4MLKA

3.05a resolution structure of ct584 from chlamydia trachomatis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
151
Chain Sequence
TFLLLEGNLKRIFATPIGYTTFREFQNVVFNCAQQELANFLFELINGKLKQSAQSLIVQFMMPIRVAKDIHERGEFINFITSDMLCVFLNRLSRVDGQEFLLMTDVQNTCHLIRHLLSRLLEAQKNPIGEKNLQEIQEDLDSLRAHFEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CT584 from Chlamydia trachomatis refined to 3.05 angstrom resolution.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Unknown function
molecule keywords CT584 protein
total genus 50
structure length 151
sequence length 167
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17435 DUF5414 Family of unknown function (DUF5414)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mlkA01
4MLKA 3Q9DA
chains in the Genus database with same CATH superfamily
4A5XA 1MMDA 2I0MA 2C0SA 4IHJE 2WZIA 4NUUA 2V5CA 1MMAA 2XSBA 1NENA 5FNVE 2CLYC 1G73A 2BS2A 4A56A 3ZN0B 2X66A 3N9PA 2D0TA 3ZT6A 1I94T 1BR4A 1Y01A 2WQYA 5L2LA 5LMUT 4B3TT 2IDOB 3ZEFB 2WCAA 3ZYLA 5F8PA 1HNZT 5JDLA 2X9XA 1KNRA 2NWBA 3ESLA 4U2YA 2PG8A 3RH3A 3OYXA 4H9PC 5JH7E 3PV0F 2A2FX 2V7MA 3AVRA 1GQEA 4QXCB 3X1DA 4CZZB 4EGWA 4E7ZA 3UUMA 2NW7A 4YXDA 4K0UA 5AFUL 4CI3B 5J0ZA 3CQGB 4LFCT 2BZBA 4YHJA 5FVKA 2Y8DA 2V7IA 2XZEA 1KK7A 1B7TA 2XUEA 2KXPB 4BJMA 3N2OA 1ZV4X 4TUYE 2VL8A 3LK2B 2XJ7A 2H88A 2X67A 1IJ5A 1NAFA 4UEMA 2OV9A 3KV4A 3NRXA 4DO0A 2EHOA 3P4RA 4DMWA 2H89A 4TNVA 2J47A 1UX4A 2L3LA 3PUZF 2FUPA 5KMGP 4DR4T 1J1JA 2NR4A 3BQKA 4UVCB 3C50A 3MZKB 2X9WA 4U7IA 4PAGA 5CA1E 4YTMA 1N32T 4NIQA 1BR0A 2WDQA 4DNDA 3I0QA 4KX6A 4CQIA 3AB3B 4YJ2E 2J4GA 4O2AE 4COFA 2HN1A 2BVMA 3I1AA 4F6RC 1T7SA 2LE8A 1E2AA 4X66T 2E5VA 4AQGA 1OEDA 4ZI7E 4B3ST 2YKSA 4FI5A 4QX7B 1WR6A 2WMNA 3AVSA 5J2UE 2DCFA 3ZYMA 2XM1A 2WMOA 2YOEA 5HEJA 2IUBA 4OFZA 3C4ZA 5KDMC 3UU3A 4X64T 3VRBA 2LM2A 1N33T 4H63H 3CVRA 2N1GA 3NBXX 4OK0A 1ZEEA 5AQSB 5LYJE 4WW0A 2G0UA 2EHOC 3CK6A 3P4PA 1ZOYA 3UU5A 4YFSA 3K3OA 2WDVA 2VVSA 3T8OA 4UF0B 5LA6E 2XM2A 4TWHA 2V5DA 5CA0E 3VR8A 4C90A 4NUVA 2X0HA 4U3CA 3UU8A 5LMNT 2LJLA 3ZMTB 2WDRA 5JR9A 3FZLB 2NP9A 1XZYA 2RP4A 3RYFE 4ASKA 3TKLB 2NTYA 5EZYE 3H37A 3RI5A 4XAXB 4QWNB 4HFCA 3ZSTA 5L3CB 3IF8B 4KHPT 3BK9A 2VK9A 5ABFA 1SHZC 5JDQA 2YU2A 3CQXC 4AXPA 2IMLA 5HEGA 3UUBA 3JAEA 4KMCA 3CX6B 1ZHCA 2GK9A 1HF8A 3GA8A 3LBXB 5AQQB 2MBGA 2DI4A 4EV6A 5ABHA 5FXWA 2VKOA 2CBJA 3Q2MA 4HWCA 2LOSA 3WAJA 1U4QA 2V7KA 3JCFA 4TZ4C 5FMNA 4LMKA 3U78A 2JQ9A 5L47A 4HFIA 3P7IA 1D1BA 3LDQB 3PUWF 5LHIB 2VQFT 2N2NA 5LG3A 2V6YA 1NWMX 4I55E 2SPCA 1SE7A 2E9XA 2OLTA 3WAKA 4ZZBA 1XMQT 5C2TA 2DHRA 5BMVE 4UVBB 2WU5A 3PU8A 4DV6T 4DV3T 1UK5A 1IZNB 3FXDB 5AQTB 5LBQB 2OA5A 3RIFA 2LSKA 3O4XE 2WWVA 4DV2T 2B76A 3HKEE 4PJNA 4YJ3E 5CJ5A 2Q9QA 2BBHA 4E7SA 3P4SA 2V1DB 4IE5A 1MNEA 2DWKA 3N2GE 2E9XC 1OWAA 4H9OC 2WM9A 3UT5E 2YDQA 2X0LB 3EI0A 2E5LT 3O9XA 2MOZA 5FKYA 2W67A 4CI1B 2CLYB 5AQRB 2LLYA 3K1SA 3QNUA 5ETWA 4YTPA 3LBXA 3IBPA 4QKNA 4X20E 5FY7A 1D0XA 3R84B 4JUYA 4U33A 3RPUA 4A97A 4GOUA 3PUQA 4HFDA 2KMFA 3HI2A 2LT3A 4DUYT 2HPJA 4ZEYA 4NPPA 2QA7A 3T1HT 2VL0A 4CI2B 1N34T 2ZM8A 4O2BE 2W61A 2YINA 4LMJA 4MBQA 2K9AA 2X9YA 2CMRA 4WZXA 5DABA 2PTFA 1YXRA 3MACA 5AQUB 3AE8A 3N9LA 2BG9A 1XDOA 2LKGA 3LSVA 3SFDA 5KXJA 4ILUA 2BKOA 2BS3A 2WS3A 3K8PC 4IDOA 4U74A 1BR2A 1UURA 2XQ4A 3KBTA 3JC6C 2C5IT 3PJAA 2K24A 5H6QB 4I50E 5EK2A 5L3EB 1T8BA 2VKHA 4LF9T 5HYAA 4OX9T 5JRCA 5AQIB 4AQFC 4LFAT 5JQGE 5HXCA 1YW0A 3I9YA 4L9IA 4PK6A 5IYZE 5J1GA 2JQHA 2CCQA 4DV0T 1YKHB 5F5WA 2J62A 3P4QA 3QUJA 1HX1B 1HNWT 3GN5B 4L5GA 2LKHA 4PFPA 3FZKB 3RRWA 3JADA 2W66A 4ILAA 2FJAA 4TN7B 3FZFB 2FBWA 3ZMZB 3PUYF 5LOVE 2VKDA 2ZM0A 3NVOA 2HPLA 4ZI3D 1M62A 3RC8A 4TV9E 1WLXA 2KWIB 3FXEB 5LBMA 3ZT5A 4X62T 3RIUC 2CBIA 3AA7B 4FJOA 1T98A 3LJCA 4LMLA 4O4JE 4IREA 3Q5DA 3E22E 1BR1A 1W0AA 2C5KT 3R6NA 5LXTE 5AQMB 2BDEA 2P9BA 2XQ7A 3JAFA 3NWIA 4I4TE 3I9WA 5FXZA 2NW9A 3L3PA 1US7B 3HA4A 2MAWA 3PTRB 4KUMB 4DR7T 5ABGA 4X65T 4IT4A 4UV9B 2XAGB 2PJQA 2CHNA 2X9HA 2D0UA 2WU2A 2VKJA 2AXDS 2MPKA 3GMIA 3B5MA 3KBUA 2BKPA 4HFBA 3ZYKA 2XPKA 4WBNE 4DUZT 1FMWA 5CB4E 4HWDA 2UUAT 2CPTA 2E9XB 1WRDA 5TAOA 2LRLA 3RRCA 3RQUA 1HG2A 3EDVA 2IC6A 4IDQA 3ZLIA 3N9QA 4UXNB 4DR5T 2NTXA 3N9MA 3RQWA 2VURA 5AQPB 3MXZA 1OEDB 3RHWA 4LF6T 2JRKA 2Q9QD 3AE7A 4ZI3C 1MNDA 4YHHT 2ACXA 2D5UA 