3K1SA

Crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
SNAMMTTAEQIPFQLILNSGNARSFAMEALQFAKQGKMAEADEAMVKAKEAINEAHHFQTELIQSEARGEKTEISVLLIHAQDHLMNAITVKELAAEFIDLYKKLEAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PTS system, cellobiose-specific IIA component
publication title Crystal Structure of the PTS Cellobiose Specific Enzyme IIA from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 40
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 3k1sA00
2V6YB 4ZEYA 1YXRA 4NIQA 2LRKA 4CN1A 2CRBA 5FVKA 2WWVA 4CN4A 4U31A 5LB7B 2WY2A 2V6YA 4U3CA 2A9UA 2JQKA 2V6XA 4A5XA 1WR0A 2JQ9A 4U7IA 3ZSTA 3EABA 1WCRA 4U33A 2CPTA 5FVLA 2W2UA 4CN6A 2JQHA 4U2ZA 3ZSSA 2RPAA 2DL1A 4P1NA 4U2YA 4WZXA 1WFDA 2LRLA 4U7YA 2MPKA 3ZT7A 4IT4A 5CJ5A 2XZEA 2K3WA 3ZT5A 3ZT6A 5CGMA 3K1SA
chains in the Genus database with same CATH superfamily
3ZC1A 4K0UA 5AQNB 5AQSB 4IDNA 4JV5T 5JDGA 3PUWF 1U4QA 2EHOA 2X9XA 2NW9A 2XQYA 3ETUA 2V6XA 3HR0A 3FZMB 2ZM6T 2BG9E 4CI3B 2PTFA 3RC8A 3J7Yq 4JI8T 3UU6A 4BJMA 3KINB 5LG4A 1ZV4X 4UIGA 3SFDA 3AVRA 3FB2A 3FBLA 2NWBA 2NTXA 1WCRA 4DV5T 4ZI3D 2WP9A 5FY0A 5JDMA 3L09A 3PDYA 3E08A 3UQ4A 4JLEA 3RHWA 1XMQT 3RX6A 2CRBA 4QH4A 4ASKA 4JI7T 2CWOA 4X64T 2N9DA 2UUCT 2CCQA 3KVAA 2BG9C 4DV2T 4HFHA 3P7IA 2FJDA 2V8SV 2ZLYA 3BQKA 4YSYA 3FZFB 3EABA 5BMVE 5KDMC 2V7KA 2XSBA 4OK0A 3U78A 4XBFB 3SWHA 2JPFA 3AE2A 4DR6T 1VOMA 3O9XA 3ZJ2A 2CMRA 4H9PC 4DMVA 2MYSA 1YQ4A 4KI0F 2YDRA 1MMNA 4OX9T 3CIRA 4IDPA 2VKDA 4UR9A 4O2AE 2VVNA 4ZZBA 4ZOLE 2ZM2A 2H88A 3QC9A 4OYKA 3JC6C 4LFAT 3FBZA 4DR1T 5AQTB 2JIWA 4I0UA 5JR9C 2WMNA 4HTEA 3MJXA 2W67A 3PURA 4DIDB 2FJEA 3GN5B 4C91A 2P9BA 4UELA 1MNEA 5C3JA 2B76A 2WM9A 5HWXA 5JDLA 3QNUA 3O1HA 4UF0B 4AKHA 2GK9A 2EHOC 1OEDA 1VCSA 1MMGA 2UXCT 3RYHE 1LRZA 3EHZA 1N36T 3N9LA 2Q9QA 1YQ3A 5LGNB 5LHIB 1V9DA 1YKHB 2KWIB 3PUGA 3N9OA 2H7OA 1GQEA 3V5SA 3AEDA 1W09A 2XY8B 3LK3B 3MKDA 2XAHB 1D1AA 5LHHB 3N2KE 1IBLT 4LF9T 2V1DB 3EUHA 4HFBA 2LJLA 5J2TE 3UFGA 1U5PA 3ZYMA 3AE3A 3N9QA 3K3OA 1YD8G 4L9IA 3A8YC 3VKGA 2XHEB 2CHNA 3UUNA 4QX7B 2W0GA 3ZN0B 4GYRA 1OXZA 3DJBA 4PFPA 2VB6A 2LRKA 3P4QA 1MMAA 5AQMB 4LF4T 3LJCA 1XNQT 2Y48B 2BVMA 2LHRA 3MZKB 4QXHB 3NRXA 5ABFA 3GWHA 4EAHA 3TLVA 3I9WA 3CX6B 4EIWA 4QWNB 4HWIB 4CXYA 3CKDA 2CLYB 2Y8DA 4U31A 3LSVA 2RA1A 4IL4A 1VRBA 3OVUA 5JRCA 1N33T 3IBPA 1IJ6A 2X68A 3AEFA 5JDFA 3ZJ1A 3VHLA 1HX1B 5HAXA 4HKAA 5HCJA 3G06A 3CQGB 2VL0A 1Z8UA 3HKBE 2D2SA 3IHRA 4LMKA 5IHYA 2WQYA 4O4LE 4E7SA 2LSYA 1HF8A 4DO0A 2A2FX 2W61A 5CA1E 3H3MA 1UCUA 4DV6T 4KP3C 3FZKB 3KVBA 2Z6EA 3KFWX 3O4XE 3K1SA 2QRXA 2LKHA 3FHNA 1X9BA 2UXXB 1OEDC 4JI1T 1YKEB 3RF1A 3RI5A 2XTLA 3AE9A 2KLQA 3ZSTA 2V7IA 4HE8A 2Q9QC 4UXNB 5JTGA 3AE5A 4EGWA 4EZ4A 4QHOA 4IE0A 1Y64B 3E22E 3HA4A 5JDHA 2E9XB 4G2AA 2FJBA 1D1BA 2E5VA 4TUYE 1HR0T 4F6RC 3QB5A 3LBXA 5CA0E 5HEHA 4WZXA 4H9NC 3ZC0A 2YK0A 4MFRA 2CEAA 3L8RA 1KEYA 2VVSA 5KMGP 