3K1SA

Crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
SNAMMTTAEQIPFQLILNSGNARSFAMEALQFAKQGKMAEADEAMVKAKEAINEAHHFQTELIQSEARGEKTEISVLLIHAQDHLMNAITVKELAAEFIDLYKKLEAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS system, cellobiose-specific IIA component
publication title Crystal Structure of the PTS Cellobiose Specific Enzyme IIA from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 40
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 3k1sA00
5FVKA 2V6YA 2CRBA 2V6XA 3ZT6A 2XZEA 4U31A 3ZSSA 1YXRA 2DL1A 4A5XA 3ZSTA 4ZEYA 2LRKA 2V6YB 4U3CA 2LRLA 5CGMA 2K3WA 2WY2A 4NIQA 4WZXA 4IT4A 2A9UA 2JQHA 2RPAA 5FVLA 2JQ9A 2CPTA 1WFDA 5LB7B 3K1SA 4U33A 2WWVA 3EABA 4CN1A 2JQKA 4U2ZA 3ZT5A 4U2YA 1WCRA 4P1NA 3ZT7A 4CN4A 2MPKA 5CJ5A 4U7YA 4U7IA 2W2UA 4CN6A 1WR0A
chains in the Genus database with same CATH superfamily
2WP9A 3B13A 4UVCB 2W66A 3Q5DA 1ZOYA 4I55E 3N9PA 2VK9A 4HTEA 1ZKEA 3N5LA 4HFEA 3E22E 2UU9T 4DV5T 5LHHB 5FY0A 3JC6C 3RYHE 3UU3A 2BKNA 1N34T 5ABFA 3H3MA 2N2NA 3DJBA 1BR0A 3ONLC 2V7IA 4DR4T 3CQCB 2YDSA 3RRCA 4LF7T 4AKGA 5FVKA 2XHEB 3PU8A 1W0BA 3KV9A 2XZEA 4UVAB 2CLYC 1VRBA 5FXXA 5J0ZA 4QH4A 2VB6A 1WYCA 2V5CA 3ZMUB 5LP6E 4ASKA 2DHRA 5AQTB 3UFGA 4JI7T 4TX5A 2V6XA 4FJOA 4OYKA 3ZT6A 3FBLA 3ZN0B 4EEDA 4KHZF 3JCFA 2CBJA 4EZHA 1NEKA 2W61A 4ZS2A 2V1DB 4X1YE 4PFOA 2JIWA 4IGUA 4MHCA 5E0OA 3LK42 4PJMA 4WYVA 4HFVA 3FZFB 4YT0A 1Z0PA 5FP3A 4IDQA 4BA9A 3PUYF 4AQFC 4PW8A 4O2BE 1W0AA 2XUEA 3RX6A 3NZQA 4IE6A 2CHOA 3UUMA 1MMGA 3ONXA 3AA6B 3E08A 4YTPA 1YXRA 3C98B 3PUXF 3RKOA 1FMWA 4DUYT 5AQRB 3ZMSB 1OEDE 2XQ7A 3MKDA 4P09A 2NP9A 1MIWA 4DR6T 2KXPB 3FZLB 2ZM2A 4HFCA 4LFBT 4GIWA 3RQUA 2VASA 4CN6A 2E9XC 3IF8B 5F3JA 5HYAA 5ETWA 2BG9C 2BS4A 4QXHB 1MNEA 2C5IT 4DR5T 1MNDA 4DMWA 2NW7A 3RRWA 4H9QC 2WCAA 3AEEA 5LNKA 2CWYA 3PU3A 3RHWA 2WS3A 3K3NA 2LHRA 5L3FB 1T72A 3AA1B 5ABEA 4X62T 2MAWA 3VRAA 2BZBA 2JQ9A 3L09A 1ZP0A 2OLTA 1HCIA 3K3QC 4Z8XA 2UUBT 3T8OA 5AFUL 2XQ3A 5L47A 1N36T 4FI5A 2ZMAA 3H3AA 1J5WA 3PTRB 3TLUA 3K8PC 2JRKA 1E1HB 3L8RA 1MMNA 3ANWB 1XNQT 3RC8A 1T7SA 5IHYA 3I0OA 1YKHB 2PBIA 2K9AA 1N33T 3PUAA 5AQSB 2RPAA 2JPFA 1R8IA 5AQIB 3D0TA 2W0GA 2M6IA 4L0RA 2XASB 4X5TA 3ZYLA 3DP7A 1KFYA 4IDOA 4AXPA 2I59A 1SUMB 1GQEA 4H9SE 5AQMB 4DBQA 2KLQA 1NWMX 3MA9A 4ISSA 1ZHCA 5AQOB 5JRCB 2XSAA 2H89A 2VVNA 3KV5A 1LRZA 3O4XE 4YTMA 4JV5T 3RIUA 2YINA 3AE9A 4DVDA 1ZV4X 2YN6A 4JBWF 3HKDE 5J1GA 4A98A 4DV2T 3HKBE 1T8BA 4L9IA 3CWZB 4IDNA 5FXZA 4JI8T 5L3CB 5DJQC 3RYCE 4EAHA 5GONE 4LFAT 4TUYE 3M65A 4I50E 5IWAT 2UXCT 3HKEE 4ISTA 2ES0A 4QKNA 2QYWA 2E8IA 4EGWA 5AQFB 1SE7A 2KNDA 5J2TE 3O1IA 4JYAT 3ZCJA 1HR0T 1UX5A 4DBRA 4YHHT 1YQ4A 2X9HA 3KBTA 2GK9A 2X0HA 4U2ZA 3AAEB 3AECA 2XQ8A 1US7B 1H7CA 1E7PA 3QK6A 3ZMVB 4UEMA 2VQET 5C3JA 4O8SA 4H9PC 4CI3B 3OYXA 4U3CA 2ZM8A 2PJQA 3KVAA 5FXVA 4PK4A 1IJ5A 2BKPA 4K0KT 2BS2A 5AQPB 2CLYB 2ZM0A 4X1KE 4YJ2E 3UUBA 