3NKZA 4LF5T 4B6XA 4DMVA 2WWUA 4HWIB 5J2TE 1FJGT 3HL6A 3V5UA 3EAMA 4DR2T 3UFGA 4CN6A 5LP6E 1IAPA 2XAQB 4Z90A 2BG9B 4H63V 4H9RC 3ZPOA 1HFAA 4PJLA 2L9QA 4IDZA 1W09A 4A98A 5F3JA 2K48A 2AE9A 3KVBA 2V26A 3L09A 4OHFA 5HXRA 3TLWA 3FB2A 3ZMVB 4JI5T 4HWFA 4P09A 4DV1T 3AA0B 4DR3T 2KWHA 2LHRA 2A3DA 4LF8T 5LHGB 5HWXA 2NW8A 3L39A 1X9BA 4JI0T 2VWAA 1X79A 3AA1B 3ZSSA 3HKBE 3OYZA 4H9SE 1JNZA 3O1HA 4KI0F 3RGLA 3KV5A 3AEEA 3OBVE 3UUNA 3JC6D 1YD8G 3AE3A 3H3MA 2B1EA 4MHCA 4HFVA 4V1Av 3FZMB 2VASA 3ABVA 5HCMA 3A7MA 4AKRB 2J1DG 4DR1T 4OYJA 4JI8T 4BA9A 3E08A 1MIYA 2XTLA 3J7Yq 3AEBA 5JR9C 4GKJT 1E1HB 3M3ZB 5LGTB 3KDSE 1UCUA 2WP9A 4LF4T 3TLUA 3RIAA 4JBWF 5LGNB 2A9UA 3LFMA 2D9DA 2WB5A 3TLVA 1VRBA 4O8SA 5C3JA 4QX8B 4U2ZA 1XWMA 3C51A 4XZCA 2V6YB 3QB5K 4LF7T 2CWYA 5JDFA 5A1LA 2E9XD 3QB5A 4YSYA 3ANWB 2IC9A 3AAAB 3SRZA 4AI6A 1XDPA 2YK0A 3ZCJA 3C98B 1D1AA 2ZLYA 4DV4T 2CEAA 4JLEA 4Z91A 2PFVA 5HEHA 3PUAA 4X1KE 4UVAB 1ZKEA 3ZJ1A 5L3GB 3CX7B 1S94A 3P8CD 2HHHT 4DV5T 1QLBA 1FMVA 2M67A 2BKNA 4IL4A 2W0GA 4JI7T 2YEVC 2UXNB 3ZN1B 5L3DB 3WI3A 1E7PA 4AKLA 5ABFB 2MYSA 2JPFA 2DLRA 2YN6A 2LSYA 4EXTA 3RLFF 3CQCB 2RA1A 4CN4A 1KNPA 4HE8A 4IE6A 1FIOA 1KF6A 2QVAA 3FBZA 3M65A 4WYVA 1UX5A 3F57A 4DR6T 3VKHA 4UV8B 4HWHA 2C5JA 2W62A 3AAEB 5FYMA 4H9QC 4HTEA 1IJ6A 5KX5E 4DV7T 1D0ZA 4G2AA 1N36T 4JV5T 4EEBA 3K3QC 4JI4T 4AIUA 4QXHB 2LSIA 2CXDA 3UQ4A 3CPZA 3HR0A 4PJMA 3OTOT 1MIWA 4PJJA 5FL0A 5L4HA 3KFWX 3RC3A 5LJNA 2CWOA 4M1PA 2ZM6T 3AE9A 1OEDC 4MFRA 3AA6B 4JI6T 3ETVA 1VOMA 3AEGA 4X1IE 5C8YE 4P0AA 4GIWA 3KV6A 4I0UA 4JYAT 5JRCB 5AQGB 3ZC1A 3I0OA 2E8IA 4JEHB 3AEAA 3FBLA 4EB6E 3AE4A 5JDNA 1M7KA 4U72A 4ANJA 5DQWA 1J5WA 2D2SA 2X51A 5ABEA 2UXCT 1ZP0A 3MKDA 5FVLA 3UFEA 3KVAA 5LHHB 2EHOD 3S4UA 5LNKA 4U31A 5JVDE 2R6GF 4IL9A 4QH1A 5AQKB 4IE4A 3NRYA 5H6RB 5HXHA 2I6HA 1WR0A 1J5ET 1JNRA 3O1JA 5FXXA 2W4XA 1VCTA 3NZPA 4IDPA 3F2EA 5ADXL 3AXJB 3P4WA 5AQOB 5HEOA 2UXBT 1SA0E 2CHOA 2NOXA 1KEYA 2LEHA 1NEKA 2JIWA 4O4LE 2LRKA 4IIJE 1Z0PA 2ZM2A 3RF1A 4YSZA 3GWHA 3ZKRA 2WY2A 5AQNB 3UULA 2WBLA 4GYSA 4ZI2C 1DU2A 2HN2A 2V7JA 2JMHA 2XHEB 2QGSA 3SOLA 5HXSA 1I6ZA 3PUVF 4EAHA 3B13A 3DTOA 4AQFA 5DJQC 3UTKA 4CXYA 3N9OA 3MJXA 2A72A 3SS1A 4I43B 2CXLA 3Q5WA 2ODVA 5CGMA 5E0OA 4DBQA 5CFBA 2W63A 3L8RA 3RKOA 3C4WA 4GKKT 4QH4A 2IHR1 2WAUA 3OVUA 3PE0A 3EUHA 2RPAA 5HCJA 3GN5A 4MALA 3ONJA 4X5TA 1D1CA 1WCRA 1HX8A 3ZT7A 2V6XA 4F8HA 2DWGA 2LSJA 2LOPA 1R8IA 4EZ4A 3VR9A 4KHZF 2Q9QC 3AAIA 2FJEA 1YQ3A 2LM9A 4HFHA 4AISA 3CWZB 4HGAA 1WYBA 2F4VT 3RYCE 3LK3B 2H3RA 2LHNA 2Z6EA 3NZQA 2M6IA 3VU7H 2IW5B 5FY1A 3AE5A 4QXBB 1FEWA 2XQ5A 1H7CA 2XY8B 3UUXB 3HKCE 1OXZA 2HH7A 4O4HE 4Q25A 3RX6A 4EOZB 3Q9DA 2KLQA 1YKEB 2WSSV 2ODUA 3J9X1 5L4EA 2YDRA 4PK4A 1Y64B 3DP7A 4ILCA 3BQIA 3ONLC 3IEEA 3LG7A 4IE0A 4UR9A 2Y6XA 4JI2T 2BS4A 1IBKT 4NXNT 4TX5A 5AQVB 3TLTA 4H9NC 4K0KT 3AEDA 4N78D 1V9DA 4IE7A 1MMNA 4UF0A 1LRZA 2XAJB 4XBFB 3C4XA 2YDSA 1IBLT 1HCIA 4ZXLA 4HEAA 3ZCIA 2BBJA 3VRAA 3ZC0A 3FZHB 2VB6A 4EEDA 5LJMA 5JREA 4EZHA 4B3MT 2CXFA 3SFEA 4YT0A 5IHYA 2Q9QB 4EYUA 3D0TA 3RIUA 2LSGA 3AXJA 3U3IA 1Z8UA 1UGOA 2XAFB 4YLHA 4ISTA 2L8KA 3RYIE 3CIRA 5AQLB 5FP3A 3IHRA 3OPCA 1VCSA 3PU3A 2M6BA 4LFBT 5JDGA 2JJ9A 3LK42 2UXDT 2H7OA 3SWHA 1HG5A 2ACZA 3F31A 1HS7A 3PJAJ 3O1IA 3PUSA 5AQJB 3AEFA 1HR0T 2W00A 2FJBA 4HKAA 4UIGA 2KINB 4TWFA 1KNZA 4AKIA 2QRXA 3UQ7A 3ZMUB 2MTQA 4BAYB 4ADZA 3A5XA 3E0ZA 1OEDE 2JQQA 2KT9A 5HWYA 4CN1A 4GYRA 5JDHA 4AQYT 4YY3T 5LGUB 4DBRA 5HEUA 1XNQT 3KV9A 5JDMA 1EZ3A 3UU4A 2XQYA 2ZMAA 2EHOB 3AE2A 4IDNA 3VHLA 2X0YA 3PUGA 4CXWA 4O4IE 4PFOA 3PDYA 1W9RA 2BG9E 1KFYA 2E2AA 3ETUA 4L0RA 3RKGA 3ZMSB 4CXXA 5L3FB 2VQET 3FHNA 5JR9B 1U5PA 2V8SV 2X68A 3W15B 4JEUB 4ZOLE 4YTNA 5HAXA 3QC9A 3MA9A 3T1YT 4U7YA 2CM0A 2XQ3A 1SUMB 4AKGA 5HXEA 5L3BB 1IBMT 2FJDA 4JI3T 5DQVA 3AE1A 2KSRA 1QUUA 3G06A 4ZHQE 1WFDA 2CRBA 2KZ7B 4AKHA 5GONE 5IUXA 1HNXT 1AJ3A 1LVKA 1UUSA 2KNDA 3V5SA 2XSAA 5LB7B 4DVDA 2CE7A 3N9NA 2PBIA 3AE6A 3QOFA 4YSXA 2VVNA 2V7LA 4TV8E 1QSDA 3KINB 3Q5EA 4PW8A 2DL1A 4TNWA 5LG4A 2XASB 3H3AA 3PURA 4GK0E 4ERRA 4B3RT 1LKXA 3N5LA 3B57A 4QH5A 3P50A 3TLSA 2N9DA 1XNRT 2JQKA 3PUXF 2Y48B 2BVLA 1MIVA 3HKDE 4G63A 4UELA 2UUCT 4C91A 5FY0A 4PK5A 2IIUA 2DNXA 3EVYA 4HN9A 2BG9C 4TWDA 1L0VA 1WYCA 4ZI2D 5AQFB 2WZHA 3BQLA 4X1YE 4J2CA 4IGUA 2W2UA 3EDUA 5LCYA 1YQ4A 3EHZA 3N2KE 3CKDA 1W0BA 4HFEA 2XAHB 4KBMB 4MLKA 1CUNA 4WNKA 1XMOT 4EIWA 4EYYR 4P0BA 3OKQA 2UU9T 2UXXB 5EK3A 3UU6A 2ES0A 3RYHE 2IAKA 3VKGA 3EABA 3DJBA 5FL1A 4ZS2A 1MMGA 3QK6A 5AQHB 5FXVA 5EK4A 4ZS3A 5BR8T 2XQ8A 2H7VC 1LVFA 5JTGA 2CA5A 4BJNA 4ISSA 2YU1A 3ZJ2A 4KP3C 4NXMT 5IWAT 2K5BB 3AECA 3A8YC 4P1NA 2XQAA 4DIDB 3IA3A 4OYKA 4WBOA 4JI1T 4QHOA 2JMKA 3CMLA 3CX8B 4ILBA 4PNIA 1T72A 3C64A 2XQ9A 3K3NA 2QYWA 3ONXA 4GK5E 1S35A 3MK7C 3Q5XA 5M4YA 1CHUA 3ANWA 1D0YA 1G8XA 2UUBT 2K3WA 2I59A 4Z8XA 4ZZCA 1HTJF 2XQ6A 3OJAA 1O3XA