3HKDE 3RYIE 2XQ8A 3S4UA 2X0YA 2WZIA 4MHCA 4QX8B 5DQVA 4IE6A 3KV5A 4AISA 4ERRA 1US7B 3RQUA 2BKNA 3C4ZA 5H6QB 4LF6T 3OYZA 4JI5T 3PUSA 1T98A 2J47A 4ILAA 1UGOA 1ZP0A 2HPLA 1MIWA 4X65T 2I6HA 4DV1T 2JQQA 2MBGA 2D9DA 3O1JA 1M62A 4IHJE 1KNRA 2AE9A 2E2AA 3UFEA 3RYFE 5AQKB 2HPJA 5LCYA 1XWMA 5ABEA 4NUVA 4YY3T 4QXBB 3FZLB 2H89A 3PUYF 2KMFA 2JQHA 4JI4T 3I0OA 3L39A 3Q5XA 5LHGB 5J1GA 1WR6A 3AE1A 5F8PA 1JNRA 4L0RA 4KHZF 2A3DA 1FMWA 3W15B 4TN7B 5FXXA 4O8SA 2W62A 5JR9A 4WBOA 2K5BB 2ZM0A 2X67A 5ABHA 2XQAA 4GYSA 3KBTA 2LSGA 4PK5A 4ISTA 5FMNA 3UT5E 3MK7C 3PUXF 4I55E 2JRKA 2IC9A 2E9XA 4P1NA 4HFEA 2WCAA 3SOLA 5CJ5A 4LF8T 4YSZA 4NXNT 2EHOD 3CMLA 4JBWF 1D1CA 3LFMA 1HG2A 3R84B 3CPZA 3ANWA 5CB4E 3JAEA 4AI6A 1J5WA 3Q5EA 1WFDA 4ISSA 4DBQA 3NBXX 2W4XA 2ODVA 2WWUA 5FXWA 1NWMX 5HEJA 2J62A 3TLUA 1UX4A 4ZZCA 3A5XA 4O2BE 1AJ3A 4B3ST 5L4EA 2LRLA 4U7YA 5LXTE 3N5LA 2NR4A 3ABVA 4HWCA 3QUJA 4YJ2E 1HFAA 1MIVA 3C4WA 3P4WA 1WLXA 3B5MA 4AQFA 4B3RT 4DR4T 2VKHA 5FY7A 3PTRB 1UUSA 3PV0F 3N2GE 5CGMA 1FMVA 4ZEYA 2YN6A 2CXLA 4H9OC 4QH5A 1W0AA 3JADA 3PU3A 4ZHQE 5E0OA 5FL1A 2B1EA 2HH7A 3EVYA 3Q2MA 3ZLIA 3RC3A 3ESLA 2XQ3A 5FVKA 4PK6A 4DV0T 2I0MA 3PUZF 2XM1A 5AQUB 1FIOA 4EXTA 2PJQA 3TLWA 3P8CD 4CXWA 2WDVA 2BZBA 1YW0A 3OKQA 5HXEA 5HXCA 4DR3T 5TAOA 5IUXA 4DBRA 2YU1A 1E2AA 3FXEB 4LFCT 3PJAJ 3TLSA 2D0TA 3C64A 1HX8A 3T1HT 1IAPA 3PU8A 4BAYB 3O1IA 5JDNA 2IHR1 1XNRT 4WW0A 4YTNA 1I6ZA 3TKLB 5LB7B 2I59A 2E9XC 4CN6A 3UUBA 2W2UA 2UXBT 3AE7A 5FY1A 3AA0B 4UV9B 4AKIA 3CVRA 5HWYA 5JDQA 5EK2A 3U3IA 3K8PC 4DR2T 3NVOA 4UEMA 3AAAB 1G73A 5AQVB 1LKXA 4CXXA 4DR5T 2WS3A 2PG8A 3RIAA 1KNPA 2KNDA 4JI0T 2Q9QD 2LHNA 4IT4A 5LBMA 2IIUA 2IUBA 3UU8A 4ZI7E 2KWHA 5LJNA 4U3CA 3PUVF 2XQ6A 1KFYA 1IBMT 5JQGE 2G0UA 4A56A 4AKRB 2C5JA 2BVLA 3FXDB 5FYMA 4GOUA 3UUMA 2K3WA 1SA0E 4Z91A 4EOZB 3KDSE 3CX8B 4AQFC 3QOFA 2DI4A 5LYJE 4AKGA 1NEKA 2LLYA 4ANJA 2WBLA 1VCTA 4ZI3C 3LDQB 1T7SA 3Q5DA 4X1IE 4DV4T 5HEGA 4FI5A 4E7ZA 2VKJA 3M65A 1N32T 4B3MT 3T8OA 4JEHB 4ZXLA 2ZM8A 3AE6A 4GK5E 5F3JA 2A72A 2XAJB 3QB5K 3LK42 3OPCA 4X5TA 1UK5A 5L3EB 2ACZA 4TWDA 2WZHA 4BA9A 4GK0E 3T1YT 2BS4A 3GN5A 2CPTA 3V5UA 2X9YA 4COFA 1HS7A 1OEDE 3UU5A 1HNXT 3GMIA 5LOVE 3ZEFB 3EI0A 2YDQA 4UF0A 4YHHT 3CK6A 3TLTA 3RRWA 4JEUB 3FZHB 3SRZA 2QGSA 4Z8XA 5L3GB 3ZMZB 3AAIA 4EZHA 4H9SE 5LMUT 2BG9B 1EZ3A 5CFBA 4Z90A 3ONLC 3LG7A 3MACA 2DHRA 2DLRA 4DNDA 3A7MA 1HG5A 3AA6B 5FL0A 4U7IA 4HEAA 1BR2A 4EB6E 3H37A 4YT0A 2V26A 3AXJB 2VWAA 1HNWT 4NIQA 4X1KE 3MXZA 3B57A 5ABGA 3K3NA 3AB3B 2XM2A 2BKOA 3WI3A 5HXRA 5AQGB 4OYJA 3KV9A 2IAKA 3N9NA 4HWHA 2X0LB 3IF8B 5J0ZA 3RRCA 4O4IE 3ZKRA 3ZT6A 3OYXA 4PNIA 4HGAA 5EZYE 3I1AA 2X51A 1SHZC 4YFSA 5L3BB 3RIUA 2WSSV 2ES0A 2LSJA 2X9WA 5L3FB 2NW7A 4Q25A 2A9UA 1LVFA 4U33A 2D5UA 2K9AA 4LF7T 5AFUL 4ZS3A 3L3PA 3ZMTB 2CBJA 1MIYA 4H9QC 2YKSA 4EV6A 2AXDS 5HXHA 2VURA 1I94T 1QSDA 4ZI2C 3RLFF 2FJAA 3DTOA 2CXFA 2LT3A 1S94A 3PJAA 