3ZMTB 5EK4A 5AQUB 2XQ4A 4PK6A 3CQGB 3GMIA 4C90A 1KNPA 5HCJA 4TV8E 5KXJA 5CGMA 5HXEA 5EZYE 3ETVA 2G0UA 3ZEFB 4NXMT 2IC9A 2LM2A 1FMVA 3AEAA 4A56A 3OBVE 3LBXA 1XMQT 3Q9DA 1W9RA 1J1JA 2EHOA 2WWUA 4PJLA 2NR4A 2Q9QC 3PUQA 3QUJA 5AQGB 1VOMA 3OVUA 2DWKA 3MZKB 4IL9A 2IAKA 1LVFA 4UIGA 4ANJA 3TLSA 4EOZB 4H63H 4O2AE 2J1DG 2WM9A 4KMCA 4ZI2C 4WBNE 4QH5A 3A8YC 4IHJE 5KDMC 5IUXA 5HEUA 2B76A 1J5ET 2H7OA 2E9XB 4X20E 1XNRT 1WR6A 2WMNA 3PUWF 2YU2A 2BG9B 4LFCT 2WSSV 3Q5WA 3ZT7A 2JJ9A 3ZMZB 3N2KE 5LJNA 4EB6E 2Y48B 2FJAA 1M62A 5CA1E 2IUBA 3PUZF 5HWYA 4WZXA 4DMVA 2ZLYA 1KF6A 3HI2A 4ZI3C 3ZC1A 2LOPA 1UX4A 2A72A 4ZHQE 3SS1A 3F57A 2NW8A 5ABHA 2WQYA 4PJJA 1MMDA 2UXDT 3RGLA 5L2LA 2V6YB 5LA6E 3LK3B 1QLBA 5HEJA 3QC9A 2V26A 4HWDA 5IYZE 4AQYT 4HFDA 5H6QB 1KNRA 3JAFA 2Y6XA 3UULA 1CUNA 3CIRA 4JI6T 5FL1A 2UXXB 4KBMB 1JNRA 2MTQA 3QNUA 4DV7T 2X0LB 4J2CA 5CA0E 3CX6B 3HL6A 1Y64B 1M7KA 3CX8B 5JREA 4KUMB 1YD8G 3N9QA 4GK5E 1BR1A 3NVOA 4EZ4A 1DU2A 5HEOA 2CCQA 2JQQA 2WU2A 1IJ6A 3C4XA 4P0BA 5L3EB 2VL0A 4Z90A 2RA1A 2N9DA 2XTLA 2D0TA 1HTJF 1XDOA 4DO0A 3ETUA 2D0UA 3AXJA 4UVBB 2MBGA 4IE4A 1N32T 2H3RA 1NAFA 3WI3A 4ILBA 3UFEA 2FUPA 2HN1A 1HX8A 1WCRA 3WAJA 1HG2A 4U7IA 3SOLA 3RPUA 4AIUA 1FJGT 1G8XA 1L0VA 3E0ZA 3P50A 5LMNT 3AEDA 2DNXA 4AI6A 2KMFA 5JDFA 4DR2T 3ANWA 5EK3A 4B3RT 4LF9T 1Y01A 3W15B 2L3LA 3WAKA 4ZEYA 3PE0A 4UF0B 4H9NC 3MACA 4TV9E 4HFHA 5H6RB 2ODVA 3KV6A 2CPTA 1FIOA 2W67A 2BS3A 1MIYA 5TAOA 1OEDC 3JADA 2WU5A 4KHPT 2ACZA 1ZEEA 2J47A 3CK6A 3V5UA 4IE7A 4ILAA 4OK0A 3H37A 5L3BB 3LFMA 5JRCA 3AVRA 2J62A 4X1IE 2BVLA 3EI0A 4MLKA 3TLVA 4U72A 5LG3A 3PJAJ 2M67A 4YJ3E 2DI4A 1U5PA 2EHOD 5L4EA 4JI0T 1B7TA 3NBXX 3DTOA 1HNXT 3UQ4A 3RIFA 2LE8A 5LG4A 5ABGA 3AE8A 2V7MA 3ZYMA 3KV4A 3NZPA 2X68A 4A5XA 2X67A 3N9NA 4YY3T 4MALA 1LKXA 4IE5A 2CEAA 4HWCA 4O4LE 2Q9QB 1VCTA 4CN1A 3HR0A 1X79A 3AVSA 3FZMB 3MXZA 3NKZA 3N9MA 3PUGA 2CWOA 5L3GB 5FXWA 3ZLIA 1UCUA 2W00A 4YLHA 2KSRA 4PFPA 4ZOLE 3OKQA 2HPJA 2E5LT 4U31A 3I9WA 1QSDA 4AKIA 4JI3T 3N9OA 2KWIB 2KT9A 2VL8A 5JR9C 3EUHA 5HEHA 3RYIE 3AE7A 4OFZA 3I9YA 5FNVE 4NUUA 3GN5B 1O3XA 4XZCA 2R6GF 1OXZA 2X0YA 5CFBA 1HFAA 1YW0A 4TZ4C 4Z91A 1HNWT 2CXDA 4BAYB 1EZ3A 2LRLA 2VKHA 4PK5A 3PV0F 2WDQA 3T1YT 5CJ5A 4DV6T 2IMLA 2AE9A 4F8HA 3OPCA 1IBKT 4YSZA 4YSYA 3TLWA 5AQLB 3EVYA 3J7Yq 4JI4T 2CHNA 2C5KT 3LG7A 4JI1T 1XDPA 3V5SA 2PTFA 2HN2A 2JQKA 4CI1B 4YSXA 2QVAA 4ZZCA 1Z8UA 4EXTA 1KEYA 3C64A 2IIUA 3ONJA 4G63A 3BK9A 2L8KA 3AE2A 5L4HA 4AQFA 4GKJT 5BMVE 5C8YE 4DNDA 4U33A 3ZT5A 2D9DA 4GOUA 4GYSA 3BQIA 4UR9A 1JNZA 4HGAA 4XBFB 4ILCA 4HFIA 4LF4T 4YHJA 4NPPA 2X66A 3LK2B 5HWXA 2IC6A 4LF6T 1I6ZA 5HCMA 5JDQA 4L5GA 2F4VT 2LKGA 2W4XA 1OWAA 4BJMA 2XQYA 5AQJB 2XAJB 2BG9A 1SHZC 1IBMT 2KZ7B 2N1GA 3MJXA 4ADZA 4EYYR 3RIAA 1D1CA 3KDSE 2XQ5A 3CMLA 4C91A 4CQIA 2K5BB 3UU6A 3UU4A 2A9UA 1D1BA 3PUSA 4A97A 4DR3T 4KI0F 4O4IE 1HG5A 4GKKT 2HPLA 2V6YA 4X65T 2HHHT 4AKLA 1X9BA 