chains in the Genus database with same CATH topology
1MMDA 4IHJE 2C0SA 4NUUA 1MMAA 5FNVE 2CLYC 1G73A 4A56A 3ZN0B 2X66A 3N9PA 2D0TA 1BR4A 5L2LA 3ZEFB 3ZYLA 5F8PA 5JDLA 2X9XA 2NWBA 3RH3A 3ESLA 2PG8A 3OYXA 4H9PC 5JH7E 2A2FX 2V7MA 3AVRA 4QXCB 4CZZB 4E7ZA 3UUMA 2NW7A 4K0UA 5AFUL 4CI3B 3CQGB 2BZBA 4YHJA 2Y8DA 2V7IA 1KK7A 1B7TA 2XUEA 2KXPB 4BJMA 3N2OA 1ZV4X 4TUYE 2VL8A 3LK2B 2X67A 1IJ5A 1NAFA 3KV4A 3NRXA 4DO0A 4DMWA 2EHOA 1UX4A 2L3LA 5KMGP 3BQKA 4UVCB 3C50A 3MZKB 2X9WA 4PAGA 5CA1E 1BR0A 4DNDA 3I0QA 4CQIA 3AB3B 4YJ2E 4O2AE 2BVMA 3I1AA 4F6RC 2LE8A 4AQGA 4ZI7E 4FI5A 4QX7B 1WR6A 2WMNA 3AVSA 5J2UE 2DCFA 2WMOA 5KDMC 4OFZA 3C4ZA 4H63H 3CVRA 2N1GA 3NBXX 4OK0A 1ZEEA 5LYJE 4WW0A 2G0UA 2EHOC 4YFSA 3K3OA 3T8OA 4UF0B 5LA6E 5CA0E 4C90A 4NUVA 2LJLA 3ZMTB 5JR9A 2NP9A 2RP4A 3RYFE 4ASKA 3TKLB 2NTYA 5EZYE 3H37A 4XAXB 4QWNB 5L3CB 3IF8B 3BK9A 2VK9A 1SHZC 5JDQA 2YU2A 3CQXC 4AXPA 4KMCA 3GA8A 3CX6B 1ZHCA 2GK9A 1HF8A 3LBXB 2MBGA 2DI4A 5FXWA 2VKOA 3Q2MA 3WAJA 2LOSA 1U4QA 2V7KA 4TZ4C 5FMNA 3U78A 3P7IA 1D1BA 5LHIB 2N2NA 1NWMX 4I55E 2SPCA 2E9XA 3WAKA 2DHRA 5BMVE 4UVBB 3PU8A 1IZNB 3FXDB 5LBQB 2OA5A 2LSKA 3O4XE 4PJNA 3HKEE 4YJ3E 2Q9QA 4E7SA 2V1DB 4IE5A 1MNEA 2DWKA 3N2GE 2E9XC 1OWAA 4H9OC 2WM9A 2X0LB 2MOZA 4CI1B 2CLYB 3LBXA 3IBPA 4QKNA 4X20E 5FY7A 1D0XA 3R84B 4JUYA 3RPUA 4GOUA 3PUQA 2KMFA 3HI2A 2LT3A 2HPJA 2QA7A 4CI2B 2ZM8A 4O2BE 2W61A 2YINA 4MBQA 5DABA 2K9AA 2X9YA 2CMRA 4EXTA 5ETWA 4AKHA 3MACA 3N9LA 4ILUA 4UEMA 3K8PC 4U74A 1BR2A 3KBTA 5L3EB 3JC6C 2C5IT 5H6QB 2K24A 5EK2A 4I50E 2VKHA 5HYAA 4AQFC 5JQGE 5HXCA 1YW0A 3I9YA 4L9IA 4PK6A 5IYZE 2CCQA 1YKHB 3QUJA 3GN5B 4L5GA 4PFPA 3RRWA 4TN7B 3ZMZB 5LOVE 2VKDA 2ZM0A 4ZI3D 2HPLA 3RC8A 4TV9E 1WLXA 2KWIB 3FXEB 5LBMA 3AA7B 4FJOA 1T98A 3LJCA 4O4JE 3E22E 1BR1A 2C5KT 3R6NA 5LXTE 2BDEA 2P9BA 2NW9A 5FXZA 4I4TE 3I9WA 3L3PA 1US7B 3HA4A 3PTRB 4KUMB 4UV9B 2XAGB 2PJQA 2X9HA 2D0UA 3GMIA 2VKJA 3KBUA 3ZYKA 4WBNE 1FMWA 5CB4E 2E9XB 1WRDA 5TAOA 3RRCA 1HG2A 3EDVA 2IC6A 3ZLIA 3N9QA 4UXNB 2NTXA 3N9MA 3MXZA 2JRKA 2Q9QD 4ZI3C 1MNDA 2ACXA 2D5UA 4B6XA 4DMVA 2WWUA 5J2TE 3HL6A 3V5UA 5LP6E 1IAPA 2XAQB 4H63V 4H9RC 3ZPOA 1HFAA 4PJLA 2L9QA 4IDZA 5L3DB 5F3JA 2K48A 3KVBA 3L09A 2V26A 4OHFA 5HXRA 3FB2A 3ZMVB 4P09A 3AA0B 2KWHA 2LHRA 2A3DA 5LHGB 5HWXA 2NW8A 2VWAA 1X79A 3AA1B 3HKBE 3OYZA 4H9SE 3O1HA 3KV5A 3OBVE 3UUNA 3JC6D 1YD8G 4MHCA 2B1EA 4HFVA 4V1Av 4AKRB 2VASA 2J1DG 4OYJA 4BA9A 3E08A 1MIYA 2XTLA 3J7Yq 5JR9C 1E1HB 5LGTB 3KDSE 1UCUA 5LGNB 3LFMA 1VRBA 4O8SA 4QX8B 3C51A 4XZCA 2CWYA 5JDFA 5A1LA 2E9XD 3ANWB 2IC9A 3AAAB 3SRZA 4AI6A 2YK0A 3ZCJA 3C98B 1D1AA 2ZLYA 2CEAA 4JLEA 2PFVA 3PUAA 4X1KE 4UVAB 1ZKEA 3ZJ1A 5L3GB 3CX7B 1S94A 3P8CD 1FMVA 2M67A 2W0GA 2YEVC 2UXNB 3ZN1B 3WI3A 4AKLA 2MYSA 2JPFA 2DLRA 2LSYA 3CQCB 2RA1A 3UT5E 4HE8A 4IE6A 1FIOA 3FBZA 3O9XA 3M65A 1UX5A 3F57A 3VKHA 4UV8B 2C5JA 2W62A 3AAEB 5FYMA 4H9QC 4HTEA 1IJ6A 5KX5E 1D0ZA 4G2AA 3K3QC 4QXHB 2LSIA 2CXDA 3CPZA 3HR0A 4PJMA 1MIWA 4PJJA 3KFWX 3RC3A 5LJNA 2CWOA 4M1PA 4MFRA 3AA6B 3ETVA 1VOMA 4X1IE 5C8YE 4P0AA 4GIWA 3KV6A 5JRCB 3ZC1A 3I0OA 2E8IA 4JEHB 3FBLA 4EB6E 5JDNA 4U72A 4ANJA 5DQWA 2X51A 2D2SA 3MKDA 3UFEA 3KVAA 5LHHB 2EHOD 3S4UA 5LNKA 5JVDE 5HXHA 4IE4A 3NRYA 5H6RB 3O1JA 5FXXA 3NZPA 3F2EA 5ADXL 1SA0E 2NOXA 2LEHA 4O4LE 4IIJE 1Z0PA 2ZM2A 3GWHA 3UULA 2WBLA 4GYSA 4ZI2C 2V7JA 2JMHA 2XHEB 2QGSA 3SOLA 5HXSA 4EAHA 3B13A 3DTOA 4AQFA 5DJQC 3UTKA 4CXYA 3N9OA 3MJXA 2A72A 3SS1A 4I43B 2CXLA 3Q5WA 2ODVA 5E0OA 4DBQA 2W63A 3RKOA 3C4WA 2WAUA 3PE0A 3EUHA 3GN5A 4MALA 1D1CA 1HX8A 2DWGA 2LSJA 2LOPA 4EZ4A 2Q9QC 3AAIA 2LM9A 3CWZB 4HGAA 1WYBA 3RYCE 3LK3B 2H3RA 2LHNA 2Z6EA 3NZQA 3VU7H 2IW5B 5FY1A 4QXBB 1FEWA 3UUXB 1H7CA 3HKCE 1OXZA 2HH7A 4O4HE 3RX6A 4EOZB 3Q9DA 2KLQA 1YKEB 2WSSV 2ODUA 3J9X1 4PK4A 1Y64B 3DP7A 