK5 E;  1HS7 A;  4H9R C;  2CBJ A;  4IST A;  2V8S V;  1XWM A;  2A9U A;  4EB6 E;  4O4L E;  2X9Y A;  3RH3 A;  2CXL A;  2RP4 A;  2BG9 A;  4FI5 A;  3K8P C;  2VAS A;  4TWF A;  5KDM C;  3O4X E;  5BR8 T;  5LOV E;  3E0Z A;  4AXP A;  3A5X A;  2V6X A;  5FYM A;  2N9D A;  1US7 B;  4ZHQ E;  2LSJ A;  3PUA A;  3CML A;  3AEC A;  1U5P A;  3JAE A;  4U2Y A;  5JRC B;  4IDQ A;  2J47 A;  4ZXL A;  5AQQ B;  1FIO A;  2Q9Q B;  4EYU A;  4IDP A;  2UXC T;  1IZN B;  4GYR A;  2XQ6 A;  2KLQ A;  3P4W A;  2V7L A;  5LMN T;  2KXP B;  2V6Y B;  4QX8 B;  2KWI B;  1QUU A;  4AQY T;  3ANW A;  4TNV A;  2XAH B;  1LVF A;  2X0H A;  1FJG T;  4HFB A;  4GIW A;  2CHO A;  4DR7 T;  4GKK T;  4WZX A;  4KI0 F;  4WNK A;  3ZCI A;  3ZT5 A;  1YKH B;  2BKP A;  5ABG A;  3JCF A;  1X9B A;  4JI8 T;  2BZB A;  3FZK B;  5HCJ A;  1FMV A;  3N9O A;  4B3M T;  3MZK B;  1D1C A;  4I0U A;  2YDR A;  3HR0 A;  3RRW A;  3BK9 A;  2YU2 A;  5L3G B;  4CI2 B;  4A56 A;  5C2T A;  3H37 A;  4DID B;  4ILC A;  4QXC B;  4ZI3 C;  4WW0 A;  2IW5 B;  5L3D B;  2BG9 C;  3C4X A;  2DWG A;  2QRX A;  4EV6 A;  2LKG A;  2KWH A;  3PJA A;  3N2O A;  3FZF B;  4AIU A;  2IHR 1;  4EOZ B;  4LMJ A;  1LVK A;  4HFC A;  3TLW A;  4JI3 T;  1WR0 A;  3EVY A;  2XHE B;  2WAU A;  4U7I A;  5HYA A;  3NRY A;  3F31 A;  1W0B A;  3PUR A;  1G8X A;  2AE9 A;  3JC6 D;  2JRK A;  3PUZ F;  4Z90 A;  2BVL A;  1MMA A;  3ZYK A;  4OYJ A;  4JV5 T;  4WBN E;  3I0O A;  1M62 A;  3AE4 A;  4IE7 A;  3ZMZ B;  1SUM B;  2QGS A;  2BG9 B;  2XM2 A;  4EEB A;  3UUM A;  3SWH A;  5EK3 A;  1IJ5 A;  3MJX A;  4IE0 A;  3ZPO A;  2IC6 A;  5H6Q B;  5JDH A;  5DJQ C;  4X62 T;  2PTF A;  3DTO A;  4U2Z A;  5LA6 E;  3NRX A;  2ZM6 T;  3QC9 A;  4JI4 T;  3ZJ2 A;  1MIY A;  2IUB A;  3LDQ B;  3LK3 B;  3I1A A;  3AA7 B;  4H9N C;  3RQW A;  2CLY C;  4BJN A;  1T72 A;  2QVA A;  2N2N A;  4A98 A;  3LBX A;  1XMQ T;  2LRL A;  4H63 H;  5AQV B;  1HR0 T;  1YW0 A;  5IYZ E;  4LF7 T;  3FXE B;  3WI3 A;  1B7T A;  1MIW A;  2E9X A;  3RIF A;  4ZS2 A;  1NWM X;  3AVR A;  3ANW B;  3MAC A;  4GKJ T;  4DV0 T;  4PJN A;  5LHI B;  3ONJ A;  4IL4 A;  4BJM A;  4YTM A;  5A1L A;  2XPK A;  4TWH A;  3RIA A;  2CA5 A;  2W63 A;  3MKD A;  2C5K T;  2JMH A;  3Q5X A;  2CLY B;  4O4J E;  5FVK A;  