2C5JA 4IDPA 1WYBA 3AE6A 5HXHA 4HEAA 2UXBT 2XM1A 4U2YA 1UK5A 2V7LA 4O4HE 2MPKA 2E5VA 3UU5A 3HA4A 3VKHA 2NTYA 2CE7A 3N2OA 3ZSSA 2FJDA 1QUUA 4UV9B 1IZNB 2NOXA 1D0ZA 2X9WA 4HWIB 1D1AA 5DABA 3VRBA 1I94T 2NTXA 2XM2A 3ZPOA 2VWAA 2I6HA 4IIJE 3AE3A 4DUZT 2W63A 5FL0A 3IHRA 4HE8A 4I4TE 1OEDB 1S35A 4DV0T 5F5WA 2V5DA 2CBIA 4AQGA 2LSGA 3GWHA 2YDRA 3K1SA 2DCFA 5KX5E 3UU8A 2DLRA 4JUYA 3LSVA 4KP3C 4GK0E 3LBXB 2YU1A 3M3ZB 3VR8A 2VURA 3KINB 3Q5EA 3PDYA 5AQNB 4X66T 5FMNA 3A5XA 4JI2T 1W09A 3B57A 4TNVA 5JVDE 4G2AA 2CXFA 4GYRA 1D0XA 2XSBA 1G73A 4QHOA 2LM9A 4Q25A 1XZYA 1MMAA 4OHFA 3R6NA 4H9OC 4MFRA 4H9RC 2E2AA 2W2UA 2QRXA 3RIUC 3JC6D 2LT3A 5J2UE 1AJ3A 5FVLA 1IBLT 3AAAB 5LBQB 4CZZB 3PJAA 2DWGA 5AQVB 2LKHA 2P9BA 2XPKA 1MIVA 2LSKA 5LBMA 3EAMA 4X64T 3HKCE 3AE4A 4UF0A 4WW0A 2WDVA 4HFBA 3T1HT 2XAQB 4OX9T 5ADXL 2JMHA 4DR1T 4TWDA 3FB2A 3IA3A 1UGOA 3BQKA 2YEVC 3EABA 2K48A 3KFWX 5JR9B 3AEFA 4P1NA 3UT5E 1V9DA 2XAFB 2XQAA 2XJ7A 4EIWA 2QA7A 2QGSA 5LMUT 5JDHA 4JLEA 2V7JA 4TWHA 5JDLA 4K0UA 1LVKA 3O1JA 3C51A 5FYMA 2VKDA 1SA0E 4TWFA 4LMLA 3SFEA 2LSYA 4UXNB 5LYJE 4NIQA 2KWHA 4UV8B 3QB5A 5ABFB 5LGNB 3UUNA 2YKSA 4CXYA 2BG9E 5JDNA 4UELA 4NXNT 2WBLA 3AEGA 2VKOA 3RF1A 4IE0A 4JEUB 4HWHA 1YKEB 2W62A 4H63V 2WZHA 3IEEA 3PUVF 5C2TA 4ZZBA 2Q9QA 4I0UA 2BBJA 4DV3T 4LMJA 3CQXC 4EV6A 2WWVA 2CXLA 3P4SA 2J4GA 1HS7A 2XY8B 3K3OA 2D2SA 1VCSA 4JEHB 1CHUA 3AB3B 3AA7B 5A1LA 2A2FX 2E9XD 1IAPA 3PURA 2MOZA 5KMGP 2WDRA 3ZCIA 4JI5T 4WNKA 2XQ6A 2OA5A 5LCYA 5HXSA 5FY1A 5LB7B 4DV1T 3FBZA 3I1AA 3B5MA 4COFA 3P4RA 2YDQA 4U74A 2EHOC 2BBHA 3AXJB 3ZC0A 3GN5A 3AE5A 4QWNB 4HWFA 4YXDA 2OV9A 2IDOB 2LJLA 3A7MA 5AQQB 1BR2A 1NENA 3C4ZA 2XAGB 4CI2B 4CN4A 2Y8DA 2V8SV 1U4QA 2BKOA 3O9XA 4B3MT 3CPZA 2L9QA 4AKRB 3P8CD 1E2AA 3TLTA 3G06A 5EK2A 2LOSA 4QXCB 3R84B 3ESLA 3FHNA 2WAUA 4E7ZA 2IHR1 3NRYA 3EHZA 3SWHA 4EEBA 5AQHB 5BR8T 3C4WA 4MBQA 5HXCA 3VU7H 5LGTB 3OJAA 3TKLB 2K3WA 2NWBA 2ODUA 2CMRA 4TNWA 1XMOT 2XAHB 4LMKA 4ZI7E 3IBPA 5HXRA 3ZKRA 3ABVA 2ACXA 4EYUA 4YTNA 1WLXA 3MK7C 2KINB 4O4JE 2YK0A 4DV4T 2IW5B 3GA8A 4M1PA 3RLFF 2SPCA 3SFDA 1KK7A 2K24A 3OTOT 4KX6A 3KBUA 3KVBA 3L39A 2WB5A 3VR9A 3P7IA 3ZJ1A 1S94A 3ZSTA 2FJEA 4N78D 4AKHA 5LOVE 5JDMA 4PJNA 4B6XA 4YFSA 4B3ST 2FJBA 4IL4A 4E7SA 1HF8A 3VHLA 5L3DB 3UQ7A 4PAGA 3CVRA 1WRDA 4TN7B 5CB4E 3F31A 4LF5T 2XQ9A 3J9X1 1WR0A 3L3PA 1KNZA 3Q5XA 1UUSA 3Q2MA 1D0YA 3RI5A 3QB5K 5JQGE 2A3DA 3NRXA 4ZXLA 3ZN1B 3P4PA 3U78A 2VVSA 2LEHA 2D5UA 3C50A 2LHNA 3RKGA 3LDQB 3VKGA 3S4UA 3AE1A 2AXDS 4IREA 3RC3A 3RQWA 2JMKA 5LHGB 3F2EA 4PNIA 1WFDA 3U3IA 2C0SA 2RP4A 1HNZT 3ZYKA 2E9XA 2X9YA 3P4QA 2CM0A 3EDUA 5HEGA 1BR4A 3I0QA 4DR7T 3NWIA 2MYSA 1XWMA 4DIDB 4QX8B 5LXTE 1OEDA 5FY7A 2M6BA 4WBOA 2ZM6T 2LSJA 3BQLA 3UUXB 5DQVA 1FEWA 4NUVA 5JH7E 4HN9A 2Z6EA 2X51A 3FXDB 3CX7B 4I43B 3N9LA 4P0AA 2UUAT 4HKAA 3FXEB 2UXNB 2VQFT 3O1HA 3AEBA 3EDVA 2B1EA 2WY2A 4QXBB 2I0MA 2Q9QD 2NW9A 3AA0B 