3BQIA 3IEEA 3LG7A 4IE0A 2Y6XA 4TX5A 4H9NC 4N78D 1V9DA 4IE7A 1MMNA 4UF0A 1LRZA 2XAJB 4XBFB 3C4XA 1HCIA 4HEAA 3ZCIA 3ZC0A 2VB6A 5LJMA 5JREA 4EZHA 2CXFA 5IHYA 2Q9QB 4EYUA 3D0TA 2LSGA 3U3IA 4YLHA 2XAFB 4ISTA 2L8KA 3RYIE 5FP3A 3IHRA 3PU3A 5JDGA 2JJ9A 3LK42 2H7OA 3SWHA 1HG5A 3F31A 1HS7A 3O1IA 3PUSA 2W00A 4UIGA 4HKAA 2KINB 1KNZA 4AKIA 3ZMUB 2MTQA 4BAYB 4ADZA 3A5XA 3E0ZA 2KT9A 2JQQA 5JRCA 5HWYA 4GYRA 5JDHA 5LGUB 4DBRA 3KV9A 5JDMA 1EZ3A 2XQYA 2ZMAA 2EHOB 3VHLA 4CXWA 3PUGA 4O4IE 4PFOA 3PDYA 3ETUA 4L0RA 3ZMSB 5L3FB 4CXXA 3FHNA 5JR9B 1U5PA 2X68A 3W15B 4JEUB 4ZOLE 5HAXA 3QC9A 3MA9A 2CM0A 4AKGA 5HXEA 5L3BB 5DQVA 1QUUA 4ZHQE 2KZ7B 5GONE 1AJ3A 1LVKA 2KNDA 3V5SA 4DVDA 2CE7A 3N9NA 2PBIA 2V7LA 4TV8E 1QSDA 3KINB 4PW8A 5LG4A 2XASB 3H3AA 3PURA 4GK0E 4ERRA 1LKXA 3N5LA 3B57A 2N9DA 2Y48B 2BVLA 1MIVA 3HKDE 4G63A 4UELA 4C91A 5FY0A 4PK5A 2DNXA 3EVYA 4HN9A 1WYCA 4ZI2D 4X1YE 3BQLA 4J2CA 4IGUA 3EDUA 5LCYA 5J1GA 3N2KE 3CKDA 4KBMB 2XAHB 4MLKA 4WNKA 1CUNA 4EIWA 4EYYR 4P0BA 3OKQA 2UXXB 5EK3A 2ES0A 3RYHE 2IAKA 3VKGA 3DJBA 4ZS2A 1MMGA 3QK6A 5FXVA 5EK4A 4ZS3A 2H7VC 1LVFA 2CA5A 4BJNA 4ISSA 2YU1A 3ZJ2A 4KP3C 2K5BB 4OYKA 4WBOA 4QHOA 2JMKA 3CMLA 3CX8B 4PNIA 3C64A 3K3NA 3ONXA 4GK5E 1S35A 3MK7C 3Q5XA 5M4YA 3ANWA 1D0YA 1G8XA 2I59A 4Z8XA 1HTJF 3ZYMA 3OJAA 1O3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLK A;  3Q9D A; 
#chains in the Genus database with same CATH topology
 4A5X A;  1MMD A;  2I0M A;  2C0S A;  4IHJ E;  2WZI A;  4NUU A;  2V5C A;  1MMA A;  2XSB A;  1NEN A;  5FNV E;  2CLY C;  1G73 A;  2BS2 A;  4A56 A;  3ZN0 B;  2X66 A;  3N9P A;  2D0T A;  3ZT6 A;  1I94 T;  1BR4 A;  1Y01 A;  2WQY A;  5L2L A;  5LMU T;  4B3T T;  2IDO B;  3ZEF B;  2WCA A;  3ZYL A;  5F8P A;  1HNZ T;  5JDL A;  2X9X A;  1KNR A;  2NWB A;  3ESL A;  4U2Y A;  2PG8 A;  3RH3 A;  3OYX A;  4H9P C;  5JH7 E;  3PV0 F;  2A2F X;  2V7M A;  3AVR A;  1GQE A;  4QXC B;  3X1D A;  4CZZ B;  4EGW A;  4E7Z A;  3UUM A;  2NW7 A;  4YXD A;  4K0U A;  5AFU L;  4CI3 B;  5J0Z A;  3CQG B;  4LFC T;  2BZB A;  4YHJ A;  5FVK A;  2Y8D A;  2V7I A;  2XZE A;  1KK7 A;  1B7T A;  2XUE A;  2KXP B;  4BJM A;  3N2O A;  1ZV4 X;  4TUY E;  2VL8 A;  3LK2 B;  2XJ7 A;  2H88 A;  2X67 A;  1IJ5 A;  1NAF A;  4UEM A;  2OV9 A;  3KV4 A;  3NRX A;  4DO0 A;  2EHO A;  3P4R A;  4DMW A;  2H89 A;  4TNV A;  2J47 A;  1UX4 A;  2L3L A;  3PUZ F;  2FUP A;  5KMG P;  4DR4 T;  1J1J A;  2NR4 A;  3BQK A;  4UVC B;  3C50 A;  3MZK B;  2X9W A;  4U7I A;  4PAG A;  5CA1 E;  4YTM A;  1N32 T;  4NIQ A;  1BR0 A;  2WDQ A;  4DND A;  3I0Q A;  4KX6 A;  4CQI A;  3AB3 B;  4YJ2 E;  2J4G A;  4O2A E;  4COF A;  2HN1 A;  2BVM A;  3I1A A;  4F6R C;  1T7S A;  2LE8 A;  1E2A A;  4X66 T;  2E5V A;  4AQG A;  1OED A;  4ZI7 E;  4B3S T;  2YKS A;  4FI5 A;  4QX7 B;  1WR6 A;  2WMN A;  3AVS A;  5J2U E;  2DCF A;  3ZYM A;  2XM1 A;  2WMO A;  2YOE A;  5HEJ A;  2IUB A;  4OFZ A;  3C4Z A;  5KDM C;  3UU3 A;  4X64 T;  3VRB A;  2LM2 A;  1N33 T;  4H63 H;  3CVR A;  2N1G A;  3NBX X;  4OK0 A;  1ZEE A;  5AQS B;  5LYJ E;  4WW0 A;  2G0U A;  2EHO C;  3CK6 A;  3P4P A;  1ZOY A;  3UU5 A;  4YFS A;  3K3O A;  2WDV A;  2VVS A;  3T8O A;  4UF0 B;  5LA6 E;  2XM2 A;  4TWH A;  2V5D A;  5CA0 E;  3VR8 A;  4C90 A;  4NUV A;  2X0H A;  4U3C A;  3UU8 A;  5LMN T;  2LJL A;  3ZMT B;  2WDR A;  5JR9 A;  3FZL B;  2NP9 A;  1XZY A;  2RP4 A;  3RYF E;  4ASK A;  3TKL B;  2NTY A;  5EZY E;  3H37 A;  3RI5 A;  4XAX B;  4QWN B;  4HFC A;  3ZST A;  5L3C B;  3IF8 B;  4KHP T;  3BK9 A;  2VK9 A;  5ABF A;  1SHZ C;  5JDQ A;  2YU2 A;  3CQX C;  4AXP A;  2IML A;  5HEG A;  3UUB A;  3JAE A;  4KMC A;  3CX6 B;  1ZHC A;  2GK9 A;  1HF8 A;  3GA8 A;  3LBX B;  5AQQ B;  2MBG A;  2DI4 A;  4EV6 A;  5ABH A;  5FXW A;  2VKO A;  2CBJ A;  3Q2M A;  4HWC A;  2LOS A;  3WAJ A;  1U4Q A;  2V7K A;  3JCF A;  4TZ4 C;  5FMN A;  4LMK A;  3U78 A;  2JQ9 A;  5L47 A;  4HFI A;  3P7I A;  1D1B A;  3LDQ B;  3PUW F;  5LHI B;  2VQF T;  2N2N A;  5LG3 A;  2V6Y A;  1NWM X;  4I55 E;  2SPC A;  1SE7 A;  2E9X A;  2OLT A;  3WAK A;  4ZZB A;  1XMQ T;  5C2T A;  2DHR A;  5BMV E;  4UVB B;  2WU5 A;  3PU8 A;  4DV6 T;  4DV3 T;  1UK5 A;  1IZN B;  3FXD B;  5AQT B;  5LBQ B;  2OA5 A;  3RIF A;  2LSK A;  3O4X E;  2WWV A;  4DV2 T;  2B76 A;  3HKE E;  4PJN A;  4YJ3 E;  5CJ5 A;  2Q9Q A;  2BBH A;  4E7S