4JI6T 4AQGA 1Y01A 2VQFT 1OWAA 3AE4A 5KXJA 4EYUA 2OA5A 2EHOB 4HWFA 4LMJA 3WAKA 5LJMA 5J2UE 3F31A 5DABA 1QLBA 2CE7A 1Z0PA 3HKCE 5HEOA 4X66T 2L3LA 4NUUA 2DCFA 3AA7B 5KX5E 2ACXA 3EDVA 4F8HA 1D0ZA 2XAGB 4TNVA 3NZQA 2BS3A 2SPCA 2PFVA 2UUAT 5L3DB 2J4GA 3IA3A 4FJOA 4AQYT 4YXDA 4G63A 5L2LA 4EYYR 4IE7A 3AXJA 4BJNA 2WMOA 4PAGA 4V1Av 2WWVA 3R6NA 4DV3T 4QH1A 4KHPT 3UULA 3JC6D 2NTYA 1KNZA 4WBNE 3VRBA 1MNDA 2JQ9A 1CHUA 3OBVE 2HN1A 4MALA 2NW8A 4WNKA 5BR8T 1H7CA 2XZEA 4DUYT 1D0XA 2C5KT 3ZMUB 4U72A 1ZHCA 4OFZA 1HTJF 3HL6A 3ZSSA 3ZCJA 3ONJA 4JYAT 3ZT7A 4DUZT 1XDPA 2UXNB 1R8IA 3ZN1B 4HFDA 1N34T 3F57A 5ADXL 3Q9DA 2BBHA 4PK4A 1T8BA 2MAWA 5LNKA 4TV9E 4AKLA 5LMNT 4GKKT 3UU4A 4YSXA 3KV4A 4YJ3E 2LSIA 3JCFA 1XMOT 1E1HB 3AECA 2UU9T 1W9RA 4TWHA 3RIUC 3ONXA 3BK9A 3AEGA 4PW8A 5HCMA 2LE8A 4QXCB 4PJLA 3N9PA 3AVSA 1O3XA 4J2CA 2DNXA 4TV8E 2JJ9A 3Q5WA 2M6IA 2H3RA 3EDUA 4GIWA 3UQ7A 4JUYA 2LOSA 1QUUA 2BS2A 2W63A 2CLYC 2QYWA 1B7TA 3RIFA 2X66A 2DWGA 2DL1A 2XAQB 2XSAA 2KSRA 3RGLA 3J9X1 2CXDA 2KT9A 4JI2T 4ADZA 1OEDB 1UX5A 2ODUA 3ZMSB 3CWZB 4HFVA 1NENA 5L4HA 3N9MA 5AQHB 2LSKA 2Q9QB 2N1GA 4KMCA 2XQ5A 4P0BA 1HCIA 1WYCA 2W00A 3CQXC 2VASA 5LP6E 3QK6A 4KBMB 1M7KA 4X1YE 2XQ4A 1XZYA 2KINB 3ZPOA 5C2TA 2K48A 1WR0A 3C50A 3RH3A 2XQ9A 4U2YA 1IZNB 5AQPB 2BKPA 2UUBT 4B6XA 5FXZA 3DP7A 2OLTA 3UUXB 1BR0A 3BQLA 4C90A 2MTQA 3MA9A 4CQIA 2C5IT 1SE7A 1S35A 2XQ7A 4N78D 4UVBB 2YEVC 2V6YB 5GONE 4M1PA 3PUAA 5ABFB 4MBQA 3C51A 3AA1B 2IMLA 4H63V 2VK9A 3RKOA 3WAJA 4UVCB 4ILBA 1MMDA 5JRCB 4P0AA 4GKJT 3LK2B 3UU3A 3SS1A 1ZKEA 4I43B 1LVKA 4ILUA 4LFBT 1KK7A 3B13A 4A5XA 5DQWA 3CQCB 2OV9A 5FP3A 3PE0A 3NZPA 3C98B 4IDQA 3AE8A 3I9YA 5AQOB 3AEEA 4A98A 2XAFB 5A1LA 5C8YE 3ZYKA 2WY2A 2WB5A 4ZI2D 4XAXB 3IEEA 3F2EA 3ETVA 5FVLA 3I0QA 4H9RC 5AQQB 3P4SA 5IWAT 4IGUA 3RYCE 2JMKA 4L5GA 2XUEA 1FJGT 3AEAA 2XJ7A 4CN4A 2YINA 4HWDA 2W66A 2QVAA 4TX5A 5LBQB 3UTKA 5HYAA 1J1JA 2MPKA 2N2NA 4EEBA 5EK3A 4LF5T 4O4JE 4IL9A 2LOPA 2RP4A 3LBXB 4TWFA 2V6YA 3PUQA 4YTPA 2L9QA 2L8KA 2RPAA 2VQET 3C4XA 4IE4A 2E8IA 2WU5A 3ZCIA 2CBIA 1BR4A 2V5CA 4NPPA 2X9HA 3ZYLA 5LGTB 1X79A 4CN1A 2M67A 2IDOB 3D0TA 4JI3T 2V7JA 3HKEE 4IIJE 3RQWA 3ZMVB 2BBJA 3SFEA 4YHJA 3KV6A 5AQJB 4B3TT 2YOEA 1IJ5A 3VKHA 5JH7E 4PJJA 5AQLB 2HHHT 2CWYA 4X20E 1E7PA 2VL8A 4DR7T 2XASB 4PJMA 2KZ7B 5L3CB 2R6GF 2X0HA 2WU2A 1WRDA 4HFIA 3AEBA 1T72A 3X1DA 3RPUA 4ZS2A 4YLHA 2CA5A 2LKGA 4UVAB 4H63H 1G8XA 1W0BA 3RKGA 5H6RB 3VU7H 4IE5A 4QKNA 4HFCA 3OTOT 4HN9A 1ZOYA 1YXRA 2MOZA 2V7LA 4KX6A 4P09A 3VRAA 2BDEA 2QA7A 3AAEB 5JR9B 1J5ET 5FKYA 4NXMT 5AQFB 4CZZB 4XZCA 5LGUB 1D0YA 4TZ4C 2LM2A 3N2OA 4CI2B 4O4HE 5LG3A 1DU2A 2YU2A 4OHFA 5DJQC 2F4VT 2C0SA 2JQKA 5FNVE 5JVDE 5IYZE 3GA8A 3CX7B 4ILCA 4X62T 2CHOA 2IC6A 1KF6A 1NAFA 2KXPB 1UURA 3KBUA 3ANWB 5FXVA 5EK4A 2NOXA 3OJAA 2UXDT 4MLKA 4I4TE 2Y6XA 4IDZA 2FBWA 4DV7T 2DWKA 2E5LT 1FEWA 2NP9A 3P4PA 4DMWA 3ZT5A 4TNWA 3NWIA 2ZMAA 