3P4WA 5LGUB 1T98A 1HX1B 2WMOA 4ILUA 4LF8T 2CRBA 3LJCA 2DL1A 2V7KA 2LRKA 5AQKB 3FZKB 2WZIA 4XAXB 3AAIA 3FZHB 4IT4A 4AISA 1UURA 4ZI2D 3QOFA 2VKJA 5FKYA 2H7VC 4ERRA 2LLYA 5HAXA 2PG8A 3ZJ2A 4BJNA 4QH1A 1YQ3A 2UUCT 3SRZA 4OYJA 3RH3A 4CXXA 5M4YA 2JQHA 4ZS3A 2PFVA 2X9XA 3UTKA 4IDZA 4V1Av 2FBWA 5LJMA 4QX7B 3OYZA 3X1DA 4U7YA 3JAEA 2YOEA 4B3TT 2H88A 4CXWA 2BVMA 2CA5A 3N2GE 5F8PA 5LHIB 2BDEA 2HH7A 5JR9A 2LSIA 2EHOB 3CKDA 5JTGA 4ZI3D 5JDGA 4F6RC 5DQWA 3RYFE
chains in the Genus database with same CATH topology
5FVKA 2V6YA 2CRBA 2V6XA 3ZT6A 2XZEA 4U31A 3ZSSA 1YXRA 2DL1A 4A5XA 3ZSTA 4ZEYA 2LRKA 2V6YB 4U3CA 2LRLA 5CGMA 2K3WA 2WY2A 4NIQA 4WZXA 4IT4A 2A9UA 2JQHA 2RPAA 5FVLA 2JQ9A 2CPTA 1WFDA 5LB7B 3K1SA 4U33A 2WWVA 3EABA 4CN1A 2JQKA 4U2ZA 3ZT5A 4U2YA 1WCRA 4P1NA 3ZT7A 4CN4A 2MPKA 5CJ5A 4U7YA 4U7IA 2W2UA 4CN6A 1WR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVK A;  2V6Y A;  2CRB A;  2V6X A;  3ZT6 A;  2XZE A;  4U31 A;  3ZSS A;  1YXR A;  2DL1 A;  4A5X A;  3ZST A;  4ZEY A;  2LRK A;  2V6Y B;  4U3C A;  2LRL A;  5CGM A;  2K3W A;  2WY2 A;  4NIQ A;  4WZX A;  4IT4 A;  2A9U A;  2JQH A;  2RPA A;  5FVL A;  2JQ9 A;  2CPT A;  1WFD A;  5LB7 B;  3K1S A;  4U33 A;  2WWV A;  3EAB A;  4CN1 A;  2JQK A;  4U2Z A;  3ZT5 A;  4U2Y A;  1WCR A;  4P1N A;  3ZT7 A;  4CN4 A;  2MPK A;  5CJ5 A;  4U7Y A;  4U7I A;  2W2U A;  4CN6 A;  1WR0 A; 
#chains in the Genus database with same CATH topology
 2WP9 A;  3B13 A;  4UVC B;  2W66 A;  3Q5D A;  1ZOY A;  4I55 E;  3N9P A;  2VK9 A;  4HTE A;  1ZKE A;  3N5L A;  4HFE A;  3E22 E;  2UU9 T;  4DV5 T;  5LHH B;  5FY0 A;  3JC6 C;  3RYH E;  3UU3 A;  2BKN A;  1N34 T;  5ABF A;  3H3M A;  2N2N A;  3DJB A;  1BR0 A;  3ONL C;  2V7I A;  4DR4 T;  3CQC B;  2YDS A;  3RRC A;  4LF7 T;  4AKG A;  5FVK A;  2XHE B;  3PU8 A;  1W0B A;  3KV9 A;  2XZE A;  4UVA B;  2CLY C;  1VRB A;  5FXX A;  5J0Z A;  4QH4 A;  2VB6 A;  1WYC A;  2V5C A;  3ZMU B;  5LP6 E;  4ASK A;  2DHR A;  5AQT B;  3UFG A;  4JI7 T;  4TX5 A;  2V6X A;  4FJO A;  4OYK A;  3ZT6 A;  3FBL A;  3ZN0 B;  4EED A;  4KHZ F;  3JCF A;  2CBJ A;  4EZH A;  1NEK A;  2W61 A;  4ZS2 A;  2V1D B;  4X1Y E;  4PFO A;  2JIW A;  4IGU A;  4MHC A;  5E0O A;  3LK4 2;  4PJM A;  4WYV A;  4HFV A;  3FZF B;  4YT0 A;  1Z0P A;  5FP3 A;  4IDQ A;  4BA9 A;  3PUY F;  4AQF C;  4PW8 A;  4O2B E;  1W0A A;  2XUE A;  3RX6 A;  3NZQ A;  4IE6 A;  2CHO A;  3UUM A;  1MMG A;  3ONX A;  3AA6 B;  3E08 A;  4YTP A;  1YXR A;  3C98 B;  3PUX F;  3RKO A;  1FMW A;  4DUY T;  5AQR B;  3ZMS B;  1OED E;  2XQ7 A;  3MKD A;  4P09 A;  2NP9 A;  1MIW A;  4DR6 T;  2KXP B;  3FZL B;  2ZM2 A;  4HFC A;  4LFB T;  4GIW A;  3RQU A;  2VAS A;  4CN6 A;  2E9X C;  3IF8 B;  5F3J A;  5HYA A;  5ETW A;  2BG9 C;  2BS4 A;  4QXH B;  1MNE A;  2C5I T;  4DR5 T;  1MND A;  4DMW A;  2NW7 A;  3RRW A;  4H9Q C;  2WCA A;  3AEE A;  5LNK A;  2CWY A;  3PU3 A;  3RHW A;  