A;  3P4S A;  2V1D B;  4IE5 A;  1MNE A;  2DWK A;  3N2G E;  2E9X C;  1OWA A;  4H9O C;  2WM9 A;  3UT5 E;  2YDQ A;  2X0L B;  3EI0 A;  2E5L T;  3O9X A;  2MOZ A;  5FKY A;  2W67 A;  4CI1 B;  2CLY B;  5AQR B;  2LLY A;  3K1S A;  3QNU A;  5ETW A;  4YTP A;  3LBX A;  3IBP A;  4QKN A;  4X20 E;  5FY7 A;  1D0X A;  3R84 B;  4JUY A;  4U33 A;  3RPU A;  4A97 A;  4GOU A;  3PUQ A;  4HFD A;  2KMF A;  3HI2 A;  2LT3 A;  4DUY T;  2HPJ A;  4ZEY A;  4NPP A;  2QA7 A;  3T1H T;  2VL0 A;  4CI2 B;  1N34 T;  2ZM8 A;  4O2B E;  2W61 A;  2YIN A;  4LMJ A;  4MBQ A;  2K9A A;  2X9Y A;  2CMR A;  4WZX A;  5DAB A;  2PTF A;  1YXR A;  3MAC A;  5AQU B;  3AE8 A;  3N9L A;  2BG9 A;  1XDO A;  2LKG A;  3LSV A;  3SFD A;  5KXJ A;  4ILU A;  2BKO A;  2BS3 A;  2WS3 A;  3K8P C;  4IDO A;  4U74 A;  1BR2 A;  1UUR A;  2XQ4 A;  3KBT A;  3JC6 C;  2C5I T;  3PJA A;  2K24 A;  5H6Q B;  4I50 E;  5EK2 A;  5L3E B;  1T8B A;  2VKH A;  4LF9 T;  5HYA A;  4OX9 T;  5JRC A;  5AQI B;  4AQF C;  4LFA T;  5JQG E;  5HXC A;  1YW0 A;  3I9Y A;  4L9I A;  4PK6 A;  5IYZ E;  5J1G A;  2JQH A;  2CCQ A;  4DV0 T;  1YKH B;  5F5W A;  2J62 A;  3P4Q A;  3QUJ A;  1HX1 B;  1HNW T;  3GN5 B;  4L5G A;  2LKH A;  4PFP A;  3FZK B;  3RRW A;  3JAD A;  2W66 A;  4ILA A;  2FJA A;  4TN7 B;  3FZF B;  2FBW A;  3ZMZ B;  3PUY F;  5LOV E;  2VKD A;  2ZM0 A;  3NVO A;  2HPL A;  4ZI3 D;  1M62 A;  3RC8 A;  4TV9 E;  1WLX A;  2KWI B;  3FXE B;  5LBM A;  3ZT5 A;  4X62 T;  3RIU C;  2CBI A;  3AA7 B;  4FJO A;  1T98 A;  3LJC A;  4LML A;  4O4J E;  4IRE A;  3Q5D A;  3E22 E;  1BR1 A;  1W0A A;  2C5K T;  3R6N A;  5LXT E;  5AQM B;  2BDE A;  2P9B A;  2XQ7 A;  3JAF A;  3NWI A;  4I4T E;  3I9W A;  5FXZ A;  2NW9 A;  3L3P A;  1US7 B;  3HA4 A;  2MAW A;  3PTR B;  4KUM B;  4DR7 T;  5ABG A;  4X65 T;  4IT4 A;  4UV9 B;  2XAG B;  2PJQ A;  2CHN A;  2X9H A;  2D0U A;  2WU2 A;  2VKJ A;  2AXD S;  2MPK A;  3GMI A;  3B5M A;  3KBU A;  2BKP A;  4HFB A;  3ZYK A;  2XPK A;  4WBN E;  4DUZ T;  1FMW A;  5CB4 E;  4HWD A;  2UUA T;  2CPT A;  2E9X B;  1WRD A;  5TAO A;  2LRL A;  3RRC A;  3RQU A;  1HG2 A;  3EDV A;  2IC6 A;  4IDQ A;  3ZLI A;  3N9Q A;  4UXN B;  4DR5 T;  2NTX A;  3N9M A;  3RQW A;  2VUR A;  5AQP B;  3MXZ A;  1OED B;  3RHW A;  4LF6 T;  2JRK A;  2Q9Q D;  3AE7 A;  4ZI3 C;  1MND A;  4YHH T;  2ACX A;  2D5U A;  3NKZ A;  4LF5 T;  4B6X A;  4DMV A;  2WWU A;  4HWI B;  5J2T E;  1FJG T;  3HL6 A;  3V5U A;  3EAM A;  4DR2 T;  3UFG A;  4CN6 A;  5LP6 E;  1IAP A;  2XAQ B;  4Z90 A;  2BG9 B;  4H63 V;  4H9R C;  3ZPO A;  1HFA A;  4PJL A;  2L9Q A;  4IDZ A;  1W09 A;  4A98 A;  5F3J A;  2K48 A;  2AE9 A;  3KVB A;  2V26 A;  3L09 A;  4OHF A;  5HXR A;  3TLW A;  3FB2 A;  3ZMV B;  4JI5 T;  4HWF A;  4P09 A;  4DV1 T;  3AA0 B;  4DR3 T;  2KWH A;  2LHR A;  2A3D A;  4LF8 T;  5LHG B;  5HWX A;  2NW8 A;  3L39 A;  1X9B A;  4JI0 T;  2VWA A;  1X79 A;  3AA1 B;  3ZSS A;  3HKB E;  3OYZ A;  4H9S E;  1JNZ A;  3O1H A;  4KI0 F;  3RGL A;  3KV5 A;  3AEE A;  3OBV E;  3UUN A;  3JC6 D;  1YD8 G;  3AE3 A;  3H3M A;  2B1E A;  4MHC A;  4HFV A;  4V1A v;  3FZM B;  2VAS A;  3ABV A;  5HCM A;  3A7M A;  4AKR B;  2J1D G;  4DR1 T;  4OYJ A;  4JI8 T;  4BA9 A;  3E08 A;  1MIY A;  2XTL A;  3J7Y q;  3AEB A;  5JR9 C;  4GKJ T;  1E1H B;  3M3Z B;  5LGT B;  3KDS E;  1UCU A;  2WP9 A;  4LF4 T;  3TLU A;  3RIA A;  4JBW F;  5LGN B;  2A9U A;  3LFM A;  2D9D A;  2WB5 A;  3TLV A;  1VRB A;  4O8S A;  5C3J A;  4QX8 B;  4U2Z A;  1XWM A;  3C51 A;  4XZC A;  2V6Y B;  3QB5 K;  4LF7 T;  2CWY A;  5JDF A;  5A1L A;  2E9X D;  3QB5 A;  4YSY A;  3ANW B;  2IC9 A;  3AAA B;  3SRZ A;  4AI6 A;  1XDP A;  2YK0 A;  3ZCJ A;  3C98 B;  1D1A A;  2ZLY A;  4DV4 T;  2CEA A;  4JLE A;  4Z91 A;  2PFV A;  5HEH A;  3PUA A;  4X1K E;  4UVA B;  1ZKE A;  3ZJ1 A;  5L3G B;  3CX7 B;  1S94 A;  3P8C D;  2HHH T;  4DV5 T;  1QLB A;  1FMV A;  2M67 A;  2BKN A;  4IL4 A;  2W0G A;  4JI7 T;  2YEV C;  2UXN B;  3ZN1 B;  5L3D B;  3WI3 A;  1E7P A;  4AKL A;  5ABF B;  2MYS A;  2JPF A;  2DLR A;  2YN6 A;  2LSY A;  4EXT A;  3RLF F;  3CQC B;  2RA1 A;  4CN4 A;  1KNP A;  4HE8 A;  4IE6 A;  1FIO A;  1KF6 A;  2QVA A;  3FBZ A;  3M65 A;  4WYV A;  1UX5 A;  3F57 A;  4DR6 T;  3VKH A;  4UV8 B;  4HWH A;  2C5J A;  2W62 A;  3AAE B;  5FYM A;  4H9Q C;  4HTE A;  1IJ6 A;  5KX5 E;  4DV7 T;  1D0Z A;  4G2A A;  1N36 T;  