2NW7 A;  2XY8 B;  2BG9 E;  1UUS A;  2OV9 A;  1OED E;  2NWB A;  2WB5 A;  3M65 A;  3KIN B;  3SS1 A;  3UTK A;  4DMW A;  4EIW A;  5AQU B;  2LHR A;  3ZMT B;  1VCT A;  3DP7 A;  3ZYL A;  4KX6 A;  5JVD E;  3G06 A;  3KV5 A;  2V7K A;  2WDR A;  1YKE B;  2LM2 A;  2V5D A;  4PFP A;  4ZI7 E;  2KT9 A;  4HN9 A;  4LFB T;  1EZ3 A;  1XZY A;  4AKR B;  2V7J A;  3UT5 E;  2JMK A;  5H6R B;  2IML A;  5LHH B;  4HFV A;  2LSI A;  4JI2 T;  3LG7 A;  2Q9Q A;  3GA8 A;  2DWK A;  4DMV A;  5ABF A;  4DR5 T;  1VOM A;  3P7I A;  3NWI A;  2CEA A;  4YJ3 E;  3AE1 A;  2D5U A;  3OVU A;  3AE2 A;  5LMU T;  2XQ5 A;  2ZM0 A;  1IBK T;  5AQS B;  3AAI A;  5JH7 E;  5HXR A;  2XAJ B;  5FXZ A;  5FL0 A;  2L8K A;  3QK6 A;  1BR1 A;  2WU5 A;  3AE5 A;  4ASK A;  3AA1 B;  4J2C A;  4NIQ A;  3AA0 B;  3UFE A;  2E9X C;  3PUW F;  1ZEE A;  1CHU A;  3NKZ A;  1HX8 A;  1N34 T;  3NZQ A;  4LF4 T;  2CE7 A;  4PNI A;  2P9B A;  5DQV A;  2V1D B;  4C91 A;  4IT4 A;  4COF A;  2NOX A;  2DNX A;  1DU2 A;  3R84 B;  2RA1 A;  1N36 T;  5FY1 A;  5JDL A;  2DLR A;  3VR9 A;  3LBX B;  2YDQ A;  5AQR B;  4TV9 E;  4QKN A;  3VKG A;  2ZM2 A;  2BKN A;  1XNQ T;  3AE9 A;  1LKX A;  4ZI3 D;  2NR4 A;  3CX7 B;  5AQO B;  3EAM A;  1UX5 A;  3HL6 A;  2PG8 A;  3OBV E;  4DR3 T;  4MFR A;  4G63 A;  3FHN A;  1MIV A;  4IHJ E;  4B6X A;  4ANJ A;  3R6N A;  2LSY A;  4ZI2 C;  4X65 T;  2XQY A;  5AQP B;  2W0G A;  4IE6 A;  3ZSS A;  4PK4 A;  5HEH A;  4P09 A;  2JIW A;  4PJM A;  4TUY E;  1D0X A;  2K24 A;  4DUZ T;  3T1Y T;  2ZLY A;  4JI7 T;  4NXN T;  1X79 A;  2Q9Q C;  1E2A A;  4IIJ E;  2XQ9 A;  2QYW A;  4GOU A;  5C3J A;  1OED A;  3K1S A;  4CN1 A;  5KX5 E;  3NZP A;  4HFH A;  4O4H E;  2N1G A;  3PU3 A;  3RIU A;  5AQH B;  3ONX A;  3PDY A;  4IL9 A;  2D0T A;  3L09 A;  5LHG B;  2E8I A;  3ZC0 A;  4QH4 A;  1UUR A;  5L3F B;  2ODV A;  3K3N A;  3EI0 A;  2E5V A;  3IA3 A;  2X68 A;  3PUV F;  2WDV A;  3IBP A;  2JPF A;  5ABF B;  5FXW A;  1BR0 A;  5CJ5 A;  3KV9 A;  3AE3 A;  1JNZ A;  4ILB A;  1HNW T;  2J1D G;  1HG5 A;  4E7Z A;  4GYS A;  3X1D A;  2LT3 A;  1N33 T;  2XJ7 A;  4H9O C;  2NTY A;  3AAA B;  4GK0 E;  1U4Q A;  5LBM A;  2CPT A;  3O1I A;  5GON E;  5JDG A;  1OWA A;  3HKB E;  1WR6 A;  2D9D A;  4HFE A;  2H88 A;  5HEU A;  