2WS3 A;  3K3N A;  2LHR A;  5L3F B;  1T72 A;  3AA1 B;  5ABE A;  4X62 T;  2MAW A;  3VRA A;  2BZB A;  2JQ9 A;  3L09 A;  1ZP0 A;  2OLT A;  1HCI A;  3K3Q C;  4Z8X A;  2UUB T;  3T8O A;  5AFU L;  2XQ3 A;  5L47 A;  1N36 T;  4FI5 A;  2ZMA A;  3H3A A;  1J5W A;  3PTR B;  3TLU A;  3K8P C;  2JRK A;  1E1H B;  3L8R A;  1MMN A;  3ANW B;  1XNQ T;  3RC8 A;  1T7S A;  5IHY A;  3I0O A;  1YKH B;  2PBI A;  2K9A A;  1N33 T;  3PUA A;  5AQS B;  2RPA A;  2JPF A;  1R8I A;  5AQI B;  3D0T A;  2W0G A;  2M6I A;  4L0R A;  2XAS B;  4X5T A;  3ZYL A;  3DP7 A;  1KFY A;  4IDO A;  4AXP A;  2I59 A;  1SUM B;  1GQE A;  4H9S E;  5AQM B;  4DBQ A;  2KLQ A;  1NWM X;  3MA9 A;  4ISS A;  1ZHC A;  5AQO B;  5JRC B;  2XSA A;  2H89 A;  2VVN A;  3KV5 A;  1LRZ A;  3O4X E;  4YTM A;  4JV5 T;  3RIU A;  2YIN A;  3AE9 A;  4DVD A;  1ZV4 X;  2YN6 A;  4JBW F;  3HKD E;  5J1G A;  4A98 A;  4DV2 T;  3HKB E;  1T8B A;  4L9I A;  3CWZ B;  4IDN A;  5FXZ A;  4JI8 T;  5L3C B;  5DJQ C;  3RYC E;  4EAH A;  5GON E;  4LFA T;  4TUY E;  3M65 A;  4I50 E;  5IWA T;  2UXC T;  3HKE E;  4IST A;  2ES0 A;  4QKN A;  2QYW A;  2E8I A;  4EGW A;  5AQF B;  1SE7 A;  2KND A;  5J2T E;  3O1I A;  4JYA T;  3ZCJ A;  1HR0 T;  1UX5 A;  4DBR A;  4YHH T;  1YQ4 A;  2X9H A;  3KBT A;  2GK9 A;  2X0H A;  4U2Z A;  3AAE B;  3AEC A;  2XQ8 A;  1US7 B;  1H7C A;  1E7P A;  3QK6 A;  3ZMV B;  4UEM A;  2VQE T;  5C3J A;  4O8S A;  4H9P C;  4CI3 B;  3OYX A;  4U3C A;  2ZM8 A;  2PJQ A;  3KVA A;  5FXV A;  4PK4 A;  1IJ5 A;  2BKP A;  4K0K T;  2BS2 A;  5AQP B;  2CLY B;  2ZM0 A;  4X1K E;  4YJ2 E;  3UUB A;  3ZMT B;  5EK4 A;  5AQU B;  2XQ4 A;  4PK6 A;  3CQG B;  3GMI A;  4C90 A;  1KNP A;  5HCJ A;  4TV8 E;  5KXJ A;  5CGM A;  5HXE A;  5EZY E;  3ETV A;  2G0U A;  3ZEF B;  4NXM T;  2IC9 A;  2LM2 A;  1FMV A;  3AEA A;  4A56 A;  3OBV E;  3LBX A;  1XMQ T;  3Q9D A;  1W9R A;  1J1J A;  2EHO A;  2WWU A;  4PJL A;  2NR4 A;  2Q9Q C;  3PUQ A;  3QUJ A;  5AQG B;  1VOM A;  3OVU A;  2DWK A;  3MZK B;  4IL9 A;  2IAK A;  1LVF A;  4UIG A;  4ANJ A;  3TLS A;  4EOZ B;  4H63 H;  4O2A E;  2J1D G;  2WM9 A;  4KMC A;  4ZI2 C;  4WBN E;  4QH5 A;  3A8Y C;  4IHJ E;  5KDM C;  5IUX A;  5HEU A;  2B76 A;  1J5E T;  2H7O A;  2E9X B;  4X20 E;  1XNR T;  1WR6 A;  2WMN A;  3PUW F;  2YU2 A;  2BG9 B;  4LFC T;  2WSS V;  3Q5W A;  3ZT7 A;  2JJ9 A;  3ZMZ B;  3N2K E;  5LJN A;  4EB6 E;  2Y48 B;  2FJA A;  1M62 A;  5CA1 E;  2IUB A;  3PUZ F;  5HWY A;  4WZX A;  4DMV A;  2ZLY A;  1KF6 A;  3HI2 A;  4ZI3 C;  3ZC1 A;  2LOP A;  1UX4 A;  2A72 A;  4ZHQ E;  3SS1 A;  3F57 A;  2NW8 A;  5ABH A;  2WQY A;  4PJJ A;  1MMD A;  2UXD T;  3RGL A;  5L2L A;  2V6Y B;  5LA6 E;  3LK3 B;  1QLB A;  5HEJ A;  3QC9 A;  2V26 A;  4HWD A;  5IYZ E;  4AQY T;  4HFD A;  5H6Q B;  1KNR A;  3JAF A;  2Y6X A;  3UUL A;  1CUN A;  3CIR A;  4JI6 T;  5FL1 A;  2UXX B;  4KBM B;  1JNR A;  2MTQ A;  3QNU A;  4DV7 T;  2X0L B;  4J2C