4JV5 T;  4EEB A;  3K3Q C;  4JI4 T;  4AIU A;  4QXH B;  2LSI A;  2CXD A;  3UQ4 A;  3CPZ A;  3HR0 A;  4PJM A;  3OTO T;  1MIW A;  4PJJ A;  5FL0 A;  5L4H A;  3KFW X;  3RC3 A;  5LJN A;  2CWO A;  4M1P A;  2ZM6 T;  3AE9 A;  1OED C;  4MFR A;  3AA6 B;  4JI6 T;  3ETV A;  1VOM A;  3AEG A;  4X1I E;  5C8Y E;  4P0A A;  4GIW A;  3KV6 A;  4I0U A;  4JYA T;  5JRC B;  5AQG B;  3ZC1 A;  3I0O A;  2E8I A;  4JEH B;  3AEA A;  3FBL A;  4EB6 E;  3AE4 A;  5JDN A;  1M7K A;  4U72 A;  4ANJ A;  5DQW A;  1J5W A;  2D2S A;  2X51 A;  5ABE A;  2UXC T;  1ZP0 A;  3MKD A;  5FVL A;  3UFE A;  3KVA A;  5LHH B;  2EHO D;  3S4U A;  5LNK A;  4U31 A;  5JVD E;  2R6G F;  4IL9 A;  4QH1 A;  5AQK B;  4IE4 A;  3NRY A;  5H6R B;  5HXH A;  2I6H A;  1WR0 A;  1J5E T;  1JNR A;  3O1J A;  5FXX A;  2W4X A;  1VCT A;  3NZP A;  4IDP A;  3F2E A;  5ADX L;  3AXJ B;  3P4W A;  5AQO B;  5HEO A;  2UXB T;  1SA0 E;  2CHO A;  2NOX A;  1KEY A;  2LEH A;  1NEK A;  2JIW A;  4O4L E;  2LRK A;  4IIJ E;  1Z0P A;  2ZM2 A;  3RF1 A;  4YSZ A;  3GWH A;  3ZKR A;  2WY2 A;  5AQN B;  3UUL A;  2WBL A;  4GYS A;  4ZI2 C;  1DU2 A;  2HN2 A;  2V7J A;  2JMH A;  2XHE B;  2QGS A;  3SOL A;  5HXS A;  1I6Z A;  3PUV F;  4EAH A;  3B13 A;  3DTO A;  4AQF A;  5DJQ C;  3UTK A;  4CXY A;  3N9O A;  3MJX A;  2A72 A;  3SS1 A;  4I43 B;  2CXL A;  3Q5W A;  2ODV A;  5CGM A;  5E0O A;  4DBQ A;  5CFB A;  2W63 A;  3L8R A;  3RKO A;  3C4W A;  4GKK T;  4QH4 A;  2IHR 1;  2WAU A;  3OVU A;  3PE0 A;  3EUH A;  2RPA A;  5HCJ A;  3GN5 A;  4MAL A;  3ONJ A;  4X5T A;  1D1C A;  1WCR A;  1HX8 A;  3ZT7 A;  2V6X A;  4F8H A;  2DWG A;  2LSJ A;  2LOP A;  1R8I A;  4EZ4 A;  3VR9 A;  4KHZ F;  2Q9Q C;  3AAI A;  2FJE A;  1YQ3 A;  2LM9 A;  4HFH A;  4AIS A;  3CWZ B;  4HGA A;  1WYB A;  2F4V T;  3RYC E;  3LK3 B;  2H3R A;  2LHN A;  2Z6E A;  3NZQ A;  2M6I A;  3VU7 H;  2IW5 B;  5FY1 A;  3AE5 A;  4QXB B;  1FEW A;  2XQ5 A;  1H7C A;  2XY8 B;  3UUX B;  3HKC E;  1OXZ A;  2HH7 A;  4O4H E;  4Q25 A;  3RX6 A;  4EOZ B;  3Q9D A;  2KLQ A;  1YKE B;  2WSS V;  2ODU A;  3J9X 1;  5L4E A;  2YDR A;  4PK4 A;  1Y64 B;  3DP7 A;  4ILC A;  3BQI A;  3ONL C;  3IEE A;  3LG7 A;  4IE0 A;  4UR9 A;  2Y6X A;  4JI2 T;  2BS4 A;  1IBK T;  4NXN T;  4TX5 A;  5AQV B;  3TLT A;  4H9N C;  4K0K T;  3AED A;  4N78 D;  1V9D A;  4IE7 A;  1MMN A;  4UF0 A;  1LRZ A;  2XAJ B;  4XBF B;  3C4X A;  2YDS A;  1IBL T;  1HCI A;  4ZXL A;  4HEA A;  3ZCI A;  2BBJ A;  3VRA A;  3ZC0 A;  3FZH B;  2VB6 A;  4EED A;  5LJM A;  5JRE A;  4EZH A;  4B3M T;  2CXF A;  3SFE A;  4YT0 A;  5IHY A;  2Q9Q B;  4EYU A;  3D0T A;  3RIU A;  2LSG A;  3AXJ A;  3U3I A;  1Z8U A;  1UGO A;  2XAF B;  4YLH A;  4IST A;  2L8K A;  3RYI E;  3CIR A;  5AQL B;  5FP3 A;  3IHR A;  3OPC A;  1VCS A;  3PU3 A;  2M6B A;  4LFB T;  5JDG A;  2JJ9 A;  3LK4 2;  2UXD T;  2H7O A;  3SWH A;  1HG5 A;  2ACZ A;  3F31 A;  1HS7 A;  3PJA J;  3O1I A;  3PUS A;  5AQJ B;  3AEF A;  1HR0 T;  2W00 A;  2FJB A;  4HKA A;  4UIG A;  2KIN B;  4TWF A;  1KNZ A;  4AKI A;  2QRX A;  3UQ7 A;  3ZMU B;  2MTQ A;  4BAY B;  4ADZ A;  3A5X A;  3E0Z A;  1OED E;  2JQQ A;  2KT9 A;  5HWY A;  4CN1 A;  4GYR A;  5JDH A;  4AQY T;  4YY3 T;  5LGU B;  4DBR A;  5HEU A;  1XNQ T;  3KV9 A;  5JDM A;  1EZ3 A;  3UU4 A;  2XQY A;  2ZMA A;  2EHO B;  3AE2 A;  4IDN A;  3VHL A;  2X0Y A;  3PUG A;  4CXW A;  4O4I E;  4PFO A;  3PDY A;  1W9R A;  2BG9 E;  1KFY A;  2E2A A;  3ETU A;  4L0R A;  3RKG A;  3ZMS B;  4CXX A;  5L3F B;  2VQE T;  3FHN A;  5JR9 B;  1U5P A;  2V8S V;  2X68 A;  3W15 B;  4JEU B;  4ZOL E;  4YTN A;  5HAX A;  3QC9 A;  3MA9 A;  3T1Y T;  4U7Y A;  2CM0 A;  2XQ3 A;  1SUM B;  4AKG A;  5HXE A;  5L3B B;  1IBM T;  2FJD A;  4JI3 T;  5DQV A;  3AE1 A;  2KSR A;  1QUU A;  3G06 A;  4ZHQ E;  1WFD A;  2CRB A;  2KZ7 B;  4AKH A;  5GON E;  5IUX A;  1HNX T;  1AJ3 A;  1LVK A;  1UUS A;  2KND A;  3V5S A;  2XSA A;  5LB7 B;  4DVD A;  2CE7 A;  3N9N A;  2PBI A;  3AE6 A;  3QOF A;  4YSX A;  2VVN A;  2V7L A;  4TV8 E;  1QSD A;  3KIN B;  3Q5E A;  4PW8 A;  2DL1 A;  4TNW A;  5LG4 A;  2XAS B;  3H3A A;  3PUR A;  4GK0 E;  4ERR A;  4B3R T;  1LKX A;  3N5L A;  3B57 A;  4QH5 A;  3P50 A;  3TLS A;  2N9D A;  1XNR T;  2JQK A;  3PUX F;  2Y48 B;  2BVL A;  1MIV A;  3HKD E;  4G63 A;  4UEL A;  2UUC T;  4C91 A;  5FY0 A;  4PK5 A;  2IIU A;  2DNX A;  3EVY A;  