4QX7 B;  4IDO A;  2XQA A;  4HWF A;  2WY2 A;  5KXJ A;  1D0Y A;  1ZV4 X;  2XQ8 A;  1MND A;  2W00 A;  4L0R A;  4YLH A;  4QXH B;  5AQT B;  3PE0 A;  3RYH E;  4DV4 T;  4NUV A;  1VCS A;  5L2L A;  2A72 A;  2LHN A;  2D0U A;  3ETU A;  2CWY A;  5HCM A;  1CUN A;  3GN5 A;  3GWH A;  2E2A A;  3UUL A;  4AKG A;  1M7K A;  5LBQ B;  1I94 T;  2XSA A;  5AQJ B;  4O2A E;  3TLT A;  4IE4 A;  5CA0 E;  4YHJ A;  4CI1 B;  5JDF A;  3CX8 B;  3TLU A;  4U74 A;  2LKH A;  2YIN A;  4UF0 A;  3ESL A;  2JQK A;  2WZH A;  4I4T E;  3K3O A;  5FY7 A;  2FBW A;  1OED C;  2IC9 A;  2DL1 A;  3FB2 A;  3EDU A;  3AXJ A;  1HX1 B;  3RIU C;  3C50 A;  4WYV A;  3PUG A;  2XAF B;  2V5C A;  4LF5 T;  3AEA A;  3UUN A;  3AE6 A;  3ZC1 A;  4X66 T;  4M1P A;  5JDN A;  2LEH A;  4EYY R;  2W66 A;  2H7V C;  3PUS A;  2XAS B;  2WP9 A;  2HHH T;  3VU7 H;  3OTO T;  3UU5 A;  4YY3 T;  1KNR A;  5F5W A;  4N78 D;  2X67 A;  1WCR A;  2A3D A;  3ETV A;  2J4G A;  2ACX A;  4HWC A;  4KBM B;  2XQ3 A;  4OFZ A;  1OED B;  1Z0P A;  4OX9 T;  3KVA A;  3FXD B;  3D0T A;  1W09 A;  1Z8U A;  3WAK A;  5ETW A;  4EZH A;  4UEM A;  1MMN A;  1T8B A;  4DND A;  4AKL A;  2H7O A;  3RKG A;  5LJN A;  1WRD A;  2E9X D;  5FKY A;  5L4E A;  2JQQ A;  3O1H A;  2HH7 A;  4JLE A;  1ZKE A;  4UR9 A;  3OPC A;  1E7P A;  3RRC A;  4A97 A; 
#chains in the Genus database with same CATH homology
 5DAB A;  1HF8 A;  3B13 A;  3C51 A;  2IAK A;  3LG7 A;  2Q9Q A;  3GA8 A;  3C98 B;  2DWK A;  4DMV A;  5JDM A;  5JDQ A;  3VKH A;  1E1H B;  5LYJ E;  1VOM A;  3PUQ A;  5JRE A;  3F57 A;  4U72 A;  2WWU A;  4MHC A;  1S94 A;  2VKO A;  2YK0 A;  4PW8 A;  2XTL A;  3P7I A;  2LM9 A;  3U78 A;  2ES0 A;  3KBT A;  2CEA A;  2HPJ A;  3AA6 B;  3N5L A;  4YJ3 E;  3NBX X;  2LE8 A;  2UXX B;  2D5U A;  4HE8 A;  4GK5 E;  4UIG A;  1HS7 A;  3ZMV B;  4H9R C;  2ZM0 A;  4DBR A;  3KV4 A;  5JR9 C;  4IST A;  5C8Y E;  2VWA A;  4AKH A;  3AAI A;  2KMF A;  5JH7 E;  2KZ7 B;  3AB3 B;  4O4L E;  2X9Y A;  4EB6 E;  3RH3 A;  5HXR A;  2YU1 A;  2CXL A;  2RP4 A;  4L9I A;  2XAJ B;  4UVA B;  3SOL A;  1SA0 E;  3AAE B;  3OJA A;  3F2E A;  5FXZ A;  4FI5 A;  3K8P C;  2L8K A;  3QK6 A;  1BR1 A;  2VAS A;  4UV9 B;  4P0A A;  4XBF B;  5KDM C;  3O4X E;  4ASK A;  2KND A;  3AA1 B;  