4A97A 2HN2A 3VR8A 2BG9A 1L0VA 3K3QC 1XDOA 1IBKT 5AQIB 1JNZA 1WYBA 1BR1A 2WDRA 2IW5B 4K0KT 3NKZA 4IDOA 2FUPA 2V7MA 3VR9A 3BQIA 4UV8B 3M3ZB 2K24A 3HI2A 5JREA 3NRYA 4AXPA 5HXSA 3H3AA 2XPKA 4U2ZA 5L47A 4I50E 2YDSA 2WAUA 4U74A 2JMHA 3P4RA 5F5WA 3E0ZA 2CM0A 2H7VC 2WDQA 2LEHA 5HEUA 2E9XD 2M6BA 4WYVA 4DVDA 4PJNA 2PBIA 3JAFA 4AIUA 1CUNA 2J1DG 5ETWA 2V5DA 4EEDA 4LMLA 5AQRB 5LA6E 3P50A 3EAMA 2LM9A 4IREA 1HNZT 1ZEEA 2VKOA 4YTMA 1SUMB 5M4YA 4CI1B 4KUMB 2D0UA 4PFOA
chains in the Genus database with same CATH topology
2V6YB 4ZEYA 1YXRA 4NIQA 2LRKA 4CN1A 2CRBA 5FVKA 2WWVA 4CN4A 4U31A 5LB7B 2WY2A 2V6YA 4U3CA 2A9UA 2JQKA 2V6XA 4A5XA 1WR0A 2JQ9A 4U7IA 3ZSTA 3EABA 1WCRA 4U33A 2CPTA 5FVLA 2W2UA 4CN6A 2JQHA 4U2ZA 3ZSSA 2RPAA 2DL1A 4P1NA 4U2YA 4WZXA 1WFDA 2LRLA 4U7YA 2MPKA 3ZT7A 4IT4A 5CJ5A 2XZEA 2K3WA 3ZT5A 3ZT6A 5CGMA 3K1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6Y B;  4ZEY A;  1YXR A;  4NIQ A;  2LRK A;  4CN1 A;  2CRB A;  5FVK A;  2WWV A;  4CN4 A;  4U31 A;  5LB7 B;  2WY2 A;  2V6Y A;  4U3C A;  2A9U A;  2JQK A;  2V6X A;  4A5X A;  1WR0 A;  2JQ9 A;  4U7I A;  3ZST A;  3EAB A;  1WCR A;  4U33 A;  2CPT A;  5FVL A;  2W2U A;  4CN6 A;  2JQH A;  4U2Z A;  3ZSS A;  2RPA A;  2DL1 A;  4P1N A;  4U2Y A;  4WZX A;  1WFD A;  2LRL A;  4U7Y A;  2MPK A;  3ZT7 A;  4IT4 A;  5CJ5 A;  2XZE A;  2K3W A;  3ZT5 A;  3ZT6 A;  5CGM A;  3K1S A; 
#chains in the Genus database with same CATH topology
 3ZC1 A;  4K0U A;  5AQN B;  5AQS B;  4IDN A;  4JV5 T;  5JDG A;  3PUW F;  1U4Q A;  2EHO A;  2X9X A;  2NW9 A;  2XQY A;  3ETU A;  2V6X A;  3HR0 A;  3FZM B;  2ZM6 T;  2BG9 E;  4CI3 B;  2PTF A;  3RC8 A;  3J7Y q;  4JI8 T;  3UU6 A;  4BJM A;  3KIN B;  5LG4 A;  1ZV4 X;  4UIG A;  3SFD A;  3AVR A;  3FB2 A;  3FBL A;  2NWB A;  2NTX A;  1WCR A;  4DV5 T;  4ZI3 D;  2WP9 A;  5FY0 A;  5JDM A;  3L09 A;  3PDY A;  3E08 A;  3UQ4 A;  4JLE A;  3RHW A;  1XMQ T;  3RX6 A;  2CRB A;  4QH4 A;  4ASK A;  4JI7 T;  2CWO A;  4X64 T;  2N9D A;  2UUC T;  2CCQ A;  3KVA A;  2BG9 C;  4DV2 T;  4HFH A;  3P7I A;  2FJD A;  2V8S V;  2ZLY A;  3BQK A;  4YSY A;  3FZF B;  3EAB A;  5BMV E;  5KDM C;  2V7K A;  2XSB A;  4OK0 A;  3U78 A;  4XBF B;  3SWH A;  2JPF A;  3AE2 A;  4DR6 T;  1VOM A;  3O9X A;  3ZJ2 A;  2CMR A;  4H9P C;  4DMV A;  2MYS A;  1YQ4 A;  4KI0 F;  2YDR A;  1MMN A;  4OX9 T;  3CIR A;  4IDP A;  2VKD A;  4UR9 A;  4O2A E;  2VVN A;  4ZZB A;  4ZOL E;  2ZM2 A;  2H88 A;  3QC9 A;  4OYK A;  3JC6 C;  4LFA T;  3FBZ A;  4DR1 T;  5AQT B;  2JIW A;  4I0U A;  5JR9 C;  2WMN A;  4HTE A;  3MJX A;  2W67 A;  3PUR A;  4DID B;  2FJE A;  3GN5 B;  4C91 A;  2P9B A;  4UEL A;  1MNE A;  5C3J A;  2B76 A;  2WM9 A;  5HWX A;  5JDL A;  3QNU A;  3O1H A;  4UF0 B;  4AKH A;  2GK9 A;  2EHO C;  1OED A;  1VCS A;  1MMG A;  2UXC T;  3RYH E;  1LRZ A;  3EHZ A;  1N36 T;  3N9L A;  2Q9Q A;  1YQ3 A;  5LGN B;  5LHI B;  1V9D A;  1YKH B;  