4HN9 A;  2BG9 C;  4TWD A;  1L0V A;  1WYC A;  4ZI2 D;  5AQF B;  2WZH A;  3BQL A;  4X1Y E;  4J2C A;  4IGU A;  2W2U A;  3EDU A;  5LCY A;  1YQ4 A;  3EHZ A;  3N2K E;  3CKD A;  1W0B A;  4HFE A;  2XAH B;  4KBM B;  4MLK A;  1CUN A;  4WNK A;  1XMO T;  4EIW A;  4EYY R;  4P0B A;  3OKQ A;  2UU9 T;  2UXX B;  5EK3 A;  3UU6 A;  2ES0 A;  3RYH E;  2IAK A;  3VKG A;  3EAB A;  3DJB A;  5FL1 A;  4ZS2 A;  1MMG A;  3QK6 A;  5AQH B;  5FXV A;  5EK4 A;  4ZS3 A;  5BR8 T;  2XQ8 A;  2H7V C;  1LVF A;  5JTG A;  2CA5 A;  4BJN A;  4ISS A;  2YU1 A;  3ZJ2 A;  4KP3 C;  4NXM T;  5IWA T;  2K5B B;  3AEC A;  3A8Y C;  4P1N A;  2XQA A;  4DID B;  3IA3 A;  4OYK A;  4WBO A;  4JI1 T;  4QHO A;  2JMK A;  3CML A;  3CX8 B;  4ILB A;  4PNI A;  1T72 A;  3C64 A;  2XQ9 A;  3K3N A;  2QYW A;  3ONX A;  4GK5 E;  1S35 A;  3MK7 C;  3Q5X A;  5M4Y A;  1CHU A;  3ANW A;  1D0Y A;  1G8X A;  2UUB T;  2K3W A;  2I59 A;  4Z8X A;  4ZZC A;  1HTJ F;  2XQ6 A;  3OJA A;  1O3X A; 
#chains in the Genus database with same CATH homology
 1MMD A;  4IHJ E;  2C0S A;  4NUU A;  1MMA A;  5FNV E;  2CLY C;  1G73 A;  4A56 A;  3ZN0 B;  2X66 A;  3N9P A;  2D0T A;  1BR4 A;  5L2L A;  3ZEF B;  3ZYL A;  5F8P A;  5JDL A;  2X9X A;  2NWB A;  3RH3 A;  3ESL A;  2PG8 A;  3OYX A;  4H9P C;  5JH7 E;  2A2F X;  2V7M A;  3AVR A;  4QXC B;  4CZZ B;  4E7Z A;  3UUM A;  2NW7 A;  4K0U A;  5AFU L;  4CI3 B;  3CQG B;  2BZB A;  4YHJ A;  2Y8D A;  2V7I A;  1KK7 A;  1B7T A;  2XUE A;  2KXP B;  4BJM A;  3N2O A;  1ZV4 X;  4TUY E;  2VL8 A;  3LK2 B;  2X67 A;  1IJ5 A;  1NAF A;  3KV4 A;  3NRX A;  4DO0 A;  4DMW A;  2EHO A;  1UX4 A;  2L3L A;  5KMG P;  3BQK A;  4UVC B;  3C50 A;  3MZK B;  2X9W A;  4PAG A;  5CA1 E;  1BR0 A;  4DND A;  3I0Q A;  4CQI A;  3AB3 B;  4YJ2 E;  4O2A E;  2BVM A;  3I1A A;  4F6R C;  2LE8 A;  4AQG A;  4ZI7 E;  4FI5 A;  4QX7 B;  1WR6 A;  2WMN A;  3AVS A;  5J2U E;  2DCF A;  2WMO A;  5KDM C;  4OFZ A;  3C4Z A;  4H63 H;  3CVR A;  2N1G A;  3NBX X;  4OK0 A;  1ZEE A;  5LYJ E;  4WW0 A;  2G0U A;  2EHO C;  4YFS A;  3K3O A;  3T8O A;  4UF0 B;  5LA6 E;  5CA0 E;  4C90 A;  4NUV A;  2LJL A;  3ZMT B;  5JR9 A;  2NP9 A;  2RP4 A;  3RYF E;  4ASK A;  3TKL B;  2NTY A;  5EZY E;  3H37 A;  4XAX B;  4QWN B;  5L3C B;  3IF8 B;  3BK9 A;  2VK9 A;  1SHZ C;  5JDQ A;  2YU2 A;  3CQX C;  4AXP A;  4KMC A;  3GA8 A;  3CX6 B;  1ZHC A;  2GK9 A;  1HF8 A;  3LBX B;  2MBG A;  2DI4 A;  5FXW A;  2VKO A;  3Q2M A;  3WAJ A;  2LOS A;  1U4Q A;  2V7K A;  4TZ4 C;  5FMN A;  3U78 A;  3P7I A;  1D1B A;  5LHI B;  2N2N A;  1NWM X;  4I55 E;  2SPC A;  2E9X A;  3WAK A;  2DHR A;  5BMV E;  4UVB B;  3PU8 A;  1IZN B;  3FXD B;  5LBQ B;  2OA5 A;  2LSK A;  3O4X E;  4PJN A;  3HKE E;  4YJ3 E;  2Q9Q A;  4E7S A;  2V1D B;  4IE5 A;  1MNE A;  2DWK A;  3N2G E;  2E9X C;  1OWA A;  4H9O C;  2WM9 A;  2X0L B;  2MOZ A;  4CI1 B;  2CLY B;  3LBX A;  3IBP A;  4QKN A;  4X20 E;  5FY7 A;  1D0X A;  3R84 B;  4JUY A;  3RPU A;  4GOU A;  3PUQ A;  2KMF A;  3HI2 A;  2LT3 A;  2HPJ A;  2QA7 A;  4CI2 B;  2ZM8 A;  4O2B E;  2W61 A;  2YIN A;  4MBQ A;  5DAB A;  2K9A A;  2X9Y A;  2CMR A;  4EXT A;  5ETW A;  4AKH A;  3MAC A;  3N9L A;  4ILU A;  4UEM A;  3K8P C;  4U74 A;  1BR2 A;  3KBT A;  5L3E B;  3JC6 C;  2C5I T;  5H6Q B;  2K24 A;  5EK2 A;  4I50 E;  2VKH A;  5HYA A;  4AQF C;  5JQG E;  5HXC A;  1YW0 A;  3I9Y A;  4L9I A;  4PK6 A;  5IYZ E;  2CCQ A;  1YKH B;  3QUJ A;  3GN5 B;  4L5G A;  4PFP A;  3RRW A;  4TN7 B;  3ZMZ B;  5LOV E;  2VKD A;  2ZM0 A;  4ZI3 D;  2HPL A;  3RC8 A;  4TV9 E;  1WLX A;  2KWI B;  3FXE B;  5LBM A;  3AA7 B;  4FJO A;  1T98 A;  3LJC A;  4O4J E;  3E22 E;  1BR1 A;  2C5K T;  3R6N A;  5LXT E;  2BDE A;  2P9B A;  2NW9 A;  5FXZ A;  4I4T E;  3I9W A;  3L3P A;  1US7 B;  3HA4 A;  3PTR B;  4KUM B;  4UV9 B;  2XAG B;  2PJQ A;  2X9H A;  2D0U A;  3GMI A;  2VKJ A;  3KBU A;  3ZYK A;  4WBN E;  1FMW A;  5CB4 E;  2E9X B;  1WRD A;  5TAO A;  3RRC A;  1HG2 A;  3EDV A;  2IC6 A;  3ZLI A;  3N9Q A;  4UXN B;  2NTX A;  3N9M A;  3MXZ A;  2JRK A;  2Q9Q D;  4ZI3 C;  1MND A;  2ACX A;  2D5U A;  4B6X A;  4DMV A;  2WWU A;  5J2T E;  3HL6 A;  3V5U A;  5LP6 E;  1IAP A;  2XAQ B;  4H63 V;  4H9R C;  3ZPO A;  1HFA A;  4PJL A;  2L9Q A;  4IDZ A;  5L3D B;  5F3J A;  2K48 A;  3KVB A;  3L09 A;  2V26 A;  4OHF A;  5HXR A;  3FB2 A;  3ZMV B;  4P09 A;  