2K9A A;  4J2C A;  5LOV E;  4QWN B;  3AA0 B;  2VKJ A;  4JUY A;  2PFV A;  4I55 E;  3E0Z A;  3UFE A;  5J2T E;  2E9X C;  3CKD A;  4AXP A;  3A5X A;  1HFA A;  5FYM A;  2N9D A;  1US7 B;  4ZHQ E;  4G2A A;  3CWZ B;  4O2B E;  1ZEE A;  5LGT B;  1HX8 A;  2BVM A;  1HTJ F;  4ZI2 D;  3NZQ A;  1FMW A;  2NW8 A;  2LSJ A;  3PUA A;  3CML A;  2CE7 A;  3RC3 A;  1U5P A;  3E08 A;  5JRC B;  2C5I T;  4PNI A;  2P9B A;  4YFS A;  4YJ2 E;  5DQV A;  4ZOL E;  5HXS A;  1OXZ A;  2V1D B;  2DHR A;  3N9L A;  4C91 A;  3GN5 B;  1FIO A;  2Q9Q B;  3HKD E;  4EYU A;  1NAF A;  2NOX A;  5JR9 B;  2DNX A;  3RKO A;  1IZN B;  5ADX L;  3R84 B;  2RA1 A;  4GYR A;  2Q9Q D;  4UVC B;  5EZY E;  2YEV C;  1UX4 A;  3DJB A;  1ZHC A;  5FY1 A;  2KLQ A;  5JDL A;  2DLR A;  1FEW A;  2V7L A;  3LBX B;  2NP9 A;  3B57 A;  2KXP B;  3N9Q A;  3CVR A;  4AKI A;  4IE5 A;  4PFO A;  4QX8 B;  3IEE A;  2KWI B;  3T8O A;  5FNV E;  4TV9 E;  2ZM8 A;  2CXD A;  4KUM B;  4EAH A;  2CMR A;  4QKN A;  4UF0 B;  3VKG A;  2ZM2 A;  1QUU A;  4F6R C;  3Q5W A;  2C0S A;  3H3A A;  3ANW A;  5KMG P;  1LKX A;  4ZI3 D;  2X66 A;  2XAH B;  4EZ4 A;  2X0L B;  2ZMA A;  1LVF A;  3CX7 B;  4KP3 C;  2NTX A;  1UX5 A;  2VK9 A;  3HL6 A;  3ZMS B;  5F3J A;  2PG8 A;  3OBV E;  4MFR A;  5TAO A;  4G63 A;  3EUH A;  3EDV A;  3FHN A;  1MIV A;  5HXH A;  3BQL A;  4GIW A;  5LCY A;  4EXT A;  3WAJ A;  2V7M A;  4ILU A;  4IHJ E;  2KIN B;  2QA7 A;  4B6X A;  1MMG A;  4ANJ A;  4AQF A;  3R6N A;  2LSY A;  4ZI2 C;  5BMV E;  3ZN1 B;  2PJQ A;  2XQY A;  4CXW A;  4HKA A;  4WNK A;  3ZCI A;  4ERR A;  1WYC A;  3ZMU B;  2W0G A;  3KVB A;  2G0U A;  1YKH B;  4IE6 A;  3C64 A;  2WMO A;  4PK4 A;  4TN7 B;  3PTR B;  2WMN A;  5EK4 A;  5FXV A;  4P09 A;  2L9Q A;  3S4U A;  1D1A A;  3HI2 A;  2BZB A;  4PJM A;  4TUY E;  4UXN B;  5FMN A;  3HKC E;  4I50 E;  4OK0 A;  1D0X A;  2K24 A;  2ZLY A;  1FMV A;  2M67 A;  1IAP A;  2LOS A;  1X79 A;  2Q9Q C;  3CX6 B;  3N9O A;  2LSG A;  4KMC A;  4OYK A;  1WLX A;  3HA4 A;  4BA9 A;  2VB6 A;  4IIJ E;  4ISS A;  3MZK B;  3JC6 C;  1D1C A;  4GOU A;  4HEA A;  3HR0 A;  1MMD A;  3RRW A;  3BK9 A;  4WBO A;  2YU2 A;  1D0Z A;  5L3G B;  5KX5 E;  3LJC A;  2LSK A;  4XZC A;  3NZP A;  4CI2 B;  4A56 A;  2LOP A;  1BR4 