2KWI B;  3PUG A;  3N9O A;  2H7O A;  1GQE A;  3V5S A;  3AED A;  1W09 A;  2XY8 B;  3LK3 B;  3MKD A;  2XAH B;  1D1A A;  5LHH B;  3N2K E;  1IBL T;  4LF9 T;  2V1D B;  3EUH A;  4HFB A;  2LJL A;  5J2T E;  3UFG A;  1U5P A;  3ZYM A;  3AE3 A;  3N9Q A;  3K3O A;  1YD8 G;  4L9I A;  3A8Y C;  3VKG A;  2XHE B;  2CHN A;  3UUN A;  4QX7 B;  2W0G A;  3ZN0 B;  4GYR A;  1OXZ A;  3DJB A;  4PFP A;  2VB6 A;  2LRK A;  3P4Q A;  1MMA A;  5AQM B;  4LF4 T;  3LJC A;  1XNQ T;  2Y48 B;  2BVM A;  2LHR A;  3MZK B;  4QXH B;  3NRX A;  5ABF A;  3GWH A;  4EAH A;  3TLV A;  3I9W A;  3CX6 B;  4EIW A;  4QWN B;  4HWI B;  4CXY A;  3CKD A;  2CLY B;  2Y8D A;  4U31 A;  3LSV A;  2RA1 A;  4IL4 A;  1VRB A;  3OVU A;  5JRC A;  1N33 T;  3IBP A;  1IJ6 A;  2X68 A;  3AEF A;  5JDF A;  3ZJ1 A;  3VHL A;  1HX1 B;  5HAX A;  4HKA A;  5HCJ A;  3G06 A;  3CQG B;  2VL0 A;  1Z8U A;  3HKB E;  2D2S A;  3IHR A;  4LMK A;  5IHY A;  2WQY A;  4O4L E;  4E7S A;  2LSY A;  1HF8 A;  4DO0 A;  2A2F X;  2W61 A;  5CA1 E;  3H3M A;  1UCU A;  4DV6 T;  4KP3 C;  3FZK B;  3KVB A;  2Z6E A;  3KFW X;  3O4X E;  3K1S A;  2QRX A;  2LKH A;  3FHN A;  1X9B A;  2UXX B;  1OED C;  4JI1 T;  1YKE B;  3RF1 A;  3RI5 A;  2XTL A;  3AE9 A;  2KLQ A;  3ZST A;  2V7I A;  4HE8 A;  2Q9Q C;  4UXN B;  5JTG A;  3AE5 A;  4EGW A;  4EZ4 A;  4QHO A;  4IE0 A;  1Y64 B;  3E22 E;  3HA4 A;  5JDH A;  2E9X B;  4G2A A;  2FJB A;  1D1B A;  2E5V A;  4TUY E;  1HR0 T;  4F6R C;  3QB5 A;  3LBX A;  5CA0 E;  5HEH A;  4WZX A;  4H9N C;  3ZC0 A;  2YK0 A;  4MFR A;  2CEA A;  3L8R A;  1KEY A;  2VVS A;  5KMG P;  3HKD E;  3RYI E;  2XQ8 A;  3S4U A;  2X0Y A;  2WZI A;  4MHC A;  4QX8 B;  5DQV A;  4IE6 A;  3KV5 A;  4AIS A;  4ERR A;  1US7 B;  3RQU A;  2BKN A;  3C4Z A;  5H6Q B;  4LF6 T;  3OYZ A;  4JI5 T;  3PUS A;  1T98 A;  2J47 A;  4ILA A;  1UGO A;  1ZP0 A;  2HPL A;  1MIW A;  4X65 T;  2I6H A;  4DV1 T;  2JQQ A;  2MBG A;  2D9D A;  3O1J A;  1M62 A;  4IHJ E;  1KNR A;  2AE9 A;  2E2A A;  3UFE A;  3RYF E;  5AQK B;  2HPJ A;  5LCY A;  1XWM A;  5ABE A;  4NUV A;  4YY3 T;  4QXB B;  3FZL B;  2H89 A;  3PUY F;  2KMF A;  2JQH A;  4JI4 T;  3I0O A;  3L39 A;  3Q5X A;  5LHG B;  5J1G A;  1WR6 A;  3AE1 A;  5F8P A;  1JNR A;  4L0R A;  4KHZ F;  2A3D A;  1FMW A;  3W15 B;  4TN7 B;  5FXX A;  4O8S A;  2W62 A;  5JR9 A;  4WBO A;  2K5B B;  2ZM0 A;  2X67 A;  5ABH A;  2XQA A;  4GYS A;  3KBT A;  2LSG A;  4PK5 A;  4IST A;  5FMN A;  3UT5 E;  3MK7 C;  3PUX F;  4I55 E;  2JRK A;  2IC9 A;  2E9X A;  4P1N A;  4HFE A;  2WCA A;  3SOL A;  5CJ5 A;  4LF8 T;  4YSZ A;  4NXN T;  2EHO D;  3CML A;  4JBW F;  1D1C A;  3LFM A;  1HG2 A;  3R84 B;  3CPZ A;  3ANW A;  5CB4 E;  3JAE A;  4AI6 A;  1J5W A;  3Q5E A;  1WFD A;  4ISS A;  4DBQ A;  3NBX X;  2W4X A;  2ODV A;  2WWU A;  5FXW A;  1NWM X;  5HEJ A;  2J62 A;  3TLU A;  1UX4 A;  4ZZC A;  3A5X A;  4O2B E;  1AJ3 A;  4B3S T;  5L4E A;  2LRL A;  4U7Y A;  5LXT