3AA0 B;  2KWH A;  2LHR A;  2A3D A;  5LHG B;  5HWX A;  2NW8 A;  2VWA A;  1X79 A;  3AA1 B;  3HKB E;  3OYZ A;  4H9S E;  3O1H A;  3KV5 A;  3OBV E;  3UUN A;  3JC6 D;  1YD8 G;  4MHC A;  2B1E A;  4HFV A;  4V1A v;  4AKR B;  2VAS A;  2J1D G;  4OYJ A;  4BA9 A;  3E08 A;  1MIY A;  2XTL A;  3J7Y q;  5JR9 C;  1E1H B;  5LGT B;  3KDS E;  1UCU A;  5LGN B;  3LFM A;  1VRB A;  4O8S A;  4QX8 B;  3C51 A;  4XZC A;  2CWY A;  5JDF A;  5A1L A;  2E9X D;  3ANW B;  2IC9 A;  3AAA B;  3SRZ A;  4AI6 A;  2YK0 A;  3ZCJ A;  3C98 B;  1D1A A;  2ZLY A;  2CEA A;  4JLE A;  2PFV A;  3PUA A;  4X1K E;  4UVA B;  1ZKE A;  3ZJ1 A;  5L3G B;  3CX7 B;  1S94 A;  3P8C D;  1FMV A;  2M67 A;  2W0G A;  2YEV C;  2UXN B;  3ZN1 B;  3WI3 A;  4AKL A;  2MYS A;  2JPF A;  2DLR A;  2LSY A;  3CQC B;  2RA1 A;  3UT5 E;  4HE8 A;  4IE6 A;  1FIO A;  3FBZ A;  3O9X A;  3M65 A;  1UX5 A;  3F57 A;  3VKH A;  4UV8 B;  2C5J A;  2W62 A;  3AAE B;  5FYM A;  4H9Q C;  4HTE A;  1IJ6 A;  5KX5 E;  1D0Z A;  4G2A A;  3K3Q C;  4QXH B;  2LSI A;  2CXD A;  3CPZ A;  3HR0 A;  4PJM A;  1MIW A;  4PJJ A;  3KFW X;  3RC3 A;  5LJN A;  2CWO A;  4M1P A;  4MFR A;  3AA6 B;  3ETV A;  1VOM A;  4X1I E;  5C8Y E;  4P0A A;  4GIW A;  3KV6 A;  5JRC B;  3ZC1 A;  3I0O A;  2E8I A;  4JEH B;  3FBL A;  4EB6 E;  5JDN A;  4U72 A;  4ANJ A;  5DQW A;  2X51 A;  2D2S A;  3MKD A;  3UFE A;  3KVA A;  5LHH B;  2EHO D;  3S4U A;  5LNK A;  5JVD E;  5HXH A;  4IE4 A;  3NRY A;  5H6R B;  3O1J A;  5FXX A;  3NZP A;  3F2E A;  5ADX L;  1SA0 E;  2NOX A;  2LEH A;  4O4L E;  4IIJ E;  1Z0P A;  2ZM2 A;  3GWH A;  3UUL A;  2WBL A;  4GYS A;  4ZI2 C;  2V7J A;  2JMH A;  2XHE B;  2QGS A;  3SOL A;  5HXS A;  4EAH A;  3B13 A;  3DTO A;  4AQF A;  5DJQ C;  3UTK A;  4CXY A;  3N9O A;  3MJX A;  2A72 A;  3SS1 A;  4I43 B;  2CXL A;  3Q5W A;  2ODV A;  5E0O A;  4DBQ A;  2W63 A;  3RKO A;  3C4W A;  2WAU A;  3PE0 A;  3EUH A;  3GN5 A;  4MAL A;  1D1C A;  1HX8 A;  2DWG A;  2LSJ A;  2LOP A;  4EZ4 A;  2Q9Q C;  3AAI A;  2LM9 A;  3CWZ B;  4HGA A;  1WYB A;  3RYC E;  3LK3 B;  2H3R A;  2LHN A;  2Z6E A;  3NZQ A;  3VU7 H;  2IW5 B;  5FY1 A;  4QXB B;  1FEW A;  3UUX B;  1H7C A;  3HKC E;  1OXZ A;  2HH7 A;  4O4H E;  3RX6 A;  4EOZ B;  3Q9D A;  2KLQ A;  1YKE B;  2WSS V;  2ODU A;  3J9X 1;  4PK4 A;  1Y64 B;  3DP7 A;  3BQI A;  3IEE A;  3LG7 A;  4IE0 A;  2Y6X A;  4TX5 A;  4H9N C;  4N78 D;  1V9D A;  4IE7 A;  1MMN A;  4UF0 A;  1LRZ A;  2XAJ B;  4XBF B;  3C4X A;  1HCI A;  4HEA A;  3ZCI A;  3ZC0 A;  2VB6 A;  5LJM A;  5JRE A;  4EZH A;  2CXF A;  5IHY A;  2Q9Q B;  4EYU A;  3D0T A;  2LSG A;  3U3I A;  4YLH A;  2XAF B;  4IST A;  2L8K A;  3RYI E;  5FP3 A;  3IHR A;  3PU3 A;  5JDG A;  2JJ9 A;  3LK4 2;  2H7O A;  3SWH A;  1HG5 A;  3F31 A;  1HS7 A;  3O1I A;  3PUS A;  2W00 A;  4UIG A;  4HKA A;  2KIN B;  1KNZ A;  4AKI A;  3ZMU B;  2MTQ A;  4BAY B;  4ADZ A;  3A5X A;  3E0Z A;  2KT9 A;  2JQQ A;  5JRC A;  5HWY A;  4GYR A;  5JDH A;  5LGU B;  4DBR A;  3KV9 A;  5JDM A;  1EZ3 A;  2XQY A;  2ZMA A;  2EHO B;  3VHL A;  4CXW A;  3PUG A;  4O4I E;  4PFO A;  3PDY A;  3ETU A;  4L0R A;  3ZMS B;  5L3F B;  4CXX A;  3FHN A;  5JR9 B;  1U5P A;  2X68 A;  3W15 B;  4JEU B;  4ZOL E;  5HAX A;  3QC9 A;  3MA9 A;  2CM0 A;  4AKG A;  5HXE A;  5L3B B;  5DQV A;  1QUU A;  4ZHQ E;  2KZ7 B;  5GON E;  1AJ3 A;  1LVK A;  2KND A;  3V5S A;  4DVD A;  2CE7 A;  3N9N A;  2PBI A;  2V7L A;  4TV8 E;  1QSD A;  3KIN B;  4PW8 A;  5LG4 A;  2XAS B;  3H3A A;  3PUR A;  4GK0 E;  4ERR A;  1LKX A;  3N5L A;  3B57 A;  2N9D A;  2Y48 B;  2BVL A;  1MIV A;  3HKD E;  4G63 A;  4UEL A;  4C91 A;  5FY0 A;  4PK5 A;  2DNX A;  3EVY A;  4HN9 A;  1WYC A;  4ZI2 D;  4X1Y E;  3BQL A;  4J2C A;  4IGU A;  3EDU A;  5LCY A;  5J1G A;  3N2K E;  3CKD A;  4KBM B;  2XAH B;  4MLK A;  4WNK A;  1CUN A;  4EIW A;  4EYY R;  4P0B A;  3OKQ A;  2UXX B;  5EK3 A;  2ES0 A;  3RYH E;  2IAK A;  3VKG A;  3DJB A;  4ZS2 A;  1MMG A;  3QK6 A;  5FXV A;  5EK4 A;  4ZS3 A;  2H7V C;  1LVF A;  2CA5 A;  4BJN A;  4ISS A;  2YU1 A;  3ZJ2 A;  4KP3 C;  2K5B B;  4OYK A;  4WBO A;  4QHO A;  2JMK A;  3CML A;  3CX8 B;  4PNI A;  3C64 A;  3K3N A;  3ONX A;  4GK5 E;  1S35 A;  3MK7 C;  3Q5X A;  5M4Y A;  3ANW A;  1D0Y A;  1G8X A;  2I59 A;  4Z8X A;  1HTJ F;  3ZYM A;  3OJA A;  1O3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...