A;  3H37 A;  4O4H E;  2N1G A;  3PU3 A;  1S35 A;  4QHO A;  4XAX B;  4O4I E;  4QXC B;  4ZI3 C;  3ONX A;  3PDY A;  4P0B A;  2W62 A;  2D0T A;  4WW0 A;  2BDE A;  3L09 A;  2IW5 B;  5L3D B;  2E8I A;  3MA9 A;  5LHG B;  2EHO A;  2PBI A;  3ZC0 A;  5L3F B;  2ODV A;  2GK9 A;  3O1J A;  3K3N A;  2MTQ A;  3C4X A;  2DWG A;  3OKQ A;  4O8S A;  3V5S A;  3CPZ A;  4MAL A;  5FP3 A;  2W61 A;  2KWH A;  4HGA A;  4UV8 B;  4BAY B;  2SPC A;  2X68 A;  3N2O A;  3CQG B;  3IBP A;  1KNZ A;  4EOZ B;  3CQC B;  5HWY A;  1LVK A;  4ZS3 A;  2JPF A;  3N9M A;  2VKH A;  4CI3 B;  3EVY A;  2XHE B;  4FJO A;  5HAX A;  4C90 A;  4UVB B;  2WAU A;  2L3L A;  5FXW A;  3VHL A;  1H7C A;  5HYA A;  2Z6E A;  3KDS E;  3KV9 A;  3NRY A;  5CB4 E;  3W15 B;  3N9N A;  1BR0 A;  3F31 A;  1BR2 A;  4CXY A;  2MOZ A;  3I0Q A;  3PUR A;  1G8X A;  2J1D G;  4TX5 A;  3UUX B;  1HG5 A;  4E7Z A;  2X9X A;  3JC6 D;  2JRK A;  4GYS A;  2LT3 A;  3CQX C;  2NTY A;  2BVL A;  3AAA B;  1MMA A;  3L3P A;  4GK0 E;  1U4Q A;  2HPL A;  4H9O C;  1KK7 A;  4MBQ A;  4OYJ A;  3ZYK A;  5E0O A;  4WBN E;  5LBM A;  2VL8 A;  2CM0 A;  3I0O A;  3O1I A;  5GON E;  5LGN B;  3KBU A;  5JDG A;  1OWA A;  3HKB E;  1WR6 A;  5HXC A;  4PJJ A;  4IE7 A;  3ZMZ B;  3LK4 2;  2QGS A;  4QX7 B;  5CA1 E;  4JEU B;  4AI6 A;  3HKE E;  3RYC E;  1D0Y A;  3UUM A;  3SWH A;  5EK3 A;  1ZV4 X;  1IJ5 A;  3MJX A;  4IE0 A;  1MND A;  2X9H A;  3I9Y A;  2CWO A;  4MLK A;  4Z8X A;  2C5J A;  3E22 E;  1MNE A;  3ZEF B;  3GMI A;  3ZPO A;  2IC6 A;  2W00 A;  4L0R A;  5EK2 A;  4PJL A;  4YLH A;  4QXH B;  5H6Q B;  2A2F X;  3PE0 A;  2MYS A;  5JDH A;  4JEH B;  3RYH E;  4X1K E;  3U3I A;  1Y64 B;  2B1E A;  4DO0 A;  4AQG A;  4NUV A;  5DJQ C;  4PAG A;  4QXB B;  3IF8 B;  3DTO A;  4H9P C;  4X1Y E;  3ZLI A;  3N2G E;  2A72 A;  5L2L A;  2EHO D;  5JRC A;  2LHN A;  5LA6 E;  2D0U A;  3P8C D;  3NRX A;  4CZZ B;  3QC9 A;  3J9X 1;  3ETU A;  3V5U A;  3ZJ2 A;  2CWY A;  3LK2 B;  2DCF A;  4CXX A;  1MIY A;  3OYZ A;  1D1B A;  3C4W A;  3LK3 B;  1CUN A;  3GN5 A;  4TZ4 C;  3AVS A;  1LRZ A;  4AQF C;  3GWH A;  3I1A A;  1G73 A;  3AA7 B;  4H9N C;  4K0U A;  2CLY C;  5JR9 A;  3UUL A;  4BJN A;  4AKG A;  2WSS V;  4OHF A;  5LBQ B;  2D2S A;  4O2A E;  5AFU L;  3BQI