E;  3N5L A;  2NR4 A;  3ABV A;  4HWC A;  3QUJ A;  4YJ2 E;  1HFA A;  1MIV A;  3C4W A;  3P4W A;  1WLX A;  3B5M A;  4AQF A;  4B3R T;  4DR4 T;  2VKH A;  5FY7 A;  3PTR B;  1UUS A;  3PV0 F;  3N2G E;  5CGM A;  1FMV A;  4ZEY A;  2YN6 A;  2CXL A;  4H9O C;  4QH5 A;  1W0A A;  3JAD A;  3PU3 A;  4ZHQ E;  5E0O A;  5FL1 A;  2B1E A;  2HH7 A;  3EVY A;  3Q2M A;  3ZLI A;  3RC3 A;  3ESL A;  2XQ3 A;  5FVK A;  4PK6 A;  4DV0 T;  2I0M A;  3PUZ F;  2XM1 A;  5AQU B;  1FIO A;  4EXT A;  2PJQ A;  3TLW A;  3P8C D;  4CXW A;  2WDV A;  2BZB A;  1YW0 A;  3OKQ A;  5HXE A;  5HXC A;  4DR3 T;  5TAO A;  5IUX A;  4DBR A;  2YU1 A;  1E2A A;  3FXE B;  4LFC T;  3PJA J;  3TLS A;  2D0T A;  3C64 A;  1HX8 A;  3T1H T;  1IAP A;  3PU8 A;  4BAY B;  3O1I A;  5JDN A;  2IHR 1;  1XNR T;  4WW0 A;  4YTN A;  1I6Z A;  3TKL B;  5LB7 B;  2I59 A;  2E9X C;  4CN6 A;  3UUB A;  2W2U A;  2UXB T;  3AE7 A;  5FY1 A;  3AA0 B;  4UV9 B;  4AKI A;  3CVR A;  5HWY A;  5JDQ A;  5EK2 A;  3U3I A;  3K8P C;  4DR2 T;  3NVO A;  4UEM A;  3AAA B;  1G73 A;  5AQV B;  1LKX A;  4CXX A;  4DR5 T;  2WS3 A;  2PG8 A;  3RIA A;  1KNP A;  2KND A;  4JI0 T;  2Q9Q D;  2LHN A;  4IT4 A;  5LBM A;  2IIU A;  2IUB A;  3UU8 A;  4ZI7 E;  2KWH A;  5LJN A;  4U3C A;  3PUV F;  2XQ6 A;  1KFY A;  1IBM T;  5JQG E;  2G0U A;  4A56 A;  4AKR B;  2C5J A;  2BVL A;  3FXD B;  5FYM A;  4GOU A;  3UUM A;  2K3W A;  1SA0 E;  4Z91 A;  4EOZ B;  3KDS E;  3CX8 B;  4AQF C;  3QOF A;  2DI4 A;  5LYJ E;  4AKG A;  1NEK A;  2LLY A;  4ANJ A;  2WBL A;  1VCT A;  4ZI3 C;  3LDQ B;  1T7S A;  3Q5D A;  4X1I E;  4DV4 T;  5HEG A;  4FI5 A;  4E7Z A;  2VKJ A;  3M65 A;  1N32 T;  4B3M T;  3T8O A;  4JEH B;  4ZXL A;  2ZM8 A;  3AE6 A;  4GK5 E;  5F3J A;  2A72 A;  2XAJ B;  3QB5 K;  3LK4 2;  3OPC A;  4X5T A;  1UK5 A;  5L3E B;  2ACZ A;  4TWD A;  2WZH A;  4BA9 A;  4GK0 E;  3T1Y T;  2BS4 A;  3GN5 A;  2CPT A;  3V5U A;  2X9Y A;  4COF A;  1HS7 A;  1OED E;  3UU5 A;  1HNX T;  3GMI A;  5LOV E;  3ZEF B;  3EI0 A;  2YDQ A;  4UF0 A;  4YHH T;  3CK6 A;  3TLT A;  3RRW A;  4JEU B;  3FZH B;  3SRZ A;  2QGS A;  4Z8X A;  5L3G B;  3ZMZ B;  3AAI A;  4EZH A;  4H9S E;  5LMU T;  2BG9 B;  1EZ3 A;  5CFB A;  4Z90 A;  3ONL C;  3LG7 A;  3MAC A;  2DHR A;  2DLR A;  4DND A;  3A7M A;  1HG5 A;  3AA6 B;  5FL0 A;  4U7I A;  4HEA A;  1BR2 A;  4EB6 E;  3H37 A;  4YT0 A;  2V26 A;  3AXJ B;  2VWA A;  1HNW T;  4NIQ A;  4X1K E;  3MXZ A;  3B57 A;  5ABG A;  3K3N A;  3AB3 B;  2XM2 A;  2BKO A;  3WI3 A;  5HXR A;  5AQG B;  4OYJ A;  3KV9 A;  2IAK A;  3N9N A;  4HWH A;  2X0L B;  3IF8 B;  5J0Z A;  3RRC A;  4O4I E;  3ZKR A;  3ZT6 A;  3OYX A;  4PNI A;  4HGA A;  5EZY E;  3I1A A;  2X51 A;  1SHZ C;  4YFS A;  5L3B B;  3RIU A;  2WSS V;  2ES0 A;  2LSJ A;  2X9W A;  5L3F B;  2NW7 A;  4Q25 A;  2A9U A;  1LVF A;  4U33 A;  2D5U A;  2K9A A;  4LF7 T;  5AFU L;  4ZS3 A;  3L3P A;  3ZMT B;  2CBJ A;  1MIY A;  4H9Q C;  2YKS A;  4EV6 