A;  5CA0 E;  3CX6 B;  3HL6 A;  1Y64 B;  1M7K A;  3CX8 B;  5JRE A;  4KUM B;  1YD8 G;  3N9Q A;  4GK5 E;  1BR1 A;  3NVO A;  4EZ4 A;  1DU2 A;  5HEO A;  2CCQ A;  2JQQ A;  2WU2 A;  1IJ6 A;  3C4X A;  4P0B A;  5L3E B;  2VL0 A;  4Z90 A;  2RA1 A;  2N9D A;  2XTL A;  2D0T A;  1HTJ F;  1XDO A;  4DO0 A;  3ETU A;  2D0U A;  3AXJ A;  4UVB B;  2MBG A;  4IE4 A;  1N32 T;  2H3R A;  1NAF A;  3WI3 A;  4ILB A;  3UFE A;  2FUP A;  2HN1 A;  1HX8 A;  1WCR A;  3WAJ A;  1HG2 A;  4U7I A;  3SOL A;  3RPU A;  4AIU A;  1FJG T;  1G8X A;  1L0V A;  3E0Z A;  3P50 A;  5LMN T;  3AED A;  2DNX A;  4AI6 A;  2KMF A;  5JDF A;  4DR2 T;  3ANW A;  5EK3 A;  4B3R T;  4LF9 T;  1Y01 A;  3W15 B;  2L3L A;  3WAK A;  4ZEY A;  3PE0 A;  4UF0 B;  4H9N C;  3MAC A;  4TV9 E;  4HFH A;  5H6R B;  2ODV A;  3KV6 A;  2CPT A;  1FIO A;  2W67 A;  2BS3 A;  1MIY A;  5TAO A;  1OED C;  3JAD A;  2WU5 A;  4KHP T;  2ACZ A;  1ZEE A;  2J47 A;  3CK6 A;  3V5U A;  4IE7 A;  4ILA A;  4OK0 A;  3H37 A;  5L3B B;  3LFM A;  5JRC A;  3AVR A;  2J62 A;  4X1I E;  2BVL A;  3EI0 A;  4MLK A;  3TLV A;  4U72 A;  5LG3 A;  3PJA J;  2M67 A;  4YJ3 E;  2DI4 A;  1U5P A;  2EHO D;  5L4E A;  4JI0 T;  1B7T A;  3NBX X;  3DTO A;  1HNX T;  3UQ4 A;  3RIF A;  2LE8 A;  5LG4 A;  5ABG A;  3AE8 A;  2V7M A;  3ZYM A;  3KV4 A;  3NZP A;  2X68 A;  4A5X A;  2X67 A;  3N9N A;  4YY3 T;  4MAL A;  1LKX A;  4IE5 A;  2CEA A;  4HWC A;  4O4L E;  2Q9Q B;  1VCT A;  4CN1 A;  3HR0 A;  1X79 A;  3AVS A;  3FZM B;  3MXZ A;  3NKZ A;  3N9M A;  3PUG A;  2CWO A;  5L3G B;  5FXW A;  3ZLI A;  1UCU A;  2W00 A;  4YLH A;  2KSR A;  4PFP A;  4ZOL E;  3OKQ A;  2HPJ A;  2E5L T;  4U31 A;  3I9W A;  1QSD A;  4AKI A;  4JI3 T;  3N9O A;  2KWI B;  2KT9 A;  2VL8 A;  5JR9 C;  3EUH A;  5HEH A;  3RYI E;  3AE7 A;  4OFZ A;  3I9Y A;  5FNV E;  4NUU A;  3GN5 B;  1O3X A;  4XZC A;  2R6G F;  1OXZ A;  2X0Y A;  5CFB A;  1HFA A;  1YW0 A;  4TZ4 C;  4Z91 A;  1HNW T;  2CXD A;  4BAY B;  1EZ3 A;  2LRL A;  2VKH A;  4PK5 A;  3PV0 F;  2WDQ A;  3T1Y T;  5CJ5 A;  4DV6 T;  2IML A;  2AE9 A;  4F8H A;  3OPC A;  1IBK T;  4YSZ A;  4YSY A;  3TLW A;  5AQL B;  3EVY A;  3J7Y q;  4JI4 T;  2CHN A;  2C5K T;  3LG7 A;  4JI1 T;  1XDP A;  3V5S A;  2PTF A;  2HN2 A;  2JQK A;  4CI1 B;  4YSX A;  2QVA A;  4ZZC A;  1Z8U A;  4EXT A;  1KEY A;  3C64 A;  2IIU A;  3ONJ A;  4G63 A;  3BK9 A;  2L8K A;  3AE2 A;  5L4H A;  4AQF A;  4GKJ T;  5BMV E;  5C8Y E;  4DND A;  4U33 A;  3ZT5 A;  2D9D A;  4GOU A;  4GYS A;  3BQI A;  4UR9 A;  1JNZ A;  4HGA A;  4XBF B;  4ILC A;  4HFI A;  4LF4 T;  4YHJ A;  4NPP A;  2X66 A;  3LK2 B;  5HWX A;  2IC6 A;  4LF6 T;  1I6Z A;  5HCM A;  5JDQ A;  4L5G A;  2F4V T;  2LKG A;  2W4X A;  1OWA A;  4BJM A;  2XQY A;  5AQJ B;  2XAJ B;  2BG9 A;  1SHZ C;  1IBM T;  2KZ7 B;  2N1G A;  3MJX A;  4ADZ A;  4EYY R;  3RIA A;  1D1C A;  3KDS E;  2XQ5 A;  3CML A;  4C91 A;  4CQI A;  2K5B B;  3UU6 A;  3UU4 A;  2A9U