A;  2N2N A;  2XAG B;  2VKD A;  2Y8D A;  2K5B B;  3LBX A;  4IDZ A;  4IE4 A;  3TKL B;  5M4Y A;  3KV6 A;  5CA0 E;  2UXN B;  4YHJ A;  4H63 H;  1YD8 G;  4CI1 B;  5JDF A;  3CX8 B;  5LG4 A;  4U74 A;  3SRZ A;  1YW0 A;  5IYZ E;  2YIN A;  3FBL A;  3K3Q C;  3FXE B;  4UF0 A;  4PK5 A;  3WI3 A;  5JQG E;  1B7T A;  2XUE A;  5J2U E;  1T98 A;  3ESL A;  5L3E B;  1MIW A;  2E9X A;  4I4T E;  4ZS2 A;  1NWM X;  3AVR A;  3MXZ A;  3K3O A;  3ANW B;  3PU8 A;  3MAC A;  5FY7 A;  2XAQ B;  4PJN A;  5LHI B;  2IC9 A;  3FB2 A;  1O3X A;  3EDU A;  5FXX A;  4ADZ A;  5L3C B;  1SHZ C;  4UEL A;  2H3R A;  4V1A v;  1QSD A;  3I9W A;  4H9Q C;  4BJM A;  3ZYM A;  5A1L A;  4X1I E;  3RPU A;  2CA5 A;  3C50 A;  3IHR A;  2ODU A;  2JJ9 A;  2W63 A;  4DBQ A;  3MKD A;  3PUG A;  2C5K T;  2XAF B;  2JMH A;  2CXF A;  1WYB A;  3MK7 C;  2CLY B;  3Q5X A;  2EHO C;  4O4J E;  3OYX A;  3UUN A;  5DQW A;  2Y48 B;  3Q2M A;  2NW7 A;  4E7S A;  3ZC1 A;  3N9P A;  2Y6X A;  3ZN0 B;  1VRB A;  1V9D A;  4M1P A;  4IGU A;  2V26 A;  3RYI E;  2NWB A;  5JDN A;  3M65 A;  3KFW X;  2LEH A;  4EYY R;  5LJM A;  3LFM A;  4I43 B;  1IJ6 A;  4NUU A;  2H7V C;  3PUS A;  2XAS B;  3ZJ1 A;  3KIN B;  5L3B B;  3SS1 A;  3VU7 H;  3C4Z A;  3UTK A;  4DMW A;  4EIW A;  2LHR A;  3BQK A;  2I59 A;  4N78 D;  5F8P A;  3ZMT B;  1HG2 A;  2X67 A;  1HCI A;  5IHY A;  3ZCJ A;  4H63 V;  2A3D A;  4HTE A;  3ETV A;  3DP7 A;  3ZYL A;  4TV8 E;  4DVD A;  2X51 A;  2ACX A;  4KBM B;  5HXE A;  4OFZ A;  5JVD E;  1Z0P A;  3KV5 A;  4PK6 A;  3KVA A;  2V7K A;  3FXD B;  3D0T A;  2X9W A;  2LJL A;  1YKE B;  1UCU A;  1AJ3 A;  2OA5 A;  2WBL A;  3WAK A;  5ETW A;  4EZH A;  4H9S E;  4UEM A;  2CCQ A;  4PFP A;  4ZI7 E;  1MMN A;  4L5G A;  2KT9 A;  2E9X B;  4HN9 A;  4DND A;  1EZ3 A;  5LP6 E;  5LXT E;  4AKL A;  2H7O A;  5LNK A;  3O9X A;  4AKR B;  5LJN A;  2V7J A;  4CQI A;  1WRD A;  2E9X D;  2JMK A;  2V7I A;  2WM9 A;  2EHO B;  5H6R B;  3UT5 E;  5HWX A;  3Q9D A;  2NW9 A;  2MBG A;  2DI4 A;  5J1G A;  2JQQ A;  3J7Y q;  3O1H A;  4X20 E;  3FBZ A;  3QUJ A;  3RYF E;  2K48 A;  2HH7 A;  4JLE A;  1ZKE A;  3N2K E;  4HFV A;  5LHH B;  5LGU B;  5FY0 A;  3RC8 A;  3RX6 A;  3RRC A;  2LSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...