A;  2AXD S;  5HXH A;  2VUR A;  1I94 T;  1QSD A;  4ZI2 C;  3RLF F;  2FJA A;  3DTO A;  2CXF A;  2LT3 A;  1S94 A;  3PJA A;  4JI6 T;  4AQG A;  1Y01 A;  2VQF T;  1OWA A;  3AE4 A;  5KXJ A;  4EYU A;  2OA5 A;  2EHO B;  4HWF A;  4LMJ A;  3WAK A;  5LJM A;  5J2U E;  3F31 A;  5DAB A;  1QLB A;  2CE7 A;  1Z0P A;  3HKC E;  5HEO A;  4X66 T;  2L3L A;  4NUU A;  2DCF A;  3AA7 B;  5KX5 E;  2ACX A;  3EDV A;  4F8H A;  1D0Z A;  2XAG B;  4TNV A;  3NZQ A;  2BS3 A;  2SPC A;  2PFV A;  2UUA T;  5L3D B;  2J4G A;  3IA3 A;  4FJO A;  4AQY T;  4YXD A;  4G63 A;  5L2L A;  4EYY R;  4IE7 A;  3AXJ A;  4BJN A;  2WMO A;  4PAG A;  4V1A v;  2WWV A;  3R6N A;  4DV3 T;  4QH1 A;  4KHP T;  3UUL A;  3JC6 D;  2NTY A;  1KNZ A;  4WBN E;  3VRB A;  1MND A;  2JQ9 A;  1CHU A;  3OBV E;  2HN1 A;  4MAL A;  2NW8 A;  4WNK A;  5BR8 T;  1H7C A;  2XZE A;  4DUY T;  1D0X A;  2C5K T;  3ZMU B;  4U72 A;  1ZHC A;  4OFZ A;  1HTJ F;  3HL6 A;  3ZSS A;  3ZCJ A;  3ONJ A;  4JYA T;  3ZT7 A;  4DUZ T;  1XDP A;  2UXN B;  1R8I A;  3ZN1 B;  4HFD A;  1N34 T;  3F57 A;  5ADX L;  3Q9D A;  2BBH A;  4PK4 A;  1T8B A;  2MAW A;  5LNK A;  4TV9 E;  4AKL A;  5LMN T;  4GKK T;  3UU4 A;  4YSX A;  3KV4 A;  4YJ3 E;  2LSI A;  3JCF A;  1XMO T;  1E1H B;  3AEC A;  2UU9 T;  1W9R A;  4TWH A;  3RIU C;  3ONX A;  3BK9 A;  3AEG A;  4PW8 A;  5HCM A;  2LE8 A;  4QXC B;  4PJL A;  3N9P A;  3AVS A;  1O3X A;  4J2C A;  2DNX A;  4TV8 E;  2JJ9 A;  3Q5W A;  2M6I A;  2H3R A;  3EDU A;  4GIW A;  3UQ7 A;  4JUY A;  2LOS A;  1QUU A;  2BS2 A;  2W63 A;  2CLY C;  2QYW A;  1B7T A;  3RIF A;  2X66 A;  2DWG A;  2DL1 A;  2XAQ B;  2XSA A;  2KSR A;  3RGL A;  3J9X 1;  2CXD A;  2KT9 A;  4JI2 T;  4ADZ A;  1OED B;  1UX5 A;  2ODU A;  3ZMS B;  3CWZ B;  4HFV A;  1NEN A;  5L4H A;  3N9M A;  5AQH B;  2LSK A;  2Q9Q B;  2N1G A;  4KMC A;  2XQ5 A;  4P0B A;  1HCI A;  1WYC A;  2W00 A;  3CQX C;  2VAS A;  5LP6 E;  3QK6 A;  4KBM B;  1M7K A;  4X1Y E;  2XQ4 A;  1XZY A;  2KIN B;  3ZPO A;  5C2T A;  2K48 A;  1WR0 A;  3C50 A;  3RH3 A;  2XQ9 A;  4U2Y A;  1IZN B;  5AQP B;  2BKP A;  2UUB T;  4B6X A;  5FXZ A;  3DP7 A;  2OLT A;  3UUX B;  1BR0 A;  3BQL A;  4C90 A;  2MTQ A;  3MA9 A;  4CQI A;  2C5I T;  1SE7 A;  1S35 A;  2XQ7 A;  4N78 D;  4UVB B;  2YEV C;  2V6Y B;  5GON E;  4M1P A;  3PUA A;  5ABF B;  4MBQ A;  3C51 A;  3AA1 B;  2IML A;  4H63 V;  2VK9 A;  3RKO A;  3WAJ A;  4UVC B;  4ILB A;  1MMD A;  5JRC B;  4P0A A;  4GKJ T;  3LK2 B;  3UU3 A;  3SS1 A;  1ZKE A;  4I43 B;  1LVK A;  4ILU A;  4LFB T;  1KK7 A;  3B13 A;  4A5X A;  5DQW A;  3CQC B;  2OV9 A;  5FP3 A;  3PE0 A;  3NZP A;  3C98 B;  4IDQ A;  3AE8 A;  3I9Y A;  5AQO B;  3AEE A;  4A98 A;  2XAF B;  5A1L A;  5C8Y E;  3ZYK A;  2WY2 A;  2WB5 A;  4ZI2 D;  4XAX B;  3IEE A;  3F2E A;  3ETV A;  5FVL A;  3I0Q A;  4H9R C;  5AQQ B;  3P4S A;  5IWA T;  4IGU A;  3RYC E;  2JMK A;  4L5G A;  2XUE A;  1FJG T;  3AEA A;  2XJ7 A;  