A;  1D1B A;  3PUS A;  4A97 A;  4DR3 T;  4KI0 F;  4O4I E;  1HG5 A;  4GKK T;  2HPL A;  2V6Y A;  4X65 T;  2HHH T;  4AKL A;  1X9B A;  2C5J A;  4IDP A;  1WYB A;  3AE6 A;  5HXH A;  4HEA A;  2UXB T;  2XM1 A;  4U2Y A;  1UK5 A;  2V7L A;  4O4H E;  2MPK A;  2E5V A;  3UU5 A;  3HA4 A;  3VKH A;  2NTY A;  2CE7 A;  3N2O A;  3ZSS A;  2FJD A;  1QUU A;  4UV9 B;  1IZN B;  2NOX A;  1D0Z A;  2X9W A;  4HWI B;  1D1A A;  5DAB A;  3VRB A;  1I94 T;  2NTX A;  2XM2 A;  3ZPO A;  2VWA A;  2I6H A;  4IIJ E;  3AE3 A;  4DUZ T;  2W63 A;  5FL0 A;  3IHR A;  4HE8 A;  4I4T E;  1OED B;  1S35 A;  4DV0 T;  5F5W A;  2V5D A;  2CBI A;  4AQG A;  2LSG A;  3GWH A;  2YDR A;  3K1S A;  2DCF A;  5KX5 E;  3UU8 A;  2DLR A;  4JUY A;  3LSV A;  4KP3 C;  4GK0 E;  3LBX B;  2YU1 A;  3M3Z B;  3VR8 A;  2VUR A;  3KIN B;  3Q5E A;  3PDY A;  5AQN B;  4X66 T;  5FMN A;  3A5X A;  4JI2 T;  1W09 A;  3B57 A;  4TNV A;  5JVD E;  4G2A A;  2CXF A;  4GYR A;  1D0X A;  2XSB A;  1G73 A;  4QHO A;  2LM9 A;  4Q25 A;  1XZY A;  1MMA A;  4OHF A;  3R6N A;  4H9O C;  4MFR A;  4H9R C;  2E2A A;  2W2U A;  2QRX A;  3RIU C;  3JC6 D;  2LT3 A;  5J2U E;  1AJ3 A;  5FVL A;  1IBL T;  3AAA B;  5LBQ B;  4CZZ B;  3PJA A;  2DWG A;  5AQV B;  2LKH A;  2P9B A;  2XPK A;  1MIV A;  2LSK A;  5LBM A;  3EAM A;  4X64 T;  3HKC E;  3AE4 A;  4UF0 A;  4WW0 A;  2WDV A;  4HFB A;  3T1H T;  2XAQ B;  4OX9 T;  5ADX L;  2JMH A;  4DR1 T;  4TWD A;  3FB2 A;  3IA3 A;  1UGO A;  3BQK A;  2YEV C;  3EAB A;  2K48 A;  3KFW X;  5JR9 B;  3AEF A;  4P1N A;  3UT5 E;  1V9D A;  2XAF B;  2XQA A;  2XJ7 A;  4EIW A;  2QA7 A;  2QGS A;  5LMU T;  5JDH A;  4JLE A;  2V7J A;  4TWH A;  5JDL A;  4K0U A;  1LVK A;  3O1J A;  3C51 A;  5FYM A;  2VKD A;  1SA0 E;  4TWF A;  4LML A;  3SFE A;  2LSY A;  4UXN B;  5LYJ E;  4NIQ A;  2KWH A;  4UV8 B;  3QB5 A;  5ABF B;  5LGN B;  3UUN A;  2YKS A;  4CXY A;  2BG9 E;  5JDN A;  4UEL A;  4NXN T;  2WBL A;  3AEG A;  2VKO A;  3RF1 A;  4IE0 A;  4JEU B;  4HWH A;  1YKE B;  2W62 A;  4H63 V;  2WZH A;  3IEE A;  3PUV F;  5C2T A;  4ZZB A;  2Q9Q A;  4I0U A;  2BBJ A;  4DV3 T;  4LMJ A;  3CQX C;  4EV6 A;  2WWV A;  2CXL A;  3P4S A;  2J4G A;  1HS7 A;  2XY8 B;  3K3O A;  2D2S A;  1VCS A;  4JEH B;  1CHU A;  3AB3 B;  3AA7 B;  5A1L A;  2A2F X;  2E9X D;  1IAP A;  3PUR A;  2MOZ A;  5KMG P;  2WDR A;  3ZCI A;  4JI5 T;  4WNK A;  2XQ6 A;  2OA5 A;  5LCY A;  5HXS A;  5FY1 A;  5LB7 B;  4DV1 T;  3FBZ A;  3I1A A;  3B5M A;  4COF A;  3P4R A;  2YDQ A;  4U74 A;  2EHO C;  2BBH A;  3AXJ B;  3ZC0 A;  3GN5 A;  3AE5 A;  4QWN B;  4HWF A;  4YXD A;  2OV9 A;  2IDO B;  2LJL A;  3A7M A;  5AQQ B;  1BR2 A;  1NEN A;  3C4Z A;  2XAG B;  4CI2 B;  4CN4 A;  2Y8D A;  2V8S V;  1U4Q A;  2BKO A;  3O9X A;  4B3M T;  3CPZ A;  2L9Q A;  4AKR B;  3P8C D;  1E2A A;  3TLT A;  3G06 A;  5EK2 A;  2LOS A;  4QXC B;  3R84 B;  3ESL A;  3FHN A;  2WAU A;  4E7Z A;  2IHR 1;  3NRY A;  3EHZ A;  