4CN4 A;  2YIN A;  4HWD A;  2W66 A;  2QVA A;  4TX5 A;  5LBQ B;  3UTK A;  5HYA A;  1J1J A;  2MPK A;  2N2N A;  4EEB A;  5EK3 A;  4LF5 T;  4O4J E;  4IL9 A;  2LOP A;  2RP4 A;  3LBX B;  4TWF A;  2V6Y A;  3PUQ A;  4YTP A;  2L9Q A;  2L8K A;  2RPA A;  2VQE T;  3C4X A;  4IE4 A;  2E8I A;  2WU5 A;  3ZCI A;  2CBI A;  1BR4 A;  2V5C A;  4NPP A;  2X9H A;  3ZYL A;  5LGT B;  1X79 A;  4CN1 A;  2M67 A;  2IDO B;  3D0T A;  4JI3 T;  2V7J A;  3HKE E;  4IIJ E;  3RQW A;  3ZMV B;  2BBJ A;  3SFE A;  4YHJ A;  3KV6 A;  5AQJ B;  4B3T T;  2YOE A;  1IJ5 A;  3VKH A;  5JH7 E;  4PJJ A;  5AQL B;  2HHH T;  2CWY A;  4X20 E;  1E7P A;  2VL8 A;  4DR7 T;  2XAS B;  4PJM A;  2KZ7 B;  5L3C B;  2R6G F;  2X0H A;  2WU2 A;  1WRD A;  4HFI A;  3AEB A;  1T72 A;  3X1D A;  3RPU A;  4ZS2 A;  4YLH A;  2CA5 A;  2LKG A;  4UVA B;  4H63 H;  1G8X A;  1W0B A;  3RKG A;  5H6R B;  3VU7 H;  4IE5 A;  4QKN A;  4HFC A;  3OTO T;  4HN9 A;  1ZOY A;  1YXR A;  2MOZ A;  2V7L A;  4KX6 A;  4P09 A;  3VRA A;  2BDE A;  2QA7 A;  3AAE B;  5JR9 B;  1J5E T;  5FKY A;  4NXM T;  5AQF B;  4CZZ B;  4XZC A;  5LGU B;  1D0Y A;  4TZ4 C;  2LM2 A;  3N2O A;  4CI2 B;  4O4H E;  5LG3 A;  1DU2 A;  2YU2 A;  4OHF A;  5DJQ C;  2F4V T;  2C0S A;  2JQK A;  5FNV E;  5JVD E;  5IYZ E;  3GA8 A;  3CX7 B;  4ILC A;  4X62 T;  2CHO A;  2IC6 A;  1KF6 A;  1NAF A;  2KXP B;  1UUR A;  3KBU A;  3ANW B;  5FXV A;  5EK4 A;  2NOX A;  3OJA A;  2UXD T;  4MLK A;  4I4T E;  2Y6X A;  4IDZ A;  2FBW A;  4DV7 T;  2DWK A;  2E5L T;  1FEW A;  2NP9 A;  3P4P A;  4DMW A;  3ZT5 A;  4TNW A;  3NWI A;  2ZMA A;  4A97 A;  2HN2 A;  3VR8 A;  2BG9 A;  1L0V A;  3K3Q C;  1XDO A;  1IBK T;  5AQI B;  1JNZ A;  1WYB A;  1BR1 A;  2WDR A;  2IW5 B;  4K0K T;  3NKZ A;  4IDO A;  2FUP A;  2V7M A;  3VR9 A;  3BQI A;  4UV8 B;  3M3Z B;  2K24 A;  3HI2 A;  5JRE A;  3NRY A;  4AXP A;  5HXS A;  3H3A A;  2XPK A;  4U2Z A;  5L47 A;  4I50 E;  2YDS A;  2WAU A;  4U74 A;  2JMH A;  3P4R A;  5F5W A;  3E0Z A;  2CM0 A;  2H7V C;  2WDQ A;  2LEH A;  5HEU A;  2E9X D;  2M6B A;  4WYV A;  4DVD A;  4PJN A;  2PBI A;  3JAF A;  4AIU A;  1CUN A;  2J1D G;  5ETW A;  2V5D A;  4EED A;  4LML A;  5AQR B;  5LA6 E;  3P50 A;  3EAM A;  2LM9 A;  4IRE A;  1HNZ T;  1ZEE A;  2VKO A;  4YTM A;  1SUM B;  5M4Y A;  4CI1 B;  4KUM B;  2D0U A;  4PFO A; 
#chains in the Genus database with same CATH homology
 2V6Y B;  4ZEY A;  1YXR A;  4NIQ A;  2LRK A;  4CN1 A;  2CRB A;  5FVK A;  2WWV A;  4CN4 A;  4U31 A;  5LB7 B;  2WY2 A;  2V6Y A;  4U3C A;  2A9U A;  2JQK A;  2V6X A;  4A5X A;  1WR0 A;  2JQ9 A;  4U7I A;  3ZST A;  3EAB A;  1WCR A;  4U33 A;  2CPT A;  5FVL A;  2W2U A;  4CN6 A;  2JQH A;  4U2Z A;  3ZSS A;  2RPA A;  2DL1 A;  4P1N A;  4U2Y A;  4WZX A;  1WFD A;  2LRL A;  4U7Y A;  2MPK A;  3ZT7 A;  4IT4 A;  5CJ5 A;  2XZE A;  2K3W A;  3ZT5 A;  3ZT6 A;  5CGM A;  3K1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...