3SWH A;  4EEB A;  5AQH B;  5BR8 T;  3C4W A;  4MBQ A;  5HXC A;  3VU7 H;  5LGT B;  3OJA A;  3TKL B;  2K3W A;  2NWB A;  2ODU A;  2CMR A;  4TNW A;  1XMO T;  2XAH B;  4LMK A;  4ZI7 E;  3IBP A;  5HXR A;  3ZKR A;  3ABV A;  2ACX A;  4EYU A;  4YTN A;  1WLX A;  3MK7 C;  2KIN B;  4O4J E;  2YK0 A;  4DV4 T;  2IW5 B;  3GA8 A;  4M1P A;  3RLF F;  2SPC A;  3SFD A;  1KK7 A;  2K24 A;  3OTO T;  4KX6 A;  3KBU A;  3KVB A;  3L39 A;  2WB5 A;  3VR9 A;  3P7I A;  3ZJ1 A;  1S94 A;  3ZST A;  2FJE A;  4N78 D;  4AKH A;  5LOV E;  5JDM A;  4PJN A;  4B6X A;  4YFS A;  4B3S T;  2FJB A;  4IL4 A;  4E7S A;  1HF8 A;  3VHL A;  5L3D B;  3UQ7 A;  4PAG A;  3CVR A;  1WRD A;  4TN7 B;  5CB4 E;  3F31 A;  4LF5 T;  2XQ9 A;  3J9X 1;  1WR0 A;  3L3P A;  1KNZ A;  3Q5X A;  1UUS A;  3Q2M A;  1D0Y A;  3RI5 A;  3QB5 K;  5JQG E;  2A3D A;  3NRX A;  4ZXL A;  3ZN1 B;  3P4P A;  3U78 A;  2VVS A;  2LEH A;  2D5U A;  3C50 A;  2LHN A;  3RKG A;  3LDQ B;  3VKG A;  3S4U A;  3AE1 A;  2AXD S;  4IRE A;  3RC3 A;  3RQW A;  2JMK A;  5LHG B;  3F2E A;  4PNI A;  1WFD A;  3U3I A;  2C0S A;  2RP4 A;  1HNZ T;  3ZYK A;  2E9X A;  2X9Y A;  3P4Q A;  2CM0 A;  3EDU A;  5HEG A;  1BR4 A;  3I0Q A;  4DR7 T;  3NWI A;  2MYS A;  1XWM A;  4DID B;  4QX8 B;  5LXT E;  1OED A;  5FY7 A;  2M6B A;  4WBO A;  2ZM6 T;  2LSJ A;  3BQL A;  3UUX B;  5DQV A;  1FEW A;  4NUV A;  5JH7 E;  4HN9 A;  2Z6E A;  2X51 A;  3FXD B;  3CX7 B;  4I43 B;  3N9L A;  4P0A A;  2UUA T;  4HKA A;  3FXE B;  2UXN B;  2VQF T;  3O1H A;  3AEB A;  3EDV A;  2B1E A;  2WY2 A;  4QXB B;  2I0M A;  2Q9Q D;  2NW9 A;  3AA0 B;  3P4W A;  5LGU B;  1T98 A;  1HX1 B;  2WMO A;  4ILU A;  4LF8 T;  2CRB A;  3LJC A;  2DL1 A;  2V7K A;  2LRK A;  5AQK B;  3FZK B;  2WZI A;  4XAX B;  3AAI A;  3FZH B;  4IT4 A;  4AIS A;  1UUR A;  4ZI2 D;  3QOF A;  2VKJ A;  5FKY A;  2H7V C;  4ERR A;  2LLY A;  5HAX A;  2PG8 A;  3ZJ2 A;  4BJN A;  4QH1 A;  1YQ3 A;  2UUC T;  3SRZ A;  4OYJ A;  3RH3 A;  4CXX A;  5M4Y A;  2JQH A;  4ZS3 A;  2PFV A;  2X9X A;  3UTK A;  4IDZ A;  4V1A v;  2FBW A;  5LJM A;  4QX7 B;  3OYZ A;  3X1D A;  4U7Y A;  3JAE A;  2YOE A;  4B3T T;  2H88 A;  4CXW A;  2BVM A;  2CA5 A;  3N2G E;  5F8P A;  5LHI B;  2BDE A;  2HH7 A;  5JR9 A;  2LSI A;  2EHO B;  3CKD A;  5JTG A;  4ZI3 D;  5JDG A;  4F6R C;  5DQW A;  3RYF E; 
#chains in the Genus database with same CATH homology
 5FVK A;  2V6Y A;  2CRB A;  2V6X A;  3ZT6 A;  2XZE A;  4U31 A;  3ZSS A;  1YXR A;  2DL1 A;  4A5X A;  3ZST A;  4ZEY A;  2LRK A;  2V6Y B;  4U3C A;  2LRL A;  5CGM A;  2K3W A;  2WY2 A;  4NIQ A;  4WZX A;  4IT4 A;  2A9U A;  2JQH A;  2RPA A;  5FVL A;  2JQ9 A;  2CPT A;  1WFD A;  5LB7 B;  3K1S A;  4U33 A;  2WWV A;  3EAB A;  4CN1 A;  2JQK A;  4U2Z A;  3ZT5 A;  4U2Y A;  1WCR A;  4P1N A;  3ZT7 A;  4CN4 A;  2MPK A;  5CJ5 A;  4U7Y A;  4U7I A;  2W2U A;  4CN6 A;  1WR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...